1QFUL

Influenza virus hemagglutinin complexed with a neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQTLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQNTHVPYTFGGGTKLEIKRADAAPTVSIFPPSKIQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A complex of influenza hemagglutinin with a neutralizing antibody that binds outside the virus receptor binding site.
pubmed doi rcsb
molecule tags Viral protein/immune system
molecule keywords PROTEIN (HEMAGGLUTININ (HA1 CHAIN))
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfuL01
5TQ2L 4AMKL 5DUBA 4XNZC 3WIFB 5EO9A 5EOCH 1LP9A 4HUUB 4ODTL 1R3JA 2HT4C 1YC7A 5GGTA 5E08L 3AXLA 1TCRA 3BEWA 5FCSH 3BO8A 3ILQC 2A6IB 5AEAA 5E2JA 4EUPA 5C09B 2LU4A 5DHYA 2VN7A 1YEIL 5IV2B 4MXVF 4C56E 1I9JH 5GGTH 1P9MA 2Q86B 2X1OA 1P5UA 4G8GD 1KB5L 3VRJA 4CU7A 4OZFH 3U36B 3KLDA 4XXCA 3WKNA 3HB3D 5EOQH 3V4VH 4F7PA 1H5BC 4D0DA 4P9HH 3KPMA 3MRLA 5E2VL 2IFGA 4D8PB 5F88B 2H9GA 4XMKH 2ATPA 1MNUL 1EK3A 4YAQB 2UY6A 4ZSOA 1A3LH 2Z92A 1NEZA 2AK4D 4WUUD 2OK0H 4ZNEE 2YD4A 5C2UB 4ZFFA 2BVTA 1V7NL 1NGWA 4QHMB 3FO1A 3DJ9A 2NXYC 4OZHB 1T5XA 4PJDF 2YPLE 4MAYA 1RJZA 4UMGA 3GFUA 3F8UB 5FYKH 3CXDL 1VFAB 1I3RB 3BPLC 4YR6A 3DROA 2OI9B 3PWPB 1BIIB 3BDYL 3OKOA 3DRQB 5F9DC 3AREA 5CHNA 4HIJB 3INUH 2RCSL 2R23B 3L5IA 3BZEA 4QWWC 2WANA 1G84A 2YA2A 1MPAH 3CDYA 4Y4FB 5KG9B 3L5WB 4ENED 4S0SD 3TBYA 4BELD 3KYKL 4BK4A 3CPLA 4O5LL 1CIDA 4ZQKB 2RBLA 4Z7VA 3FB6B 3P11L 5TPWL 1N6QH 3DBXA 3MV9D 3QXAA 4TSAL 3SKOB 1KPUA 1YC8A 2ED8A 4OT1L 1T2QL 1ZLVK 3H9HB 3H9YA 1CGSL 1X6NA 2EDBA 4OCNC 3HNVL 2YD5A 3V6FA 4WHTB 5JMOC 3SJVA 1K8DB 1ONQA 3CFEB 1BBJB 1BAFH 1T1ZB 3IJHA 3I6LE 5IIEB 3WDJA 5ACMA 4XTRC 1JF1B 4CMMB 4XXDA 5HHOE 2CK2A 4HHAA 5GJTL 2CR3A 3FB7A 2KL6A 6FABL 1TTUA 2EDHA 5J13B 4D9LH 3BIKA 2FRGP 5I2IB 3QA3A 2VDNH 1QKZH 5I8EA 3O41A 4KTEL 5JHDD 4LEOA 1Y0LA 4UU9B 4ETQB 2IAMA 4H88L 5J1SC 3MZGB 2X4PA 1SEBB 3O6KH 2P24A 3I85A 1A5FH 4KVCH 4MJIE 5C0JA 5J6GA 5ANME 3S36H 3HA0A 4GG8B 5BVJB 1G7HB 3DOSA 1S78C 5BO1H 3MA9H 1JPFA 4MNGA 1R3IL 3OZ9L 1XT5A 5DD1L 4X5LA 4YHOL 2AJZA 5I0DA 3STZB 3RNKB 