2WZPD

Structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
VQLQESGGGLVQAGGSLRLSCTASRRTGSNWCMGWFRQLAGKEPELVVALNFDYDMTYYADSVKGRFTVSRDSGKNTVYLQMNSLKPEDTAIYYCAARSGGFSSNRELYDGWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords PUTATIVE RECEPTOR BINDING PROTEIN
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
total genus 30
structure length 122
sequence length 122
chains with identical sequence E, F, J, K, L
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wzpD00
1GHFL 3F6LA 3PE9A 3R0MA 2AJZB 1S9XA 1RFDL 3MC0A 5ADPL 4K9EC 3DX6A 3TJHD 5ITBL 2DQJH 1RZJH 2H41A 2XWJA 4J3WA 4JM2F 2B4CL 2O61B 4QT5A 1NEZA 3C5SB 4XWOD 2AK4D 2NXZC 4U1JB 3RFZC 3SJVD 5INCB 3HLAB 4YUEH 1EUUA 3QNZA 1JK8B 4L29A 2P24B 3TA3A 1U3HD 2FEEL 4Z7NF 3O3DA 3FRUA 5C07B 4MB5A 4LPXA 4QY8A 2UVFA 2F19L 1N6VA 4XNUH 3N06B 4YDLB 2RR3A 4JRYD 1NC4D 1T7ZA 2Z9TA 2I07A 4NZRH 2VTFA 4HDIB 3K74B 2Z8RA 3QDJD 1E4WL 3MRIB 5HGDA 2Q3ZA 4MDIB 3MLPA 3BISA 5JIIA 1EEUA 1DANT 1MJ7H 1CBVL 2ESVB 1MVUA 1OAQH 1YEIL 4OLXH 5E6IB 4KVNH 3N1QC 4PV9A 1DUZB 1MWAA 1OAZL 2GTZB 3GRWL 5ALBH 1PSKL 5HD8D 5TQ0H 1CL7I 1EX0A 4Q6IB 5MI0C 3VI4F 1CFVL 1FAIH 1OB1A 1BQUA 4MA3B 4PRIE 4AL8L 3KYKH 3HS0B 5LQBL 4OI8A 3NCMA 4PJ7E 3G5YB 4RMRA 2FR4B 4XCYB 4S10A 3VXUD 1AFVH 2EIZB 2BSSB 3S7GA 5JORA 2ATKA 1I3GH 3RPKA 1CLOH 1OD7A 3O3BB 5D7LA 2WWKT 1T21A 1INEL 2C3WA 3BP5B 3O6LL 1SY6A 4RMTA 3RGVB 4G9DA 1CTOA 4Y16A 2AP2A 3EIFA 3RL2A 1I8IA 4MNQE 2FDBP 1ZLSL 2ZOLB 3L3HB 1TETH 3FL7A 3ZDZF 1YYMH 2KKQA 3WFEH 3VI3E 1JPFB 4PJBF 1AGFA 1S7VB 2D31B 3HE6D 5C0BE 4D2NA 3C5ZB 3K2MC 5HDBF 1Q9KA 1WC7B 5I15L 4P5TD 1YEFH 3NVQA 3F7QA 4JFDD 1SMAA 1FJ1A 1DQTA 5JDSB 4OGAC 4OD2B 3PV6A 5TQ2H 2QHRH 3MJ9A 1MNUL 2YD1A 4F7EA 4OTXH 5E8EB 2DWDA 1OGAA 4P46D 2DTMH 5BVJA 5DJ8A 2J5LB 1TZHA 2H26B 3OAUL 4LSUH 4ZDHA 5CSBA 2D4FA 4GMTH 5JPNB 1AQKH 1OM3H 5C08D 1A3QA 3LD8C 1TJHH 3O6KH 5B3NA 1S7WA 3HUJE 4OV5B 2OR8A 3REVA 1FG2A 1Q9LA 1K3ZA 1KCKA 1KTDB 2ERJC 4D9LH 1LK2A 1FIGL 3GB7A 4ZODA 3VH8B 1M4KA 4HCRL 1AIFA 4F7PB 4WI4A 3MLWH 1IQWL 3RVWD 1X5FA 1QBBA 3BQUC 3OZ9H 4G6KH 1EFQA 3WE6B 4GG6B 1UGNA 2H3NA 1I8KB 3ILQC 3ZE0F 4DCQB 1BZ7B 3V5DB 1SEQL 4M6OH 5F9WC 1DQQA 1BWWA 1BF8A 5DD5L 1J0HA 3WO4B 3MACH 5EO0A 4CL7A 4J3TA 2IADB 4UNVA 5DEGA 5FGCB 4PBXA 3VXSB 1T89A 4FFYH 3JBG7 5GZOD 1HK6A 4NQXA 5I8EB 2QSVA 4OF3A 5DSCA 4LEOB 5BW7A 1AP2B 4M7LH 3QXDB 1D5XB 3AUVA 5F1NB 2O5YH 2EDOA 4ISVB 3OKLB 1XCQA 3QP3A 3DUHA 3IDYB 1ZGLP 5E2TH 4J3OC 4DFIA 4KJPC 1AO7B 3BPCB 1TCRB 2C3VA 3CFEA 1IL1B 4JRYE 2R4SL 3SCMB 5FDYA 4FQ1H 1U2CA 2CUMA 2JIXB 3QDJE 4X6CA 5E8NB 1W0WB 2YPVH 2OL3L 3FQTB 2K7QA 1FVEA 4K7FB 2OR9H 4K71B 1QP1A 4JHZA 3D87B 4YWGL 1H3PH 5ALCH 4MSWA 1XF4A 2W0KA 2F8VA 3SDAD 2JE8A 3VXTA 4IRJD 1RFDH 1CQKA 2MFNA 5JO5B 1PX3A 1KCVL 3MXVH 4S1RH 3GKWH 4O02L 1XGTB 3K80A 5DMGC 5I8CA 2FIKB 5IB1A 1MY5A 4OZGF 1ZHBA 3PHSA 5IKCA 1A21A 5FFLA 2COQA 4X4YA 2G5RA 3BPNC 1SVCP 2W38A 4MAYB 1GZQB 2F19H 4MNQA 3ARTA 5CZVL 4G7VH 2J8UB 4PJXB 5IFJB 3T2OA 4JGMA 2F58L 3V6FB 5DYOA 1Q9OB 3BKYL 5C0BA 1Y6MR 1E4WH 4P2OB 2A0LC 4J4PA 4L1DA 1G7HB 1FYTA 2D9CA 5D7JD 4FQCL 3T1FA 1JZ3A 4I4WB 3SE4A 3QRGL 1MCQA 2BCKA 3CPLA 2CIKA 2Q87A 1CBVH 2CQVA 3V8OA 5DLMH 1YEIH 3MBEC 4LGRB 4G6FB 5E95B 4RRPG 2DI8A 4UU9A 1RURH 1OAZH 2A6DB 5C6TH 4NKOA 4O4YL 2K3TA 5F1OB 4JFDE 4QRUB 1IGCL 1PSKH 5I76A 4HUWB 1GOGA 3HG1A 3ROOB 1JUFA 1QR4A 1CFVH 1IBGH 2BNQB 1MY7A 3WLWD 3CDGB 2HMID 1XF1A 2KUTA 1JPTL 5CIPH 4NO2A 4XHJC 1UG9A 5C2BH 4M3KB 4JFEE 4YHOH 2GIYA 4AEIL 4HXBL 3WSQH 5JXAL 3GSNA 1AR1D 3T1WA 4UTAH 5E1AA 5EUOB 3O4LD 1OCWL 3D48R 4P2QD 5F8RC 2V7HB 3MRFB 4YEFA 4LSDA 4JZNB 1SJEB 1K85A 3EJJX 5EOTB 2M26A 3UTQB 4FTVD 2E5EA 5D2LE 1INEH 2D0GA 3O6LH 4UI2A 4RGMB 1VKXA 5KVEL 2BVQA 3HRPA 2X42A 1T22A 4G6JL 3HC3H 1F2QA 3EO9L 1ZLSH 5C8JA 2W65B 3ARED 5IMMA 3EYFA 2VQUA 4YE4L 2YA0A 3DVFA 5DWUL 2X4QA 1G9NL 2ZSWA 5IK3A 2FYYB 4R3SA 5KS9E 5E99L 3GSVA 3O0RL 4M43H 1U3HA 5ISZD 4CU6A 1EAJA 1Q0YH 3LKQA 3VMOA 3JSSA 4Z78B 3MUJA 3UX9B 3SKOA 4HJJL 3B2VL 5J1AA 4JRYA 1IC5L 5F7DB 3A6BL 3MV9B 1KXVC 5FKPB 2FD6H 4BELD 3QDJA 3V0VA 9CGTA 5C0RH 4JAMA 1ODAA 5GGVY 3S3PA 4BKLA 5T5NG 4CMMB 1G7LA 2A83B 4P57B 5IB4A 3IDGA 2J1KA 5D7IB 1UEYA 5TDNB 5IF0A 1FIGH 3ZSSA 2OJEA 1CICB 4BH8A 3G6AA 1U8PA 5AWNL 1IQWH 3BN9D 5DRWA 3TO2B 1A7RH 1JGDA 2BVYA 4DKAA 2BHUA 1D6VL 2O93L 4F9LC 4X83A 4BFEA 3TO4D 3NN8B 3VH8G 4J2XA 5D72H 1SEQH 4PD4J 5DHYB 1A6AA 1LEKA 2YOCA 5IHZB 5J9PB 2ICWA 4JY6B 1I7RB 1JP5A 2R29L 3EHBC 5DD5H 1T1WA 3QZWB 5GS1B 2G9HB 4I3RH 5JW3L 4FXKA 4TYUA 5C0AD 3I6KA 4OT1H 5DJ2B 1QFPA 4LHUG 2O26U 4KJQD 4MNHB 2Q20A 3S3JA 4PJGF 1J18A 1F6FB 5C0ND 1BLNA 5DURB 5D6DC 1PGRB 1QSED 1ZAGA 1KBGH 1XZ0B 4NQED 5KG9B 1SYSA 3MQIA 4J1UA 4N0FA 4JDZA 3QEHA 1MFEL 3V0WH 1ORSB 1KN2H 4HFWB 3MCG1 3MRRB 1Q1JH 2R4SH 5DT1H 5E4EC 5F88B 1KFAH 4LDLB 3KLSA 1NGXB 5EU3B 5E9DA 2IANB 4PR5A 4PJ9B 3HZYB 4R7DA 3MLXL 1D5ZA 2OL3H 2XKNA 1JPGA 5LGKA 3KLHC 3S5LG 3QUYC 4OCXL 5IB2B 2E7LC 4YWGH 3GJEB 4QF1A 5HGGS 1OVZA 4LLUB 3GSWA 4XBPB 2F8OA 3QUXA 4LNRA 4O2EB 4P46A 3ILPB 3Q48A 1T04B 5DS8A 2W1NA 2FBJL 1KCVH 3ISWA 4B53A 4JFEA 4OZFA 4K9EL 1JWSA 