2N7BA

Solution structure of the human siglec-8 lectin domain in complex with 6'sulfo sialyl lewisx
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
145
structure length
145
Chain Sequence
MEGDRQYGDGYLLQVQELVTVQEGLSVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHGSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Sialic acid-binding Ig-like lectin 8
publication title Structural basis for sulfation-dependent self-glycan recognition by the human immune-inhibitory receptor Siglec-8.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2n7bA00
3A67H 1VENA 2O5XL 3DVFA 4XPFL 3VXMA 2F53E 3MLSL 4LKCB 5JTWA 3IB4A 2CPCA 1I8KA 5CBEB 4X6DB 1PAMA 5HI4C 1N6QL 4X7SL 1ZK9A 4NDMB 1JGEA 4XAKE 4GAYA 2BXYA 3SHSA 4YDVA 5B4MC 2N1KA 5HHQA 3N9GL 2A83A 5DJYA 2HFTA 1P4IH 4LSUH 1FNEB 1IAIM 4QRRE 3T1FA 4DVRH 2VR9A 2AJZA 3UAJD 3RVTC 3S37H 5I17B 3O4LE 2NY5H 4JQVA 3F62A 2FO4B 3HKFA 2OYPA 3IDJB 5CSZA 1GOHA 1FIEA 4F7MA 1AD9B 1B0GA 1DQQA 3E1F1 1ZGLA 3LQAL 3RHWK 2NR6C 2I5YL 3UTZA 3L3HB 5DFWH 3AS0A 1YEHH 3HNTH 4NSKA 5E99H 4IOSD 2A6JB 5DQDL 2F5AL 1CGYA 2FJHA 5F7MC 4YFDB 1FRGH 5EU6D 5ITBL 1EAJA 3SKOA 1NAKL 3QDJA 4D9QD 1S9XB 4I18A 1AQKH 3O6MH 1QFWH 5IQ9B 3V52H 2CDFA 1LO0H 5I1IH 1HCFX 4WWKD 5DC4B 5FYLL 3BDXA 2IG2L 2XG5A 4U1KA 4HH9A 1A6VH 4L4JA 4K94L 1QA9B 1YN6A 4LHUD 2OTUB 5CLWA 1FFRA 4LGPB 2W9LA 4EQ2A 5EBGA 4F7PB 1HKFA 2R56H 4P3DB 4UILL 4PRDB 3PDGA 2K3TA 4W6WB 2ZCKH 3CZFA 1BIIA 3RUGE 3TNNB 1ZV5A 3X14B 3OKEB 1ZA3B 1TZIA 1LO2H 2FDBP 5HVGB 1QFUH 2QKIB 4Y4HA 1UG9A 4Y19D 3AU1B 1RU9H 5HYEA 1X44A 3VXSB 3WFBH 2M26A 1RIHL 2CKBH 4HC1A 1NGQH 2PYEE 5F7YC 5CFHA 5IFAH 1J05A 4PTTA 4CU7A 3FQUB 4LLYA 1CDGA 4M7LH 2O61B 2D4FA 4NZJA 3RX7A 5IB3A 2A6DA 1AP2B 4WI4A 4CKVX 3MV8B 5KG9B 4A6YB 1EVUA 4ZXBB 3TT1H 4XP6L 5FB8B 4Z77B 1A0QL 2ITDA 4MX7A 1BBJB 3V7AG 4FZEH 1LO5A 3N1QC 2CK2A 5E5RB 2VC2L 2P49B 5T5NG 3WIHL 4M5ZL 3SE4A 3U6RA 1H3PL 4S1DD 1QFWM 5B8CB 4J8RB 3WS3A 5FECA 3RKDD 5F89B 2F5BH 1KJVA 3GMLB 3VD7A 1K3IA 3DI2B 1JI1A 3TVMC 4NKDB 5FXCH 4AYFA 4ZFOL 4PJGF 1P4LB 1MHEB 1MCOL 2IAND 3FB8B 4IMKC 5I1DB 3F7QA 2XFXA 3ARDA 3TV3H 3MJGX 3UTTA 4MJ6B 5D2LA 1N0XH 1NFDE 2DM4A 4LBEB 3ZSTA 4NKMB 4WJ5B 4JZOB 3HE7D 3RVUD 1D6VL 4YNYB 3ABZA 1RUMH 4NNXB 5IW3A 1G0YR 1F97A 2AKRB 1EFQA 4RX4D 4APQB 1K9TA 2RBLA 5IESL 5CSBA 5F1NA 3N06B 3O41B 3LQZA 5CGMA 5DEFA 5J06A 1NGWB 1PX3A 1Q0YH 1PKQE 3NPZB 3C6SB 4J1UA 2A73A 2X4QA 4YXHL 1CIDA 5CD3B 2ORBL 5E56A 1QYGL 1IAMA 3OPZH 4G6AC 3H3BC 4QNPF 4N1HB 3PHOA 3QDMD 1H3GA 3RAJL 3U7WL 4HG4K 3MO1A 4IIQB 4WHTA 5EN2B 5TDOA 2J12B 3DBXB 1S7VA 4TSAH 3KPSE 4KFZC 3F8UB 5KSAD 4NO0D 1MEXL 4LVEA 5HJ3A 3D69A 3I6GA 1QPXA 2AJXH 3ESUF 4E41D 1TQCC 1JGUL 2G60H 1EEZB 2VABA 3VE0A 3STZA 4GBXD 4UZGA 5F7WC 5T3XE 2JLLA 1T0PB 3F12A 4OF3A 3X13B 1S5HA 4KVNH 4J3UA 4DTGL 4HXAH 4KUZH 1MELA 3KPMA 1T7XA 3NIGF 2QL1A 4LSTH 3D39B 5TE6L 3KPQA 3STLA 2NMSA 2B2XL 1NMCC 2WBJB 2F54D 2G75A 1NC2D 5ID1B 3MRPA 4JR9H 4OBSA 4QWWD 5C0CB 5EU4A 2QSVA 2Q3ZA 1WUNT 3X3FL 1T1XA 4Z7VB 4ZUTA 3LKRA 5ELIA 2W07A 2NXZC 2VSDA 25C8L 3L3GB 5ICXB 1IC5H 2OL3A 2VZ1A 3L3KA 5FGBC 3C8KB 4KKLD 4UTBL 3UJJL 4LQ1A 5E8PB 5C0AA 4Y4KA 3W5NA 2BHZA 1OM3H 4P9HH 1JF1A 5D2NA 4CGTA 5F9WC 2FYYA 1HZHL 1FDLL 5TF0A 3NA9H 3I50L 4NRYB 3UPRB 1YYLL 3QDGD 2YUZA 5D1ZB 3WNKA 2BVOB 1BZ7A 5HPMA 2IBBA 4NN6B 1DN0B 2OI9C 1IKFL 3EYFA 4JRYE 5HGDB 4P4RB 4L3EB 3GSRB 4DN4L 1J8HA 3WFHA 3QFJA 1KELH 3OKYA 1RMFL 2BNQB 3RTQB 5HI5C 2HA1A 4U0RC 1G9NC 4DQOH 3GSQA 5DJ6A 1OTSD 2Q8BL 4GFTB 4DKFL 4EUPA 2ZSWA 1KPRA 2FRGP 1T4KB 5A3IC 4PGBB 2E7LA 4XBEL 4BQ6A 1IGCL 2H32H 3B2UC 5K59E 3BZEA 2AK4A 2YC1A 5FYLD 5F88A 3QUML 1GAFH 3BUYB 2UUDK 4ZAKD 1JYNA 2ZG1A 2EH7L 4K9EC 4E42A 3HZYA 2V5TA 4QRQB 2OSLA 1Q38A 5JIIA 4N0UA 1I8MB 3THMH 2J5LB 4F8QA 1KPVB 5LGHH 2VITA 5BS0A 3FO2A 4YGAB 1F4YH 2X89A 4L9DA 4TPRL 2NTFB 1MFAH 5HGBA 3P11H 3FB6A 1OWWA 3D9AL 4JLRB 4RFEA 4ZSOB 1BD2E 1T0NB 2IMNA 2V5YA 5DJZA 1NGZA 5DQ9B 2IGFL 5A2JH 5J0BA 4GRLC 1A3RL 5MI0B 2XY1A 3FCTB 3PQYB 4C58B 1FFQA 2XZAL 1IEHA 4TQEL 1ACYH 1XGYL 4IHOA 2PKDA 2R4RH 3LEYH 4U1IA 1KCSH 1NEUA 2OK0L 5MEPB 2LTQC 1G0XA 1CN4A 4CAGA 2VN7A 3WO4B 1MFCH 5DJAB 3C5SA 5F3HB 1A6TB 3OKMA 1DEDA 4XVUC 5H8DA 3MOQA 3CXDL 4UNVA 5LWYL 2EC8A 1ZANH 2DKUA 2BSED 3QQ3B 4X0KB 4RQQB 1JGVL 5C0NC 2XZCH 3FFDA 3OKKA 3RWJB 5T3XH 3EO9H 5CKGA 3RP1A 4QRUA 4Z7UB 5JXEA 1ZSDB 4GRMB 5E1AA 4WU5B 5HHOA 3WS6C 2YPLE 4WFED 3UTSD 5F9JB 2LE9A 2VLJB 4W68A 4BUGA 1ZT4A 4M1GH 4TOYH 3DUHA 2OXHA 5JHDE 3L9RA 1AGDB 1E4WL 2VDMH 3MBEC 4OLXH 4RA0C 1QBLL 4JAMB 5MHSD 4QHKJ 3L95B 4YAQB 5MEQA 1EJOH 3PIQA 4DN3L 7FABH 1XIWA 4OM1L 1S7UA 2GJZB 1CFTB 2GSIB 4UT9H 4XGZA 1F11A 3HPLB 5GISH 2JIXB 2WINA 1IGFH 4LGRB 5IV2B 3QRGL 4J3SA 1OGTA 4I2XE 3OX8A 4JQIH 4NRXA 2H26B 5CJ8A 4HUUB 4BZYA 5CBAB 1IBGH 3RPKA 2NTSP 5CUSH 1MJUH 4KJQC 4YHNB 3MLPA 4RAVB 4HS6B 3ZKQD 1RJZB 1KIPA 4KK8C 4RGMC 2AQ2A 1UA6H 1RZKH 1INQA 1A1OB 5FHBH 3LIZH 3SPVB 1GRWA 3VCLB 4P5TC 3QO1B 5I8OH 4K3DH 5MEOA 5CP3A 4QOKA 5K9OB 1UT9A 3DXAE 3P2TA 5GS0L 1LO4H 1WFNA 1KTRL 3BE1H 2DL9A 4YHMH 2V5SA 1KENL 1UFUA 3MA7A 4X9HA 4QRPE 1DZBA 3BKML 4C56B 1X4ZA 5C0GB 4ELMB 