1BBJB

Crystal structure of a chimeric fab' fragment of an antibody binding tumour cells
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
212
structure length
212
Chain Sequence
EVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWAKQKPEQGLEWIGYISPGNDDIKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCKRSYYGHWGQGTTLTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chimeric Fab' fragment of an antibody binding tumour cells.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immunoglobulin
molecule keywords IGG4-KAPPA B72.3 FAB (LIGHT CHAIN)
total genus 39
structure length 212
sequence length 212
chains with identical sequence H
ec nomenclature
pdb deposition date 1992-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bbjB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bbjB02
1YZZA 3T08A 1I1CA 4MNQD 1UJ3B 3VFNB 1MJ7H 1S7SA 4N0CC 4U2ZA 3C8DA 4YEEA 4L8BB 1EMTH 4HWEL 1A0QH 2D03L 1VFAA 3RGHA 4PJEE 3UJIH 1WT5C 2A6KA 3ULUF 3U0WH 1QBBA 3HMWH 5EOTA 2X2YA 4G6MH 3DBXA 1HHKB 1TETH 1UFUA 4ZUTA 1PYWB 3M07A 1JVKA 2YPLE 4RWYH 3L3GB 4APQA 3GSXB 3FKUS 3I2CH 5F7FA 3RHWF 3LHPL 3MV9D 5JDSA 3P77B 3IJHA 1NEZA 1ORQA 2QKIB 3V7MA 4PIRF 4IRZH 3HE6A 4ISVB 4WUUA 1CDBA 2ICWI 3FL7A 3PGCB 3T4AA 5D2LA 4HPOH 4C57C 5I1JH 5I1HL 3RX7A 1BJ8A 4RGMB 3VWJC 3STLA 2QQKL 5DQJB 5DRXB 5B3JE 4LLMB 4LRNH 4QY8A 2V17L 4GW5B 3W9EB 4WTZG 5DD6B 3S37X 4H5SA 4ZFOB 5GGSA 4L3CB 1NFKA 4DKDC 4G6FB 1RZIB 2IH3A 1YEDB 2E5EA 4HQQL 1C5DA 3TO2B 3ZKNC 4ELKA 3DJ9A 4XGZB 5HY9B 4NQXB 1AD0B 4M1CD 3GM8A 3V0WH 4S10A 2PYEA 2WAHA 2FGWL 3M17A 2C26A 4JZNA 4UOW0 4OD1H 5EUOA 1LVEA 2CLVA 3TPUA 1UJTA 4OCYL 3UZEA 2BHUA 3B6SB 1LGVA 2V7NA 1EX0A 4ODUB 4UNUA 5DEGB 3S98A 1LE5B 3WJLA 1JIBA 4PRAB 2A6DA 3O45B 4YHZL 2PYFA 4XVSL 2P48B 5D4QA 4HWUA 2B7DT 4PG2A 1QSED 5BO1L 5DJZA 2DYPB 5FKPA 4Q6YA 1KN4L 1XR9A 5IW6A 2VDLL 3LRGA 3OAZH 4PRNB 5DK0A 5KZCB 2EE9A 1DLFH 3BDXA 5DD6A 1W8OA 3WCYA 1F6FB 1N59B 2GJ6A 4FFZL 1Z9LA 4FXGB 4N0UA 5T1DL 2EEAA 4DFHA 1DBBL 1AC6A 2Z8WC 4D0BB 1BHGA 3SE3C 3H42L 1OP3K 1AO7B 3Q3GB 2QLVB 3TO4B 2VH5L 2DQDL 4XCCL 3W5NA 1LE9A 2V5MA 2EDOA 1A7QL 3O3DB 4XPFL 1PG7L 2CLVB 1D6EB 1FL3B 2VN7A 3VFUB 4POYA 4X5XB 3DVFA 4K3DH 4ZPTB 2NNAA 1YEJH 4M3KB 5I1KH 3BP6B 2DKUA 4MJIE 5C0EA 4D9QE 2E7MA 1EGJA 4DOHB 1KELL 3KPOB 3UPRA 3MO1A 1JPTH 3IJSB 1UG9A 4WEBL 3SDAA 3U7WL 5TE7H 1KEMH 4U1IB 3INUL 3H3BC 1EEZB 4I18C 4AEIH 2L7UA 1J1XL 3HC0B 4M8QB 5HYJD 5DJAA 4ZFZA 1TNMA 4YDJB 1XR9B 5IW6B 2IWGA 3AREA 4W70A 1IGIH 4Z7WB 5J13C 1KLFA 4OLVH 4Y7MA 5LJYH 2H1PH 2VDQH 4OLZH 4K7PY 1ZHLB 4ORGB 1TVBA 3G08B 1JWUB 3VWJA 2RFXA 2DL9A 1YJDC 2D9QB 5HJ3A 2X9WA 4Z7WE 2R2HB 3EYSH 4NC1C 1XF5B 1G7IA 3VG0L 1UZ6E 4R3SA 4WHCA 4MD4A 5DRZB 3ZTJG 3VU2A 3T3ME 5GZOD 1EUUA 3LIZL 3QIUC 1N3NB 4P4KD 1WCBA 1A3RL 2EE6A 4GXUN 4GUPA 3SQBA 1FFRA 2E7HA 5GS0D 4OLYL 1RU9H 2CUHA 3C5ZB 3ARTA 2VLJA 3MROB 4MA7L 4L3EE 2WW8A 1UM4L 4S2SA 3ZYIA 1MUJB 3F7VB 5EORH 1U2CA 3ILPB 1M71A 1YN6A 2P42B 1UXWB 2DKMA 3WUZA 3NABL 5MEOA 1OAZL 4Z7WF 4HXBL 4UV7L 4F33B 2MKWA 1H3VA 3VD7A 1NLDH 3QG6A 1MHCA 1UZ6F 3LKSA 1I9JL 5F1OB 4DUVA 4GRLB 4CMMA 3P9LA 4LLDA 4TSAL 1OY3B 4N1EA 2EDWA 4HULB 1X6NA 5GRUH 1KYOJ 1FSKB 4KKAD 2A0LC 3O8XA 4D2NA 1EVUA 4V2CB 3MSPA 4XPAH 3OXSA 5GSVB 1EBPA 1INQB 2E7BA 2ZSVB 2K7QA 1QKZH 1CE6A 1JHLL 2YA0A 2DBJA 1CD1B 1CFTA 3BQUA 5F21B 2ILLA 1LO3H 3HCVA 4W6YB 5DFVC 2DJSA 1IGCH 1OQXA 1BF8A 1OAUL 2VLLA 3GO1H 4PJCF 3P0GB 3MRNB 5ITBL 3QRGH 3I6GB 3PDOA 2EDKA 1AGFB 4GS7B 2AJZB 4HIHB 5EBLA 5EU6E 4ODSH 4P2RE 1PKQE 4OZFH 2Z92A 3IXAB 4NT6B 3B2UD 3RGVA 1Z9SA 3MRPA 5EOQH 5I17A 3H7BB 1PY9A 5ENWA 5CEZH 1BGXL 4OJFH 4IOIA 3PWVA 4RFNC 4M7LT 3EGSB 4OFPA 3AXLA 5EFIA 4OT1H 1IC7L 2Z35B 2A0LD 4MDIB 1MY7A 5I8CA 4HGWA 4JG1H 3ULVC 2V2XB 3C6LA 2WSKA 3MRRB 4U1IA 1LO0L 3MRHA 5K9JL 5EA0L 5KW9L 3WIHL 1SHMA 1OSZA 3ZKMC 1AQDA 3SKOA 3LN9A 1V5JA 5SX5K 3ZT6A 4Z76A 1QSFD 3CLEH 2OYPA 5JW5A 2Q8BH 2HLAA 1L7TH 2FIKA 1PX4A 5IFAL 3U0TB 1NJ9A 1ZLUH 1MQ8A 4L4VD 1LEIB 5I1DA 4AL8L 3OKNA 2ZPKL 2FD6H 4MJ2A 5JLZB 4QYOA 5KANG 3C08H 3QXWA 5CWSB 1LO2H 1CBVH 4Y4KC 1NDGB 4F57L 5LAXA 2XTJB 2HTKC 4QTHB 4XWOC 4ZODA 2O5YL 1MSPA 1HHIB 3QQ4B 4X7DC 4YNYA 3VA2C 3MXWL 1OARL 4E41E 1SMAA 3N06B 5EUOE 4RDQF 2Z0BA 4UQ3B 1ZSDA 3LCYA 1U3HA 4NQCD 4PJIB 1DANU 1TJIH 2X4OB 3O0RH 4Y4HA 3QI9D 2IFFH 5ABDE 2JCCF 1YYLL 4RDQG 1KJMA 2E7LC 1XH3A 2VXVL 4QXTB 4MAUH 3SQOL 5CKGA 3F65A 5HVFB 3GSVB 1A64A 4PTUB 2FEEI 2ZNXA 4YEFA 1F3RB 1NCDL 4CU8A 2VYRE 1NMBL 5MHSE 4Z7UE 3T0DA 3TZVD 3OR6A 5IT2L 5INDA 3KYKL 5DR5H 2VLMD 4PRDB 3WYRA 3HG1A 2DMKA 3GSQA 1AGFA 2DQIL 2ZPKH 3QNZA 1NBQA 1Q0YH 2HJLB 4D9RE 3EOAA 3CZFB 4HFUH 2JTDA 1T3FB 2NXZB 1MCEA 1NC4A 5D70H 2NXZC 1K2DB 5J6GA 4I77H 1NEZG 4KV5E 5BV7H 4Y4FC 1DBKH 4LKCB 4UU9A 2JF1A 2A6IA 1FORL 5FAAA 3E6FA 3PF2A 3CFCH 3RUGA 4GAGH 5SV3A 2DIBA 3D25A 3RVVD 2YN5A 2AXFA 4ZMAT 3QWOB 3ULVE 1H3TA 2KH2B 5GGTA 4U1JA 2GJ6D 5I74C 3JWOC 5C7XL 3QFDB 5HYQA 4YR6A 3WFDH 3WIFA 3PGFL 2F54A 1FVCA 5DMGC 3EYVA 3Q5OA 3FO1A 1WBYB 4HFWB 4MVBD 1ZGLA 3JV5A 4Q9BA 4PRPD 3MBEB 2NY6C 4O9HH 1TNNA 2EH8L 1CVSC 1TFHA 3CFEA 1IM9B 2GFBB 5T1MB 4LSRH 1F97A 1YECH 3LRSB 1FPTH 1W72A 