2NZ9D 5FKPB 1HQRA 5JHLH 3LRSA 3HZVA 4JQIH 3PGFH 3TV3H 1G1YA 1BFOB 1H3WM 4JY6B 3RUGA 4CUCA 1JHLH 1IC7L 4EI6A 4RQQA 3NPSB 2XKNB 5CD5D 3U0PB 5CBEA 4R26H 1LEGB 1QRNB 5SWSB 4M6OH 3RVVC 4MHHI 5ADOL 3DGGA 4MLSA 3HI5L 3BDBA 1QG3A 1PKQA 5LQBH 2B1AH 1UM4H 3FT2A 1HDMA 3DHJA 3ZKXB 3KWWB 3GMMA 4L1DA 2ED7A 4MB4A 3RZCB 2ZUQB 2B4CH 4D0CA 5JPNB 1XF3B 3OWEA 3SDYH 3PDOB 1KLGA 1SBSL 4U6XA 5E24E 1ERNA 2OYPA 4PGEA 3KNBA 5JNYA 4WV1C 3ME0A 2VKWA 1JGVH 4HJGA 1H15B 2QADB 2CLZB 4N9GA 5EFIA 5D8JH 4JGUA 4FQJL 3CX2A 4WDIB 4OGZA 1U8MA 1FZOB 3V6OC 2H32A 4OZ4A 1J1OH 4HUXB 1T80A 4W4NA 3PNWA 2B2XH 1CK0L 3IDIA 4Z7UA 4YBQD 1AD9A 4ELMB 1A2YB 2IBBA 3KPPA 1MCFA 4HZAA 4NZTH 3UTTA 1FGVL 5J6HB 1AGFB 1ZHNB 4O2FB 2VXSL 2EDKA 3GZKA 3RHWK 4ZDHA 1MF2H 2QADC 1H9VA 1OPGL 3PJSB 3UTPE 1GRWA 3LIZL 1KN2H 3GSRB 4Z7NE 1SVZA 4GXUM 1OW0A 5EBWA 1L4IA 3T8XA 4BYHA 3ZDYF 1PZ5B 1CFQA 3ABZA 5KJRL 4RWHA 3TFKC 5ID1A 4BQCA 1RZGB 1AHWC 2ZCHH 3AS3A 4Y19B 5EUKA 1K3ZA 3REWB 2AXFB 1FG2A 2YR3A 3O6ML 4XRCA 2APVA 2OL3A 1MF2L 2FR4B 4JFOA 5GZNC 5F9OL 4OD2B 3LKOB 1KIQA 1RZIB 1ULVA 3W9DA 4PRAA 3HC4L 5T3ZL 4ODUB 2GQHA 3HN3A 1JYWA 4FP8L 1BMGA 2BVPB 1UG9A 4JRXA 3P9LA 1NGYB 4B53A 4R2GD 5FK9A 3O8XC 2GITB 3PGDA 2AVGA 3KNBB 1AGEB 5JNYB 2BY1A 3PL6D 3IAPA 2X1WL 3CVHA 5FM5M 5E8DH 3T4AB 3NZHL 1W72A 2CPCA 4NKMB 1OAQL 1HIMH 4WTXA 1T2QH 5FGCB 1SY6A 2E9IA 5E00B 1KEML 4M7LH 3U30C 3CK0H 1R5IA 4ZS7L 2B4CL 5DK2B 4GRLC 3QFDA 1ZK9A 2WLYA 5T1KB 2PW2A 2AJ3B 1E6OL 1LEGA 2YA1A 3F65A 3FO9B 1M05A 1B4JH 1X7QB 5D71H 2ZCHL 3G08B 2V5MA 3OXSA 4EI6B 5F7DA 4P5TA 5C0BE 4X7TA 2X89A 1IMHC 1SMOA 2DLGA 4JDVA 2WNGA 4RBPK 4GRWF 4AIOA 2KKQA 3STZA 4Y0GA 5HGHB 2W38A 3OXRA 4MJIB 3QG6B 4TUJB 4OLVL 1MCNA 1VB9A 2OQJA 1LE9A 4XP9H 5HBBA 4X6DF 3LEVL 4JRXD 4HS3A 3U4BH 4I3RL 3RIFF 5I9QC 4XNXL 4GBXA 4MQ7A 3N85H 2L0DA 4M1DH 5TDPA 5EUOF 3RWDB 3QDGD 5DTFA 1YPZA 3VFSB 1NFDA 1QZ1A 5LAXB 3VFSA 1I8IA 1VEPA 2VDLL 2DQUH 3FQNA 1T22A 1D5MA 3ARXA 4LLYB 1SMAA 3MJ8B 4N8VB 5HJ3B 3GB7B 4PTTA 4AENB 4QF1B 3L7FA 1UENA 4PG9A 5D1QB 1HNFA 3UAJD 1JI1A 1GZPA 4ZOEA 1BAFL 4OIAA 5HD8C 1UQSB 3MODH 4IMKC 4ZPTA 5L6YH 5GHWH 