5DLMH 3W81A 5BMFL 1IC4L 1RULH 1MQKH 4LLDA 1J1XH 1ED3A 3B9DA 3EJYC 1UB5B 4PRPB 4Z0XA 3IAGC 4N5UA 2VO5A 3VXMD 3D85A 4RGNC 4AQ1B 2AS5M 1SVZA 1I1AC 1YEIH 3B3IA 3ZYJA 5CJQH 4DGIH 5FGCB 4UT6H 1O5DT 1AO7E 5CEYB 4RAUB 5CZXD 3SDXA 3E8UL 2BVPA 3SGKC 1FYTD 1A47A 2OR8A 1GGCH 3WLWD 3H2WA 4QRRB 1TTUA 3DLQR 3HC4L 1A7OH 5KSBF 2OL3L 2ZCHH 1C12A 2FJGA 4Z7NE 2FD6H 5SX4H 3CMGA 1KCRH 1LNUB 1WC7A 5IBUG 5KVEL 3HC0A 5DJCB 5E6IB 1Z9OA 3UYRH 1FPTH 4LF3A 5D1XC 5FV2A 4X4YB 5B3JF 2R8SH 5FCUL 3ZMRA 4LAJH 3RL2A 3Q2CA 1S9VB 4FFYL 3EOBA 1I7ZA 1AFVH 3VWJB 3TZVB 1UKSA 4KJWD 4ZMAT 3S5LA 3L7EA 4ZUVA 3LMJH 3VFGL 4PJCE 4HSQA 3QDJD 1NCNA 1C5DB 3S34L 1F90L 4JDZB 2HJFB 4ZTOH 3MRBA 3MUJA 2AI0L 2FHFA 3RWCA 5EC1A 1MFDH 1DCLA 3D3VE 1U8JB 3EFDH 1WAAE 3IGAA 2I07B 1SJEB 2HLAA 3EYOB 1DQJB 1TCMA 1MIEL 3QO0B 3GGWB 5IK3A 3IDGB 4M6MH 1YQVL 1MCWM 5F7KC 4G6KL 5BRZA 3TCLB 4P3WA 3RUGB 4NHUB 4LRIC 2F8XC 4DZBB 5MENE 3JWDH 3HI6H 3L3IB 4NT6B 3RVWC 4H0HB 4Y4HD 4JHBA 2H2PD 3KYMA 1MVFA 4X5LA 2VRAA 2A6KA 4KI5F 4UUJB 3IDNB 3MREA 2F9BT 4C59B 2JJSC 2EXYD 3H9HB 3M07A 2WP3T 2CR6A 2YD7A 5I15H 5IQ7H 1J1OL 2VXQH 2XIDA 2HT3C 1IGJA 5DUML 2FHBA 5FOBB 2HN7B 2DLTA 1C5CL 1YDPA 3RL1B 5HVWA 1UWGH 3HN3A 4XMPH 2C5DC 3S4SG 4WU7A 3RDTA 4I9WE 3JV4A 4G6ML 2NX5E 1WBZA 2OJZH 1YN7B 4PJDB 5C70A 5JORB 4OLZH 3SKJL 1KOAA 3HHRB 4X5XB 4OCRL 3H0TA 4XCCL 5I1AA 5KTEL 1A2YB 4KHXH 3NACL 1LE9A 4U05A 5EUOB 4PJEA 4PJAA 1AH1A 3ARDD 1NLDH 3P4OB 2VDNL 3UTTD 1TTGA 5EZLA 5FUOH 5DK2B 3N50A 1R3JA 4GMTH 3EOAB 1PYWB 5DSCB 4P2CG 1MI5E 4LPVA 2CLRB 4NYLB 3NVQA 4PJ5A 5IHZA 1PZ5A 5CZVH 1MREL 2QR0B 4R2GD 5DZLA 5CJXC 1F4HA 3ARGC 2LV4A 1T0MB 1RZIB 1PKQB 2HJLB 4NKIH 5HHPA 1AJ7L 2WWKO 3DJ9A 1MLBA 3ULVE 2BNUB 3BESR 2X9XA 2AW2A 1KNOA 3CK0L 1NGPL 3N1MC 3QXWA 3T3PE 4N9GA 5ALBL 1AGCB 3ARED 1DQML 3VXOB 1KLUA 3BMVA 4JZNA 1A1MA 1OSPL 4HCRA 1Z5LB 4NP4L 2X41A 3DYPA 1RSFA 4O2FA 4TUKL 5KSUA 2B7DT 2HJKB 2P8PA 3DVNA 3DV6B 3GMRA 3KPSB 2AEIT 3T2OA 2BFVL 1KB9K 1MJJB 4P2RA 4B7LA 2HH0H 5LJYH 4UI2A 2BHYA 4FTVD 2H1PL 4YE4L 4PV9B 1YYMH 2YHGA 4X6CA 1QKZH 4HWUA 1BJMA 4H0GA 3PWLA 3AS1A 2ADJA 5EOCH 5TDPB 3INUH 3KXFA 4XCNB 5T3ZL 4JZJB 3IJHA 1LE5B 3LD8C 3FAXA 5KZCB 5SWSE 3V4PH 3MV7E 5DUBB 5GSVA 3HE6C 1BEYH 4MJ4A 4N0CC 2W0FA 3LKOB 4C4KO 1KB5B 5GGQL 2UYLB 3MBEA 2YPKB 4QKXB 2DQEL 2UWEE 4JFQA 2D31A 4YDLC 3ZT5A 4B41A 1GVIA 4G6FB 1F4XL 1VPOH 3CAFA 5KS9E 4S10A 5KVMC 1I4FA 4KROB 4LLUA 2D7NA 1E6OL 3V95A 1R3KB 3F7VB 4X7EC 1I9IH 3HMXH 1ZA6A 1XCTA 4KJPD 3QG7L 3QIWC 4LQFH 1Q0XH 1FORH 4Z7OF 3QNYA 5C0AD 1CR9L 4ODWB 4Y4KD 3BSZL 1JHTA 2YZ8A 5CEXA 1NCWH 4FQ1H 3S36L 5FM5O 4PB0H 1DR9A 4BKLB 5AEAA 4Z0BH 3RQ3A 2Y07L 1PLGH 4XH2A 1UWEL 4GXVH 3RIFK 5CHNA 3FB5B 3SDAC 2FBJH 2CIIA 1CG9A 4JRYB 4KJYA 4NOBA 4P5TA 1T3FB 1ZVSA 4POUB 4JO3L 5GXBB 4MD4B 2X6MA 2YD4A 3B5HA 1J8HD 4EVNB 3QFJD 1YECL 4U2ZA 5HYJA 5LGJB 3UTPD 3UXFA 5FUZH 3GB7B 4MA7H 2AJSL 5F96L 2EDQA 1DFBH 1NAMA 4X6DA 3T4YB 1NJ9B 2AK4D 4NDMA 5IBTL 4P57B 4MAYC 4G8FB 1GHFL 1FNEA 2Q76A 1I8IB 1OAXL 3C6LB 4GAGH 5FO9A 4XP9L 5F44A 3HRPA 5C7XL 3B5GA 5HI4D 1VADB 5BS0D 1OAUL 3VGEA 2E7CA 3BKJH 2X89D 3BQUB 5TFSL 3SGKA 3TO4C 2VKXA 5IG7B 1B0RB 5DXWA 1FIGH 4M93C 3ULVH 1BD2B 1I9JH 4MNHA 3DWTA 4GW5B 1CQKA 5FA4B 2JKXA 1IT9H 1A7RL 3GRWA 4YHZL 4S1RL 4P3CH 2A6JA 4UV4L 3HA0A 2I9TB 4FP8H 1FGVH 2VKWA 1IQDB 1UCBL 2BK8A 4CW1B 1F4WL 2NR6D 5D1XA 3FN3A 1J5OL 1H15A 3U4EB 3IAQA 4XVJL 3VFSA 1SYSB 4N8CL 3IFLL 4DW2L 1NEZA 1HSBB 4NKQB 1NCDL 1ONQA 4G6JH 3RGVC 5T5NF 1S7RA 3BP5B 2ERJB 2DI8A 4O4YL 1QA9A 2BERA 4NWTL 1YY8B 1IQWH 3PWJB 2OTUA 4YDJA 2HWZH 1MRFH 5JXED 2DIAA 2ZP0T 3SOBH 4OB5H 4F7PA 4I0PB 2YPLB 3E3QE 5HHOD 2ICWI 4P3DA 4PRDA 2XICA 2N7BA 4IJ3B 5JHDB 4Y8AA 3RFZC 1QHOA 2ADIB 2WUBH 2X70B 1N64H 3QG6B 3X14A 5I66B 3TJEH 4K9EL 5GJTH 3CFCL 2X4TA 4JRXE 3RWHB 3TIEA 2QKIA 3ZL4H 4O5LL 3ZDZE 1X4XA 3AU1A 2VDLL 3VXSA 1X4YA 1RZJC 1OTUC 1XH3A 2BSTA 4HMDA 5HHME 1NCAL 5ENWB 5ESAA 5E8NB 4PTUB 5K9KB 5EUKB 3BZFB 3E0GA 3I9GL 5D6CA 2GJ6A 4M1DL 5DHVA 5FFLA 1MRDL 4B5EA 5L8KB 2DQHH 2P5ED 4DGYL 3WXWL 3MV8A 5KG9A 3BWUC 5FB8A 4ZXBA 2EDLA 4XNUL 4HCRL 1KJ2A 4O2EB 1XGRB 2CK0H 3HR5B 3V5KB 2JJSA 4U6VH 3FOMA 4PP1C 1CXHA 4X6EB 5B8CA 4WENB 2ZPKH 5F89A 4KTYA 2DTSA 4QOKD 3DXAB 1S8DB 3MR9A 5D7LE 4NKDA 2XTJE 4EIGB 3W0WE 3AS2A 3FB8A 4L3AA 3VH8G 1C5BL 3ARFC 4OFDA 4X83A 5JR1L 1VFMA 4MXVF 3WKNA 1WZKA 3FL7A 1JPFB 4FQPA 4LBEA 2MKLC 4XMKL 5ADOL 4PY8J 1FZKB 2X4PB 4NNXA 5KVDH 3GIVA 4F57H 3D85D 5T3ZD 2YXMA 2AKRA 2UUDH 2P5WE 2NW2A 4APQA 4RZCB 3MYZA 1FO0A 1NMBH 2MMXA 4L8BB 3O41A 3LN9A 5HHXH 1AO7B 12E8H 3CU7A 5D8JH 3TYGL 4LMQI 3ZKSD 2PXYC 3C6SA 1HH6B 5D1QB 4KK6C 5ICYB 3PWNA 1TVDA 4OZHF 5T1KA 1RIUL 5CD3A 4X7TB 3NAAH 3I75A 3FQTB 2HLFD 4OGXH 1P5UA 1AY1H 3K8KA 5CJXA 2YRLA 4OGAC 3ARGA 2RFXA 2VDKH 5DJ2B 1F2XK 5D6DA 3WFDL 4H1LG 3FT4A 4CL7A 5IHUL 1JFQH 5F1KC 2VXTH 1F3JB 4TUOB 2PN5A 4GQPH 3IFPA 2W9DL 1EEZA 4OF5A 4G6AD 3WN5B 5EU6E 1UM5H 2IH1B 1MH5B 3T08A 1GGBH 1PGRB 5JHLL 1EXUB 1CXEA 3GSWB 4NNYB 3X13A 3QI9C 4PJCB 3GK8H 4WW2C 2VXVL 1WWAX 5DRWA 3R1GL 1YZZA 5ID0B 3ZDYF 4YXLH 2PO6B 4P46C 1NAML 4AG4L 3D39A 1I7RB 3MLWH 3JVGC 3BDYH 2YEZA 2Z92A 5ID1A 3LS4L 