2WZPD

Structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
VQLQESGGGLVQAGGSLRLSCTASRRTGSNWCMGWFRQLAGKEPELVVALNFDYDMTYYADSVKGRFTVSRDSGKNTVYLQMNSLKPEDTAIYYCAARSGGFSSNRELYDGWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
molecule keywords PUTATIVE RECEPTOR BINDING PROTEIN
total genus 30
structure length 122
sequence length 122
chains with identical sequence E, F, J, K, L
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wzpD00
3D69A 3DECA 2HVJB 3E6HB 2B1AH 1RMFH 4ZD3H 1RZGB 5CGYD 2BXYA 3L6FA 1CZ8L 1FYHB 5TE6H 4WNQB 1I3RB 3GSOB 3EFFA 3QCTL 1K2DA 3E6FB 4PRHA 2ICEB 4XZUA 5I8KL 5HHOE 4EDWL 1F4WH 3VXUE 4PY8I 1K3IA 3H0TB 5DJYB 1OAUH 3CFKA 1G9MC 3VFPA 2DIBA 3EDFA 4MAUH 1HYRC 1JIBA 4GQ9H 3EDDA 3U30C 1BIHA 3EYOA 1UENA 3WO3B 2MQ0A 5BVPH 5BV7H 3EJZD 3R1GH 1KLUB 5IGXH 4XPAL 3IDNB 1LILA 3HNTL 1W0WB 5MEQB 1MQKL 4PGDA 3S3PA 5DC4B 3QNYA 3P30L 1JGEB 3RDTB 5IBTL 1DEDA 3SE3A 1QBMH 5EPMB 5L9DL 3QIWC 1BBDL 3ZT5A 1KB5A 4HZAA 3QXAB 4HS8L 3OAZH 1BOGB 1HH6A 4LCWD 3PL6B 1ZGLB 3OXSA 5DO2C 3HNVH 5KSAC 5FYKU 4I13B 1RUQH 1DN0B 1KXTB 4U6XA 2EKSB 4PJDB 4NRXA 1KCSL 3KLAA 2H32B 4UDUA 3WN5A 5HYFA 2P1YA 4MXWH 2A73A 3RGVC 3JUYA 4YFLF 1MEXL 1NEUA 4FN0A 4E0RB 4IBLT 2NY0B 4JFHE 4K3EL 2ZPKH 4X5LA 2VDOH 3BP4B 2EC8A 5EH1A 2UYLA 2CK2A 4OV6F 3U79A 4ZNCD 3UJJL 1F2QA 1TVHB 1T7ZA 3NFSH 1ZGLA 3N1MC 5D1XC 2UWEE 2LU7A 3QXAA 2R0LH 5D8JL 3NZHL 1QRND 2AEWA 2YMXL 3HFMH 5C07B 4PRBB 1GC1C 3RWJB 1I7TB 2VLRE 1J0YA 3VG0H 4D9RD 3RBGA 5CBAB 3S35H 4Z8FL 3QFJE 1T3FA 5EORL 4PJDF 4XHJC 2HT3C 4P3CH 3UTSA 3WUZA 1LO5B 1VB9A 3IF1B 3BSZH 1OWWA 2JB6A 5FGSA 5LCVL 1BBJB 1WBZB 3DETC 3R06B 4OF5A 4DZBA 4BSVB 3TZVC 1IAIH 5F89A 5TDNA 2CKBA 3HC0A 5HGAB 4DFIA 1S7QB 1SMAA 3KPSA 4NNPL 1ND0B 5DFTA 2R2EA 1F3DH 5T5NF 1G9ML 4I3RL 3FRPA 3AMKA 4FQIL 5DFVD 4X7SH 1BD2A 1EZVY 3P11H 3PIQB 3T77A 2K7QA 3S97C 1KEMH 3RY4A 5FHAH 2VKWA 3MGTA 5F72S 1MOEA 1U3HB 5D2LE 2CKBL 1QRKA 1IZKA 2AABL 2FX7H 3UO1H 5FOBA 1OGAA 1A02N 4JFZH 1S7UB 3ZL4L 5KBNC 1P84K 1DSFH 4JG0H 1EMTH 3VI3F 3C9NA 4R0LC 3P0YH 1KFAL 2XZQH 2WP3O 3KG5A 4PTUA 4KK6D 4LCCB 4OCMC 3F65A 4XT1C 1A7RH 4M1CC 1IEBA 1B0RB 1GGIH 1S5HB 4FQJL 1IAMA 5TQ0H 5E94A 1HXYA 1KF9B 3HR5B 1MHCB 4CJ1A 2ZSWB 3S36H 2AK1L 5GS1A 4A2LA 3O6LL 2DQIH 1SJEA 5KZCD 4JZJA 2FHCA 1A21A 2VC2H 4P23B 4OSUL 1A0QL 2KL6A 1OTUC 5T5FH 1CWVA 4K3DH 4HS6B 1WBYA 4WU7A 1JYWA 2Z91A 1MI5A 3CU1A 1JE6A 3MRDB 2VLJB 4GRWF 3RVTC 3WNLA 4ZOAA 4OIBA 3C08H 1RFDL 1QFUH 1U3YA 3S96A 5GISH 3ARBA 4XI5D 1I9JH 5I76A 3AAZB 1U8QA 3GMRA 1U36A 4EI6B 1FNEA 1NC4B 3UTSD 2JK5A 2DWEB 3TBSA 3VGGA 2R2BA 5HDQH 5CJBA 4M62H 3G6JA 5K9QI 3RU8L 3MUJA 4JGJA 1TNNA 1DTUA 2X4OA 3L95B 1N64L 2VWEE 4OGZA 1MCBA 1NCAL 1S5IL 4GKZB 1FL3B 1UA6L 1I8MB 3L3JA 4OZFG 4I8DA 1FE8L 1G7JA 4YHIB 2WW8A 1JGLL 3LQAL 3EYQC 3NFNB 2QR0B 1N8ZA 5DUPH 2I5YH 1G9NC 3VGHA 5AZ2L 4X7DC 3ARDC 4KQ4H 4O2FA 2ZNWA 4ALAH 3HI1B 1JPTL 3MV9E 3T8XB 4LVEA 3WD5H 2LAAA 3V5HA 4KTDL 3TBVB 4WVRA 3H9SE 3HG1B 1JPST 1E28A 5GSRA 2ICWA 5EO9B 2Y9RT 4R4NC 5CJOH 4M03A 1ZVSA 3B9DA 2M26A 1HXMB 2P24A 3GJFK 4S10A 1QRNB 3QUKB 4EIZC 2DKMA 1MFAL 2E27H 2YK1H 4MD4B 3STBA 1DVFA 1R3LA 4NP4L 1DQLH 4HF5H 5JPMB 2NYYC 1RHFA 3RWGB 3WFBH 3V8OA 1BQUA 1KUMA 3DROA 4PJGB 4ELKB 5ITBL 1C16A 1SVCP 4QHUA 1Z9SA 2EYSA 1EJOH 4R8WL 2CO7B 2EO9A 1CDYA 5MP6H 4GAGH 4NKMA 5LG1A 3ES6B 4WWKC 3MREB 5KG9B 2EICA 4Y4HC 2APXA 3LS5H 5ERWB 1XGQA 3GGWB 5EOTA 3VXUD 1N3NB 15C8L 5EU4B 3QCTH 4K9EH 3IYLW 3T8XA 1ETZA 2EH7L 4XP1L 5H37H 1FVEA 3MROA 3GI8H 1QUNA 5BS0E 1IGYA 1JNHB 1Z6JT 4NZTL 1PZUB 1XF1A 4OAWB 4X7TA 2C5DC 1MWAL 4QRUB 2MMXA 3GMLB 2AK4A 2GFBA 3AMLA 3MRFB 1D5BB 4AIZB 2DIAA 3IS0X 3ZHDA 4Z7NF 5K59F 5KTEH 2WQ8A 4WTZG 1UXSB 4KK9C 1FSKB 5E4EC 3F7RA 4PRDA 2DWEA 1R5IA 4NRYA 4OLXH 3P30H 1A14H 1CCZA 1P5UA 3VCLA 1MAJA 4ZFZB 4ENEC 2G75A 4WHYH 4LARH 1A4KA 4P57A 4NOFA 1LQSR 2R0WH 2AGJL 1KJ3H 3ULVH 1WFUA 1HIMH 3S96B 3UTTD 3LS4L 3RWIB 1UB6A 2YPVH 3ARVA 2ZCLL 3NIDF 1U8KB 4JQXA 3BZ4A 3T2QA 1HXMA 1GL4B 4R97B 5SWSB 1YUHA 1N59B 2H26A 4HUVB 4XBEL 3VDBA 4YIQA 4JY4B 1A3LL 1AFVL 2XN9E 1FZJB 4EOWH 3ZDZE 4PY7B 4LLUA 5FYLH 1J8HA 2DQJL 3I2CH 5IBLD 2C4XA 1H15A 3STZB 3UCRA 1HEZB 2X70A 1JWSA 4UTAH 3CC5A 2D03L 3GMQB 2AXFB 1OCWH 5IFAL 4P2RE 2GUOB 3MLVL 2VQTA 2MTPA 3I6GB 4XC3L 2VH5L 5EIIB 4CN4A 4F9LC 5D71H 3B2VH 4LCCA 3U48A 1UB5B 3I3EA 4PBWD 1EDQA 5DA4A 1XGUA 3WXVL 3WV0A 2VE6B 1BECA 1YECL 4UINL 5GGRB 1SY6H 1HHHA 4E9LA 1P9MC 3L1OH 4X5XB 3KWWA 1F4XL 5IK3A 3VD7A 2DKUA 5C0EB 3GBNH 1S9XA 3AVEA 4L9DA 2HTLD 2ZOKA 4I0KA 3JV4B 4ZDHA 4YDJB 4PJIE 1G9MH 2OTWB 2J2ZA 2HT2D 3QZWB 3O4LE 4UOJA 4PJAA 4X7SL 3C6LC 2DI9A 3P11L 3KPRB 1T5XB 5J6GB 1LK2B 4JANA 5B3JE 3OTTA 3IU3B 3D0VB 4HS6A 3HI5L 4HPOL 3PGCB 3GJFB 5C09A 1JPFB 5ANMB 3IDGB 5INCB 5JIKA 1RVFH 2DQTL 2ORBL 3B2UC 4JM2F 5DD5H 5L8JB 3S3JA 4WUUD 4BSVA 3VFMA 3INUH 3BAEL 5JW3H 5TGBA 2FX7L 4L29A 3UO1L 4RFOH 2HYMA 3ZL4H 1EFXB 1DN2A 1S9VA 3WFDH 3TNMB 3P40A 5DJXB 1XEDA 4TNVK 4LVNC 4EDXB 3FONB 4QY8B 4HJGB 4ZOEA 3UBXG 5DD1L 3MLXH 5SWZA 1K8DB 3MSPA 4WGWB 3K4DA 5DFWH 1IEBB 4EZMA 1IEAA 4HWNA 1LO0H 4OJFL 3QQ9C 1E28B 3WHE0 3C8HA 2PR4H 