2WZPD

Structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
VQLQESGGGLVQAGGSLRLSCTASRRTGSNWCMGWFRQLAGKEPELVVALNFDYDMTYYADSVKGRFTVSRDSGKNTVYLQMNSLKPEDTAIYYCAARSGGFSSNRELYDGWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE RECEPTOR BINDING PROTEIN
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 30
structure length 122
sequence length 122
chains with identical sequence E, F, J, K, L
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wzpD00
4WEMB 3L3OB 2HFFB 5ISZD 3W0WE 5I1AA 4JRXD 1H3PL 1FNSL 1JRHI 2VC2H 5GGRB 2OR9L 2P8LA 1U3ZA 3VXTB 3DBXA 4IMKA 4LCIL 1FCCA 3MX0A 4Y8AA 2QR0B 4V1DB 5IGXH 3IXTA 4DW2L 3VFVA 4OGZA 1FVCB 5ISZE 4YBLB 3R0NA 5T1MA 3AVEA 4Q58C 2QTEA 4Z7VF 3B9KC 3SQOL 4NFCA 3OKOB 3CK0H 5LVEA 3U9PL 4YDIL 3QBTB 5E4IA 1CD1A 3RDTC 1CFVH 4JHAH 1KJ2A 1LE9B 5IV2A 3QZWB 5DJAA 3V6BR 1V7ML 4KMTL 1NC2A 4LCYA 4UV7H 1F2XK 5FGCE 5ELIA 3IKCA 1E4JA 5F7LB 2GAZB 1R0AL 2D0GA 5IB3A 2XRAH 4EI5D 4MNHB 2C1PA 1XF2A 4NWTH 2EDTA 4PJ7F 3IXTB 5KG9B 3VFVB 1A2YA 4J4PD 1XR9A 1Q9OB 5T1MB 5C3TA 5EN2B 4J3SA 4JFDE 1PLGL 2ATPA 4M5ZH 2NXYB 4Q9BA 2UVEA 1KELH 3QB7C 5F6IB 5IV2B 2X4OA 4UILL 4XNMB 3P73B 3V0WH 1DVFD 3WIHA 4ZNEE 3AAZA 3IDMA 5CJBA 1MLCA 4LKXA 4I18A 1VKXA 1S7TB 3FFCB 5J3HC 2VISA 1IT9L 4B41A 2JJWA 5J89A 4I0PA 3MXVH 5I2IA 3EO9H 4GQ9L 5F7DA 1EERB 5CMAB 4RWHA 3R8BB 2E7HA 5FK9A 4BZ2H 1XGRA 1E6OH 4JZOA 5INCA 3BE1H 5F21B 4I1NB 4OV5A 1DBAL 4CN4A 4JQXC 1AJ7H 2IPKB 2HJKA 4EKXA 2VLRB 3QIBA 4OFPA 2YD4A 3AAZB 3IDMB 5HGHB 5L6YH 1JZ4A 3LHPH 4LSQH 1VKXB 2IEPA 2VISB 4D9RD 2XZAH 1HHKB 1M4KA 5LQBL 1F4YL 2XZCL 4C56D 4GW4A 3KXFD 3L5XL 5F7DB 4HBCH 1ZVSA 1FFOB 1S9VB 3T4AA 1DDHA 4NRYB 3IFOB 3U1SH 4E5XA 5EPMB 2HN7B 5F88A 3MUZ1 4NC1C 1E4XI 3PDGA 3QNZB 1BX2B 5DO2D 3WL9A 1F58H 2WUCL 4N8VA 5E2TL 5JHLL 3LOWA 4D9RE 3BSZH 5GZNC 3PQYE 2H26B 1CLZH 1QSEB 4PJGA 1G7LB 8CGTA 3T0BA 2OQJA 3CCHB 3K1KC 4GW4B 3LEYH 2DMBA 2XA8H 4JQIH 5EO9B 5MP6L 1A6ZB 1EO8H 3H3KA 1D6EA 2A9MH 1UVQB 1F90H 5MEPB 4U1HA 5SV4A 4JR9L 2IFFL 2Q6WA 5LXGH 1INQB 2NR6D 4DKEH 3WL9B 4P48A 4N8VB 3D9AH 4OV6F 2CDEA 4NJAH 4LCWB 3RHWK 4DCQA 4QY8B 3K3QA 3STLA 3MACL 4PJGB 4LVOB 1FSKB 4HCRA 2J1KA 2ICWI 3B2VL 1UWEH 4PRBA 4UI2A 1D6EB 2L4OA 1A5FL 1NGPH 1P7QB 1QVOB 5E2WL 5TF1H 1QR4A 2XY2A 4U3CA 3VXRA 1J0KA 4QHUA 2GTZB 1BMGA 2JCCF 5DD6B 5J1TC 4PBVC 3ARVA 3RZCD 4JQVC 2VSDA 2IH1B 3ARGB 3BAEL 1YNKH 4QRSB 1OD7A 1BM3H 3WNKA 1JPFA 3GSNH 4YNYB 3WS6C 2E6QA 5HGBA 15C8L 4XTRC 1PEZA 3MRRA 5C0BB 5M7QA 1SHMA 4R4FH 4U0RB 3VWKC 2ERJC 3UTSD 1MCLA 4XAWH 1KEGL 3MZTA 2V9QA 1BFVH 1UWGL 2VXVL 3SOBH 4RAVB 1AHWC 3MRBB 4PRIA 1S9WB 1TXKA 5KSAA 4YDJA 3M1BA 3EFFB 1WWBX 1D7FA 4JZJA 2C1OB 3ZTNL 4OI9A 3UJIL 1FNEA 3PF2A 1F4XL 4W6YB 3ALWA 2ORBL 3WE6A 5DRXA 2BNUB 3UTSE 4M7KH 1ULVA 4Z5RB 2RFXB 3P40A 4DUVA 3CU1A 3V95A 4L4TA 5DZOA 2VLKE 5T1LA 4P5TA 2IBGA 3RVUD 4GBXA 3B6SB 1YQVH 4GW5A 1RJCA 4GSDH 1WAAE 5KSAB 1BVZA 1S5IL 4K8RC 2EIBA 2GK0B 3D3VD 4HJ0D 4HJJH 3UTTD 4YDJB 3PP4H 5CILL 1OAZL 1FNEB 1DQLH 2VWEE 5E7BA 4RGNC 1F4HA 1ADQA 5HBBA 4W68A 4XNUH 2J5LB 3C60C 3QEGL 2J88L 4Z7QF 4NRZB 2V2WA 4P23C 1JIBA 3OF6A 4KROC 3ZLQC 5IR1A 5T1LB 3D5OF 4XMLL 4PJ5A 4N1HB 1ZLUK 1TFHA 1QSFB 4XCFH 5L8JB 3ZYOA 1FPTH 4K7PX 4JFPB 3IYLW 4P2OA 3BXNA 4PV9A 3Q5OA 1RZJC 1JYXA 2Q3ZA 3SQBA 3IJSB 4TSAL 5JXED 3BX7C 1JGUH 4QHNA 1KPUB 2UWEB 4GW1A 1V8HA 3MRDB 4UT6L 4O2CA 2E3VA 5SWSB 4DKFH 1FG9C 1VFBA 2Y7QA 3Q5TA 4U1IA 1H5BB 3F7VB 2Y06L 4IIQA 4TNWK 2X4QB 1TQCB 4TNVK 5I1DA 1F3RB 5TE7H 2X05A 2GQHA 4G6AD 5EUOB 1S7WB 3EYUL 4NGHL 4JRYA 3U4AA 2RCSL 4MNQD 3BXNB 4PV9B 4ORZC 3SGKC 2F53E 5FYJE 2IAMB 1OWWA 3D0VB 2V2TA 1AGBB 3OKEA 1MI5D 1NFKA 3BRFA 5HTSA 2WINB 1FNHA 2F58L 5D1QC 2FGWL 3SCMD 1T3FB 2YD8A 3O2DH 4MJID 3HZYB 5I1DB 4S11A 2NTFA 4MNQE 1T0MA 2HAZA 1C5BL 2NY0D 3GKZA 4TTDC 4GFTB 2Q86B 3G5XB 1BJ8A 3UPAA 1JGEA 3CD4A 1MI5E 1LVEA 2C3XA 4H1LA 4KZDH 3VD5A 1OP3K 4HIIB 3ZL4L 4U1GC 1INDH 2YS4A 5GS1C 3U7AA 4X98B 4MD0B 3QIUB 2F5AH 4LVEA 1QFOA 2NTFB 2BERA 2XWJA 1QEWA 4BSVB 1JGVL 2Z8SA 4NN6C 4M7ZB 1ZGLA 3RBSA 2ZOLA 1DBKH 5ERWB 1GGUA 1CE1L 3HE7C 1YECL 4J3OC 1CG9B 3GUTB 2FX7L 4XPFL 3O2VH 2AEPH 3FN9A 1IGIL 4CKVX 1FH5H 1R3IH 2DJSA 3TJHC 4QHMB 2BNRA 2BOBB 4GT7A 3F6LA 3ZTJH 1OP3H 2YHGA 1JVKA 5F7EL 4FQXC 5J1AB 2H32H 1A6AA 2WP3O 1RUQL 4QNPE 4ZSOE 3U83A 2X4SB 4LSPL 1ZLWK 1D3CA 2EDKA 5CBAA 5GISL 5ISZB 3MV8A 1JJUA 5E9DD 4HIEA 4ORGA 4JRXB 3GDBA 4PJBA 2HVJA 1JE6A 2GFBA 5MEND 3S34H 1PAMA 3VI4E 3NIFF 4K3EH 4Q9RH 1OAUH 2DKSA 1CICC 3HAEB 3MV01 4U1MB 3UMTA 5L0QB 3ORJA 3FB8B 2J8HA 1HZHH 2W1NA 3ARDC 4P9HC 1S7XA 3TA3A 2Z91B 5BV7B 1AXTL 3MRMA 3IU3A 4CUCA 3S5LG 1MNUH 2EYSA 2HH0L 4WU5A 1IQWH 1FO0B 2D7OA 1QLRA 2V9RA 5E9DE 5JR1H 3WHXA 5GGUB 2ICWA 2CO6B 2W9EL 4J6RL 4X99A 1ZLWH 5MENE 2PR4H 4NO5A 4IDJL 4PJBB 4K8RL 2HVJB 4LLUA 3RWJB 2DICA 4YLQT 5LCVL 4MS8D 2EXWC 2N7BA 5KS9F 3MGTA 3TA3B 4U4BA 1KJ3L 1S7XB 1AFVH 4MXQC 3P2TA 3AB0C 4EI5B 1PFCA 4TUOA 5CEYB 4JRWA 4HKBA 1BFSA 1DEEB 3PP3K 2D03H 3HA0A 4XP4L 3C5ZD 3BDYL 3RGVA 3KPSD 4HX1A 3HG1E 2EDQA 3O6MH 3SKMA 4OIIL 4ZPVA 4NO5B 4MQXC 1RZJL 3NCCB 1KTDB 1C5DA 4JN1L 4LLDA 2R29H 1MCWM 1DVFB 3IAPA 