5T5FL 1SM3H 1P6FA 1S7VB 3GSNB 1U3HD 3L5XL 4LCWE 4NQCA 4NZRH 1I1AD 2QQLL 4NWUL 2JKXA 4NRYB 4L9LA 5TGBA 4KKLD 4PGBA 4GW1B 4ZPTA 4DN4H 5CJXA 4OIIL 3LS5H 4ZUSA 1OTSC 1J05A 4LGPB 3QUYD 5E5MA 1WJ3A 1X5HA 2V2TA 4WI5A 5EC2B 3LKPA 3OB0K 5TQ2H 4GG6F 4PBVC 1MREL 3BAEH 3IETB 4PUBL 4JFPB 3G5XB 1PLGL 4H26A 4WHTA 1S5IH 1HZHL 4JFED 3RNQA 4PJBF 3UO1H 4I5BA 1G6RB 4NFCA 3FFDA 3WHXB 1OOAA 1EMTL 4HWEH 3A6BH 5LGJB 4MS8D 4M6NL 1U8HA 1IAKB 2DM7A 2F53B 1NGZA 4XPBL 4IRSC 5JQHC 2AK4E 5F89B 4C55A 4XRCA 3BPCA 3RI5F 2LU3A 4DOHE 2P8PB 4N68A 4RCAA 4CMHC 2BCKB 4P9HH 4ZUWA 3T3MF 3EYQC 4PV8A 4MCYB 3IAPA 5B3JF 4J3XA 4LF3B 2C3WA 5IQ7L 1C08B 4L3EA 3GMRA 2G2RB 3P0VL 4QT5A 1M05B 2VOTA 4LVHC 4OB5H 4X6CF 3D5OF 4L8DB 3O6FB 4GKNB 4PBWD 1TVDA 5DS8B 1TJHH 4O58H 4Z7VB 1N2RB 2OZ4H 4BJLA 4G9DB 3LEXB 5E1HB 1NCCL 2VDQL 2X41A 4OLZL 1ZV5A 4U2YA 4JM4L 2XQYG 3RWDA 1K3IA 3G6DL 3IB4A 4HS6B 4U7KA 4CN6A 5D7SH 3MJ6A 4HH8A 5LGJA 1V7NL 4NJ9H 2NPLX 3NIGF 4IIQB 1OT1A 3FQRB 1B4JH 2GUOB 3UJJH 4PJEF 1FCCA 2ZOKB 4KI1A 2GTWB 5TE6H 3BP4A 4Y16C 1LEGA 3MC0A 2DICA 5HGDA 2IANA 3RKPA 5E2TL 5E8PA 3WMSA 5KSBF 4X6CB 4HGKC 1U3JA 2ZOLB 3C60D 4I0PB 4YHZH 3ULUC 3C5ZA 4ZOAA 3PDGA 1SYSB 3CFIC 3OF6A 1PZUB 2EDNA 3D69B 3VXQB 4M4RA 1DQJA 1A2YB 5CP3H 5F8QC 5D2NB 7CGTA 1A9EB 4JDVA 1JHTB 4OUOA 5D93B 1U42A 5HI4C 3H6JA 2ZCKL 3ARWA 4LKXA 3QXAB 3H3PL 1BZ7B 5L8LB 3GSWB 4UTAL 5T1MA 3SDYH 5IB1A 1B6DA 3P0VH 4LLWA 1WZ1L 1HE7A 4OGXL 5FGBA 5SWSD 3RL1B 5TFSL 1MOEA 5IHUH 3R4DA 2NY0B 1A1NB 4BH8A 5I9QC 1URLA 4GRWE 3S5LA 3WS3B 4KJYA 5I1HH 1J05B 5CJXC 4F7EA 6FABL 1YQVL 4HUVA 5C0BA 4Y5VC 1NFDE 1VCAA 4POUB 3WUWG 3DO3A 2APXA 3BN9C 4TTDC 2VR5A 5EIIB 4UAOC 1L6ZA 1CLCA 3EYFA 5SWSE 3IYLW 4XNUL 2EDHA 5EOCJ 1VSCA 1VFUA 3AS3A 3P11H 5CJBA 3S37L 4LK4A 1T89C 4RNRB 3BW9A 3MBEA 2BNRE 2BVPB 4QXGH 1OAXH 3U1SH 1DEDA 5BV7B 4X6FB 3BFOA 3V2AR 4JQIL 5EBMA 6CGTA 3VGAC 2NZ9C 3AB0B 2VZVA 4JFYB 3PGCA 5F9AC 3EOTL 5H2BA 4MJ5A 1LILA 3S96A 4URTB 3DHJA 2MQCA 5JORB 1P7QB 3JBG7 1EFXD 4YUEL 2F58L 3THML 5KVMC 4QHMA 1AIFA 4X6CE 5MP6H 3MJ8B 4QY8B 2ICES 3DGGA 4OCSH 1YEIL 1IVLA 1G0XA 2WUBH 4S1SH 1HXMA 1ZA6A 2OP4H 2QADB 2A6KB 5FKPB 4J1UA 2R0LL 1QQDA 2G2RA 4QT5B 4GRWF 3MOBL 3FO1B 1MLCB 3B2UC 3BD4A 5ICXA 2J1KA 1GPOL 3QEUA 2EO9A 1NFIA 4U1LA 3KWWB 5B8CC 3K2UL 2OR9L 4OM0L 4KKBD 2X5PA 3B6SA 1ZOXA 1X7QB 5CINH 5HHNA 2R23B 3MUGA 4WY7H 4EEEA 4DZ8B 1HXYA 1PAMA 4HSQA 5EU6D 1B9ZA 1OP3H 5FGCE 3OJMB 4NKQB 4PRHB 2X4SA 1UJ3A 3VFNA 1A3LL 2C1OA 3BH8A 5H94B 3GKZA 5I1KL 4WJ5A 3QULB 5DFWH 1MCWM 5F1SA 3QH3A 2HKHH 2IH3B 2UUDH 5EN2B 3RWFB 2XA3A 3DECA 3VRIB 3LOWA 1FG2A 2YPVH 4WTZA 2VXUL 5BMFH 5C70A 4LU5L 5GQBA 5C0BD 2CGRL 3BP5B 5FUZH 3QDMD 2MQ3A 5EU7E 3MXWH 1QKZL 1QQDB 1ZA3B 4OFVA 1J86A 1UM5L 1JF1A 4Z7QF 3OJVC 2D03H 4ZFOL 5F1NA 3BUYB 4OLVL 5B8CA 4JY5H 1BFTA 3KLDA 2H1PL 4LP5A 2PO6A 2KL6A 1QP1A 5FO7A 4UV4H 1MJJA 3BZDA 3I6LE 2R15A 3EHBD 4Z7QE 1N8ZB 4N0FB 4OZ4A 1K8DB 1CZ8L 3FQRA 3BUTA 4F7EB 5GISH 1FCGA 1CDYA 5IBLD 3O11A 3RUGE 5I18L 5EOTB 1F00I 1YYML 3BZFA 4TSBL 4XHJC 2HT4D 2V5TA 1R3HB 4PRHD 4WIQA 2FYYB 4PJDA 4QTIL 3I75A 5F6HI 1AKJB 3PWJA 2C3VB 4JM2B 2F54D 3BW9B 4LIQL 3DOSA 5CINL 3OKMA 1RZ8B 3CVHA 3JV4A 3T0XA 2ADJB 3TBSA 4YFLF 3QHFH 5F7WC 3HNTH 1KJ3H 3BVNA 2PUQT 1KJ2B 3F12B 1FNGB 4LP4A 4EI5B 5L2JA 2DQIH 4F15C 3HRZB 4X8XA 1JHTA 1MAML 2Z31A 2YBRB 3MRKB 2JE8A 4Y5YC 3WD5L 1UH3A 5DJCA 1FE8H 4ODHL 5F1NB 3RDTB 4ZXBA 1OAZH 1NUGA 3B3IA 4HUXB 4Z5RB 2A9NL 3QUYA 3WFZA 1CLZH 4I77L 1ND0B 3E6HA 1MVUB 4X7TA 3ARBA 1ZHNB 3CXHJ 1LP9A 2HFGL 1EXUA 5IBLC 2H3NA 3R8BB 3SJVD 5JOEA 2XWTB 4MSWB 5JPNA 3CZFA 4RFNB 1FC2D 4KMQA 3STZA 3AFLA 3GHEL 3AREB 3WJLC 2DS4A 1X5GA 3CLFH 2HRPH 2NX5D 2ARWA 4PLJC 3ESVF 3DYMA 5D2NA 5DDHA 3VFRA 4YAQB 3VFSB 3WFDL 5HGGS 5I18H 4J3UA 4J8RB 5FM4A 4DN3H 4UT6L 2ADIA 2GK2A 2BNRA 2HTLD 1BX2B 4HS8H 2FHCA 4HCRA 5H35B 2Z31B 1HEZB 2DTMH 4JFEE 3QYCA 4P46C 4F7TB 3QA3B 4GW1A 1L9NA 4IJ3B 1T2JA 1BIIB 4KTYA 5HHMB 1Z5LA 3HC3L 3NOIA 1A1NA 2D7OA 2D0HA 1DSFH 3ARBC 4NNPH 2VLJB 4ZFGH 4M00A 3CPLB 3TNNA 2ITCB 5FCUL 3EYFB 3CJJA 4KUZH 2NR6D 1R3KB 3DX9B 5DJXB 3UTSA 3D85D 2Y6SC 1BZ7A 3QUZD 4WGVB 4EUPB 2VLJE 5CLTA 3IU4L 4JFOA 1ACYL 1FNAA 5AYUL 4DVRH 3DV4A 2FX7L 3AU1A 5IB5A 1T0MB 2XWBB 3DVGA 5LBSL 4YO0A 1ORSB 5GGVH 1QZ1A 3QDJA 5IP4A 2VLME 1U3YA 4ZS7H 1DN2A 3V95A 3BUYA 3SDXA 2FYYA 2YPLD 1BD2D 1F3DH 1VEPA 5JQ6H 5MHSD 2NTFB 4NQDB 2VQTA 1HHHA 1I7UB 1AFVH 3I3DA 5IFHL 3QDAA 1B88A 1V3KA 2XTJE 2DQJH 5CEZE 4HD9A 3L6FA 5D1XA 2QJDA 43CAA 2ZP0T 4GG6E 3ARFD 4HEME 1CTOA 1HN1A 4XVJL 2DTML 3BKCH 3TEUA 4KK8D 4HK0A 5I19L 1XF4A 1DBJH 4R97B 1ZLSL 1N7ML 3D85B 5HGHA 3PXHA 3O2DA 1R24B 3BDBA 1FFNB 3PP4L 4O58L 4N8CL 5C08E 2W1NA 3BIKA 4LQFH 5ILTH 3C5JA 3SDAD 1CGSH 2GUOA 2O61A 2D3VA 3QIBA 1QEWB 5I1CH 5TF0A 1U8NA 3L3DA 1D9KB 1EPFA 4L4TA 1S7TA 1JNJA 1C16A 2C3HA 5C0DB 1PKQA 1QR1B 1VPOH 4YC2B 5ALCH 3LRHA 3TYGH 3EO1A 3QCUL 5FHAL 1QLFB 2RAMA 4S1QH 4K3JH 5EO9A 5DD0H 4LVNC 1KCRH 3BKYH 1B3JA 5GGVL 4CU6A 3HI1A 1G84A 2IH1B 4N0RA 2NXZD 2FO1A 2AABL 3VWJD 5CILL 4FA8A 2YC1B 3OZ9H 2HVJA 4IRJB 3BZ4A 1FNHA 1F8TH 4BFIA 1UACH 1EERB 3CMGA 3FFCD 3KPRE 1KC5H 4NQEB 3RNKA 3QUXB 2IPUG 2KKQA 3OXSB 5GSVA 2GYSA 