2WZPD

Structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
b'VQLQESGGGLVQAGGSLRLSCTASRRTGSNWCMGWFRQLAGKEPELVVALNFDYDMTYYADSVKGRFTVSRDSGKNTVYLQMNSLKPEDTAIYYCAARSGGFSSNRELYDGWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE RECEPTOR BINDING PROTEIN
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 30
structure length 122
sequence length 122
chains with identical sequence E, F, J, K, L
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wzpD00
1T5WA 4P2OB 3LQZA 5B8CB 3ZLQC 1KIPB 3F12B 5C0FB 3TN0B 2X4NA 5FYKH 1H3GA 4JDVB 2HYMA 4HIXL 4F3FB 3S88L 4UOJA 3FTGB 3VXUE 2ITDB 3GMPB 4X9HA 2R0WH 2Z31D 4QF1A 3P4OA 1K4CB 4KMLB 5ADOL 5IFHH 2WAHA 4EOWL 5GJTH 1N5AB 3O3BA 4IRJA 1NGPH 2HT2C 4MJ5B 4I18A 1FVEB 3IJSB 3U82B 5HHXL 5IP4A 2FGZA 4AYFA 1MCLA 2APXA 5HYJD 1XGUB 1NFDA 1MLCA 43C9B 3NIFE 4U6TA 4NQEB 4PGDA 3WHE1 3ZYZA 2DBLH 4HXBH 3RWDB 3FN0L 1FNFA 5J1AA 3CX2A 4WJ5A 3QULB 4OZGA 4XHQA 2PTUA 3IDGA 1YJDC 3SKMB 4BJLA 3H42H 1J1PL 5KZCD 1QFUL 3E2HC 5F6HI 3SPVA 3PXJA 4XXCA 1T03L 4PLNC 4B41A 5LQBH 4P9HL 1SY6H 3BP7A 1ZLWH 3NAAL 4KRNA 4LP4A 5KANI 2YR3A 3O6FA 3LMJL 3BUYA 4ORZC 1NL0L 2VXVL 3BH8A 3U4BL 1YQVL 5I76A 3FN9A 3DOSA 1U6AH 1IC5H 5FUCC 2VYRE 2G5BA 1GZPA 1MCPH 4JPVH 3A6BL 3TWCL 3IDNB 4NRYA 1M71B 4XRCA 4JN2B 5C9JB 4X6CB 3LKPB 3O9WA 5DDHA 5C0BE 3VFTA 2OTUA 1NCBH 3PIQB 2VAAB 3IAGC 4BQCA 4R3SB 1XF2B 1FBIH 5C2BH 2LVCA 4MXQD 1GGIL 1BFOA 1MVUB 3X3FH 1ZHBA 2AJXL 4EJ1C 4JY4A 1JMZA 2JB6B 5EA0L 3QIWA 1YDPA 2Y9RT 2FL5A 3H2WA 2CLZB 1ZWIB 4KAQH 1KELH 3BWAB 3W81A 1HWGB 1BVZA 1P84J 5C0NC 2X4OB 1QRNB 4FFVC 5IGXL 5CWSB 5BOZG 1TITA 5C0GA 2NXZB 5CJ8A 3OGOE 5E9DB 3TIDA 5DZOA 5E1AA 5DUBA 4IRSD 5FOBB 2GT9B 2Z8WC 3CVHB 4LLQB 5GSVA 5DJYA 2NY6D 4AENB 1QSVA 1CE1L 2VABB 3L95B 4U3HA 1J0JA 2Y36H 1A14H 3GBMH 3ALXA 3B43A 2PUQT 4MDIA 4Y1AE 3MRHB 4AG4L 5J12C 2YUVA 5FYLD 5EWIH 3P9LA 4PJ5E 4TTGA 3D3VD 4PLKD 5GS0C 1JBJA 3IFOB 5I1CL 2EC9U 5D7KD 5IKCB 3WMSA 3FONA 4PJHA 4MB5A 1H3WM 3IFNH 4JFEB 5DT1L 4KROD 1DVFD 1RZKC 3QDJD 1FVDB 1KPVA 1MFBL 5E8EA 3X13B 4PJGE 4NQUA 1OAQH 4Y16A 4F33B 4L3AA 4NO3A 2W60A 3EYQC 5I1IH 2HJFB 1OW0A 4HWNA 3IF1B 4OV5A 2P47B 1AE6L 3I6GA 5FEBA 2XZQL 3KPSA 1CZ8L 5JO5A 1F4XL 2ARJA 2EE6A 3OR7B 3BQUC 5DJ6B 3MYJB 1ES0A 3DX9B 1GRWA 1R5VA 3HAEH 1DANU 5E99L 3GSWB 3PGDA 1G7JA 5B4MD 1OB1A 4ZAKD 3NCYP 5HJ3B 4NQDB 4HIJA 3IRZA 3KLSA 2FZ3A 1A4KA 3EOTH 2EE9A 4G80A 4NQVA 3TNMB 5L2KB 3ARUA 3U1SL 2HVJB 1ZT4B 4HWZB 1G7PB 3DYOA 4E42B 3HNSH 5IMLB 4L1HA 5ISZD 3IAQA 3HC0A 5D96C 3E3QC 3QQ3A 3U7WL 4OUUA 4EEEA 1N5YH 1ERNA 4PJAE 4WY7H 5KSAC 1KYOJ 1WBYB 2ZSWB 1I8KA 1QKZH 5GGUB 1ZK9A 3O2WL 5HHQB 5E2WL 3P30L 3AUVA 3FOMB 4IS6B 4LARL 2BC4A 4PD4J 1QEWB 2WLZA 4OGXH 4JVPA 3MLTA 1OF2A 4JHWH 5HHPB 1H0DA 3MLPA 1T1ZA 5AAMA 4U1IB 2VL5A 5EU7E 4Y4KD 4ZTPL 5IB3B 4ZS7L 5A16B 3T3MF 5GZOD 5ANME 4UT9L 2XPGB 1I1AC 5F21B 5I16B 2HWZL 2UWEA 3QCUH 3T3ME 1EAJA 4HQQH 2JCCA 5EFIA 1F4YH 5BS0D 4G7VL 1KCRH 4K23L 1YMMD 2BJML 2Q7YA 4X7TA 1CLCA 3NCCB 1OAXL 4RAVA 1RZFL 2P5EE 2R29H 4NQSB 1QO3A 2DM4A 4G6AD 4NQXB 4R7NB 4JFZL 1J5OH 3ILPB 2X70A 3BW9A 1UKTA 5CZXD 5HYEA 2W9EL 4IDJH 5FGBC 5D8JL 2GW5A 4P3DA 2DQEH 2QKIB 2DWDA 4DGYL 4YBQC 3C5ZC 4UNUA 1HHJA 1LO3L 4LCUB 4J3VA 5HHME 1U95B 4PJ9D 1N64L 1BQLL 2A9MH 2X5PA 1TZGH 3EHBC 4PJBA 5DJ0B 2V2XA 1Q0YL 3WSQL 3MA9H 3WN5A 4LSTL 5TE7H 3RY4A 5GJSL 2O5ZL 4HUWB 2NXYB 4M6NL 4MNQD 3GUTB 4GAYB 5DSCB 3MREA 3OAUL 4OCMC 4LNRB 2KH2B 3IJHA 4N0UE 1U0QA 4RGMC 5I19L 5C0IB 1PLGL 5J4MA 4XTRC 4Y4FC 4XVUC 5DGQA 3UJIH 5I71B 5FGSA 5D96B 2J3SA 4YBLB 3RWHB 2SEBB 5TDNA 4LGSB 5HI4D 5EN2A 3WUWG 3C60A 1CDHA 1F11B 2B1HH 4YBHA 2C1PB 5F1OB 5F9WC 1DN0B 1FAKT 5DWUH 3KS0H 2DQUH 3O4LB 2ZSVB 3PHQB 1HYSD 4FQQB 5T1KA 5I8OH 4LCIH 5IROA 3DIFA 5C09D 1NC2D 4WVRA 4HJJL 4LPYA 3JWOL 3ARYA 3MV01 5TFSH 1LNUB 4JJ5A 4XP9L 1CDIA 2Z31C 2D7NA 4XP5H 4LHJB 2BNQD 7FABH 3ZT6A 5DEFA 2Y5TA 1CG9A 4RAUB 1RUPL 4XWGL 1KFAH 2BNUB 3GJEB 4M7ZC 1T7YA 2LQRA 3NTCH 2IADB 3VFUB 2BSRB 1RJLA 3MPCA 1F4AA 5CGTA 1Y6NR 3VXPB 1I75A 1JGEB 3O3EB 1KT2A 4I77L 1JGUH 1NC4D 3V52L 3LD8C 5J13B 2F9BT 1RJYB 1J7VR 1K8IB 4TOYH 3WIHL 1Q1JL 4KDVA 4MA3A 3L5JA 3O3AA 5EPMA 4Z7OE 5T3XL 3BDXA 4YFLF 5DZLA 3P9MA 5J6HB 1RULL 2QSTA 1MH5A 4HWBH 5JOEA 1T80A 3FFCD 4EUPB 4D9QD 4YHNB 2AW2A 5D7LB 1RZ7L 5FB8A 4M6OH 5LKNA 2FO1A 1G7HB 3V0VA 1FLRH 4NC1E 3OZ9L 5EUKA 1G6RB 4OFYD 2A83B 1IZKA 2QSCL 3C5SB 4P2QE 3IDJB 4Y4FB 4MCYA 2F54A 1YC8A 4O2FB 1KIQB 4QNPE 3HC4H 1NAMB 1JJUA 2YUWA 5BQ7B 3V0AC 2VLMD 2E5EA 2AABL 4RMUA 4BZ1H 2R2EA 1NBVL 1I1YB 4MA8L 1W0WA 3NABH 1MWAL 3G5VB 5F9WB 8FABA 4MXQC 5FO8B 1BQUA 2VXTH 1UM4H 1ZVHA 3TA3B 5C8JA 4NSKA 2EIBA 4DN4H 4GMTH 3N1FC 5CCKH 5SX5H 2WWKT 4FQ2L 4DTGL 5JA8B 1NAKL 3PE9A 4TPRH 3MLZL 1AGFB 1FH5L 1SVZA 3WFZA 4GKSB 2I07B 3H9SE 1M7DA 3QPXH 5EZIH 2IBGA 3FQWA 2VDLL 2FBJL 3F5WB 4UV4H 2VQTA 4EI6B 2ICEA 2Z31B 1EVTC 1A47A 4PRBB 3S4SB 5JOPD 3P11H 2NTFA 5K9KB 2AV7B 4MAYA 4QXWA 3THML 4I0PA 4Y2DA 2R2BB 4IRSC 4JG1L 4WWKA 4M7ZB 3SE8H 3T0EE 4E0RB 3MLUH 5HYJB 4KZDH 2NY6C 3T0AA 1OGTA 4XMKH 5J8OA 4KJPD 1ZHNA 2GCYB 1NJ9A 1E6OL 3ZE2F 1MHPL 5EU6D 4OCYL 1P7QD 3FFDA 4QCIA 