4GAYA 3JTTB 2DS4A 3RVTD 1M7XA 5J06A 2PW1A 1S3KH 1RK0B 3G6JA 3ULSB 3UYRH 2IPTH 2Q3AA 1KIPA 4OI7A 4C56A 2WBJA 3P4OA 3PP3H 3FO1B 3KG5A 1G84A 3HMXL 3IB4A 3MFFA 3LKSA 1BVLB 4MAUH 3I3BA 2NY5C 3DUUA 3QXTA 3IF1A 4PGEB 3V4PL 1XIWC 4B0MM 2OS7A 4WCYH 3W11D 3LDBB 3QI9D 1NCDH 2BJMH 4ZS7H 4XVTH 3OKMB 3RTQD 4I2XA 4LPUA 4FQHA 4NUGH 1OGAD 2R0WH 3LKPB 1JWSB 4R8WH 4MXWL 1FV1B 5HHVH 1FNGA 2EDHA 3RL1A 1QACA 1MFAL 4XNXH 2XWBA 4C56B 3WLBB 3KXFB 1ZT4B 5I76A 1JI1A 4ZFZA 1ORQA 3S35X 1RQ5A 2VXTH 1AI1H 3LD8B 5D7IF 5CEXA 3MLZL 3CNKA 5I75B 4OGXH 2P45B 2BDNL 4GRWB 4WHCA 2B1AL 4WJ5A 3JZ7A 5IHZB 4Q9QH 1QOKA 1INEH 4TVPL 4EEEA 4OCRL 3HUJA 3W9DA 2C3GA 2XWBB 1KN2L 3GO1H 1KENL 5I76B 3IDNA 3KYOB 1R3LB 1ZTXH 3O3AA 5D2LE 5H2BA 4U0QB 3BP7A 1U0QA 3QQ9D 2XACC 3F5WB 3FQRA 5JZ7C 3PHQA 4Y5XB 1GGIH 2H3NB 5ETUB 4D8PB 3NFPB 4QTIH 4HAFA 2E9IA 3C6SA 3PHOB 1A7NL 2QQNL 2YKLH 5IFHH 1U3HC 2IADB 1UM6H 3W9DB 3QAZB 3I02A 5IF0B 1IM9D 3QXDA 1EGJL 3G5YB 3WS3B 4QCIB 2W91A 2MNUA 3O3AB 5EIIA 2V5MA 2PETA 4DVBA 4OAWA 1WVZA 2G75B 3PHQB 1A1MA 1NJ9A 5GRJH 4ZMAT 4JHWH 4FQ2L 4LHUG 5SWZA 1OTTD 1AQDA 1OTUD 3ZHLA 3K8MA 3IRZA 4XH2B 1D9KD 4P9HL 3RZCB 1YEHH 4LRNH 1NGXA 1TZIB 5HHOE 3IVKB 4FXGB 3KGRA 3HRPA 2Z92A 1B0RB 3ALPA 4HXBH 2VDOL 2R2CA 2HMID 4XX1E 1VFMA 4XP5H 1Q9KB 2BK8A 4D94A 1BQUA 3PG2A 1BF2A 3U48A 1BHGA 3UJJH 1AQDB 1JPSH 5DEZA 4Y19E 4FQPA 2EIDA 5FUZL 3I6GA 4Y4FA 1A0QL 2VH5L 1MRFH 4I3SH 4HLZH 5HYJD 2KKQA 1DCLA 4OCLC 3IJYB 4LEOB 1S7SB 1J05A 4R0LC 1P4BL 4WU7A 3QZWG 3V7MA 5C09A 5J13B 2DQJH 5DR5H 1SEBA 5I66A 4Z7UA 2H6PA 5I19L 4AM0A 3SE3C 5JDJA 1U93A 5EZJB 3A6BH 3ILQD 4UNTA 3O41B 4PUBH 4WWKA 3KWWA 3D3VB 3UTTB 43CAA 5CHNA 2VABA 4HPOH 3ZHKA 3K2UH 2IQ9L 1IAKA 3CFJA 5INDA 5KVMC 5I66B 1BBJB 2G60H 1NGQH 4CRPA 3V8OA 5JUEL 4L29A 1ODAA 2UZYB 4TQEH 1L7IH 3DROB 1N0XH 1HILB 2E7CA 3CXHK 4JFHE 4QF1B 4WUUA 1U93B 2D3VA 1A7QL 4LVOC 4ZXBD 2IANA 3D85D 3VFRA 3M17A 5JORA 2DQHH 3GSVA 5AYQA 3EO1B 1KB5L 2ADGB 3ULUL 4NYLA 2DIBA 4G6MH 4DEPB 3ARFC 3V4VH 5F89B 3CFJB 3P0YH 5LGHH 4YO0A 5AZEH 1UYWL 5F96L 4C58B 4QRQB 3E6HB 2PTUA 1FL3B 2X10A 4WUUB 5IVZB 4XT1C 4N1CA 2CIKB 4HQQL 5A2KH 1G9NC 3UROR 4M4RA 3MROA 1LEGA 4WDIB 3VFRB 5JORB 2HJFA 1KSRA 3PGFH 4WFGD 2FYYB 5J0BA 4HS6B 2QQQA 4LP5A 1A47A 4YDLB 2DQIH 3D39D 2NW3A 2YRZA 1FIGL 4Y1AA 3SCMB 4DZ8B 4Y4KC 1CXEA 4MJIB 3GMQA 3OAZK 4HIXH 4Z76B 5FYLL 4EI6A 3K0WA 1IZJA 3ARED 5FOBB 3U6RB 2NY0B 2HJFB 4QGTA 1MPAL 1JNLL 4ZAKD 2BSRB 2JELL 1DUZA 3D39E 3N1GC 4X9FA 3EHBD 3TBSB 3HNTL 2K1MA 5GJSL 2DD8L 5I6XB 1EO5A 4MWFB 2G2RB 2GT9B 5EOCL 5EU4A 5C1MB 3OG4B 3EW3B 2ARWA 4KU1A 1BP3B 3EOBB 1U8HA 5CEZL 3MNWA 3OAZH 2WP3T 4UTAL 4KUZL 3B5HA 4YDVB 3OB8A 5DVLA 4Z95L 4ODXB 2DMKA 3G5ZA 4R4ND 2CGRL 4PJIE 2BRRH 1WSST 4M7JH 3GMPA 2OLDA 4OGYH 4B7IA 3VCLA 2GTWB 5ACZB 1P53A 4MJ5B 3QQ3B 1BJMA 1XFPA 2A77L 1KFAH 2ZG2A 3MOBL 5EU4B 4PY7B 3FQWA 5C0GA 1QFWL 3V5HB 4NQCD 5CCKH 5ENWA 3LRHA 4XCNA 2QBWA 4HV8A 1MQ8A 3DRQB 5A16B 4YHKL 3QPXH 1HDMB 1TVDA 1MRDH 4WTZG 5E9DB 2AXHA 4NZRH 5FGRA 2P43B 4F58L 5MENB 3GMPB 5E5MB 2OTWB 2OTUB 4JG0H 1H5BC 4HUWA 3WIIL 3WFCH 4NQCE 4NHCH 2E8YA 1A9EB 1M6OA 4Q2ZB 4NO3B 1ZGLM 3O4OB 5ENWB 1IBGL 5IVXB 2VAAB 4KV5F 1ZAGA 1MWAB 1P4IL 3QUZD 1AQKL 3LQAC 3WUWG 1OPGH 3B3IA 5I1GL 2XICA 1KBGL 1U8OB 1T22A 4QRRD 5D2NA 1RUAL 2WUBL 5GJTL 5JW4Q 2EH7L 1LP9F 1NDGA 3QT2A 1LK3L 1RIHL 5EU5B 3VI3F 3MJ9A 2I25N 1FGNL 2HT2D 4ODVL 1IGJA 5EC1A 1GZPB 4O9HL 1C7TA 1UM4L 5DT1L 3SGJA 5JXAL 1YZZA 3N9GH 3QIWA 4WO4C 2Y07H 1DFBH 5DVNA 3V7AG 1FZJA 3QP3A 3MRJB 4JDTH 2O93L 3KPSB 5CIPH 4X4YB 4FFZL 5D96C 2VDNL 4OTXH 4HUMB 2XZZA 3EDFA 1QLFB 5FM8A 3TEUA 1IGJB 3LS4H 3RI5K 5EC1B 5L88H 5HYQA 4Y4HC 5EU6D 5DD0L 4N0CD 3QIUC 1WZ1L 5T3XL 3Q5YA 3MA7B 1UZ6E 3IDXH 1OOAA 5E08L 5D7JD 2X7LA 4M7ZC 3QA3A 1G7HA 1G9NL 4OT1H 1FNSH 1NGWB 3MGAA 2OR9H 4X6CA 1K3IA 1MCPL 4PGZA 3LS5L 5DVMA 1T7WA 3MCLH 1A6PA 2FDBP 4JLRB 4TN9A 1GPOH 4P46A 5CGYD 3VGAB 5HXMA 3QI9B 2P47B 5CKGA 1CLCA 5LGJB 3TLRA 3FHQA 3K81A 3C5SB 4JM4L 3DVGA 4DW2H 1OGAB 4L4TE 2YOCA 3WFHB 4JKPL 1G9EA 5MERA 3NMEA 2CKBA 3SQOH 1U8PB 3MO1A 2X7LB 1AGFB 3C9NA 1XF3B 2XTLA 3NN8B 5T3ZE 3O8XD 5DWUL 43C9B 2P1YA 1EHNA 4WNQA 1BOGA 1MHPL 4JFXA 3D87B 5DZNA 4F7MA 5FECB 2HG5A 1V7MH 2AXGB 2GUOA 3GSOA 4P9ML 4HUVA 1CVRA 4X80H 5L0QC 4P46B 5BV7C 1DQML 1R0AH 5TH2A 1F02I 2P24B 4H25A 4PJXA 1CL7L 2ZNXA 4PV8B 1PG7W 4U3XA 5D70L 1YYLH 2MCG1 1PJ9A 3I6LD 1QQDA 3RX7A 3MO1B 4RX4A 4LF3B 5E6IA 4PJ5E 3MYJB 4HKJA 4OZIB 1PLGH 4OZHB 5DK0B 2EXYC 3OGOE 2DQGH 4PJEA 2C5DC 3AXLB 1II4E 3TJEH 4JFXB 4J8RB 1I4FA 1NBQA 4UILH 3E6FA 4XXCC 3GSOB 3FB7A 4N9GB 1DE4A 1EEZB 3NGBB 4LPWA 5TH2B 4FOMA 3PJSA 5F3BA 4EI5C 4ALAL 1RZ7L 4Z0BH 3O3BA 4Q0XH 3I6LE 1IT9H 1YDPB 1HQRA 1QLEL 5FGSA 3L9RA 5B3JF 3NIDF 4KI1A 2DBJA 4YUEL 5TQ2H 5E99L 3TNNB 3HTLX 2NZ9D 4FFYH 4HKJB 4JRYE 3HZMA 4RAUA 1OQOA 2YWYA 2Z31D 3X11A 1DBAH 4UUJA 4PTUB 1JMXA 4X6EB 3E6FB 3NFSL 3RPIB 3FB7B 2HRPL 3R0MA 4XWOC 1QFUL 1DVFC 2VDLL 4MA1B 1YYML 4QHLA 1CK0L 4I13B 3SBWC 3O3BB 3O9WA 2W65A 3QXAA 4WFHD 5LQBH 1F4YH 2XZCH 4X8JB 1E0OB 4GG6A 3L5XH 1YEKH 1DL7L 4JFZL 4HIJB 1CQYA 3HE6C 3P0GB 3HZMB 3ZE0E 5C9KA 2EYRA 3LQAL 