2GJ6B 1P7QA 1NGWA 3ULVF 3MRJB 4XZUB 4YHYB 3VD5A 1T1ZA 1W0VB 2YC1B 4JFOB 5IFAL 4Q0XL 3X14A 3DYPA 1FNLA 4ZPTA 4MCZA 4RQQA 1RUQL 2WUCL 5D2LA 1KEGL 2F5AL 2VQ1B 4PJIF 5GIRA 4P2QE 5CBEB 5GGSA 3O6FA 1LQSR 5DJZA 5CZVH 1WTGT 3L5HA 5CWSB 4APQC 2F58H 2X89A 1OAKH 1KXTB 5IESH 3BKYH 4U0QB 3HMXH 3NMEA 3HB3D 5B21A 3W81A 4CJ0A 3HR5B 4Q9BA 4YBQC 5D1QD 2WBWB 2F8XC 1II4E 4FQCH 4OLVL 3HMWL 1FBIL 3QRGH 5ICZA 5KS9A 5GGRB 1N59B 4R4FH 5JLZB 4AENB 4GSDH 5I0DA 4CUCA 4PRDB 4DAGL 4M7KH 1HNFA 4HS8H 4TTDD 2VL4A 2RBLA 3DPBA 3B8SA 3GDBA 1QRKA 4I1NB 4OQTA 1VPOL 4WNQA 4EN3B 1IGCH 3BPLC 2NY2B 4OLYL 5DUMH 4WV1C 5ISZE 2XN9D 3VGAC 3DMMB 4XPAL 3MGTB 3OJDB 5HYJD 2B0SH 4Q2ZA 5C9JA 5F6IB 3HAEG 1A4KB 3CGTA 4OF6A 2R9HD 4GRMB 1FVDB 1UB6B 2IMNA 1FCGA 3GMMA 3FO9B 4XWGL 4ZO8A 4AEIH 3P4NB 5T3ZL 3C5JA 3BPOB 5FK9A 5E5MB 1OCWH 2X5PA 2AABH 3JUZA 4M5YL 1NBVL 1RJYB 2BERA 3BT2H 3MNWA 3DO7A 4PJDB 3G6JF 2QQKH 2IF7A 3WHXA 4JG0L 1C5DA 1QFWH 3C2AL 2F74A 2X1OA 4G6JH 2VDNL 4PJAE 1Z9SA 2P8MB 3FT2A 2ARJA 3EO9H 4IRJA 2HP4A 5D1XD 2C7UB 5DEZA 1TZIA 3HZKA 5GGTH 5IMLA 4X99A 4UIMA 3ZKMD 2AXGA 4YE4H 2YEZB 5DWUH 1G9NH 3BZEA 3S3SA 3MGOB 5IR1A 4I0PD 3RUGB 2IQAA 2VOTA 1DN2A 1DP0A 4RFEB 3O0RH 2X4UA 1P4LA 5C0AE 1QRNB 3DV4A 4JFFD 2Q6WB 3S36L 5FHAL 1F6AB 1IGYA 1JWUA 3ARDC 1VGEL 4UT6L 4IIQA 3MV7D 1BIIA 5C0DA 1MHEB 4WDIB 1P9MC 2ZUVA 4HJJH 5EO9A 1KTLB 3B2VH 2GT9A 1OD9A 1QSEE 1JNNH 3AM8C 3IF1B 1IC5H 1UXWB 4U7SA 3IFLH 4LBEA 1IM9A 4NQEE 1UJ3B 1CLCA 3PWUA 4TNWK 5C86A 3OF6D 1ZWIB 4MGXA 3SE3A 3NA4A 3HAEH 1U93B 1CGSH 3SKNB 4HMDA 2PF6A 4LCWB 5ID0B 3SGEI 1IZKA 3CFJA 1YEEL 2DICA 1H8SA 5F89B 2BNUB 3OXSB 3LZFL 4I13B 4KKNA 3OAYH 3VJ6A 5BXFA 1D5BB 1CFNB 3GZKA 4HUXB 4ZOEA 5AWNH 4GT7A 4S1SH 1D6VH 5BMFL 2FJHA 1I1AD 3MRDB 1I8LA 4N0RA 4JFHD 4UDUB 3U48A 4MD5B 4NSKA 4YJZL 1XMWA 2R29H 4RWYL 2WNGA 3RZCB 3PWVB 1G9MC 4ZAKB 5JW3H 4PRHD 2CUHA 4MDJA 1FLTX 5IMKA 4WFGD 4PJEE 2P5ED 1H0DB 2AQ2A 4PJ7F 3QZWG 3S37L 4YHZL 3GIZL 2Z93A 1KENH 4YDJA 3WNLA 5LKNA 3KXFB 4LLWA 5JW4R 4Y4KC 5IMOA 3ZE1E 3JVGC 3L5WA 4L8DB 4XVTL 4QRPD 3S97C 1RK0A 3RNKA 4QEGA 4BK4A 4DVBA 2AVGA 5DI8B 3AREA 4DGIL 1QA9A 5F7EL 5DUBB 1PAMA 4MQXD 2GI7A 2HWZH 3LQMA 3MLXH 5GXBB 4FQIL 4KKLD 4LHUD 4D0BA 5T3XL 2YD2A 1PDKA 4DGYH 2AQ1A 1P84K 3F62A 3FT4A 3L95B 4MD0A 1ZT1A 3PL6B 3I6GB 3FFDB 4F15B 1XGQA 3BEVA 3EYQC 1CVSC 1FC2D 4ONHA 4W4NA 1IFHL 4POZD 2D7MA 4K9EH 4MXVF 5L2JB 1UB5B 5MEOB 4GUPB 2XN9E 1TIUA 4MAUH 4XXCA 2OX5A 3HTLX 5HYJE 4N8VB 5T1MB 4HZLB 5IFAH 4QCIB 5FUCE 3MRCB 1JRHL 1RUQH 4Z5RA 2WUCH 4QRSB 4PRBA 1Y0LA 2F5AH 1I9IL 1MFDL 3MYJB 4G7YH 4PJAA 4Z7QE 4QGTA 5CJXA 1VADB 3HN3A 5FA4B 1NCDL 3QCUL 3HUJF 2BY0A 2NTSP 3G5ZA 5ICXA 3IU4L 3BAEL 1NDMA 3OR7B 4OCSL 4HWBL 3TO4A 3KHQA 2WWMC 3QIBA 1XCTA 1WBYB 3WJLA 5DD1L 5GS0C 3MNVA 2R0WL 1MCSA 4OUUA 4X6EB 4CVWA 4OLVH 3OKOA 1ZLVK 1FBIH 4MS8D 4Z95L 3WJJC 3U30B 2PKDA 1UJTA 4EI5B 5C0AA 3C09B 3BDYL 5JOEA 1J1PL 4HG4K 1JV5B 3PV7A 1T0PB 1E6JL 1JF1A 3KPMB 4Z0BL 1Y18B 3JTSB 1QSEA 2Q8AH 4OLYH 2BVPB 4JFFE 1S7UB 3F7VB 4NQEA 3E0GA 1U8IB 3HI1B 5BZDA 4XPAH 5K9JL 3MV7E 3SGKC 1VHPA 1WFUA 4LSTL 3UC0H 3WO3B 3DETC 2VAAA 4XWGH 2ZKHH 3KPLB 3KYNB 2NR6D 4HWZB 3JWOH 3BMWA 4Z7UB 5T3ZH 3W2DL 1ZT7B 4XCCL 5IWLA 2VDPL 2EC8A 1FNGB 4KKCC 4ZD3L 5E6YA 1B0RA 2W9EL 3UTPD 2RAMA 4LLAA 4XCFL 4PJFE 1CXEA 3AY4C 4F9PC 3I02B 1CZ8L 4NRXA 5F7NC 3UYRH 3GUTB 3MV8B 2VDNH 4FQQA 4E0RB 2ICCA 3MRGB 3OX8B 2WIIA 1WZKA 4LCYB 2ADFL 4AIOA 2NY3B 4X0KA 2IH1B 1BD2E 3GMOB 2GJZA 1QLEH 3BEWB 4PJEA 4HK0B 2NY6D 1HOCA 2OTUB 3CFBA 5HTSA 4KRPD 2A74B 2QL1A 5E5RB 3D0LA 4WWKB 3ALPA 4PRHE 3QHFL 3FO2A 3QSKB 1W2KT 3S36H 5ACZA 5FHAH 2DQHH 3GRWA 3DVIA 5L6YL 2P5EE 4ELMA 4UT6H 3OXRB 4G80A 4LKXA 4TN9A 1XF2B 1B88A 4GW4A 1KNOB 3SCMC 4U1NB 1OSPL 5J12B 2P5WD 1OW0C 4YHPB 4YDKL 4PREA 5DQDL 5F7FA 4FS0A 4OZHE 3MRPA 3VW3L 3NFNB 4G8IA 2HJLA 1CIDA 4QRPE 4ZOAA 4A6YL 3MUGB 5D1QA 2YK1L 1SJHA 4K7PY 3LZFH 1HZHL 4JKPL 3CC5A 4LSVL 3BJ91 3O3AA 3VFVA 2DTSA 2X4NB 1X3DA 2EDQA 4OIIL 2B7DT 1NBZB 5CEZH 3WD5L 2ZCKL 3DURB 5IM7A 2WINB 1MREH 2XTJB 1X6LA 1QQDA 3B5HA 5A2IH 4JFPB 3IAQA 4I48B 3ULUF 3ZO0A 4Z9KB 2CIIA 3OR6B 1OARH 1LO2L 5IG7A 4RWYH 2ZPKH 1QVOA 2ZWLT 1KC5L 1IAII 4JQVC 4AH2B 2FCBA 5AUMB 1A47A 1GC1C 4MJ5A 2HVKA 5DJAA 4N8PA 1U36A 3CVIL 1HXYB 1BWMA 2DKUA 4E41E 5HXMA 1V05A 4UDTA 5CD3A 1W72L 4GW1A 3BIKA 5BRZB 3S8WA 4XVTH 2H1PH 2DIAA 2ED8A 5EPMA 1DJSA 4U6HA 5HHMD 4DGIH 4AIZB 2NXZD 5T1DL 5F7EH 5TE4L 5ERWB 3DRQB 5FM5O 4E5XB 4F7TA 5CLTA 1MCWW 1G1YA 1X5IA 4FQIH 4I0PA 5T3XH 2YWYA 4HCRA 1KIQA 1A3RH 1S78D 3ARPA 5FIEA 4PTTA 1F4AA 4PGBB 4JJ5A 1WQVT 4LNVA 5TE6L 5IB5B 1IFHH 3UEZA 4ONFL 4P5MA 4R6UA 2YD8A 5DR5L 2R2HB 5L8KB 3OF6A 2BDNH 5GGVH 5JUEL 3L3JB 1UQSB 3FQUA 1IKFL 1CL7L 2LVEA 1NUDA 5IV2B 4M3JA 2K7PA 2YPKB 7FABL 2XYCA 1FL6A 4MCYA 4G8FA 4OI9A 3MV01 4FZ8L 1J1OH 3PUCA 4N8VG 1CXLA 2PYED 4X7CC 2VDRL 3QCUH 2CD0A 5L88H 3D3VB 1VFBA 2FLBT 3IU4H 4EJ1C 4HQQL 1ZVSA 4OCYL 5GHWH 3O9WC 1BD2A 4HWBH 4BSJA 1NGPH 5F3HB 4IJ3C 3WFCL 2R0WH 2XFXA 2ADJA 5T3ZD 4XAKE 1QSFB 4Z95H 4NQTA 2OR7A 4KV5F 3ZKXB 1T4KA 2FH6A 3WNKA 1HINH 3BDYH 4PRPB 1PYWA 2APBA 4MWFB 1J1PH 2YXFA 4NRZA 2NW2B 1E6JH 