2HJLA 2L0DA 2ENSA 4XMPH 3AMKA 4B0MM 1UQSA 4Q6IA 3LN5A 5E6IB 2IAMC 2Y4SA 3J8F7 1EFXA 5E5RB 2HWZL 3SDAB 1ZLWH 3VGDA 1D3CA 4QOKB 4TUOA 4Y5YA 4Z7UB 4CMHB 2NLJA 3QIWD 2GCYB 1C5BL 2OSLA 2DQEH 3D3VB 1G0YR 3T0EB 1BM3L 2C4FT 5FECA 5JHLL 1BAFH 2ZUVA 1N6QH 5DJYB 1D5BB 2P5EE 3MBED 1SEQL 1ZVHA 2WINB 3CVHL 1BFVH 3PNWB 4F58H 1CGSL 3RGVC 3O6FC 2DQHH 2K7PA 4X5WB 1GOHA 1A5FL 2CKBH 2JB5H 5ITFA 2HT3D 4IRJD 3EYUL 2H9GB 1AGCB 4FTVD 3X13A 4F37F 1NUNB 3FOLA 4QHLA 1OT2A 1FH5L 4RQQA 1XGTA 3LMJL 5C09E 1YMME 1TPXB 4MDJA 1IZJA 3MGOB 2I25N 1XGQA 3IDMA 4QTHA 3OZ9L 2OL3H 2XRAL 4WW1B 5FYLL 5ISZE 1Z0MA 1VGKA 3CZJA 2FJFA 5IKCA 2A77L 2RCSH 4P5TA 2QHLA 3IAGC 1UWEH 4HXAH 4XAKE 2X1OA 5C09D 5C0AD 4CW1B 4KTEH 2MCG1 3TBYB 4PJGB 2GKIA 2A1WH 1YNKH 2WINA 4HKZB 1Q1JL 4HJJH 1J1OL 4EDXB 4IRSD 4RFOH 1MREH 5EU6A 1P84K 2R0LH 3VE0A 2HJKA 3GSOB 4NKOB 2VAAB 4PPTA 4JZJB 3B43A 3O8XB 4R2GD 4UU9B 3T0WA 4JZJC 4J3OC 1NFDF 2Y1VA 2Q86B 4G8GA 4OD2B 5IEKB 4X6EA 5L88H 3L5IA 5F3HB 2CKBL 1U8NB 3L3DB 4YBLB 2F5AL 1GVIA 1RUKH 3L9RA 5HYIA 3RVUC 1F11B 3EZ8A 4XWGH 4ZG1A 5FUCC 4K23L 3O2WH 4MWFB 4NCC1 5CEYB 4EIGB 1FH5H 3HFML 4YHNA 1JZ2A 3W9DA 4MCYA 3LDBB 3SY0B 1S8DA 1NMBH 2DD8H 4YDVB 1JRHL 4LNVA 5EBLB 3KYKH 1XAUA 4Y0GA 3REWA 1QA9B 4E5XB 4GKZA 1UM6H 4P23C 3U4BH 5DUMH 3WKNA 1BOYA 3VE0B 2ZUUA 5IJVB 2E9JA 3BEWA 4XNUH 1U8HB 3QIUB 3TH3T 4JREB 1JWSA 3X12B 4XVUC 4L9LB 5TGBB 5BRZB 1IC5L 3PXJA 4HFUL 1FAIH 2O93L 1I7UA 2QSVA 2ITCA 1Y6MR 3GZKA 4NQDA 5D7SL 1IE5A 4MZ3A 4XC1H 4DWHA 1ZT4A 5DHVB 2Y7QB 2YPKA 1B4JL 1LP9E 2OXHA 2VLKD 5DMIH 2UV3A 1RMFL 3GI9L 4M7LL 3PWJB 1VKXA 4OI9A 5I66B 4FFYH 2NX5A 2BDNH 4M5YL 4OQ1A 2XWBA 2LTQC 3LKNA 1PEZA 2X09A 5B39G 3ARZA 4LSQH 3RNQB 1QFPA 3CSYA 4WDIA 3ARYA 1JK8A 3OG4B 5C1MB 3TNMA 2H2SD 3STBA 3PG2A 4J6RH 1A2YA 1TETL 4XCNA 3WEXB 4HWBL 4JFFA 2CKNA 3B9KB 1JWMA 1N6VA 5EUKB 2CSPA 2GY5A 4WW2A 1MWAB 2DMBA 4CADA 3B5TA 3HFMH 1H0DB 1MAKA 1QBLH 3LH2H 5F96L 3QO1A 3WLWD 5IQ9B 2EDBA 4HDIA 1J5OH 2ADFH 5I1IL 5I15L 1XCQB 5E8DL 2P7TB 5AZ2L 1WAAF 1NEUA 2QQLH 3K8LA 3FRPG 4MHHI 1WGOA 2XZZA 3G9AB 3T0AA 2WQ8A 4WFFE 2LQRA 3GJFA 2XOTA 1ZT7A 2WMPA 2XYCA 3V5HA 4ZFFA 1CVRA 5BQ7A 2F8OA 4GG8B 3QNXB 2R0KL 4G6AD 3KR3H 4LASL 4ORGA 1FHGA 1RZ7L 2YPVL 4BQ6A 4HH9B 5I73C 4HUMB 4OIBA 1P6AB 3U9PL 1IL1A 3ZKQD 3X13B 3JWDL 4S0SD 1NGYB 1DVFA 5E8NA 5SWQB 4KKNA 2EDDA 3TVMA 2BHYA 3O3BB 3HZVA 1T0PB 4U7SA 3R06B 4X7SH 4WI8A 4HBCL 3SOBL 5C0JA 3VXUB 3PHOA 2Q7NA 3IFLH 5DJYA 4NP4H 3MLTB 5GRVL 1T83C 2VJXA 1FO0L 4EI5C 4KZEL 4AT6A 3B9EA 5HY9A 4X98A 5DVOA 4RWHA 1NKRA 4HWNA 3KYNA 5HPMB 3AM8C 3AC0A 3ARGD 1I1AA 1F90L 3MZTA 1E28A 1IAOA 5LCVH 1KJVB 4GW5A 1VACA 1J0YA 2VH5H 4C56E 4D8PA 3T77A 2VWEE 3O4LA 4WFFD 4QWWC 5H37G 3RJQB 2HFTA 3N0PB 2GTZB 5C6WH 4L4VE 3K8KA 3QEQA 5L6YL 5F7NC 3BT2L 4ZDHB 2J4WH 5IMOB 4JO3L 4ISVA 1INEH 4W6XB 2RB8A 3VGHA 5JXAH 3DX9A 3LQAH 4P3WA 4X4XA 1RIHH 5C0BB 1PD6A 1RZ7H 3OMZA 3UJJL 5KN5A 3IDXL 4PJGA 3PHOB 1OWWA 1EHAA 3SBWA 1QACA 4NYLA 2B2XH 4BQCA 4FG6D 3IDUA 4YK4B 4U4BA 2NY2C 3MLUL 3QRFM 4D0BA 4D0CA 1G7QA 4OV5B 4WI9A 3ZSTA 4P2QD 1P4BH 4QHNB 4XZUA 1FG2B 2E8ZA 2J8UF 5I19H 1A4KA 1KIQB 5GHWL 3HMWL 1XZ0A 4CDGC 3SDCD 4I8DA 4U0QB 1WLHA 3GNML 3FB8A 1SBSH 4F15B 5D1ZC 5F3BA 1FBIL 4P46B 3B83A 5IIEB 1UM5H 3JTTA 3LHPH 5F6IB 5LKNA 1WAAE 3ZKMD 2Z92B 3S34L 1NDMA 5E99H 3TESA 3MYJB 4G80B 5E6IA 3QDGB 5A2KH 1I1FA 5GJSH 3MACH 5DEGA 4FS0A 3DROB 5IM7A 2FIRT 2R0WH 3SGKA 1MLBA 3UBXG 3EW3B 3DX6A 5MEQB 3BPLB 4O2EA 4HGWB 2DI8A 5ALBL 5CEZD 5DJAB 4ZFZB 5FA3A 5FO9B 1UM4H 4IRJA 4ZSOE 3NMEA 1OD7A 1ZTXH 2BVPA 1FNEB 3CMOL 3DI3B 3P40A 1YDPA 1NCTA 1CDUA 4J4PA 3GMQA 4I2XE 2FGWH 4OZIE 1F3JA 4P2QB 1UACL 4R0LC 3RWGA 4HIXL 4HUWB 2J8HA 5IK3A 1A6AA 3SDCB 2WBJD 1CG9B 2XFXA 4UB0H 4EI6B 2HFFB 4ZQKA 5TDPA 4UILH 1W72L 2PR4L 1N4XL 1WC7A 3MLUH 4KJWD 4DQOL 1NCAL 3QG7L 5FM5O 3CX5K 3QBTB 1P4BL 4JFEB 2NX5B 3GHBL 5FO8B 1AO7A 3ARDA 4NKDB 3BZ4B 3IVKB 1C12B 4GRMB 2CMRL 4I4WA 5FYJU 1D5XA 4R6UA 4PYHA 2W60A 2VXQL 2DM4A 4WO4C 3B9KA 4XCNB 3WEXA 4MNHA 1LK3H 1AIFB 2HRPL 2VDPH 1L6XA 1RQ5A 5FUOL 1GJIA 1FLTX 3AUVA 4TQEL 3LKSB 4K7PL 2YUXA 5J7CC 1D9KC 4LLUA 2DF3A 2XZCL 3IFOB 4JJHA 3WNKA 3L3KB 3DMMD 1UB5A 3KPMA 1FVDA 2WBJC 2X4TA 3K1DA 4K3DL 4KK9D 4AQ1B 1BGXH 4S2SB 4CN4A 1RFDH 4WDIB 5EIQA 4XP9L 3MPCA 3OR6B 3MJ7B 4FFVD 1QTYT 1T7YA 3U7WH 3SPVA 4YXHH 4AIZB 3KJ6L 4XVTL 3T2NH 5EA0H 3TZVC 4XP4H 3KPQA 3IDGA 3VXTA 4RGOL 4APQC 2Z93A 5DXWA 2XZQH 2EDFA 3MXVH 1A02N 5E6IC 4OKVA 2AABH 1U8KA 3VGGA 1M7DB 1T89A 2EDXA 3EOYG 2AGJH 2I60L 5H37H 4YHYB 5HJ3B 4NOBA 4JFHE 4YHYC 5LBSH 1E27B 4XXCC 1YMMB 5ESAA 4NZTL 5CIPA 3S7GA 1BJ1J 4NQDE 5HHPA 4NWTH 2CJUL 3V7AE 4MVBC 4KI5F 4G8EB 4PRIE 4Y1AA 5HYSA 3F6LA 3OKMB 3QXTA 4HIEA 5IFJA 2HWZH 4CVUA 1QNZL 5ACLA 4IM8A 3ZDXF 1BQUA 4YQXH 5IJKA 1DQMH 3W9DB 2YK1L 4XP1H 2WIIA 5I76A 2EXYD 3TV3L 1I9IH 3RVVC 4FFVC 5F1IA 1QPXA 2JIXB 3CGTA 1K6QL 3VWKA 1E28B 3P9MB 1S7UA 4JRXE 4O5LH 4OFYD 4TPRH 3ABZA 2FECL 2W59A 4JFFE 5EBMB 4MNQB 4X9FA 4EKXA 1T04A 3QPXL 4ZNCD 5FGRA 3QHFL 4Z78B 4S1DD 1MVUA 5DUML 2Y72A 1TMCB 3VGBA 4R4NC 4Z76B 3PQYB 2PETA 3MYZA 4RRPG 4F9PC 4FMFA 2JK5B 1UCTA 5C0EB 2VL5A 3GRWA 1T6VN 3TPKA 5FCSH 4ODHH 1Y18B 2HG5A 5L2KD 