4O2FB 3C8KB 1YN7B 3HAEG 4XGZA 5CJQL 2FHFA 2DBLL 2RAMA 3MLTA 4XBEL 1PKQB 3VXNB 3TCXA 1EX0A 3LDBC 2AV7B 5E2TH 4G3YH 1HSBA 3BKMH 5A40E 1A4KA 3W9EA 1UKSA 4FRWA 3D18B 4WFHE 5JMRA 3PABA 4PRNA 3Q0HA 4HKXB 3IDGA 2Z35B 1ZWIA 3STZA 3V0VB 5HYJB 1R5WB 3EDEA 4ZG1A 3QDJA 1G7JA 5F8QC 1A3RL 2VZVA 4ZUSA 4ERSL 5H37G 2EICA 5I17B 4P2YA 1K8IA 3MLTB 3F7YA 4OBSA 4U1JB 1U8IA 2BNRE 4POZD 1WC7B 5KVDH 3TFKD 2DJ4A 4PRNB 4M1GH 1P1ZA 1U2CA 4HEME 1ZWIB 3STZB 2AGJH 1WFTA 1RI8A 5ILTL 2L7JA 1V3MA 2A6IA 3DI2B 1QHOA 1JYVA 1B6UA 5BZDB 2P5EA 1VGKA 4UBDD 2PNDA 5HVGB 3MV8E 4Z77A 5F9WC 4DOHE 5IJKA 1HKFA 4K9EC 3WDHA 4LSDA 3RNQB 5F1NB 5C07D 3CFBA 3AM8C 3DMMC 4ETQB 1I8MB 3BPOB 1P1ZB 1EAPA 1YNTA 3AY4C 4ZXBB 3QG7L 1UJ3C 2DQFA 2GSIB 3UCRA 2WWKO 4JO3H 1OAXL 5EBLB 3QAZC 4HWBA 3MXWL 1RUKH 2VERN 1T7XA 4L4JA 3DUSA 4WUKL 5ALBL 4YHLL 2P5EB 1ACZA 5TDOB 4H88H 1N26A 4CNIA 5BZWB 3JUYA 3VFTB 5IWLA 4P2QA 1N6VA 2F74A 1U8LA 3DWTA 4PLKD 3D2UA 4P5MB 3RIFF 5BV7L 3RZCC 1YNTB 4OKVA 2DDQL 1YMMA 1R5IA 2DQFB 2X4RA 3ZTNH 2EDWA 3N06B 1FO0L 4NQTA 1OLLA 2YRPA 3CFDB 4Z7WA 3C8HA 4ZDHA 3DURA 1TVHA 1RHFA 3GGWB 3L6FB 1JNNL 1A1OA 3GIVA 1C08A 4P2QB 1RFDL 1K2DA 1QYGL 2VMFA 1S5IH 4XMKH 3NCBB 4D0BB 3AREB 4R96B 4AENA 1I7UA 3PWJA 1OAZH 3BEWB 5CILH 1JGDB 4GH7B 1U58B 5CFHA 5EBWB 2RBLA 4LFHD 4PJDA 4ZAKB 1XZ0A 1AR2A 2VWEC 1D5MA 2D7QA 5EU7E 5C71A 3VDBA 3QEGH 4PJIB 3VFMB 2J88H 1IZKA 5KSUA 1WCBA 3I85A 3DX7A 4YHZL 1H0DA 2X4NB 3CDFA 1BD2A 1BZ9B 3RVUC 5KVFL 1CFNA 4JO1H 3T8XB 3P0VL 3E2HB 3KPTA 3UTPD 2JIXD 5BS0D 4IOIA 5DHVH 4HJ0C 1I7UB 3OPZL 4I2XE 1YUHA 3S36H 1GSMA 3FB5B 1PGRB 4E41A 5CINL 3DSFL 2J6EL 1WBYB 1QR1A 5DC0A 4LLWB 8FABB 1G7IA 5EZIL 3ESUF 4ZUUB 3H9ZA 1ORSA 3ROLB 5KSUB 3OKNB 1WTLA 4M6NL 4OFYD 5EOQL 1BD2B 1IAIH 2AI0H 4AEFA 2QSQA 4PG9B 3GSNB 2CLZA 4NGHH 4OCWL 4ZO7A 5D72L 5FB8A 1NLDL 1HSAB 4QXWA 1K4DB 3K4ZA 2A6JB 5DXWA 3UTQA 3NCMA 3R4DA 4EVNA 5HHXL 3MRFA 3BZFA 1JPST 1VACA 3OHXB 3HUJE 5F7UA 3MNZB 1QR1B 5IBUB 1Q72L 1XGTB 5EZLA 3U79A 4U1KB 2FGWH 4PB0L 3QPQC 4AIOA 4G6AC 3MJ6A 1AKJA 2B4CC 4HWEL 4ZFGH 1C5BH 4MQ7B 3QUZB 4NC0B 2E7LC 4LVHC 4PJ9A 5HVFB 5DC4B 4LGRB 5F6HJ 4QRRB 1CE6B 5DEGA 3HRZB 4OF8A 4MA7L 1MHHB 1SBBA 2BC4A 3R1GH 3AS3A 4PGDB 3SCMC 4KUCD 4JHBA 4Y16D 1WAAF 3OZ9L 3QUYA 1TTGA 2XKNB 3NFNB 2X4PA 2C3HA 1N64H 1AKJB 3K2MC 3I6KB 4KJQD 3TO2B 1AGEB 3PWUA 4PRHD 1Z0MA 4NP4H 5DJ0A 3A6CL 2CD0A 2NY0C 4HWZA 4PD4J 3TYGH 1NCCL 1PYWB 4C4KT 4LMQI 2BSTA 1CE1H 3OR6B 1YECH 5C0IB 4XPFH 3HNSL 3QUKA 4MJ4A 3O45A 3KYNB 1KIQA 2NY3D 2UV3A 1F6AB 3TN0C 5I6XC 3Q3GB 1JFQL 3FCTA 1WITA 5F7EH 4YR6A 3WFDL 2R2EB 1OSZB 5EU6B 2EE9A 3MRNA 5E95B 3U9UB 3B9AA 2X4PB 4PRHE 4OQTL 5DDHB 4X6DB 2I24N 5DJ0B 1JHTA 3ZKMD 5GISH 5D7JB 3VU2A 1NANI 4OGAC 4TSCL 2NZIA 3G08A 4F9LA 3IETA 3MV9A 1UXWA 1CLYH 4ZODA 4JY5H 4O4YH 4OLEA 3C5JA 4G9DA 4GKSA 1NMAL 4LGPB 2WMPA 1OAKL 5C09E 1WBXB 3FO2B 4EXPX 3W2DH 3TP4A 2OJEB 2HH0H 4MDJB 3GEWB 3OGCA 4YK4B 4Z7UE 2C3VA 1KNOB 3ZYJA 4PJAA 1HINH 5F7FA 5IK3A 1AD9A 1RUML 1N59B 4JPVH 1ZXQA 4TUKL 3TWCL 5JOEA 3PWPA 3X14B 4K8RH 4ZD3H 3MV9B 3U7YL 4HFUL 4CMHC 3R06A 3C5JB 3BQUA 3FT4B 1KJ3H 12E8H 5EO0B 5CSZA 1J1PL 5JIHA 5DD3H 3Q6GH 3JTSB 1IEBA 1XF5A 1LD9B 2HWZL 5CZVH 5GRXG 2D4FA 5IK3B 3BDYH 4NZTL 1HWGB 1TZGH 3QEHA 4IRSA 5HDQL 4L8CB 1EV2E 4D0DA 3GSRA 2ATKA 3BW9A 4F15C 1BBDL 1BEYH 1GGBH 3PL6A 2X9YA 2WNGA 3BQUB 4KI5E 4L8BB 1ZS8A 1RHHB 4MS8C 4C83B 4DQOL 1FYTA 4LSUL 1N0LA 4NCC1 3GMNA 3IXAA 2DQTL 1WICA 2VB5A 2JK5A 1GOHA 3EJJX 1XF5B 5F9DC 2GK2A 3H7LA 2SEBA 1CXLA 3ESVF 5C3LD 5IG7B 1VFAA 3C5ZC 1UACL 3FQUB 1OF2A 2W9DL 5DQDL 3QEHB 4IRSB 2VXUL 4K94C 2ED8A 2ATKB 2Z31B 3GZKA 2H32B 2CJUH 2R4RL 2WQ8A 4FFWD 2BVPB 3V6OA 5GGSA 3VGBA 3V4PH 3FFDB 5FO8B 5K9QI 1FYTB 2R0LL 4AEHL 3DVNB 1MHEA 3GMNB 2YD2A 1A1NB 4LPTA 3W5NA 4QNPF 2D31B 2GJZA 5CUSH 3RVTC 1UH4A 2P7TB 3KVQA 4Y1AE 4OI8A 4PGBA 1RVFL 4MA8L 4PY8I 2F19H 3SKJH 2XV6B 4PR5A 4YIQB 2X9WA 1MAJA 4LLQB 5EZOH 4KQ4L 4I4WB 3CX5J 4JDZA 5CJOH 1YEGL 2B4CL 3PGDA 3VI4F 4YBQD 2GSGA 1CDUA 3RQ3A 4E42B 3BZEB 2XXMB 4Y2OA 4K3DH 5GGSB 1MJUH 3LKNA 2EDJA 3HHRB 4F7PB 3CLEH 2EKSB 1NC4A 3VFSA 1FG2A 2KUTA 2VZOA 3DYPA 4EOWH 1ZOXA 4LCCA 2I26N 4OF0A 1J8HA 3D69B 3RTQC 1RZ8A 5DSCB 5DK2A 4U7SA 2YUZA 4TVPH 2AS5M 3H42L 1EXUA 1NBYB 4KRPD 4OCRH 3VD4A 1BQLL 4NO2A 1NBVH 2EE6A 2VUOA 1KN2H 2JJVA 5C8JA 4BH8A 1SJVA 2M1KA 1SYVA 4QKXB 1MQKL 2PO6A 2P42B 4WW2A 5DJ8A 3NZHL 2P8PA 4TYUA 1CBVH 4JANB 2FO4A 1NMCC 3P4MB 3NAAL 3UYOD 1FVDA 1T4KA 2AVGA 4PJ8C 4ZUVA 5IMLA 1A7NH 2FEDD 2QQNH 5FUCE 1J8HB 5I1JL 1RZ8B 5DK2B 4ODUA 1KGCD 3Q2CA 2FB4H 2BNQD 4E9LA 4GAGH 1EXUB 4BK5A 5F93C 4NO2B 1J1XL 1EGJH 3LQZB 1CD0A 2WWKT 3C08L 1CTNA 2C9AA 2VLLA 5GS3A 1QKZH 5C0CD 2VE6B 3QQ9C 4HHAA 5DJ8B 4RMUA 3SDDD 2C7UA 4I0KA 1JZ7A 1CDBA 3NGBC 4AEIL 5JIPA 5C07B 1MHCA 4HXAL 2I27N 2UZIL 2E7BA 1ES0A 3T77A 1X5HA 1QFPA 5FCSH 2Q8BL 2DWDA 1B6DA 1XCTB 5ESAA 4UINL 1MELA 5JW4R 4U6TA 5I8OL 4NBYB 3MLUH 4XNQA 3LPFA 1IGFL 1T5WB 4I48A 5C0CE 1RU9L 4X4XB 5JW4N 4JM2A 1MCKA 4HHAB 5D2NE 5GGTA 5FO9A 4TTGA 7FABL 4G80A 2FX8H 1AGCB 4Y5YB 3T0ED 1ED3A 1OTUC 1WWWX 3IFLL 1ES0B 1Q1JL 1XGUB 4UDUB 1D9KC 4YWGL 2VH5H 3VGEA 1NCBL 