3DBXA 4BH7B 4Z0BH 3MCKB 4R4BA 2JJTC 2E8ZA 3QXTA 3HRZA 1ZGLM 4P4KB 2PUQT 4ODUA 3C6SB 4OZHA 5SWZD 5K9JH 4QRPA 1CG9A 4D9QD 1D5MA 1IEAB 2P5WE 2EE9A 5LVEA 3MRLA 3TT1L 3MOBH 3TT3L 5HY9B 3LKNA 4DW2L 3W2DH 3FMGL 4ZD3H 1EA9C 4OGAD 5CD5C 3BGFB 3BP4A 2W9EH 4LHUA 3HC4H 3LQAC 2X9YA 5LG1A 1HH9A 1I75A 1JVKA 4NNXA 1CZ8H 5FYJH 3NZHL 2NY0C 4I18B 5ILTL 5B39B 1X5GA 2EH7L 3P0YH 4Y5YC 3BDBA 5GSRB 1KYOJ 3B2UC 3B9VA 4YGVB 5DD0H 4KHTH 4U1LA 2E7HA 2ADFH 2AKRB 5HHPA 3V6BR 5ESVB 2W0FA 1ADQA 4NGHL 3L9RB 3HE7C 5I1GL 2ILLA 3NCFB 3QNYA 3PJSA 4F37K 5I1LA 1U92A 3ESVF 4ONGH 3F5WA 4ZUWB 4E41A 1NANI 5HI4C 5DRZA 3BQUD 3IDXL 1Z9MA 4YX2H 2CK2A 1MH5B 4YQXL 3ILQD 4YXKH 4HBCL 3U2SB 4NC0B 1OSPH 3B6SB 3S36X 5EUKA 3IKKA 4L8CB 3QXAB 2HKFH 2WM0A 3S96B 3KYOB 5C2UB 3E6FA 1VFAA 4JY4B 2PW1B 4HUMB 3VW3H 4X7TA 4OLEA 2X6MA 1S5HB 4WEBL 4PGEA 2X1WL 4NRYA 2YK1H 5KSUB 1IILE 1NKRA 5HHME 5DJXB 1CDUA 5C7XL 2LQRA 3O8XB 4JKPH 4LSVH 4PRNB 2VZUA 1F3JB 2A9ML 2YD7A 2VXTL 5A43C 4OIIH 2FSEA 1M71B 4GJTB 1K5NB 4X98B 3L3GB 4UAOB 4KJPD 1G7JB 1NCCL 1I3VA 1YNLL 2EDHA 5D2NE 3TCLA 2FJGA 1HWGB 3UTOA 3I3DA 4HJGA 3CVHA 2BJML 4JO4L 1CF8L 2YMXL 5F6HJ 1G9ML 1E4JA 5T3XD 4RGNB 3UDWC 3T2PA 1OF2A 5I1JL 5ACLA 1UZ8B 1MCKA 3H9SE 3MLSH 1GZPB 4DUWA 4J3SA 3BGAA 1FSKB 5BZWA 3DI2B 1OP5K 2IAMB 3RWHB 1XGUB 1KSRA 3S37X 5HPMB 4BYHA 2PYEE 2C1OB 3UTZB 2VKWA 5DHVA 5DMGD 4M93C 2H45A 4NT6B 4YAQB 1T20B 2GCYA 3QEQD 3I6LD 5TE4H 3WKMH 3P4OB 3QDMD 4NO5B 1CGUA 1A7QH 1XF3A 2ED7A 4WW2F 3QULB 3TYFA 1NLDL 5T3ZE 3KPOA 4EN3C 2RIKA 1T1YA 1FV1B 3P11L 4KKAC 4BSWA 2GYSA 1IAKB 2NY1C 4WJ5B 4OZ4A 3UJJL 4YPGA 1R3KB 3Q6FB 5FUZL 1S7SA 4OKVB 1UKQA 3MRMB 4WFED 2ICWJ 2A0LD 3VXRB 1FFOB 3A6CH 1ZHLB 3ARUA 4O5LL 4P99A 3ZKSD 4ONFH 3CJJA 1L7IL 5DR5H 1CFSA 1M7DA 5K9KA 3N1GC 4JM4L 5SWZE 3B5GA 4YH6A 3CFKA 2H6PB 3WUZA 1FFPB 4FABL 4D9QE 1ULVA 3PQYD 4K55A 3MBED 2UWEA 2NMSA 5TJWK 1CL7H 2AV1A 3DGGA 4EKXA 3G5XB 2ZP0T 3M17B 4C56B 1I1YB 3RDTC 5CEXB 4NHUB 1A7PL 2EDLA 2NX5E 2VDRH 1KLFA 4FMFA 3RVXC 5AG8A 4LF3A 2PCPB 3B9KC 3S88L 3LKPB 4HQQH 4MZ3A 2RFXB 3LEXA 4KZEL 2NY5C 4OCYH 4XHJD 3WN5C 3W0WA 2FGWL 4Y5XA 1JBJA 4OBRA 1PG7L 3KJ4B 4HEPG 1P53A 5JQHC 4FQXA 5GS0L 3RGHA 4H26B 2L7UA 1F3DH 5IQ7L 1ES0B 1BX2B 1I3RA 2JELH 3IAGC 2CDFB 3QCTL 4JKKA 4JVPA 2WBJB 3U83A 1JTPA 1UC6A 3OKYA 4OFYD 3DSNA 2UYLB 3MR9B 5IHLB 2QHLA 1I7UB 2YD4A 2RJMA 5H94A 3K7UA 4NO0A 1N2RB 1QYGL 5EB9A 5JW5A 1EEZA 3ARGA 3F65A 3QA3B 4NWTL 4F3FA 1T0MA 4GG8A 5FO7B 5D6CA 3ARBB 1S9VB 5JDJA 3QEUB 3TT1H 3CCHA 2YWZA 3TT3H 3ZE1F 3ULSA 5I1DB 3K4DA 5ENWB 5HSFA 5SWSD 2AJYH 3TGXA 4GQ9L 5KN5A 2HFEA 2Z35B 3DROA 5JQ6L 3OJ2C 5F6HI 4UNTA 3S34L 4QHNB 3ARFB 1QZ1A 3NZHH 4OI7A 4G8EA 3NH7L 5ILTH 5D2NA 2JLLA 4U3CA 2X4TA 1U8QA 5KSBB 3TBWB 3FB6A 4MMXC 5EZLA 2VE6A 4ZAKC 1MRDL 2HFGL 3N9GL 3NTCH 5FOBA 2E6JA 5K9OB 2VLMD 2JK5A 4ZUTB 2UZYB 4NGHH 3FQXB 4O51A 3X12B 1MLBA 1WWBX 3SHSA 3S35H 5I1GH 1DVFB 3H9SA 4DFHA 4V1DD 1EEYA 1EO5A 2AQ3A 5H2BB 2WLZA 2XI9A 1IAIM 4Q9CA 1CQYA 4NQDE 2F53B 1YY9C 3IDXH 1MHPH 4YQXH 1G0YR 4JM2B 5HGBB 4R90L 3GSQA 4L3EA 5F9JB 2G75A 3BDXA 5DJYB 1QO3A 2HFFB 3EHBD 4H25B 3QDGB 2VL5A 2AJSL 3EOBA 4QOKB 4Z7QF 2P49B 5DZNA 1QLRA 5FF6A 1X5YA 4J23A 5SWQB 4WEBH 1LDPL 2ICWI 3IETA 4TUJB 5DZLA 3EYOA 5D71L 3MZGB 1Z9LA 3TZVB 1XT5A 1A6ZB 3I6LE 1CDJA 2DBJA 3QDME 5D1ZB 4JCLA 4KQ3H 1JGEB 5JA8B 1F4YH 5DD3L 2A9MH 2VXTH 3D85B 5EC1A 2Y23A 2AXFB 2I25N 3P73B 1KLUA 4M8QB 3VDBA 3SO3B 1E28A 3LDBB 4U1HA 1NCCH 1AD0A 3INUL 1YNLH 2P45B 1VACB 1IEBB 1KJ3H 5D5ME 2CO6B 4ZTPL 3U0TB 3CH1A 2YPLB 3MLTA 4QLRA 3WIIH 2R0ZL 4GLRI 3X3FH 4RZCB 4WFEE 3F58H 3DRTA 2BJMH 1CF8H 2YMXH 1RMFH 4ODXB 4L8SA 4S2SA 2AJ3A 3TA3C 5IVOA 5MENB 4OCRL 4M4RA 4QRRD 4R8WL 5I1JH 3MO1B 4L3CA 4DKFH 3KLHD 3QUYD 1GC1L 3U0PA 1JE6A 3PQYE 5DK0B 2NX5A 4UILL 1U95A 2QEJA 4K23L 1KB9J 5GRUL 1ACYL 1EPFA 5EU6B 3VFNB 4FXGA 4OZIF 1AHWA 1DCLA 5E2JA 2ZUSA 2QSTA 3CDFA 1YJDC 4JRXE 2Z8SA 4HEME 3LIZL 1U8MB 4PJFF 1ZEAL 1U8LB 1HHIA 3IJSB 1HHJA 1U9KA 2BMKA 3KVQA 4LVOC 1N26A 3EZ8A 1MPAH 4L8BA 3F12B 5C0GB 1KJVA 4PB9L 3LN4B 2Z92B 1F2XK 2UUDH 5DJCB 2DMCA 3TIEA 1U8JA 2DDQL 4WO4B 3JXAA 2OSLA 5F1IB 3RY5A 1EHNA 3BQUA 1CGWA 4GQPH 1SEBA 2JCCE 3OGCB 4PJBB 2H9GA 4APQD 3D2UD 4MXQC 1RJLA 4F7MB 5FUZH 4HGMA 3LRHA 1BJ1J 5HHXL 25C8L 1OGTB 1U91B 5HGAB 4YBQD 5T5NF 1A1OB 1WAAF 3IVKB 1FZMA 4LFHD 1L7IH 4ERSL 3IYLW 5HBBA 4RIRB 4HUKB 2Z4QA 5LCVL 2Y25A 1HEZA 5FDWB 4J3VA 3WFBH 2FO4B 4RAUA 4K7PH 3SDDB 3MLYL 2FX7L 3MFFA 3X11B 5C70A 1D3CA 2FZ3A 3T0DA 1R0AL 4Z7OF 4Y16C 1KN4L 1P4BL 1ZS8B 4KTDL 1A7PH 4XAWH 4U6VL 1A6UL 2AXHA 4YK4B 3UTSD 3CXHJ 5EWIL 3GI9L 4KZEH 4Z76A 4KI5C 3JV6B 4YHIB 4ZXBB 1QNZL 1PG7H 1LP9E 5JHLL 2V9QA 3MOAL 4JDTH 5IQ7H 4WU5B 5KZCB 43C9A 2IALA 5DJDB 1NL0L 3QCTH 3QO1A 3WL9A 4NQDA 3WNMA 1A9EB 2FHFA 4L9LB 3KLAA 3D39D 4XP4L 2XZCH 1B0GB 1NCWH 2WK2A 1CFBA 1WIOA 1NBYA 3HZVB 3FTGB 3WIHH 2HJKB 4ODSH 5CFHA 3VA2C 3T0VA 4MX7B 4WUUD 5FM4A 4EDWH 3P30L 3SY0A 2BNRE 4NWTH 3FZUC 2NNAA 1HHHB 1INDH 1A7BA 1R5IB 4P3DA 1WLHA 1RIHL 2LV4A 1G7IA 1J8HE 3CFDA 2BY1A 2AK1L 5INDB 4NYLA 3V6OA 3DUSB 1EEQA 3NA9L 3PXJA 1SHMA 4LAJH 1NFIA 3QDMA 2R23A 1C8PA 4DOHE 3BZ4B 