1KPUA 4JB9L 1PY4A 1T21B 5DJ8B 3ZE2E 1Z6JT 1OLZA 3M1BB 4PLKC 5KZCB 1MUJB 1GOGA 1MFEL 3MC0A 2HH0L 3PL6B 3C5JB 1CS6A 4NRXA 4HUUA 5FDWB 15C8H 5GRUH 4JCMA 4N0CD 4NUJA 1AC6A 2J4WL 3AS2A 4Z7UE 1BGXH 4KVCH 5C0RH 4G8FB 4KROC 4P3CL 4HUXA 3SDAD 1S9VA 4XBPA 3SN6N 1WAAF 3MBEA 1PY9A 2QHRH 3UPRB 2F8OA 3LSOA 4P99A 3MRNB 5F7EH 1GC1H 1NMAL 4FQLH 4DAGH 4DOHE 4JAMA 3T1FB 4KFZC 1I8LC 1F4WL 1D5XB 4UDTA 1PSKL 4XCYB 5MI0C 3EZJB 4F7MA 1ZE3C 5E6ZA 5IW1B 1M05B 1TJHH 4O2EA 3FRUB 4ODVL 2R69H 1U8OB 3O81A 4NT6A 5B4MC 2DQIL 3KPQB 4ZAKC 1G7LA 5FF6B 2AK1L 5D2NC 4KKAD 3SE4C 5LVEA 1ZLUK 4G7YH 2YD6A 1NBQA 4RDQG 3RPIA 5DLML 3ETBF 1BVLB 2R1WA 3PV6B 4XPGL 3H3KA 2MFNA 1TVBB 1I4FB 1KCVH 1OCWH 4JPWH 2XFXB 2X41A 1MHCB 1Q9KA 4J3OC 1J0KA 4JFPA 4XAWL 5E2TL 1FO0B 3VJ6A 1D9KD 2O5XL 1VFOA 4H20H 4RFNC 4PJ7F 1IQWL 5D1QD 1KNOB 5MEND 1AP2A 1ZLWK 1SEBA 1N6QL 5DQJA 2OL3B 3I75A 4XPHH 2R0ZH 3QEHB 4N0FB 3OB0H 5ALCL 4CJ1A 4Y4KC 2H1PH 3TO4D 5GISL 3U9UB 2J2ZA 3BH9B 1YPZA 5GZOC 4CVWA 3HE7B 5E7BA 5HVGB 4DQOH 1P69B 3CDYA 5LCVL 1Q94B 1LEGB 4ZOEA 1K2DA 1MCSA 2KQNA 5HTSA 2J6EH 5ICZA 5DO2D 2YKLH 3AGVA 3WO4C 1CD1B 2K7PA 3DUUB 4ZFFB 2W91A 3AS1A 3SJVE 3JWDL 2CO6B 4PS4H 1U91A 1VFMA 1HXMB 3QP3A 1CBVL 4G6AC 5SWZE 3RWHA 4AT6B 4R4BA 4JZJA 2JJTA 3QRGH 1NGWB 4QHKJ 1T22B 1YNTA 3H9HA 1OSPH 4KROB 4ODUA 1LO4H 3QDJB 4XBEL 5DR5H 2ZCLH 2PETA 5CZXC 3VXMA 5IR1A 4Z76A 2XI9A 4QRSA 5F9DC 1ZSDA 32C2A 3QZWA 3KR3H 4OCWL 4X0KA 5BRZB 3FQRA 5DHVA 4PJ9C 1WC7A 3CFJB 2EXYD 2IALB 1RIHH 4LEXL 5IVNA 2NX5B 1SJXA 1FFNA 3I85A 3RGHA 1Q9OB 4WDIB 3UO1L 3V95A 4LL9A 1D5MB 3MXVH 4UT7L 3GEWB 2BSED 3RX7A 1MRFL 4GRMA 1GZQB 2WLYA 4LSRL 1AC0A 5C0AE 1CGYA 5D2NB 4YGVB 4CU6A 2ZUXA 1MNUL 2XOTA 3VMPA 4UDUB 4WU5B 1DUYB 3L3HB 2K1MA 3DO3A 1KB5H 4HWBA 5ISZB 4YLQT 1QPXA 1T83C 5C07A 5JHLL 2X4QA 2AAVA 4DW2H 4L8CB 4JQIH 3QXAA 4JG0L 4EDWL 5HI4C 4JFDE 1TVDA 3WUZA 3R1GL 3ES6A 2F53E 2FIKA 4HCRH 4PJ8A 4RFOH 5F8QC 1PG7L 4I4WA 4WTWA 3SDXF 4NPYB 1ZVSB 4FQXB 1HYSC 1TVHB 1MI5B 3RNKB 3TT3L 1IGFH 3DGCR 1YJDH 2V5RA 4AL8L 3RX5A 3SDXE 1I1FA 4WRLA 1UZ8A 1CGWA 5IJKC 1BOGA 3RVTD 4ZG1A 5JHDB 4ZFOA 1U8NA 1AGBA 3MO1B 2HN7A 3KJ6H 1WWAX 5IV2B 4UIMB 5BS0B 2C3GA 2OI9C 4XZUB 2OZ4H 4X6FB 1RK0A 3WO4B 1LILA 1VGKB 1BVKB 1CQYA 4KGJA 3STZB 2F58H 3C6SA 3I3BA 5CBAB 1RZJL 4Q58C 1NEZA 1FHGA 3L7FA 3SGJA 1WBZA 4KZEL 5IB4A 1N59B 4U6HB 1Z0MA 2HVKB 2F5BH 4GG8B 2IAND 5TQ0L 3W0WA 1VPOL 4ZYKA 3KPRB 3U46A 2M2DA 1U58B 4HIEA 4U6YB 1KJVA 3CC5B 4NKOA 3R0MA 4NWTH 1NLBL 4PJDE 1NFDF 1XR8B 4PJ9B 3VE0B 4OF3A 5CJQH 4Z5RB 5HDLA 3EO0A 5JUEH 5JLZA 1NFDE 4UB0H 3VXSB 5FCUL 3T04D 4YXHH 3FO2A 5JQ6H 1R3KA 1CK0H 3LEXA 4HG4K 3HLAA 4Z78B 4WFGD 1VKXA 2A6DB 2DYPB 1AXIB 4NFDA 1II4E 3QJHB 5FGCE 2XQBL 4NKDA 4S0TD 2MPAH 4GOSA 4OZGE 4AMKL 1XGYH 5DYOB 3L9RA 1NKRA 1JZ6A 3BVNB 4K2UH 3GHEL 2OXGA 2X1OA 4GT7A 1CU4L 3MA7B 1FJ1A 3ZDXF 4G6JH 3EDEA 4C56D 4NKIH 5A3ID 1GPOH 2A6IB 3BEVA 3G5ZB 4WO4B 5T3ZL 5DGRA 1IT9L 3DV4B 1H3TA 4JFHD 2H41A 4ONGL 4P2OA 2AP2A 2A73B 3D39D 5B8CA 3HCVB 3F12A 5C0FA 3TN0A 5F96L 1XZ0B 5GS0H 4JDVA 4F3FA 5JIHA 1H3PL 5C09B 1UWGL 3FTGA 2YK1H 1A9EB 2ITDA 3B9KD 3GMPA 2GY5A 4JM2D 1K4CA 1OAKL 3W2DL 1RZKH 1T0NB 3KYOA 1N5AA 5JW4R 1TCMA 2PO6D 4LHUD 4MJ5A 2JK5B 1FVEA 3IJSA 4KJYB 2R2CA 1YYLH 4FZEL 1CE6B 3ULVF 1XGUA 1KCUL 1DDHB 5H2BB 2J5LB 1OP5H 43C9A 3SDCD 4QGYA 4ZFGH 4NQEA 3RWDA 3N9GL 3OJVC 4KJPC 2FNBA 1WUNT 1OAUL 4Y4HD 2GJ6D 3CVIH 1QSEB 2ICWJ 1W72L 3QULA 1TJGH 2VN7A 5C3TA 3RJQB 5C3LD 4M62H 3SKMA 1EHXA 2PYED 3MCKB 3W82A 1WIOA 2AJ3B 3F7YB 2V9TA 2W0KA 2FJFB 5I1EH 4UILL 5I6XB 4BSWB 5FCSH 1YEHL 3GRWH 4N0CC 4DCQB 3BGMB 1JI1A 5CP7B 4R90H 3H0TB 4Z7WA 4CMMB 1PKQB 3UROR 1YN6B 1IKFH 1AKJD 3SDAC 2O26U 3BWUC 5CSGA 3BO8B 2CRMA 2AVGA 3AXLB 3G9VA 3IDNA 2HFFB 1M71A 4JN2A 3QDHA 5C9JA 4X6CA 1NCDL 1PZ5B 3LKPA 5DS8B 1BLNB 3MV8D 5DQDL 4M00A 3HFMH 3CMOL 2VLKD 4PJHF 3PIQA 2VAAA 1S9WB 4QHKI 1JZ5A 2VKWA 3ARED 4R3SA 1XF2A 4Z0XB 4XC3L 2AEIT 3G6AB 4PJHE 4HFWA 5DD5L 4JFXB 2HKHH 2ZUSA 3EOBB 1MVUA 4KKAC 1L0QA 3HRZB 2GEEA 4NP4L 4PRIB 2VDML 5DJAB 1A6WL 1IM3B 5CGMA 2JB6A 5EH1A 4UTBH 4FABL 1U8MB 1FZMB 2CLZA 1ZWIA 2MQCA 3BWAA 4PP2B 3OTTA 3UYOD 3G9AB 2X4OA 1QRNA 5CWSA 2PNDA 4NN5C 5ERWA 1VESA 2ENYA 4NIKB 1D9KC 1P84K 2MKWA 1JE6A 1NDGB 5E9DA 5D1QC 2OX5A 4M9OA 5DD6B 3QEGH 5DJ2B 1I7UB 2RCSH 2BDNL 5FOBA 2GT9A 3QI9B 4MSWB 1IMHC 3T8XB 3CVHA 2CXKA 3CXHJ 4AENA 3MJ7B 4AM0A 2VABA 4J4PA 1WK0A 4Z95L 2EDQA 3O2DA 3TO4C 3L95A 4MYWB 5E94B 5HVWA 3VI3F 1BBJB 3MRHA 3UZQA 3VI3E 3DVFA 5DO2C 4PJIF 5ICXB 2J8OA 3QUXD 2B2XL 4PP1D 4Y0GA 4PG2C 4Y19D 1WCQA 3IFOA 2OR9L 4HS8L 5GS2D 1CYGA 3AVEA 5I75C 1BFTA 5IKCA 4NFCA 4X4MA 4P23D 3HMXH 4S1RH 5K9JH 3SGDI 3WDHA 5HHOD 1G9EA 1CR9L 1FVDA 4KI5E 5SX5K 3D9AL 4F33A 1C5CL 2DQFB 3FQXB 2UWEF 3NZ8B 4X9FA 2HJFA 2O61B 4JPKH 4F7PB 3IF1A 1BZQK 1HKLL 3VGHA 3UAJD 2JCCE 5E03A 2IBBA 5FM5O 1JHLH 3SY0B 3QDMA 4OB5L 4NZJA 2E7BA 3SGDH 3T2NL 3TBYB 1FC1A 1CWVA 2EXYC 3OR7A 1Q38A 3P73B 5A40E 5DJ6A 5DTFB 3MYJA 3DX9A 2AQ3A 2HKFL 3GSWA 4P9HC 5HJ3A 4NQDA 1H3UA 2JJWA 4ZS6D 2MQ0A 4AJ0A 5L2KA 3TNMA 4NZTL 2HVJA 4HWZA 1G7PA 4OM1L 1MOEA 3S36H 3QBTB 4E42A 5IMLA 3V6BR 2X1QA 