5I30H 1DZBA 1RZGA 5CD3A 3PXJA 1D6VL 5BQ7A 1F45A 4K7FB 1ZANL 4Y2DA 1P4BH 3QHZL 4I48B 5IEKA 4RMSA 1WT5A 1C5CL 1TZHA 4YFLF 1KCLA 3EOAA 4ZYKA 2HMIC 3GJEA 3T0EE 2ESVA 3RKDD 3MJ7A 4R97C 2C3WA 4QWWD 5IM7B 3RNKB 2X70A 2KZWA 2W59A 1KT2B 5J56B 5DMJB 3ROOA 3LKOB 3O4LD 3HCVA 5D2LF 4FG6D 2UVFA 4LU5H 2ICWJ 3BZ4A 4WI7A 1X5LA 4Y2DB 5E4EC 4G8GA 4F9PC 5HDLA 4G6FD 3RA7H 4OZGA 4QLRA 3O6LL 3O6FD 3EOAB 4BH7B 3DXAA 3BD5A 4NNXA 1FDLL 3SKUD 2I9TA 5KZCB 4N90D 2NY5H 4X6CE 1DUYA 4L4VA 1QRKA 3LV3A 2BSED 5F7YC 3EO0B 2PN5A 4XC3H 2OTPA 3L5JA 1SEQL 1A7QH 3QJHB 5DRNA 5KSBA 4GKZA 2VDQL 4XHJC 1TJHH 2X70B 3O4LE 1M1SA 5BS0B 2GCYA 4PJFA 3HCVB 3NA9H 2V17L 4IMKC 1KB5H 2AEQH 3BZ4B 5E6ZA 3V4UL 4RMQA 3O11B 3QCUL 4L8DA 5GHWL 4OZGB 3WNNA 3PWVA 4LIQE 5BOPA 3RWEB 1IFHL 4YHNB 1UYWH 5DGQA 1IM3A 1U95A 1C7SA 1T89A 3QRFM 1DUYB 3HI6L 4HGKC 2YSSA 3PNWA 2HFGL 1RV6X 4KH2A 3H7BB 4D9LL 5FO7B 1YEJH 3OKKA 4G43A 3BPOC 2IC2A 2UY7A 3TVMD 4ZXBC 4PJXE 4BYHA 3GB7A 4APQA 3DV4A 4KRLB 2ZNWA 4OD3H 1HHJB 4DJMA 2O5YL 3D0LA 3LEVH 3BD3A 2CR6A 4E0RA 4HC1L 3EGSB 4OIAA 5F1IA 1FIGH 1DBBL 1N7MH 1PY4A 5D71H 5TE4L 4HBQA 4PJEE 1BZ7A 3QUXA 5DMGD 4P3DB 5FYLH 4OLZL 4W4OC 1LMKA 3GFUA 4H0GA 3UO1H 2BSSB 4O5LL 4M9OA 4LAQL 3WXWH 1T7YA 5C70A 1MPAH 5HHME 2VDMH 3ZO0A 4WFFD 4U1SB 4RSVA 3SE9H 3HR6A 1UCTA 5GGVL 2HKHH 4MHHI 3L3KA 5GJSH 2RIKA 3EJYC 5GQBA 4OCMC 1ONQA 3FQXB 5EOCH 1D5BB 4N8CL 3DHJA 1DN0B 4Y16B 1S9KC 1FHGA 2YPLA 1WIUA 4JY6B 5KOMC 3CPLA 3KPQA 5KAQF 2W07A 4AH2B 2DB8A 2BX5A 3LEXB 1MF2L 4NQXB 1G0XA 4KAQH 1SY6H 3QIBC 3AREC 1IGTA 1EDQA 4Z95H 4X7CC 4PRHB 4WFFE 4PRPD 4JO4L 1TETL 3LSOB 1TCRA 4IS6A 4JKLA 3WYRA 3TT3H 3HZKB 2CGRH 1RIUH 1S7QA 3CMOL 2ZCHH 4MAYD 4GG6E 1MRCL 1TQBB 2MQ0A 4IBLT 1DBMH 2NY3B 2BVYA 1TVBB 4KWUA 3JV4A 5FKPB 4HG4J 4HF5H 1Q0YH 1QFWH 3MODL 2YPLB 3O2WH 1J1OL 4YJZL 3B9KD 1NFIB 5FYKE 2NY6B 3NA4A 2Q87A 3BMVA 4YHKH 3PGCB 4XRCA 4NRXA 4PJHA 1XGYH 5FHBL 5DUBA 3BKCH 5HVHB 4IM8A 4CVUA 2VC2L 3LPWA 5EDXA 5C6TH 1HHGB 4F58H 2UZXB 2J3SA 4NHUA 3ZDXE 3L7EB 3OX8B 2R2HB 4CW1B 2A1WH 2HKFH 3WIIH 3MGOA 1JN6B 2FECL 5AZ2H 4LLMB 5IGXL 2XFXB 1IBGH 1CGSH 4F57H 4O58L 1EPFA 1P4IH 5ICZA 3UBXB 2JF1A 1OGTA 2X89A 5I1GH 4MCYB 3SJVD 3ZT7A 5A2IH 2YMXH 1RUAH 1UKQA 2IQAA 5CWSB 1PQZB 5D1XA 5KOVC 2EH7H 5C0EB 1EEYA 1OHQA 3BZDA 4YHIB 4R90H 4HK0B 1FGNH 3WN5A 5HYEA 4ODVH 3FT2B 1RPQA 4NWTL 5DT1H 2FBJH 4DWHA 5JXAH 3RVWC 4DGVL 1EIBA 1JCKA 2GIYA 3DO7A 3QH3A 5TF0A 3KR3L 3T1FB 3C8DA 1MJJB 2AKRB 3FJTA 3LH2H 5JW5A 2DYPA 1UWXK 2CDFA 4M5ZL 4FABH 2I60H 3TPUB 1UA6L 1EAJA 3ARXA 3BP4B 4JG1H 1CGYA 2VDNH 4IRZL 3RL2A 3V0WL 5I73C 2MHAB 1KLGA 4DKAA 3MBEA 3KLSA 2HT2C 1I3GL 4FZ8H 4YEEA 1S8DA 4XP6L 5DD0H 4CU6A 4O51B 2Q76A 2Z8VC 4JFED 4P99A 1DBJL 3FN0H 3DO7B 4XB8A 3MXVL 1FP5A 2W0PA 1S7VA 4RWYH 1GGTA 3WJLA 1W2KT 5SX4H 4JY4A 3VFOB 1T1ZB 2DYPB 4PJIF 4BZ2L 1E6OL 1LGVA 4GRLA 1G9NH 3GSQB 1YMME 4OKDA 1KPVA 1UWXH 3DX9A 3RL2B 2NLJB 4P2RD 3SKOA 5AG9A 3QWRD 4TUJA 3A6OA 4LOUC 5L6YL 1S8DB 2FLRT 4JFEE 2ZSVB 1TIUA 5D4QA 3DARA 3A67H 1J12A 1VADB 1PBYA 4HBCL 1BVKB 4EQ3A 4JJ5B 4JY4B 1K4CA 4NQED 5D7JC 4P5TC 4GBXC 4ZO6A 3DGGA 4LPYA 1BWWA 2EO1A 4IMLA 4PBWD 2WQRA 4RCAA 5IBUG 1KPVB 1MHPH 3MUHL 3EAKA 1NCWH 1MSPA 4YAQB 1QSZA 1SJXA 4OLVL 4PJDE 4CDHA 4BKLB 3Q6FB 4P9MH 1MFBH 1DQMH 3DIFB 5CGYC 3QDMD 3RWHB 3BSZL 1DQJA 2CXKA 5CIPA 2MFNA 1CLZL 5D70H 5GSVB 4XNYH 4KRMB 1BF8A 4KRPB 1W72A 1YPZA 2RGSA 2XA8L 1C1EL 4JQIL 3FMGH 1EO8L 3GSWB 1XGQA 3O8XC 2A9ML 4HUXA 3HZVB 1F90L 5JW4M 4P2OC 6FABH 5LXGL 4DKEL 1E28B 1TNMA 4E41E 3CLFL 3REWA 3L5HA 3QDME 4NJAL 4LCUA 2ZSWA 5FHAL 3K4AA 4P49A 5DLMH 4BFIB 2MSPA 4ELME 1DQJB 4IRJA 2XN9A 5CIPB 2BY3A 1OP9A 5EBGA 2BNQB 1QLEH 1UT9A 3S96B 3T04D 4QRPD 3H0TB 1YPZB 4IIQC 4N1EA 1MFEH 1A6UL 4YUEH 3T08A 3VE0B 4XTRD 4LDEB 4MCZB 2APFA 1MFCL 1NGPL 2IBBA 2D2OA 2AJVH 4NPYA 3TO4D 4AIZB 3LN5A 3CXDL 3F12B 5C0CB 4HUNB 1KCRL 1CFQA 1BQHB 3REWB 1QFUH 3SDDB 2VDLH 4LCUB 2ZSWB 5J6HB 2OZ4H 2I5YL 3MLXL 3N1QC 1CK0H 1KCUL 1O7SA 4MD5A 1UZ6F 2H1PL 1I8LA 3JWNC 5KBNC 1CWVA 4UOJA 2JB6A 1CGXA 3T2NL 1YNKL 4KK6C 1BM3L 1W0WA 4UQ3A 3BIKA 1P84K 1Q9WB 5FGBC 4JFZH 3OB0K 3GSNL 1R5VB 5D7LD 1ZT7B 1VENA 5EOTA 3BJ91 3LQAH 5I8CB 2IMMA 5CJQH 4NPYB 1OAQH 2GJ6A 3LN5B 1F2QA 5BRZA 3BKYH 5IB2B 5K9OB 5IVNA 4XAWL 3DYOA 2FJFB 4Z6AT 4W6WB 4J3VA 5TGBB 1BFOA 4XWGH 3SOBL 5FAAA 1MIEH 4Y0GA 3BUYB 3OR7B 3MRIB 1T6WA 4K8RD 4RQQA 1QBAA 2EKJA 2YZ1A 2JB6B 1KC5L 1I1AD 1W0WB 5BJTB 4RGND 5E94B 3VWJA 1MH5B 3LKRB 5EOTB 3P30L 3C60D 4V2CB 4PLJC 3WNMA 3MOAL 3SPVA 2AJ3A 1S5HA 2VQ1A 2RR3A 3MLRH 5IFJB 2DLTA 3EYQC 3MV7A 1JZ3A 2H41A 3IFPB 3ARWA 3UPRB 4PLOB 4GSDL 3H9HA 4NQUA 3OXSB 2FSEA 3VXSA 3GI8L 1JF1A 5JOFA 1S9XB 4GLRH 1M7DB 5JLZA 5A43C 1BWMA 3SDAA 4Z7VA 1CVSC 5I9QB 1U6AL 4G6FB 2AK4A 2AJ3B 3O6FB 1G6RL 2KH2B 1NFDA 3M07A 4BZ1L 1E27A 1JHLL 3MOQA 2PW2A 2VZUA 1MVFA 1SJHA 5DJYB 3V52L 3WIFA 1CFSA 4LSRL 4X5WB 4Q9CA 3CMGA 2GJJA 5DURD 1HXMB 4DAGH 2XA3A 5DQ9B 3AS0A 1JGUL 1OAXH 3ZTJG 1J5OH 1X44A 5IMOB 1L0XA 3UC0L 2FD6H 4WUKH 2OP4L 5ALBH 4YHLH 4DKFL 1JNHB 1IQDA 5D1QD 2A6DA 4UBDC 2AK4B 2VZ3A 2BFVH 3PWPE 2VRAA 3AGVA 3WHE0 1ZA6A 4U6YA 1QO3A 1Z9MA 4HK3N 3P9MA 