2MKLC 1OAQH 4XMLL 1MFAH 4LRIC 4QXWA 1CLZL 2VABB 3QCUH 4MYWB 4Y19B 5DR5L 3EGSA 4NZUL 1INDL 5MEQA 5B39B 4HBQA 3BGFC 1OWRM 1M6OB 3B9VA 5JPMB 4DAGH 2LU4A 3B4NA 1KIQA 1VB9A 4XZUB 1YA5A 5DC4B 5CGYC 4ZFFB 1P7QD 4UIMA 4W6WB 5ITBH 4UIKL 2B1AL 4WRLA 1KJMB 3QRGL 4E0RA 4DKEH 3BMWA 4ZXBB 4HF5H 2F15A 3LS4L 1IAIH 4IIQC 4NBYB 4ZXBC 3WV0A 1MHHA 2YWZA 4M48H 4RIRB 3KLAA 4RFEA 2JB6A 5CFHA 1UYWL 5HGAB 3TFKC 3EUUA 4TPRL 3GIZL 1YY8A 3LDBC 3BDYH 4QXTA 5DK2B 3OJ2C 1VHPA 3F62A 4CVWA 2E6PA 1K85A 3ROOB 4Y1AD 2FX9H 4R26H 4UUJB 4OD3H 1NDGA 2HT2D 4KI5D 4UDUA 4PGZA 3JXAA 2YD8A 3D18A 4L8CA 3ARDC 1JWMB 5KVGL 5T3XE 4NNPL 4UINH 1Q94A 4JRXB 1SEQH 3FB7A 4XBPA 3HKFA 1S9VB 3W11C 5ESVA 4F58L 1R3JA 2EYTB 4C56A 2J8OA 4DTGH 3TZVA 2EIZB 3O4LE 3Q1SH 1YECL 3OKYA 3QWOA 4KJPD 2XQBH 5CCKL 3UJTH 1U8PB 2FX7H 5EO0B 1I3VA 4D9QD 3LPGA 5DYOA 1YY9C 3V0AC 3MRGA 5JMOC 1CWVA 2NY0C 3M8OH 1NL0H 1K2DA 3PWPA 4X4XB 4GXVL 3RIFF 5C0ND 2VLRE 1CFQA 4LVOB 3H8NA 5E4EB 3QDHA 3FOMB 4G42B 1RVFH 1WIPA 5ELIA 5JIPA 3KPSE 5DO2C 4OCLC 4FFYL 4B53A 3QWRA 1X3DA 5FOBB 1FGNL 2YN3A 3LAFA 3U2SA 4F9PA 5T5NF 1YNKL 2Y07H 4U1NA 5E8NB 2Q6WB 35C8H 3L5HA 4H0HB 1HSBB 4LSQL 3FCTB 1FQ9C 2IFFL 3O2VH 4OI7A 4X99A 4MDJB 4OD3L 4TRPL 3FB8B 5HI4D 4N0YL 4QEGA 4Y4HD 4L3EB 1JPFA 2ZJSH 3V6FB 4Z0BH 4FQQA 1T5XA 4JO4H 3T3PF 1KCSH 1NH6A 5JOFA 2YD2A 4K9EH 5D7LA 3RZCD 4EBQL 3TIEB 3DROA 4AEHL 1I7RB 2R56L 3QDMB 3NH7H 3CH8A 5BVPH 3ECBB 4S1QL 1HILB 3ZHLA 3F7YB 3KPQB 4NRXA 2QADC 3HAEB 2GTWA 1WWWX 4PGCA 3WHXA 2R4SL 1AJ7H 3JWOH 3N9GH 1NL0L 2JJUA 1WWCA 3RWIB 2BHZA 2X9YA 2Y23A 3TT1L 5D2LE 4OBRA 3S88H 1HKFA 1A1MB 1IEAA 4MD0B 2ICCA 1JPSH 1N5YH 2BSED 2DBLH 5IWLA 5D9SB 4GQPH 4JN2B 4NYLB 1II4E 5E2TH 1NFDB 1JGLL 4EOWH 3O6KL 1GL4B 1CN4A 5HHOD 3EJJX 3SHSA 3L1OL 4XXDA 4PJ9D 1LHZA 1AGCA 4N0YH 2UVEA 4OZHE 5JHLH 3MCKA 5SWZB 3TWCH 1AC0A 1MJUL 5DWUH 2IBBA 3RDTD 3G5YA 4XAWH 3QZWA 3KWWA 4O00A 4LCIL 1LK2B 3TT3L 1P4IL 2YSSB 1F90H 2R1WB 1GC1H 1SVZA 4ODWB 3RA7H 1T7XA 5HI5D 3BEVA 5TE7L 1C7TA 3P3YA 2N56A 1EJ6A 2OTWB 5CZXD 1MCCA 2H8PA 2WANA 4OTXH 1OAKL 2VABA 5EO0A 5D1QD 4Z7NF 4HKJB 3KLSA 3VW3H 4PYGA 1F5WA 2CIKA 1VKXB 3SY0A 3LN5B 4LSSH 3CFBB 3W39B 5D1ZD 5FM8A 2EXWD 1KEGH 1E0OB 5FYLH 3GMQB 3GJFK 4DGYL 4AH2A 4UZGA 1NPUA 3OXRB 4EXKA 2P5WA 3NPZB 1U93B 3EDDA 3OKLB 4JQVA 4BQBA 3T65A 3VGEA 1JPSL 2PXYD 2GITB 1R3IL 1YC7A 2ICEB 2AK1L 3EFDH 4G8GB 3JSSA 5FF6B 3RU8L 5AD0A 4KJWC 3EZJB 4OGYH 4JGMA 1Q0XH 2N1KA 4ZD3H 1J1OH 3VXUD 4PG2C 5HHMD 2FJHB 2Q87A 3H9HB 3U7AA 4LPUA 5F89A 5J3HD 4N5UA 3RRQA 3QHZL 5L9DL 1I7TA 3A0OA 1Z9MA 4YXLH 2APWA 4HAGA 3UTQB 5F9OL 5I8EB 1FVEA 4RMQA 5IMLA 3TWCL 4L4VB 3ROLA 1TLKA 1MFEL 1NC2A 3NCFB 1YEIH 4HBCH 1PZ5B 2V7HB 3I3BA 2FR4B 4S1SL 2XV6B 3LEVH 1H3PL 4JPKL 2HN7B 2EXWC 3QFJE 4Z7UF 5SWSA 3P0YL 2PCPB 3DVIA 4GAFB 3HE7C 1YC8A 4RGOH 3SN6N 1GPOH 3KYNB 5ECJE 5HPMA 4XNQA 4MA8H 4WV1B 4Z7WA 3C60A 1PW3A 4FZEH 3NACL 5JNYB 3MA9L 3TJHC 3G6DH 1S7XA 5C07E 4WFGD 3D39D 4DGVH 1NMCC 2EDQA 2UWEF 4KJYB 3T3PE 5DUPL 4NNYB 3MRGB 1HSAB 5CAYB 2GTZA 1RULH 4HC1L 5L6YH 3NTCL 2I07A 1Q94B 3BP5A 4LFHD 4X6CA 1RI8A 4N8VB 4YHNB 4YBHA 2Q7YA 3BXNB 4XWOD 4TOYL 1RIHL 3BGMB 4C4KT 1OGAD 1LE9B 1ONQB 3BQUC 4KWUA 4P2RB 1FNSL 5GGTL 3RL2A 3V4VL 1RIVL 1JNNL 1RUMH 3BEWB 3IJHB 4N0UB 1U0QA 4U3XA 3NZHH 3MX0A 1OTSD 4RNRA 1FJ1B 3VJ6A 4I2XB 5BZDB 2EZ0C 4KY1H 1KLGA 4HWBH 5E2WL 5HHOE 3ZHDA 1F02I 5FK9A 4HIIB 3V4UL 3EOBA 1AP2B 1G6VK 1IKNC 1T20B 4M7ZB 1OP9A 1NSNH 1KXTB 3VFUA 3FT3B 4QKXB 4X5XA 4RISH 5IHUL 4FXLA 4ZPVB 2V5RA 3OPZL 1BOGA 3HS0A 2GJ6E 3EJZC 3NACH 4N1HB 1Q8MA 1UCBL 3IAQA 2VKWA 3DBXB 3Q0HA 3TN0B 2FSEA 5E8DH 4Z18A 2JJWA 4M93B 3QUXD 3RIAK 5IFAH 3LVEA 4R97C 2AJZA 1F6AB 4HIHA 4G9FE 1JGVH 1S9YB 4DAGL 4JPWH 1T7VA 3WNOA 4PB0L 1JYVA 4P2RA 5TQ0H 3MODL 3QJFB 1G9NL 4P46A 4MA1C 1GIGL 3X3GH 1FNFA 4K8RD 3CD4A 5C09B 4FQXA 2YMXH 1I3RA 3OL2A 4PP2B 3FO2A 1CE6B 1D6EA 1FL3A 3ZKND 4M5ZH 2O5YH 2IGFL 4OF7A 2C7UB 5B38A 3QCVL 4RZCA 1OL0A 1Z3GL 2YEZB 2AJSH 5DQ9A 3V4VH 1CFSB 3GMNB 1OF2B 2D0GA 5SX4H 4BM7A 3QQ3B 4H8WC 3CXDL 43CAB 3GSUB 3VI4E 1MCIA 1Q9WA 4P5MB 1A8JH 3O8XD 1BQLH 4R2GB 1BQHA 1ZVSA 3RWFA 1YYLH 5TH2B 3MV11 2G60H 3TN0D 1T22B 1ED3A 4TUJA 1YEFL 2R1XB 3MRPB 4PJGF 1D5XB 2VZOA 2MSPA 1VERA 3TV3H 1J1PH 4LFHG 2B1HL 4QRPE 2PYFB 4RAUA 4WNQA 3LD8C 2PW1B 1S9WB 5J11B 1OB1B 4U1SA 4HPOL 2BXZA 3TNNB 4UNVA 1VEMA 2FJHA 3F6IA 3ZE1F 4EN3B 1I1AC 3HR6A 1GGYA 2NZIA 2BOCB 5I1DB 3CUPB 2XZCH 3ULUE 4EUPA 1LP9F 3OKDA 1CD1A 1FVEB 4JFHD 4X4YA 3PWLB 4UBDC 4MA3B 4B41A 3VRLF 4HG4J 2J4WL 4FXKA 3T0BA 3DLQR 2GK0A 3T0EC 1F3DJ 2UWEB 3BE1L 3QEQB 1I7RA 5C0JB 4LCWD 3RX8A 3RVUD 3IU4H 4BA8A 1JTPA 4X7CC 4PJEB 3KJ6H 2J6EL 4D8PB 4HS3B 2OMNA 1CT8A 5DC9B 1U3ZA 4PGEB 2DLGA 2EECA 1RZGA 1TZGL 2Y07L 2X4NB 4MS8C 3O6FD 5E95B 3CXDH 3RZCA 4EI6A 2HFFA 4ZQKB 2Y36H 3FN9A 1BQLL 4JB9H 4U1SB 5I1AB 5F93C 2GJZA 3KLHD 1JZ7A 4K7PX 3W2DH 5GGRA 4PJDE 1XGPA 5EBWB 4XVUD 3WHE0 4NUJA 3S34H 1QFUL 3EYQD 5CZKA 4XNZB 4AEFA 5HYSB 1TQCC 2VITA 3BPNB 1MHEB 3B9AA 3TBTB 1U91B 1PGRB 3QO0B 3PABB 1CGUA 2F53D 2Z35A 5I75C 3R1GH 2FB4L 3L5XH 4FNLH 3LZFH 5I75B 1KJ2A 3F12A 4LCWB 1HYSC 3QIUD 4XCFH 4BZ1L 1MFBH 1IGML 4W4NA 1U8IB 1KT2B 2M1KA 5B38B 5EZLB 