1DLHB 1ZANH 4PJBF 2Y4SA 4YGAB 3PUCA 1MSPA 4ZXBB 3OF6A 4JKKA 3BDBA 2DD8H 5J1TC 2ZSWA 5J11C 1KYOK 5GGUA 1RZGB 1I7ZB 2DICA 4F15B 5HHQA 5KSVB 2WK2A 3S5LG 1EO8L 3FOMA 4IS6A 4EBQL 1QEWA 3WV0A 3VGGA 4RWYL 1C7TA 2EC9T 5D1QB 3RGVB 4HC1L 3RIFF 4PD4K 4YAQB 1OTUD 4U1IA 4PB0H 1MAML 4Z8FL 4GQ9H 2EIEA 4K3HA 5IB3A 3QCVH 5A16A 2AJZB 5MEQB 3TO4B 3FHQA 2KUTA 4JY6B 1PAMA 1UH2A 2XPGA 2QQNH 3RVTC 1J05B 3NCMA 5I16A 4GJTB 3BPNC 3TLRA 4NQCB 4Y88A 5FYJE 1P2CB 5J9PB 3G08B 1EFXD 1K4DB 1T2QH 2V5TA 3U0WH 4NQSA 1A6TB 1FGVL 2L0DA 2CGRH 2DLTA 4P9ML 5BV7B 4NQXA 4R7NA 4Y89A 5FUZH 3N06B 1DANT 3BJLA 4LQ1A 3ILPA 4LAQL 1NCAL 4UZGA 4OFVA 2RAMA 1SEQH 1D3CA 4NJAH 4NBYB 5E8DL 3OAZH 3NIDE 3AM8C 2QKIA 3WJJC 4LCUA 3BPOB 1U95A 1H8NA 3QNZB 3ARFB 5J57B 3EFDL 2FJHB 4OI8A 5DJ0A 4L4VB 5HYSB 1RFDH 4M48L 4QKXB 2HTLD 4HUWA 4QRRB 1BMGA 1X5JA 3GUTA 2ICWI 4NO5B 3QA3B 5DSCA 2E8ZA 1S7WB 2L4OA 2QADB 3MLRH 3NFPB 1UCTA 4Y5YC 4M5YH 2EH8H 3OB0K 4HZLB 5I1GH 5C0IA 3TZVD 1B4JL 3WFCH 2JIXD 5CSZB 4X7CC 4J2XA 4P59H 1FYHB 1T04B 4M6ML 2SEBA 4MWFB 2PXYB 1JNLH 4L4TB 4KK5D 1F11A 1LEIB 1NUGA 3FL7A 2C1PA 1DN0A 2WBJB 1IKNA 3UTTD 5DVMA 3O4LA 3VFRA 2ZSVA 2CIKB 1HXYB 4AQ1B 5A3IC 3IETB 3PHQA 5D1XD 1J10A 1JZ7A 4FQQA 5KVDH 1SBSH 4MNHB 1YMHB 3QG7H 2IPUK 5JW5B 3SKOB 2ZOKB 2NY7H 1CDGA 2W92A 3B9KC 1LNUA 4LSVL 5FYJH 1JPSL 1UC6A 2XV6B 2NMSA 5FV1L 1JCKA 3M17B 4ONOA 2XZZA 4BSVB 5FYKL 4GAJH 2PO6C 4PREB 2BNUA 4YXKH 2IAMD 5GGVH 3BKJL 2ADFH 2IADA 2R0WL 2C7UB 3SDCC 2BSRA 3VFUA 5IFHL 2EEDA 1G7QB 2Y07H 3CLFL 5I1KH 5GJTL 3VRLE 3VXPA 1JGEA 3O3EA 1ZMYA 4X7DC 1J8HD 1OY3B 1NGPL 3TBWB 1RJYA 1K8IA 4Y4HC 5FGBA 1A6AB 2FLRT 1W8NA 4MQ7B 1KBGH 3MRIB 3MACL 4PGEB 4QRPB 2HA1A 2UZYB 3U4EB 4BQ6A 1MCCA 3NCYS 4HXBL 4YHLH 3MLVH 2VE6B 4GRWH 1CF8H 5HDQH 4TVSa 4EUPA 3ARBD 4YHNA 1PQZB 3H42L 5FK9B 5D7LA 1KXQE 1X5LA 4UAOB 1CDBA 5JDJA 1G7HA 5I15H 3Q3GB 4H0GA 3QFJE 1G6RA 2A83A 5LQBL 1J1XH 4HAFA 1SY6L 3GO1L 4Y4FA 5GGRB 4E41D 5JIPA 5E4EB 1CGXA 2RFXB 3CFEB 1XAUA 4O2FA 3ZHDA 1EAPB 4P46B 1NAMA 4TTDD 2XICA 2Q1EA 4YHYC 3O45B 1DQJB 1U6AL 1IC5L 1UH4A 1ND0B 2VLRD 3AREC 4UIKH 5BQ7A 3DNKA 4JPVL 1JPTH 4GW1B 1I1YA 4M5ZL 3G5VA 4M03A 5FO8A 5JTWA 1PGRB 2QV2A 4NM4L 3VRJB 3TA3A 3PQYE 1U3ZA 1NCBL 2R0LH 1UCBL 2VXQL 1AGFA 3D39B 4GKSA 2I07A 5C2BL 1WWBX 3AB0C 4LIQE 2VXSL 3SGKC 2FH6A 3UMTA 1WT5A 2MQ3A 4J8RB 5D70H 3F5WA 3X3FL 2BXZA 1VFAB 4PV8B 5HI3D 4EI6A 3O8XB 3GSQB 2Z31A 1PEWA 4PRBA 3S4SA 5JXED 3CFDA 5K9KA 2AV7A 3EJZD 1A7QH 1D5ZB 2R2BA 2ZP0T 4R2GB 3RIAK 4E0RA 2Q8BH 5HYJA 5F1KC 3HE6D 5ETUB 2XRAH 5M94B 3SDCB 5DRWB 3VGAC 5D7JD 3KYKH 2GCYA 3RWCB 3RWIB 5JW4M 1HOCB 3B9DA 1IAIH 4MA1B 3JWOC 4Q2ZB 1WZ1H 1T21A 5DJ8A 2Z9TA 3KYMB 3BE1H 2W65B 1MUJA 2VXUH 3QUXC 4PP1C 4ZNEA 3QHZH 5EUOF 3PL6A 3C5JA 1A14L 2LU7A 3GBML 5FDWA 3TT1H 2F8XC 5DFWH 1OT2A 4WI4A 4P23C 1YPZF 5EWIL 4G8FA 4HFUH 3RWEB 1AKJB 3MJ9H 5E4IA 4WHYH 2OMNA 1XGTB 2Q3ZA 3UPRA 1EUTA 3WDJA 4PG9B 3MRNA 3IFNL 2NY4D 3UAJC 3T1FA 4QOKB 3LH2H 1D5XA 4XCYA 1OAQL 5I1IL 2CRZA 1KXTB 2HJKB 4YHYB 4BUHA 5IW1A 1M05A 2VNCA 4ONHB 2JF1A 3FRUA 1WZMA 3OKNB 3KPQA 5DD3H 5JIIA 3KXFB 1LO5B 4ZS6C 4L8BB 5FF6A 1OP5K 2YXMA 3BKYL 2I60H 3MRCB 4WTXA 3DJ9A 1R3LB 1BVLA 3ARDD 3PV6A 1UEYA 3TGXA 1TVBA 4LVNB 1Z9SA 4PGZA 1I4FA 4NQTA 2XFXA 5FOJA 1RD6A 4AEFA 3KYAA 3DHJA 3T3PF 1MHCA 25C8L 3WKNA 3EOTL 4Q9RH 2EDBA 1EJOH 2AEPL 4P2RB 1FO0A 3QNXB 3HNSL 1FYTB 4WUUD 3T3PE 4NN6C 1I9EA 2G75A 2IPTL 5IFJB 3Q2CA 4U05A 1KNOA 3GK8H 1N5YL 1IGTA 2VDKH 2OL3A 1ZTXL 4NO0D 1U3HB 3Q0HA 3MV7B 1OTUC 3QEHA 4N0FA 4YDIH 3QWRA 1QKZL 1IGIL 3IGAB 4KJWD 5JR1H 2FHBA 3HA0A 3BH9A 3D85D 5C07E 3VGAB 5DC9B 3HE7A 4OGXL 5JIKA 4EIGB 1ZGLM 1Q94A 3AS0A 1LEGA 3JBG7 4CGTA 1RUKH 1T7WA 4KMTH 1CD1A 3DUUA 2X89D 4MD0B 4ZFFA 2C1OB 1CIUA 5C6TH 3QUXB 2DKSA 1BIHA 1HXMA 4X7FC 4N5ED 3NGBB 4S1SL 4AT6A 2Z8VC 4LSQL 1WCBB 1H5BB 3QCUL 5F7NC 4HQQL 1JHTB 1F4YL 2VZ1A 1NGWA 1KCRL 5GPRA 5ADPL 1T22A 4O02L 3UBXI 3QDJA 5DUPH 5HHOB 1UZ6F 3WLWD 3NCEB 3SKNA 2R29L 1CI5A 1YECH 5E6YA 2X42A 1FRGL 1UZ6E 2MNUA 2D0GA 3QXUA 4HUVB 1CLYL 1LO0H 5BRZA 1TTFA 3BN9D 2OM5A 3CFJA 5E8PB 2IALA 1I8LA 2MWCA 4JO3H 5IK3B 2NX5A 5GS1C 1Q9OA 4WW2C 1D5MA 4D3CH 2HTLC 5IMKB 3HZMB 3MV9B 1HQ4B 4L9LC 3WIIH 1YEKH 3VXNB 1GZQA 2NY3C 5D2NA 2H2SD 3LDBC 4GQPH 4XGZB 4YGVA 3WFEH 4PJEA 1OAZH 2XQYK 3VI4E 4Z0BH 3TZVC 4UDUA 2V6HA 3MA9L 1DUYA 3L3HA 4WU5A 4J3SA 5ISZA 1U2HA 2FR4B 3SKJH 3TCXA 4KPHH 5D9SB 4L8CA 3HNTL 4KK5C 1MIMH 4JQVA 1N7MH 4OQTL 3MV11 4GAGH 4EKXA 5IBUG 4F57L 2YWZA 1ETZB 4I2XE 4U31A 3D87B 4NPYA 1ZVSA 1HHGB 5D1XC 1TVHA 1MI5A 1MWAB 3RNKA 2UUDH 4N68A 2W0LA 4F8QA 1S7QB 1Y18B 2XNAB 2B1HL 2YD5A 1GGCH 4ODXB 1R3HB 4BQBA 5DWUL 2DQUL 1P1ZB 2XWTB 2R9HD 5JHDA 2GQHA 2XG5A 4IRZL 5C7XH 3MO1A 5I8OL 4DVRH 1ZT7B 4LCIL 5IV2A 4UIMA 5BS0A 1DFBL 5M7QA 3NPSC 4XZUA 4X6FA 4OLWH 4QRTB 1VGKA 1EFQA 4I3RH 1BVKA 3QUZB 2YSSB 5C0CD 3STZA 1GJIA 2Y23A 3H9YA 5TFSL 1RUQH 5CBAA 2IAMC 2LAGB 3MGAA 4FRWA 2P24B 2ENSA 1N59A 2PCPB 4U6HA 2E7HA 4P48A 2HVKA 3U7YH 3JZ7A 4GG8A 1Z9OA 2NY0D 4RGNB 3C09C 4PRPB 1K6QH 3KPRA 1OSZB 1U58A 3C6LB 3LPWA 3NTCL 4U6YA 3CC5A 3LKSB 2BVQB 1JRHI 2BY3A 2PKDA 2PR4H 1XR8A 4PJ9A 3VE0A 