4ZPTA 5TE7L 4NUJA 2P49B 3WIFB 5KW9L 2WW8A 5DJ6B 2DDQH 2NX5A 3NCJH 4TTDD 4UDTB 4PJ7B 5D9SA 5IMKA 2Z4QA 3TVMB 1ETZB 3ZE0F 5JPNA 5JHDA 3GMRB 3ZKXB 1B9ZA 1K85A 2CIIA 4RDQG 4TVPD 4L3EA 3S4SB 3RGVC 4I3GA 3O2DL 2X09A 3ECBB 1QYGH 2QSCL 1Q9LB 5EWIL 2NX5B 5D9SB 5D5MB 5DA4A 5ESQA 5IMKB 5C0FB 4U6HB 4QXGL 2IALA 3JUZA 3TCLB 2X4TA 4G7VL 1NGYA 1ZHKB 5JHDB 1D5XB 3TJHD 1I75A 3MMEB 3WD5L 2PXYD 5EU7C 1U36A 2WBJC 1INDL 4PJCE 3V6OE 3FZUC 4WHTA 1M05B 4OZFH 1RZIA 2ZJSH 4MNGE 35C8L 2QHLA 5IIEA 4D9QD 1KB9K 5D8JL 1DBKL 3OPZH 4U1LB 3V9FA 4PRPB 3RDTA 5HGAB 5IW1A 3O2VL 2J7LA 2R1WB 3KLAA 2X4TB 1TDQA 5CINH 2AEPL 3DSFH 2J6EH 1FH5L 1B88A 1CICD 4QTHB 3N1FC 3ARDD 4AEEA 3QR2A 3DVFA 3QYCA 4AL8L 5D1ZD 4AYFA 2A6KA 4J3WA 1FZOA 1IILE 2BVQB 3QEUB 1A6WH 4I9WE 2EO9A 1F4AA 3V8CA 1S9YA 4RFNC 4OCWH 4OUUA 1HEZB 4CVZB 4D9QE 2YD5A 3B9KB 3ZHDA 4NZJA 1L7TL 1MCWW 4HKZB 3RDTB 2DI8A 1A9BB 2ICCA 3NTCH 2XQYG 3UTZA 3AUVA 5LGKA 2NY4C 2EXWD 4JZNA 2F54A 2FIKB 1IKNC 1HZHL 2A6KB 4MXQD 5AEAA 3EJZC 1MNUL 1XH3A 4JKMA 2X1QA 2Q1EA 5E5RB 5A3IC 4XPHH 2FO1A 4LNVA 4FZEH 3CFKA 5D6DA 5D7KD 5JR1L 5EULV 2HLAA 4X9IA 4ZQKA 3RIAF 2B7DT 3RX5A 2DLIA 3T2QA 3VFNA 1ZLVK 4EN3A 2PR4L 3UYPA 3SJVB 3S37L 3ZSTA 2VR5A 3WHE1 3WEXA 5HJ3A 3TZVA 4MA3A 5B4MC 1GGYA 1KG0A 3IDJB 4UB0H 4FN0A 3CU7A 1AFVL 3X17A 3I2CH 4LSSH 2B0SH 2Y4SA 4J3TA 2ZKHH 4F7TB 1PY9A 4M1CD 2EYTA 3OZ9H 3RVVC 4PREB 4K9EH 3CVIL 2D03L 2JCCB 3U2SA 4OUOA 2HLAB 2G9HB 3OXRA 3A6CH 3O6ML 4LFHG 4KKBC 3QDGD 3WEXB 1JMZA 2ZOKA 1ZLVH 3RPKA 5DMYA 4LQFL 1KG0B 3I84A 1NH6A 2VIRA 4P2RA 4R4BA 4YE4H 5DHVB 1MIML 5C0JB 2VR9A 3WFDH 1MFDL 3PIQB 3G04A 3UYRL 4JFEB 3DO3A 2IPTL 4KJQC 3VXUA 1XGPB 3H9SD 5JQHC 1KN4H 4AT6B 2ZUSA 5IEHA 4TSCH 4Q97A 3OJDA 1DLHB 2ZOKB 3S3SA 1FAIL 1UQSA 1P7KB 1T5XA 4RMTA 2FEEL 4WCYL 4P2RB 1P4LA 1NCDL 4Q6YA 4R4BB 5I1IH 5ID0B 4ZS7L 2VXSL 5SWQA 5MHSE 5IBTL 4HH9B 2EZ0D 1PKOA 4NUGL 2R0WL 3ILPB 4R8WL 4X5XA 2ESVE 1GRWA 3H9SE 1J10A 4X0KB 1NAML 1MCFA 4F7CB 1RUMH 4NQEB 3HUJF 4X6BA 1ZEAH 4NQVB 1FFNB 1GOFA 4HFUH 5BXFB 3V5KB 4WWKC 5IKCB 4CN6A 2Z93A 3BP5A 5T5NG 4HLZG 2EDNA 5ID1B 4OGXL 4G8GE 4PYHA 2EC8A 2VITA 1QTYT 5SWQB 2APBA 3QDMB 3DXAE 1U3HD 1INEL 4JQVA 3CZFA 2HWZH 3WKMH 1Y0LA 4ELMB 3KNBB 4L4VE 4U1NB 4X6FB 2BVUA 4GRMA 5DJCA 3GO1L 4JAMA 4N0FB 4Y5VA 3WS6A 1MUJB 2GY7B 1JPGB 4BQ6A 2D7PA 4ODWA 1MVUB 4YHOL 4PJFE 1BBDH 4YHML 2CO7B 3VWKA 5TDNB 5CP3A 3BP5B 2F8VA 1GGIL 2PTVA 1OARL 4CVXA 4XCYA 4QTIL 3AMLA 2VITB 3OBAA 4LSUH 1AHWA 4PBXA 2ID5A 4KI5C 3VXMA 2YKLL 2GYSA 5IFHL 3NIGE 1XR8A 4W4NA 4QRPB 2LABA 4JPKL 3FT3A 5DJCB 2NNAA 3T0DA 4XVUC 2IPUG 3U46A 3O3DB 3QFJD 3DI3B 3VWKB 2ERJB 2BZDA 5FDWB 3TO4B 4YGVB 4JHWL 3FHAA 5FYJH 2EEBA 4RIRB 3VXMB 1VFOA 1RULH 4X7SH 4XBGA 1U91A 4W6XB 3QEQA 3F8UB 5JDSB 1HIMH 1KULA 3PWLB 4L3AA 1YEHL 4LRNL 5IJVA 5KN5A 1RVFH 4MA8H 2VDKL 3X12B 3DRTB 2VLJA 2B4CH 5IW6A 2AXFA 1XEDA 1ZHLA 3S6CA 5D7LB 4GMTH 4HXBL 4ZUTA 4K3HA 5C0AD 2EE2A 3RY4A 1N8ZB 3B83A 2XYCA 1A6TB 4FFWC 1E4WL 3QJFA 4P23A 3TM6A 4ONHB 2G5BB 4M7LH 4O2EA 1Q94B 3G6DH 2OJZL 4Z7UF 3QEQB 3UBXG 4ZTPH 4BFGA 2GY5A 4L1DA 5M94B 1BQLH 1I1AB 1X7QA 1JWUB 3VFWA 1FZKA 4RGNB 3NBNA 5FXCH 4KJYB 5IW6B 1QA9A 1ZHLB 5DHXB 5I1LA 2MTPA 3C60B 3HLAA 2DKUA 4FNLL 5DR5L 4R3SB 1KEML 1QZ1A 4UIMB 1CIUA 3LIZH 2BMKB 5IB1A 5DQJB 5IQ7L 4KROB 5FF6A 3WNPA 3NAAH 4NSKB 4LSTL 4X9BA 5I1JH 4EDXA 3A6BL 3KPOB 3HMXA 2A38A 4POYA 5DVKA 5FUCC 3FOLB 5AD0A 4FA8A 3SGKA 3VFGH 1J1XH 3ARFD 2GITA 3VXPA 5FA4A 1KYOK 1JP5A 1DANU 2FNBA 4HS3B 5FFLA 2B5IC 3WDIA 4KI5F 3K4DA 2DWEB 2VZTA 4OF3A 4PJHE 5HYSB 4S1SL 3GMOA 4KTDH 5FF6B 4AEIH 3EYOA 1N0XL 3DX8B 2HVKA 3BH8B 3QCVL 1R3JA 3QSKB 3S5LA 4HXAH 4NKQB 2FEDC 1GYAA 5DURB 3ES6B 4FQIL 4N68A 2Q8BH 1X5FA 4YXLH 1H3UA 4YPGA 2R56L 2DQHL 3HI1A 3SDXE 2DKMA 2YN3A 2ZG3A 4J3XA 1JHKH 5L2JB 1DQQA 2AJSH 3GMMA 1IGFH 3KPNA 3FRPG 5D1QB 1QFWI 2JE8A 3PXHA 3QFDA 5AZEL 4F7EA 2CRYA 4Y4KD 3D25B 2NMSA 7FABH 5GS1A 1KPRA 4K71C 5D2NC 5KS9B 3S5LB 3M8OL 3OTTA 4YWGH 4P4KA 3HI1B 3TBYA 4LHQB 3SDCA 5H35A 3HE7A 1U92B 1ZVHA 4NNYA 1AO7A 4OCXH 1D6VH 2E27H 3W39A 4QXTA 1ZANH 3QULA 3K8LA 2Y23A 2W0FA 4LLVB 2DQIL 3RP1A 2CXGA 1C5CH 1A7BA 3MRKB 3V6ZB 4U1GB 2J8UA 2UYLA 4FQXA 4HIXL 4NBZB 5H94B 3RZWA 4M62L 4X7EC 4PJCB 1GC1H 4QRTB 4NO0D 1T0PB 3T0EC 2PYEA 2YD3A 4M8QA 4N0UA 3DTXA 1H8SA 1UZ8B 4NN6B 3UPCA 1FAKT 2PCPB 3PDOA 4QRUA 3FTGB 5F6HI 5H35B 4G8IA 2OSLA 4MD4A 2K3TA 3TIEA 4RA0C 4Z7OE 3QULB 1HCVA 1W0VA 3O6LH 3FONA 4KK5C 4K94H 2PXYB 4DN4H 4FQXB 1K8DB 1UH2A 1SMOA 4S2SB 4QT5B 2W92A 1SEQH 2MQ3A 3IJHA 4QWWC 5L2KA 4G8EB 5DVOA 1YEEL 3VGGA 5BO1H 5AWNL 1HCFX 4FQQA 4G8FB 1T1YA 3BH9A 2BRRL 2XXCB 5JW3H 2ADFH 3KHQA 5GHWH 4OGYL 1AXSB 3HN3A 1CICB 1BQHG 4NQDA 1AXIB 3O6FC 3ARDB 3HI5L 5D1ZB 4GAJL 4R2GD 3HI6H 1X5GA 5D7IB 2CLVB 5GS2H 5CCKL 1AP2A 4Y7MA 5IHLB 3PWNA 4HIHA 3MR9B 4FTVE 2Q20A 1AIFB 1QRND 4NZRL 3BH9B 3OWEA 4F9PA 4KXZI 2O5YH 1VHPA 1MCEA 1U8JB 3HPJA 4JG0L 3W81A 5E6IC 1DQDH 2L7UA 5TE4H 3WFCL 3AB0B 2YN5A 3X3GL 1Q8MA 2CPCA 4KKNA 4WO4D 4PB9L 4OLZH 1I8IA 5LJYH 1AP2B 4HJGA 4LLYB 4RFOL 4KPHH 3PWNB 4LAQH 1OPGL 2W38A 1S7UA 2YD9A 2XN9E 2DRUA 1T2JA 1X9QA 3ARQA 4YDKL 2DQCH 5E6YA 3G5VB 