4G80A 1NL0H 1OP9A 1KJ2A 1QLFB 3MBXH 4MA1C 3GBMH 4HAFA 4YHZL 5TFSL 3WDHA 5FOBB 4U6HA 4Y1AE 4RIRA 4KUZH 3QUYB 2C3XA 5FA3B 1T66D 4I0PC 4CU8A 3ARUA 4JY5L 3RVVD 3RDTD 1IC5L 1RY7B 3U4BH 5C1MB 1S7XA 4KPHH 5T5FL 4LHUG 4TSBH 5DHYB 3RIFK 1BPVA 4NZRL 3K7UA 4L8CB 2V2TB 4C56A 1RFDH 4HCRA 3BDBA 4HQQH 1KB5H 3MCLH 1FIEA 5GISL 4PRAB 1RURH 4H0HB 5C7XH 3KPSD 1S7QA 2AERT 1DL7L 1TZIB 1Z0MA 5C0FA 4ONOA 1NBYA 3SGKA 2DBJA 3V4UL 1TJGL 2NXZB 3QNYB 5IB3B 5GRJL 2AK4E 1LO5A 3N1PC 1FDLH 4NKOA 2R9HC 3N9GH 2FJHB 3QUZC 1N64H 3NIGE 2UWEF 2GCYB 1UWEL 5DC9B 3U7AA 1UA6H 1LDPL 4N5ED 3LRSB 4HIHA 3MLYH 4OLYL 1A2YB 4M8QA 1HCVA 3IJSB 1FE8H 3QO1B 4XWGL 4Z7VB 1RUML 4HCRH 3TM6A 3R8QA 4TTGA 1ZT7A 2Q86B 1X5JA 2UWEB 1S7WA 4G9DB 3G5YA 3RX7A 2F58H 3ALPA 3SY0B 1ZLSH 4ALAL 2ZKHL 3BPLB 5C0BE 1RJLA 3WD5L 3MCKA 3G08A 1NPUA 5FYKE 3L5WB 5ID0B 3ZTJH 3MXWL 3QCVH 3B9VA 5DEZA 5IJKA 4ZOCA 4Z0XA 5SWZD 3FAWA 5JOFA 1K5NA 4R90L 3HLAB 3AC0A 4X4ZA 4BM7A 4PP1D 4QRQA 4Y4KD 5DEFA 1BQSA 3SGEI 3BHBB 1K4DB 3RKDD 1CIDA 3VXOA 4G43A 5GRUH 4F7EA 4FQXB 1GHFL 4HKXA 3E8UL 1T4KB 4UOW0 3LQAC 5EZOH 1P69B 3HPJB 2YZ8A 3EO0A 1GGYA 2F5BH 4MA7L 4MSWB 4NQTA 3L5IA 5T3XL 4PJ5A 1MRCL 3DETD 3BGFC 5L7XH 3TJEL 3HZKB 2VN4A 4K07A 4S1SL 1FNGA 3NA9L 4PJ9A 3TWCH 2NZ9C 5F7UA 2UWEA 2DWDA 3NCJH 4R4FH 5C0RL 3MXVH 2X44D 1YDPB 3CVHB 3OX8A 1CFBA 5F7FA 1HINH 1F00I 5HVWA 3ZMRA 5I1HH 5C0CB 1JF1A 1NMAH 4NM8H 1HHGA 3IDYB 4XXCC 3V4VH 3WSQL 2AQ2A 5EU6D 3BWUC 3HE7A 4KC3B 4MJ4A 3ZTJG 1W2KT 2PO6D 2J8UA 3MNZA 4M7JH 5CHNB 2OTWA 2DTSA 4RGNC 2V5TA 3EGSA 3OMZA 3PV6A 4A6YB 1NFDF 5T1LD 4PJ7F 5F9JB 2CUIA 1Y0LB 4XRCB 3W2DH 5E6IB 3U9UB 3HNTH 5IVZA 1SBSH 1W72H 5L6YL 3QEHA 3U0PA 3GM8A 2XPGA 4GLRI 5F9OL 1SEBA 1QSEE 3ZKNC 2Z4QA 3H9SA 3T0WA 1QBML 5DHYA 1P4BL 4JO2H 4QYOB 4IRJC 5GZOC 1I3GH 3VDCA 2O5ZH 4FQ2H 2IGFH 3GK8H 5KZCB 3FAXA 4JZNB 2DLEA 2X1QA 3KHQA 1VEMA 1YEKH 3GMQA 4ZAKD 1IARB 4MVBC 2ZCLH 1N0XL 1CL7L 3V5DB 4MMXC 5IHLB 5IFHH 1HEZA 2X70B 1WJ3A 5IQ7L 4KI5D 3MRMB 3UEZA 3O3BA 1LP9A 4JPVL 3PXJA 5EBLA 3VXSE 3ZKXC 5JQ6L 3LH2H 4DAGL 3MFGB 1OPGH 4NO5B 4G6FD 1W8OA 5CEXA 1AXSA 3FRUB 4WUKH 1LVEA 2ADFL 5F7HA 1U92B 3WIHL 1ZTXL 2DQJH 3I2CL 4GG8B 4Z7VA 1R3IH 3CJJA 2BHYA 4KZDL 3JWDH 1MJUH 1NMBH 4FQXD 3UJJH 2HTKD 3FOMB 1MVFA 4P2RD 4PJ9D 3FCTB 3QUZB 3P4NB 4LLYA 4HS3B 4LRIA 4NWUL 1JGVL 1EERB 3TA3C 4AH2A 4EUPH 5DLML 4MNQA 5D71L 3B2VL 2HFFB 3KVQA 5BVJB 1MIEH 3EHBD 3WIIL 4WO4C 1X4ZA 3FFCE 4OLEA 3EYVB 4PR5B 2AEIT 4HX1B 3PGCA 4IDJH 5C09B 2AV7A 5KOVC 4JANB 4JFQA 5EUOE 4U1JB 1U8PB 35C8L 4PRHE 4JVWA 4OBRA 2V2TA 2ZOLA 5AYQA 1D6EA 1B6UA 1XF2B 1S7RB 3VXUA 4NQCB 3GBNL 3IFLL 3MRFA 5ILTL 5C0EA 1WZ1H 4EUPA 5I1DB 5F9AC 4WFFE 3KYNA 2Q8AL 4MD0B 3TBTB 1YPZB 3BH9A 3PHOB 3VFUB 2IFFL 3NH7L 3ZDZF 4LKCB 4MLSA 1MELA 3UTOA 1JHKH 4I3SH 1ITBB 3SJVA 5C0DB 3ES6A 2AABH 5D1ZD 1H3GA 4G6JL 2O5YH 5DSCA 4ONHA 1QLEH 1T7XA 3OZ9H 4ZFOA 3ULVC 4ZUTA 2APVA 4HJGA 1EEZB 5E6ZA 2DQCH 3QHZL 3QHTC 2V6HA 5DD1H 3VRJB 2GTZA 4L8BA 2MNUA 3MV8A 4AEHH 5TE4L 1EA9C 3WJJC 4Y5VC 2P49B 4HUXA 1GGIL 1BD2D 1P4IH 1JNLL 2J6EH 4Y5YA 3FJTA 4HFUH 1A22B 4M1CD 2P24B 1AD0B 5HGBB 3LEYH 1HDMB 2HT4C 4M7LT 4D9LL 2IMNA 3QBTB 4TSCL 1HSBB 1I75A 4P5KA 3BKJL 3CH1B 4U6TA 2WK2A 4HKZB 2Q3AA 1OAZH 4L3EB 4QWWD 1DQML 2CDEB 4DGVL 4H1LH 1O7SA 1AQDA 4RA3A 5IJVA 1LO3L 1ZE3C 2JJSA 3H7BB 3QDME 2KH2B 5DXWA 5IK3B 5ISZA 4JFFE 5ACLA 5EBMA 5FUOL 1MFBH 4OQ1A 3IAPA 3GBLA 4OM1H 4CVXA 1FL6B 3T3ME 3BE1H 2B20A 3GRWL 5KS9A 4JKPH 4O9HL 2HH0L 1WUNT 4X5WA 1JHLH 1CDBA 2AK4D 5F96H 4NQCE 4KMQA 1CU4L 3V4UH 1F3JB 2PCPB 1C5DB 4P59H 1HILA 1K8IA 4GFTB 1FQ9C 3RU8H 1CD1B 3HAEH 3FFCB 4XVSH 1T0PB 1ZA3A 1BZ7A 4PJGF 3PDDA 1BZ9B 1IGFL 1M71B 5F1IB 1L6XA 4OZ4A 2AJYL 3WFCH 4ZPTB 2GJ6A 2OL3A 4ONFH 4U1LA 3OKMB 3CSPA 2QJDA 4MAYA 5CZVH 3KXFA 1RD6A 4WTZA 3KJ6H 3MREA 1T0NB 4RDQG 2AJUL 4K55A 4EIGB 4M61A 4UBDD 4JE4B 5I73B 5LWYL 4CKVX 4J3UA 5DK2A 5DWUL 1VESA 1UJTA 4OGXL 1PG7W 4TUKH 1ZSDA 1F3RB 4X4ME 1X5LA 5E56A 2DYPA 1G7IB 3PUCA 4P4RB 5F1KC 4XNYH 1J1OH 3C2AH 2FO4A 1SY6A 2XKUA 1B9ZA 4IJ3B 4M9PA 4KKNA 1GSMA 2CLVB 3C8KA 3QRGH 3QWOA 1EEZA 3TYGL 2YUXA 4W4OC 1U8HA 1P7KB 4F7MA 4WEUD 5ESQB 3JSSA 4L8SC 4UNUA 4H20L 3LHPL 1FFPA 5J12C 2QSCL 2HWZH 2A2QT 2GT9B 5J11C 5EZOL 4M61B 5GSRB 4HH9A 5EO1B 4PTUB 3GHBH 2Y06H 4ODHL 2ZSVB 5D7JB 2AK4B 2GFBB 4Y16C 3O81A 4R8WH 3BZFA 4E5XA 4OCLC 2BMKA 1Z3GL 1OGAB 2HLFC 3E1F1 1J87A 1ED3A 1FPTH 5FCUH 4Z7OF 3HMXL 4P2RA 4WI3A 3BO8B 4X9HA 2L4OA 2EDBA 4K9EL 2VQ1A 1I1AA 3MPCA 4HUWB 3X12B 2VDPL 4XP1H 2B2XH 2ZOLB 5ICYB 2NXZC 4JFQB 4R2GB 2FEDD 4M7JL 2VXVH 1TZGL 2HLFD 5CJQL 3CC5B 3L3HB 2R0KH 1KJ2H 4GJTB 4WW2C 3QWOB 3VGAC 1FV1A 5LBSL 1QFWM 5EO0B 2WLZA 2G9HA 1AR1C 4N8VA 1KIPB 5EN2A 5B21A 1OGTA 1A7PH 3OHXB 2Z91B 2IALA 2H6PB 2WINA 2W9EH 2O5ZL 3MLTB 1AD0A 1FSKC 5E4EB 5D5MA 4YEFA 2ICWB 4LPUA 5BCAA 2P8LB 1W0VA 3DMMB 3F7PC 3HG1A 3OKKA 3G5VB 3L3GB 4ODWA 4D0CB 25C8H 4GBXD 4EQ3A 1NGQH 4G8GD 2D3VA 2GY5A 5GGSY 2MWCA 1NLBH 5KANG 5IMLB 5C0AD 4WU5B 1MFCH 5HGHA 1GOHA 2DJUA 3T2NL 5FXCH 1BEYL 3RVUD 1Q0YH 4FTVA 4QYOA 4JEGB 2YRZA 2P47B 4UTAL 3PL6A 3C9NB 2G5BB 3BUTA 4NWUH 3LSOB 3IDIA 2AP2A 5IVZB 4Y88A 4L8SB 