3VGFA 1K3ZA 2E7LA 2VZVA 4LPXA 4TOYL 1IAMA 4U6VH 4Z5RA 3BRGC 4XCCH 4GS7B 4JFFB 3CFBB 5E5MB 3VXSA 5IEHB 3ARBC 5KW9H 4NQEE 4QEGA 3NFSL 3QCTH 1HNFA 4L9LB 5FXCH 1JRHH 4Z78A 2A6DA 2DYPA 4PYGA 1U8QB 2NY3B 5ENWB 3C2AH 3QJHA 2JIXB 3IS1X 5DYOA 5FUOL 1VEMA 3CK0H 4WI6A 2FD6H 3BVNA 1MJ7H 1FLRL 4Z7WF 3O11B 4TUJB 4KWUA 3S5LB 3MA7A 5EIIB 1MCIA 2DIBA 3LAFA 5CZVH 4ZDHB 2G60H 1HK6A 3PWPD 4MX7B 2A6IA 3G5ZA 4WO4A 3HC4L 3DV4A 3RDTB 4PUBH 4JFOB 5D1XB 1L4IA 2A73A 4X6CF 4JKPH 3BIAX 3P0GB 4P49A 3HCVA 5KSBB 5H8DA 1XZ0A 4BZ1L 4EOWH 5C09A 2CRYA 3NABL 3V4UL 4X6CE 4H0IA 3MUJA 1A9EA 4PB9H 4PTUB 1A3LH 1ADQH 5HI3C 5CCKL 4KC3B 3MFGB 2QSVA 4LMQE 1T0NA 5JXEC 2NLJB 1EK3A 3QPXL 4MJ6B 5EZIL 2JK5A 3EJZC 4KJYA 4OV6F 3L3KB 1CE6A 4G8EB 3FN0H 1DDHA 5H2BA 5IVZB 1YEEH 1DLFL 4UV4L 1A7RL 3HE6C 2B1AH 3P11L 5D7JC 4NKQB 1U9KA 3N0PB 3FOLB 1J8HB 1QSEA 4HKJB 3CZFB 4JR9H 4UQ2B 3SE8L 1T03H 5IT2H 1BPVA 1XFPA 3MCKA 3MLUL 3PWJB 2AJ3A 1OD9A 4KZDL 1QRNE 3F7YA 4K8RH 4XMKL 2LVEA 2FJFA 3REWB 3U4BH 1IFHL 4BSWA 4LAJH 3BPLC 1YQVH 4DCQA 5K9QI 3BGMA 5CP7A 3W39B 5DC0A 3H0TA 4CMMA 1PKQA 1AO7B 1YN6A 1CTOA 3ARBB 3TCLB 2VC2H 3A6OA 1NANI 3DUHA 3S35H 5GRUL 1BREA 15C8L 3IJYB 4D0DB 1NBYB 4OFYA 2WZPD 4DUXA 3BO8A 1XCTB 3AXLA 4S0SD 2HFFA 2NY4C 4KVCL 5DS8A 1PKOA 1PZ5A 2E3VA 2W59A 5C0RL 1BLNA 1NANH 2FB4H 2CKBH 5GRZA 1S9WA 3OKLB 4JHBA 2QHRL 4Z0XA 3SHSA 2AJXH 3G6AA 4L8SC 3OG4B 4X4ME 5F7EL 2NTSP 2XKUA 3QH3B 4GKZB 4JFEE 4GRLD 2E7CA 4JFXA 4FQLL 4DAGL 3HRZA 1SYVB 4PRIA 5DJAA 2BFVH 3NCBB 2EDEA 4ZNCD 2IFGA 2QQLL 1IM3A 3V5HB 4H1LH 3ARDC 4M8QB 2RIKA 4AY0A 5TDOB 4P5KA 1U8MA 3B6SB 1NGXB 1QFOA 1FZMA 4QHLB 3S3SA 4PP2A 3KWWB 4G7YL 3EYVB 3BN3B 3G6JB 4PFEA 4OZHF 1KCVL 1NDGA 1OCWL 4JPWL 4NQDE 1R24B 1EGJH 3PDGA 4X5XB 1I7UA 5DJ2A 5I1AA 4ZUVB 3NIGE 3QI9A 4MSWA 3TBVA 3T8XA 3CMGA 2HG5B 5D6DA 4AG4H 3RIAF 2IG2H 3MJ7A 1QSFD 1JI2A 4KJWC 4LLMB 5E94A 2D4DA 5HY9B 5EU6A 4XPHL 5SWSD 2R0ZL 5D1ZD 2H1PL 3F65A 5D93C 5C08D 1MFBH 2XKNB 1G0DA 5FYKD 4RGOH 5IESH 1I8IB 5KSUB 4HLJA 4N5EC 5FHAH 4DQOL 4Y5XB 1E27B 2J6EL 5GRXG 4D9RD 2YKLL 4RWHA 2DMBA 3HG1D 1INQB 2DQFA 4JCLA 3FQXA 3WLWC 2XZQH 3NZ8A 2GK2A 2BX5A 4PS4L 2O61A 2ED7A 4F7PA 3KAAA 5DFVD 3MUY1 4WEMB 5SX4I 1G7MB 3SY0A 2NY4B 3QRGL 3GMMB 3BN9C 3TBYA 1OSPL 1V3MA 5DR5L 3VXRD 2ZCLL 2Q7NA 5DTFA 2DI9A 2VZ3A 2ZUUA 1QFPA 2EEBA 3U1SH 4RX4D 4O00A 5SX4H 3KR3L 3EYFB 3OB8A 1LD9B 4BSJA 2GSGB 3JV0A 1FSKC 1Q9LB 1JGVH 2H2SC 1RIHL 5A43C 1A64A 1J8KA 1DLHA 1MHHA 2WBKA 5E2WH 4ZXBA 1NMCC 3P30H 3N1GC 4LARH 1DBMH 1JF6A 5C2UB 2BNRE 3J7HA 2X9YA 4UOW1 2DKUA 1RZGA 1I7ZA 3EIFA 4ZOCA 5L8KB 5BO1L 5KSVA 1KB5L 1E6JL 4LFHD 5DRZB 2B7DT 3I6LD 4XBGB 5EOCH 4ZTPH 3EFFB 4DW2L 1MREH 5D1QA 3T0VA 3TEUA 1HNGA 1C5DB 3QUMB 4YAQA 4TULH 4UT9H 1QR1B 3S37L 1V7NH 2HWZH 5D7IE 3GSNB 5MEQA 2AJZA 4K23H 3TO4A 2BJMH 4HCRL 3K1KC 3CDFA 4JY6A 1OAXH 1PDKA 1J05A 1RZFH 5L0QC 4WCYH 1IGFL 1I9RH 1YJDL 1S78D 4NQCA 1S7RB 3KPLB 1MIEH 1P2CA 5J9PA 1NFIB 3G08A 1K4DA 3VXUD 1EZVX 4PG2A 1A6TA 1D5BB 3C8KB 4NRZB 1QVOB 2HLAB 4M1GH 4DKDC 2W9EH 4DK6A 5BZDB 1KN4H 2UV3A 4ZPTB 5D8JH 3VRIB 2Q3AA 4GG6B 3KJ6L 1OP9A 4P0DA 4HV8B 4Y7MA 4KKLD 5GRYA 2BOCB 2NY0C 2IFFH 3CLEL 3VWJD 2GIYA 2F58L 1U42A 5JZ7C 5A2IH 1KGCE 1W72B 2UVEA 1YZZA 3K2MC 1E4WH 3QNZA 3ARFA 2Z0BA 2B5IC 1FG9C 2FJHA 1DP0A 3T4YB 4L4VA 1KF9B 4EIZC 5HYSA 2FLBT 4W6WB 4JEGB 3CGTA 4B5EA 4QRRA 5F3HB 3GNML 5C0EB 4NO5A 3QA3A 1S7WA 3NFPA 1CICD 4NWTL 4HZLA 1K8DB 1NSNH 4XX1G 3LB6D 5JUEL 5CSZA 4HH8A 4PRHB 4UB0L 1DSFH 1T04A 3CJJA 4YXHL 4H5SB 5HGAB 4JDTH 5JQ6L 1DQTA 4MWFA 1TPXB 5DVNA 2PXYA 4OCLC 4BUGA 1NMCB 4L4TA 5GXBB 2MOVA 1LEIA 4CU8A 2WBJA 2MPAL 5CZKA 5DA4A 2O5YL 1G84A 4O51B 3QXDB 4F80A 1XGYL 2RJMA 5C0BD 2CIKA 1HXYA 5D7LE 5TH2B 3IETA 4HJGB 1QLRB 3WXVL 4K94L 4K2UL 4A2LA 4MNHA 1MCRA 4M7KH 4OGZA 1YMHA 1IGYB 2W0PA 5JW5A 4G6JL 5F44A 4K71B 3NVQA 5IW6B 3SKOA 2ZOKA 5GS2H 1BWWA 4FQ1H 4CN1A 3AY4C 3M17A 4BZYA 4XPBH 2GY7B 1QBMH 2Y72A 4BSVA 3DVIA 4UMGA 4CVZB 5GS0L 1F90H 4PREA 1YY8B 5DURD 2YK1L 5DRXB 3GMRB 4LSUH 4RISH 5C0CB 3V52H 4CNIB 2C7UA 4UQ3B 1G7QA 5EZJB 1RZKL 1UB6B 3TBWA 3LKQB 1HHKB 4XVJL 1J87A 1A6AA 1REIA 4MQ7A 4NNYA 1RULH 3MRIA 3MLWH 3AM8A 4WI9A 3CXDH 4FXKB 3WJJA 4ZFGL 4PGEA 4QRPA 4Q9QL 3U4EA 2MHAB 3T2OA 4Y1AD 1NGZB 4QTIH 1ITBB 2B5IB 2VE6A 2DBJA 2W38A 2VMFA 4L8DB 3CVIL 3HI1B 3H8NA 1TJGL 4PJ5D 1PQZA 3P0VH 5FK9A 2UUDK 3Q3GA 5DMGD 4YZFE 4PRDB 5I1EL 1VACB 4N0YH 1UACH 2EDYA 3CCHB 3IFPB 5GGRA 1WFTA 4JFQB 2G5BB 4RBPH 1IKFL 2RFXA 3CFEA 3AMKA 3QEQB 4OLYL 3C8HA 1EAPA 4P46A 4ZNEE 1OL0A 2X4UB 5DVOA 2VR4A 3QIBD 3O45A 5IBUB 1DQJA 3QZWG 2BY0A 3IDMB 3OKKB 1ND0A 1RMFH 1TQBB 3P2TA 4FQ2H 1TMCB 4GW1A 3BZEB 2X1PA 4G8GB 4AZ8A 4GRLC 3VRJA 2R56L 4YHKL 4Y5VC 4KKCD 3G5XB 5H94B 1KEGH 3D39A 3QO0B 3D69B 2VDPH 1MCHA 2HKHL 1EEQA 1A3QA 4J8RA 3THMH 3OKMB 3ZKXC 1VFAA 4PV8A 3JTTB 3GSQA 1A7PL 5IEKB 1PEZA 2FJGB 4JZNB 3QUYD 4WIQA 1YEFH 1EEYB 1BFVL 2ERJC 4X9GA 1D5ZA 2QJDA 2FHCA 5SWQB 3VG0H 5C0JB 4OCYH 3SDCA 1DUZB 1MFAH 4JB9H 1AD0B 2EH7L 5DRWA 3RWCA 3CFIC 3WNNA 1UB5A 3DSFH 5A1AA 3RWIA 3QEGL 3BIKB 1HOCA 4U1KB 1D6EB 1MFEH 4JQXC 2HH0H 4PRAA 3JVGC 4Q2ZA 1U36A 3D2UB 2GJJA 