3WFDL 3GSXA 4MYWB 2ZUQB 4DKEL 5C0JA 3CMGA 2F54D 2B2XL 3VXOA 2P7TB 1EFXD 5C1MB 3KLDA 4NWUL 3TBSA 5DJ6A 3LQAL 3ARDD 5BJTB 4WI9A 2UY7A 1NCBH 3PP4L 1I4FA 2JJUA 1KJ2B 3T8XA 4DKDC 3D5OF 1S7TA 1KELL 1T0NB 5HDQL 1T89C 3PABB 3KPPA 1DBAH 3N9GH 1F8TH 3O45B 1CDCA 5BW7C 2R1YB 2VLRB 1I1FB 1C08B 1RUPL 1V7MH 4X9HA 4DUVA 3FOLB 3VFTA 4N5UA 3UBXI 4HXAL 4KAQH 5EN2B 5H37G 3HHRB 5F97E 5F9OH 5BQ7B 4JRXA 4B7IA 4XMPH 3VWKA 2I9LA 2DLTA 1OAYL 1ZKAA 3PNWB 1KB5A 1E6OL 2AJUL 4OZGB 3FO1A 4TVSa 3GSUA 1EHXA 4Z7WA 3QQ3A 1QHOA 5C07D 2PO6B 1RZGA 4NKDB 4WRLA 4AMKL 4C54A 1MCHA 5I1HH 1LE5B 5DVKA 5D71H 3D0VA 1KULA 3GGWA 4U3HA 5FUOH 1JWMA 4QRQB 3BUYA 5TF1L 1DQJA 4ZPVA 4U33A 2OXGA 4PUBH 5DD3H 3HNSH 4OFYA 4R0LB 1YMMD 4QTIL 5T33L 2ATPA 5TGBB 4Y4KD 1W8NA 1F00I 4F80A 4HWEL 5CGYC 1RZKC 1Z6JT 3PWLA 5ANME 4WHTB 1ETZA 3MJ7B 4JFXB 2EDNA 3F7RA 1HI6A 4GRLB 4N0UB 1TCMA 2A6JA 4ZTPH 4KDWA 2ARJQ 2R0ZH 4ZSOB 1WITA 4M61A 1LE9A 1DTUA 2BSTB 1EAPA 5LBSH 2XZZA 4CW1B 1BGXL 2W92A 1OAXH 1RHHA 1CE6B 1LO5A 3LS4L 1YN6B 2ZG2A 2MCPL 4KQ4H 4LL9A 4K23H 3O3UN 4OGXL 2Q7NA 4JE4B 3VFPB 3EYQD 1L9MA 1MCOL 5J11C 3BMVA 4R26H 4M7ZB 5H37H 1Z3GL 5TDOA 4AT6B 4X7EC 4KDTA 4RNRB 4I77L 4XC3L 35C8L 3CLEL 3LIZH 1LP9A 3DI3B 3RRQA 3SE4C 1ZEAH 4YFLF 1ZHNB 3UTSE 1K4DB 4A6YA 3DYOA 1RK1B 4F33A 4X9IA 3ARZA 3RIFK 1NC2D 3GJFB 3MRBB 3T2NL 4PB9H 4BFBD 1QFUL 3BW9B 1MI5A 3CDCA 2IPUG 5E7BA 1OTSC 2YSSA 2CSPA 2DDQH 4J8RA 2D7TL 4Y19B 2BNRA 2JB5L 5HHOE 5JNYA 4NN6C 1FG9C 5H8DA 2FWOA 4P2RD 3QFDB 3DLQR 2PTTB 2G5BB 5HHXH 1J8HA 3T4YB 25C8H 2WWMD 4N1CA 5BOZG 3EO1A 4NJ9L 4L9DA 2EKJA 3ARSA 5GS0D 1CK0L 4ERSH 1BFOA 4H5SB 4M6MH 4XMLL 5LCVH 4GAJH 3BGFC 4I8DA 1BBJA 3SDCB 2DYPA 3LMJH 4NQCB 1S7XB 4R7NA 4RAVB 4HV8B 3RWGA 3IXAB 1RIVL 3MLYH 2FX7H 3VXNB 2EO9A 3LV3B 4NUGL 3RWEA 4PJ5B 5IUSA 2X4PB 1A6PA 4CMHB 1A6WH 2HKHL 1DFBH 1YPZA 1P4BH 5D6DA 4KTDH 4X4ME 1MCEA 2F54E 3ZT7A 1A6UH 2BVOA 1MCPL 3RL1A 3HZMA 3V52L 2VZVA 5EWIH 3GSRA 2NY5L 4Y4FA 5EORH 5EOCJ 1T7WA 1NAMB 3DETD 1K2DA 1QNZH 1FZOB 2HYMA 5DUPH 2PXYA 3MOAH 1WBXB 2NXYC 5C0EB 5DMIH 1S7QB 8FABB 1H5BA 4KKCD 1AGBB 4NQSB 2OMBA 1PG7X 1NL0H 1XR8A 1U3HC 3LSOB 4XP4H 1EV2E 4P3CH 3MROA 3VG9B 3QFJD 3QI9B 4X9BA 4P5KA 5IOPA 4AEHL 1GGBL 3GMPB 4IDLA 3OB0H 1XGYL 2H32A 1EGJH 3BVNB 1XGRB 3EYVB 3S4SB 5JPMA 1RIHH 1TJIH 3V4VL 2MSPA 4TSAL 4POUB 1VB9A 4NCC1 1Z0MA 3MMEB 32C2B 3LN9A 5CSZB 1A1MA 4X6FA 3CSYA 3O8XC 4PJGB 2C9AA 4GRWH 3WFDH 3TN0A 3MA7B 1YEKL 2B2XH 5C07E 3OV6A 4P3WA 4PB0H 4NWUH 3B3IA 3T65A 3L6FA 1WBZB 3MRNA 4YNYA 1D9KA 4LLVB 3U4EB 3WLBB 4FQJL 3GMLB 3QNZB 3U9UB 3SCMD 1RJZA 3PP4H 4IBLT 4O58L 5EC2B 4JPIB 3K2UL 4OLUH 1DQDH 5IFHL 4LGPB 1UYWL 4H1LB 2UVEA 3D2UA 5HDQH 4RMVA 3WS6C 1FO0B 2CRZA 2GUOA 4NM8L 2GY5A 4RGNC 3IDNB 1REIA 5D4QA 2AW2A 2Z31A 2XWTA 3IJHA 4YIQA 4GS7C 2FJFA 2DWEA 3KG5A 5I1IL 4RA0C 3CD4A 4LKCA 2IAMC 5K9QI 5JA9A 4F58H 2F9BT 4IHOA 4UTBL 3F6IA 3HI5H 1PBYA 3BP6A 1DEEB 4WV1A 1MWAB 3C6LA 1IAIL 1W8OA 2EEBA 1OAYH 1BFSA 1JYXA 3RU8L 3KWWA 1KIPA 2AJUH 4OF8A 1X7QA 3PXHA 5ESQB 3RY6A 5T1LB 2Q8BL 4PJIB 4AMKH 2LU3A 4EUPA 4GFTB 2EYTA 5KOMC 5BS0D 1MHHA 1R3IH 3L3KA 5KTEL 4IOIA 5TF1H 3PGDA 4F37F 3VFUA 2CKBB 5HHOA 2MHAA 4XRCA 1QPXA 3QUXC 2ATKB 5F7KC 1QACA 2BHZA 3EFDL 1H3GA 4HWEH 3DIFB 3IXTB 4KROC 1I7TA 5D7LB 12E8L 1T21B 1UACL 3OWEA 4P49A 2A77L 5C0IA 4P2RE 4JY5L 4XNXL 4L4TD 3CSBA 4XH2A 1RUKL 4ZQKB 1I8IB 1CD1A 5ETUA 4G6FD 3OQ3B 1UM6L 4U3XA 4NKMA 5FKAB 1YNTB 3IFNL 1XF5A 1Q9KB 4X4MA 3R06B 3NZ8B 2BNQD 4Y4HB 3O6FC 2PW2A 3BN3B 3QUZA 4HAGA 1EFXA 1IM3A 2MCPH 4HC1H 1JZ7A 4OGXH 5I74B 4YR6A 3GMNA 4PGZA 5MEQB 3VFOA 3D69A 4PJDF 3HA0A 1MCOH 4NQVB 1P9MA 4U1SA 2JJSA 1MLCB 1Z3GH 5EBWB 1YJDL 2Z0BA 35C8H 4ODVH 3CLEH 5DVNA 1WT5A 2WP3O 2DWDB 1OGAB 2SEBA 3LN5A 3HKFA 5CS7A 4Z18A 7CGTA 3DTXA 5DFVC 1TZHB 3KDMB 3RIAK 3KPRD 1VSCA 3V6ZA 3G6JB 3CLFL 1X5KA 4M4PA 2OYPA 5CLWA 2R2BB 1GL4B 1QFUH 3ZL4L 5I1CL 4MLSA 3ZLQC 2VDML 3GMQB 5A2FA 1DLFH 1TNMA 5GRVL 5HVGB 2D7TH 4GG6E 2CRMA 2JB5H 3CK0H 1GIGH 1LK2B 4X5WB 4U7KA 3GB7B 4F8TA 4XCEA 2O61A 3O9WD 1MELA 3RNQB 3CMOH 1FGVH 3NGBC 1E4XI 4JO2L 4NJ9H 1CK0H 5DC0A 2H3NB 2IEPA 5FGCE 4U1JA 4WVRA 4XMLH 5INCA 3HLAA 3SGDH 4NZUL 2P24A 4QWWC 5C07A 1UEMA 4A2MA 5EIIB 3O2VL 4AG4L 1OT1A 5C0CD 5BV7B 1RIVH 4LCCB 1SY6L 2IBZX 2L4OA 1EBPA 1UA6L 4FOMA 1Q9WB 2IPKB 1GXEA 1KUMA 2Y7QB 4HDIA 1MFAH 1MCPH 1HKLH 4WI7A 4GAGH 4MDIA 5KVFL 3VXQB 3NCJL 4N68A 4DZBA 2C3XA 2IPUK 3DVGB 5E6IA 5DGQA 1RHFA 4H0IA 1WCBA 5FM5M 3OB0K 1DUZA 3BX7C 4NN7C 2MQ3A 5CD5D 1CLZL 1UKTA 3O6ML 5D5MF 1AC6A 2GTZA 3EO0A 4X6DF 1HHKB 4Q6IA 3L1OL 4MA3A 4AEHH 2XQYK 3W5MA 1GAFH 1GGBH 3HS0A 1KCLA 4KU1A 3B2UD 3GJFH 4XNMB 3G5YA 1NGZB 2FR4A 5LAXB 4KJYB 3EYSL 4PRIB 4XCYA 3FFCD 3V4VH 2B1HH 1JZ4A 1AXSA 3TZVC 2RGSA 4PJ7B 2FECI 3HE7D 1UH4A 2PYFB 5KAQG 4U2YA 3O3BA 5FCUL 3KPSD 2FRGP 1ZXQA 3FRPA 4LHQB 1NGQL 4R2GB 1FFRA 5HI4D 1RIUL 3RGVA 1EZVX 1GRWA 3GSOB 2YA2A 5GGSY 3MV11 3GBNL 4WFHD 1MFCL 3LDBC 5CHNB 1I8LC 3UJTH 2ZOLA 3L3HA 2J8UE 4O58H 4HKJA 4XXDB 1NEZG 3P0VL 3QNXB 4POYA 1JPFA 1S7VA 1KJMA 2D31A 3C5ZA 1WC7A 3UJIH 3EJZC 5HDLA 1Q72L 3NIFE 4WHCA 5EU5B 3KHOA 4AJ0A 3ZDXE 2JCCF 3QG6B 3E2HC 3FB7B 