5DJCB 3SKJH 5GS0C 3O4OB 3OAYH 4R8WL 3MYJA 2X4TB 3UTSD 4Y19D 1EAPB 1JPTL 1S9KC 4MZ2A 4JJ5A 1IFHH 4BFGA 4I18B 3BVNB 3ETBF 1PY4A 5ADOL 1N5YL 3VXRA 5F8RC 1E6JH 4KH2A 3KLHC 2KUTA 5JHDB 2DLIA 4G8FB 4GRLD 3GSVA 3V6ZA 3UPCA 1SJVA 2R9HD 2Q8BL 3SDDA 1V7ML 2EIBA 3VMOA 4X4ZA 5I2IA 1RZJL 2KZ1B 1DBAL 4J4PC 2X89A 4F7CB 4UTBL 2EH7H 1G1YA 1MIMH 1L9MA 1WTLA 1X5JA 3VDCA 3UTPE 1Y0LA 3SO5A 1A7BA 4ZTPH 5HXMA 3QJFA 4CU7A 1RZKH 1AXIB 4GKSA 1RZFH 2OR7A 3LIZH 4PGDA 2Z8VC 5TDPB 1G7MB 5L0QB 3WXWL 2WWMC 4IDJH 1IT9L 3QUZA 1ZT1B 1QVOB 1JE6A 3NPSC 5DJXA 3UTSB 5IG7A 1JRHI 1A6TB 3IRZA 5KAQG 5CBEB 5JW4R 3SDCA 5FUCE 5C0RH 3IVKA 4JFDE 3OBAA 1BLNA 3DNKA 4TNWF 4FABL 2WBKA 4I3GA 4LKCA 4J3WA 5TF1H 2BSTA 4W68A 3BH9B 2Z91B 3NIFF 1XZ0B 3CFDA 2HVJB 4LARL 1LK2A 1BZ9A 2WLYA 3MZGB 1NC4B 5TH2A 4EBQH 3DUUA 2NY4C 2R56H 4L29A 3FN0H 5HVGB 3VRJA 5CD3B 5JO5A 4GAYB 3CH1A 2X1XR 3GM0A 4KXZH 3VFGL 5D1QC 4HZLA 1CR9L 4MXVE 2ESVA 3MJ9H 3TA3C 1T3FA 1KYOK 1MCFA 5FA4A 1IILE 1XCTB 4MJ6A 4AM0B 5AAWA 3D3VA 3UCRA 1HI6B 2OK0H 2VC2L 3K7UA 3ET9F 5AYQA 1SY6A 1ADQA 3C5ZC 2H32B 4FZ8H 3D0LB 4HC1A 3QFJB 4Y4HB 2AXJA 1T21B 3QQNA 3SDXF 4L8DA 1DUYA 4FMKA 1QFWI 3NN8A 2B0SL 3L3JB 3UTQA 5TFSH 5GJTL 2JB6B 2X4RB 4N8CH 2WUCH 4MA8L 4DK3A 3FONA 4K8RH 2Q8AL 1NAKH 3DX8B 1H0DA 4Q9RL 4CW1A 3EO9H 2I27N 3GUTA 1YQVH 5HHME 1CU4H 3N50A 4K55A 3TA3A 2GFBA 3UTTB 3KXFD 1OGAA 3FO9A 1IC7H 1EEYB 4Y2DA 3J7HA 4Y5XA 3RAJL 1BZQK 2AW2A 3WJJA 3TPUB 3WNLA 1IAKA 3NTCH 3VXMA 3WIHH 5DF0A 2HLFC 2X42A 4X9GA 3PJSA 1KCRL 3BKYL 5JR1L 3TM6A 3FZUC 3TBWB 1VADA 2VITB 2IAND 2VZ1A 1D7FA 4ZSOB 3MFFA 5BCAA 2D4FA 4U1JB 1RK1A 2I9LB 1OAQL 1Y0LB 4RQQB 4K3EL 4H5SB 4P46D 1KB9K 1P7KA 1P53A 2G5BB 4ZFOA 2Q6WA 4JM2D 3QFJD 3U36A 3G5XA 1T0NA 4DN4L 1U8IA 1A9BA 2I07B 1A0QL 4XT1C 1DQQA 3RTQB 3UDWC 1T03L 4MMZC 5DK2A 2EICA 1CICC 3O2DL 3I50H 4OUUA 3TLRA 3IDIA 2DWDA 5HHOB 3V6FA 3FO2B 8FABB 1MCWW 4HF5L 3PWNB 3PV6A 3CSYB 2R2EB 2R69H 3G6AB 3KXFB 1L4IA 1MHEA 3GI9H 4M7LH 5FXCH 5MEPA 3QNZB 3BYTA 3QHZH 4X8JB 4Z95L 4IIQA 1ZE3C 4ALAH 4E0RB 4BQ9A 2AV1B 5F9OH 3REVB 2UZYB 1BD2E 5GJTH 3VFMB 3CH1B 4GKOA 1MCSA 3OPZH 4LHUB 1JGLH 4U1NB 4WV1C 4FQXD 1ZKAA 2HLFD 2IANB 3SJVB 1DL7L 4DZBA 3BOVA 1AR2A 1YNTB 4NPYA 4QRPA 5DRWA 1CQKA 1YEKH 1DUZB 4PJAF 1PVHA 3KJ4C 4GJTB 5E4IA 1CFVH 1MCOL 1NBVH 2IANE 2J12B 5DJ0B 1RSFA 5DT1L 4L8CB 5E9DD 5ISZA 2HKHL 5C0IA 5F6IC 3N1MC 2B5IB 2F8VA 3PGDB 4P2CG 3MV8A 3VMPA 4FQLH 3F7RA 4M5ZL 3L7EA 5BJTB 5BMFL 1JBJA 4GG6B 1J18A 5MI0C 1VFAB 3KXFA 4ZOEA 3PWLA 1BWWA 1M1SA 1DUYB 3RFZC 5E24E 2EZ0D 4LSSL 1QSEA 4D3CH 1P5UA 2BVOA 2A73A 3P2TA 2VLJD 1KTLB 1AXSB 4D9LL 2CDEA 3MLWH 1EHLL 2XIDA 5D70L 1TDQA 4P59H 2B20A 2XN9B 4JY6B 4KROC 4P5TB 2KQNA 3D18B 3RBSA 1MIEH 1HDMA 2AJVH 2IPTL 2XT1B 4WU7A 2AJYH 1J0IA 1GZPA 5GRVK 2AK1H 4KJQC 5KG9A 4MNGE 4R90H 1HOCB 1UZ8B 3FB6A 4QTIH 1JNNH 4JM2F 1DBBH 3EKCA 3ZDZE 5ICZB 2VNCA 1I1YB 5F9JB 1NGQH 1LQSR 1YEEH 3D3VE 2D31B 1WSST 3F7YA 1OQOA 4JFPA 3NCCB 5INCB 4YDIL 2K1MA 1ZANH 1KTKE 1K3ZA 1Z9OA 5FGBC 3MGTA 4M03A 3MRRA 2OL3B 4NUGH 4OQTH 3ZL4H 2AEPL 2NW2B 2XXMB 5AEAA 2ZCKH 1A3QA 1S9WA 1KG0A 5L7XL 1H3XA 1T66C 2CRMA 3ME0A 4LSRL 3VRIA 3D39B 5LWYL 5I1JL 2IAMD 4UDTB 1IGYA 2BVTA 4HH9A 3VI3F 3L9RB 5L2KB 4IOFD 1D6VH 3DUSA 3BIBX 1HXMB 1ZA6B 4L8SA 1E4XH 3P4NB 1AE6L 1I7ZB 4Q97A 3KHQA 5DVLA 4M6AA 4NGHL 3I6KB 1IGIL 2OQJA 4Y4FB 4KAQH 2NTSP 2IMMA 3MNVA 1X5ZA 4P2OC 4X4MA 2D2OA 4BSVA 1U95A 1GIGH 3V0WL 2ZG2A 3BZEA 3ARXA 4QNPE 4XC1L 1OGAB 4XBGB 1KJVA 5I0ZA 2AS5M 1KPVB 1GGCL 2D9CA 4JGJA 3VXME 4QRSA 4XBPB 1ZLVH 2K3TA 4QNPF 4OLWH 4PJIE 5C2UB 1HQRB 12E8L 3BP7B 4M5YH 1HZHH 4X5LA 3U7YH 2YPLB 2PO6C 4R96A 5CGTA 5IWLC 4ODUA 3B2VL 2NW2A 3UYOD 5FKAA 5K9KB 4JQIH 4ONHB 5KS9B 2OS7A 2IAMB 5DZOA 3PQYD 5DUBB 1T66D 2P5ED 4ZUUB 1T0NB 3C6LB 3KDMA 4TVPH 2XWJA 3I02B 2D7NA 4GRLA 2EO1A 5HVWA 4J3SA 3U0WL 3IGAA 3UTPD 1P4IH 2JJVA 2ZCHH 3VFOA 4CNIB 3E1F1 1N64L 4N8VA 4TNWK 5GXBB 1MEXH 4PJGE 2XN9A 4Z77B 1OPGH 2AV1A 3BKJL 3MCKB 1DEEA 5AAMA 2NMSA 1NCCH 4UOJA 4XNXH 4PLOB 3X11A 3C2SA 1GOGA 2Q3ZA 2ZSWB 1IJ9A 3D0VA 1I8LC 3SE8H 5FDYA 4OGAC 2ARJA 4AEIL 4FQPA 5F7DB 4FQIH 3W11D 3QISA 2F74B 1X5XA 2J6EH 3BN9D 3JWDC 3CFKA 1A6ZB 1GSMA 1T2XA 2W0KA 1C7SA 1WAAA 3LD8B 4RGMC 1AY1H 4QCIA 2WV3A 5CS7A 3BKCL 1JF5A 3L7FA 4LNRA 4HK3N 5D2NC 3ZKXB 3OX8A 5IOPA 3KPTA 4I1NB 5IB2B 4CMMB 4JRXD 5FYKH 3V0VB 2CGRH 5FUZL 3GI8H 4M8QA 5F7MC 2FBJL 2VDRL 3T8XA 3IS0X 5ILTL 5MEOB 4RGNE 4XP6L 2ESVD 5DLML 4G8IA 4QRQB 2VLKE 5I1CL 2WWMD 3RZWA 2Y5EA 1FYTB 2HT3C 4UTAH 3OKOA 4JE4B 4JG1L 4XCEB 4HIJA 3GSRB 2GSGA 5I9QB 3RVTC 3LEYH 5EO1B 1J1PL 5K9JH 3FTGB 4YBQD 5IF0B 1T20A 4CGTA 1ZHNA 5E8EA 1UEYA 5LGHL 5KSAC 4XX1G 3SKJL 1X5KA 1A14L 5DD3H 3QULA 4Z5RA 3HR5A 3GGWA 1BD2A 1U95B 2A6JA 4NHUA 4OZFB 5HPOA 3O4LB 3SKUD 1PG7H 3V9FA 1QLRB 5CD3A 3VFRB 5ADOH 1D5MA 1N0LA 5BS0A 1HH6A 4MXVF 3TIDA 4QGTA 2HH0L 4TSAH 1YQ2A 1ED3B 3D87B 1W0WB 4TUJB 5E70A 3U4EB 2LABA 3MLXL 3VXSD 2AV7B 5BV7C 5KZCD 2CXKA 1M4KA 3TBSB 3TA3D 1T1ZA 1KF9B 4KKCC 3E2HC 4KRLB 4G9FA 4R4BA 4Y2DD 3IXAA 4A6YH 3E2HB 5CKAA 5GHWH 3D85A 2W9DL 1DBAH 2AXGA 4HIJB 1GH7A 2EKSA 4U7MA 5GGVY 2IFGA 1HSAA 4Y1AE 4P49A 1UB6A 1BFVL 5D72H 2DRUA 1EEQA 3EBAA 1FIGH 