3RI5K 4HK3J 3KGRA 2B20A 3KYMA 2W65A 5D1ZC 1JUFB 4YE4H 2VQ1B 1SYSB 3B3IA 3B9EA 2DLGA 4R7DB 1QUNA 3ZYJA 5FO7B 3OKDB 3OPZL 4B7LA 5DF0A 4KTDL 3QEUB 3T2QA 2E6JA 3ZE1F 2QTEA 1GH7A 3T0XA 3X17A 4KRPB 4HSQA 4P4RB 2XZCL 3RWEA 2P5ED 1XF4B 1AKJA 1F3RB 1XGTA 5HYIA 1PSKH 1D7FA 3OQ3B 4O5LH 1NEZG 1ZLVH 2YPLB 3P40A 4PG9A 2NY2D 5DFVC 3FJTA 2DMCA 3RHWK 4ORGB 3LEYL 3HMXL 1JPGB 2OTWB 5K9JL 4QOKA 3QISA 4JGUA 5BZWB 2HJKA 2AK1H 3T0BA 4LDLB 3U36A 5KBNC 3S8WA 4JPKL 4LOUD 1JL8A 2DL9A 5HHNB 5DLMH 5HHMD 3OKNA 5EDXA 2VUYA 3KXFA 1JHLL 1LO5A 4X6DB 4L8BA 1EBAA 4GRLB 1RSFA 1EEUA 2Z93B 5MHSE 5FIEA 3MRCA 4GKOA 1R3LA 1RURH 4G80B 4QT5B 3MRQB 5E2TH 4OSUL 1SHMA 5ITFB 1T1YB 5H37H 5BRZE 4U1GC 3SGKA 2O5XH 3ROLB 1O0VA 5JMRA 4OUUB 4P2RA 3S36L 3QNXA 1FYTA 2NX5E 3B83A 4OLZH 1OTTD 3IRPX 3BYTA 5IFJA 1MLBB 4PJEF 4U2ZA 4GRWF 1SQ2N 1TENA 5ECJE 4XH2B 3OAYH 1U3HA 4PJIB 2DD8L 3MV7A 3Q48A 3I9GH 4KDTC 5LCVH 3IGAA 1QPPA 3W9DB 1JPST 5CJXA 1UXSB 1JTTA 3UTOA 4ZSOB 2NNAB 2Z4QA 5DHYB 2GFBB 2AJYL 1S78C 3EO9L 4PB0L 4WV1B 4GQ9L 2C1OA 3QUXA 5IFAH 4HGKC 3ZZ1A 2QQNL 1MI5E 3RRQA 3KLAB 1WCBA 1H5BA 3VFSB 1JHTA 1P7KB 1EHAA 5HHOA 4OCWH 1MVFA 4KKLC 1T2QL 3VWJC 4R0LC 1MFNA 4YHPB 3VG9C 5JHDE 4ZMAT 4WENB 5FUZL 2WQRA 4HUVA 4BH8B 1WZLA 3WIHA 2CR3A 2DWDB 5E8PA 4UT7H 1SEQL 4R97B 1HHJB 1TNMA 3VXRB 4CMHC 2P8PB 4LSRH 5IK3A 4XPFL 2FECL 5LGHH 4RZCB 4OZIE 4PJBB 1BZ9B 5IMKA 3HZMA 2V2XB 3MV9A 4OJFL 1HQ4A 4M93B 3B2VL 3VXNA 1TDQA 2J8UB 3RZCB 1CICC 5ACZB 4XGZA 3PGFL 4QRUB 4LCCC 3LB6C 2LFGA 3BD3A 3IJHB 4EDWH 3KPRE 1RFDL 4EN3B 3L3JB 4ODSH 1EV2E 1DQDL 2FR4A 2RGSA 3X3GL 5D9SA 2DTML 2CXGA 4WUUE 3TVMD 3HS0B 4U1GB 1LO2L 4QO1A 4M5YL 2EH8L 3PP4H 4MLSA 4P2QD 2MCPL 3IDYB 3WFCL 1FLTX 4M3JA 5LBSH 3VXSE 4P59L 2DL2A 3JUZA 4XCFH 1ETZA 2VDNL 5CAYB 3BMVA 1HHGA 1MWAA 1S7QA 1Y18A 2XNAA 1IC1A 2DWEB 4JO4H 1FZKB 4ODXA 4ERSH 1R3HA 3E8UH 4GMSH 2XWTA 4X8XA 3VD5A 4ENEC 4FTVE 2ZCKL 2C4FU 5KVDL 4N90E 4A6YL 1SBSL 1ZT7A 3MRMB 3H9SD 1T3FB 4LLWB 4LCWB 3MNWB 1Z3GL 5ESQB 4OT1L 4K7PH 1T89A 4LHQB 3QUZA 4XB8A 4ZUWB 4K7FB 2P8LB 5FYJL 3V6OA 5TQ0H 2AK4E 3GIVB 1I7RB 1VPOH 2P24A 3QRFM 3U79A 2PCPA 3QXVA 1D5IH 1V05A 5IMOB 4GAJL 4R4ND 1RJLB 1NLBH 2BHUA 2CQVA 3T0ED 5ALBL 4PRPA 1EO5A 3VWJB 1OSZA 3C6LA 1UFUA 2ADFL 4YFDB 4YQXH 2WIIB 2X7LB 3QDGB 3LKSA 2Y07L 2E7MA 2BVQA 1CD8A 5FCUH 5I1KL 3O3AB 4P4KD 2I25N 1ZKAA 4NO2B 4CMHB 4JFFA 4YR6B 3CFBA 5E5MA 5IEHA 1KBGL 3Q6GH 1MH5B 4AMKH 4L9LA 5DJDB 1U8QA 4N8VB 5DMGC 2LABA 3EW3B 1CICB 5ENWA 4YHLL 1RV6X 1ODAA 1QSEE 5F3BB 4LCCB 5GGTH 1CF8L 1IARB 3TZVA 1TJIH 5HDQL 2WQ8A 2GJZB 4HEPG 2JIXA 2BY2A 1T1XB 1OWWA 1KIRB 4L1DA 4HKBB 1OOAA 3O11A 3QIBC 1JK8B 3CNKA 5EIIA 1J1XL 1Q0XL 1C08B 5T1DH 4OUOA 1JZ3A 5L8LB 1PKQE 2XTJE 2R4RL 1D6VH 4MX7A 5F96H 5ESAB 1F6LL 1H3PH 3RDTA 1G9NH 4KKCC 4JFOA 5D1XA 2C3HA 5CS7A 3IDUA 2AS5M 4UIKL 5KSBA 1JF5A 2DJ4A 4JKLA 1OAKH 3SOBH 3DGGB 3BISA 5HDBF 4Z7NF 1JPTL 3O6KH 3W2DH 3FAWA 4PTUA 3HAEB 5HDBE 1KPRB 1MF2H 3VD4A 3K74B 3LCYA 4FZEH 3OR6B 4BKLB 2NLJA 3RQ3A 4B0MM 1W0VB 3QUYC 2D4FA 4YEEA 5DI8B 35C8H 5CIPH 4HW6A 3L3KA 4G8EA 1R3IH 5IVZA 4PRIE 5D70L 1IL1B 3OXSB 4YXLH 1A21A 2VR9A 5INCB 3P0YH 1XF1A 1TZIB 3TH4T 2M8XA 3FOLA 1J8HA 5CMAB 1IGCL 4HKJA 1A7QL 3LZFH 2PTVA 4UQ2A 5F7KC 3PWJA 2BVPB 2Q8BL 5EU7C 3PGCB 5BVPH 4KUCD 4QCIB 1UENA 3WFHB 2DJUA 3KYKL 3S7GA 3REWA 2W9DL 4TNWK 2APBA 4OZFH 1IAIL 3W39A 1WZ1L 3WL9B 3S3PA 1AO7A 1U41A 3ARBA 3TCLA 4YX2L 2VDQH 3SJVD 5IB5B 1HSBB 2QR0B 2VXUL 3QHZL 5T1LB 5DQDH 2EDKA 5SWZD 3IJYA 1PX4A 4D0DA 1NBYA 2C3WA 3TT1L 3MLSL 1MHEB 3KJ4B 2NY2C 1S5HB 1XCTA 3U7AA 4XC3H 2IBZX 4JN1H 4RIRB 3CZJA 1N6UA 2FX8H 4HFUL 3MJ9L 3OKLA 4NCC1 2D03H 5I1DB 1P53A 2AI0H 4LOUC 4IEFB 5D5MB 2KDGA 1JP5A 3QH3A 4GKZA 1VEOA 4EZMA 2H6PA 3CUPA 2VDRH 4FABH 3O4OC 5IG7B 1SYVA 1IVLA 1FFOB 2NZ9C 4M8QA 3RPKA 5TDOA 5F1SA 4X6EB 5DD3L 3B6SA 1NGXA 5C0AD 2NY1B 4G42A 3RTQD 4QHLA 4BH7B 3KWWA 1YEDB 2V7HB 1OVZA 2BDNH 3EYVA 4JFPB 1OTTC 3G6JA 5JXEA 4J6RL 4ZPVB 4MZ2A 1R24A 4UI2A 4WU7B 4X5XA 2E9WA 4JFDD 4ZUVA 3VFMB 4Q9RL 2F53D 1EJOL 5K59F 1AP2B 2HG5A 3T0WA 4N8CH 5EUOB 1CGSH 2DLHA 4LLMA 1P6FA 5HSFA 1B0WA 1KJMB 2KZWA 4D9LH 2VDKL 3JTSB 4K3EL 1QNZH 5HY9A 5KN5B 5L9DH 4RBPK 3I02A 4YDIL 4F9LC 3BZDA 4WTZA 3RI5F 5JR1L 4XNZB 1WAAA 1B6UA 4G3YH 2XKNA 5CP3A 4XP6H 1I8IA 5KSUA 3L5IA 5FM5M 2DIJA 4Y5XA 1E27A 2EEAA 3CDGB 3FB5A 2ICES 3ET9F 1RUKL 4NC2B 4XPTH 3PXHA 1INQA 4OB5H 1OWRM 3MR9B 4XHJD 3T2NH 3VXMB 4QRQB 2YRZA 1AQDB 2YD2A 2P5WB 1G7MA 4PLOB 5E24E 1S7VB 2D7TH 2HKFH 4NQCE 4RMWA 3GMMA 5HHVH 4IOSD 1X5IA 4NZRL 1F8TH 3X11B 1YECL 4OCNC 4X4XB 3UTSB 4M3KB 5BW7A 1HHIB 3LV3B 1V3KA 1FDLH 3EYFA 1LO0L 4IRJD 1KLFA 1LD9A 5FA4B 5HHMB 3C9NB 2GSGA 4L3EB 1Q9LA 4XCNB 1X5FA 1QG3A 2VLJB 3PWVB 4JO3L 4OM0H 4S2SB 4M1DL 3BRDA 4RMRA 3QWQB 3WIIL 4NC1C 1YEKL 1B0GB 1EO8H 3TVMC 4EBQH 3SBWC 1LEKB 1P5VA 4RWYH 3WFEL 1OAZL 4L4VE 2DM2A 1FN4B 4JKWA 4Z0BL 5DMIL 4PRNA 5DRZA 4QRRE 1MAMH 3DMMB 4XBGA 3SKJL 2VH5L 4C4KO 5CEXB 3EFFA 1FGNL 1XIWB 4JZOB 4Z7QF 1C5DA 3QUMA 3ULUE 3U30B 3SO5A 1XGPB 4YH6A 4DZBA 3DTXB 5B38B 1QR1A 1N7ML 2CSPA 3GSNA 3O6FD 5EIVA 4MJIB 2QLVB 1ZLVK 4N5UA 1BECA 1BF8A 4X4ZA 1CVRA 3NA4A 