5FOJA 4I77H 2VH5H 3UTTA 3WNPA 3M8OL 4GG6B 1OHQA 3KYNB 3T65B 1NCCH 1NFIB 3UXFA 3BDYH 3QFDA 4ZXBD 1FVDA 5DJAB 5GS0D 3TN0D 5L9DH 3C5ZB 2QQQA 2DQFB 3W81A 1FYTB 1HOCA 1NFDB 2MSPA 3UDWA 5D6CB 1RZ7L 1PFCA 1HSBA 1HHGB 3IDJB 2A0LC 3KPSB 2FX9L 4HWUA 2DQEH 3HPLA 5FYJE 1CE1H 5J1AB 4WI7A 5C08A 1MEXH 3TJHC 4HIXL 4LHUD 3HI5H 5KSUA 4F9PC 4JJ5B 3S37L 3IS1X 4XBGB 4O4YL 3BVNA 3VH8G 1BQHB 4Z0BL 1S5HA 3NFSL 2XTJD 1A6AA 3S36X 5C07E 2YKLH 3NABH 1AH1A 1HKLH 4HIJA 1J7VR 1QLEL 3UROR 5DFVC 3CZFA 5D8JH 4AG4L 1HCFX 3IXTA 3VRLE 3DV4A 4LSDA 1T1ZB 1SJXA 3V5HB 4LLVB 4YLQT 3GJFH 2VLJD 1MCDA 1MFDH 1PEZA 4OZHE 3A6BH 4NKDB 5CAYB 1A7OH 5EORH 1GXEA 1FG9C 3EO1B 3BMVA 4QOKA 4MDJB 4MYWB 4P23D 1JNLH 1P4IL 2J6EL 3D39B 4AQ1B 4OKVB 2PW1A 1B3JA 1KT2A 3GBML 5J4MA 4PRPE 4BFGA 2DTML 4KUCD 2AS5M 4NUGL 2E9WA 2Z35A 1EXUB 3K0WA 1NAKL 4UDTB 1BJMA 4A6YL 2AQ3A 1J8HE 2IH3B 2PO6B 5TDPA 2BVQB 3JWDC 4JFXA 4PUBH 1FH5L 4PLKD 3CFIC 1YPZE 3TBSB 1LO3H 5CD3B 4N5UA 2ICES 2FL5A 4Z6AT 1YYML 3EYVA 3I9GL 5I1KL 4F7TA 5EUKB 2J6EA 3DX7B 1F4YL 2BY3A 3SKOA 5IHBA 3OG4B 2P5EB 3FZUC 2YA0A 2WP3T 4WFHE 4LDLB 3OAUH 4BH8A 3CVHL 4Q6IC 1C08A 4JFZL 2Y7QA 5JHDE 2DDQL 1G0YR 4JG0L 3TO2B 1AGFA 5F96L 5JIIA 1RK0B 4ZPVA 3WS3A 5SX4I 3P0YL 2EE2A 4M48L 4D9RE 1OB1B 2I60L 1RHHA 4OZGF 4IIQB 1BQLH 2CH8A 3HE7D 4RAUA 5F70A 1BGXL 3CFKB 5J6HA 3UTPD 3O4LA 3H0TA 2G60H 3CAFA 1I1AD 5EU6B 5C0CD 1OTTD 1T0MB 5ABDE 2JKXA 2NY5H 3H9ZA 4FXKB 4WI9A 1LWRA 1UADC 2VAAA 1OP5H 1YEDA 1ODAA 5HVGB 4WUUA 3QUYA 3T04D 4HKXB 1PZ5A 3OAYH 5ACZB 1SJVA 4CJ0A 3VXOB 4IRJB 3P0VL 3Q2CA 2YXMA 2GIYA 4OSUH 3P4MB 3MOQA 2FECL 2Z4QB 2HFTA 2CJUL 1S7SA 4HKJA 1OVZA 3MTRA 2NXYD 3QFJB 3QUXB 4JDTH 4H26B 1J1OL 3C2AL 4Q58C 1E4WL 4NC1E 3VD4A 1JV5B 4DKEH 4FMFA 3HLAA 3C09C 4IMKA 3RQ3A 6FABL 2PW2B 4XNXH 2D7NA 3QDJE 3VE0A 1R3JB 2J8OA 1GGBL 5HXMA 4QCIA 3FONA 4QY8A 1CF8L 3W82A 3T0EA 3L5WA 4KAQH 4H20H 1QFWL 3JWOC 2XTLA 5GRUL 5GGVL 5AAMA 5DHVH 3PIQA 2OQJA 1MHEB 3KPOB 3WE6A 4I2XE 3RI5K 3RWEA 1CLOH 5C9JB 2XNAA 3GSXB 3AU1A 1NCAH 4M7LH 5D72L 3ARXA 1U3JA 2IADA 3GSNA 2ZUQB 3NA9H 1YDPA 2Z31C 4DZBB 1NAMA 2YS4A 4Y8DC 2HJFB 3BEWB 1HHJA 3LKOB 5HYJE 2VL4A 3B9KA 5M7QA 2ICEA 2P5WD 2BX5A 3BYYA 2APFA 3DRTB 4BKLA 1I3RA 5IVNA 1CDIA 4M93C 4JFEE 3T0AA 4ODBD 4PJ8A 1CFQB 1KPRB 4AQOA 2OJEB 5D9SB 1WCQA 3Q6GL 4DFHA 3S5LA 3RA7L 2P8MB 4O02L 4LP4A 5CSGA 5T1KD 3G5ZB 3LPGA 5GHWL 5F3HA 2B5IB 3KYKL 3AGVA 1BJ1J 3TYFB 5E8EB 1XGRA 4K7FA 2DJ4A 3FHQA 3VW3H 3SKMA 2AW2A 2VL5B 5F8RC 2A73B 3QPXL 4WU5A 1IAOA 2ZUXA 3O2DL 4YHKL 1U8JB 3OKNA 3RTQD 4WWKA 4YO0A 4Z7OE 1I3GL 2OSLB 2V7HB 4K9EC 3T3MF 3H42L 4XB8A 2MQCA 3L3GA 4YNYA 32C2B 4FZEH 2Q86A 3R8BB 1F2XK 3GNML 4LAQL 4MWFB 5D70L 1NMCC 2VZOA 2YUVA 2A77L 4IIQA 4NWTL 1TZHA 3CSYA 4YX2H 1QACA 4JFOB 3EFDL 2XQBL 1CDJA 1JNNH 1A64A 5EC1A 3IJYA 3D3VB 4YHYB 3REWA 3MV8D 2KPNA 4U3HA 5E9DA 4IS6A 1Q0YL 3V79C 4NNYB 2X1PA 4NZTH 4ODXA 3B9KD 3IFNH 1MJUL 1CE6B 1MWAH 4PLJC 3SPVB 4RFEB 1JNJA 5C0NC 2NY2D 5E1HB 4YXLL 2VJXA 3ULVD 2OL3H 3QDJB 5IB1B 4OT1H 4P0DA 4RFNC 2E9IA 2OM5A 4NKIL 4NN5C 3JBG7 4OLXL 2PUQT 3OB8A 1UKTA 2QQLL 3QWRD 3WMSA 2NLJA 5CJXC 3T2OA 1PYWA 2YHGA 4UV7L 3G04B 1TFHA 5A16A 5C09D 4UILL 1LEIA 2EDRA 5KN5B 1KCLA 3C60A 4YJZL 5IT2H 1A5FL 1TJIL 2PW1B 2YRLA 2IJ0C 4L8DB 3QQ3B 1FO0B 3FT3B 4XMPH 1LP9F 2AEPH 4CBPA 3VRLF 1ZV5A 4NDMA 2HT2C 1A47A 1IGJB 4KK8D 2GTWA 1RZKH 1INDL 1WT5C 5E2UH 2AXHA 2XN9B 1VFUA 1M7DB 4KDWA 2BSTB 1T6WA 4X6DE 3PP3H 4HLZG 2EYSB 5D2NA 2VDML 4XH2B 4Q9RH 4O4YH 1ZANH 4B7LA 1CT8B 3ESUF 4OCWL 2EDHA 1EHAA 4Z0BH 2F19H 3BIBX 3CCHB 1PQZB 3BVNB 3V0WL 3NABL 1EIBA 1H15B 1ZLVH 4YAQA 5D7KD 4O2CB 4YHOL 1QSZA 3RWGA 4EXKA 2CXGA 4XC3H 4HD9A 2ESVD 4JY4A 3TZVA 3VXRA 3SCMA 1MFDL 1ORSB 1YUHB 4LEOB 2V5SA 2FJGA 5DYOA 2BJMH 3DHJA 3SE4A 1IBGL 1JPFA 3BP6B 4LLWA 5HI4D 2HFGL 4X4MA 4AK1A 4DN3H 5FO9A 4O51B 4KJQD 2K7PA 4P5TC 1A7BA 2AJXH 2NY1B 2WUBH 1FCCA 5HHXH 2XZAH 4P46A 4KRNA 1TJHH 1RUPL 4O5LL 4F8QA 3C6LA 2DQDH 4F3FB 1ZMYA 3CLFH 1OGAD 3GJEB 4YDJA 4ZPTA 4Y2DC 1IL1A 5T1LB 3CUPA 1A1NA 3QEUA 2ZUTA 1P7QD 2O26U 4PUBL 1CD0A 5CIPA 1X5ZA 2FDBP 1S7TB 1TDQA 3ARGA 1L0QA 3HCVB 2J88H 3MYJA 4UV4L 1D5XB 2R4SH 1H3UA 3DO7B 1U8LA 4OQTH 3U1SL 4AIZA 2ED8A 5F7MC 3BZEB 5FYJH 4FTVB 3BAEH 4X5WB 2X4TA 4NBXB 1WFOA 8CGTA 4CVXB 3BJLA 4GKSB 3U0TB 5HI4C 4JDZA 3WUWG 4Y19A 2R69H 1G6RH 5IM7B 3ZHLA 4EI6A 1W0YT 4GXUN 3RZCD 1MY7A 4FS0A 1NGXB 6CGTA 1KXVC 2VDQH 2NX5E 4PY7A 1X5GA 1AKJA 2CDEA 3F7VB 5BZDA 4ZXBB 5C8JA 3CXDL 1FIGH 3QIUB 1AGCA 5FO9B 4KY1L 3OJMB 4KFZC 1GZPB 3AXLB 1UJ3B 3CFCH 4TULL 2MPAH 3CMOL 3HRZA 2Q7NA 4DEPB 1UXWA 3LN4A 3QQ4A 1CXIA 3FQUA 4GRLD 3MRPA 2D0FA 3W9DA 3OGCA 4PJXF 3S88L 3ARBC 3MMEA 4BQ9A 1Q8MA 3VRJA 2WV3A 4OLZH 1A6WH 4TUKL 1VA9A 4U31A 1MCNA 2Y07L 2HTLC 3IGAB 3LKSB 1MPAH 2JIXB 4R2GC 5DRZB 1I9IL 1FFRA 1CVRA 3WN5C 2Z92B 3RNKA 4YHPB 3RGVA 1P2CB 1GGUA 4S1QL 3RVVC 3VWKB 5C86A 3QT2A 5DJCB 5D5MF 2DM2A 1BREA 4R96B 1BVLB 3W0WA 2HKFH 3QJHB 4MHHG 1CLOL 2HFEB 2EDTA 2XA3A 2X89D 2DLIA 1G7PA 4X8JA 2OZ4L 4YDIL 5KN5A 2YRPA 4DJMA 1DQDH 4DVRL 1XIWD 4GKZA 1I8MA 5IW6B 3RGVB 1XGQB 4XPHL 4W81A 1XF2A 3WCYA 1VHPA 4P2QE 2XKNA 4HH8A 1II4E 5CCKH 