2CDFA 2DB8A 3KYMB 5E08L 2YWYA 1K4CB 4O2EB 4YQXL 4ELKB 1KPRB 3KNBB 4ZSOA 4QRSB 4Y88A 2VTFA 2NTFA 3ULVL 2P8MB 4DN3L 4XBEL 1MRDH 1GCFA 4P4RB 2BRRL 4NT6A 4PG9A 4JRXA 5D8JH 1J9CT 4XHJD 1XH3B 4UT7L 3LEXA 3L3KA 5EZJB 5KOMC 4JFEA 1IAOB 1KXVC 1JCKA 3TA3B 4OF3A 4XH2A 1T1ZB 3RI5K 1BOGB 2V9RA 1NCNA 4GFTB 3GMPB 5E1AB 4PD4J 3PWUA 3QUKB 4PB0H 4KPHH 3B9KD 1ROWA 4EI5D 4P5MA 3NCJH 4E9LA 4NN7C 1YMHA 5I1EL 1CR9H 5HDLA 2ADJA 3KXFE 1QFOA 3UTSE 4GRWB 5F7EH 4PREA 2QQNL 3CSPA 4NBXB 1I9JH 2V2XA 4KMTL 2XZAL 3CNKA 5M94B 1IARB 2EC9U 5DI8A 4YE4H 1G6RL 3FT2A 1D5BA 4YR6B 5E9DA 1WFTA 3OKNB 2J3SA 5GRZA 2R4RH 3C5SB 1MI5D 5T3ZE 1ZLVK 1FV1B 2AJ3B 4L4TE 1NCBH 2VDPL 1KCUL 1OSPH 3JVGA 4WUUE 5HGHB 2QQQA 1WWBX 3OKEB 5D1QB 3HPJA 1UA6L 3JTTB 4FQHB 3MRJA 4MCZB 5GS1A 1J11A 2XI9A 1I8IB 5D6CB 4CVXA 4X6BB 5D96B 3MV01 4R96B 3QIBC 1SM3L 2HTLC 5C9KA 3TYFA 2E6JA 1RFDL 3QO0A 2PXYB 1FN4A 1UWGH 3WO3B 3QIWA 4L1DA 3S8WA 5DUBA 2ZOKA 2FHFA 5DSCA 4BH7B 4H20L 1L0QA 4YHKL 3GMLB 4NRZB 4JHBA 2VAAA 1HH6B 4NM4L 2VUOA 4O02H 1FJ1A 2DLFH 2X70B 1U6AH 3NCJL 1XGRA 1G9MC 3DARA 2GJZB 4Z7OE 3I3EA 4O2CA 1GAFH 4K3EH 2X4UB 3BWAB 2NY1B 4K3JL 1KENH 2LAGB 5F9DC 1I75A 4Q9QL 1BPVA 4WGWB 2FBOJ 2EC8A 4D0DB 4P2RD 3WNNA 4XI5D 3M8OL 1FZOB 5D5MA 3WE6B 2DQUL 5DGRA 4WI2A 4NO2A 3SDDC 4KU1A 1QFWL 3LKPB 3UTTE 5LXGL 1XGQB 3VFPA 3SO3C 3DYPA 1K4CA 1ZANL 5IW1B 4JCMA 1OLZA 4ZO8A 1UA6H 3DVNB 4P5KA 4KZDH 3BP7A 5MERB 4HPYH 3HRPA 5JTWA 2UZXB 3GMPA 1FORH 5J9PA 3ARGC 5C09A 1QRKA 2DN7A 3IDYB 3VXQA 2KQMA 3UTTD 3RUGF 3D0LA 3SGJA 1IM3B 2W92A 3L7FB 4LNRB 5JOFB 2JJSA 2AJUH 3GB7B 4YH6A 5EU3A 2J88H 2YZ8A 4JFQA 5IVXF 4H20H 3QUML 3ROOA 2F8XC 1IKFH 4R9HA 5HDBF 4AM0A 5IBTH 2X4NA 3KS0J 1ULVA 1J0JA 1K4DA 4AQOA 1KBGH 1PX3A 4Y89A 3MNZA 4OF8A 4JZOB 3FCTA 4QRUA 5CP7B 4JFDA 2PYEE 4UDTA 1LEKB 1RIUH 5I6XC 5J3HC 4MB5A 4X6DE 2VLKA 1ACYH 4PREB 1V3MA 1JN6A 1EVTC 5FGSA 5E2JA 5DS8A 32C2B 1T1WB 5DHVH 3U7YL 4X5WA 1ERNA 4R0LB 3QHTC 2EE2A 3ZE2F 3Q6GL 3OTTA 1FIEA 2ZCLL 3WSQH 3VD5A 1MCLA 4BFEA 5IQ9A 3MLWL 2FJGA 3P77A 4F80A 1EHLH 3BP4B 1OW0C 2H45A 3U46B 4EDWL 1L7IL 1M6OA 4ONOA 5EWIL 1ZEAL 1MPAL 5F7KC 4X0KA 4NP4L 5IFHH 1NANI 2GCYA 4GAJL 1MWAA 3TF7C 3GMOA 2ITDA 4NNXA 5C0CB 5C08D 4DKFH 4LOUC 4K3GA 2QHRL 1T2QH 4PJBA 1ZT7B 3WXWH 5IFJB 5C0FB 4Z6AT 3LY6A 1YEEL 3HE6D 4WUUD 3RNKB 4K3HA 4YXKH 4OGXH 4OZHA 4CUCA 5HYJA 3QIWB 1E6OH 4YGVA 1FDLH 3D2UD 3MMEB 4W4OA 5E9DB 3QIWC 2WK2A 2BRQA 1EH9A 1LD9A 4OSUL 4WUKH 1CXFA 3PWPD 3S97C 3KYAA 5I71C 1A7OL 3HA0A 2Y9RT 5JXAL 5CSBA 2GAZA 5I71B 1ZGLP 2ATKA 1GC1L 1L0XA 5C7XH 4OD1L 4P2OB 1CDIA 4N0CD 5C0BE 4OB5L 3QUZC 1CFVL 3OHXB 2FJFB 3QIUA 5IJVA 5DT1H 2H6PA 5IW1A 4FTVB 1LO4H 1HHIA 4P4KA 4EUPH 3OR7A 3DTXB 3Q5YA 2R2BB 2X4SB 2LV4A 2BC4B 3IXTB 4CJ1A 1MHPH 1BECA 2UWEE 3BXNA 2ED8A 2R1WA 2FX8H 4M93C 4KJQD 2DQCL 3GI8L 1NAMH 2G5BA 1SBBA 4S1DC 4HEPG 4TSCH 2CKBA 2BY2A 4Z7OF 5JPMA 4JRYD 1DVFC 2W91A 2D7QA 2NY3B 4JDZB 3DETC 5HGBB 4OGZA 3MGOA 4LGSB 2F53E 2A73B 1EZVX 1PJ9A 5T1DH 3FMGH 4XNYH 4L4VA 3ROLB 4ZD3L 4ETQB 2SEBA 5KSBA 1PSKH 1WCBB 3ARGA 2ZUXA 1F2QA 1G9MH 4X9BA 4F7TA 2JJTA 3HZMA 4KK8C 1NCWH 2A9MH 1JGUH 3D69A 1YEGL 4KMLB 1KLGB 4LSVH 4JRYE 2B0SH 3FO0L 4JPIA 4R90L 1FDLL 1BM3H 4M1CC 3DGGB 5MEPB 1UGNA 3PIQA 3VRLE 1ZTXL 4YDLB 5KTEH 1F58L 1IGJA 3QEGL 2NYYC 5D9SA 5D7LB 1P4LB 1FZOA 5D5MB 4Z0XA 1PQZB 4K8RC 5M7QA 2RGSA 1YUHB 1KCSL 4Q9CA 4OZGE 5CGYD 1VGEH 3ULSA 4UMGA 2H8PB 2DJ4A 4E42A 1KIPA 3D1MC 4MGXA 3ZE1E 3D9AL 2AQ1A 4AZ8A 4QRTB 1YNTA 3P0YH 4JFOB 3EJZD 1WV7T 5D7JD 3H2WA 4KRMB 4HGMA 1S9YA 2PTVA 3KPLA 5DMGD 2Q86A 1H15A 1AH1A 1I8KA 4R0LA 3QG7H 2MPAL 3WDIA 3N9GL 3G5YB 5D6DA 1H9VA 1HXYB 3H9HA 3QDMA 2IEPA 5KS9E 3GGWB 4Q58C 5GGUA 1U3HC 3V7AG 3L3HB 3U46A 1AGBB 1BBJB 1Q72L 1CGTA 1NFIB 2YD1A 1IAII 2X4RA 2IC2A 3BGFB 4LPTA 1X44A 4G7YL 5HSFA 1A9BB 1QA9A 3I9GH 3TJEL 4E5XA 1GGUA 1H5BC 2P5EB 3L3IA 4CN1A 3C6LD 3K2MC 4K7PH 3IT8D 3WDJA 5BXFA 5CUSH 4EI5A 5D7JB 2R9HC 2FBJH 2VDRH 3HZYB 3SCMC 3B2VH 3MFFB 3VA6A 5KSAB 2VSDA 3C5JB 5DLMH 1S7XB 2NY5H 4JAMB 1CK0H 1KB9J 4LCIH 4N0FA 3QUMA 3T77B 1KCLA 2DM2A 1MCPL 2X1PA 2JELH 5F9WC 4YXHL 1Z2KA 3I75B 5CJ8A 1DANT 2WBJA 1MCOH 4J3TA 4XWGL 4K23H 1GHFH 4GW4A 4K2UL 5IVXA 1VEOA 4I3SH 5I1EH 2X7LA 5ERWA 2VDOL 4U6YA 4ZTOL 2GEEA 2AGJL 3NN8B 4OM1H 3C60B 4I0PD 1MRFH 5K59E 1I85C 1HHHB 2VQUA 3VGAB 5KJRL 1PG7W 3MV8B 1CD8A 4YE4L 1EO5A 2H2PD 2QSCH 2VR9A 1YPZF 4GRWH 1R3IH 3VXPA 1FAIL 1UADC 1UT9A 5CWSA 5DJ0A 3X3GL 2COQA 1JFQL 3NIGE 1IBGL 1SY6L 3GMOB 4NNXB 1PZ5A 2V7HA 3AU1B 5IB5B 2WLZA 4G3YH 3O4OC 5DRWB 1BWMA 1AD9B 3IGAB 4FQ2L 5I17B 2H3NB 4JN1L 1T22A 5H94A 3BO8A 2XACC 3V5HB 1ITBB 1OAXL 3U1SL 2GSIA 3LSOB 1J10A 1RJZA 4DCQB 1FZMB 4KHTL 2F54E 4DGIH 1ZHKA 1XF5A 2BFVL 3ARDD 5FYKL 5K9KA 1KTDB 4M7JH 3HNSH 4LLQA 1S78D 2ZUQC 5FA3B 1EGJL 2B4CC 3IU3B 1CFNA 2I5YL 5KW9H 4H1LG 4X7EC 3IFPA 3STZB 4OZHF 4XC3L 3X3FH 2XA8L 4Z8FL 3LH2L 1F4YH 3G04B 4ZOCA 1NUFA 3H7BA 3O3EA 4I3SL 4KGJA 3WUWB 2Q7YB 3WFEH 1KV3A 2YSSA 5DQDL 1Y6NR 4LIQH 1MNUH 5C0FA 1DE4B 3VFSA 1NQBA 3GB7A 2BNQE 4NZUH 3DPBA 4PRDA 2Y5TA 1NBZA 3DV6A 5B38G 1X4YA 5KBNC 2F5BL 4BUGA 4A2MA 4CAGA 4L8SC 3MRFA 5E5MB 1WTGT 4L3ED 4L8SB 1MCRA 4F33A 4ZPVA 4P2YA 5JHDE 