2B5IB 1MHPL 4OM0L 4HLZH 1H8OA 2W38A 4UQ2A 4HWEH 3HE6A 1M71B 4NO2B 1LEKA 4Z7VA 5DT1L 2BY0A 1T2JA 3FJTA 1R0AL 1Q9WB 5BRZD 4YHKH 4U1NB 15C8L 3L3GA 4TVPL 5CJBA 3OF6A 4XXDB 1A6PA 3FQNA 1NBYB 4XCEA 1KCUH 2B1HH 3PWVA 4YPGB 4U6YB 5JOFB 5IB1B 4Y19E 2A9MH 5MENB 5E8PA 1RK1B 4JVWA 3MRKB 5D93C 4ZNCD 3W9EB 3C60B 4RMTA 3FMGL 1PG7X 2GTZB 1MAKA 5EWIH 4Y5VB 2CR3A 3MLZH 4NRYA 4G7YL 2NXZD 3KHQA 5IFJA 3RY6C 2BVOA 4MA8L 2NY4C 1AC6A 2NY6B 2OZ4H 4MNQB 1DN0A 1OLLA 4PYGA 1V7ML 4EI6B 5IMLB 5HGDA 3BD5A 4R3SB 1QBML 1GH7A 2ICWA 2X1OA 5E8EB 2JELH 2Z31A 2BVEA 5E2WH 3QAZC 4FXLA 4KQ4H 1M6OB 1IGMH 3RTQA 4UV7H 4WI3A 1CFNA 5DMGD 1T4KA 3NFSL 1CL7H 5K93A 3SDAA 5I1LB 4AEIH 2NX5B 3BPCB 2Z91B 4X99B 5FUCC 3IDMB 3MRRA 2DWDB 3ULUC 4NC0B 4ERSL 2IANE 3QQ9D 1CBVL 2BDNL 4Y5YC 3CPLB 1U8PA 2W60B 3ARXA 5DD0H 3OAUH 4YBQC 1A7PL 3ALWA 1FCCA 1TJGH 1IC1A 1EFXB 4OCMC 1V05A 1U92A 3MZTA 3B2UD 1N4XH 4MAYA 3BAEH 1CWVA 1CFSA 3RPIB 3C5ZB 4GW4B 2ARJB 1HE7A 1MI5B 1WGOA 1BVKA 3MOBL 1E6JH 4PJ5D 1HXMB 2AJUL 4ZSOA 1CXLA 4O2CB 4CVXB 1DE4A 1KIQA 1F02I 5IVOA 1PG7W 5SX5H 5CGYC 3SCMC 4CRPA 2DBLL 3C2AL 5EOTA 2DBJA 3FCTA 3PQYA 4U1MB 5EZJB 5IHBA 2BOBB 2DAVA 1IEAB 5L2JB 3ZYOA 1KJ2L 1SYVB 1N26A 1H0DA 4HFWB 4HZAA 4PB9L 4GKNB 5DJAA 5F3HA 3TLRA 3QDME 3GUTA 1G9NH 4GRLD 3CLEL 3W39B 3FAWA 3GI9L 3CXHJ 4RQQA 4K7PH 4YWGH 2X09A 1TJHH 1DQTA 3RWJA 2ADFH 3EO0B 1JPST 4E41E 2Q3AA 2GFBB 4P59H 4Z76B 1IZKA 1ZSDA 2R0WH 4GRMA 1QLEL 3EYUL 3WXVL 4HPYH 3M8OH 5J3HC 2C3VA 4XVUD 4Q9RH 1Z9MA 3MV01 2VH5H 4Z7WE 4UTAH 5DD3H 4FQLL 3GSVA 4PRBA 2H3NA 1XF5B 4MHHI 4WI8A 3KXFD 4CADA 2LVEA 1SY6L 4L8DB 1MCCA 3G6JE 2RCSH 5ESVB 3DTXA 3FHQA 1RIVH 4JFYB 3CSYA 4QF1B 1FO0L 2JIXA 2PTVA 2F54E 1OF2A 3EFFA 1REIA 3MBED 5KJRL 1OB1B 1KTKE 3QIBA 1F6AA 3BKYH 5D5ME 1CF8L 2UWEB 5FYKL 1VACB 2Z4QA 5CBAA 4ORGB 1OPGL 1XCQB 5KS9B 4GAJL 3HG1A 3VI4F 3VFOA 4HS6A 1JP5A 3LKSA 3ARBC 3JV6B 3RHWF 2OTPA 4XP5L 1NSNH 1D5IH 2GITB 2I27N 3T8XB 5DR5L 1BGXH 1ACZA 5J1AB 4YHPA 3SPVA 4NZUL 4M48L 1RUAL 5I1JL 1WWCA 4KJQD 3QDGE 5IVXE 4CVWA 5K9OA 3OR6B 2HFGH 4FQQA 1B4RA 3ZSSA 5AAMA 1DLFH 5E4EC 4X5WB 2QQQA 4KRPD 4J3VA 4C56A 4YUEL 3NA4A 3S7GA 2XN9A 2XT1B 2IPTH 3MRJA 3UCRA 4P5TD 3OV6A 3DOSA 4RISL 3BXNA 1ES0B 1CE1H 4PRPA 4NFDA 3S9DB 3Q6GL 2MSPA 4JN1H 1WWWX 4NBYB 3HS0A 5HYJD 5F6HI 3R8QA 2GCYA 3ARFA 5FYLE 3AUVA 4BUHA 5CEYA 1KJ3L 3ARRA 2WUCL 4J6RL 3RVXC 2QQKL 4OZFG 1G6RB 1PD6A 4JPVH 4AEHL 3GSUB 1LO3H 1UYWL 3V6OC 3EAKA 5ICZB 2P8LB 1W0WB 3HAEB 5JIKA 1RVFL 2OTWB 4PGDA 1YNLH 3VGHA 1TJIH 5L2KB 2LABA 3KS0H 2O5YH 4ZO8A 1LNUA 3ZHKA 1CLOH 3GJFH 1U8IA 3RIAK 1G7JB 4PJHE 2H8PB 2PNDA 4G43B 5DA4A 3BPOC 1M05A 3DO7B 4OV5A 4MB3A 5DEGA 2FNBA 3MLRH 3MNVB 4X4YA 1MFEL 5TQ2H 1FBIH 4M5YL 4JJ5B 2FSEB 5I1HL 1IGTB 2NY2B 5ISZA 2ZCLL 1FZJA 1P4BH 4TN9A 3HZKB 4DGVL 2WV3A 3OKNB 4OGZA 3SE8L 2V2TA 2A77L 3W82A 1ZHLA 4JDZA 4I5BA 5D1XD 3KPNB 2G2RB 3T0EC 4LSRH 3FO0L 4LLVA 3FN0L 2E5EA 4BZ2H 3QB7C 4M4RA 4ONGH 1EMTH 1ZVHA 4ZOBA 4F80A 4AMKH 4WUUE 5TDNB 1DBAL 1U8JA 2IH3B 5KSBB 1SJEA 2DLFH 1YEGH 5BW7A 4S0SD 4ZPTA 3NFPB 3QO0A 3GGWA 3SE3C 4WFEE 2X4RB 3IDYC 3IDGA 4NC1C 1A1NA 3G6DH 3MLVL 2NY1B 3KYOB 1AD0A 2XPGB 2MQCA 1IEBB 5MHSE 5ANMA 3VXRA 3JVGA 4S1SH 2D2OA 3LPWA 1JRHH 3FOLA 3SKMB 1JNJA 3GHBL 1HNFA 1P7QB 1DUZB 3L3IA 4NT6A 5KANI 3QBTB 1VKXA 1E4XI 2X1XR 1JV5B 2BSRB 2BY3A 4LSVL 5H2BB 5HHMB 2PR4L 3V0VA 4JM4H 5C3LD 3VMNA 4K3EL 3TNMA 1A21A 1DJSA 4NQCB 4LPTA 2GJ6D 1I7TB 1ND0A 3IJYB 4LNRA 1N5YH 2XZQH 5GRWA 3MV8D 4ZXBD 5FOBA 2HN7A 2WBKA 1EBAA 4OFVA 5IB5B 1XF3B 3WD5L 2VDPL 3RL1A 5F3BB 3F58L 1ZLWH 2V17L 3PL6B 4NQVA 4TNVK 1DBKL 3U0TB 3LZFL 3MCLL 2UZYB 2GY7B 5DMJB 1AE6L 4KC3B 4CN4A 5JORA 4WY7L 3WKML 3UJIH 2G5RA 3MXWH 4X5XA 4LGSB 4CJ1A 4NGHH 4HK3N 2C7UA 2RIKA 4J3OC 3MV9E 5D7LB 4WRLA 1KC5H 4OQTH 5LCVL 2UVFA 4PJ8C 4PJXE 5EUOA 4OSUL 2FGWL 3QUYB 1WLHA 1H3UA 1JF6A 5GIRB 5KVFL 1I3VA 5DK2A 4M43H 3VXME 3EOAA 5LBSL 4N0YL 4XWOC 4RWYH 4ELKB 4B53A 5HYSG 4JDTH 2PTUA 1WCBB 4Y5YA 4XXCA 3X3GH 4L4TA 1B4JH 1TETL 1ITBB 4J3XA 3CUPB 3WBDA 4OD3L 3GKWH 1TQBC 2MCPL 4MCYB 3TN0C 1T66C 1T0MA 4RRPA 3IETA 1T21A 4KUCD 1MRCL 4ORZC 1A4KB 2OBGA 1DVFC 2B0SH 4F9PC 1RZJL 1KIRB 5FYKD 2W91A 1U8OB 5T1KD 2JB5L 5I8EA 1J0ZA 3IFOA 4HXBH 3VXOA 1U93A 3RU8H 4XBGB 3ARGD 1OOAA 2HJKA 2H9GB 3DMMA 4JRWA 4P99A 2XTLA 3C5JB 4OQ1A 4M8VA 1JF5A 2VOTA 2EZ0C 2YK1H 3MRMB 3DV6A 1A6ZA 1WISA 4UB0L 5EO1A 2EE6A 2EDBA 2E9IA 4R4NC 2HT4D 1MJJA 1F8TL 4KDWA 1XZ0A 2A0LC 4BSWB 5JNYB 4D94A 2K9UA 4TUJB 1U8HB 4U3CA 2VDRL 5EU6B 2FX9L 1JNLL 3QDJE 4EKXA 4UU9B 5C8JB 4XCNA 3VU2A 4M6NH 3LH2H 4S0TD 1IC7H 1P2CA 4WWKB 5DJXB 3OL2A 2ZSVA 5DUBA 1CLCA 4M3JA 2VAAA 3WFCL 6FABL 2E8YA 3V9FA 1TITA 2IQAA 3N1FC 3D39D 5TE7H 5HGHB 2YPKA 3S3PA 3T2PA 1NBVH 4P2OC 1LP9F 2DJ4A 4B0MM 1J12A 3KNBB 4LHUB 4XNXH 5E8DL 3KR3L 3A6CL 5EBLB 4ODVL 4F9LC 2EDDA 5L6YH 4JHWL 3OJVC 1XF2B 3Q3GB 3B9VA 3HE6D 3VDBA 4JPKL 2DQJH 5DD6A 2YN5A 1R3KA 1HH9B 1JZ8A 3F7VA 1H3XA 3CMOL 4NQXB 3OF6D 1I9RH 5EULV 5L9DL 4Y19B 1FVDB 3NCYP 4ENED 1UXSA 3BP4B 1PW3A 4ODWA 4OZGA 1KEML 3ARBA 5F7DB 5BXFB 4ZNEA 4LEOB 3RY5A 4BKLA 3H3KA 2FATL 4MCZA 3DX9B 4LSQH 4GG6A 4ZOCA 5F6IC 5BOZG 4R97C 5CIPH 3CVHB 