1TLKA 5IB1A 4AL8H 3KYMB 5BMFL 3O2DA 1QD0A 5JLZA 4R2GD 1YQ2A 1OAKH 3G6JE 1CLCA 3DX6B 2CRIA 2VDPH 5I75C 2C7UB 4PB9H 4NNYA 4KROB 2D0HA 4F33B 1DR9A 4NFCA 1P7QB 3PWPE 1CFNA 1KJ2L 3Q1SH 1U8MA 3TBWA 1X3DA 3CSYB 3IJHA 3IDMA 1BJ8A 2EDJA 4MWFA 3ME0A 5C0JB 1AHWC 1A3RH 3E8UH 4JFEB 5I1AA 1CYGA 5F7YC 5I1IH 4LNRB 5I19H 3ECBA 1AKJB 1F8TL 2BNQA 4GRWH 4MA1B 5T3XH 5D7LB 3VFVA 2W9EL 4N90E 4J3SA 3VMOA 1IQWH 4M4RA 4X4YB 5CSZB 4NHCL 1GPOL 4XVUC 1E4JA 1LE5A 5I1GL 5HHPA 2VDNL 3H9HB 3U7YH 25C8L 2FWOB 1N8ZB 4RNRA 3D1MC 5HGDB 4L4VE 2A77H 1U93A 5AWNH 5FF6B 2EKSA 1VKXA 5C70A 2W1NA 3ILPB 3B5GA 1NLBL 2NY3B 3MV9B 4FFYH 4OUOA 1BAFH 1BFOA 1DUZB 5KSBE 5JOPE 3RVTD 2FR4B 3PHQA 1DP0A 1OY3B 2BHUA 4R0LB 3MLUL 3QH3A 5KVDH 4A6YA 2NY0C 3QUZD 4NSKA 5I76B 3PQYA 3GJEA 4ZNEE 2X4UA 2CRYA 3BP7A 1W0WA 2IPTH 5D7LE 4I77L 2HJFA 2WWMD 1BWWA 1RZJC 2M8XA 4UIKL 4RMVA 3VFWB 3MRJA 2H45A 4EN3A 5M95B 1UKSA 1FGVH 5K9OA 4BK5A 5IT2L 1A5FH 2CKBB 1U6AL 1XF3A 5DJYA 1WBZA 4HUXB 2JB6B 1J1PH 3FOLB 3THMH 2EDOA 3VFOA 5J13C 1TENA 4QXWA 4XHJD 5JR1H 2X4QB 4WDIB 4QXUL 3OR7A 4NQUA 2AXJA 3EO9L 3KHOA 1IKFL 4YAQB 3GSOA 3DURB 4NQED 4J7RA 4MB5A 3I84A 1F90H 3NFPB 1JWMA 2NR6D 1B0RA 1T4KA 4LQ1A 1YA5A 5DHVA 4RX4A 4HIXH 1G9NH 3D3VD 3LVEA 5SWQA 3FZUD 4H26A 4ETQB 1Q94B 3M1BA 5EBGA 4TVPE 4KRPC 3NN8A 4CDHA 5FHBL 4LCWB 1MHPH 1JGUL 1PW3A 3K3QA 5EUOF 1JGVH 1CGYA 5CWSA 3C2SA 3B6SA 5EOCJ 1AE6L 2H32A 2RIKA 3PNWA 4AT6B 1EX0A 3VXPA 3RTQB 4DW2L 1K4CA 3RJQB 4M6ML 4UU9B 3MGTB 5FA4B 4OLVH 3AM8C 3AS3A 4KHXH 4LK4A 4WIQA 3BPCB 4HC1H 2AXGB 1B0WA 3CNKA 3JWOH 2DQDL 4J3OC 4JHBA 3CLFL 1V3MA 3LCYA 3QXWA 4K8RC 2DTMH 1ND0A 1NBVH 1GGCL 3TH2T 1H9VA 3LRSA 4HIHB 4F15B 2DL2A 3P2TA 1CK0L 1WBXA 3NCBB 3TO2A 1MREH 4ONGH 5GRZA 4KK9D 1HI6A 2F8OA 1OOAA 1B0GB 3MNWB 4QRPA 3LIZL 4Q0XH 3VWJA 2R4SL 3EJJX 3GIVB 4RGNB 5FK9A 3WDIA 3RI5F 4FQLH 2LU3A 1G1YA 4CRPA 5BW7C 2ED9A 3QDAA 5C0IB 2E6QA 5CGTA 5ICXA 5ETUA 4ZFFA 1YEJH 1WFNA 4LGSB 1RK1B 4K3GA 1CFTA 2YC1B 2IH3A 3LKPB 4LHUB 4N8PA 5BQ7B 3EFFB 2MHAA 2NY7H 4UU9A 4C57C 1NCBL 5DI8B 3MFFA 4CN1A 4HG4K 5K59E 2G60L 3QP3A 5IHZB 4OB5L 4Z78B 1CLZH 4HFWA 3ARFB 5IBLC 3MRRA 1CN4A 1ZK9A 4HFUL 3OKEA 3H3PL 2FH8A 2A38A 4GLRH 1EO8H 1F97A 1YEHL 3GFUA 5IMOA 2ZUQC 3T2PA 3H3KA 5IFJA 3EDKA 1YEEH 1T1ZA 1F58L 1PLGL 1F11A 1SHMA 3PJSB 4ZFFB 1JZ5A 4O2EA 3QEQE 4NT6B 4OZHF 5C6PB 3OKLB 1K8DA 1A6WL 3QUMB 3NFPA 1JVKA 4X7FC 5FGCB 5JA8B 3QPQC 3CDCA 1AO7E 1E4WH 1S9VB 2XZCL 4DKEL 4OZHA 3U82B 3BKYL 2FD6L 3PWUA 5T3ZL 5F6IB 1LEKA 3CDYA 4I18B 43CAB 5HDBF 1NJ9B 3GSWB 3P9LB 5F44A 3TIDB 1QFHA 3HPLB 1V7NH 2P46B 4HKBB 1CU4H 2KQMA 4NCC1 1MQKH 5SV3A 1JF1B 1U8NA 2QTEA 4HMEA 4Y7MA 3ULSA 2A1WH 1N7MH 4S2SA 3D6GA 3IU3A 4RRPG 2UUDK 4WW2B 5FM8A 5JIHA 4ETYA 4HEPG 4B0MM 1KIQA 2R39A 1WVZA 1FL5B 4OZHB 1AC6A 4P48A 4ONFL 1J9CT 1G7MA 5JOEA 2X1WL 4TPRH 4PTTB 1NSNL 4GG6A 2E9BA 4X99A 3B6SB 4NT6A 4FQXA 5AYUL 4IRSA 3D2UB 1HWHB 5D1XA 1JTOA 1XH3A 4Y4HD 1PEWA 5GS3A 1GVIA 1XGTB 1JRHH 1S7SB 4HKJB 5DURD 3MJ9A 2NY4B 4RGOL 3MJ8A 1MCOL 3H9HA 3OAYK 3MLZL 5JW4R 2BVEA 5IG7B 5DTFA 3KPSE 2W0LA 5B4MD 4MJIA 3MA7B 3SDDA 3O6ML 2WBJB 1TITA 5GS0H 1KELL 2YC1A 3HUJB 4PS4H 2HWZL 3SY0A 3SDAB 5J6HB 2A6IA 3MGOB 2VZVA 5BO1H 1J86A 3SOBL 2NW2A 1AIFB 4JRXD 4W6WB 3D85A 2H2PC 4C4KO 5GSVB 1IAIL 4L4VD 1SVZA 1MJJA 1OGAE 2ZP0T 1BVKB 1H5BA 4LLAA 3U7YL 5DJ0B 4YR6A 3MRGA 1C08B 3FTGA 2QEJA 3IDYC 4TVPL 4FZ8L 1DQJA 3WFEL 5IB3A 1WF5A 3PQYB 5F6HI 4YX2L 4BFIB 1A4KB 4P57B 5I8KH 3MA9H 1INQA 4V1DB 1X7QB 2V5YA 5C6TH 1KEML 3WFHA 3EIFA 1C1EH 4PJ5E 4UT9L 1DDHB 3U36B 5I1LA 4PJBA 3KYAA 3MLUH 3IFNL 1ZHNB 3C5JB 2ARJA 2KQNA 5DJZA 5FM5O 4AEEA 3OR6B 1VCAA 4OBSA 4YXKH 5E2TL 4LIQL 1CQKA 5CMAA 2QV2A 3QZWG 1RZIB 5I74C 4KMLB 4R96A 3W0WB 3ULVF 1VGKA 3QWQB 1AXTL 1OAXH 3A67H 4WHCA 5KSBB 1FN4B 4CMMB 3SKNA 2X7LA 1CGSL 3O9WC 4JZJC 5SWSD 2ZSVA 1ZT4B 4HS8H 5TQ0L 3UC0L 5SX5K 2GK0B 2LU4A 3RPIA 3SGKC 2YD1A 3HNVL 3S36L 3MRKA 1XF4B 2DM7A 5ESQA 3QDMA 3MNVB 3QHFL 2YSSB 4L4TB 4MZ3A 5T3XE 2ATPA 1J0ZA 5FYKH 5H37G 1WGOA 1QFOA 5KJRH 4JREC 4AIOA 5FCSH 1HZHH 2EXWD 1OP5K 5KSUB 3OWEA 4K3EH 2ZPKL 5E5UB 1NUNB 4JO4H 4XPBH 2DAVA 4J1UA 2F19L 1QFUL 4AMKH 3TBYA 3V0WH 1UJ3A 2YWZA 4F80A 4ZYKB 5EG6C 1YMMB 2GW5A 2HJKB 5DC0A 2FJFA 3QI9B 4GAFB 3T09A 3UBXI 1JYNA 1EGJL 2CO6B 3BRGC 1TTUA 1T0NA 5B22A 5IJKC 1NEZB 2BFVH 4WI8A 1MCKA 2E7LC 4U1NA 1ZT1A 4X6BA 1NCCL 4DTGH 5CGYC 1NGPH 4N0UE 5F71A 1YJDH 4FG6D 1N6UA 4JZOA 2F53B 1N6QL 3P77B 3O8XB 4FXGB 5E8DL 2GJZB 2WUBL 5ICZB 4RMTA 1PX3A 4X5XA 1HHKA 2HFEA 1HHHB 3V5KA 3IETB 3SDYL 5INDB 1JGLH 3LQAH 2AI0H 3MRLB 2JIXD 5LXGL 3O2WH 1KYOK 2H32H 4PP2A 1YYLL 2YR3A 1JF5A 4Y1AD 2VUOA 3IVKA 3EJZC 2VXQH 4EN3D 2ZUWA 3SGEH 3ZZ1A 3MO1A 5KSAD 5FDWB 5ICZA 3SE8L 1SM3H 1GC1L 2GJZA 1DFBL 5I75B 2FIKA 3GSRA 1N26A 5HHOA 1OTSC 3V6FB 4QNPE 4M43H 1QBLL 4XPFL 3L9RA 4N0CC 1DSFL 2EIEA 4RAHA 4CW1B 3U6RB 1JUFA 2XXCB 4OCXL 1DQLL 3F5WB 2WQRA 4PJFE 4OZGA 3MC0A 3ARPA 4K8RL 4K3HA 3VXMB 3OHXA 1ORQB 5D1XD 3V0AC 3DSFH 1WFTA 3JV6A 4UT6L 4MVBD 1MCQA 1FJ1B 3KPRE 5DRWB 3LV3B 4GRLB 3W39B 1MHCA 2JJSC 4XXCA 3U4AA 1FGNL 2VQUA 3CFCL 3VG9B 4Y5XC 1YEEL 5DTFB 1IM9B 1T89A 2FGZA 