5JDSA 4EOWL 2EZ0C 2GITB 5CZXC 3QH3A 4L4TE 1OWWA 1AXTL 4OD2A 2XZAH 2VABA 4IEFB 1R5WB 1UKSA 4XCNB 1ND0B 5E8EA 1BQHB 1NAMH 2BCKB 5IBUG 2CIKB 2H26A 4UTBH 5J13C 4OGYL 1MCNA 2BNQE 4QYOB 5GJSL 4S0TD 1ZVHA 1A2YB 1BZ9A 5D8JL 3QXVA 3H9YA 4GBXC 5HI3C 1IAIH 5JPNA 1RZIA 3SGKA 5I76B 4ODHH 3RKDC 2HG5A 3SQOL 5IEHA 4JFZL 4ZOBA 3WUWB 4OV5A 1QG3A 1JF6A 2E8YA 3JUYA 1KTDA 2HLFC 4GW5B 2Q8BH 4Y89A 1N64L 4F7PA 1A0QH 4HFUL 3UXFA 3HUJB 5KTEH 5JIHA 3WE6A 4GG6A 5E1AB 2XOTA 4FZEL 1I8KA 2P44B 3UTTB 4ZYKB 1BZ7A 3BWAB 3V5DA 3EFDH 4LQ1A 1QTYT 1RZKL 3WHE0 1BQLL 4K3GA 2IADA 3MLVH 3VXSA 2VZSA 5KW9L 2HH0L 4JY5H 4XNXH 4G8GD 5I8EA 1RUKH 4LAQH 2OJZH 4LEOA 3HMXA 4NFBA 5C8JB 1UM6H 5J6HB 4JN1H 1AP2A 4GAYB 3QXDA 1D5XA 5F1NA 4EN3D 4ISVA 3IFNH 2J2ZA 5I73B 1AE6L 3OJVC 5F96L 5HYQB 3ALXA 1K6QH 4KKAD 1KPRB 5CJXC 1HDMA 4RDQG 2AK4B 2NY1D 3MCLL 1HYRC 4R3SB 5JXEA 1SBSL 4XP5H 1AO7A 3BPCA 3SJVB 2DLFH 1TCRA 1R3JB 1IL1A 3REWB 5CMAB 3SCMA 4PJCF 2BRRL 1Z0NA 3QIBC 1OW0A 1FORL 1OLLA 2VDOH 2FB4H 3WKNA 4AYFA 4HGWB 5DJ0B 3UZVB 5E8NA 1W0WA 1AGDB 3FQTA 1NC4B 3IRZA 1ZTXL 1HIML 3QCVL 5L2KD 3BFOA 3CLFH 4W4OC 1UM4L 3BYYA 1IC4L 2P1YA 5I19L 1K8DB 1MWAH 3QDJB 4GRWE 5I1CH 4ZNEE 4ZFOB 3RDTD 4ESKA 5IB4B 4PLNC 5JO5A 3RVXD 2BRQA 2D7QA 1WGOA 3VA6A 3B9KD 2E9BA 4G6AC 2CLZB 5DK3A 5DRNB 2OJEB 3C60B 2FIKA 2DQIL 2XA8H 4JKMA 3I3BA 4LRIC 5GGQL 4P23C 1JGDB 4JO2H 3OG6B 1PJ9A 3GSNL 5HGHB 3CDYA 2CKNA 3CU7A 5CJQL 5DTFB 1S8DA 5EIVA 1RZFL 4M00A 4NZUH 4M48H 5IIEB 5GGTA 3FFCE 4N1EA 4MXWL 3ZTJG 3O2VH 3FB8B 4AG4H 1TTFA 4MAYA 1GZQA 4Q9QL 1SY6H 3RX5A 3IDIB 4OJFL 3KPSE 1GGYA 2J8UA 4FXKB 4PJXA 5IFJA 1YQVH 4OFPA 2ZNWA 3VXUB 1KOAA 1Q9OA 1WV7T 2VDQH 2VXVH 4RBPH 1MRCL 4P2OA 5EO1B 3DSFL 2WUBL 1T03L 1G7HA 1SJXA 1BLNB 4DJMA 4I4WA 1BAFL 3NCJH 4C4KO 1C5CL 4TSCL 4YHKL 1XIWC 4MJIB 3WFHA 4N0FB 4L4TA 2R0KH 2R56L 2RHEA 3K4AA 2OBGA 1A02N 3GJFK 4KVCL 3T77B 1S9WB 2A6DA 3MBXH 1QSZA 3CX5K 3O6MH 4MJ2A 3MJ9H 3HE6B 4HUWA 1PZ5B 1RZ7L 3ROOA 5A3IC 1HH6A 1M6OA 2BVTA 3L1OH 2BNQA 4PV8B 4P5TB 3WIFB 3EOAA 3CDGA 1JPGB 4JFDB 1VGKB 4ZO6A 1H8OA 3ZKQD 1KEML 3CUPB 4X8JB 3STZA 4MHHG 2I27N 4Z77B 5FGSA 4QF1B 2W60B 4ZAKD 3WEXB 2VITB 1HN1A 2PO6C 1NUGA 3BGMB 5EUOA 3LCYA 3GFUA 5DS8B 2V7HA 2XNAB 3MRFA 4JZNA 1SJEA 1CWVA 1A7OL 1I1CA 5EOTA 3UTQA 3W39B 5FCUH 3RVTC 1NGWB 3KXFD 1FRGL 1U6AL 3ZDYF 5T1KD 4EXKA 3ZTJH 1YY9D 5C08B 4LSQH 3R1GL 4ZPTB 3VFSB 4WI8A 1MFCH 4YBLB 5E03A 4U05A 5FGRA 2W65A 4M5ZH 5GIRB 3P0VH 3VGFA 2LTQB 3FN0L 1FNEB 4Y2OA 5EULV 2FYYA 2HN7B 4I2XE 3U46B 1FQ9C 2DQCL 4HMCA 4G8GE 1AXTH 2J12B 2P8PB 1NPUA 3X13B 3JTTB 4KMTL 4B50A 4Z78A 5ICZB 5KS9B 1U58A 5FO8B 3VRLE 5F7DA 2JJTA 4GXUN 1YYLH 5GJSH 3QEGL 1INQB 5FKPA 1B3JA 1JHLL 3STLB 2D4DA 5D8JH 5TH2B 4QNPE 5F70A 2MQ0A 4FFZH 1OTUC 3E6HA 5L0QC 4P57A 4JFZH 1FAKT 1LD9B 1CI5A 3TA3D 5D7IA 5EU4B 2D7NA 4LDEB 1U8KB 5TDNA 1YUHB 4XP9L 5IROA 4ZNEA 1CICA 1N64H 5CP3A 3KS0J 3JV4B 3GK8H 3TO2A 5L2KE 2V17L 2WBKA 4Y7MA 3PWNA 4FZEH 5FK9B 4BQ9A 3NN8A 2FATL 5DHYA 2LU4A 3K8KA 2LU7A 3IGAB 5I8OL 5IHZA 4JY6A 5J9PA 3DO7B 1I7RA 1BVKB 4GKZB 3LKRB 2DIBA 5HYIA 3PGCB 5D9SB 5F7WC 5GS1A 2G9HA 5KW9H 1CDYA 2HH0H 3GHBL 4IOFC 3FB5B 5EFIB 4YHLL 1OHQA 3FFCA 3SDAB 4IRJB 4MNHA 3TYGL 3T4AB 4X99B 5F93C 3OKKA 5F96H 5KG9A 1XZ0A 4NKQB 3MCLH 5IR1B 5AAWA 4ODWB 4JHWL 1SBSH 2MKWA 1ORSA 1VENA 4HFWA 4MXQD 3MRRA 1QKZL 1GPOL 4L4JA 2HVJA 2PTUA 4HT1L 5F88A 4IIQB 4Z7VF 4FN0A 5L9DL 5E5UB 5EU3A 5CJ8A 2V5TA 3HZYA 4JFQB 4TSBH 4LBEB 4AIXA 1UM4H 1YEHL 1IC4H 5I19H 3PWUB 2DD8L 4X9FA 3VG9C 3GNML 3O2DH 4UUJA 2WQ8A 5KJRL 3GJEA 4OQTL 4Y16D 1M7XA 3HNVL 4LLUA 5D7JB 3CFJB 3ILPA 4X7SH 3RA7H 1T04A 2XV6B 2Y36H 2GQHA 3OAZH 3QIUC 1KXQE 3VJ6B 1KT2B 3MRJA 5JOPD 4KI5D 2XIDA 2DQIH 2P8LA 4MB4A 3D9AH 4LCIL 4HIXL 5GGQH 4LVNC 2YC1A 2FJHB 4Y88A 3U7WL 3NIGE 3GSNH 2QQLL 3L3IA 5CJQH 4RBPK 2D0HA 1RZFH 2VQ1A 4HIIB 2X44D 3WYRA 2WP3T 3UDWA 1L4IA 5JW4N 1MIEL 5CBEA 4LPCA 4RFNB 1VESA 5KSVB 4OJFH 5AYUL 1FPTL 3KXFE 4OCLC 1DE4B 1S3KH 5CWSA 4LPUA 3O4LB 5EOQH 4LASL 4P2QB 2DQDH 4XB8A 1J0IA 3RI5F 3P0GB 3FZUD 4JO3L 3DSFH 1UVQB 1RJCA 3HR5A 1T03H 4FTVB 4YDJB 1BAFH 4CU7A 1C5CH 1G7PB 3TNNB 4TVPL 4TSCH 5GGRA 1N59A 5JLZA 4AENA 4G8GA 4BSVB 4PRDA 3FQRB 1HQ4A 5I71B 4KVCH 4DVBB 3AREB 4UOJA 4WTWA 4KXZH 4JQIL 1PKQB 5ELIA 4EN3A 1QA9B 4NQUA 1URLA 4J6RL 4OCMC 4H88L 4NNPL 2XWBB 4W70A 1G7MB 4FP8H 3DMMA 3QUMB 1CDHA 3MGTA 3OJDA 1XH3B 1KEMH 1TZGH 1IGIL 4GRMA 1FVDA 1UB6A 4UBDC 2DRUA 2X7LA 3FO9A 5ISZB 5EBMB 4MD0B 2QADC 1ZT1B 4X6BB 5HYSA 3P4NA 1EO7A 5E5MA 1A7NL 2FX9L 4LLMB 3KPNB 4LCUB 3VD3A 1RJYA 3K8MA 3I9GL 4HD9A 4DK6A 4DK3A 1FRGH 2V9RA 4ALAL 1U6AH 3TPUB 3PF2A 5DK2B 5L8LB 4FQHB 5IVXF 5BRZD 4U1GB 2P8MA 4OZFG 1NFDE 5SX4H 1Y0LB 1EIBA 3TBYB 1N8ZA 1UCBL 2NY4C 2YEZA 3T0EB 5DEFB 5TDPB 5ABDE 1JMZA 3MGOA 1NMAH 1N0LA 4OCNC 3RUGA 2Z91B 2W0LA 4G9FB 5B3JE 1IE5A 4B5EA 4RFEA 3TO4B 5I2IB 2DQCH 2APFA 5L7XL 2Q6WA 3LQZA 4YFDB 1F6AA 2VZTA 3VXPB 4PS4H 1MHEA 4WDIA 5FYKL 1KTLA 3SDXF 4GKOA 4LSSL 5IW6A 1BPVA 3C8KB 1R5VB 2J6EL 4OLWL 5DFWH 5CGYD 5C0AB 1UXWA 2ZCLL 4XVSL 3BD5A 4JPWH 5F44A 1UJ3A 2D3VA 4MA1B 1ZWIA 1GJIA 2YN3A 3RKPA 4UQ2B 5BCAA 3BZDA 4LSPL 3LAFA 3SKNA 1QSEB 