2W0KA 5C9JA 4N5EC 1T3FA 2ENSA 2LQRA 4X7FC 4MD4A 4ZG1A 2Z31D 3CDGB 1V7NH 5T1DH 2NYYD 4QXUH 2CDEB 3P0VL 4PR5B 4L8CB 5LGJA 3B6SB 1QFHA 3W11C 3GB7A 1RUKL 4K71B 3KPOA 5HVHB 3SDAD 3T4YA 2Q8AL 1NJ9A 1TZGH 3B83A 1FJ1A 3H7BA 1KBGL 3JWNC 4DFIA 4G8FA 2Z35B 1I3GL 2IANB 4G5ZL 4K8RL 5EU3B 5E6ZA 4MA1C 3R4DA 5EOQH 4WV1C 3UTTE 5D2LE 3NABL 3PXHA 3O8XC 4MAYD 1W72A 5C08E 1AGBB 2J8UF 5JPNA 5HDBF 1P1ZB 5AZ2H 3QWOB 3OG4B 1C1EL 4RFOL 1B0RA 4DJMA 2J88L 1L0YA 1PQZA 4WNQB 4Y2OA 3PGFH 5FA4A 1J0KA 2EO1A 3H3PH 3WHXA 1INEH 4PJFF 4EXPX 3O6FB 4BQ8A 2XRAL 1MCNA 3GJFB 3PQYD 4WW1A 1CLYH 1HXYB 1N59B 1A22B 3IT8D 4XPTL 4EI5C 3VW3L 2B4CL 4FFVD 5DWUL 4CW1A 5EU7E 1JPTL 4MXWL 4RSVA 1UM4L 3U4EA 2HTKD 1TVBB 4HDIA 4R90L 3VXNB 4AL8L 4XHQA 1G1CA 4W81A 3QDMB 4DUWA 3TCXA 4Y5XC 2G5BB 1A02N 5KSAB 4NO0B 3RZCA 2HYMA 3S88H 4E41B 3PWJA 3T0EA 3O11B 4XI5D 5GS2H 2IAMA 1TMCB 2QQNH 1FSKC 2VLRB 4HGMA 5FYJL 3OR7B 5B39A 2W1NA 5EBWB 5EU5B 4Z7WB 4JFDA 5A16B 4AJ0A 5TH2A 3ULUL 4Z8FL 4D3CH 5I1EL 3RWEA 3VDCA 4BQCA 2KDGA 2VXSH 4FABH 3SE3A 4KDTA 4HHAB 1GPOL 3C09C 4GQ9H 4JO4H 4R4FH 4S2SA 2FCBA 1ZLUK 3O0RH 3BP6B 1MCEA 2JIXD 4ODXA 3H9YA 4KK5D 3UDWC 5ENWA 1HINL 4L1HA 4O02L 5E8NA 3LKNA 1Y18B 1MIML 5K9KA 1ZTXL 3QIBD 5EUKA 3N0PB 3PDDA 5D5MB 5EIIB 1D5BA 2EYTA 2DTMH 2YS4A 3P73B 4NN7B 4D0DB 3ZDXE 1GGTA 3GNMH 3GBNL 3VD9A 1S78D 3HG1D 3IDXH 1Z0MA 5F6HJ 3T0XA 2ZOLB 3HRZA 2Z8SA 5IVZA 3JUYA 1EHNA 1XGRA 32C2A 4KKBD 1KEGH 3HR5A 4RFNC 1FNGA 4HC1H 5D7IF 1ZGLM 3MGAA 5C0AE 3Q48A 5D2NE 4PJEF 4PJAF 2Z8RA 4UAOC 3RWFB 2O93L 4OD1H 4G80A 4UOJA 5FO8B 3QDGB 5IVXB 2IQ9H 3ES6B 1G7PB 1YEFL 2DD8L 1NGYB 1S8DA 1KGCD 4OTXH 1VEOA 4G42A 2R29H 3NZHH 1JYVA 4OJFL 4PP1D 2DDQL 2XN9D 4IIQC 4N0FB 1J8HE 3WUWA 1Z9SA 4RIRA 3QNZA 1FZKA 1DLHB 5ILTH 2X4PA 4MVBD 3MLXL 4PRPD 5BO1H 3OAZK 4PJ8A 4RGOH 5I74C 1DQLH 4M7ZB 1FZMA 1X5XA 1H3TA 4JKWA 5HGAB 3ARFD 1U8LB 4OKVB 4MHHG 2AK4E 2HFFA 1JMZA 3IJSA 3X11B 4H88L 3SDCC 3OJ2C 3WJLC 4UINH 1BM3L 4ZUSB 3GHEH 1JZ7A 5KW9H 1HH6A 1L9NA 3MYJA 5I16B 5DVLA 5ECJE 5FGSA 4TSBL 3AAZB 5DS8A 4X7TA 3MODL 3FQTA 5BS0E 3HMWL 3PGCB 5HI3C 1BMGA 4OLUL 5FO7A 5JLZA 4BZ1L 5AWNH 2WNGA 3DUSB 4PJGA 1J18A 5DJ2A 5I75B 5DFVD 2B1AL 5BV7H 4LCYB 4KK6D 3KJ4B 3E6HB 4PJHB 4WUKL 5L88L 4OFKA 3DARA 3NH7L 4HIJB 4PUBH 4TUOA 5GGRY 4JFFD 3OB8A 4OGAD 4U0QB 5ISZD 1NDGA 2IH1A 4ODHL 1S3KL 2Y7QB 1YJDH 5HSFA 5HHNB 3HZVB 4XPBL 3O2DH 2WZPD 1EXUA 4WCYL 5FHAH 4NNYA 4D0CB 3KLHC 4RRPG 4O58H 1N0LA 4XPGH 2EYRA 2R2HB 4F3FB 1CICC 3MRHA 5BZWB 4UOW1 2PO6A 4LVHB 3TWCH 1F45A 1E4XL 3OB0H 1GXEA 1O0VA 4NZDA 3WLBA 4H20L 5C0IA 4XP4H 4M03A 5HHOE 3UTSB 2R2EB 3MUHL 4AM0B 3ARUA 4O9HL 5FF6B 4ZFOB 1Q9WA 3ARVA 3VWKC 1U95B 3VXRD 4OLEA 4K8RD 4XAWH 2NY0D 1W72L 2YRZA 4XVSL 1BAFL 2QLVB 5JOFA 4YPGA 1RZ7H 4F9LA 4QTHA 2Q1EA 2F19H 2AV1A 3O3EA 1RK1A 4PJ7F 4HWZB 4UQ3A 5HHVL 3ZYZA 3C60A 5GGVY 5DRNB 1R3HA 1AXTL 2ATPB 1F58H 2OM5A 2J5LC 1AHWB 2A9NL 3C08L 1C8PA 4XPHL 2XQBH 5GGTA 1YEDA 1NBQA 4MNQA 2CJUH 4ZFGL 3T2NH 1UZ6F 5IMLA 2JTDA 4F7TB 2BRRH 3FT2B 3T0AA 5F9OL 1E0OB 3ZTNH 2LVCA 1OAQL 5GZND 1BBDH 1SHMA 4LCCC 2MTPA 4HT1L 5GGVL 1M6OA 2NY5C 4MWFB 4EN3C 4XTRC 4KQ3L 3U7YL 5MI0C 1S5IL 2NY4D 3GBMH 1U6AH 1MHCB 1BOYA 4YHIB 1IMHC 4Z7QF 5IEHB 4YIQB 1NBZB 3NTCH 3BP7A 3BPCA 2Z91A 1TFHA 4X99A 3QCVH 3MA9H 5IMOA 2DWDA 1Q1JH 1FFPA 4WTXA 3BEVA 3WIFA 5JA9A 2R69H 5HYQB 5I0ZA 1ADQH 3I2CH 4NJAH 43CAA 1C16A 2VDOH 3VFWB 4PJXB 1MNUH 4GS7C 2AABH 2DMCA 1MJ7L 3EOTH 3NZ8A 3MJ8A 1KCVH 4X80L 3GSNH 2XWBA 4PV8B 5EO0B 5HDOA 3QCTH 3VJ6A 3RPIA 2EDXA 3L5XL 3VRIB 3C5ZA 3VGAC 1VFUA 2GTWB 3LHPH 4XVTL 3ULUD 4R7NA 3VD3A 1INDH 2FEEL 2IPUK 3MRFA 1M7XA 4L4TD 4MQXC 2M1KA 3MRCA 1I8KB 2X7LA 4YBQD 4CVXA 4U2YA 1WICA 3ECBA 1R3LA 4HS8L 1BX2A 4HS3B 3OG6B 3SDXE 3O8XA 8CGTA 4DEPC 3FB7A 5KANG 4YDVB 5HHQB 3REVA 5EZJA 2A83B 5DJYB 1FYTB 1IEAA 1IARB 3RJDA 2X4UA 2FX8H 3T1FB 3CZJA 4TSCH 5E7BA 2AJZB 4ZYKA 2LU4A 2QADC 4LRNH 2NXYC 2JJTA 4P2QE 2HRPL 3BKCL 5SWZA 3SCMD 1FL3A 3I3DA 3GMMB 5L8LB 1HKLL 3MBXH 4FQCH 4F7MB 2MOVA 2VLKA 4EI5A 3K7UA 3DMMD 1Q72L 2Y36L 3RIFF 2GFBA 1OARH 5CWSA 4OV6F 4OZIF 4FN0A 4QHMB 4NSKB 3C9NB 1R5VA 4CN6A 3KJ6H 4Y5XA 2FJHB 1DUYA 3K80A 4ETYA 5D71L 3SKOB 1YEJL 3LV3B 4HJGB 4I18B 4LDEB 3MJ9A 1NQBA 4R9HA 3UBXI 5LQBL 4NBZB 1T7VA 2EDNA 5ESVA 2CDFB 1HHJA 4X4ZA 5T33L 4ZPVA 4JFYA 5KZCD 1SM3H 4GKOA 4QF1A 5DQJB 3DETC 5J3HD 5ERWB 3VFMB 2UVEA 4KAQH 5I1CH 1YNKH 2AJYL 1K6QL 1OB1A 3MXVL 3TH2T 4PJIF 1YN6B 1QD0A 3ETBF 4XCFL 1U42A 2WW8A 5DTFB 3QUMB 1BJ8A 2IFFH 4HKXA 2APXA 2VWEC 4J2XA 5BRZE 2GY5A 3U30C 4KROD 3CZFB 1BIIB 5H35A 4KMTL 4Y16C 3AB0C 5IT2H 4MXQD 5B39G 1CFVL 4BH7B 3WO3B 1TZIB 3T0DA 5IFHL 3P0GB 4UNUA 5T1MA 2IMMA 5J1AA 3B8SA 5E9DA 5C6TH 5IB2A 3OR6A 2XNAA 3ARBD 3TBSB 4H26B 1N6UA 4C54A 4X5WA 3S3SA 1J05B 5AZEL 5J13C 5E6IC 3RI5K 2A6DB 5E2VL 5CP3H 4OBRA 4MAUL 1WEJH 5FM5M 3HR6A 4DKEL 2D7QA 2ITDB 4MX7B 4U3HA 2NY3B 1LO5B 3IU4H 4XC1L 1A5FL 3L3DA 3LRGA 4M61A 3VWJC 1J0JA 3U6RB 5LAXA 1U3HC 4JFHD 5FA3B 5DK0B 3RBSA 1QNZL 1KJVB 3QIUC 5HPOA 3G04B 4JO1L 1JGDA 3OMZA 4I3SH 3MRDB 1JZ5A 2NZIA 4NO3B 1UJ3A 3HCVB 3ROLA 4NC2B 1W0WA 3ARDB 1MPAL 2EIZB 3HAEA 3ZKNC 5IBUB 3UTTB 5J11C 