4MA8L 3FRPG 4JAMB 3KDMA 4RAVA 1R5IB 2C9AA 3RWFA 3DI2B 4XCCH 3ROLA 4UTBL 2SEBB 4EDWH 3MV8E 2BK8A 4OLZL 2FGWL 3ZTNH 4CU7A 5ESVA 2Y1VA 3BPLC 5A2FA 1ZA6B 4JB9H 4QNPF 4GKNA 3W9EB 1M1SA 1GJIA 1S7UA 3GO1L 4L4VB 2J12B 3V5KB 1CS6A 4XAWL 3MLSL 4PTTA 1QQDA 5FV1L 1FFOB 5IGXL 1KTDB 3WKMH 1L4IA 3EHBC 1IL1B 5E6IC 5HYQA 2BY2A 2P4AB 4JVPA 4U0RC 5A16B 4G8EB 1NBZB 2EC9U 5DEGA 3RFZC 5JPNA 4XVTH 2HMIC 2VZ3A 2D7TL 2CDFB 4IRSD 4PJXA 4G6AD 1YMMA 2HJKA 2RQ8A 1RIVH 2VIRB 4YC2C 5DD3L 5HGAA 4ZUSB 4RFEA 5TDNB 5AZ2H 2E6PA 4DOHB 1TCMA 2CLVA 3O6KH 3PGFH 4N0RA 4OLUH 4KQ4L 2ZUYA 3PWPB 5DQDL 4E41B 4YR6B 5CJ8A 1IGTB 5CINH 3VXMA 4UIMB 1Q9LB 1ZSDB 4GG6F 4LCCC 1A1MA 3D85B 4NO0B 5FKAB 2O93L 2UZIL 3T0EC 3BGMA 4WI6A 3SDXB 4S1RH 1T2XA 3HS0B 4LBEA 2RAMA 1X5FA 4MJIB 4Y5VB 4O2FB 2IAMA 4Z78A 3TEUA 1AGDA 3HUJF 3WXVH 3N1QC 4OQTA 2E6JA 4ZFGH 4LLDA 5ECJE 5IW1B 4P3CL 5BRZD 4YE4H 2IANA 4M7LL 2DRUA 4U7SA 1YC8A 4LNVA 3EYUH 1IQWL 4KGJA 5ESAA 4MQXD 1P7HL 4QHNA 2NY2B 2NY6C 3OXSB 5HJ3A 3BKCL 1CGXA 3KR3L 3SQBA 1PSKH 4JR9L 4KVNH 4YHLH 1JRHI 3U9UA 2C3WA 4YDVA 3FQNB 5E9DD 2XOTA 1NC4A 4U2YA 4OTXH 3U46A 1YN7B 1RJZA 2IEPA 1CGVA 1RQ5A 3WO4C 1T03H 1FNSL 3DGGB 3TESA 3C6LB 4MQXC 3F58L 3L7FA 4JG1H 1X5HA 2APWA 5LAXB 3GEWB 5J3HD 1WV7T 5K9QG 1CR9H 5GIRB 5I6XC 2GSIA 4I4WB 4JM4L 3QDJD 1MLCB 4Q6YA 4YXKL 1P1ZA 2E5EA 1IZJA 2BSSA 4WRLA 3J7HA 1NFDE 3EYFB 5F9WC 5I8EA 2VXSL 3N06B 1A7RL 1F6AA 1KJ3L 2X4RB 3ULVL 5GJTL 3HZKA 3TPKA 3PV7A 4MSWA 5IG7A 3ZYJA 5E5MB 4HJ0D 5HYSG 1G0DA 2BVYA 5AZEH 1I3VA 3MJ8B 1XF4A 3UPRB 3QIWA 3VI3E 1FO0L 4CVZB 5GRYA 3FN9A 1F11B 4P9MH 2JE8A 4QWWC 3BQUD 4F37K 1JF6A 2XQBH 3D3VE 3REVB 4JPKL 4LKCA 2VZSA 4APQB 1BOYA 3SKNB 2VZTA 4G9FA 4GXVL 2Z31D 2YPKA 4PFEA 1DLFH 1VGKB 1EH9A 4LPWA 1K5NB 1ZGLP 2AEQL 3RZCB 1AO7D 5JORB 3LKNA 4L1DA 4JFYA 4MB3A 4P2OD 5TPWH 5GJSH 3DURA 5C7XL 2F8XC 1S7VB 3O45A 5DJZB 1EGJH 4RDQF 1AD9B 3G5YB 5EC2B 2BFVL 4KH2A 4PJCE 1AE6H 2YOCA 2QQLH 5E2VH 3C60C 4XMLH 3KLHC 4NO0D 3EYFA 3V8CA 3ARSA 4LCUB 4RAUB 5E4IA 1U8NB 1I8LC 3HHRB 3B8YA 1YECH 4UINH 4D94A 4JKWA 2OMNA 5LAXA 3VFTA 3X3FH 2CK0L 3DIFB 3DX9A 1H3VA 4L9LB 4F9LA 5HPOA 1RUMH 4HCRL 3TV3H 1MHHA 2AI0L 1HQRB 2P44B 2ENYA 5DJ0A 5FFLA 5LXGH 5DUPL 1JPSL 3O2WL 2Q87A 1BVKA 1JGDB 3RBSA 2W9LA 4PRPD 3T0EB 1DZBA 1YYLH 3U46B 4JKMA 4G8IB 1KULA 5GRVL 3O6FD 4LCUA 4IEFB 3NIGF 3S98A 4NC2B 3WNMA 4PJGE 2VDMH 5D1QD 3FQWB 1GC1H 2OP4H 2RCSL 4OCWH 3CXHK 1T5WA 1DUYB 1DFBH 4YFEA 4ENED 4HV8A 3O45B 5KAQF 4HZLB 2BRRL 5F93C 3JVGC 4F7CA 4M7KL 4RMQA 3SGDH 3WEXB 1EHNA 2AQ1A 4OLWH 3BD4A 1UACH 1S8DB 1TPXC 1VFMA 3OQ3B 4LLQA 4U6XB 3FKUS 3TVMA 3CPLB 3DYPA 1M7XA 1VPOL 4IJ3C 1OSPH 3KPRD 3A6CL 5CSBA 4XP4L 2Z9TA 1WWAX 3FQWA 4OCNC 1DJSA 3KAAA 4F2MA 3O4LB 2B0SL 1NL0L 3P9WB 5ETUB 5HHMD 4S1SH 3TT3L 3UPRA 5C0IA 2QKIB 3TWCL 4GAGL 3IJHB 2ZJSH 3MLPA 4HW6A 3LS5L 3QEQD 4EDXA 1QVOA 1P84J 2F54A 3FHAA 4CVUA 3DRTA 4ELMB 2GHWB 1I3UA 4JY5H 4OD1H 1LE9A 1YMHA 2PKDA 5CD5D 5DMYA 3U4BL 2VMFA 4CMHB 4QOKE 4YDLB 4WW2A 3DMMC 3HNSL 2Q6WA 3ORJA 3GIZL 4OQTL 5DMKA 1VADA 3O6FB 4GKOA 1ULVA 2XZCH 3AU1B 3O8XC 1I4FA 1NGZA 5ADOL 5B39B 4M5ZL 4NZJA 2DWDB 5I2IB 4YDKH 1E6JH 1MFNA 3E3QC 1JK8B 5D7LD 5KTEL 3MOBH 2OK0H 5CD5C 1SBSL 1W72L 2NY4C 4PV9B 4NZUL 3QFDB 3VXPB 1RJZB 5H94B 1N4XH 1NFIA 3IB4A 4XBPB 2Y36H 1IGCL 2KUTA 2CLRB 4AT6A 4D2NA 3HPJA 5JORA 3QH3B 3D69B 1MCIA 4XNQA 2IGFL 3GK8L 4Y1AB 2VE6A 3SDCC 1UVQB 1A7QL 1D9KA 3MLYL 4OLYH 2X4NB 1UWXK 2DLGA 1CL7H 1DANT 1T22A 1RJYA 5H35A 3TFKD 5EB9A 2WM0A 2SEBA 1QPPA 5TH2A 2Z8RA 3T4AA 1BFTA 2EC9T 5ALCL 3O8XD 1AKJD 1JRHL 2A9ML 3PL6C 3WIHH 4N0UB 5A40E 5ID0A 4XBGA 3SQOL 1QP1A 4PJAE 2X4RA 3QULA 4HMDA 2X4QA 5DJDA 2XRAL 1NCDL 4D0CA 4UAOC 3RIFF 4WFEE 4Z7WB 1S7WB 3ULUH 1WC7A 2C4FT 2L7JA 1U58B 2JELH 4JO3H 5GXBB 4RWYH 3DSNA 5DLMH 3O6MH 3IDMB 1C5BH 1MLCA 4P49A 1GHFH 5I15L 2OTPA 1DBJL 5BO1L 3UTPE 4NKOB 3V7AG 2DQFA 1JWUA 2MFNA 3RWCB 2ENSA 3GUTB 4EI5B 1D5IH 4DOHE 4H0IA 1R0AH 2IQAA 3QUXC 1WSST 1CXKA 3QJFA 1KEGH 5C0RH 4DN4L 3VD3A 4FQQB 1T83A 5JO5B 4YFLI 3PG2A 3BH8B 2VOTA 2V5MA 1FC2D 3R4DA 3MRNA 3DWTA 2GY7B 4HUWA 3IT8D 5L2JA 2W65B 2QQKH 4U1HA 1E6OL 4J3TA 4OAWA 4G8GB 4I3SL 3VXSB 2ESVA 4X6DF 5DD5L 4JG1L 1OQOA 3IETA 5F3BA 2AVGA 4GBXB 1CGUA 4PJEF 3L3KB 3EOTH 5E00A 5BV7B 4RFOL 1EK3A 4P9HL 4LSQL 2VLRD 1OLLA 3ETBF 2BNRD 2EH8L 1RUKH 1LNUB 3BMWA 4MA3A 2OXGA 1N3NA 1A7NL 2XY1A 2R0ZH 3UJIH 3CU7A 3EOYG 1G0XA 1L7TL 3DO3A 2WWMC 1GIGL 5SWQB 1TTFA 3MLXL 1IEAB 1FFPB 5LQBL 4Q6IB 3FN3A 3NIFF 2HVKB 4NO2A 4LRNH 1F02I 2VLRA 2NPLX 4J1UB 2BNRA 4PV8B 1BQHG 1VGEL 2VDNH 1QSFE 2EDDA 3HE6D 2WUCH 4Q9QH 4E41A 3SO3C 2J8HA 3MRPB 5JHDB 3CFJA 5GGQH 3QQ4B 1MRFL 2P5WE 4H88L 4YZFE 4PJEB 5J8OA 3UBXA 3DX6A 1FAIL 3BIKB 2NY5C 4HHAB 5K9OB 3GJFA 1UT9A 4OZIF 4Q6IA 5D2NB 2V9QA 2H9GA 5F9DC 3TCLA 4Y19E 3JWDL 5ICYA 2VSCA 5KVDL 3OKMA 3TJHD 1ZT4A 2CIKA 1WISA 2GJ6E 3KGRA 4MJ2A 5FECA 3GRWH 2YN5A 2GJ6B 3GSRB 1ZHKB 2DMBA 3MUGA 1NGXA 5ELIA 3N0PB 1MF2L 1K6QH 2XQYK 4KRPB 4DGYH 1NCWL 2VLMD 3LD8B 1LD9B 3UTTB 3U0TA 2DL9A 1WTGT 5DJCA 2O5XH 5GGVY 3EOBA 1I1FA 4LRIC 2MOVA 3BYTA 1WT5A 2ADJA 2PYFB 4MJ5A 2IH1A 5ID1B 3ZE1F 5BJTA 1WK0A 1HH9A 2XKSA 