3S6CA 4LCWA 5HVHB 5ID0A 2ZOKB 3VG0L 4DUXA 1LDSA 4NQEB 5F89A 2BNUA 2EDJA 3OXSA 2GY7B 5IW1B 4Z7UE 2V2WB 1N6UA 4XB7A 1D5BA 1CFNA 5KVGL 4HUXA 2VAAB 4KPHL 2PTVA 3M07A 2V17H 1NGYB 3MRDA 1WFTA 1LHZA 2X41A 3RJDA 1QSVA 2FATH 3MV8E 5I8OH 1I85A 3V95A 1FYTD 1V3KA 1GH7A 1A9BB 3RZCA 4NRXB 1LO0H 3PWVA 3Q0HA 3AROA 3ZYJA 2FEDC 3C2SA 4ZAKA 3GHBH 5JOPE 4KI5E 4YHLH 2C1PB 1U3ZA 3SPVB 3STBA 1H0DA 3VFWB 1KYOK 4K2UH 3TYGH 3AU1B 4JB9H 3O4OB 5GS2D 3KXFA 3HG1D 1OTSD 1UZ6E 3P9MB 1QPPA 5I6XC 2EDKA 4L8DA 3AC0A 4HX1B 5I9QB 3R8QA 2XKSA 1FCCA 5LGJB 1QKZH 3JV0A 5DI8A 1N6QL 5ACZB 4HT1H 1T83A 5DUBA 4FQXC 4WU7B 5KBNC 5L9DH 4G80B 2XZQL 3DX7B 3FCTB 3PWPB 4FMKA 3RZWA 1F45A 3QG7L 4RMWA 3OAZK 5CIPB 2WSKA 3B4NA 4JO1L 4N9GB 3PDOB 1L9NA 1YEHH 2VB5A 3MRPB 3FQNB 3GNMH 1RZ8B 3MLZL 3L95A 4OQTH 5D1QB 3EW3B 3I6GA 3FFDA 3HNVH 5HHVL 1DQML 1G6RL 3ZDXF 3RWIB 3ARGC 2NPLX 5E8PB 3V9FA 2Y4SA 3O3AB 2G2RA 1DL7L 1BVLB 4UZGA 5L2JA 1UB5A 5MEOA 4GUPA 4IRZH 1ZA6B 5I1EH 4WI2A 5KVMC 15C8L 3UPRB 4DQOL 3NFPB 4LCIH 3S9DB 2IC2A 5T1MA 3UBXG 4PGJA 3FT3B 4HZLA 3DVNB 4QCIA 3VFRB 3U7WH 2VIRB 3MRCA 2QQLH 2BFVL 4YC2B 2NXYD 5DMKA 4QRSA 1TQBB 2XN9B 4R2GC 3SE8L 3RIAF 5HYJB 2CIIB 1FP5A 1MIEH 4N5EC 5IG7B 1U42A 3OKNB 3U4AA 3WXVL 1NFDA 1F3RB 5AYUH 1PEZA 1S78C 5EZOL 5D2NC 1C5BL 5LJYH 2APVA 4LASH 2XKUA 4CN1A 4FNLH 4XPHH 5BRZE 2EIBA 5FB8B 4JO3H 4ORGB 1EJ6A 2EYRA 4X6EA 3QJHB 1T2QH 1ACZA 4JZJB 3NCBB 5B8CB 1GGIH 3BIKB 2IH3B 3O8XD 1DDHB 4H8WC 2FO1A 4X6CE 5CSGA 1G0XA 2VZ1A 4U6HB 5F7LB 3WXWL 5CUSL 2XXMB 1JV5A 4R96B 4LLYB 5D1XB 4JQIH 4MMZC 3KPMA 4OQ1A 3QR2A 1Y18A 3JTSA 4J6RH 3T3ME 4NNPH 2BVPA 1S7UA 3V7AG 4F7TB 1BP3B 4XNYL 4HS3A 5K33A 4I0PB 1IT9L 1R3LB 4DGVL 3VD7A 3D25B 1IGIH 4AM0B 1UXSB 4JFFB 3RY4A 5DDHB 3KYNA 3SDYL 3F7PC 4UV7L 1N3NA 4HWZA 3MV7B 4RGND 4Z7UA 1ZT7A 4P2CG 3BI9X 1H15B 1A7NH 2CJUL 2FX9H 3VE0A 4XPTL 2M1KA 5J7CC 4N0YL 3ZHDA 1WF5A 3GO1L 1IAOA 2IAMD 4ALAH 3I02A 1CN4A 2YN5A 3K0WA 4OZIB 2YUVA 1ZANL 5DA0B 3V5HB 3GUTA 3MV8A 4N9OB 1J9CT 3FQUB 4E0RA 4PGDA 1N0XL 2EH8L 4PJFB 2EDDA 4K8RC 2CUIA 1CE1L 1LGVA 3OX8A 5JOFB 1ZLUK 4MCYB 4GRWF 3MJGX 2IH1A 4ENEC 1UCBH 3GMOA 5E9DD 1FDLL 5F7UA 3BEWA 2R69H 4HK0A 3QHTC 4L8SC 1FYTE 1VFBB 3GIVB 1I1AB 1JCKA 1V7NL 4PG2A 3RHWK 1QBLL 3RJQB 1QSFE 2VR9A 2V5YA 3VFGL 4M1DH 4WWKA 1KPVB 4QXTB 3ARQA 1SBBA 3OXRA 3JV5A 4J3XA 3W9EA 3QUXD 3ESUF 1KNOA 4HIEB 1AHWC 4O2CA 2OL3B 4PRHB 4YHPA 4JFED 4KROD 1UT9A 3HG1E 2ZCLH 4XVSH 1P7QD 1QBML 5F7MC 2P5EB 4IMKA 3DOSA 4CAGA 2KL6A 3NFNA 2VUYA 2XQBL 4KMQA 5EOCL 5DO2C 3MUGA 4OIAA 4G5ZL 4LSPH 1U0QA 3OPZH 2VC2L 5D93C 4FQLL 3HRZB 2AEQL 3VG0H 4OZHB 3AAZB 3QUMH 4RX4A 1X6NA 1XEDA 2KZ1B 5I75B 1OOAA 2X4NA 3EGSB 1NBZA 1N5AA 3JWDC 3O6FD 4KPHH 3MRLB 3RWJB 3N1PC 2WINA 3ZKNC 1CXFA 2X89D 3C60C 1PFCA 4U6YB 1T3FB 4JFPA 4I48A 4LHUB 3SKUD 1BOGB 4QXGH 5AYQA 3OR6A 1CLYL 2YHGA 2VYRE 1SM3L 4NFCA 5DFVD 2MOVA 5DQJB 2VISB 2X05A 4UINL 3KAAA 4WCYL 3NAAL 4K3JL 1TFHA 3I3EA 3MXWL 1AJ7L 3TLRA 5HHPB 2VDKL 3BO8A 1HQRB 3FONB 4NHCL 1E4XL 5BRZA 2B39A 1U92B 1YEDB 4OSUL 2V2TB 4ZFZB 5I66B 3ECBB 3NFSL 4AIZA 3JZ7A 4NN5B 3S5LB 1A3LL 3I75B 1BEYL 3DX9B 2XZQH 5ERWA 3DRQA 4E5XA 1XGPB 5GJTH 2IG2L 2DS4A 4QWWD 3AB0B 3U36B 4HKZB 5I1KL 1P84J 2DLHA 3OKDB 2HTLC 4PJHF 3H9ZA 3ULUC 1GHFH 4PGEB 3AS0A 1FYHB 4HUNB 4PGBA 5HHVH 1DQMH 3PWJA 2CRYA 3TBVB 5IB5A 4E42A 3D18B 5ADPH 2IFFL 2QV2A 1EHLL 4HUUB 5ITBH 2R2HA 5KANG 3LS5L 2B4CH 4TVPD 4DQOH 2FSEB 4EI6A 3V6OC 3L3JA 1R3HA 1LMKA 4YDIL 2NYYC 5IV2A 3TCLB 2FJGB 3NCYS 4RGNE 3SE8H 4PG9A 4HJGB 4U1KA 1CT8A 2RB8A 5EZOH 2DOCA 2YZ8A 3D3VA 3AS2A 1J86A 2H8PB 1IM9D 1U8OB 4GMSL 2FECL 1CU4L 5F3HA 4M1CC 4HZAA 2EXWC 2YUZA 2ZJSL 1T2XA 3WNNA 3VWJC 1ADQL 4ZUUB 1QSFA 3TZVD 1OL0A 3QAZC 4PY7B 4XTRC 5E9DE 4HG4J 4KUZL 4HUVB 6FABL 5SX5H 5CGMA 4ETQB 2NW2A 3HAEB 1U8NB 3SE9L 4BH7A 3MCKA 3GRWH 5B38A 3UMTA 1NLBL 1P2CA 4FQPA 4P4KA 2NY6B 4UNUA 4XNYH 3C6SA 3VWKC 5KSAC 4KRPB 4AL8H 4D8PB 5E6ZA 2MCG1 4DGVH 3LB6C 2OZ4A 5LQBH 2HA1A 1EERB 1A64A 3VXRE 3EJZD 4NP4L 4OZ4B 1RU9L 5HY9A 1Q0XL 1LNUB 1FFNB 3OSKA 2CJUH 4OAWB 1NCTA 2EZ0D 4XPTH 5CZXD 2P5WB 1CFSB 1M7DB 5EU6D 5K9KB 2VUOA 3BUTA 5FYKD 2FL5B 4PJ8C 3CFKB 4I18A 3CIQA 5B39A 3KPQB 1IEHA 4UT9L 5EG6C 3DGGB 5GSRA 1FN4B 2EH8H 1F4XL 4YGVA 2BK8A 5LXGL 2GK0B 1CE1H 4GBXD 4I5BB 5HI3D 3VXMD 1C7SA 2AKRA 1DLHB 5ESVA 4WGWB 3RKDD 5E2UL 3CVHL 1FDLH 4LMQI 3L9RA 3SN6N 5I15H 1E0OB 4LF3B 4QO1A 3VD9A 2HLFD 1V7NH 3LEXB 4QHLA 4ZUWA 2I60L 5IBTL 3EZJB 3IU3B 4KRNA 4YHNA 3PHQB 2DQTL 1MNUH 1HNGA 5CJBA 4D9RE 2Y72A 3CNKA 1KPUB 4Y2DC 3U2SA 2K1MA 3B6SA 3U1SL 3OAUH 4L8CA 2XG4A 3QXAA 4KDTC 3S96A 3KYOA 3MUHL 1QBMH 3VMPA 2PW1A 3NPSB 5EOCH 1S5HA 2DQFA 4WFFD 2VC2H 5KSUA 4FQLH 5JW5B 5DJXA 3DV6A 3O8XA 5T5FL 4GG8B 4PRNA 5D6CB 4KGJA 1EMTL 1F3JA 5E8OB 1HWHB 4HCRH 3FAXA 1A8JH 1TVDA 2ZCHL 1IGJB 3HR6A 5HHMB 5E94A 5C9KA 1KCSL 2NXZB 1M71A 3PDGA 1K5NA 3MOQA 3L3GA 2NLJA 4HLJA 1G7JA 2GHWB 1C12B 2X09A 3EFFB 3P9LB 1K8IB 3QIBD 1U8HB 5E24E 3M8OL 2YD5A 3BSZL 4M9PA 4ZS7L 1WICA 5KAQF 1SM3H 4LOUC 1BHGA 4UIKL 3BKML 3WS6A 2F5BL 1ZSDB 1ED3B 3RVUC 4UINH 3VRJB 2VJXA 3LKOB 4TVPE 1W0YT 3NAAH 4K3JH 3P40A 4HH8A 1GZPA 2YRZA 3MXWH 