3WDIA 5CJ5A 1L0XA 1S7RA 3KPLA 3FO0H 4TSBH 1GGUA 3V8CA 1NFIA 5J89A 3EBAA 3O9WD 1YNLL 2YA0A 1D5BA 3C8KA 4NRZA 1HH9B 1QVOA 2HLAA 1INEH 4WHDA 5BZDA 3S4SG 2JJVA 4I5BB 4ZPTA 5C7XL 3VRIA 4GG6A 3ALWA 3D18B 4HV8A 5GGRY 4OLWL 2BOCA 3L7FB 4R4NC 4RRPA 1QLEH 4NN7C 4I3RL 2E8YA 3WHE0 4Z6AT 2DQJH 2XACC 3BT2L 1B6DA 1RUQL 3LHPL 5HGBB 3P4LA 1T4KB 5EBLB 2EDXA 4ZO6A 2BP3A 6CGTA 1W72A 1G1YA 3FB8B 3QIWD 4L5FH 1WFUA 4P4KC 3U7YL 4ZFOL 2HP4A 4OCXL 1A6ZB 1I1RA 1MJUH 3T4YA 2QSQA 3TYFB 5IJVB 1K6QL 3LN4B 2ORBH 5F3HA 5C0EA 3OAYK 2OP4H 4HG4J 3JWNC 1Z9MA 2DM3A 4U0QB 1K8DA 3QFDB 4MB4A 1PX3A 3CU7A 4XPAH 4K3JH 2XYCA 4U6VL 4XCCL 4JO1H 4PRHA 4H5SA 5HGAA 2VKXA 4NKDB 3RFZC 4QRPE 3QCTL 2OR7A 1IC4H 1HN1A 3TVMB 1X4XA 5DA0B 1U2CA 3C2AL 1J0HA 2YUXA 4N1EA 4O51A 3QXDA 4U2YA 3T4AB 1UKSA 2LTQC 3E0GA 4X4YB 4OD3H 3O3UN 3CK0L 4HJGA 4CAGA 2FD6L 3BGFC 3QYCA 4TSCH 1P7HL 1WITA 2RBLA 1MJ7L 3RL2B 1DJSA 4OLVH 1KXVC 2WP3O 1IGYA 3VFOB 5CZVL 1HQRB 5IW6A 2FHFA 1DQQB 4KHTH 2G60L 4Y16D 1VEPA 3EOAB 3VWKD 2ZOLB 4PUBL 5LAXB 1P4LB 4JKPL 3BKJH 3BESR 3H9SB 2VERN 4CVZA 2XKSA 4DEPB 1TIUA 3TO2A 1YY8A 3CLFH 3KYOB 1KLUB 5DRXA 3GMRA 3DETD 2Q76B 4PB9L 4YHOH 5C0CA 4CNIA 1A3LL 4YDLC 3LY6A 1ADQL 4YDJB 5CHNB 4UQ3A 5EZJA 1UB6A 1ORSB 1ZVYA 2EIDA 3MACH 3LKQA 3Q6FB 2DM7A 3BXNB 1HHKA 4ZFZB 5JW4N 3KG5A 4XNMB 5BMFH 3QHFH 5MEOB 5EZOH 1YEEL 4V2BA 3TBTB 4FXKA 1YEJL 3B9AA 2B1AL 4ZO8A 1KCSL 2MHAA 3UJTL 3E6HB 4G9FB 5I9QC 1NGZA 4L8DA 4APQC 3HI1A 1MQ8A 3GMNB 3KS0J 4JR9L 3RY6A 5IT2L 2JLLA 3DHMA 4QTHB 3GO1H 2MSPA 1AFVL 1UM6L 5IMMB 4K8RL 4Z7WB 3ARTA 4PRDA 1VACA 4TN9A 3CCHA 3IFPA 1WWCA 3ZDYF 2APTA 5A2LH 4JFQA 4KI5D 5ESVB 2VZTA 1AI1H 3QEQA 3GSXB 2VC2L 3GSUB 4M5ZH 2X4UA 3SDDB 4NM4H 2VWEE 3S35L 4HEME 3IDMA 3BHBB 3HI5H 3OKKA 4KTEH 3WYRA 4FFZH 4OCSL 5GRVK 3BEWB 3OXRA 4X8JB 4XI5D 3RAJH 3BZEA 4XMLH 1UCBH 4G8GA 3ZE0F 2VXQH 4R96B 2LTQB 4HFWB 5CEYB 1R0AL 2VXSH 1SJEA 3G5XA 2FB4L 2CKBL 5H94A 2VUOA 3DXAE 4IIQC 4W81A 3QO0A 3ARGC 3D69A 4QOKE 4Q7DA 3OKMA 4FQCH 4JRXB 2Q20A 4JHAL 12E8H 2BFVL 3JTTA 5IEKA 2FJGA 2P4AB 4JZNA 4CKVX 1EEYA 1LE9B 2NQCA 1NH6A 3KXFE 5ERWB 5SWQA 5KJRL 1KB5B 4WEUD 4ZD3H 5C0JA 4IJ3C 1U8HA 1V3JA 3P77B 4NFBA 3ZKQD 3OSKA 3F6LA 4K94C 4YDLB 2NCMA 5DD0H 1DUZA 4HC1A 3TP4A 1XCQB 1AD0A 2NY5H 2HT4D 4JM4L 1ITCA 1DN2A 4AM0B 4XVSH 1FNAA 1EGJL 3BIKA 3CPLB 1D6EA 4U1KA 1HH6B 3D2UA 4P2RE 5E00B 4ODBD 3QIUD 4ZTOL 4NCDA 1ZHLB 1FYTE 2IG2L 3WJLC 3DARA 1QBLH 1CDYA 5ABDE 1JUFA 2VQ1A 1SYSA 1CFQB 3UX9B 4ETQB 4R7DA 3E2HB 3JV4B 5I9QB 2VR5A 1RJZB 5HDOA 3C60D 3REVB 3PHOB 5FO7A 2IH1A 4APQB 4C55A 3OKDA 4YDKH 3MV7E 3QEUA 4HJ0D 5FYJD 4ZUUB 4KH2A 4P4RA 4NOFA 1XF4A 4WUKH 4LEOB 4TNVF 4XHJC 4OQ1A 5DMKB 2CK0H 4RGOL 5IESL 5T1KD 4PLJD 1S9XB 2YPLA 5FHAL 3O2DL 4ORGA 1JPGA 2OTWA 4IMKA 3QDMB 4OLXL 5BZWA 3OL2A 3BKYH 3QWOB 4MD4B 5HHNA 5IHZB 4DN3H 4IRJC 1WIUA 4X6DA 5E2VH 4GRLA 4I18C 2Z93A 2H32H 1URLA 25C8H 4QT5A 2AEPH 1K5NB 5IOPB 4OZHB 3MRQA 1LQSR 5ITFA 1T1YA 4OI9A 3ARGB 5ILTL 4OIIL 3HR5B 2IPTH 3ROLA 1JGVL 5T3XE 4XXDB 4V1DB 1ZTXH 2B8OT 4W6YB 1IGIH 3MV9E 3VFWB 1MLBA 1S3KH 5F7UA 4OLEA 3DVNB 1F00I 4NWUH 4XXCC 2B0SH 4XH2A 4O9HH 4PJIA 1DBML 5FM8A 1VA9A 1IEAB 3W9DA 3O6FC 3I6KB 5E70A 1UXSA 5EOCL 1QACA 3X14B 1MREL 4ZSOA 2NNAA 4MLIA 4RMTA 3JVGA 4TULL 1KJ3H 5DHYA 2GFBA 4S1SH 4WV1A 4LSQH 1V7NL 3O9WC 3TBSA 5J12B 5ADPH 2V7NB 3ARWA 4O02H 3T77B 3SDYL 4DJMA 1DEEB 3MRKB 3KLAA 1Z5LA 1F3DJ 3VFSA 4WCYL 5DEGB 1H9VA 1I9RL 1X7QB 1FRGH 5GS3A 1P7KA 5C9KA 1YQ2A 4OF8A 1MIEL 1CLYH 1IGJB 3ESUF 3BIBX 4S10A 2DI8A 1NBZB 2JJUA 3CX5J 4DFHA 4YHPA 5HYQB 4KRMB 4M1GL 1KN4L 4B50A 4ODWB 4BH8A 4JRWA 4GBXD 1L7IL 4J3TA 1FQ9C 3ZKND 4N9GB 3QIWC 4PJXF 4I13B 1ZV5A 4AK1A 3VXRA 2IFFL 2P8PA 4AH2B 3GBLA 1KJ2H 2VTFA 2BK8A 3V6OE 4RZCA 1U3YA 1BZ9A 4PJCA 4RX4A 3UTZB 4FXLA 3BQUB 4MAYD 4LPWA 5L88H 1E4WL 2FH8A 2J8UA 4PJDB 4I0PD 3RZCA 5FKAB 4Y2DD 5JPMB 5ACZA 4RGNE 3ZL4L 4QRUA 1KUMA 2OS7A 4WWKD 4PRPE 4EN3A 3HNTH 3O41B 2OLDA 3L3JA 5KVEL 2YS4A 3QR2A 2VZSA 4OQTH 5BVJB 1SY6A 1QYGH 4F57H 4HKXB 3MRLB 3HS0A 3QFJD 5I8KH 4YUEH 2XN9B 1NSNL 4WW2F 4YFEA 2XY2A 5FGCB 4HZAA 2B39A 5KSAB 4JFFE 5I0ZA 1MPAL 2FIRT 1DSFL 1A5FH 4JGMA 4JDTL 5IWLC 2K7QA 3IXTB 1WTLA 3EGSA 1ZGLB 5I8EB 4OTXH 1W0YT 3VFRB 5JW3H 3RBSA 5HVFB 3ARRA 4EI5C 1TQCC 2DWEA 1FNLA 4IRZH 1FZKA 1FZOB 3BMWA 3K3QA 1DFBH 3GDBA 4Y16C 3PQYD 1RU9L 4L29B 3VWKC 3UZVB 4XT1C 4M7KL 1CTNA 3GMQB 3MRMA 1T3FA 4LLWA 4LCWA 3MNWA 5ESQA 3GJFH 1I1AB 4FMKA 4DKFL 3FT2A 4FQ1L 4XP1H 5C70A 1TZHA 3DETC 5KSBF 4ZUWA 3HNVH 4K7FA 2P8LA 5KVFH 3GIVA 1I7RA 4XPBL 4O58L 4B53A 5KSBE 2R1XB 2I27N 1QBML 5IMOA 4BK5A 4MNGB 5DVLA 1F90L 4X7SL 2ILLA 2HFEB 3VD9A 4OBSA 1OGAE 3V7AG 4LSUL 4RISL 3VWJA 1MCOL 2DTSA 3QQNA 2WIIA 4NUGL 4ZOAA 2X7LA 3QDGA 1OAYH 4G43B 1XT5A 4WGVB 1ACYH 1QFWL 3K2UH 4RMSA 3NFSH 3C5ZB 4NO2A 3WS3B 4M1CD 3SEPA 4YR6A 2RR3A 3MLWL 2CH8A 3CXDL 5SV4A 5FUOH 1F42A 5DJDA 4N8VA 1CICA 4QTIL 2FGWH 5F3BA 3WKMH 4LCCA 2BZDA 2GJZA 4RGMB 4KI5C 4K3DH 3KHQA 3P0VL 4I1NB 1T1XA 1KIRA 4F37K 1MRDL 4U4BA 4HKBA 3FT3B 5KS9B 3MCLH 2D7QA 5MP6H 1JK8A 2C4FT 2ESVB 1F97A 4N0YL 1UACL 1C08A 1LP9B 4XI5C 3OMZA 1AO7E 1WEJH 5ESAA 3V4UH 5EBWB 