1XF5A 2IBZY 4W70A 5HGDA 5INDA 1FLRL 1U95B 5D2NC 4P2OB 5CZVL 4WO4A 5I8CA 4YEEA 5LGHH 3D39D 5ILTH 3EO9H 1OP3H 2WIIB 1G7QB 3DUSA 3RJDA 4YK4B 3QEUB 4OFPA 2ZKHH 5BZWA 1U41A 5IKCA 4K7PY 3HAEA 2M1KA 4HXAH 3LMJL 5E7BA 3FO9A 4HT1L 5I30H 3QR2A 4OUUA 5I73C 3TCLB 4ZYKA 5HGBA 3GMMB 1T2JA 1U8KA 1FORH 3F5WA 4KVCL 4N8CH 1VFAB 3NCMA 4QGYA 4CW1A 3V6OA 2J8UE 1NGYB 3QHZH 3B43A 4N8VB 1AO7B 12E8L 1V3KA 3QULB 4X6DA 3NMEA 4YZFF 4G9FD 4WWKB 3VXME 1U8JA 2F5BL 3G9AB 2HVKA 4HC1L 1ZA3B 1IQDB 3MO1B 2B0SH 5L7XL 4C54A 3JWOL 2XICA 3B9KC 3TT3H 3ARGC 2A83B 1QOKA 4MNHA 5IVXB 3HZVB 2X4TB 3BD3A 4D9LH 5BJTB 4TSCH 4S0SD 3WNKA 2X4PA 3V95A 1CI5A 5IW6A 1IGJA 4KDVA 3OAZK 3WJJA 4R3SB 4ONGL 1OAZL 3DRQA 4EUPG 1MAML 3G6AA 3PHOA 4U33A 5JDSB 1X6NA 3WS6C 4JQVC 2OJEA 5D6DC 1OAUL 2CDGA 4XBPA 3VXSA 3TPUB 3FO1A 2D7OA 1YC7A 4WO4D 3QXUA 4ODTH 4HIIB 4OM1L 2R0KL 2Y5EA 2V9TA 5J7CC 4YHPA 5LBSH 4YDKL 3T08A 3RZWA 1YNLH 1BD2B 5B39A 5LGJA 4Z7VE 4YGVB 3ARFC 5DGRA 2ESVE 2UZXB 5FAAA 1ZGLM 3WFHB 2E7BA 3CGTA 2FX8L 4Y2DD 1X7QA 3GSQA 3MJ9H 4PGBB 5IBTH 3VGAB 1SYVA 4PJGA 3RVWC 2XWJB 3OB0K 3RWEB 3VH8B 2MJWA 4BFEA 4LQFL 4X6FA 2AJVL 4O58H 5DJ8B 3C8DA 1CLZL 3QUYD 1A7QH 3UTSB 5E9DB 5B3JF 3BP5B 2ITDA 4P2OC 3FCTA 1N0XH 3O0RL 1QVOB 3K4AA 3QUZA 5L0QB 4QTIH 5ENWB 3QUKA 1V8HA 3OJDB 4ZFOB 1T7WA 3QDMB 3CX2A 5LWYH 4P2QD 1OPGL 1IILE 2BSTA 2QADC 5DA0B 4LPTA 1MRDH 3FRUA 3RAJH 5AG9A 3SDAA 1ZHLA 5CEXB 2A9MH 5IMMB 4JM2D 3NACH 4U7MA 4F8TA 1H8NA 2IWGA 3TVMB 4UUJA 4PLJD 2XQYG 2OXHA 4WHTB 4K71B 4X80L 4MJID 4XX1E 4ZS6C 4E42B 2P7TA 1BZ9A 5E00B 1FO0A 4HFWB 3BKYH 3Q48A 1KG0A 3QDHA 1Q0XH 4BZ2L 5CJXA 2IBBA 4PREA 4JREB 2W0FA 4P5MB 1CXEA 4YHIA 1PDKA 5KS9F 2B4CL 4H1LG 4TNWK 5T1KB 3KLHD 3VG0L 5CEZH 3RVXC 2A1WL 4I2XB 4N0YH 3LKPA 4J6RL 5L2JB 4U2ZA 2XPGB 2Y06L 1EPFA 3MYZA 2R2BB 1UCBH 4PJBB 4BUHA 2MKLC 1DDHA 5D9SA 4W4OA 35C8H 1ZVYA 4OZFA 1N5YH 5C0CE 1KJVA 4DEPC 3BT2H 3DUUB 5MEPB 4YBHA 4ZUWB 4FNLH 4FFZH 4X9BA 3HMXH 4PV9A 1JTTA 4L5FL 4TSAL 2VZ1A 5CKGA 3UAJC 4YHLL 4QRPB 3FQTB 4LVOC 1HHJB 2Y5TB 2PNDA 5DDHA 4HKZA 3OG6B 2B8OT 4JRXA 1MI5B 3ROOB 4QRRB 4LGPB 4TVPD 5C2BH 2NW2B 4Y2DA 3O6FA 4HGWA 3GMOB 3HZYA 2ZCHH 3V9FA 5KVMC 5CJQH 5D5ME 2R1XA 1ZLUK 4I18C 4KWUA 1F6FB 5JHLH 4PJIB 2N56A 4UMGA 1HYSD 1EXUA 2APBA 1S7VA 2J5LB 3T0BA 3KNBA 1AHWB 1UM5H 5HHMB 3U2SB 3ULVE 1DBKH 4HK0B 5IWLA 1J1XH 3UMTA 1RUAL 5I6XB 1EO5A 2DD8H 4XCEB 3NA4A 5I16B 3TN0C 2EEAA 4H5SB 3KPNA 5DZLA 3NAAL 5F3HB 2PXYB 5J89A 2LE9A 4ETQA 3HB3D 3ZO0A 3D0LB 5FUCC 1I1YA 4RISH 3ZKMD 4K7PH 2BXZA 4P3DB 1RZ8B 1H3WM 3CFBA 4G6KL 4RZCB 1FH5H 2NY1C 3U2SA 2IG2H 5C6TL 1MFCL 2DQUL 4WTXA 3QUMH 3AS1A 1GZQB 1ITCA 4QOKD 1C1EL 3I50L 3MRHA 2AEQH 4JN2A 3BRDA 5EU6A 4XGZA 1JFQL 4MNGE 3V4PL 2CR3A 4JO1L 5FGBA 3X3GL 3QDMD 2N1KA 1I4FB 1NGZB 4HGWB 4KXZI 3HTLX 1JBJA 3MUHL 3IDJA 2GAZB 3STLB 3P9LA 2F53D 3B5HA 1PG7L 3BGFB 2HFFA 5FM4A 2LABA 3BISA 3CK0H 1M05B 3SO3B 4RMWA 5HDQL 4R26L 5IW3A 2VDRL 1B0GA 1AJ7H 4P4KB 3VFTB 3VWKD 1IJ9A 4HXBH 1RU9H 3OXRB 4JHZA 5EULV 1PAMA 2FZ3A 1NUFA 1UYWH 4OFKA 1KJVB 5E8NB 3MOAL 4MJ6B 3QI9D 2JJVA 4CVWA 2AJYH 4OIAA 4K23H 2NY5L 5EZLB 2R4RH 3LZFH 4ZNEA 3J8F7 2FIRT 3DI3B 5LGHL 1JPSH 4LLMA 3LSOA 4Y4KA 3KJ6L 5JXAH 1LO4L 2I25N 1OARH 2VLLA 4LCIH 1JPTH 1ZEAL 4HDIB 1PKQE 4F58H 1XAUA 3OKOB 2EE3A 5SV4A 1XCQA 3WIFA 5I71B 4LSRL 3KPLB 1UJ3C 1QLRB 4GBXC 2YZ1A 4OKVA 3ZSSA 5I30L 5IHZA 4NJAH 1KG0B 4JO4L 4XPBL 2EDXA 2R23B 4X6CA 4XNYL 5KAQG 4UB0L 3D25A 5JXEC 4WHTA 2F54D 5DJ6A 1DN0A 2IC2A 4LDEB 1T1WA 1HKLL 4WHDA 1R6VA 1MFAH 4MD5B 3HS0A 4PGCB 1MCEA 4LPCA 1YMMD 4Z77B 3E2HB 1DBML 3DV4B 4Y4KB 4ZTOL 1WWBX 5EBWA 5J9PA 4G9DA 1IE5A 3IU4H 4G7YL 3NTCL 4C56E 3LHPH 12E8H 4J3XA 1HE7A 5IBUG 2YA1A 5SWZB 1WLHA 5EOQL 4GRWE 5HHME 2F15A 3RL2A 4UQ2B 4OZIE 5TQ2L 1RPQA 5FEBA 3BP5A 5DMIH 4DZ8B 3UP1A 1PY9A 4F33A 3MLWL 5DJ8A 2B1AL 3ARBD 3FOLA 4GAYA 1FPTL 5FCUL 1NAMB 2CR6A 4P2CG 5L8LB 1P6AB 3O3EA 1P1ZB 3ET9F 1NLDH 1MAMH 4LASH 5HI3D 1F4WL 2OR9H 2B2XL 3KPOA 4LEXL 4JHAH 3ZKQD 3Q6GH 3T0XA 5JW5A 2YEZB 5DJAA 4HIIA 1S9XB 1QBLH 3DMMD 1CFVL 3PNWB 3VE0B 4XPAH 5BOZG 4ODSH 4PJBE 3MV7A 3VDAA 2DYPD 5F7LB 4HPYH 2XWTA 3P9MB 4K8RH 3E0GA 3O2DH 1A7PL 4PJHA 3KPNB 2DBLL 4JN1L 2R0WL 1OF2B 2AGJH 3T0VA 5C92A 3S4SG 4PJ7E 1KN4L 4LLDB 4LSSL 3PWVA 1DANU 1H3XA 4NQDB 1I1RA 2V17L 2DIJA 5E5MA 4X8XA 4FXKA 1CTOA 3KNBB 2LVCA 4I1NB 4LVHC 1J18A 3OR7B 3U30B 3W9DB 1MRDL 1KCSH 1NANH 3H2WA 5EA0H 3RAJL 3U0WL 3VD9A 1A3LH 4Y4HB 4P4RA 5ALCH 3NPZB 5I1AB 2GI7A 3TFKC 4NFBA 1JHTB 4EOWL 2FATH 2FBOJ 2LV4A 1R5WB 4JDTL 1MJ8H 1YZZA 1CXLA 3GMMA 5ANMA 2OCFD 3QIWD 5H2BA 2Z93A 2DLHA 3U6RA 2DF3A 1OCWL 5TE7H 1QSFA 5IFAH 5DQ9A 3KXFB 2IFGA 3NCFB 4K2UH 4NQDD 4LDOB 5M94B 5SX5H 3IXAA 3MODL 4WGVB 3BPOB 5C3LD 2VITA 1TQCB 4DWHA 1PJ9A 4UV7H 4ZFZA 3DXAD 3DX7A 2XACC 2NX5D 2NTFA 4X6CF 2EZ0C 3BDYL 2FL5B 4WEBL 1DBJH 3UX9B 2HP4A 2D7TH 4FQXC 4S11A 3MZGB 1BD2E 1D5IL 1SYSA 1GH7A 1JN6B 5C08E 1PY4A 4F57H 2YD8A 4QHNB 2IH1B 5FV2A 5HJ3B 1KN2L 1FNAA 4XMPL 1H0DA 1RZ7H 4QHKJ 4Y16A 5T1KA 2W07A 5EZJB 1VSCA 4EJ1C 2GUOA 3JV5A 1RZKL 3BO8A 4RNRB 5D2LA 1FFOA 4NN6B 4QHLB 4ISVA 4LMQI 4XX1G 5CINL 1IC4H 1A8JH 5J13B 3H3BC 3SDDC 