3EUUA 3WJLA 3LDBC 4PJ5E 1OCWL 2X5PA 2BZDA 4NPYB 4LLWA 5E2JA 3WUWG 1JPSL 3WFEL 4G43A 1JZ3A 3WV0A 5D7KD 3QRFM 5F1NB 5GGTL 2FBOJ 5DEFB 2AJ3A 5E2UL 4CMMA 4JCLA 1G7LA 1EO5A 1E4KC 4UT7H 1MF2H 4I77H 1VDGA 4J1UB 4N0RA 3MLUL 1DQDL 1S9WB 3GKZA 4FQXC 2X4QB 1WBXB 3RWGA 3KYAA 1KTLA 4R26H 4XNZB 3AREB 2Q86A 3SDDC 2XQYG 4P9ML 5IMMA 2FWOA 3P4LA 3HUJF 3PHQA 1NLBL 3PHOB 4MQSB 5JOPE 2YMXH 2IH3A 2VAJA 3MO1B 5E7FA 4GH7B 4P9HC 5TDOB 1S7VB 2WIMA 5KSBA 3WYRA 3RZCD 4P2RE 3NFPA 3WCYA 3I6GB 4FTVB 3T0ED 1CICA 4L3CA 2ZKHH 4XPAL 3IS1X 2VABB 2IAMD 4X6CE 5E03A 3QHFL 1IEBA 1RZFL 3S36X 3P0YH 1Z3GH 3U0WH 4JFDD 1ZEAL 3SKMA 1U8KA 3OKOA 5I18H 3H9SA 3QHZL 3DIFB 4EDWH 4JM2C 1P7QA 3KPMB 1DUZA 3BZ4B 1WCQA 1JV5A 2BSRA 3O2WL 3STLB 2Q7NA 4K2UL 2Y06H 4PLOB 5BVJA 5H2BA 5DZNA 4JE4B 1UM6H 3JWOH 3QEHA 5FOJA 1CGSL 3SGJC 1RJYA 4RCAA 2W9EL 1FNSL 3QNXB 4HFUL 2J1KA 4G3YL 1T1XB 4ZUTB 1DP0A 1C08A 3S4SB 5HVFB 4EXKA 3IFNH 2I9LA 1A6UH 1T89C 4POYA 4FNLL 1FGNH 5HDLA 2FIRT 1XF3A 2F58L 1IAKA 2OL3B 3PL6A 4YC2B 3UBXA 2P46B 3MSPA 3U0TA 5C2BL 3BYYA 4LCIL 3RNQA 4PLJD 5TPWH 1QP1A 4Y4KB 2DLGA 3SQOL 2FYYB 1JCKA 3P77A 2FLBT 4EN3A 1MCIA 1DL7H 1OAKH 2R1XB 3VGGA 4YXKL 5HPMB 5ALCL 4HX1A 3QA3B 1MVUA 2LU3A 4KRLB 3FQWA 3BEWA 3EYFB 4MZ3A 4JGMA 3QUYA 3OJMB 5GIRA 5DD5L 1NCTA 3WFHB 3QFJB 2OJEB 4L4VA 4ELKA 1UACL 5HYJE 1B3JA 5E24E 3GSQB 4TTDD 4EUPB 1MY5A 2ZSWB 3IXTA 4NM8H 4KHTH 4PJ8D 3OTTA 4X6DE 4JB9H 3BZEB 3LEVH 2AK4B 2YC1B 4GG8B 3EHBC 5F88B 4YHLL 2GIYA 5CJ5A 4Y4FC 4XWOD 2HKFL 3MGOA 4MD5B 4MJIB 4E42B 4FQJH 4G8IA 2OSLB 1FV1B 4IRSC 5CLTA 4N0UB 3O6LH 2UV3A 4KVCH 2ZUSA 2VITB 5BS0B 1LDPL 3TA3C 3BPLC 1T66D 43C9A 5HGBB 5F9AC 1NFIA 3EO1A 3FB6B 1KXQE 1I85A 1U2CA 3L5JA 2VISA 3MRMA 4LIQL 4RFEB 3PE9A 5L0QC 1NGZB 1ZHNA 2MQ0A 4PJ9A 1H5BC 5JNYA 4O51A 4IDJL 1WV7T 5B38A 1DSFL 1ULVA 2AEQH 2IF7A 3VA2C 1K4DA 2DKMA 1EK3A 5TQ0L 4IHOB 4Y0GA 4U1IB 4UU9A 1EV2E 2DM2A 3NN8A 3QEUB 4D9LL 2GJJA 2EZ0D 1GC1L 1MAMH 5I9QB 3C5SB 4R4ND 4MA3B 3OKMB 1TXKA 2H41A 2CKBA 1RZKC 1K4CB 2PO6D 2JE8A 1AXIB 3AY4A 4Q58C 2DF3A 1YEEL 1JZ2A 4HIIB 1NUGA 4ZO6A 2FX7H 4QRUB 1SJHA 3HNSL 4JG1H 5EBLA 3TJHC 3V4UH 1EGJA 5HHOB 2ILLA 1ZT4B 3Q1SH 4JKLA 1MWAH 3U4AA 4I3RL 1ZLUH 1MJ8H 5JXAH 5MEQB 1HH9A 1EPFA 3PIQB 5E5MA 5FYKU 4YBHA 1S7UB 1U3ZA 1FVDA 4EOWH 1J1PH 4ACPA 3VXSE 5D70L 1OQXA 2LAGB 4KGJA 4MLSA 5F7DA 3OX8B 4KPHH 5BJTA 4KY1L 4NRXB 2YD5A 4YX2L 2GJ6E 4ODTL 3CU1A 1WTGT 1N7ML 3BQUC 5ADPL 1P9MA 2P5EB 3CC5A 1IAIL 3MV8E 4NFCA 1V3KA 4CUCA 1CLZH 1UWXK 4I3GA 2N56A 2EDFA 3DHMA 4M7KL 5E8OB 5F7LB 2BC4A 3BIKA 5IOPA 4PR5A 1INQB 3TPUB 2R1YA 1RFDH 3KWWA 1R3IL 4EZMA 3NOIA 4W4OA 4GSDL 4N5ED 4QOKB 2M2DA 4FQ2L 5IEKA 3CDYA 5AYUH 5ETUA 4OIAA 1A7QH 5BVPH 2DQUL 2EYSA 2PCPA 1ZS8B 5EU3A 4PS4L 2IPUG 3W11D 1G0DA 1QLFA 3OAZH 3TEUA 1JGLL 3P4MB 4LLDB 2ERJC 3QIUA 1CDUA 1ED3B 3D0VA 4Z0XB 5C9KA 3MNZB 3D85B 3C5ZD 1BFTA 4F58L 4RX4A 4I0PC 3B3IB 3A67L 3SKUD 5INDB 3K2UH 2AXGA 1CFQB 2VTFA 4NHCH 4L8SA 2BVPB 3O6FA 3O8XD 4LASH 1BFSA 4JKKA 5FYKE 3QUYD 1N59A 1T1ZA 4ONHA 2AV7A 3R8BB 2IALA 3ARWA 4K23H 1C12B 3FRUB 1AGFA 1HHGB 2FJGB 4WW2F 2BMKA 2I26N 1HHKA 3FQRA 4ISVA 3VXNA 5C71A 1KCKA 5CMAB 1N2RA 1BQLH 1P4IL 2ZNWA 4LSUL 4HH8A 1H8NA 3JWDC 4PG2A 5SWZD 1WT5C 2PF6A 4DVRL 3GRWH 2CLVA 1YPZF 2BHUA 2G5BA 1MFBH 4FQXA 3S37L 4LF3B 1WZMA 2VLKD 4EI5D 2NY5L 5D4QA 2HVJA 4I48A 3RL2B 3I85A 2VLRA 4KRNA 3EOBB 4XNYH 4N90D 1J8KA 3CCHB 1JIBA 3S5LB 3VD4A 3L7EB 4ZUVB 1WZ1H 2AJVH 1YEHL 2KQMA 3HNTL 1GZQA 2I25N 5E99L 1TQCB 3VXUA 3RWCB 4HHAA 5EC1B 1EH9A 1FRGL 3FO1A 3D39E 3QP3A 1NFKA 3WDIA 3IGAB 1AQKL 3O6ML 1QFWL 2FLRT 3V52L 5JW4Q 1Y18A 1A9BA 3LKQB 1LO0L 5SX4I 5I1IL 5EIIA 1FNFA 5JMRA 4TULH 3U9UA 4HV8A 5IK3B 3P73A 4XX1G 3BH9B 1XMWA 4Z7VE 1A6VL 2VDQH 4LARH 3DYMA 3TT3H 2H32A 1NMCB 1JHKL 2VB5A 2ZOLA 4HIXH 3RIAF 4KV5F 2YBRA 3MLYH 2R56L 2DQIH 4X9IA 4JFEA 3ARSA 2ZCKL 4M62H 3W9DB 4QCIB 1Y6KR 4YO0B 4LP5A 3KYMB 1QSFD 1NMAH 2JJUA 2XA8H 5E9DD 3VH8B 5CD5C 1EEYA 2NXZB 5C09B 1LO2L 1T89A 2A6KB 4YZFE 1FAIH 5T5FH 1FN4A 1NGYA 4A6YH 1QFUL 1RK0B 4IRJC 4X6BA 3HB3C 4WWID 1RU9L 3UYOD 3WFBL 4BELD 3MQIA 4ODSH 2E7HA 4F7CA 4ZQKA 4LVNC 1XF1A 4J7RA 5F9WB 1CXIA 2CKBL 2E27H 1NGQL 2BNQE 1YDPB 2GHWB 3MRLA 4LP4A 4WO4A 5IFAL 3UPCA 4M7LL 3ARZA 4WU7B 2OI9B 4E5XA 1KLGA 3WN5C 3TT1L 1U8LA 1WBZB 2W65B 1CDHA 1OAZH 2YD9A 3WJJC 4Q7DA 3UBXG 1L7TH 4FZEL 5K9JH 3QWQB 1ZWIA 3H0TB 2DQGH 3LEXA 1YMHB 4U0RB 3WL9B 5I16A 2JJVA 1LE9B 3AAZA 4PJAB 2F5BL 4PJEB 2BJMH 2ZG3A 4H1LB 2KQNA 5KVGH 3GIZH 3PGCA 5EZLB 1R3JB 2ZJSH 3QUKA 3DUSA 4ZTPH 2MQ3A 3TV3L 5IHZB 1BQHA 1N0XL 4ZSOE 5AYQA 2EDRA 1L7IH 1KF9B 2QQLH 4HIJA 4QRTA 1RUML 4PRNA 3TA3A 2A1WH 4U1GC 3PQYE 5DI8A 2P45B 1MCBA 2ZG2A 1NL0H 3MNWA 4QXTA 4KU1A 5HHPB 3QPQC 3ALXA 1LK2B 4HK0B 3HZVA 4OLYH 1MLBB 1NC4B 2D03H 1T1WA 4TNVF 2IBGA 4D0CA 1KNOB 1Q0YL 4Y5VC 4DCQA 3BFOA 1H5BA 3LS5H 4GRLB 4F3FA 5BZWA 3AXLB 1DBBH 1KLUB 3FTGA 4JZNB 3SQBA 1A1MB 2V2XA 4ETQA 2N4IA 4O2FB 4OZHA 1W2KT 5IJKC 1UH3A 3OPZL 3O81A 2LTQB 2XKUA 3DVNB 3FFCA 4HULB 3GMRB 3AMKA 3KHOA 2R2EA 1CICD 1JNHA 5GRVK 4TSAL 4X6CB 2FB4H 3QFDA 3DX6A 2FH8A 3PWLB 1FNLA 1U95A 4I0CC 2ADJB 2HT2C 4M6OH 3STBA 2AJXL 4FG6C 3KXFB 