1AJ7H 2JK5B 1X4XA 2IAMA 1QEWB 3BHBB 3RWHA 1XGUA 4O51B 1E4XH 5C09D 5HPMA 4G6AD 4OFVA 2C1OA 4OSUH 4Y4FC 3C8DA 4NT6A 4YAQA 3KNBB 3AGVA 3NFSH 1T20A 4P23D 4QKXB 3IJYB 2PXYC 1KCUL 2EKSB 1BEYH 3P4OA 4NO5A 2PYEB 5I71C 5MI0B 4Z7NE 1H5BC 6CGTA 1XFPA 3QULA 2G75B 1QFWI 4IRSB 1FV1A 5I1KH 5A2LH 2Y06L 1AQDB 4NOBA 1IAKA 4WJ5A 4LQFL 1FZJB 1R3KA 2ADGB 3IETB 2EDRA 3Q6FA 4LVHC 2OI9C 2VLJD 4OKVA 2CR6A 3QUKB 3MRMA 3VXRA 3E3QE 1FFOA 1SYVB 1YY8B 1ZHLA 2IFFH 1MIML 1MCRA 1EHLH 4O02H 2M8XA 4BK5A 3LS5H 1AH1A 4HKBA 1XIWD 2Z8VC 1S5IL 1FFPA 5JW4Q 4YDIH 4U1HB 1L0XA 3G5XA 3TN0C 3M17A 2DM2A 5SWZB 5E70A 5MENE 4F8QA 5EDXA 4C56A 1D9KC 5A3ID 5CEXA 2DI7A 4NHUA 4TNVK 2VNCA 2XPGB 4PP2B 4JZOB 2D2OA 1WWAX 4MD4B 3FQWB 4S2SB 5AZEL 2PCPA 1KCRL 5EU6E 2DM4A 3QWRA 2RFXA 5FYKE 4L3CB 1MCWM 5SX5K 3T0EC 1Z2KA 4GMSH 1JNHB 4WW2C 1CU4H 2X10A 1MAJA 4I3GA 3V7AE 4RWHA 3FO0L 2NW3B 2PO6D 3E8UL 4PTUA 4H26A 1WUNT 1ES0A 1BX2A 3MRHB 4FXGB 3TEUA 4U0RC 3VXME 2Z31C 1N4XL 1TPXC 4XPFL 2CDFA 4H8WL 2WBJA 4TOYL 3RVTD 3BH8A 1MJJB 2DQGL 4RDQF 5K59F 3ARYA 3K81A 4HGKC 4O4YH 3MR9A 3SE9H 1HHJB 3LD8B 1N2RA 3ZDZE 3QA3A 1MAML 3RPIB 3C6LC 5FECB 2ERJB 3W9DB 1PQZB 3EBAA 4YO0B 5FO7A 1JPTH 3ARBA 3A0OA 1CVRA 1S9VA 1T7VA 1I8MA 3L3DB 2B8OT 2OSLB 3QEUA 4HXBH 5EBGA 3RY6C 1JZ6A 5I1DA 5JXAH 5FYKU 1Q0XH 5ENWA 1KG0A 4BZ1L 1LVEA 2BSRB 1NJ9B 2BC4B 3MYZA 4WFFE 4Z8FL 2Z35A 5F9WB 1FZMB 4BFIB 4QHNA 1JPSL 3ARFA 2HAZA 1RPQA 2V2XA 2Z4QB 5KVEH 4F57L 1UH2A 1IGML 1F4XH 4K8RL 4OF7A 3TBWA 5KSBA 3TH2T 2YZ1A 2CMRL 1QR1A 5DMYA 1OTUD 3ZT5A 4ZUTA 3T2QA 2ZG3A 3CVHH 3L5IA 4Y5VC 3X12A 4NPYB 4P9HC 4AY0A 5H2BA 5E99H 2WWKO 3QUZC 2F53A 2DQTH 3IKCA 3ZE0E 4JM2A 5HGBA 3GKZA 2JJSC 3U1SH 5F9JA 1F4WL 2FBOJ 5DJYA 2HFFA 3CZFA 3A6BH 3KLAB 4H25A 3TV3L 1WT5C 1JHKL 5DHVH 3VGDA 5C09E 5GISL 3FOMB 4BQBA 4YGAB 4S1QL 4IOFD 4TUJA 4TRPL 1CDGA 3PDDA 4HJ0C 3TZVA 3UBXA 1A6ZA 2NNAB 1SQ2N 3CAFA 5D1ZA 5FA3B 5T5FH 4HPYL 3IFOB 1JGEA 2V9TA 3D85A 2AXFA 3P73A 1KIRB 2ZCHH 3JWDL 4JLRA 1ONQA 3C87A 3QEQB 1KCSH 4XT1C 4PGCB 5A16B 1NFIB 5IHBA 3QDMB 1P69B 4XNZB 2NY7L 1VACA 4X6CF 1IEBA 1BD2D 3TBSB 3U0TA 1ZA3B 4NM4L 2W0PA 4OF5A 3BPNB 3M8OH 2VLJE 2ORBL 4O9HL 3BSZH 4RZCA 2V7NB 1TQBC 4UIKH 3BKMH 2F5BH 4MVBC 1WVZA 5D5MB 5MENA 4LSRL 1N7ML 2B5IB 3T8XB 4I0CC 3MO1A 4X6DB 4AEEA 4K3EL 4YDLC 5DK0A 4P0DA 3IFPB 5EU6A 2O5XL 3QT2A 3VFNA 1WZ1L 1MFBL 3RWFA 1D7FA 4ELME 5DHXB 2J6EA 3PQYB 4NBYB 4DTGL 3MBEB 4GXUM 3QIUD 1MFEH 5TFSL 1U8MA 3H7LA 4UQ3B 2MPAL 1U3JA 4GBXA 1U8LA 1GOHA 3Q2CA 3VXMA 4OZGE 1K4CB 5E6IC 2QQNL 3F12A 2CDGA 1GGTA 3V79C 2Z92A 4KC3B 5DJCA 4U49A 2CGRL 4FQ2L 3VI3F 4XC1L 3H7BB 1OTTC 1BM3L 3BP7B 3DHJA 4Q6IC 3GSUB 2Y06H 4OCXH 4WO4A 3QQ3B 5F1IA 4BZ2L 2FHBA 3ULUL 4LQFH 3OGCA 4IMLB 4F7MA 1DSFL 4Y1AD 4OV6F 2FBJH 1U91A 1G9EA 5HGAA 1A1OA 5IP4A 3IVKA 4ZPVB 2Q7YB 2JCCB 1BREA 1LO3L 4G42A 2ZUXA 5FDWA 4BA8A 4Q0XH 1YMHB 4JEGB 4NC1E 1HI6B 3HPLB 3X11A 1MCBA 4E41D 1KEGH 3RGVC 4NDMB 4ZFFB 1ZS8A 4NNYB 3TWCL 2J88L 1KCRH 4LK4A 3L5XL 3U6RB 1RHHB 5SWSB 2AGJL 1F5WA 1LO5B 3C5ZC 2ZSVB 4ZXBA 4UBDD 1QD0A 2QADD 3FO0H 3E8UH 4X9GA 4UT7L 5CP7B 3ZTNL 2YBRB 1AY1L 1MQ8A 3O41A 4WU5A 3HMWH 3LH2L 2AJVL 5DJDA 4XPFH 4H8WH 1A9EA 1MF2L 4L9LA 5D96B 4W4OA 2C3GA 4DAGH 2DQGH 2IPTL 1B0GA 3DGCR 3HZVA 3HI6L 2J5LC 3FTGA 1YZZA 1JZ2A 1VPOH 2HJKA 3A67L 2I5YL 2OTPA 4MX7A 1G6RA 1BF2A 1MAMH 1TQCB 1HHHA 4GKSB 5C09A 4V1DB 3B9EA 2GSIB 3BJLA 1KB5L 2NY4D 5EZJB 3MNZB 5INDA 4J8RB 4LDOB 3DUSA 4LRIA 1NMCB 4P23A 5HHNB 2FWOB 4KI1A 3MUY1 2APWA 4Z8FH 2ITCB 2P7TA 2R2EA 5CGTA 4NQCE 4M5YH 1NBVH 5BJTA 2EYSB 3TIDA 5E1HB 1WWWX 4NUJA 4JG0H 2L0DA 4PJCB 1BBJB 3R8BB 3BXNB 3C2AH 3IDMB 4R7NB 1KJ2A 5IQ9B 1IGMH 4K8RH 1T0NA 3WO4C 4JFYB 2VLJA 3JWNC 4CDGC 3QPQC 3PABA 3P77A 4XAKD 2CMRH 2ZG1A 3BH9A 2APXA 2BOCB 1HKFA 3QXWA 4NZRL 2DIJA 3O45A 3ORJA 1YDPB 4HF5L 3BZFB 1FH5L 2E6PA 2JB6B 1ZT4A 2R1YA 1W72B 1XIWA 1I1FA 1C08A 5ESAA 1CFQB 3FOLA 5GRJL 4MNGB 5E4EB 4CGTA 4HKXA 1MJ7L 4BM7A 3IDYC 5FXCH 4OLXL 5JXEC 1VGEH 1S7RB 2X4SA 5BQ7A 1HHGB 3OBAA 1RUML 5A40E 4D0DB 1LEGB 4KK9C 2X70B 1F4WH 3PNWA 4QRRB 3OAYK 4OZGA 3TV3H 3MROB 1JHKH 3QUYB 3RX8A 5GISH 1NCNA 4P5KB 1XAUA 2FEDD 3KYKL 4S1QH 2PO6A 4NKDA 3AB0C 5M7QA 2AV7B 1LE5A 3LRSB 4O2FB 4K71C 1A22B 1YEEH 4LLQA 4QGYA 4QRQA 4GO6B 4L3AA 3H3PL 4CADB 4HPYH 4XBGB 3IRPX 3RHWF 1AFVL 1GSMA 3SKMA 4R0LA 3TBTB 1FNAA 1P1ZB 3G04B 1G7QB 5TGBA 4P59L 4F7CA 1A1MB 3CSYB 4PRAB 3KYMB 5BMFH 3MJ7A 4K94C 4JFXA 2NY7H 3W0WD 4GRLA 4LLDB 4NM4H 1X5LA 4FQXD 2Y5TA 4Y1AE 3RTQB 5ANMB 4A2LA 4ZSOA 3HC0A 43CAB 4CW1A 1N7MH 1A6TB 4APQB 2WZPD 5AD0B 1CE6A 1M05B 4JGUA 4MAYC 1YN6A 3L7FB 2Y07L 1JGLL 2QR0B 4YHZH 3S37H 4QTHA 3GIZH 5I1AB 1UWXH 3VFPA 4NO0D 1HXMA 4JVUA 4KK8C 5F3BB 1MFBH 3ARGD 2CDEB 5TQ2L 4P2OC 2QHRL 4YIQB 4AT6A 5JTWA 3ULVE 4RNRA 1S9YB 3ROLB 5MERB 2MPAH 3CZJA 5D2LF 3U7AA 2DL9A 4LSUL 4HMEA 1RK1A 3BP6B 3MRBA 1FHGA 4R2GD 4V2BA 5IJVA 4PJIE 4GMTL 1R6VA 3BW9A 4JANB 5FYLE 2YUWA 3UTSB 3RWDB 1EUTA 3DX8B 4BUGA 4N5ED 3O6KL 4XC1H 4U1MA 3AS3A 2OP4L 4ETYA 1EVUA 1P6FA 4D9LL 1DBBL 3QFDA 2I9TA 4WY7L 1DSFH 2EYTB 2G5BA 1TVHA 2GFBB 5KS9F 2NTFB 1TXKA 3PGDB 4L1HA 2FIRT 3VFUB 3D39B 1B9ZA 4H5SA 