2ZZUT 2ED8A 2CRIA 3D6GA 4PV9B 1RMFL 4MMXC 4EI5B 3DGGA 3WIFB 1QBAA 2W1NA 1AHWC 5AWNL 3HAEA 3K4DA 4TRPH 1KPRA 4CL7A 3VWKB 3RVWD 3OG6B 3OR6A 2EKJA 4BKLA 1RQ5A 1KEGL 1DLFH 1NAML 1A7RH 1W0VA 1I85C 1L0YA 4RFEB 4OF5A 5DI8A 1GIGL 2VDPL 3CFDB 2Y06H 4I0KA 2EDWA 4G9DB 1IL1A 3OXSA 1A6UL 3DRTB 2ADIB 2D7MA 3WN5C 1YNKH 5INCA 4K9EL 3OKEB 1TZIA 2DKMA 1YEFL 2HT4C 2R15A 3VGDA 4YFLI 5CMAA 1IE5A 3MJ6A 1BM3H 3VG0L 3G6JF 4LLAA 2WP3T 1IFHH 3LD8B 2BVPA 2COQA 3QIUC 1KB9J 3PGCA 4DK3A 4NHUB 1JWUB 5J6GB 3MXWH 3WFHA 5C07D 1MFAL 3DSFL 1CD0A 2EC8A 3W5MA 3B5TA 3C60C 2AKRB 2EO1A 3WL9A 4HJ0C 4MA7H 3EO1B 2YD3A 3MRRB 5IB5A 1HSBA 2QR0A 4PJ8D 2BMKB 4YE4L 1ZLSH 5T1LA 1DVFC 1JVKA 3LN5B 3GKWL 1QQDB 4J7RA 4PLJC 1MHEA 1S5HA 5IROC 2VQUA 1L6XA 2AXGB 2FSEB 1A4JB 3Q1SL 1AR1D 3U9PH 2NW3B 1KENH 4RIRA 3VD7A 5ITBH 3MOQA 1WAAE 4JRYE 3FRPG 3DROB 1EBPA 1KTLB 4JREC 2Q6WB 4LCYB 4LPCA 4DGIH 4H8WH 4JFYB 3H9ZA 5I1DA 2PW1B 4O5LL 3DLQR 5D5MA 1BD2E 1E4XI 2QQLH 1GL4B 5BXFB 1X5KA 3X12B 2UZIL 2R4SH 5IG7A 5HYSG 4ELKB 5GHWH 1NGQL 1EHNA 1F3DH 1FFOA 3IB4A 4ONFL 3GSOB 2JTDA 4X6EA 1E4XH 3QQ4B 4HHAA 1AHWB 1RZ8B 4TVPE 4BH7A 4AIOA 5LXGH 2OBGA 2YWYA 1YEDA 2J8HA 3F58L 2V7HA 1RURL 1KC5H 5L7XL 2CLRB 3V6FA 5KAQF 4QY8B 3OBAA 4U1LB 4ZPVA 1MCDA 4IDLA 1NUNB 4WU7A 4UT6H 5JOFB 2G75B 5KG9B 3VFMA 4LSDA 3RY5A 4YHZH 1PG7X 1IGTB 1Y6KR 4I8DA 1AQKH 1NGYB 2ICWB 5EUOA 4IRSB 3V9FA 4OLZL 4PJ7E 5CLWA 1CFNB 1KJMA 1CDCA 3LRGA 2NY6B 4LLYB 2FRGP 4M7JL 4UBDD 3JTSA 4LRIA 3WNKA 5KN5A 4G5ZH 3BZ4B 3TH3T 3LEVL 3I9GL 4D2NA 3QIUB 2MTPA 2ZUVA 5AZ2H 2OK0L 1YYMH 5B39G 1JZ8A 3D3VB 4IMLB 1YA5A 3CDGA 2Z92B 5T3ZE 3FMGH 3CFCH 3STLA 4K7PX 4C54A 5I17A 1UVQB 3KLDA 5IFAL 3MR9A 3FO1A 5IB2B 3MROB 5DD1H 1DVFB 4QRQA 4LPTA 4P2OD 1AQDA 3PNWB 3NN8B 2YEZB 2P5WA 4ZQKB 3SKNB 3KPMB 3TN0D 7CGTA 1S7VA 4GBXC 1N2RA 3X11A 5F88B 4R8WL 4GG6F 4YC2C 4X4XA 3UTSA 1HHIA 3FQNB 5LGKA 3LV3A 4RQQB 5DK0A 5MI0B 2AQ2A 4GG6E 5FA4A 3RU8H 4MAYC 3U2SB 3C9NA 2CDGB 1RUAH 5F89B 4L3EA 4I0PC 4XCNA 4Y2DC 2VLJA 4K8RD 4F9PA 3PWVA 4ZAKB 4FQPA 4S2SA 4WWKC 4XNYH 4NQED 4PJEB 5LGHL 3HC3H 4GRWB 4GXUN 5BO1H 5IBTL 3F7VB 1E6JH 3MZTA 3C2SA 1B0GA 4KV5F 1LEKA 4F7TB 3B8YA 3HRPA 2W07A 1FN4A 4KV5E 1U92A 4Q0XH 4ODSL 3DMMA 3S37H 4ZO9A 5CEXA 1CXHA 2Q8AH 1XIWA 4M4PA 4JZOA 3T09A 4LDOB 1XGPA 4RFNB 4LASL 3PP4L 5IHUL 3DTXA 2F74B 4QHNB 5B38A 3IU4L 1I3UA 5D4QA 1AD9A 4PRHE 5LBSL 4MJIA 5INDB 4XCFL 4Y4KB 4M02A 1QP1A 1YC7A 3P9WB 4OAWB 4HKZB 4F9LA 5AG8A 4JO4L 4ERSL 3E8UL 4GMSL 1I9IH 3QO1B 1HH9A 4LVOC 4NJ9H 1YMMB 3MX0A 3QUKB 1IZJA 4I5BA 2P43B 3CLEH 1S7UB 1CLOH 4U7SA 4GH7B 2F5AH 1N0LA 4AIXA 3D18A 5DEZA 2XWBA 1TLKA 4K7PL 1F45A 4I48B 5GRVL 1H3VA 2HTKD 3NBNA 4QYOB 5HGBA 3I3EA 4CADB 1T4KA 5EBLA 3MOBH 1C8PA 1BHGA 3FB8A 1D5IL 3GNMH 3S3JA 1A6ZA 1M7IB 4NCC2 3BX7C 3TYFA 5IJVA 1N6VA 2JKXA 4M1CC 2AEQH 4YC2B 4C83B 2YD8A 3VD3A 1QRND 3LN4A 4NC0B 4YQXL 4U7KA 1UT9A 2NXZD 2FO4B 4NGHH 4D0CB 5EO0B 5B22A 2EDFA 5IW3A 3QFDA 4MNQB 1GOFA 2OYPA 1HYRC 3HZKB 1QR4A 4M7LT 4J4PD 3Q6GL 3LKOB 1XEDA 2O5YH 2B4CL 3BKCL 1E4KA 4BQ8A 1I3GH 3TVMA 3QFJB 3SBWA 3WXVH 4K94H 2M1KA 5GGTL 2EZ0D 1TJIL 4LLDA 1HIML 4F7CB 3TPKA 3T4AA 4TQEH 3VFPB 4X4YA 1T7VA 3SGEI 1G1CA 3RL2A 2X2YA 3ZDXE 2XWJB 2JJTC 3VFOA 4JFED 3ZDZF 2P7TB 5T1DL 1HQRA 3EJJX 3LQMA 1DQQA 1EERB 2KL6A 1D6VL 2ZUWA 3EOAA 3HZVB 3ZDZE 3PQYB 1CT8B 1T0PB 2DI7A 2ZOLA 1NC2B 1G9NL 3CSBA 3SGEH 5LAXA 2QBWA 3RVWC 3LS4H 5DUMH 4POZD 1NPUA 5EOQH 3IFLH 1P4LA 4AEHH 3H9SA 4N8PA 3SOBL 5D6CB 4JO2H 4G8GE 5AAWA 3O6KL 1R3JB 1X5AA 1F13A 1KLUA 3GBNH 2BNQB 2Q76A 4HT1H 2OI9B 1WFNA 4WI2A 5HPMB 4XVJH 4YDJA 1MF2L 4EQ3A 4W4OA 5CHNA 3M07A 3VDAA 2P44B 5IUSA 1ORSA 4KI1A 4NQDD 2A1WL 1A02N 3Q6FA 3BXNA 4Q9QH 4ZFZA 5L2KD 35C8L 3ULVE 4XNMA 3NCFB 5MEOA 1R3IL 1G0YR 1BZ7B 2A74B 1NC4B 5CSBA 1OP3H 3TBTA 4YXLL 4U49A 2ATPA 3P0YL 3QPQD 3E6HA 4G9FA 5B3JF 5JNYB 1Z2KA 4P2CG 3LN9A 3GMNA 3LZFL 4M8VA 1QTYT 3S97C 5L6YL 2APFA 4QTHA 4FQJH 5BVPL 4HPOH 5IMMA 3O3DB 1CCZA 3RVVD 4PJ8C 3FFCB 2DIAA 2J6EA 4OLYH 3MUGB 5CEZE 1E0OB 1WSST 4GLRH 3GI8L 5GQBA 2C9AA 4Z7UA 5ESVA 1AR1C 1DQML 3GSXA 4KQ4L 3TJHD 5TDPB 4BZ2H 1FPTL 3GSUA 1F6AB 2VDQL 3HPJB 1G6VK 2CJUH 5D71H 3K46A 3SDDA 4F37F 1NCWL 2FX7L 1JYNA 2R56H 4YHKH 3BHBA 3MRBB 4IBLT 3GJFK 3BEWA 4X8JA 5T33H 5TJWK 1IEBB 4R96A 2XIDA 4HLZH 4JN1L 2R23A 5EG6C 5CEYA 2FX8L 1TXKA 5KVMC 4U6XB 2C4XA 3LS5H 2YPLE 2D03L 5D72H 3UBXB 2AI0L 3SGJC 2DLFH 2I9LB 1A7PH 3UTQB 5IF0B 4UTAH 1BFVH 4P5KB 2VDRL 4PTTB 4JRXA 4RA0C 1HSAB 3KPSE 2H45A 4P5MB 4UU9B 4X6DF 3TYGH 1LE9A 4RA3A 2EH7H 4X6DE 3DO7B 1HDMB 3HTLX 2BNRD 1KB5A 3EUUA 3P77A 3FQTB 1GAFL 5I1AB 2AGJL 2NXYD 3DVGB 1XCQA 3TBVB 2CDEB 2KKQA 3IDXL 4KTYA 3UTPE 3FZUD 1XGQB 2AXFB 2DMKA 4UBDC 3CPLA 3ZTJH 1HH6A 4JHZA 5E00A 3GMLB 4HCRA 2IPKB 1ZHLA 3OPZH 4N8CL 5EU6B 1MFDH 1CGSL 4KTDH 4A2MA 1P7QB 3WNLA 2BCKB 2VDOL 1CFQA 4W6XB 4ETQA 2XZCH 3JV4A 4D9LL 1RJZA 3REVA 3PHOA 3RA7L 4APQA 5L9DL 1QNZL 4PJIE 2W0FB 2J88H 1FNHA 1RHFA 5F7DB 4ZUUA 1FL3B 1AGEB 5I1HH 2BOBB 3O4LD 4PJFF 3ORJA 3LEYH 4LEOA 1RUMH 4G3YL 1CDUA 5DMKA 5TPWH 4XP6L 1S9XA 5CINL 2OZ4A 4YHIA 4ZSOE 4P2OC 4LQFH 3SDAB 4OCRH 3TN0C 1GHFL 2G2RB 3MRFB 2UWEE 