1J0HA 5JQHC 1JHKL 2W0FB 2CDGB 2X9XA 3PGCB 3G5YB 4WI7A 5GGUB 2HKFL 5F7EH 4YHLH 3O6FC 4KUCF 3DTXA 4B50A 2ERJB 5DSCB 1OSZA 2WP3O 3V0WL 3OHXB 3EIFA 5JOPE 1ZSDB 3B43A 1WFUA 3TBWB 2AV7A 4BZ2L 2C4XA 4OF5A 1NAMA 4ODWA 1N6QL 1E0OB 2PW2B 4MA3B 5KAQG 1CGWA 1CI5A 1DUZA 1JTOA 1A7BA 3BKYH 5FB8A 4LPVA 3CMGA 3OKEB 4Y4FA 1JZ3A 2AK4A 5E8OA 1BPVA 1U3ZA 1T22B 3T0EB 2VLJD 4GLRH 3ESVF 3R1GL 1S78D 5LAXA 5IBUB 4N0UE 4I3RH 4QXTB 4AENA 1A6AA 5I1AA 2EIZB 3I3EA 3WFDL 1OM3H 3ZKND 4E42A 4LSQH 4LLYA 5ERWA 4LLDB 1QTYT 2EDNA 5DRZB 5JW3H 5E8NB 1AGEA 1P4BH 3DHMA 1DVFA 1GGUA 1R0AL 5EZJA 4NN6C 5CKAA 4OZHA 1AO7B 2H1PH 4HBQA 3HNSH 3V6ZB 1QLRB 5KVDL 3C5JB 5KSUA 2W9LA 3O81A 1LMKA 4IRZL 1DANU 2VUOA 2AK1L 1BECA 2DWEA 2R69H 5MI0C 5HYQB 3CDGA 2EH8H 1NUDA 1I8KA 5I71C 2RAMA 3AS0A 4H1LB 1G7QA 1XCQA 1FFOA 3MV9A 4FQXC 1KCUL 2A38A 3KYOA 4LU5H 1MI5E 3MXWH 2R1WB 4GXUN 4P5TB 1X4XA 5ELIA 3G08A 4UTBL 1IM3B 1UADC 4RA0C 2YMXL 2JB6A 4LCCB 5IVNA 4OZGB 2WIIA 5GSVB 5I19H 5K9QI 4AM0A 5F7EL 4N5UA 1J5OH 2HVJA 3GI8L 1U8KA 3P77B 3W0WD 1QBMH 1TZHA 3BKCH 1OGTB 3HUJB 4C57C 4PYGA 1XGYH 1BD2D 4JFQB 1MRCH 4R8WH 4CVZB 2RR3A 4UAOB 4MAYB 5DRNB 4KJYA 2Z4QB 1J1XH 3RZCD 4I3SH 1HEZA 1XR9B 1PSKL 1LP9B 1OAUH 2NLJA 2BVYA 3D39B 3R06B 4X8XA 3TLRA 4OZ4B 4HJ0C 5IWLA 4PJGE 1DN2A 1KC5L 5CINH 4PRAB 1BLNB 4N9GB 5EFIB 4G5ZL 1JGDA 3NGBB 3C5SB 2FX8H 1TQCC 4EN3A 1MCDA 2HVKA 3SDDD 1PKQE 3GIVA 1VEMA 3H0TA 2JE8A 4HMCA 2I25N 1XGYL 3MFFA 1FNSH 4HKBA 1H3PH 4P5KB 4DN4L 1CT8B 3GSNA 1AO7E 3W0WE 3BT2H 2JELL 3AB0C 1WT5A 4FMFA 2DMBA 3WXWH 1UH2A 3PQYB 2VLJE 4FQXB 4YDVB 5H94B 3UX9B 2PETA 2WMPA 4JRYB 4Y19A 3BWAA 4TSBL 4X5XB 3I9GL 3PF2A 3D3VE 3SDDC 4PBWD 1FGVH 1EFXB 2HT2C 4H0IA 2BMKB 2NZ9C 3GI8H 3WLBA 3LS5L 1T1WA 4FQLH 1S9KC 4OV5A 3RWGB 3D25B 4X6BA 5JR1H 5J3HD 4XP5L 1PQZB 1ZTXL 4LSVL 5IVXE 4M5YH 3L6FB 5E8DL 3EOTH 3OKNA 5EN2B 1MELA 3B6SB 4GG6E 5HY9B 4P2OB 5C8JA 4F2MB 5IB5A 2R0LH 5IMMA 3OL2A 4EOWH 2DWDA 3PWNA 3QIUB 3KPOB 2CLRB 3S96B 1QFUH 3V5KB 5FA3A 3P9LB 2BVPA 1DR9A 3VCLB 4LPCA 1QSFE 2ZG3A 5HYIA 3LKQA 1H0DB 3EYSL 2EDQA 4GW5B 3CFCH 5IROA 3VXTB 3FFCB 1FFNA 1OLZA 1XR9A 4UU9A 