5I17A 2AEWA 2MHAB 2HT3C 3M1BA 1LO3H 1NFKA 3PIQB 4P4RB 5JHDD 5DVMA 1A4JA 3MPCA 3H9SD 3I85A 4NQCA 1S7XA 4RAVA 4WUUB 1TTUA 1JRHH 4HV8A 1OPGL 5MEPB 3MACL 3VXNA 3LV3A 4RGMC 2OTWB 3KS0H 2X4PA 3OG4B 1I9IH 4FFYL 1MFDH 4M6AA 4QXWA 2XTLA 4YHML 2IBGA 2NQCA 5J06A 2CH8A 1NCDH 3B9DA 4PLOB 4L3ED 2O5YL 3L5XH 3B83A 1BBDL 1RUAL 5DMJB 2AGJH 1I1RA 4URTB 3BAEH 4OCSH 2F54B 3E1F1 1EFXB 2BP3A 4QHMB 2A2QT 2BY2A 1FZOA 4GKNB 3ARDB 3BE1L 4UT7H 4LPVA 5DD1H 5EBLB 3ZTNH 1AY1H 1WBXA 4LEXL 5C0EA 8FABA 1S7QA 1AGBA 3LH2H 4NQSA 2AJVH 1KLGA 1MF2H 4CRPA 3U82B 1PY9A 2IPTH 3QI9A 4KMLB 3QPXL 2YPVL 4EVNB 3GMPA 2AI0L 3IDUA 4CVUA 4K8RD 3LEVL 3BVNA 1Z9OA 4ODBD 1H3PL 5ALCL 3EYVA 3S4SA 1UFUA 4D0CB 3QIUA 3WCYA 4ENED 1KB5H 2A6IB 4LSTH 5AEAA 3MMEA 32C2A 5CSZA 3MXVL 4S1RL 4PJGA 3GKWL 2BXZA 5IROC 1MHCB 5CJ5A 4XCEB 1CICC 1MEXL 3ALWA 3LOWA 4XCCH 2VDPH 1ERNA 3MA7A 4C57C 2NX5D 2UWEE 4C83A 1WBZA 4XCFH 4QRTB 1VDGA 4LLVA 4CNIB 2A73B 3U4EA 3WLBA 3GMLA 3U9UA 3EDDA 5EC2A 4JPIA 1OSZB 1TVBB 4H1LA 4Z7VB 2RCSL 4Y1AA 1FL5A 5GS1C 4G7VL 1FO0A 5DO2D 1A14L 3V4UL 3IDNA 3W0WE 1YMMB 4HF5H 1FH5H 4Y4KB 1MJUL 4P9HL 3FAWA 2X1QA 4HHAB 1QLFB 4CVXB 5GRJH 5FO9A 4DZBB 4KK6C 2BOBA 3QHFH 1ORQB 1BECA 5DLML 5DC9B 5J3HC 5L6YH 4ZOCA 1WCBB 3QJFB 1DEEA 5DZOA 3ZKND 1RURL 5C6TL 3C60D 3MSPA 1RUMH 3TJEL 4OKDA 3EO0B 2E7BA 4YDKH 1B4JL 3DO3A 5DQDH 2MNUA 4YDVB 4JVWA 1IBGL 4MQ7B 1B2WL 4PJ9C 5ESQA 4A6YH 2P48B 5T1LA 4IRSC 4CU8A 4PJIA 2IBZY 1J05B 2VERN 4M02A 5C2BL 4WI5A 4YHOL 2R8SL 1KTKE 1HZHH 3H3PH 4FFVC 3WSQL 3L3OA 3JWOC 2CKBA 3FHAA 3KYAA 3RX7A 4CVZB 4UTAL 3UYPA 1AXSB 4HIJB 4P59H 3WD5H 2HT2C 3AVEA 1WIUA 2QJDA 2ZCKH 3DIFA 3IXTA 4DZ8A 1NC2B 4XPGL 2XG5A 1KACB 4IDJL 4YHYC 3R4DA 4MJID 4TUOA 2WMPA 3HC3L 4ZQKA 1Z5LB 1UWXK 1HILB 1M7IB 3LPWA 1LO2H 4BQ6A 4ZUVB 4ZUSB 1KC5H 4HKJB 5FKAA 5IT2L 1YNTA 4NQDD 4P2RB 1KJMB 1AXIB 4X5XB 1SMOA 5JHDE 1F11B 3R06A 3NZ8A 4Y4HA 2HTLD 4KY1L 2Y07H 1JGLH 1P5VA 3ULUD 1A1NB 2EE6A 5MEQA 3CVIH 2EO1A 4LVEA 4NQVA 4M43L 2VO5A 3QH3B 4MXVE 1W72H 1MLCA 1FFQA 2VABB 3I84A 5EBWA 1Q0YL 3MRKB 4NC2B 5DRXB 4LFHG 5GSVB 4L3EE 5J8OA 1XR9B 3KDMA 1D6EA 5T1DH 2YRPA 3G6JA 1MSPA 3HCVB 1AD9B 1EZVY 2NYYD 1BZ9B 2FD6L 4PJAF 5C0RL 1BZQK 2R2BA 5IVXB 1RZIB 3GMQA 4ELKB 1CD9B 2NY2C 1AGCA 2HG5B 3MREB 2HT4C 5IEHB 3DMMC 2OP4H 1DBBH 4X5WA 5F6IC 3UTTE 2R1WB 4WY7H 2ZNXA 2H32H 3RNQA 5TE6H 4M62L 1A7RL 3Q6GL 5I0ZA 4M1CD 2EC9U 5DVLA 2EXWD 3BPOC 2CLRA 3VWJD 3QFJB 5CILL 5D72L 1FZKB 4MJ6B 4EUPG 5JUEH 2OQJB 3O81A 4XTRD 5EIIA 3HFML 1IKFH 5AAMA 1OPGH 1YN7B 4LCCA 3SDXB 7FABH 4I3RL 1I9EA 4YHMH 1Q9WA 2IPKA 2IBBA 4OT1L 4FZ8H 2FNBA 2Y7QA 3TCXA 2VWEE 4JRXD 5CKGA 2AK4E 3VWKD 1IQDA 5KSAD 1R24B 3LB6D 3SJVE 1BBDH 1RUAH 3VXQA 3MODL 2Q3AA 1H3WM 2DKMA 5HVFB 4FG6C 1IKNA 1HDMB 1KBGL 1MVFA 3WFCH 3U0WL 2VN7A 3BE1H 3DVGA 3V0WL 1KN2L 4LEXH 2EDTA 1Q1JL 3QQ9C 1LILA 4AZ8A 5DT1L 1P7KB 4C55A 4LGSB 2YD6A 1KFAL 4G43B 3SOBL 4NZTL 1HHKA 5C0FB 4PJ8D 3QPXH 2XRAL 2J3SA 4JKLA 4MA7L 2AI0H 3H0TB 3ARXA 4OM0L 4TNVF 3LEVH 4XNMA 1UJ3C 5ICYB 1FVCB 1NGZA 3F7YA 2ICES 4PJEF 5LAXA 1NDGB 1ITBB 1IGTB 4KJYA 4PRIA 4DN4L 2IFGA 5D7SL 1CXHA 5H35B 5SV4A 4PJ7A 4N90D 2DM3A 4WTXA 1U41A 1JN6B 2PYFA 1PVHA 5I16B 1J10A 1BIHA 4ELMF 4DW2H 1MEXH 1JTOA 3FMGH 4EUPH 5C92A 3GSOA 3OKMB 3DHMA 1J0JA 4XNZC 2F15A 2KH2B 1AGEB 1YC7A 5CHNA 2CLVA 3FN9A 1S8DB 4Y2DD 3VXUE 4XXDA 1TITA 3QNXA 4EDXB 2EH7H 1I85C 2RCSH 5IEKB 2D03L 1Q94B 3RZCC 5BS0B 5HJ3B 1FL3B 4PLJC 4WEMB 5MHSD 5EU5A 2EE3A 1A14H 3V4UH 2B5IC 2XICA 5ECJE 3QG6A 5GGRY 1OAKL 3FB7A 4MJIE 4XX1E 5IESL 1TMCB 3HMXL 3K4ZA 2GITA 3AXLB 5JHDA 1MJUH 4P9HH 3DXAD 4B41A 1WZLA 1R5WA 1MI5D 1T6WA 4XCNA 3NPZB 5L8JB 1ND0A 1BQHA 4WW1B 2DJ4A 4R4FL 3WFHB 5EU7C 4GSDL 2BNRD 2X1PA 4L4TB 1KTRL 5CEYB 1IZJA 2QKIA 4HS8L 2W9LA 4M7KL 4QYOA 5CBAB 1A2YA 3O2DA 3ULUE 3TJEH 1J8HD 4HBCH 1T66C 1EXUB 1T83C 1B4JH 3DUUB 1HH6B 3QWOB 1M6OB 5DUML 5CJOL 3WUWA 4CN4A 1B2WH 4LOUD 3EOAB 2R1XA 3RVUD 4GW5A 1P4IL 2B0SL 3GHEL 2DYPD 2Q86B 3MJ8B 2ED9A 1SVZA 2YD3A 1JF5A 4X4ZA 3STZB 4K3DL 3V6OE 3WHE1 5C7XH 2R8SH 3HUJA 4AQ1B 3PL6C 4F15C 3WDIA 2G60L 2D9QB 3UTTA 4ZYKA 3BWAA 5C08E 2AABL 5HHQB 3KPRB 3BT2L 1TLKA 4XPGH 2VSCA 4IDJH 2QQKL 4K94L 4Y4FD 2X4RA 1QFWL 3VFMB 4X5LA 2PXYD 3LKSB 3V5KB 1UWEL 3LY6A 5GRWA 3FRPG 4JO4H 5J6HA 4GAYA 1G9MH 5GGTL 5IT2H 4RA3A 4Y8AA 5HYQA 2EICA 3O9WB 1KPRA 2YXMA 4KY1H 2AK4A 4IJ3B 4W81A 3SJVA 1R3JA 1J12A 2HLAB 5CMAA 3REWA 3RWCA 5C0CB 5ID1B 4Q9RL 2X4OB 4HGWA 4HS6B 5DJ0A 4MZ2A 1U58B 3EJYC 3U30C 1AGDA 1JNNL 1NC4A 3BD3A 4EI5C 4HIHA 3C09C 3GBLA 3IFLL 1Y6NR 5D96C 1BFTA 1K8DA 1P6AB 4Z7WE 3TN0D 4WIQA 3ZMRA 1NLDH 1CGSL 4ZFOA 3E6HB 5FM8A 1D9KD 5A2KH 3P11H 4RGOL 3W82A 2HJFA 3TVMB 4HLZG 3UPCA 1ZGLB 1TQCC 4GRWB 1IVLA 2VMFA 1J87A 3AS1A 3UJJH 2CLZA 4HH9A 5DRNA 2VH5L 3T0ED 4JQXC 3C60A 1NEUA 5DQ9B 4M62H 1NMCC 3MLUL 3Q6GH 4S1SL 4DN3L 1T1XA 4O5LH 2J7LA 3PWNB 4G9FD 5HGHA 4KZDL 2AEPL 4KV5E 4QHKJ 5DTFA 4JM4H 5CILH 2NY0B 2Z31D 2MTPA 1E27B 4JN2B 5IIEA 4FABH 4Y5YB 1DBJL 3FB8A 3HFMH 4W6WB 5F1KC 4N90E 1F4HA 3IDIA 4OZHF 1I7ZB 3VXUA 3FFCB 1JGUL 3RVVC 3MRQB 4ZG1A 3HE7B 3C6LD 5EO1A 4JR9L 1NBQA 3KPSB 4DWHA 1KENL 3OKKB 3S88H 2NY3C 3IS0X