1CI5A 4YLQT 4MNHB 3ULUL 3UBXI 1HCFX 3WLBB 2A9NH 5CIPB 1ITCA 1IAIL 5DO2D 1CE1H 5EC1B 2Q76B 1IQWH 4M6ML 4YHOH 2ARJQ 3M45A 5ID1A 2XZAH 4MD5B 1T1WA 2OL3A 5HDQL 1XF3B 1RUML 1TZGH 4D0DA 3VWKD 1LNUA 5DK3A 1JPGA 5D7IA 3MBXL 1OM3L 3VXTB 4JM2C 4FG6C 4LCUA 2R2BA 1V3LA 3WS3A 4Y5VA 3V0VA 4RWYL 4WCYL 4UINL 5I8OH 1R3KA 3ULSB 2PF6A 1QRNE 2VXQH 2APBA 4RISL 5A16B 5EZLA 1KLUB 1RV6X 4ELMB 1CZ8H 2IADA 5E6ZA 2FATL 4FNLL 4TQEH 5F7DA 5AG9A 4J23A 4KTDL 1BIIA 2DQTH 5BRZE 5HHQA 2C7UA 3NBNA 3HC3H 4HCRH 5I16A 3O81A 4P57A 2BMKA 4KK6D 5F9JA 3OGOE 5KSAA 4H8WH 5JNYA 1KSRA 4KKBC 5GGUB 3HG1D 4TULL 4KUZL 5F88B 5IMKA 3LN4B 4LRIA 3L5WB 3VWKB 1BF2A 2WWKT 1IQDA 4GXVH 2E9WA 3LQAL 2GSIB 2GK0B 4HX1A 2HJKB 1QLRA 3D2UA 3O3AB 3T1FA 4YHOL 5J12B 5JW3H 5F6HJ 3T8XB 3NVQA 3U9UA 3EYVB 4HFWA 2B2XL 4LHUD 4DW2H 2AJSL 5TPWL 2QHRH 3O6FA 4GKNA 3E3QE 5J13B 2R0ZH 3LQMA 1FL5A 3HC4L 2CK0H 2K9UA 1SEBB 4OV6F 1CYGA 4XPAL 2W07A 4AENA 2ED7A 2UZIH 2ZKHL 2XFXB 3CC5A 3FJTA 3S6CA 4XB8A 5HHNB 4HMEA 3RDTC 2DQJL 2W0PA 1I85A 5I8OL 4U6VL 1B2WL 5J1AB 1LO3L 4HPYL 5JDJA 4PJAB 3GHEH 1S8DB 4FXKB 1CICB 2XTJC 3GRWL 4YNYB 4YHIA 1T04B 3HE6C 2R0WL 2R8SL 2AEQL 3ZE0E 1XGYH 2EYSB 3G6JF 3LEYL 2YD5A 4JVUA 1A6PA 4OLEA 4YPGB 3VXRE 5ESVB 4XPFH 1AI1H 3U9UB 3PUCA 3MCLL 4J2XA 4DUXA 2RQ8A 3PNWA 4Z0XB 3CMOH 3JWOL 3QPQC 3H9SB 1WIUA 3IDGB 2ZUWA 3C9NA 2RIKA 1NGXB 1ZHLA 4P5TD 3PL6C 1XF4B 3C6SA 2NY1D 1W2KT 2CIIA 2W65B 4PJ7A 4U1HB 2QR0A 3MQIA 1FV1A 2AJ3A 4N9GB 5FGCB 3V4PH 1XGTB 2X44D 4M1DL 4MA3A 2LFGA 4JDTL 3C2AH 4U05A 25C8H 3NA4A 5D1ZB 5E2UH 5JXEA 1U6AL 2PR4H 1ZLWK 1YPZA 4O51A 3WSQL 3EDKA 2CQVA 2MFNA 5IV2A 4PS4L 5EC2A 3BPCB 4APQD 3DYOA 1DJSA 2ED9A 1PDKA 3LSOA 4DCQA 5DMKA 1HWHB 4R4BB 3UBXB 4B50A 4RFEB 4G8GD 2VC2H 2J5LB 4M61A 5KTEL 1R3LA 3Q48A 5DD5L 2NXYD 3BH9A 3EFFB 4WHYG 3MRDA 3GSNA 3QCTH 4PTTB 4IHOA 3TT3H 4G6ML 2BSRB 1XR8B 4MJIA 4D94A 4QHUB 1XGRB 3LZFL 4PJHA 4X9HA 1KT2A 3BRDA 3QUZB 1A7PH 5HI3C 2V7NB 4LHUG 1UYWH 4MJ5B 1XGUB 3RWCB 4MMXC 5E00A 2OZ4L 4I13B 3WHE1 3ARRA 3CVHH 4NZJA 3MREB 3O9WA 1KEGL 5C2BL 1FG9C 2R1YA 1DQDH 1DVFD 4R26L 4WI7A 1FYHB 1ZLSH 2ICWJ 3TYFB 4I48A 5JOPD 2ATPB 1FFQA 1PKOA 2V17H 4UV7H 4U6HB 4XP5H 4WTXA 4NQXA 4APQB 4NM8H 4HT1H 4LQFL 1DN0B 3GMLA 1UKSA 4MXQC 3V8CA 2QBWA 2ZOLA 4I0PA 5IBTL 5E2UL 3TVMB 2IG2H 1Q0XL 2LE9A 3GBNL 3P9LB 4JEGB 3QWQB 2FWOA 2IPKA 2LU7A 4PB9L 4R4FL 1SEBA 4G6JH 4JQXA 3O3DA 1UENA 5JA8B 3X17A 4KQ3H 1XEDA 4OCYH 1MCDA 1G6RH 5GS1B 3SE9L 2E7CA 3PQYE 2BNQA 2RBLA 3Q6GH 4KROD 3C87A 4YDLC 5J56B 4L5FL 4CVZA 2CIKB 3IRPX 4PRNA 1IQDB 1Q1JH 3CIQA 4JKPH 4LSUH 4EDWH 5DJ6B 5DSCB 1G9ML 3MRNA 2KBGA 5KSVB 4WW2F 5F1KC 3SGDH 2NW3A 3BO8B 2B4CH 5K9QG 1T2QL 3PWPB 1RJLB 4FP8H 4PRID 5HHQB 5FYJD 1EEYA 3IFNL 3ARFC 4KK9C 1K9TA 1U8QA 3QUXC 4G7VH 1DQDL 5C0IB 5F70A 5J11C 3VWJB 3V52H 3GIVA 2JJSC 3CC5B 4X9IA 3ZLQC 4NKIL 5J0BA 3VFGH 3FFCB 4O02L 4KKLC 3C6LC 3A6OA 2DIAA 1N5AB 2JCCE 2DD8L 4QXGL 2QEJA 5LAXB 3JZ7A 2O5XH 4YHIB 2BSSA 3ZDYF 3T1FB 5E6ID 1NBZB 2W9LA 3DV6B 1RUAL 4MD0A 4S11A 4JY6A 3FQTB 4Y5XB 2ENYA 3CSBA 1KCVL 5GIRB 4BUHA 1FL6B 3SE9H 5CP3A 4WI3A 4I4WB 4YUEH 3D3VD 3D39E 3FHAA 1FYTD 3DRQB 5ISZB 3PWNA 3FB5B 4M9PA 1RJLA 1JZ8A 3V5KB 2FGZA 2WUBL 4D9LH 1DLHA 4F57H 4OF6A 3AXLB 4W81A 4DKEL 4LPCA 4PJAA 1DUZA 3K4ZA 4HJ0C 3L7EB 3P30H 3HE7A 5DJ8B 3QZWG 4AH2B 3M1BA 5C0NC 4BH8B 4JKKA 1T7ZA 3SKNB 2MTPA 1KFAH 2R29H 4FXGA 4XHQA 4LPVA 4FQ1L 2A1WL 4I0PC 2X70A 2Y5TB 4QGYA 2V5SA 4XNZC 1D5ZB 2YPKB 3RP1A 3IKCB 1JV5A 1NMAL 2ZNWA 2HMIC 3BGMA 4XPBH 3BEVB 4WHYH 3NCYS 5DTFA 3PV6B 1JGVL 4MA7H 5TDNB 3HCVB 1JYWA 3QNXA 5EORL 1WZKA 5LGKA 1QFWM 4JFXA 5EU3B 2AEPH 4P9HL 4NQSB 1MLBB 1BX2A 5L7XH 3QEQE 4XAKD 5A1AA 3DSFH 3QR2A 1NANH 1TCRA 3O11B 3G6AA 1FNEA 5SWQA 1J8HA 2XNAA 4HUUB 3SDXE 4PJCA 4P57B 5IHBA 2XXCB 4OUUB 5BVJA 1SYVA 5EIVA 5ICZA 4LVOC 4Y2OA 4KAQL 1S5HB 4WFEE 2E8YA 4Y5VB 1OM3H 3WS6C 3U0PA 2GT9A 3WFHA 3C9NB 4WU7B 3S4SA 4I3RH 1L7IH 2O26U 3O6LH 5HHVH 4JO2L 3RWEB 8CGTA 4ZS6D 1ZEAH 5JMRA 2HN7A 1A6WL 1YUHA 3S36X 5BV7L 4S1RH 2DKSA 3IFOA 4P3DA 1XR8A 2APTA 1VA9A 3MUJA 3GO1L 5KSAD 3OB0H 4MLIA 5FOJA 3RPIB 4IOSD 5JHDD 4F9LC 2UUDK 3H0TA 3O2VL 3N85L 3LKRB 4M7KH 1VFMA 3KPNA 5BJTA 2CDGA 2YHGA 3CCHA 4HKXA 1YPZE 4ZDHA 5IMOA 3GIVB 1TCRB 4YDKH 4YXLL 4PR5B 2B8OT 5CUSL 5CBAB 1YEJL 3MRMA 4NJAL 5GPRA 2I5YH 2CLZB 4HJGB 4Z77A 1WBZB 3FQTA 3PHSA 1Z6JT 4XC3H 1S7SB 3VI4F 1KACB 3ALPA 5FYJE 2BX5A 3H3PH 5CJ5A 3AS1A 5K9OA 4DVBA 3BKMH 1R5VB 1MEXL 1WISA 4FQCL 4NWUH 4KK6C 2CR3A 3ARPA 4OCWH 3QSKB 4K2UH 3GBMH 1IGFH 3H9SA 5E7BA 3SKNA 3HI6L 5F88A 5IMKB 4JZJA 1K5NB 1IGTA 2HT4C 1Z0NA 3W2DL 1IC4L 2ZUQB 3QUXA 5DD1L 1MRCH 5J4MA 4AG4L 4FQIL 4LVEA 4LDOB 2VQ1A 5D96C 1E4KC 5DTFB 4ONFL 2JCCA 3LV3A 1LO2L 1DBML 2PXYC 3MV9E 2VXSL 4ZUTB 1F2XK 4FRWA 4NBZB 4ENED 4NN7B 4GRMA 3WLWC 3KPLB 5IROA 4Y4HC 4PJFA 4MJID 1N2RA 2BJML 5C08A 5E99L 1JPST 4JPVL 4OCSL 4PJHE 2EDRA 1KTRL 1DLHB 3ZSSA 4DZBB 4HXBH 4F7PA 1PQZA 1AGBA 3D9AH 3FQWA 2IAMA 4DVRL 4XVTH 3T2NL 4GLRI 4Y16D 4HCRL 4U1KB 3CDYA 4K9EC 1HCVA 4N90D 3MA7B 3VJ6B 4E41A 4NN6B 4OI8A 4G8EA 3D0VB 4YJZL 3BGAA 2VUYA 4U6YB 1YNLL 5CZVL 1BQHB 2AI0H 4HUVB 1PKQB 5JW4Q 3S9DB 4NSKB 1DEEB 4NJ9L 4JRWA 1Q9KA 5K33A 3SGKC 