4QHKI 1R5WA 2IANB 4RNRB 3SDAB 2Z4QA 4KY1H 5ABDE 1OY3B 3MROB 1RULH 4J7RA 4X0KA 5DC4B 1CDCA 2J4WL 5GRXG 4MJ6B 4XWOD 2R2CA 3U2SB 1XCTB 3PP3K 3T8XB 1EMTH 4HX1A 3SE8L 3VI3F 4BZ2H 2HA1A 4P2QE 1BEYH 2MCPH 1IM3A 2NQCA 3KYNA 5JXEC 2DRUA 2A6JB 4QT5A 1FYTE 5KANG 5AAMA 5BW7A 5A16B 2MOVA 4ZDHB 4I0PA 3QEGL 2XA8L 1T0PB 4J8RA 5CSZB 3GBNH 4KHTH 3E6HB 3MR9B 3C09B 1GGYA 1K5NA 4AYFA 4WTZG 1FNAA 4Y5YB 5CP3A 3KG5A 2EC8A 1U8QB 1SEQL 2W07A 5I1LA 1CE6A 4X4YB 3G6JA 4TN9A 3BGAA 4IHOA 3PWJB 4BUGA 3NA4A 4WEBL 3IDNB 5BVPH 3N1QC 3P73A 4PJ5D 3O9WB 1U2HA 1L7IL 1UWGL 2YWZA 5BV7L 1BGXL 3QFJB 4MS8D 3CMOL 5EBMA 5GRUL 5HYJB 2AQ3A 1D9KD 3RUGE 3FB7B 1HCVA 4G9FE 4XBGB 2ZSVA 1I3GH 1JF1A 4LIQH 4QXTA 4PRBB 3QH3B 1GGIH 1T7YA 1U3JA 2FD6H 3X13A 2Y36H 5FYJU 1EA9C 1CXKA 3AAZA 3LEYL 3CFDA 1NCAH 3L3GB 4FNLH 1JN6A 5EIVA 3RIAF 3CSPA 5JLZB 1HZHL 4PJIF 5E5RB 1IQWL 4PJCE 4FQXD 3HG1B 2R9HD 2DB8A 2R2HB 3BYYA 2FECL 1IFHL 2YSSA 4JM2F 1E4XH 5F88A 4LPYA 2VH5H 2X4UB 4KROC 4LVOC 5D2LF 5DSCA 5HDBE 4RFEB 2A6DB 3U30B 3LRSB 4NO0D 3HI5H 2XTJB 2H2SD 2COQA 5K9OB 3NA9H 5C6WH 5FKPA 1LD9A 3QXUA 5C0BD 2WWKO 4KC3B 4PJIA 1M7IA 3O8XD 1YMMD 2AJVL 4ZFOA 4LVHB 1IQWH 3VRJB 3SCMC 4XMPL 3SDXA 1GZPB 1ZEAH 3ZYIA 4JFXB 3MJGX 4PGBB 3BJ91 2BVQA 5EUOE 1BIIA 1IC5H 3OKOB 4K55A 1C5CL 1VFAA 3F5WB 5D4QA 4G6JH 1BZQK 4OI7A 4YDIH 3LD8C 2VDNL 1KIPB 3ELAT 3HMXA 4XPFH 4XMLL 3RAJL 3JWOH 4JRWA 5EO9B 4YWGH 2WBJA 3BSZL 5JXED 1KIPA 2VDPL 4GW1B 1S9YA 1L9NA 3T2OA 4HUVA 1P6FA 4OM0L 4V1DB 4WGWB 3FO2A 5CJQH 2OCFD 3EZJB 5GISH 3H7BB 4UNTA 3WSQL 2C4FU 4P2OC 4XNQB 1G7IA 1AR1C 3MO1B 3OR7B 3VG0L 1M7IB 2D4DA 1P6AB 4U6YB 5DJ2A 1EH9A 3DMMC 5FO7B 1NCUA 1T03L 1EBPA 1ZLUK 4HKZB 3KXFE 3SO5A 3BQUB 3U36A 5IG7B 4UIMA 3STBA 4Y5VA 3SDXE 3FO9A 1MAML 5TF0A 2FATL 3ULSB 4ZQKA 5D7JD 4D0DB 1QSZA 1KTKE 4HGKC 4WVRA 3RL2A 2AK1H 3NZ8B 3L5WA 2C3GA 5IJVA 1LWRA 1RJYB 1WCBB 5C09A 5F93C 4I48B 2W59A 1S9WB 4OBRA 4O2CA 1GGTA 2EDRA 3JWDH 4FXGA 1CLYL 1T89C 4MJ5B 4HFUH 4YHNB 3AM8C 1X5XA 5KN5B 4YGVA 1U92A 5KSBE 1RVFH 2X7LB 1CBVL 3MRIA 5JW3L 1L0QA 3GMOB 5GRYA 4XAKE 1MHCA 1ZVSB 1CTNA 2ARJB 4TTDC 1FPTL 1T5XB 4HEPG 