3W2DH 2G60L 3H9SD 1IM9B 1S9YA 3IJHB 5J56B 2EH8H 2ESVB 1P7QD 3D5OF 3I6LD 2V5MA 4HWZA 3GZKA 3MFFB 4PBWD 4Q6IC 2BP3A 5DRNA 2W0FB 3EYQC 4KVNL 4HIEB 3MBEB 4BH8A 4HXAL 4KUZL 1AHWA 3VWKD 1Y0LB 4IBLT 4JO2H 4HBQA 4JFQB 3PUCA 4HUMB 1QZ1A 4LSTL 1FG2B 2BOCA 1ZLVK 2BCKB 3HG1E 4LLUB 5HY9A 4JR9L 3P30H 3G5XB 5C1MB 4JGJA 3NFNB 1UENA 2GK0B 1RUPH 1PX4A 1SEQH 3PL6D 2NZ9C 4YDKL 2E6QA 5CEZE 4YIQA 1NBZA 5IKCB 3QNYB 4LEXH 5F1IB 2OR7A 4OGYH 1T83A 1JHTB 2GAZB 3ULVC 1IC5L 3IS0X 3D6GA 4RGMB 3UPAA 3CFJA 3SE8H 7CGTA 5JW3H 3GSXA 1T22B 5HYQA 4PGJA 4KRPB 4XTRD 4EN3D 1EO8H 4C56E 4XH2B 1OM3L 4P9HL 1SQ2N 3IU3B 2XN9E 2CIIB 4M4PA 1CG9B 3NA9L 4P5TB 3QXUA 1ZVSB 4DVBA 1T04A 1FNHA 4PV8A 4KI5D 5EO0A 4PRPE 3VRIA 1ROWA 4L4VD 2GTWA 1A9EA 4QT5B 5HYJB 3RJQB 2BX5A 3K1DA 5JZ7D 2YA1A 6CGTA 5FGCE 4C57C 1NAMB 1KELL 3MLVH 4MS8C 4OCYH 1Q9LA 4LL9A 1K85A 5I73C 4P5KA 5ACZA 4DQOL 4HS3A 3ZE1E 35C8H 5IGXH 1FYTA 4QXGH 1F13A 1I1AB 1GGIH 2Q76B 1L0XA 4Y2DC 1G9MC 5FO9B 1GAFL 1KN2H 1ZVYA 1HQRB 2CKNA 5F71A 2OX5A 2RB8A 3GMMA 1VEPA 2W0LA 2NY7H 5EFIB 3THML 3U46A 2EO9A 1X5FA 5LGHL 4URTB 3NGBC 4JVUA 2P8MA 2EEAA 1F4YL 4MNHB 2R0ZH 4PJ9D 1MFAL 3RWDA 4QHMA 2QADD 3P11L 2NXYD 3C9NA 2DIJA 3GEWB 3L1OH 1JPGB 1G7QB 3ZHLA 3LV3A 4HJGA 1DTUA 4OCWH 5D1XB 1H15B 4M00A 3D0LB 3VFSB 1ACYL 1NEZB 2R4RL 3OGOE 3LEYL 1KCSL 5DQJA 5FYJU 5ERWA 4FFWC 3VFMA 2D9QB 3IVKA 4HPOH 1ONQB 4OLWH 3FQXA 1HHHA 3VD5A 1MFCL 3PP4H 3ZE2F 2MWCA 1S7RB 3RKPA 2QSTA 5DRXA 2CGRH 3B4NA 4PLKC 4PJBF 2YKLH 1QR1A 1QSEA 1VA9A 4YDJB 3ET9F 5DTFA 3QUMA 2EDJA 2XZCL 3SJVB 2X05A 5T3XL 3EO9L 1G9EA 1MSPA 3DETD 3VXRE 4QRPA 4R6UA 5I2IA 4QTIH 1U8NA 4EBQH 3ZLQC 4BH7A 4OZIB 4PRHA 4TOYL 4M1GL 2X4TB 3TIEB 4OLXL 2VDML 5IUSA 4LOUC 5K33A 3LN4A 4LSSH 1EJOL 1XH3B 2BSTB 3P3YA 7FABL 3JTTA 3TBSA 4H26A 5ESAB 2DQCH 3VI3F 4UT9L 5D6CB 4JY5H 2GJ6B 5GISL 1IGFL 4KRMB 5DHVB 4IEFB 1JHLH 2VQUA 3EYVA 1ZHBA 1KTDA 1NCBH 3OXRB 4JQIL 5CEZH 2PYFB 3VFVB 3CFKA 3S6CA 1KJ2B 1IBGL 5A2FA 5CUSL 1JBJA 1MJUL 1CGUA 2R0LH 3X12B 4XC3H 3O4LD 5D72H 3FOMB 4OT1H 3BUTA 1ZT7B 4OZFB 4PJDE 5FA3A 5DK0A 5H37H 3LSOB 1RV6X 1K8DA 4ONFH 4KXZH 1UA6L 1EA9C 1RZKL 3G04A 1YNTB 4RMVA 3MR9B 5FHBL 3MRDA 3LIZL 4NO3A 3HCVA 2QSCH 4EJ1C 4U31A 5EUOE 3EYSH 4K3DL 5I8OL 1KIUA 1VFAA 3R06A 1AKJB 2EIZA 1LO4L 3WJJA 3BE1L 4YHML 4G8GB 5INCA 3ULUE 4OCSH 3QIUD 4C83B 2YD6A 4LU5H 1QTYT 4L4TE 4HMCA 3GIVB 4NPYA 5DLML 1RULL 2NY1C 1MQKL 1K3ZA 4HZLA 2NW2B 3QJHA 1IFHH 1J1XL 1FO0B 4Z5RA 5DVKA 3ZKND 2P1YA 3DGCR 4L1DA 1YEIL 3CGTA 1KYOK 5I1GH 3BWAA 4KK9D 1KT2B 5CJQL 3O6FD 4DGIL 4OUOA 1S9WA 2HAZA 3PWNB 4UT6L 2VL5B 4WI7A 3Q6FA 4ZOEA 5T1KB 1WBXA 3JSSA 3ZT7A 3I75B 4IOFC 4ZS7H 3AREA 4YQXH 2X1QA 2D3VA 3ZTJH 3ARGB 5HYIA 2RFXB 1GGCL 3PABB 4IM8A 3DPBA 2IADA 1A7OL 3FT4B 4F15C 1HK6A 1RZGB 2ZCHL 4BM7A 3ARTA 4FQXD 1W8NA 2OP4H 2FD6L 5IW1A 3MACH 3OGCA 1KCRL 3V79C 4FTVA 3IFPB 1BQHG 3TYFA 4OLVH 2VLRD 3UYRL 1FPTL 4UDUB 4X7DC 3V4VH 2L7JA 5IJKA 4UIKH 1NKOA 3I3BA 5DVNA 1OP5K 2R8SL 3G5VB 3ZE0E 4GRWE 3DIFA 4M1CD 5DRWB 1AFVL 3BZ4A 5DMIH 3EZJB 1QFPA 1CDYA 1URLA 3VXUD 2XTJC 4WFGE 3LMJL 4BK5A 1T7WA 4NUJB 4ZTOL 4FS0A 2VERN 2YEZB 4G5ZH 1ZHKA 2QBWA 2Z92B 3MUGB 1NANH 3K4DA 5I30H 3NIFE 5DHXB 2V2WA 4FA8A 4DAGH 1MFDL 3HUJB 3LD8B 4NQEB 3QNXA 3EFDL 4H0IA 4NM4H 4UQ2B 5IJVB 3HE6B 4X9GA 1LEKB 1VGEH 3S4SA 2FIKB 2BVTA 1QR4A 2MFNA 1RURH 3TH4T 4NJ9H 1NCUA 1BFVH 4PD4J 4M6ML 3FQNB 1V3MA 4HKBA 4XCEB 3DVGA 3PWVB 2AGJH 4JY4B 1NCCH 4YDLB 2WM0A 1CD9B 4JFED 4KH2A 3AFLA 4K7FA 1EVTC 1T5WA 4OI8A 4OZGE 4U1SB 3VFRB 3FKUS 1P6FA 3UAJC 2VLMD 4UBDC 4ZNEE 5IFJB 3JWDL 3HI6L 1PZUB 5HD8D 5I6XC 1CI5A 2R1XA 1NUDA 3LAFA 1UWXH 4GG6E 3QA3A 2DYPA 4Z95H 5SWQB 3QIWB 1CDJA 3UTQB 2ICWB 1Q9KB 5IHLB 2Z31B 1JN6B 1HOCA 5EC2A 2OJEA 4WEBH 5DYOB 4AT6A 4D0BA 1L4IA 4WO4D 3B8YA 5E2TL 1CFNB 4JFHE 4U1LA 5I15L 5IQ7L 3SDAB 2VXQL 3VRLE 1C7SA 1LDSA 3VMOA 1QVOB 4Z78A 4GG8A 3MRRB 4OFPA 1UWGL 2ITCA 1T6WA 4MD5A 4MJIA 4WWKC 1U8PB 2OJZL 2ZUUA 4ZO9A 4G8EB 1N8ZB 4OLZL 1FV1A 2EE3A 4KTDH 3T3MF 1HSAB 1U92B 2XOTA 5T3XD 2HMIC 1FYHB 2X2YA 4HJJH 4KHXL 4MAYB 1CFSB 1FLRH 3V5HA 1B0WA 2D7TH 1CXFA 5I19H 4GMSH 1BVKB 1FVEA 1NLDL 5IVNA 5D7KE 5KOMC 3O4OC 5FUOL 4KTEH 4Y2DA 4GMTL 4CDHA 1DE4B 1E28A 1KIQB 2DWEB 4WFHD 4OCXH 2CRYA 2X1WL 2Q87A 3TA3D 5EOTB 1OQOA 4HKJA 1CL7I 1P84K 5CZVL 3VA6A 3PJSA 3QEUA 4LK4A 4JDVA 5GJSH 4JANA 4M93B 1H0DB 2VR4A 2J4WH 4MA3A 3TP4A 4NKIL 5IW6A 3GUTB 1K4CA 4GKZA 1QUNA 4HIIA 1HILB 3FFCD 4NCC2 3T0EE 4U7MA 5I8KH 3WUZA 2MPAH 2C3VB 2V7NB 1P7KB 2XG4A 4JFDE 3RA7H 3RGVB 2W59A 3GSVB 3FHAA 3ZKXC 4PRBB 3WNNA 1KB5H 2H3NB 3DX7A 3KYKH 2HH0L 3ZO0A 3AGVA 3RKDC 2SEBB 4YHYC 5EOCJ 5GRJH 4UNTA 4CADB 1YYML 4NC1E 3BN9D 3TJHD 5C0JB 3DTXB 5FKPA 1QKZL 3CSYB 5FDWA 3ZYIA 2PTTB 5EOCL 3BT2H 4XBPA 1YQ2A 3INUL 1OF2B 4CMHB 3EFFB 1F6LL 5EIQA 1ZXQA 4QYOB 3QIBB 1F6AB 1NUNB 3V4PL 3HE7C 3RVUC 1BEYL 1MLCA 2Z4QB 2D7OA 4AH2B 3PWPB 2YWYA 2FO1A 5DGRA 2P5EA 3HG1B 3VFOB 3HI5H 1J86A 2Q6WA 1X5LA 3LKSB 4E0RB 2CXGA 3U2SA 1LP9A 4JJHA 5E8OA 2A6IB 4MQ7A 4RDQG 4MQTB 1VPOL 3TO2A 4X4MA 1ZOXA 3TPUA 1D6EB 1QLRA 1RUQH 1GCFA 4YHPB 4LCWB 3OZ9H 4TYUA 5I71C 1XF4B 2DQDH 1I9IL 3HMXL 4FQQB 3TM6A 2QHLA 4KKCD 