2ITDA 1XIWA 1C8PA 5HVWA 1F6FB 1CL7I 3WBDA 3ZSSA 2WLZA 1ZHBA 3ME0A 4N8CH 4LHUA 3CC5B 3THML 5CGMA 5L8KB 1UGNA 3N9GL 4IHOB 4FXKA 3V6FA 4RRPG 3RGHA 2Y07L 1KB5A 3HC3H 4GS7C 1MF2H 2HFFA 1JK8B 3W0WD 5GGRA 3QDGB 3CMOH 4WI9A 3O9WC 1V5JA 1K6QH 1MRCH 1XIWB 2X1PA 4CGTA 1DLFH 3L95B 4X6CF 3IS0X 3VXTA 5D6CA 3LS4L 5DK3A 5F8RC 2RB8A 3GJFH 4K7PY 2QR0A 2GJ6E 2YEZB 4V1DA 3RBGA 3MODH 5BRZE 4WTXA 4I3RL 1KB5B 4A6YH 1J1OH 1FVCA 1MY7A 4BA8A 3IDXL 3FAXA 2ENYA 3H9SB 3OKOA 5BOZG 1URLA 5FHBH 2GHWB 4OT1L 2JJSC 5C0RH 3WFZA 1LE9A 3I75B 5ITFB 1WISA 3QZWA 4MAYC 4JDVA 5FIEA 3MCLL 5HGDB 1RZKC 2EEDA 5D6CB 1GPOL 2GAZA 5AAWA 4MNHA 2ADJB 1IGYA 2AJXL 1J8KA 2B20A 5KG9A 3QUMH 1Q9OA 4NKOB 4O58H 3SDYH 4PJXF 4MJ6B 5EN2A 4LARL 4XP9H 3C6LD 2XG5A 4HLJA 4AZ8A 2EXYD 5B39B 4JFDD 3GSUB 3VXSE 5J9PB 1GAFH 1TCMA 1YJDC 4P59H 1DR9A 1V3JA 5F71A 4YZFE 4XNMA 4EUPH 3P73A 3S4SG 3CH1A 4JDVB 4PJEF 3B9DA 4X80L 2AQ1A 5IB4B 4JFYB 1OSPL 1MAKA 2X6MA 4BELD 4PRAA 1IGYB 1S7TA 3B8YA 3FFCA 4AQ1B 1NFDE 4MSWB 4KY1L 1U3HB 3MREB 2ZUVA 4DGVH 1YYLL 4XP1L 5E00B 4GO6B 3KR3H 3GRWL 3CIQA 3KPRA 4XPTL 5CMAA 3N50A 3SGEH 1CZ8H 1DJSA 3TH2T 3MRPA 4DN3H 2DQGL 1CXFA 1UA6H 2O26U 2OL3L 3N0PB 4NQSA 4IRZH 3TJEL 2FL5B 4JN2B 2IPKA 3CH1B 4XWOD 2VLRA 3BWAB 3VRJB 1R24B 1I3GH 5HGHA 4PRAB 4X83A 4XP6H 1T2QH 5D5MF 5T1KD 4Z0BL 4Q0XL 1HHKA 5CJXA 1DBJH 3VDAA 3KPRB 4OF6A 5C6PB 1YEDB 3HE6D 1FFOA 1S9VA 4WI5A 2R69L 5TQ2L 1KJ2H 3BESR 3HPLA 4FFYL 5IWLC 5L8LB 3MRPB 4GG6F 4NRYA 3IFOA 4NQSB 5EPMA 2HN7A 1JV5B 5GS0D 1YMHB 3QFJB 3QNZA 4OB5H 5HY9B 1VA9A 1BX2A 3QCTH 2BVOB 2VZSA 3SE3A 3TYFB 2X40A 3WCYA 4L3EE 1I8KB 1YY9C 2H26A 1HI6B 2ZUQC 1IMHC 1QSEA 1G7LA 3PQYD 3S37X 4LHJB 3VMOA 3I9GH 3CCHA 2YBRB 4LKCA 2D9QB 1YEKL 2P5WD 5TPWL 3CX2A 3HPLB 5EO9A 4JKWA 4YQXH 4R0LB 1A6ZA 5ESVB 4HZAA 3ZDXF 1UVQA 1QNZL 5C0AB 5TFSL 5MEPA 2EEAA 4PS4H 1INQA 2I07B 3DECA 4HW6A 4OLVH 2FH8A 1Z9SA 3E8UH 4LCWA 2ADIB 4G3YL 4QY8A 4X7TB 3BKML 3DETD 3TH4T 2XTJD 5IESH 1LEKB 1NDMB 5FCUL 2P5WE 4U05A 4LKCB 1VEOA 1C1EH 2HJLB 3P77B 1HE7A 1LNUB 5E8EB 5ACLA 4YHYC 4QOKD 4XCEB 1P7QA 1QVOA 1EFXD 5KSVB 1IC7L 3CLFH 2N7AA 2B39A 5FHAH 1J0ZA 1JZ8A 2P8MB 2GTZA 3DMMD 4ODTH 5KVDL 1XF1A 2XTJE 3NABH 5DD6A 3T3PE 4M1GL 3U4EB 2IH1A 3ARGA 5I18H 1AY1L 5AAMA 4QRSA 1CT8B 2AGJL 3QO0B 5A2LH 1I1YB 1A6UH 4WFEE 4CJ0A 4YNYA 1OM3L 5C7XH 2FR4B 3ARFB 4WTZA 4QOKE 1FZMB 6CGTA 1G7MB 3ARBD 3UZQA 4WW1B 5C0BA 1MFCH 5FYKL 4KGJA 3CXDH 5DMIH 4ZOCA 1KCRH 2F9BT 3DUHA 2V7HB 2BY0A 4KJWD 4MMXC 4PG2A 1KJMB 4RAVA 4GG8B 3MRBA 2I5YH 3MLXH 1S9WA 3RWIB 1KCUH 1RZKL 2V5RA 2H1PH 1CDIA 3ARUA 1MCDA 1KTLB 3CVHL 3EFFA 3T2NH 4JO3L 2C1OA 4PY8J 3KPPB 3WUWA 1RUKL 3BN9D 4LPCA 5F9JB 1I85C 4LLAA 5ANME 3B9VA 3IFNL 2BNUA 5IW3A 4Z5RA 2RFXA 4H88L 3TO4C 1LP9B 1I7TA 4HSQA 1YJDL 4Y4KB 3CXHJ 1A4JB 1FBIL 2VLKD 3B6SA 2IFGA 2RHEA 4AIXA 2GK0A 4D2NA 2Q8AH 1KC5H 3GBLA 5F9OH 1AD0A 2DMCA 3RUGE 3WUWB 1F8TL 4NC2B 3DGCR 1CIDA 4OF5A 3QUYC 3P30H 1BIHA 2V2XB 3MOAH 4PJDF 4F37F 5CZKA 4NRZA 1I7TB 3RY6A 2IBZY 5HI3D 4RMVA 1QSFA 4XMKL 4XHQA 4JFPA 3GI8H 3IJSA 1AD0B 1I1AC 4I5BB 1KPUA 2UWEA 3MRDA 4XCCH 1OL0A 5SWSA 1KCVL 2NW2A 1U6AH 5HSFA 2FATL 1NQBA 3GBNL 1G6RH 3K1DA 1H5BA 3F7VA 4BZ1H 2X4QA 1JHLH 4ELMF 1H3GA 4F9LC 3BMWA 4CU7A 5CKAA 3V52H 4EBQL 2ICEB 4HT1H 4OLXL 3KDMB 3VH8B 5EUOA 1S7WA 4BSWB 4JO1L 4LSRH 1MCBA 2Y36L 1CF8L 1B2WL 3S36L 2IAMA 5FKAB 3D0VA 1TPXC 1CXIA 2F53D 1AGBA 5FYJD 3LRSB 3UC0H 2OP4H 2NW2B 2WINA 3UDWC 4RZCB 1NCAH 3QPQD 3VFPA 2MKLC 1T3FA 2E6PA 3HZYA 2ARJB 1N2RB 1EZVX 5T3ZH 5GIRB 5C0DA 4R2GB 4ZOAA 2WAHA 1IC4L 5SV3A 1IAIL 4DK6A 2AI0L 4KRNA 4HWNA 5KW9H 1JRHH 3QXUA 1ADQH 4HEPG 4CU8A 2Q86A 3Q1SH 3BPCB 3G5XA 3EYVA 2A0LC 1WK0A 1MOEA 1QRNB 4ZTOH 1MAMH 3E3QE 3FRUB 1U8QB 4UT9H 2FLBT 4HIIA 3VFPB 2R4SL 4Y4HA 4OCSH 5C0DB 4X98A 3AU1B 4MD0A 3QIUA 5J11B 4L8SB 4WO4B 2R1XB 2DQUH 2QSCH 3PL6C 5EWIH 4BSVA 4ZFGL 5J6GB 4WEBH 1UJTA 3BP6B 3IDIB 3KYMB 2CR3A 5E8OB 5ERWA 2LAAA 3EYVB 1CG9A 1Z3GH 4QXGH 5D96B 3GUTA 2E9JA 3N1PC 1BAFH 1SBSH 4G7VH 1N6QL 2BY2A 4H8WC 5KJRH 4RAHA 3U4BL 4QHMA 4KKCC 2BOBA 1EHLL 2YXMA 4DGYH 3TN0D 2R9HD 3R1GL 3WD5H 1FC1A 3MNVB 4Y4HB 5J1AA 2X42A 5FM4A 3CDCA 5I16B 1N64L 5C08D 2X4SA 3V6OC 5JOPD 4ODSL 35C8H 2W9LA 4NP4L 5I74C 4OGAD 5ISZA 1OVZA 3TYGL 5K9KB 5D8JH 4DVRL 4JRXA 4UTBH 3RWFB 5DRWB 4FQJL 3W0WB 1ZHNB 5HYSG 5M95B 3VFUA 2VLJE 1I3UA 3HAEA 2DM3A 4U1MA 2CLRB 1OTSD 2MQCA 3FB8A 4AL8H 3CUPB 2AP2A 2PXYC 2Z91A 1F00I 4DFHA 4TNVF 1LO4H 4Z18A 5C08E 5JOPE 3SKNB 5I1KH 5CZXC 3NH7H 1FO0A 4EIZC 4GMSL 1R3HA 3ALXA 25C8L 5GGUA 2WWMD 1HH6A 1F3DH 4H1LH 1L7TH 3QWOB 2YD1A 4LCCC 3VA2C 1MEXL 4NOBA 1CLYL 3RWJA 2PUQT 4JY5L 4O4YL 3VFUB 3WNOA 3QHTC 2VYRE 4NFBA 4X5LA 1QPPA 5D1ZC 5FGCB 3W2DL 4BFBD 5ADPL 4EI5A 4YFDB 5DI8B 5CEYA 1TENA 3UTOA 4J4PA 2PO6C 1DEEA 4YPJA 1R3HB 3HC0B 1HINL 4G6KH 3MUY1 1A64A 1X6LA 4HK3J 4R7DB 4JPVL 1J0HA 1HH6B 1E4XH 3HG1D 3S37H 1IC5H 4JFDB 4ZD3L 2R2BB 4DUWA 1KTDA 3LKQB 2JJTC 5EFIB 1I9RH 3HS0B 1DVFA 2Q7YA 4S1RL 5DUPL 3QHFH 1B0GB 12E8L 3MRGB 3JTTA 1UFUA 4X7DC 3L3JA 5DD3L 3Q6GL 3SBWA 2ZZUT 5AUMB 1RK0A 1UB6B 1GGCL 3ULSA 3CVIH 3WV0A 5CZVL 3IAQA 3BKJH 4J1UB 2J6EA 2YC1A 3S3PA 3HE6A 