1BD2A 1RIUL 2ICWI 4OCYH 1FN4A 4NBXB 4LKXB 1NGYA 3OG6B 3QDJD 4F9LC 3CXDH 4ONHB 4ESKA 4GXVL 2GJ6D 5T3XL 1OW0C 3QO1A 1L0XA 1B6DA 3N0PB 1EHAA 1K85A 2HTLC 1VERA 5C6PB 3QNZB 2A6KA 2A83A 4HF5L 4ZO7A 4XVJH 1BQHA 3VMPA 3G6JB 3MRRB 1I9RL 1EDQA 2Q3AA 5ANMB 4YDKL 3VW3H 3ZDXE 4LBEA 1S7WB 1BVLA 4N90E 2OMNA 4JFHD 2BCKB 4S1RL 3BESR 2BOCB 1BIHA 5D1XA 1OB1B 3LKNA 5J06A 3O4OC 3K3QA 3GDBA 1PG7L 5C2BL 4Y1AB 2FIRT 3BPCA 4X99B 4LPTA 5D9SB 5INCA 4JJHA 2JTDA 2WWKT 2Q86A 2XRAL 5ETUB 2YWYA 4Z9KB 1MFDH 4TULL 4XC3H 1BQLL 2QSQA 3BZ4B 3DYPA 4HQQL 5JHLL 1VGKB 2EXWC 1DUYB 2J8UE 3QUYA 3QWOA 5JO5B 4EBQH 2GFBA 4LCYB 1K2DB 2OTUA 3DSNA 1CG9B 4P9MH 3RY4A 1FZJA 1Z9OA 4L5FH 1C08A 1OTUC 4M48L 4R26L 3SOBL 4YJZL 5DURD 1VPOH 2VZ3A 5IB1A 2VITA 5DUMH 1JYNA 5EC2A 4LL9A 3WFHB 3REVA 1FFNB 3NFSH 4MMZC 3ZYZA 4G5ZH 4L4JA 3VFVB 3ARRA 3PL6A 3EYSH 3P0GB 3ZKQD 4J3XA 4ONFH 3GBLA 4LQFL 1WIOA 15C8L 4QRQA 5HDOA 3RY6C 3VXUE 4HKXA 3QQNA 1N59A 2ARJA 4KVCL 1AGDA 2XXCB 4L8CA 3GMOA 2Z8SA 3MCKB 1J87A 1FZMA 3LMJH 4XPBL 2AS5M 1NKOA 1HCFX 2HN7A 2BXZA 5D2LB 3G5XB 4P23B 1MFCL 5C0CD 2GK2A 5CZXD 2BRRH 3O2DH 5EULV 3VJ6B 1D5ZA 2DD8L 3CSYA 1PLGH 2K3TA 3EHBD 5L8KB 3B4NA 3TVMA 4FQHA 3VFRB 4TSAH 3MJ7A 5IJVB 5EBLB 1A0QH 4RQQB 4GRWE 3VWKA 4G9FB 4P5TD 1BFOA 4RBPH 3RUGB 3SE4A 4MAYC 1HQ4A 4UZGA 2PUQT 4YDVA 3SCMD 1NMAL 2OR8A 3HZYB 4OCXH 2NY0B 2EIDA 4U1IA 3IFPB 4Q6IB 2VQUA 5FGRA 4ZPVA 2FZ3A 1E27B 4ZFGH 5FDWA 1N6UA 2W1NA 4NSKA 3TJHD 2ZWLT 5TF1L 2VLLA 4NNYB 3QEQE 4OGYL 4JFFA 3PUCA 1C5BL 4RMQA 5DUPL 1RZJL 3DV4A 1XF2B 2LU3A 1RY7B 3O6FD 2VLKE 2FGWL 2DTSA 4IRSB 4MB5A 2AI0L 5TQ0L 3L9RB 1AC0A 1RUAL 3C5SA 3NPSC 1A3QA 4L4VD 3BE1H 4IMKA 5EUOA 2PYFA 4G80B 3D39A 3R06A 1ZGLB 2VABA 2HMID 1S5IL 5CUSL 2P5EE 3EDKA 4LARH 4NOFA 2B0SL 2VIRA 2EDDA 2OR9H 3R1GH 4IRJC 2Q87A 2CXGA 2DBLL 5MHSE 3O3EB 4TULH 2ICWA 1JNLL 4HQQH 4R4NC 3U1SL 1DQTA 3MRGA 4GRLB 3LVEA 5IVXA 5ESVA 3QNYB 1OCWH 3HKFA 4GW4A 3QO0A 4MCZA 5C0GA 1JHKH 1D6VH 4B7IA 3L3HA 3RZCC 5HHXH 5SWZA 3FFCE 1X5IA 3MV9B 3LRGA 9CGTA 4I18B 4H1LA 3D2UA 4TQEH 3QUXA 4RFEA 2HFEB 4JFDE 4KJPC 5HYQA 2MCG1 1JF6A 4ZTPH 1Q9KB 3H8NA 5C2BH 