5J0BA 4MX7A 5HHVL 5E8PA 4OZFH 1LP9E 2B4CC 4WCYH 2BVOA 1S9YB 1EV2E 1PKQA 5KG9A 4H8WC 2YKLL 5DMJB 4Y4FA 4P9HH 2CQVA 5AD0A 5KW9L 5DRZA 3WFDL 2EZ0D 3QI9A 1MY5A 2FJFB 3KDMB 4RAVB 2EH8H 5DVKA 5SWSA 1BX2A 2XI9A 1A7NH 2NY0D 1L7TH 4ELKA 1CGWA 3AS0A 4N1HB 5E08H 3CVIL 3HAEG 1A6VL 1EHXA 1OGTB 4S0TD 3U83A 4NHUB 3VXMD 2HFGH 5BW7A 4WI2A 3MV8B 4XMKH 1ZAGA 2C7UA 4EXPX 3JV6B 3MLRH 3RUGE 3VH8A 4YHNA 3FFDB 1A6ZA 3QPQD 3T0ED 1FV1B 1PQZA 4FQJH 1URLA 4LRNL 4YHZH 5CEZE 5IB5A 7FABL 5DD6A 2VIRA 1Z5LB 1T7YA 4FZEL 4F7PB 5HTSA 1BFVH 3VWJC 5D70H 2QADB 2RBLA 1IEHA 3KS0J 3QG6A 2X4SB 1X6LA 2BCKB 4OKDA 3I6KA 2NX5A 4POUB 4MB4A 2J8UF 3UJTL 4TSBL 1LMKA 3FT4A 5DD0H 3BH9B 1ZLWK 2ICWI 4JRYB 4KV5E 2NR6C 3PXHA 1KIRB 2LTQC 2QR0A 1CR9L 4XNMB 3T4YA 1BZQK 3OPZL 4G8FA 3RUGB 3ZYOA 1P2CA 5J1TC 1UB5A 4FXLA 4DGYL 2N7BA 2NLJB 1D5XA 3MRBA 4RX4D 1KCUL 5EO1A 2ITCB 2NCMA 3HI6L 3BN3B 4ORGB 5IR1A 4GUPA 5HGHB 2F74A 3I6LD 4HX1A 1MUJB 1IQDA 4TTDD 5GJTH 4QHUB 4LHJB 3HRPA 1UYWL 1RZKC 4L3ED 2F53A 2LVEA 5DZOA 3X17A 5GZOD 5HYSA 1XCTA 5CEYA 1XR8A 2P5WB 1RIUH 2VWEC 3W39A 2R4RL 5DRXB 2FO4B 2WIMA 5DT1L 3MRGB 4PJAF 4ODWB 4P46B 4L3EA 4ZTPH 2ADIB 1J5OL 1R3LB 4JCLA 5EC1B 3T3PE 2A6DB 5I0ZA 1N59A 2H26B 2EDYA 1PG7X 5E8OB 1QR1A 4HUUB 3H9SD 4M3KB 4H8WL 3NCCB 4HUUA 2XG5A 4YBQD 5MHSE 3LMJH 1NUGA 4KK5C 3SCMB 1DLFL 3MV7D 3QIUA 3SE9L 5HYJA 4YNYB 3K80A 4WV1C 3CX5K 2IPKA 3TBVA 4GMSH 1NCTA 2ZSWA 5CJOL 5DUMH 3X13B 4NQCD 4XNXL 2X1OA 4WWID 3FO2B 4C4KT 1GGBH 4ZTOH 3VCLB 2WIIA 5JMOC 1IAOB 4ZUTB 5D7JC 4ODUB 3MNVA 2BVPB 4PRDB 4NYLA 2BJML 1IBGH 3QIUD 2HKFL 1MNUL 1FBIL 5CUSH 1C5DA 3QFJD 4DCQB 3MRBB 4Z18A 4MA7H 3MRIB 3L3IB 3RPIB 3P73B 2PXYC 4Q7DA 2PYFA 3P9MA 4YWGL 4QRUA 3X3FL 4DVRH 2BY0A 3MRLA 2P8MA 5L2KE 2VABB 4NQVA 1FL6A 3H7LA 1P5VA 4L8DA 3EKCA 1MCHA 2XY2A 1ZS8B 2DQGL 3MCG1 3O41A 5BMFH 4FQ1L 1UC6A 1LEIB 4Z7UE 5B8CB 1ZT1B 2K9UA 5BS0D 1KIQB 4LEXH 2BNQE 2CGRH 4PRNB 3QAZC 5DVNA 4U1JA 2D9QB 1WBYB 4WU7B 1EHLH 1OP3K 3VXRD 5B38A 5JUEH 1HDMA 4NIKB 5E7FA 3HC0B 3Q1SL 1EEQA 2P42B 3R06A 2R69L 5BXFA 1EEYA 1LEKB 5J06A 5D93B 4OLWL 1OT1A 5L6YH 1LE9B 4HAGA 5F9OH 2GTZB 4HPYL 4L8BB 4P3WA 4TQEL 1JZ4A 5E1AB 3QG7L 4XXDB 4N0FA 3CXDH 1FIGL 5FUCE 2FEDC 3KPPB 2H2PD 2FH6A 4HLZH 1HIML 2FO1A 3JTTB 2EYRB 3T1FB 4TUJA 1FFQA 3VG9C 4EN3C 1OAQH 3O0RH 3RUGF 1U42A 2XN9A 5IQ7H 4LKXA 5TE6L 3RY6A 4LF3A 1AC0A 1G6VK 3SDXE 3MA7A 1BM3L 3O3BB 3U9PH 1M4KA 4JFDA 1MH5A 1X5IA 4N8VG 1YPZF 4XBEH 5JA9A 3X14B 4GAJH 2P45B 5BS0B 3FB6B 3FFCA 4YQXL 1ZTXH 2D0GA 1U3HA 3H9YA 4BZYA 3C60B 1G7JB 3D2UD 4XWOC 1QYGH 3DV6A 3Q5OA 1FL3A 2YEZA 1YEGH 4M4PA 4BSWA 1S7RA 1TVDA 3MRQB 3VRIB 1BOGA 3QDGE 3G5ZA 4L3AA 1KLGB 4GRLC 4U1KB 3WUWA 1AGEA 2LAGB 1QKZH 2R2EB 5D96C 5F9JA 5CEZL 5D7SH 1U3HD 1R24A 2EEBA 5IV2B 1IGCH 1OAYL 3H7BA 5GGTA 4OF7A 1VERA 4OGYH 5IESL 2H1PH 2OZ4H 4YDIH 2FSEB 2N4IA 2V2WB 2ZNXA 3V6ZA 1HKFA 1F4XH 3MRDA 3SKOB 5C0FB 4HK3N 3F7YA 4L5FH 3LAFA 1ZWIB 2A6IB 2R56H 3MGOA 4HBCL 3S9DB 3BXNA 4A2MA 1OAKL 1UEMA 3IAQA 3C5ZD 2X1XR 2ZG1A 3EOAB 4CAGA 2I9LA 1BJ1H 1K2DB 4XZUB 5FA4A 1HWGB 1TMCB 4QRSB 2VDOL 1RZFH 3SQOH 3BP4A 3DXAA 4Y8AA 5I18L 3QB7C 3V5DA 1RZGA 1TIUA 3D39A 3PWVB 1P4LB 4BSJA 5JHLL 2AJZA 4JZNA 4NJ9L 3ULUE 1I7RB 4RWYL 1TQCC 2RGSA 2B1HH 1C5BL 4PJHB 4FTVE 4IHOB 1BP3B 4IHOA 1DBKL 1XGTA 5I15H 2XWTB 1XH3B 3NCYS 5HHQB 1J1XL 5I16A 5D7IA 3QEHB 5I1IL 4Y1AA 3WNOA 2YD5A 1I9RH 1MCWM 1I8IB 4KUCF 2PR4L 4NHCH 4AYFA 3BRFA 1AHWA 3WJLA 3VMNA 1BFVL 2ERJB 4RISL 4L3CB 3LKOA 3IDNA 4NQCA 4FQIH 1JK8A 3BEWA 4PLNC 3BXNB 3IKCA 1QFWI 4XCNB 43C9B 3NCEB 4FQHB 1MVUA 1E4XL 4DGVH 4JCMA 1XIWC 1W72A 3EDEA 3LIZH 4Q0XL 1BIIB 3IDGA 5INCA 2ZUSA 1BIIA 3VFNB 4IRZL 4MMZC 3MRJB 5D6CA 5IHUL 1A1OB 3TT1L 4XGZB 4E41D 5FYJL 1FYTA 4JO1H 3X3GH 2V2WA 5MERA 4JKPL 4ZUUB 3ZT7A 5FUZL 4QGTA 2X4UB 1UEYA 4NN7B 1FRGL 4XP6H 2ZOKB 4FG6C 3WXWL 4BQCA 1TVBA 3EO0B 3M17A 1I7TA 4RQQA 3KPQB 4QLRA 5FYJU 2ZG2A 5MI0B 4OB5H 2ATKA 4PLOB 3BPCA 4BSWB 1J1PL 3HA0A 3DLQR 4AIXA 3MRMA 2C4FU 4QXUH 3OB0H 2WUCL 3DX8A 4OCYH 4Y4FD 4Q9QL 2W0FB 4ZTPL 3LDBB 3O6LH 4WUUB 2AXFA 2P48B 5DUBB 2F5AH 1KTKE 5EIQA 5DUBA 3B9EA 5JXAL 3PWJA 2ADGA 3A6OA 4HK0A 4RBPK 1UWGH 4XNZB 4YBLB 3MV7E 1F90L 1YQVL 5IROA 1A0QH 3OKOA 4QRSA 4CNIB 3QUXD 3ZDYE 4EVNA 4H25B 4ZAKC 1RJLB 3QWRA 4NO3A 3JXAA 3LEXB 4PJHE 4WFHD 4LNRA 2ILLA 4YC2B 4G80B 1D5MA 4P2QA 1CLYH 3M1BB 3SBWA 2R1XB 3SDXA 1RZJL 1MCWW 4U4BA 1YMME 2O61B 3JTTA 5ICXB 1I9IH 5E6IA 5ADPH 5FKAA 1YNKL 3MACH 4XCFL 3HE6A 1I9JL 5FO7A 2Q8BL 1U8MB 3TBWB 1ERNA 2MCPH 4K94H 4K3JL 5JIPA 3HN3A 1AGFB 1E4XI 2XG4A 5DDHB 4G7YH 5DJXA 4CN6A 1VDGA 1XGPA 5MEQA 3VWJB 1L9NA 3FQTA 3PWPA 3VWJD 4JVUA 5EOQH 2UZYB 5DZNA 3EYQD 4ELME 3D18A 4L4TE 4IRSC 2X10A 3TJEH 1S5IH 5GS0C 3S37X 5B38B 3BDXA 5GRWA 2CDFA 4U1KA 3WUWB 1J05A 5KS9E 1CIUA 4RSVA 4TPRL 1MCJA 1C12B 5EU6E 2PO6A 5TDPB 2DQGH 3DJ9A 4DK6A 3LKQA 3ZDYF 4FQ1H 2P5ED 1H5BC 1ZS8A 3O41B 3ILQC 1T7VA 2DMKA 4HIEA 1F6LL 4JFYB 3N85L 2PTVA 1FVEB 2YWYA 1A6UL 3ZE2F 5KVGH 2BOCB 4FQLL 4DKDC 5HDLA 4WUUE 4X9FA 2RJMA 1JI2A 3MUZ1 1KENL 1K4DA 3GSNH 4KVCH 3ZSTA 3I6GA 3NGBB 3HZVA 4NP4H 3NIDE 1D9KD 1U93B 1X5XA 1KELH 1R5VA 2W60A 1KC5L 