4EVNB 4XPTL 1QRKA 2WIMA 1OARH 3IYLW 1KGCD 3QWOA 2EYRB 4MD4A 1EEZA 1JTPA 3CU1A 4HWEL 5IHZA 2GUOB 2D7TL 4WI7A 4OSUH 5HHVL 1QD0A 3NA9L 1F8TL 4JDZB 3MGTB 3EDFA 4K8RC 1UKQA 3WHXB 1K5NA 4IIQA 4OZHA 4TYUA 5C71A 5IOPA 3V0WL 2A77H 3R06B 1FDLL 5ID1A 3ARGA 3TIEB 2FCBA 3HR5A 5DRNB 4Z18A 1MHHB 3L5XH 4PJCF 1M6OB 3H7LA 5CILL 4XXDA 4V1DA 4OM0L 4W4NA 1CLZL 5E2UH 2J8UF 4HXAH 4PJBE 5CBEB 2GYSA 3VFWA 3K7UA 3DVNA 2D31B 2J8UE 1X5ZA 4NN5B 4HUKB 1NUDA 1D9KB 5EU5B 4JLRB 5T5FL 1B3JA 5GRJL 3ZTNL 1U93B 2WWKO 3VMNA 1XF3B 4OFDA 5MENB 1IEAA 5DJZB 3U0TB 5D7LD 2AJYH 3EO9H 3I6KA 4I2XB 2EDOA 2YRPA 3EAKA 2VO5A 2IEPA 3X14A 4E9LA 2R0KH 3JV5A 2X1XR 5A2FA 4Y4FD 1UYWH 3WJLA 4QXGL 2V7NA 3T77A 3QB7C 2ZPKH 1DEEA 3FHAA 3MRKA 4X80H 1V3LA 2VN4A 4GUPB 3TH2T 2Z35B 3LRSA 2FECI 5DEGA 1X7QA 5I75B 2NW2B 3FO0L 1FVCB 4TSBL 1IGJA 4Q6YA 3UPAA 4ODTL 3TA3D 1NBZA 2L7JA 5HYQA 2HTKC 1INEL 1GVIA 4MXVF 2DAVA 4ODWA 5J3HD 2IF7A 3CX5K 4IM8A 2GITB 4XPFH 3U4AA 4LCWE 3HZYB 4N9GA 4MXVE 4OJFH 4WFHE 1Q9WB 1U8PB 3ZHKA 4CDGC 4DGVH 3SCMD 4HPYL 3B2VH 1QLEL 2ARJQ 4AH2A 3PGFH 2DQJL 5GGSB 3GHBH 3UTZA 3BQUA 2NXZC 4PJDA 5BV7L 5FKAA 4ZO7A 1DQDH 1G9MC 4L5FL 5JPMA 3NIFF 2BRRL 3X3GH 2DTMH 2F15A 5C92A 1MJUL 3MODH 1LO2H 4FFYH 4MCZB 3O41A 2MCPH 2DN7A 2ORBL 5A2JH 4J4PC 1ZLUH 3QDGE 2WUBH 5BVJA 2OP4L 3GRWA 4HKXA 3MRLA 2XN9A 1Q8MA 2VDNH 5J1SC 3BP5B 5KSAA 4XPAL 4K3JL 2EZ0C 4JO1L 1CFSA 3OKYA 5J11B 3MFFB 3IXTA 4J3UA 2CLVB 3R8QA 1ZGLA 3PL6D 5I8EA 1AH1A 1IC4L 1C1EL 2VSCA 4YK4C 2D7OA 2ZCKH 4A6YH 1FZOA 2CKBB 3T1WA 3ULUL 1Z3GH 4OD3L 4OT1H 4L29A 4POYA 2F54E 1PFCA 4TSCL 1FCCA 4LSPH 4Z7VB 3GMQA 4POZC 4OLVL 4MZ3A 4JM2C 1PW3A 5B39B 5C6PB 5FECB 5DFTA 2YMXH 1I1AA 4EXPX 3VW3L 1GXEA 4KHTL 3MNVB 3BPNB 1NQBA 3OKOB 4H1LB 1BJMA 1OM3L 1KSRA 4HIHB 1QZ1A 5ALBH 43CAB 2R1XA 4X9BA 2UY6A 4MNGA 4M43H 3HUJB 2I26N 2HFEA 3D48R 2GAZB 4Q97A 4YHOL 1S7SB 4X7EC 2IANB 3K1DA 2PN5A 4G43A 4NNYB 4NYLB 3QPQC 2APWA 3C5ZA 1VADB 3WS3A 5BMFL 1WFOA 3QHFL 1X4YA 4WTZG 5EZOL 1TFHA 2IQ9H 1DL7L 1PVHA 3RVVC 4E5XB 3RKPA 5EU4B 5KTEH 3O6MH 4KVNL 4Y5YB 3QWRD 1W2KT 1EHLH 4HMEA 4JKMA 1Q0XH 3TJHC 1RI8A 1PYWB 2VLLA 1W8OA 2R4RH 3HE7D 4BFEA 3FT3A 3HMXA 3HI6H 5KS9A 2ESVA 5J0BA 4HK0B 2IH3B 1LP9A 3BUTA 2E6PA 1AI1L 4XX1E 1MCKA 2Y1VA 1KG0B 3H6JA 2NZIA 3G6DL 5L8JB 5IWLA 1J9CT 1X5XA 1TCRB 5EBWA 8CGTA 4C56B 1VFBB 4W70A 2I24N 3HI5L 4KTEL 4PV9A 4FFZL 4PJGF 3V4VL 4YK4B 4D8PB 4EI5A 1ROWA 3WIFA 3WXWH 3RAJL 4XMLL 3ZKSD 3IU3B 5KAQG 3U6RB 5MHSD 2V2WB 3VWKA 5D5MF 4I0CC 1SVCP 1QA9B 3N50A 3B9KB 4Z77B 3BP6B 4JM2B 5D5ME 4RFEA 5BRZD 5TF1L 2MJWA 1SJHB 4G9DA 3B9VA 4FFWD 4FQCL 2PO6B 2NX5D 2ZG1A 1IGCH 1QFHA 3DRTA 3EKCA 12E8L 2ADIA 1IAII 4LHUB 4WFEE 4X5LA 3V7MA 3OKEA 2O93L 3NCJH 4X98B 2NXYC 2JB5L 3ARZA 1N0XH 4J12A 5DZNA 3FZUC 1WVZA 4MHHG 4LLUB 3ZSSA 4OKVB 5AD0B 4ZD3L 1UB5B 3AU1B 1VERA 2W9DH 3V2AR 5I71C 4PJAF 4Y4HB 1GGTA 2GJ6B 4NHUA 4PRAB 1JWUA 5DD0L 1CGUA 5J6GA 2QHLA 2V17H 1P6AB 2NY5L 4YBLC 1KB9K 4YX2H 2PYEB 4XVSL 3IVKB 4ZUTB 2JJSC 3B3IB 2AKRA 4N9OB 3DWTA 5B21A 4ELMB 1IKNC 3MLSH 4LPVA 4LRNH 3SQOH 1EIBA 5EUOE 3EO1A 1QBLL 3MRRA 1RPQA 2BMKA 4BFIB 3LN5A 4FQXD 4KY1L 1F3JB 1MI5D 2N4IA 1QQDA 3I2CH 4YDKL 1YPZE 5F9OH 2CUIA 2FSEA 2AXGA 1A4JA 6FABH 5FYKU 1CFTB 2NW3A 1ZEAH 1ED3B 4RRPG 1DBAL 5SV3A 4LGRB 3DROA 1KTLA 4H88H 4WUKL 4YHMH 2IMMA 4R26H 2Q6WA 4LCYA 4JFYA 3PWNB 5JHDD 2CK0L 3K8LA 2PW1A 2V5SA 3MV8B 2VLKB 1JV5B 3U36B 1I9JH 5BXFA 4P2YA 3AREB 3X12A 3AMLA 4ELKA 3A6CL 1JNJA 2Q86B 1HZHH 4WW1B 3VXME 2ED9A 3KLHD 4PR5B 3GSOA 4LIQH 2P5WE 1MELA 4GW5B 4DN3L 4CJ0A 3QQ4A 1P5UA 1IBGH 5E2VL 5J13C 4J6RH 1AHWA 1RZ8A 3MRGB 1OP3K 3MJGX 3AB0B 5GIRB 3KPRD 4OZFG 3UTSE 5CLTA 1TETH 2CLRA 2BSTB 4QY8A 2AERT 1C16B 4U1LA 4O4YH 1I85A 4HS3A 1VHPA 5CKAA 5JOFA 5KG9A 4L3EE 2BNRB 2VLJE 5CGYD 5GRWA 4K3EH 3VXSD 4FNLH 1NGYA 2ICWA 3OJ2C 1MY7A 2CUMA 4CVXA 4IRSA 3PWLB 1CFNA 4UINH 4L9DA 2A9NH 4WNQB 1S3KL 1J1OH 2DYPD 2WBWB 3K0WA 1A6VH 4LLYA 4NWUL 2B0SL 2CR6A 4MDJB 1Z9LA 4O9HL 4FXGB 3BZ4A 1I8MB 3IKKA 3MRJA 3KHOA 3QIUA 4PY8J 4PYHA 5D7IB 4A6YA 2Z4QB 1NKOA 1ZS8B 3VCLB 3IXAB 4FTVD 4N90D 3D3VA 4IMLA 3MMEB 1FE8L 4ACPA 4Y19B 1F4HA 2BVYA 2Z92A 3PP3H 4NNXB 1KJ3L 3LKNB 1FFPB 2CK2A 4MJIE 4F2MB 5IVXB 4K9EC 4WO4D 1UVQA 1HILB 2FEEI 4P23B 3TA3C 5IB2A 3MROA 1A1MB 4NZRH 1DVFA 2WUCH 2AK4D 3UYRH 3PNWA 3NN8A 2YEZA 2DDQH 4ZQKA 5J3HC 3KPMA 1BBDL 5JQHC 3PWUB 2GTZB 5F88A 4NZUH 1WT5C 4J3WA 3SCMC 5E8NB 3FQNA 3L6FA 4RQQA 4GKNB 4L3CB 5HGHB 4M1DH 3U2SA 2CDGA 1XH3B 2XA8H 5F89A 1WQVT 4ZAKA 3LOWA 1VCAA 5I2IB 4NHCH 4OF6A 1KJ2L 3SE4A 2QQQA 5D2LB 3W0WE 5DHVH 2DQCH 3F7VA 5DMIH 3Q5YA 5L88L 3HPLB 1QSED 2VH5H 4F7TA 4H26B 1FGNH 4Z7OF 1DBJL 1J88A 2JE8A 4S1QH 1PD6A 1KOAA 5IVOA 3SQBA 1QYGL 3PL6C 4NN6B 5EORL 5I8KL 4YUEL 1QHOA 2ADGB 2F74A 4QHNA 2EDDA 1A7NH 2MKLC 2XTJD 3P4MB 3UPCA 5INDA 1A5FL 1HINH 1U8JB 1BJ1J 1OLLA 2ZG2A 4OTXL 4Y4KA 3VH8G 1YNLH 5E5UB 5JW3L 2X4PB 1IC7L 1UWEL 2AJSH 4OAWA 4HKZA 1CXEA 4QNPF 5HGGS 3QO1A 3O6LL 2WW8A 5EB9A 1YMMA 3QUKA 1JIBA 4OI7A 1EFXB 1S7UA 2X10A 4MQTB 3AFLA 3BT2H 3LHPH 3P3YA 4PJXB 3O2VH 4I48A 4PRID 4LKCB 4XP1L 1OPGL 4QYOA 3DV6B 3HNVL 4OCXH 4CADA 3UCRA 3VDCA 5KVFL </