1WWBX 3TO2B 5IB2A 2GTZA 3WN5A 4W81A 1Q0YH 1V3LA 2Y06H 4X6CA 1CDGA 4N8VG 5TE6L 3CXHK 4PYHA 1MCRA 3H9SD 2DMCA 4Z6AT 1I75A 5DJAA 4HT1L 2FB4H 3B9KA 1NGXB 1NH6A 1ACYH 1DQLL 2ZCLH 3GHEL 4OQTA 5HI4C 2MNUA 3O3EA 2P8MA 5D70L 5DRZA 1L0YA 4LLDA 2Y9RT 4HFWB 5T5FL 4QHNA 3WLWC 1B9ZA 2WBJB 3JV6B 3O45A 1DE4B 4YXKL 3EO9L 5HHNB 3U4AA 1JFQL 4FZEH 4R7NB 3QFJA 2DN7A 1CVRA 2NX5A 2J5LC 3HNTH 4ODBD 1VENA 4OGYH 1OAZL 2D7TL 3F7PC 3I6KA 3SE3A 2DKUA 4JLRA 3G04B 4U0RC 5CLTA 2ESVD 1RJCA 1DUZB 4Y4KD 2QTEA 4RAUB 5KS9F 3BKYL 3SDXB 4CL7A 4R4BB 2MJWA 1PEWA 1OARH 3QHFL 2OTWB 3T0DA 4F7PB 3TZVB 2RQ8A 1MJUL 1I7RA 1QFPA 2A1WL 4FFWC 3QHZL 4J8RB 1E6OH 2FZ3B 5J57B 5EC1A 3G5YA 1KXQE 3TH3T 3X17A 2BRRL 3MRFA 3MNZA 3MNWB 1IGTB 2YSSB 5IV2A 2XTJC 3EYQD 3DMMB 2FWOB 1MFBH 1J0KA 1FP5A 1GIGH 2P44B 3HE7B 3VDBA 4Z7UF 4LMQE 1U3YA 3FTGB 4U6VL 3NZHH 3D87B 4PLKC 4TPRH 4QXUL 5T1KD 4UV7L 5CMAB 3SKUD 1WZ1H 4NGHL 2FL5A 4X0KB 1P7HL 2VABB 2BC4B 2YA0A 3U0TB 3UXFA 1NFDB 5TDPB 2GY5A 5CEXA 1IKFL 2OSLA 2E9BA 4P23D 2ZSVB 5J9PA 4H20H 5I66A 1XF5A 3FN0L 3X3GH 1S8DA 3SDDA 4QRRB 5FOBA 5FA3B 1ZT4B 5FHBH 4POYA 2EEBA 4NNYA 4WWID 1LO3L 3RL1B 1IVLA 5D7IB 5IBTH 1F4WL 2NY5H 4P3DB 3WV0A 2K7PA 4X4ME 3IFPA 1CFVH 1IC5L 2DI7A 4P46B 4RDQF 3ZE0E 3RVTD 1G9NC 1IEBA 5DZLA 3MREA 4F33B 3CUPB 3TIDA 4MD4B 2GIYA 5ICZB 3D0LB 3RKDD 1JPTH 2CRYA 2W0KA 1RIVL 3VFPB 3BZFA 4K3JL 4LCYA 3ET9F 4KH2A 5D71L 1CK0H 1CYGA 1DUYA 5A16A 2DS4A 3VJ6A 1F4WH 1KOAA 2FHFA 2HTKC 5DEFA 3KPLA 5M7QA 3BKML 2BC4A 2ADJB 1RQ5A 1N8ZB 2FD6L 2H8PA 3EJZD 3N1PC 3LKSA 4EDWH 3RBSA 5BRZB 3MLUL 1KCKA 4N90D 2EE2A 4UV4H 5LXGH 2Z91A 1IKFH 3P0VH 4OFDA 5MENB 2XQYG 3H0TB 2DQTL 1CN4A 4PJBA 5DHVH 3C5ZA 4IRJB 2VDOL 4XVTL 1KG0B 1JP5A 2R29H 5C0AB 3VXTA 3IXTA 3QDME 3O2WH 3IDXL 5DVNA 1YEDA 3LQAH 4PJXE 2QQKH 4PY7B 5MERA 4JO4H 2NLJB 4X9HA 1IGJA 3HC4H 4OTXH 4X83A 2H26A 4PJHF 4EQ3A 3HI6H 2BDNL 3G6DH 5EA0H 3EYVB 2GJZA 1HSBA 2O5XH 3EO0B 3N06B 5CD5C 2BNRA 3B8YA 3B6SA 4JFPA 1RHHB 2ARWA 4XPAL 2R1YB 3TZVD 1AIFB 1OQOA 4LVEA 3LQZA 4GAYA 1A1OB 1QSEA 4RWYH 1G7PB 4JM2A 3O6LL 3C2AH 3MV8A 1F3DH 3V5DB 3TYFB 1QP1A 2R1WA 5GGTL 5KVGL 