3GKWH 3QIWB 3CFDA 3RWFB 1INEL 1NH6A 1J12A 4PJFF 3IGAA 4LAJH 5TJWK 5EU3A 4L9LC 4R7DB 4JHWH 5HGGS 1F8TH 4BYHA 3Q6FB 5D7LA 3X13A 3PGDA 3OF6D 3T0EE 3ECBB 2HA1A 3WNNA 4U1GB 5MP6L 4KI5E 4LSSH 1G6RB 4L29B 3VFOB 3OKKB 1WCBA 4KHTH 2P8LA 3DMMA 1IC7H 4B53A 4ZD3L 3BUYB 1ZT7B 2Z8VC 4MD4A 4HUVA 5MENE 1IGML 5EU5A 4M1GL 3TNNA 4TVPH 4FZ8H 5JQ6H 1BM3H 5AWNL 3U9PL 4B50A 4ZFOL 4PGJA 3D0VA 1I7ZA 3BGAA 3VFWA 1IT9L 1LK2A 5IBUB 4PLKC 4PRNA 3DTXB 4JLRB 2OI9C 3VFSB 4LL9A 4ZXBA 2W38A 3F7VA 5BZDB 1I7UA 4EBQH 2BY1A 2NW3A 4GMTH 4OZ4B 1RSFA 3CD4A 3VA2C 5JOPD 4Q2ZA 2FBJL 4X98B 1EUTA 1OSZA 4WO4B 1NGWA 3K2MC 3DVGB 3SDCA 1UXSA 3MODH 4RGMC 3M8OH 4HWZA 2YPLA 1DQQB 2J4WL 2EXYC 1N7ML 4APQD 3WIIH 1KCVL 1HYSC 3MJ9L 4NCDA 5HD8C 4G9FE 1IGIH 3DO7A 4DCQA 3W5MA 1NCNA 5I1JL 1CFSB 4JPIA 2H1PL 3K8MA 3ARGB 1G7PB 5D1QC 5GQBA 1QNZL 5HHNA 5K9KA 4JPWL 4F15C 4TUOB 1LE5B 3UTZB 4F57L 3I85A 4TYUA 3VFRA 4U6HB 5A43C 4HBQA 3AREB 4X4YA 3FO2A 3IFLH 2BMKB 1NSNH 2D7QA 1GYAA 3ARFD 4LBEB 1RUQL 3HG1D 1AQKH 3WHXB 5C0BD 3ARDD 1NDMB 1ZHLB 3DTXA 1QA9A 4YIQB 1AFVH 1IC4L 3L7EB 5C0ND 2WINB 3BP6A 3MLTA 2E7LA 4HHAA 3LKSA 1FG2B 5T5NG 3TIEB 4FMKA 4X6EB 2YUZA 1XGYH 1A6ZB 3MLZH 2GITA 3WO4B 3LN9A 1P7QA 4U7KA 5F7KC 4APQC 3TNMA 2NY3C 3AUVA 4N68A 4WY7L 4AG4H 4AEFA 3T1WA 3MLVH 3FB7B 4R4BA 4O2CA 5E70A 3NZHH 2AJSL 2B1HL 2ZUVA 5BXFB 2IAND 5EO0A 5BZWB 3QNXB 1DVFB 1YEFL 3GSQB 4PGBA 1K9TA 3A6BL 2VXUH 3D87B 3MR9A 3OL2A 1YJDL 2WSKA 4M6MH 1T83C 3L7EA 1WZLA 1WAAE 3C87A 1CGTA 4PJDE 5E8DH 3PWLA 2C1PA 4KHXL 5EOCL 4PRIE 3DGCR 3SDAD 5CEZD 4PG9B 1HH9B 3V6OE 4ZG1A 2HN7A 2GK0A 3IFOB 4PJCB 4U05A 1D5BA 4QRPE 3LB6C 7FABH 4NDMB 3CH8A 1DCLA 4NUGH 1LNUA 2JF1A 4MA3B 4X7TB 2XYCA 4NNPH 4XNMA 3T4YB 1BHGA 5ISZE 1QQDB 4U1SB 4Y19B 1DLHB 3O6FC 4N9GA 1BVLA 5GGRA 1HILB 3AFLA 1MCCA 1H8OA 3FO0L 3G6AB 3V7MA 1SEQH 1FAKT 2VR9A 4HPOH 4J12A 4KTEH 3JVGA 3FT4B 2LQRA 4PJBF 1F4HA 1T89C 2PCPA 4AJ0A 1QSEB 1RVFL 2DQTH 2ORBH 3VJ6B 1U8LB 3MRIA 3SDCD 1NAMH 5FUOH 4Z5RB 3PWLB 4MLIA 3RVWD 4M43L 5JO5A 4U49A 2HG5B 3BE1L 5FUZH 3O3DA 1UM6L 1U2CA 5KVEL 2E9JA 3WXWH 1Q1JH 1OSZB 1UGNA 5JW4Q 4D3CL 1T80A 3U4EA 3QAZB 1KCUH 3TN0A 5C2UB 3DPBA 4QEGA 1Q9KB 5IJVB 3RWCA 4P59L 1QSED 3FQRB 1WZKA 5GGRY 5GZNC 3P4NA 4LLYB 3WIHA 5HI5C 1ORQA 4X6EA 5FKPB 3OBAA 3BPNC 2ZCKL 5H2BB 1C7TA 1I85C 4IDLA 5D4QA 1A4JA 4X0KB 5HVFB 4B5EA 1A4JB 4X0KA 3BZ4B 2BDNH 5AD0B 3VXRB 5DT1H 1B88A 3QHFH 3MBEA 1H3PL 4Z7WA 4G8GE 4BJLA 5GS1B 4UTBH 3HAEB 4FP8L 1IC1A 5DWUH 4CNIA 1Q9KA 3LN5B 4G6MH 1NCUA 4MX7B 5FGBC 3OKNB 3RGHA 2H41A 4R7DA 4N0UA 5EFIB 5HI5D 4Z76B 1CLYL 3SE9H 1MUJA 3BQUA 2I27N 5KVFH 4AMKL 3O3DB 3DX8B 1CG9B 3IRZA 5A1AA 2VRAA 4QKXB 1E27A 5T3ZH 1T22B 4CMHC 3LRHA 5E0QA 4CDGC 5HYIA 2X9WA 3RUGA 3WKML 1PVHA 4KAQL 3BH8A 3MYJB 1PGRB 3D2UA 3VFUA 3M45A 4DTGL 1YPZA 1S7TA 1CBVL 1DLHA 1FBIH 4Z7QF 1CDCA 1S9WA 2YD4A 3FFCD 4M62L 5E6YA 4FFWC 4KZEH 4I3GA 1MI5E 4M7ZC 5ALBL 3ALWA 3DHMA 3PDOB 1WIUA 1ADQL 2A74A 3GMPA 2CIKB 1REIA 1IMHC 3T3PF 4OCSL 2P5EE 2X4SA 5I1EH 1ZLSL 1KYOJ 3UYOD 5CLTA 3VFNA 5GGSB 3B8SA 2BNQD 2FJGB 5DYOB 2ID5A 5EU5B 3TNNB 3ABZA 5DMKB 4LSRH 4Y5YB 3DROB 4L1HA 1TXKA 4ERSH 4O02H 3TA3B 2XT1B 2FYYB 2WBJC 4S1RL 2EDLA 3Q6FA 2GITB 4LU5L 2F54B 4ZSOB 2OTUA 3CCHA 4QCIB 1R3JA 4PBVC 2VAJA 2EXWC 1TNMA 3IU4L 3K2UH 2F53E 5TH2B 3CFDB 3R0MA 1KC5H 3GKWL 4WENB 5GS0L 3VXQB 4PS4L 5DHXB 1KBGH 5HHQA 1NDMA 3QUXA 4RGNE 1RI8A 4MCZB 1MRCH 4EVNB 4UT6H 4QRQB 2RHEA 2UYLB 2X7LB 1DBAL 4LGRB 4YO0B 2JCCB 5F1SA 1DQTA 2EKJA 4XNQB 3L3KA 2UY7A 3MLWH 3UTZA 4KHTL 1IC7L 4W68A 1XIWB 3GRWA 1IGMH 4NQEE 5L88H 4PJDA 4NWTH 1ZLUH 5F7DB 4Y16B 5FGRA 5I1HL 4OD3H 1TQBC 1M6OA 5BQ7A 2EO1A 5DO2D 1AR1D 3T77B 3EOAA 4OF6A 4XPTH 3F7QA 2PTTB 2PYEA 3OKDA 2OR9L 1SYSB 1EZVX 1KCRH 5CZKA 1YNTA 4K94C 4GRMA 2HAZA 1KB5B 1NQBA 3S5LB 4JFFD 4MXVE 2XFXA 5EPMA 4HC1A 4GMTL 1KPRA 4PJXE 1V3LA 4JFHD 4XAWH 2NW3B 1EFXD 2A6KB 3FL7A 2CUHA 5EDXA 5E2TH 3GSVB 2J4WH 4K7PX 1ZLVK 5F7NC 1T3FB 1GOGA 4JLRA 4MNGA 3VFSA 3D3VA 1KCVH 4P9HC 4NM4L 4UILH 4LARL 5D2NE 2HKHL 4YXHL 3K4ZA 4G7VH 4KRMB 5K9JH 2HTKC 4NQSB 4OGYL 5ACMA 5IESH 3UTQB 1V3JA 1JHTA 1WC7B 4JFDD 1RIVL 2VSDA 3HC4H 1KGCD 2AXGA 4Z77A 2V17H 5EZIH 1I8LA 3GHEH 1TVHA 3I75A 5IFHL 4OM0H 4LFHD 5JW4N 2Z35B 4JPVH 5F7DA 1MLBA 5C3TA 4DAGH 1IKNC 4LOUC 4OFYA 2QSQA 2HLAA 3D48R 2VERN 3FMGL 4HBCH 4XHQA 5DS8B 1RZ8A 3KLAB 4KQ3L 1WQVT 3SKMB 2FATL 3VFGL 3WIFB 3CSBA 2MQ3A 4R4ND 1FNLA 4JKLA 1NMBL 5I18H 4MCZA 4KKCD 1XGYL 5DMGD 1T5WB 5DEFB 2YD6A 4ZUVB 2D03H 4YHOH 3BN9D 1KTRL 2C3VB 2OR8A 3CZFB 1O0VA 4NJ9H 3B3IB 4MCYB 4D0DB 3BI9X 1JWMB 3DNKA 4JRWA 1TVBB 4N0FB 5H94A 2VXUL 1MLBB 3DXAB 3QXVA 5JZ7C 4P4KA 3MCKB 3PQYE 5TF0A 4JFPA 4QRPD 3RX8A 1N6QH 1M05A 1I9RL 2DQHL 1SY6L 5HHXL 2XZAL 1S3KH 1ZXQA 3LQMA 5HI3C 3RPKA 2G2RB 3L1OL 1XF3B 4HJJH 3HZYB 3TVMC 3SDYH 1J05B 1D6VH 3GSNB 4QF1B 4QTHB 5E6ID 1EGJA 2BSSB 3ZKSD 4P23C 5GPRA 1ES0B 3VXNB 1CTNA 4JFFB 2X2YA 3HMWL 1A6TA 1WZ1L 1RK0A 4MNGB 3WL9B 1EJ6A 4I18A 4XCNA 3KPRA 4X7CC 2Y5TA 1G7LB 4XAKE 4KROD 5F1NA 5KSAB 2J88L 3AROA 1XGPB 3DGGA 5I1KH 3DBXA 2P5EA 1XZ0A 2GKIA 2RCSH 1EFQA 5MEPA 2WLYA 4YK4C 4XNZC 1JMZA 3KWWB 2A9NH 4OZFB 4OZGE