1U9KA 5DD1H 4N9GA 2BNRB 1JYNA 4JY4A 3HMXH 1H3WM 2AERT 5TPWH 2PW1A 1QSVA 3QCTL 3QUMB 3HC4H 1BQSA 3CU1A 3G5VB 4BZ2L 3GSWA 4M1GL 1C8PA 4PJ5E 2R1XA 1FLRH 2XWTA 1XT5A 3NFNA 4PJ9C 4NO3B 2BK8A 4F3FB 5HDQH 1DR9A 1CTNA 3GBLA 4TVPL 1OHQA 4OCMC 5FIEA 4DVBB 5KG9B 3V79C 3UROR 3C09C 4M61B 4PJEA 1U41A 5IGXH 2BY3A 3E8UH 2VIRA 3QNYB 5BW7A 1DQJB 3SE4C 5I6XB 5D72L 2CD0A 3W82A 2P45B 3VXUE 4LARH 1FNLA 1RJZB 1CIUA 4JPKH 4NQEA 4UT9H 4NQSA 2JELL 4O2FA 1N64H 5A3ID 2Z93B 5ICYB 4X4YB 4OFKA 4MWFA 3QIBD 4TSBH 2QKIA 1LEGB 1T1XB 1U8MA 2LVCA 4OLUH 4MNQA 3GSRA 1KB5H 1BFSA 4FFZH 2DOCA 4R3SB 4XPHH 4ZTOH 1YN7A 1WCQA 1IAMA 1NMCB 3Q6FB 1EHXA 2WIIB 4D9RD 2DWEA 5BS0D 4LAJH 2OK0L 3S4SG 1HYRC 2JK5A 2VISB 1P7QA 3IDNB 1OP5K 1U2HA 1DN0A 4NO3A 4F3FA 4P9MH 3U0PB 1X4XA 4OZIB 1CDJA 2J5LC 4WHDA 3K80A 1C08A 4JR9L 2GIYA 4AT6B 4Z7NE 2H26B 4E41D 5HD8D 1R24A 1W0VA 3LS4H 3D2UB 3O3AA 1CGXA 1J0ZA 4ONGL 1FLRL 5M95B 1KGCD 4M48L 4RA0C 1A6ZA 3CFKB 4IOFC 1FL6A 2OI9B 4GO6B 1S5IL 3P4OA 5IBUB 2HFGH 4QRQA 2CJUH 1B0GA 4JHZA 3BDYL 1NGZB 5HTSA 4KHTH 3UX9B 1VGKB 2BMKB 5IESH 4P2OD 4JB9L 4DGIL 5JA9A 5T1LD 2BVQB 4HIEB 2ZKHH 4XCYB 2G9HA 2GHWB 4LGRB 4MAUL 4KRPB 3PWVB 1ZAGA 2OJZL 1J88A 5EZOL 4NKIH 2ZZUT 2C1OB 2C1PA 1HSBA 4H26B 3SGDI 4WHTB 5K9OB 3TN0C 4H88H 1YN6B 4OLUL 5JR1H 3GSUA 2P8LA 1HNFA 1KULA 2YRZA 4IMLB 2FEDC 4WI6A 2GI7A 4JY4B 5FUOH 1MNUL 5E94A 5ID1B 1RUAH 5IHZB 3MV7A 4EN3D 3ZT5A 4NSKA 2CDGB 3CCHB 1KCVH 4MA1B 2NYYD 1A4KB 5SX4I 3OWEA 4PJ9A 1WZMA 4TVSa 4QXUH 5I16B 4P9ML 4Z9KB 3WFBH 3WL9B 2AXHA 2EYRA 2X4PB 1EHNA 2DLFL 4MJ4A 5DRZA 1XFPA 4XP9H 4YC2C 3ZDZF 4FTVE 1O7SA 4WW2C 5I2IB 2IQ9H 3F7PC 3VXSA 4Y4KB 4NO2B 1JWUA 3P30L 3QEQD 4M1DH 5I1AA 3QCVH 4JANB 3MLVH 3WLBA 1S7QB 3HPLB 2VZ3A 3AAZB 1JPFB 3CFCL 4X6BA 3DX6B 3KPSA 4M6OL 1X5AA 4WFGE 4IRJC 4MSWA 5JPNB 3MBXH 4KRNA 2Q20A 5J9PB 2DM3A 4PS4H 2OLDA 1FIGL 2GQHA 1QFWH 3B5HA 1DL7H 4Y4FD 2F19L 2B1AH 1RD6A 2JLLA 4HJ0D 2FEDD 1MFNA 1KCKA 3MLTA 1I9RH 3S35X 1HILA 2OJZH 4NRZA 1F3JB 4P2QA 4NKOA 4BKLA 3KPOA 4Z0BL 4GMTH 4FQJL 4EN3C 1ZWIA 4HMCA 5GGRY 3N1QC 4P99A 3FQWB 2JCCB 3LV3B 1I4FA 4F7PB 1DVFB 4G6KH 4PJ5A 5CJOL 3RWHB 3SDYL 4UT7H 3SGEH 3QA3A 5E8OB 1K4DB 4YWGL 1U93A 5C9JB 5AUMA 2IADB 3LPFA 3UDWA 1HQ4A 3JV4B 3DETD 3DMMC 2C3GA 2I9TA 5SV4A 1FZMA 5TF1L 2V9TA 1AJ7L 3TVMD 3F5WA 1IEBA 1MQKH 3F7QA 3MOAL 1IM3A 1VPOL 1F4AA 3MRDB 4QOKE 2QQNH 2OR8A 2KDGA 3C6SB 5JW3L 3VFWA 2BVQA 3DUHA 1MELA 1FN4B 1WEJL 5I8EA 4DW2L 1S9VA 3QEUB 1U8OB 3L95B 4PRBB 1FFOA 3IDIB 4PFEA 4OV5A 3BPOC 1AKJA 4LMQI 2YXFA 1LDPL 2OBGA 3NGBC 3VFPB 1SYSA 4L9DA 5F9WB 1NGQL 4ELMA 3UTOA 3HNVL 1FZJA 1YPZB 4O51B 1G7JA 2EYSA 3MLSL 3HPJB 1KCUH 1OSPL 1Z5LB 4KVCL 1TQCB 4Z7VE 2FZ3A 4YDIH 5JZ7D 3U79A 2W0FB 1NDMB 1MJUH 1OTTC 5DWUL 5DEFB 3HRZA 3BI9X 3CSGA 3RJDA 4EDXA 4L5FH 3MLRL 3EDFA 4WV1A 2DQGL 1NGWB 1UXSB 3DRTA 1R5VA 4FZ8L 5IQ7H 1HIML 2NY6B 1RUQL 2YD3A 3ARVA 1JGEB 5DURB 3HZVB 4QLRA 3BKML 3MV8D 2R8SH 2Y6SD 2Y06H 4Y2DC 1UWGL 4AENB 4FOMA 2OJEB 4YO0B 1H5BB 5KVFL 4P4RA 1A6VH 2WUCL 3MUGB 2R23A 3WNPA 4I0CC 1HHJA 4JLRA 4KGLA 3HB3D 5EULV 1NAKL 5DVKA 4B7IA 4YHPA 2PW2B 1MQKL 5AD0B 5FF6A 4ODWA 2EYRB 4YBLC 1CU4L 5EIIA 5D7JC 4WWKA 3WXVH 1CD0A 2ESVB 1OGAE 2WP3T 3RIFK 3JWNC 3UBXA 3NH7L 3EYUH 3ECBA 5F71A 3NZ8B 3C2AL 4OAWA 4X8JA 3JWDH 3EFDL 1LWRA 4K7FA 1EO7A 4ONFH 3MGTB 2YEZA 5AWNH 1C1EH 4ERSH 2X4QB 3RKDD 3LB6C 3ARDB 1KUMA 1VACB 4BSWA 2DWDB 2D31A 3UYRL 3SOBH 1ES0A 1I4FB 2OTWA 1QUNA 4QRPB 1LEIA 2ZSVA 4GMSH 3OKKB 1MIML 2QR0B 5HYJE 4HXAL 5F7HA 1CG9A 3C60C 3CFBA 4LHUA 3K46A 3CDGB 3I50L 1F42A 3SDAC 1UQSB 1IGJB 3RWIA 2HMID 3MV8E 1H3PH 5JXEC 3VXSB 4RFOL 2V2TB 1O0VA 1RVFL 1JI1A 5DJ8A 2GJJA 4LLVA 1NCWL 2A9ML 2LTQB 3UZQA 5DMJB 1BQHG 2NY7H 1FFPB 1FGNH 5DVNA 5IMMA 1TZHB 1G7QB 2VERN 1QSEE 5A2LH 3TFKD 1BVKA 1PEWA 1RHHA 1CGYA 3DX7A 5B8CB 4K7FB 3ARFA 1EO8H 4BELD 4ZUVB 2X9XA 2UWEA 4PRPA 3I85A 3RKDC 1YEKL 4PJ8C 2HT2C 2YBRA 3MRKA 2Q3AA 4KI5C 3RWDB 3U4AA 3HZMB 43C9B 5EOCL 3IJYB 2ZJSL 4QHUA 1MAMH 4WEUD 3O2WL 2C1PB 3DTXA 3QH3B 4O9HL 4L1HA 4BZ2H 4EVNB 1XF2A 5FEBA 3MJ9L 4XVSH 3D25B 4JANA 4KDTA 4HUWA 1KIUA 3U4BL 4NHCL 3ILPA 3EOTH 2OTUB 5IKCB 2P5EA 2BC4A 1HQ4B 4LEOA 2E7LA 1YDPB 1JZ3A 1IC5H 1JNHB 2P1YA 3TCLA 1TZHA 1CDGA 5DFTA 1N8ZA 1N26A 3GK8L 1F4WL 3B8SA 4I3RL 3BJ91 4KY1L 3BRGC 3TBTA 1G7LB 1A6WH 3JUZA 1CICD 3FRUB 4POZC 5HYJB 3EDJA 1RY7B 2VR4A 3MOBH 4RX4A 3FFCA 3IKKA 5T3XD 2BY1A 4HS8L 4MNGA 4BK5A 2CKBB 1UWXH 4X80H 4Q9RH 4PJAE 2VMFA 2DQHL 1HKLL 3U6RA 3STLB 1EO8L 1CK0L 3UAJC 4FQXB 5ADPH 4JHAH 3V52L 2FR4A 5AUMB 4JKLA 1JP5A 2ARJB 3TC9A 4X98B 1U92B 3O9WC 3IKCA 1JHKL 3S36H 2H6PB 4N9OB 4UB0L 4OFIA 1SJXA 3FT3A 3PP3H 5FCUH 5JIHA 3ZTNL 2XWJB 1Y18A 1Q38A 3PE9A 5JW4M 2VN4A 5TJWK 4DQOH 2AAVA 3B3IB 4HUXA 3CVIL 4JVWA 2O5XL 5EUOF 1LO5A 3P4OB 3QAZC 2FHBA 2HFEB 3DO7B 1I8LA 2AI0L 3F8UB 3GSOA 2DYPA 2A77H 4GBXA 1CLOH 1Z3GH 2F53A 4NZDA 4LSPL 1NAML 4PJ9B 4MB4A 5EO1A 2YD7A 4ZS7L 1QSFE 3L3HA 5H2BB 1QEWA 1N0XL 4HWZB 2BCKA 4ZUWB 4OLXH 4TUKL 5IOPB 5BO1H 5F3HA 1U8KB 3Q3GA 4NO5B 1BVLB 3U6RB 3AROA 4N8VG 1YEFH 4RRPA 1CQYA 3RWEA 5JW5B 3T09A 3S4SB 1G9NC 3I6KA 3U9PH 5IVZB 2X1WL 3PIQB 4ALAL 4TTDD 2BOBA 1MI5B 3K81A 3UZVB 2A6IB 1MJ7L 3FFDB