2X2YA 3BWAB 2JF1A 5JPMB 1DBBL 3MXVL 3UTQA 1ZANH 1F00I 2PTTB 1JGUH 4ZTOL 3H42L 3H3KA 4OBSA 5I8CA 4QGYA 2DWEB 4KKBC 3TVMD 3GK8L 2F15A 5C08E 3HAEH 5T3ZE 3P0VL 4U1NA 4QHLA 2ZG2A 1HOCB 4XNUL 4HJJH 4PB0L 1X4YA 1NEZG 4XCNA 5H37G 1I8LC 4HK0A 3S97C 3UJJL 2I07A 1MHCB 1JGDB 3MLSL 3IF1B 4ORGB 4LMQI 1RIHL 1TXKA 3O6FA 4KROB 2VE6B 1N2RA 1G0XA 4NGHH 5GPRA 1MSPA 5AUMA 2XG5A 2N7BA 5T1DL 1L7TL 5I1AB 3SDXF 3VXQA 1W0YT 4A6YB 1WK0A 1VGEH 2LVCA 4KJYB 1J8HB 2P7TA 3RY5A 2G2RB 3QO0B 4DGIH 2DM7A 1HI6B 1R3HB 5D2NC 3DX7A 1TZHB 5C08D 3FT2B 1BFSA 1TNNA 4Y8DC 3GGWB 4Z5RB 4XPTL 4X7EC 5GSVA 4DAGL 1VACB 2KDGA 4UI2A 1RZFL 5MENE 1AI1H 3T0XA 4AT6A 3JXAA 1J0YA 1U58A 1ZSDA 4RRPA 2V2WA 3D85D 1KYOK 1OCWL 1A6PA 3DTXB 2R0WH 3MLYL 3FN9A 3HE6D 4X9IA 2WBJC 5A2FA 1P5VA 1FFOB 1X5KA 1Z9LA 4WEUD 5KAQF 3H7LA 2DIBA 1CGXA 4OLEA 3O8XB 1D9KA 1AKJB 2Q3ZA 1WVZA 1Q94B 1NC4A 5CILH 2VLKA 4ALAL 4KK9C 1A4JB 4OUUB 2QQNH 4DFHA 4WO4B 1LK2A 2AEWA 5F7FA 4KRPB 2BNQB 2IGFH 1EFXD 1KXTB 4CW1B 4OZFA 1SEBA 4N8VA 1A6TA 4JKWA 1OAYH 3RVXC 3CFDB 1YMHA 3GJFH 5B3NA 1T5WB 1N0XH 4NNPL 5E8NA 5B3JF 3GRWA 4HPOL 2DJUA 4NPYA 3WHE0 4OCWL 3DPBA 1C1EH 4HS3B 4RRPG 3QEQB 3LN5B 4WO4C 1BWMA 3MRDA 3MV7D 5JW5A 5C0RH 3ARVA 7FABL 2XA3A 5IHUH 4M4RA 5IFHH 5FYJL 4L9DA 5BMFL 5DZOA 2HN7B 4KVNH 5DDHA 1IT9H 1LNUA 32C2A 4OLWL 4CMHC 4WI4A 2DQJH 4WJ5B 4HPYH 3WS3A 5BQ7A 2Y7QB 2J8UF 2YXFA 3SDAD 1GHFH 3MRKA 4U1MB 5HDQH 2MKLC 3U9UB 4H1LG 4DOHE 5C09D 4Y4KA 5IWLC 1Q8MA 2FJGA 2R2HA 4HS6B 4M61A 3QRFM 1KCVH 3CPLB 3VFTB 3DXAD 3FQTA 1Q9LB 3ECBB 3FOLA 3ZSSA 1IQDB 5KSVB 4EZMA 4OB5H 4WI5A 1AP2B 5FCUH 2IALA 2X4RB 5TDNB 5IB3A 3N9GH 1UXWA 4N0UA 1X9QA 3UTTE 5KVDH 4JR9H 5CZXC 2AQ2A 3KYMA 1DJSA 1WT5C 3V4PL 3C60A 3EO9H 5D1XC 1D5MB 12E8H 5I30H 4F7CA 2MHAA 4TNVK 1CICA 5DJCB 4AL8H 2VLME 3DUSB 4LP5A 3FRUB 4PRPD 2HP4A 3DRTB 2FSEB 3FFCA 1JVKA 2V9RA 5FO9B 2FB4L 5MEQB 3UCRA 1F90H 2KZWA 2ZUXA 5AWNL 3NIDF 4ZFOL 4F37F 4ZFGL 2BCKA 3TT1L 5ISZD 2BOBA 5F7HA 4NC2B 1YECH 4ZNEA 3U46B 5IW1A 3PWUB 1T66D 2DQCL 3GRWH 5ESQB 4NN5B 4LASH 3GJFA 4P2RE 3RWGA 2BY2A 2F5AL 2XG4A 2IPUK 1OT1A 2VTFA 1BD2B 3X12B 2RGSA 