5D7JC 5DA0B 4LQFL 1Q0XL 1FORL 3KPLB 4F37K 3O3AA 1ZS8A 2ZOKB 5CILH 2XN9B 1NCWL 4FQ1L 1JJUA 3MRJB 4YHOH 3REWB 3QEGH 3P4MA 4PB0L 3PGDB 2JCCF 4Z0BL 3BXNB 1PLGL 3TVMA 4GXVL 1SEBB 2N7AA 4GW1A 3MNZA 4LPYA 2FBJL 3Q0HA 3VXQA 4OI9A 3HS0B 4GBXC 2A74B 2GCYB 4IMKA 4H8WH 3ARFB 4ZFZA 4W70A 3NIDF 5INDA 2EE9A 1XGQB 2IJ0C 1CFQA 2HTLD 5FUZL 3SDYH 2A38A 2VUYA 4MA7L 4JG0H 4BQBA 2GEEA 1DFBL 1XGUA 1TPXC 2NLJA 1SVCP 2EC9T 5SX5K 3DV4A 3V6FB 4PGDB 3FRUA 1HHGA 2X9YA 2HKHH 5IB4A 4LAQH 1CTNA 2Y25A 4QWWC 4ONOA 3S35H 5CMAA 4PJGE 4OF8A 1U8IB 4GAGL 2YPVH 5GRYA 2Y9RT 1SMOA 1M05B 4OV5B 5DEGB 1LK3H 4YEFA 3BKJL 3BPNC 4JFFB 3RI5F 2J8UA 5ISZB 1MCLA 1FZJB 2V9RA 1FIGL 3CCHA 2P4AB 3ULVL 1I9JL 2V2TB 5C6PB 5C6WH 3KPPA 1ZHLB 1IT9L 3AROA 4I5BB 1SBSH 4HG4J 4JKMA 4LLVB 4P3CL 4PJFA 4FP8L 1ODAA 1FGVL 2OZ4A 1CGVA 4K3HA 3SGEI 4IRZH 1FZOA 4HUXA 2X4NA 3QI9B 3LKQA 2WK2A 4ZPTB 3T77B 4WW2B 2AEPH 5JUEH 4QNPE 4FQHB 1QSED 3BH9A 1A1NB 4G6JL 5KSVA 1CD0A 4K3JH 2O5ZH 1YPZB 1AD0B 4J4PC 1CZ8H 2Y23A 5ANMB 3VXRB 4QRPD 1IQWL 2NY0B 3FOLB 2CMRH 2HWZL 1MRFL 3SOBL 4U7KA 1BLNB 4OB5L 1P7HL 1RJCA 2R0KH 4PRHD 4ZAKC 5ACMA 1P6AB 3SEPA 1VKXB 1RAMA 3W9DA 5EORH 4QCIA 1J0IA 2WUBL 4NQTA 4ODBD 4YO0A 5F1OB 1N64L 1ZLVH 3VH8A 4EDXA 3TJEL 5C09A 5GJTL 2P5WA 1UQSA 3V0VB 1QBAA 5D9SB 1RK0A 1DANT 4FQIH 3H6JA 3TNMB 3ZL4L 4MNQE 4YGVA 5FGBA 3NIGE 2E6JA 2JB6A 1ND0B 5I75C 4LNRB 1R5IA 4M6AA 4FFZH 5D93B 3J7HA 4PGZA 1U91B 3ORJA 4GLRH 3RVVC 4Z7UF 5HTSA 2P43B 3D18B 2NY4B 4NQVB 4IRJD 2NY3D 2DQHL 2AK1H 1HWGB 2Z0BA 1JRHI 1MCPH 5DJ0A 2W65A 4CNIA 2OQJA 3MCKB 2CK0L 1RHFA 3QAZB 2C9AA 2C7UB 2E9JA 4U6VL 1YMHA 2MCG1 3WL9A 5D7IA 4M7JH 2ZPKL 2CH8A 3UJTH 1P69B 1QG3A 3OKDB 4H1LA 2EKSB 1OD7A 1OSZA 5HDQH 4G9FA 4YFLI 4N8VG 1AXSA 2ARWA 3BDBA 4Y5YB 3CDCA 4L4TB 2GSGA 4WDIA 3WE6A 2G9HB 4BA8A 5M95B 1VESA 3HNVH 4UMGA 4LVOC 5KVDL 3E6FB 3GJFK 3PWUB 4F57L 4V2BA 1X5YA 3IETB 1T21B 3JV5A 4JQXC 1L6ZA 3WDJA 5IROC 3NMEA 3LCYA 3QXTA 4M02A 1LK2A 4HK0A 1K2DA 4PG9B 2V9TA 1NMBL 4WHYH 1NC4A 4KZDH 4LSPH 5HHXL 12E8L 5D8JL 5DF0A 5I8EB 4XRCA 3SGDI 1T1YA 4GRLA 3IFOB 3B2VH 5SWZE 3SCMB 3AXLA 1U93B 1PKOA 3O6KH 4Y88A 1BPVA 2XYCA 3NAAL 3IXAA 3SBWC 4AIZB 2VLKE 3DMMB 4OGXL 3QPQD 1AY1L 1IVLA 4JEGB 3LRSB 5EO1B 1A6ZB 2ED7A 4ELMF 2UZXB 2AXFA 1FFOA 1XZ0B 2VDKL 1SMAA 4JFZH 1U3YA 3FZUD 5GS0D 1T2QH 1JFQL 4LCUB 4QHLB 2VXTL 1I75A 2FHCA 1LHZA 1UADC 2IWGA 4GRWB 1IM9A 5TF1H 1FHGA 1UM5L 1P2CB 1W0YT 2ESVA 1MHHB 3DECA 3QHTC 3WS6A 1GGBL 2ZSVB 3MFFA 2VAAB 5IWLC 1FL6B 2IQAB 4HIEA 4HUNB 1UVQA 3GK8L 4I9WD 1VFOA 3UC0H 1Y0LA 2X4OA 1IGIH 1WFOA 3ILQD 4FG6D 5J8OA 1FL5B 4YXLL 2UY7A 2V6HA 1FG2A 5C92A 4LHJB 1FH5H 5AG8A 5DVMA 2BCKA 3MLWL 3BDYL 5DD6B 3EYQD 2OR9H 1LGVA 3G5XA 4R8WH 1KFAH 5DVOA 2APFA 5GHWH 2R4SH 3NFNA 4XHJC 1BFOA 2GK0A 4HWEL 4XP1H 3U36B 4ZUWA 3MX0A 1B6UA 5E9DE 1UXSB 4YHKL 5IKCA 4JPWH 3SE9H 3V0WH 3B9KC 5F1IA 3WLWC 5F7EH 5DMKA 4OZGB 2GAZA 2VL4A 3ARBB 1ZLWK 4CU8A 4ALAH 4ZD3H 1GSMA 1KCUL 2B1HL 3HI1B 2A9ML 1T22A 4JHAH 1XGPA 4MCZB 4LHQB 3HC3H 3IU3A 4J3WA 3MV11 4PJ7A 4GG6B 5EWIL 4WI9A 2NZ9D 3CDFA 4QO1A 3MLZL 4MDIA 2DYPD 5C9JB 3E2HC 5IF0A 3FONA 2JK5A 4OZ4A 1T7YA 2KPNA 2OZ4L 4NZTH 4R4BB 5D7JA 4QT5A 5E4EB 3OAYH 1EHLH 4U1JA 3UMTA 2JELL 1CK0H 5TGBA 2NW3A 4HGWA 5E2WL 3KPOB 5GGRB 4BFIB 4KQ4L 5TE4H 1IGML 3GO1H 4PGEA 2R9HC 1FJ1B 3H7BB 4I18C 3RUGF 4UV7L 5MERA 3DRQB 1CL7L 5D96C 5GRUH 4AEIL 1I1AA 4MJID 3TBVB 3UO1H 1ZGLP 2UZIH 2B20A 3UX9B 5F97E 1CU4H 4MS8D 1JTPA 5L2KE 3NCJH 3BRDA 1HQRA 5FAAA 3D25B 5DD0L 1W72B 3OAUL 3VFUA 5JPNB 1GOFA 5DD1H 4IOIB 1TJGL 5B4MD 5EFIA 5CINH 2YA2A 4U6XA 1H3VA 4DZ8B 2D7PA 4HD9A 1N4XL 5EA0H 1QFOA 5SWSD 3MV7D 1PQZB 1FE8H 3BAEL 4LDOB 4Y2DD 3MLTA 3RVTD 5M7QA 4U6TA 3WHXB 5IBLC 4YR6A 2APWA 1E6JL 4FNLH 4W4NA 4WW1B 1DBJH 1JPGA 1G7QA 5I1KH 2B8OT 4NQUA 4FMFA 4Y4HC 1T20B 3BPOB 2F15A 1JWMA 4K7PY 1UEYA 3D0LA 4HDIB 1TCRB 4JM2F 2ICEB 1OAYH 3VG9B 4NUGH 3KPRA 2EXYC 4Y1AA 4XX1E 2R23B 2X1PA 2ZZUT 4U49A 5KSBE 2J6EH 1UZ8B 3RZCB 1G9NL 4R0LC 1RQ5A 4HLZG 1NGXB 1OP5H 3T0EB 3GFUA 3MJ9H 1NFDF 4YWGL 4AENA 4K7PL 2IAMB 2VE6B 1TJHL 4YJZL 5B39B 2ADFL 3SJVA 4JFDB 1OW0C 3WNPA 4YDIH 4AIXA 1CDIA 4H25B 3SE4C 4P59L 4P2YA 2X40A 1G9MH 2R0WL 3H9SE 5TH2B 5B3JE 1PSKH 3GM8A 4HPYL 3RWEB 3M8OL 4OZIA 3T04D 4Q9RL 3I6LE 2VH5L 4UTAL 5DD3L 3IDYB 1DEEA 3BIBX 4S2SB 3K8LA 4OFYA 1V3JA 4J4PA 3L3JA 4IMLB 4ODXB 3SO3C 2RCSL 1WFTA 3LKNB 2I60H 1G7IB 3G08A 1RIVL 2WAHA 1D5BB 4NQCE 2EYTB 1BZ9A 4LRIA 4RMSA 3ROOA 1HHIA 3RWIB 1QRKA 3BHBB 3OXRA 5F7NC 2PYFA 3BKYL 3VFVA 1T5XA 2YXFA 3ILPA 4R2GC 4NWUH 4JREC 4PJIA 3HRZB 2ZUQC 5IVZB 32C2B 5EZOH 1H9VA 4M9PA 3X12A 2BNRB 1FNGB 3CLFH 3EIFA 5BV7C 3G6AB 4XWGH 2V7HA 1ZT7A 4OZFA 2NQCA 4G80B 3LSOA 1ORSB 3L3OB 2Y72A 1NSNL 5MP6H 1D5IL 5EU7C 1YNTA 1BGXL 3MOAH 1KLFA 4XNZC 3GMPA 1N6VA 4PRIA 4R96A 1J87A 4HWBH 4F33B 1DN2A 4G42B 2ZWLT 1YJDC 1JK8B 4YK4C 4Q74A 1AKJA 4S1QH 2HFGL 4BK4A 4KI5E 4G8GA 5D7SH 3WUWB 1DLFL 4L4VE 2AVGA 4RIRB 3QNZB 4JY6A 3WSQH 4C83A 3TVMD 5SV4A 2CRZA 2EEDA 3BH8B 1SY6A 2IPTL 1WIOA 4PJ8B 1G6RH 3BJ91 5KOVC 3UZVB 1BECA 1FZMB 3IAPA 4FZ8H 3VRJA 2HFFB 1XR8A 4WUUA 5GGSA 1CE1L 3HAEH 2XWTA 3IJSB 2EIEA 4JN1L 1U2HA 