1TZGL 3FO1A 2XY1A 4QYOB 5B8CB 4JFFD 3VD9A 4YHPB 1BVLA 3BEVB 5I0DA 1J87A 1BEYL 1GGBL 4LEXH 1IVLA 1HQ4A 4PGEA 4LQFH 4OZFB 3RIAK 3T2OA 1BJ1J 2IF7A 4PJCF 2Q7YB 2XQYK 1UCBH 4B53A 1X5ZA 2A2QT 1NEZB 1HHHB 4GJTB 1V3KA 3OKMA 1MIMH 3L3JB 1O7VA 3SEPA 5DFWH 1MFDH 5T1KB 4M1CC 3HB3C 5LAXB 3LKPA 1JWSA 1FV1A 4JM2C 2X1XR 2YC1B 3T0XA 1YN6B 3WLBA 3KXFA 4JFFE 1ZT4A 3E1F1 3HE6B 2MKWA 1HHIB 1ZMYA 4HMEA 3FOMB 4OBRA 5GS2D 2CJUL 4MB4A 2CDGB 1FAIH 1HQ4B 5DMKB 1KLUB 1QBLH 5EU3B 1I7ZB 4PP1D 4XPBL 5IB5B 1RZFH 4WI6A 2VXSH 5CUSL 5IBTH 5IHZA 2J8UE 1N5AB 3S88H 3UZEA 3PQYB 1RIVH 2F19L 3SKJL 1NAMH 1EHAA 1QFWM 1H9VA 2PYEE 5EZOL 2P5WB 5CJOL 3KYOA 4N0UE 1R3LA 4RISH 3EBAA 4K3DL 4BUGA 3F5WA 4XI5D 1U42A 1MJUL 2YK1L 4I77H 4EXKA 3CLEL 1WV7T 1ZGLP 4Y5XA 1UG9A 2H3NA 5ETUA 2MCPH 3GK8H 4A2MA 4D8PA 3NFPA 1A7PH 4H8WL 3PHOA 4PJ8D 2A73B 4EOWL 4CADB 4NN5C 3BDXA 1T04B 4YX2L 1F11A 3MLSH 5DEFB 3AC0A 2EZ0C 2LAGB 2ILLA 1G7QB 4IOFD 2IADA 3U7WH 4G9FE 1NBVL 5TDPB 3TF7C 2YA2A 5IF0A 3WXVH 3G5YA 5K59E 3WS3A 4QCIA 4NKMB 3TBVB 1LDSA 5L2KE 4YHOH 1TLKA 5HPMA 5F9WB 4QOKB 4YHMH 2G75A 1EFXB 5ADOL 1UM5L 5FA3B 1CBVL 1OARH 1SYSB 3BPNB 1J9CT 4OQTA 4Q6IC 3DMMB 4R9HA 4MLIA 3S7GA 4XH2A 1F11B 2FB4L 4GAGL 3P4NB 3RZCA 4KKLC 5KVGH 1Z6JT 1UJ3B 4RFEB 1TZIA 4JPKH 4YFEA 1T89C 3IVKA 4FXGA 2H2SC 5HHOD 4OSUH 1B0RA 3UZVB 5HPMB 1QKZL 5ANMB 3UP1A 3B5GA 5E8NB 1Q9KA 4BK4A 3UTSA 3S9DB 2ZUWA 1RJZB 4JM2F 4APQC 5ITBL 4AMKH 3BJLA 1TITA 1T1XB 1YEFH 4UIKH 4Y19D 1M7IB 4P5KB 4NJ9H 1CS6A 3H3PL 2ZCLH 1OW0C 4LASH 3WDJA 2JB5H 1UXSB 3IJYA 4LEOA 1S7SA 3S98A 1EEQA 2VDKH 4UAOB 3MLUL 2B2XH 3QUXC 1NPUA 1PVHA 4M1DH 1PG7L 2XWTB 2HYMA 4OFIA 5IQ9B 2R0KH 1E4WH 3UTSB 4MVBD 3U0WL 2FX8L 2H8PB 5F1SA 4YFLI 2OJZH 1FL6A 2VLKB 5EZJA 5E03A 3O41A 4R26H 4M9PA 1JUFA 3T0VA 4M03A 5I30L 3D3VA 3UTTA 5IT2L 5B39G 3REVB 2UUDH 3ULUE 2V5TA 5L7XH 3TIDA 1U8MB 4FNLH 5HHNB 1KEMH 1BBJA 1ZE3C 1EA9C 2IPUK 5IQ7H 5DJZA 2EDEA 3FB6B 3DROA 1HILA 4QF1A 1FL6B 4S1QH 4LSTH 4JFHD 1X5JA 4F3FA 4XHJD 2AJUH 1JUFB 2AQ3A 5JXEA 3EO1A 1EBPA 5ICYB 4GXVH 4LU5L 2ADGA 1EMTH 2AQ2A 4OCNC 4MDIB 4PJFF 2GW5A 5F89A 3RA7L 3TIDB 3L7FB 2VDRH 2DOCA 2FHBA 4S1SH 2NY5L 4QRQA 5DJZB 3E6HA 3GHEH 3LY6A 2XZQL 7CGTA 2BXYA 3QCVH 1FL3A 4XC3L 5IVZA 2CIKA 3NIGF 5CSBA 4F3FB 1NC2D 5C2UB 5E24E 1TJHL 1DSFL 4FQIH 4WDIA 4MNQA 1LHZA 2R56H 4YC2B 3NA9L 4ODBD 1AGDB 2AEQL 2FYYA 2F53B 2FHCA 4UU9A 2KDGA 3BWUC 1MI5A 1U8KB 4HS6A 1PSKH 4H20L 3MRHB 3BVNA 3TT1L 1N3NB 3SCMA 4DZ8A 2HA1A 2BOCB 4MJIA 3MBXH 4N9OB 4Z76A 3MC0A 5CP7B 5CEZE 4OCYL 4G42B 1TJGH 4ODHH 3M8OH 3AMKA 1YEJL 3EFDH 1WBZB 5DRZB 5JPMB 4PGCB 5FOBA 4G5ZL 5BVJB 4LVHB 1CD9B 1JF6A 3U6RA 3WN5C 4MNQB 3ZKSD 4OD3L 2BSRA 4UU9B 1MI5B 3LEVL 4I0PD 2FECI 3OMZA 3TBSA 1RJYB 3EZJB 3EJYD 1HNFA 4U7KA 5D71L 1N7ML 3BVNB 4MWFA 1GIGL 2G2RA 2GT9A 5GZOD 5I15H 4M62H 3EOBA 3IRPX 2VLRE 1CI5A 5GSRB 3UO1L 5EC2B 3QIBD 4M4PA 4YDVA 3WXWL 4GQPH 1RAMA 1MJ8L 3MBEC 4FQLH 4ODXA 2DLEA 3FO9B 5J4MA 2VDML 3T09A 4HGWB 3SE9L 4XVJH 2F5BL 2Y5TA 2HKHL 1R3KB 4M48H 2GTWA 5ACZA 4FP8L 3WJLC 4MJ5A 3QQ3A 4PRDA 3TN0B 4PY7A 1FNFA 3MCKB 4GRLC 4UQ2A 1IL1B 3V5HA 3SGEI 1JZ5A 3OAYH 1FFPA 5C08B 1EHXA 2M2DA 4KAQL 1SY6L 3DRQA 4ZSOB 5A16A 1HDMA 5C9JB 1YEEH 5E9DA 5AWNH 5IOPB 1VEPA 1B0WA 4DZBB 3VXOB 4RGOL 3TT3L 1RIUL 3OKYA 2DQEL 2ZCHL 5MENA 2Y5TB 4PJHF 5IMMB 5E5MA 2OTWA 4LAJH 2OTUA 1DBML 4PRDB 1ROWA 3HI5H 4GAJH 4JREB 4UQ2B 1A9EA 4HF5L 1Q0YL 4NO3A 4Q2ZA 3MRQB 2PTTB 3O2WL 3TNMB 5IVXA 2VAAA 1OB1B 3HMWL 4D0CB 4NFDA 1MWAA 1WQVT 1FFPB 1I3RB 4LCWE 3SDXF 1HKLH 4JPWL 5E8PB 3UAJC 2E6JA 1NAKL 5E1AB 1U8OA 1XGYL 2W0KA 1T21B 4JO2H 3BKCL 4PJGE 3BYYA 4PPTA 1T20B 1H15A 5C6TL 4CMHB 3KS0H 5EU5A 2A1WL 1LQSR 2HKFL 4HMCA 2EDRA 3P3YA 4LRIC 3DSNA 5JIKA 4F33B 1YY8B 1GZPA 4ZUWB 2BCKB 1LO0L 5AZ2L 3X3GH 3JV6B 3NCYS 2FX9L 3BGMB 4R2GC 3RVWD 5T3XE 4PB9H 1CGSL 3MJ8B 1H3VA 3CSGA 1KOAA 4F57L 1F4WL 4RFOH 3BRDA 4G7YH 5B38B 3VXRD 2APVA 1IKFH 3C5ZA 3MRJA 5IROC 3VD7A 3GMLB 3KPSA 5FDYA 2D9CA 4X4YA 4YDKH 1H15B 1YNLH 2EDOA 2YMXL 4IRJC 2E9BA 2NXZD 3HG1B 4F15B 2WLYA 2CUIA 1K5NB 4K2UL 1QLFA 5HDBE 1CYGA 2HTLC 4R90L 1LEIB 4WI2A 5E5UB 3OKDB 4C59B 3T4YA 3RX8A 5C0BE 3THMH 3SO5A 2FZ3B 5F3HB 4ESKA 2FBJL 1RJLB 3NPZB 2DM2A 5J11C 3S36X 4L8SC 3MA7A 3VXRE 4Z0XA 3T65B 4JB9H 3C5ZB 1A7RH 4U2ZA 3LH2L 1N4XL 4PRID 4Z7OF 4FABL 3RWDB 2I60L 2HTKD 1NGWA 5KSAD 4RA3A 4JG1L 5HI5C 1I8LC 2NQCA 2IH3B 3TBTA 2VN4A 1IGCH 4JLRA 4LOUD 3T4YB 3QI9A 4FZ8L 1Z5LB 5LGJA 3VH8G 1FL5B 3RTQA 4H5SB 3C5SA 3V5DB 1X5KA 4I3RH 4R7NB 4J23A 4Z0XB 1OGAA 1XCQA 3FN0L 5T1DL 4C4KO 3QXWA 4HUKB 3WFHA 4RWYL 4M5YH 4XPAH 3LN4A 4L4TD 3BIAX 1U8PA 4PRIE 3O3EB 1AGFA 1HXYB 1P6FA 4P5TD 4GBXD 1XF3A 1OT1A 4HC1A 5T1LD 3NN8A 2ZUTA 4XVSL 3W82A 43C9A 5T3ZD 3WNLA 1WEJL 3TBTB 3V7AE 5FECA 4FS0A 1GZQB 3LRGA 2AXGA 3VWJC 2FWOB 4NNPL 4O02H 5F1KC 4CL7A 2BY1A 2AK1L 4X8XA 3RTQB 5D93C 1YC8A 2P24A 2AJXH 4H26A 3T1WA 4PV8A 1Q0XH 3A67L 1XCQB 2DTMH 1EVTC 4JFQA 1CLOL 1B90A 3LN4B 3OF6D 4TOYL 4LARH 5HHQB 4YBHA 3HKFA 4LF3A 3MYJA 1QSFE 1H8OA 4OZIA 1I1FB 4OZHA 5DK0A 4PJ5D 5AG8A 4HH8A 3AXLA 5J1SC 4P2OD 3WO3B 1I7RB 2BVEA 4J8RA 1NCWL 5D2LB 2UWEE 2DAVA 4N9GA 1LDPL 1EEZA 4JHZA 5DTFB 1NMCB 1MFBL 2ZWLT 1Y6NR 5SWSE 1X5AA 1OSPH 3L3DB 4PJ8B 3SDAC 4DTGL 4OLUH 4H26B 1J7VR 4KY1H 1YDPA 2X1WL 4XP1H 4XNYL 1PZ5B 1JI2A 4JFQB 4POUB 3GRWH 2XNAB 4XPTH 4WY7H 3TNNA 2X4UB 1E4KA 5EUOE 2R39A 3C6LC 1IM9A 3FMGL 4IOSD 4JRYD 4U2YA 2OL3H 1OY3B 4Z78B 4PTUA 4X6EA 1FN4A 6FABL 2ZCKL 4M02A 3RPIA 5I8KH 2HFEB 4NZUL 3RI5F 5DLML 3PHSA 1Y6MR 2CKBH 1BIIB 1D9KA 1A14L 4LIQH 4KK6D 1PX4A 4X8JA 4FFVD 4U6XA 4S10A 1MFEL 5GGRY 4CVWA 5CSGA 4NDMB 5I71C 2R69H 4HIJA 1UH3A 1IM9B 5HHOB 5HHPB 5B8CC 2XPGB 3VRIB 4O2FA 3C8KA 1YN7A 3GJFB 1F3JA 1FN4B 2AJVL 1QPXA 4WV1C 3EDJA 1PKQA 4A6YB 3VXNA 1CR9H 4L9LB 4OLWH 5IUSA 2AV7A 2OZ4L 1UADC 5I8EA 3SO3B 5HI4C 3D18A 4Y19B 3X3FL 1D9KB 4HKXA 5E2UH 2Z35A 3V0VA 5HYJA 4U6XB 1R5WA 2DL2A 2AJZB 5TPWH 3AROA 4OZ4B 4PLJD 2UY6A 2VLME 1QNZH 1F3JB 5TFSH 5HD8C 1OAQL 3F65A 3KPLA 5I17A 3BKYL 3EYQD 3QUMB 5GS0C 4AG4L 1G9MC 4U1JA 1MJ7L 4XWGL 4R97B 4U31A 1MIEL 1S7RB 1KIRB 4EJ1C 1WC7A 5I8EB 3KLDA 2BNRD 2QQKL 1ZT1B 5I1CH 5FCUH 1P7HL 2AV1B 4EUPB 2FRGP 3QQ4B 5E4EB 1W8OA 4IJ3C 4L3CB 4YZFF 4PLNC 5BZDA 2BVTA 5CBEA 3UJTH 3KPLB 4JRXE 5E7FA 3MLRL 3MV8D 5I1AB 1IC7H 1WWAX 5B21A 2V5YA 3RNQA 5F1NA 1NFDF 2P8LB 4KKAD 4ETQA 4NWUH 1I8MA 4XZUA 3DETC 2XTJC 3TA3D 1AY1H 4ZXBA 3D85A 2GSIA 3DBXB 2AW2A 5EBLA 1IEHA 3ZDYE 1OM3H 3NCFB 2WANA 4OZFG 5EIQA 5CBEB 3ZKQD 5TDOA 5FYKH 4PJBE 3L1OL 1YQ2A 3AS1A 3MLYH 1BECA 1NEZG 5BZWA 3VFTA 3BPNC 1CD1B 4W4OA 4N0YL 4MMZC 1KJ2B 1RZKH 2AAVA 5DJAB 4P5MA 4XZUB 4DAGL 1NC2B 4LCYB 3VGFA 4OFKA 2VNCA 3IKCB 1UENA 3D85B 3CVHH 1FE8H 5IB3B 1WIOA 2C1PB 1J5OL 1XF2B 3KHOA 1O0VA 2FD6L 5JA9A 5FM5O 9CGTA 1A2YB 1XR9B 1NKRA 2KBGA 3CFDA 3IFNH 3ARBC 5D6DC 2WZPD 3RGVD 3D39A 2BFVL 3VRLE 1YJDH 2ATPB 4EN3C 3L6FA 1KIUA 2XG4A 3GGWA 4B7LA 4KJWC 1FBIH 3TZVC 2X4OB 4KVNH 4D0BA 3SE4A 2YPKA 3AREA 4R96A 3NCJL 5AYUL 1FC2D 3BEWA 1JGDA 1MLCB 1U58A 4LKXB 4I18B 1F8TH 4UAOC 5EBWA 2LV4A 2LE9A 4ZAKA 3BN9C 4HWUA 1CN4A 4I0PB 3CH8A 4OM1L 2EH8H 5I2IB 4PJIA 3VFMA 3D39B 2WBJD 5FK9B 3SY0A 4ONGH 2X4NA 1XGRB 4JZOB 4L5FL 5INCB 3SGDH 3FZUD 1I9JL 4OV5B 1BZ9A 4L1HA 4P4RA 1CDHA 3JVGA 2HJKB 3T8XA 4HWBH 4KTYA 3FKUS 3F62A 2YPKB 3QIBB 3V2AR 1OCWH 5CD5C 3G6JE 3FB5A 3GNML 4MQSB 4OD1H 4C56E 1WBYA 1KCVH 5EOCJ 3KXFE 3MA9H 4LLWA 8FABA 4ZUUA 3IT8D 2FATH 1KCKA 3GBNH 1ZVSB 3ROLA 4HAGA 3T4AB 3SY0B 3OKNA 4M93C 1DDHB 3JSSA 5HI3C 4E5XB 3T3PF 5F88B 4EBQH 4NQCA 4PG9A 4OLXH 4P4RB 3GSNA 1ZSDA 1QBML 2ZJSL 4F37K 2L0DA 2Y36H 3D1MC 1HSAA 3EDKA 1O5DT 4GRWE 4NM4L 1PG7X 1CF8H 1K4DA 2A6JA 1B2WH 1X5XA 4ZFOL 1CU4H 2OR7A 2APWA 2CK0H 1B4JL 1PW3A 3OHXA 2NY4D 1VESA 3MNZA 2KL6A 3F58H 3I3EA 1XGTA 2OQJB 4JVUA 4U1KA 2B1HH 2NPLX 1MCOH 1XT5A 3EJZD 5FOJA 5A3ID 1A6WL 1IC4H 3PDDA 1KV3A 5GS0L 4NQCB 1G9ML 4U1HB 4YXKH 1ZSDB 3RWGA 2GKIA 2Q6WB 3DHMA 4MQ7A 3QUZA 5F97E 1KUMA 2CDEB 4YC2C 4DCQB 1WF5A 4QRRA 3STLB 1CE6A 2FEEI 3NTCL 5B4MD 3OKLA 3SN6N 3HRZA 2CRZA 1MHHA 2AEIT 3E3QC 4X7FC 2R4SH 4PGDA 1EJ6A 4Y5VC 5CJ5A 2OM5A 1J86A 4PRBB 3RVVD 4XPHL 2ENSA 2XKNA 3NFNA 4FZEL 1BLNA 3RWGB 3TO2A 3I6KA 5FYJU 1AGEA 3RUGF 5SWZD 3VXRB 1WZLA 2NTSP 1PYWA 4KKBD 4M61A 4KHXH 4QHUB 1G6RA 3OR6A 5C0IA 2APTA 2NXZB 2QKIA 1N6QH 3OKLB 5K33A 3KYNA 4FHBD 3U4BH 5I73B 4XNZC 4UB0L 3VG9C 5J12C 1EHLH 1F6AA 1JPFB 3Q3GA 1VFUA 3I2CL 3RU8H 3P11L 4LSSL 2B0SL 2ZKHL 4OQ1A 2R2EA 1OSZA 5EU6A 5HGBB 3MRRB 3B5TA 3EKCA 3NPSC 3U9UA 4K9EL 4F8TA 1BLNB 1VCAA 5SWZE 4ODSH 1MCHA 4X6DA 5DDHA 3GBMH 5D7JA 3D48R 3RAJL 4M61B 3FQNA 5GRYA 1G6RB 1H8NA 4DVRH 3GHBH 4PRIB 4WHYG 3WFBL 4Y4FD 4FQJH 1AE6H 2QKIB 3M1BB 4I0CC 5B22A 1P9MC 4JZJB 1YC7A 5EUKA 4RGMB 2LTQC 4YE4L 2R9HC 1WBXA 4W81A 3GIZH 3FO2A 5I0ZA 2Y6SC 3TGXA 1RUPL 2OJEA 3LZFL 2ICES 5DRXB 5C09D 3WE6B 4MDJA 4K3JL 1KNOA 4GMSH 5DD5L 1NCNA 3WLWD 25C8H 4L4TB 4ZNCD 1KN4L 1N59A 4P5TB 3FQNB 4GBXB 3BDBA 3X14A 1YEIH 4GW5B 3O2DA 3O8XA 4TULL 3D3VE 3UTTE 3VXQA 1MEXH 4WWKD 4Q74A 4OFVA 2A9NL 3EYSL 3FT4A 5EUKB 1VPOH 5I1IL 2IG2L 1OTSC 5EO0A 1PEWA 5ADPH 4JREC 4Y8DC 5I1HH 4LQ1A 3JTSA 4OLYL 1Y6KR 1LD9A 3ZMRA 3KYKH 1CXKA 2V2WB 4N5UA 1N5YL 1J18A 3STBA 5IR1B 4L8CA 2WWMC 4WUUD 3TBWA 3O8XB 3TC9A 4PJ5B 1ZEAL 1LO3H 3T3ME 3VXQB 2IAND 4P2OB 2MOVA 1ZLUH 4L8BA 3O6KL 3DYMA 1RHHA 4S1RH 1GXEA 4QHNB 4C83A 1RY7B 1F13A 5DUPH 4KI5D 4GW1B 2Q7NA 3MRCA 5IP4A 4O2CB 3WKML 1GGCH 1VFBB 2Y7QB 1T66C 1JPTH 4U1IB 4IIQB 3EOTL 2QJDA 5CGTA 5FGBA 5IG7A 4WUUE 3FQUA 2KQNA 4GOSA 3LAFA 4XVUD 3JV0A 3TBWB 2IANE 4S1DC 1MCNA 3ARZA 2EDLA 2Z31A 4JRYB 2H32A 1QP1A 3J7HA 4FQ1H 2BVPA 1GC1C 3FFDA 2OXHA 1S78D 5FO8A 1YA5A 2V2TB 3DVNA 3OKEB 3MRCB 1A1NA 2VJXA 4J7RA 1V7NH 2D31A 2P7TA 4LSVH 4MJIE 4Y1AD 4YIQA 1FRGH 1LO2H 4LLQA 4I4WA 4KFZC 1LE5A 4E42A 3BZEA 1OT2A 5DFTA 1T0MB 4F7PA 3ZKNC 2EKSA 4P4KC 4ENED 1WUNT 1FYHB 4XPBH 1JGEB 1P69B 5FYJL 3SDCC 2H9GA 4LGSB 1JNJA 4LPXA 1RULL 1G1CA 3D69A 2D4DA 4X7SL 5DSCA 4H1LB 4HDIA 1HIML 5CAYB 1SMAA 1NBYA 1DEDA 1B3JA 5EO1A 2E5EA 2HP4A 3OAUL 3F7QA 4GMTL 2XWJB 1LE5B 1QEWB 2V9TA 1KCSH 3BRGC 2YK1H 3QO1A 1ZGLB 2ZOLB 4JANA 4M7LL 1UEMA 1DANT 2H9GB 4PP1C 3P4MA 3G6DL 1OLZA 4H8WH 2OMBA 2HT3C 1HWHB 4NM8L 4YX2H 4HDIB 4Y89A 4ZTPL 4JGMA 2BNRB 5B38G 3CJJA 5JIIA 3UBXI 4KJPD 1P84