4QY8A 1CS6A 1KT2A 3QWRA 3QZWA 3EDKA 3MYJB 2VL5A 1I1YA 5DS8B 1RI8A 2ICES 1TQBB 3IDUA 3HLAA 1E4JA 1K5NA 3TN0B 5FO7B 5JLZB 4JPVL 1J88A 4QGTA 1LO3L 3EJJX 4L9LC 4PJGB 3PABA 5IROA 1DVFB 1YNLL 3NCEB 1RZGA 1KG0A 3H42H 3CFEA 1TJIL 1YMMB 5EZIH 4NNPH 4X9BA 4D9RD 2O5YL 4LLQA 3NCFB 1CLOL 1NDGB 4KJPC 4UDUA 3QPXH 4D9QE 3MLRL 4G7VH 4Q2ZA 1FBIL 5TQ2L 3L6FA 5D2NC 1HDMB 3G5VA 3DURA 5K59F 1P4BL 2EYRB 2LFGA 3MRHB 5C0RH 4U1HA 5BZDA 1KB9J 5J7CC 5CIPA 4I8DA 4QHKI 3WLBB 1NDMA 4NUJA 4WGWB 4LSRL 3MRQB 1LVEA 5C0IB 3MUGA 3LVEA 1LEIA 4BZ2L 4ONGL 2CO6B 1EMTL 3BYTA 1UB6A 3HUJA 4AMKL 4NQEA 4Q9QH 5IJVA 3MV9A 1PG7H 1N3NB 5IWLA 2DLFL 2XTJD 1YEGL 2FIKA 2CUMA 3OKLB 4HBCH 1K8IA 1AGEB 1HIMH 4P2OB 4HUVB 3G6DL 4XNMA 4WFFD 4JY4A 3O2VH 4QTHB 3PDOB 2AV1B 2XWJA 3O3EB 4TRPH 5T1LA 1DBMH 2VWEE 4L5FH 4S1SL 1JRHL 4UQ3B 3U1SH 4U1SA 1R3HB 3VFRA 5EPMA 4FXGB 1JYXA 5C09D 3F6LA 2P5WD 1X5HA 3LPGA 1RY7B 4P23C 5GS1C 4NRZA 1YEDB 1PFCA 1UEMA 2IBZY 5SWQA 5HYSA 3QIWA 4OCNC 3UTQA 1Q9KA 3B9KA 4JM4L 2JF1A 1JN6A 1KN4H 3F7RA 2BVYA 3ZT6A 5DYOA 4UBDD 1HNGA 2DM3A 1N5YL 4NO5A 4I0KA 2XZQL 5F6IB 1M7IB 4X6FA 4R97B 2BY1A 1MOEA 1S7SA 1QVOA 2YUWA 2FGZA 3BP7B 1VSCA 3K4AA 1N5AA 5IMOB 3MUY1 1FFPB 3BEVB 5I9QC 3WIFB 3QH3A 3S37X 2YSSB 5HI5D 5DC0A 5IIEB 4Z7OE 43CAB 1C16B 4G8EA 1N8ZA 3UJIL 5AG9A 3MXWL 5A3ID 4NGHL 3NZ8B 1HSAA 3MJ8B 3ULSA 1KV3A 3N85H 1A7NH 2RJMA 1KC5L 2XWBB 4G9FD 4OQTL 2X10A 3VJ6B 4KGLA 3B5TA 5JXEC 5CJOH 4YBLC 4R7NB 1EEUA 3MRFB 2FEDC 2J2ZA 4NKOA 3MRCB 4JN2A 4MA1B 3HFMH 1B2WH 2X7LB 2GT9B 2C3HA 4M43L 4TNWK 4WV1B 5LKNA 4RWYL 2DWEA 1S7WA 3ECBB 1R3LB 2BY2A 4JDTL 1BX2B 3X3GL 4N8PA 3O8XB 1B4JL 2HMID 3FB7B 5ESQB 1JHKH 1GIGH 4GUPB 5F7FA 1XIWC 3REVB 3UYPA 3QEQB 3GKWL 5DURD 3TO4A 2X4UB 3MC0A 2Z93A 1NC4D 5CCKL 5C0DB 5JW4N 2AXHA 4ZYKB 1QQDA 4P5MA 1ZLSH 2FR4A 1EAPB 3P9LA 1A6WH 4GKSA 5KN5A 5FKAA 2B0SL 3WIIH 5SWZB 2RR3A 4CBPA 4RDQF 1FL3B 2XKSA 2O26U 2VZSA 2VLKB 4EI5B 1HILA 2CUHA 1A3LH 1ZT1A 4HXBL 5CWSB 2C26A 3RU8L 1T03H 3OB0K 5GGSY 3NCYS 5KAQG 2VLRE 1D5MA 5I8CB 4KZEH 4LLMB 2V7NA 1P7KA 2YK1L 1R5VB 4Y5XB 3RGVA 1DUYB 3PHSA 1OWRM 5C0ND 2GKIA 2C1PB 1AI1H 2SEBA 4OIIH 2EDHA 3S96B 4R0LA 3ESVF 3U9PH 1ORQA 3VXUE 1IM9D 5C0JA 3DGGA 1HHJB 4ZPVB 4J12A 1FSKB 2ESVD 5F8RC 2PTTA 1EGJH 2QSQA 1UCTA 4ESKA 1MQ8A 1MCJA 5C07B 1OW0A 4M6NL 3P4NB 3T65A 2ED8A 4ZFFB 3LH2L 4QYOA 1IC7L 4I4WA 3QQ4A 4XMLH 4Q0XH 4WI6A 1YY9C 3DSFH 4ZUUA 3L5WA 1CGXA 3V5DA 4AH2A 3PWPA 3C09B 4HKXB 3V7AE 4PBXA 5TE7L 4Z7NF 3V7MA 1NBVL 2D9CA 4HUKB 3CNKA 4XNXL 4E0RA 5H35B 2A6IA 3QCUH 5L6YL 3I84A 1JTOA 4HF5H 1D6EA 4JFEE 5T1MB 2DQJL 1A7BA 2GW5A 4LCWA 4PRAA 5C08A 1XF4A 5JQ6H 1F4AA 1QSFB 5E9DB 5E08H 4GAFB 3CVHH 2VLME 4HJ0C 1IZJA 5JDSA 5IB2B 1ETZB 2HLFC 2XNAB 5DUPH 4MNGB 1I9RL 4KK8D 4PJCF 3ZZ1A 3O3DA 1YEKH 3TBYA 1U8MA 3KPLA 4RFNB 2ZOKA 1R6VA 4P4KC 3TIDA 3FO9B 3REWA 4UAOB 4FHBD 3PGDA 1WAAF 3L7FA 1JNNH 4LSQL 1S7TB 1SEBA 4G9DA 5D7JD 3GM0A 2DQTH 3BO8B 2A74A 3L3DB 3VXPA 3GI8H 5JW5A 5L7XH 4M61B 3O2DA 5LAXB 3CJJA 3MRNA 1V7NL 1AIFB 5C0BA 4D8PA 1XGQA 5T1DL 4QXUL 2CIKA 1VB9A 2VQTA 1JGDB 4EEEA 1A14L 3EJYD 1UJ3B 2QHRH 4RGND 5I74B 2HP4A 3ROLB 1I1AD 1TZGL 3M17A 4PP2A 3SGEH 3BW9B 3V6FA 5GGUB 1PBYA 4N68A 4NQDA 4UOW0 2X4SA 1QSZA 4HQQH 3F6IA 1UJTA 1EERB 3SDCB 3VG0H 2PUQT 2PXYA 5EOQL 4TVPD 1IM3A 3OXSA 3QUZC 4LLWB 3AM8C 4MXVE 3T09A 4WFHE 2ICWJ 5IR1A 1I1RA 2JCCB 1CT8B 2APTA 4JFFA 3JWOC 3U4BH 2AJ3B 5AZ2L 4CMMB 1MCDA 4PY7B 1G7LB 5GQBA 4L9LA 4Q97A 5J6GB 3CVIH 1BHGA 3RWGB 3PGFL 1KTLB 3H3PL 2AQ1A 4YDKH 1INEL 1X5KA 2E6PA 3QZWG 2Q86B 3I6KA 3EDEA 1CLYL 5IMMB 2FWOB 5LXGH 3PHQB 4OZHE 3KPRD 1Q94A 4Y1AD 3CSPA 2VXUH 3FFCE 4UDTB 4GOSA 3R0MA 3QI9A 4TTGA 4JKPH 3CX2A 3T77A 4WW2A 1H8SA 3UTSE 4FQHA 2BVQA 1CICB 4L3CB 4P46A 1YPZA 2O5XH 4XPFH 5DMGC 3RDTC 3SJVD 3MLSH 1D5XB 3S88L 3BMWA 4HKZB 4RBPK 1U8KB 3OKOB 1FC2D 3H9SB 1BLNA 2QQNL 4QHUB 3VFNB 2QJDA 3UP1A 3QQ9C 4QGYA 1N6QH 1ADQA 4X7SH 5E1HB 3RX5A 2J8HA 2AEWA 1FFNB 4OFYD 4YEEA 4J4PD 4D3CL 4NN5B 3N9GH 2VXSL 1CE6B 3VWKB 4FABL 5BVJB 3ULVF 3G5ZA 1WBYA 3D2UB 3GSNA 4XB7A 5D9SA 4GQ9L 2YD8A 4JO4L 4R4FL 3QEHB 5JQHC 2DJUA 3ZDYE 1RJYB 3T3PF 3WEXA 3O0RL 5EO9A 4ZO7A 5I76A 1C08B 3RVWD 2H45A 2I9LB 1U91A 3NCMA 5HYFA 2DTML 3LQAH 3RY6A 4P23A 3U0PA 2I5YH 1QRNB 1IAKB 3D18A 5GS1A 3UBXB 5AD0B 1G7HA 3EGSB 3GNML 3QUXC 3IDXL 5CS7A 3RNQB 1WTLA 3KLAA 2CSPA 4PIRF 5F72S 4DKDC 4MB4A 3MCKA 5DQDH 2F5AH 3P77B 4LCCB 4X7CC 1KEGL 2HT3D 3O9WC 4HC1L 3SGDH 5ITBH 1NAKH 4EN3B 3RVVD 4PRID 4HX1B 3TBTA 1MVUB 4OD1L 3FQWB 3BEWB 3WHE1 2AXJA 2IQ9L 5EDXA 1AKJD 3OKDA 2EKSA 4OTXL 5FYLH 2H6PB 2IG2H 3HZMA 4KMQA 4G8GD 1BWWA 1VGKA 4L4VB 2R29L 3NZHL 2UWEF 1A4JB 4K94H 2KZ1B 3IXTB 2LU7A 4MB5A 2G9HA 5KS9F 1M7DA 4GS7B 4H5SA 4QHNB 5ILTL 4WUUD 5GSRB 4UILH 3E6FA 3PWUA 5BO1L 4RGOL 3TESA 1DQLL 3MJ7A 3VGAB 3MGOB 1FYTE 3BGFB 4PG9A 3QWRD 4G8IB 5FEBA 1IL1A 3J8F7 3M1BB 3N1PC 5F7UA 4MSWA 3JZ7A 4UINL 4OD2A 3GHEL 5KW9L 1KXVC 5FDYA 3SCMA 3BD4A 2P7TA 4DEPB 5DHYA 1ERNA 43C9B 2DRUA 2BRQA 1JZ6A 4AIZA 2PW1A 1NFIB 1RIHH 2VN4A 3EO1B 3MJ6A 2VISB 3LRSA 2EDEA 2EE2A 1ZHNB 5AWNL 5CAYB 1XR9B 4PJ9B 4O51B 2QADB 2NXYB 2XXCB 5BV7L 5B38B 4XP6H 4LCUA 4QHLA 1K4DB