4HPYL 3W11D 1CZ8L 1OQXA 2X4SB 2VB5A 3IKCB 4Z7WE 5CSBA 3FB5A 5DD0L 4KJWC 2YBRA 4C4KO 2ORBH 1VFBB 3BX7C 4WW2A 3SKMA 4HGWA 5C71A 4WGVB 5D2NB 1HHJB 2AJXH 5I15H 4GAGL 5DO2C 3LEVH 4YZFF 1QUNA 4I3GA 3P30L 1KN4H 4LARL 5F97E 1H0DA 2ZUUA 3DETD 3WNPA 4POZD 4CVWA 4U1LA 4KFZC 5EB9A 3TEUA 1MEXL 2L7JA 2JIXB 4TTGA 3KPQA 3TN0A 1CIUA 5MEOA 1Z3GH 3LV3B 4OF6A 2Q76B 4OUOA 5HXMA 1DL7H 5L2KE 2AABH 3L7EB 2EDJA 1FC1A 1RSFA 4HAGA 4KK5C 4S10A 5I1JH 1EUTA 1NQBA 1ZT1B 4PS4H 3PWPD 2FIKB 3W9EA 2XN9E 4EIZC 5DO2D 3Q3GB 7CGTA 3TF7C 4OGAD 3T08A 4YO0B 1J5OL 1PQZA 4XNZB 1J1PH 5SWQB 1TITA 1UJ3B 1CLOL 3ARDA 5IM7A 4R97B 4JFED 1M71A 4OF3A 1J7VR 1YN6A 4UT6L 3HR5A 3HAEG 5BOPA 4DW2H 1FVEA 1MHPL 2Q6WB 5ITFB 3KS0J 4M7KL 2E9WA 1QFOA 4M02A 1BM3L 3CH1A 4NZDA 2A73A 8FABB 4MJ2A 2NY3D 3UYRL 3OPZL 4GAFB 3T1FA 1FYTD 2BNRD 3ARZA 4XGZB 3V52L 5JOPD 3BUTA 5I8OL 2R2EB 2YD9A 4UQ2B 5IMLA 1BFTA 4PV8A 2AKRB 2FH8A 4PP2B 2Q8AL 4M7LL 3BISA 5L9DH 2EYTB 3E0GA 3C6SB 4MQSB 4HXBL 2X42A 5DYOA 1J0IA 3BSZH 2CRZA 5B38G 1D5BB 1OAYL 2EDTA 1MWAB 4LDOB 5LBSL 1IC4H 4JFXA 2HFGL 3F6LA 4JFEE 3WCYA 3IB4A 5T3ZH 5GGQH 4PJEA 2UV3A 3H9SA 4PJ5E 3LS4L 4JG0L 1KCRL 1ZLWH 3S8WA 2P8PA 2G60H 3QR2A 5B8CC 4NO3B 1CFSB 4LF3B 3IU4H 2GJ6E 1HKLL 1PX3A 5I8EB 2E9JA 1DVFB 4H26B 3DO3A 4N0FB 1F4HA 5ERWB 4HC1L 2CKBA 1A7PL 2UUDH 2QADD 3C8KB 1NLDH 3M1BA 3RI5F 3SCMA 3HG1A 2QHRH 1FGNH 1FJ1B 3WN5C 1HE7A 1S5HB 4LCCA 1UCTA 1Q9OA 4GJTB 2X40A 4S1RH 4G7YL 1QLFA 2BX5A 3MBXL 3JUZA 3GSXB 3NTCL 3GMQB 2W9EL 1DBML 2CDEB 1FFRA 1RFDL 2F74B 1C8PA 1BQLH 3VXRD 1CLZH 5DVLA 4QNPF 3F6IA 1J0JA 5DJZA 1A6WL 2EDFA 4LSPH 1NAMB 2DDQL 1BX2B 4ODWB 3CAFA 1FNLA 1WITA 4PREB 4ELME 4OFYD 5DS8B 5I74B 4CGTA 3PWLA 3H9ZA 4I77H 4LGSB 3MRPA 1KJ2B 4UT9H 5A43C 4NUGH 3MFGB 5K9JH 1QPXA 3MPCA 5GGVH 4YDKH 4OJFH 3B9KD 1CDUA 3SE9H 1JGVL 1DFBH 5JW4Q 4I0CC 5BJTB 3JTSA 3H9SB 4U0RB 4OM1L 4Z77B 3V7AE 5F44A 4PG9B 1U8IA 3TBTA 1A6UL 2DKSA 2BHUA 2Q20A 3STLB 4K7PY 4XAKD 1XZ0B 2X9YA 1KELH 4GAJL 4R4FH 5GGVL 1JTPA 1SM3L 1NPUA 2AJSL 1N4XH 4UT9L 5HHVH 1HHKB 4EI5C 1M6OA 1BOGA 3IRZA 5EIQA 2ADIA 5LQBL 1GGBL 2IH3B 3VFWB 3CVHL 5K9KA 5DMYA 3HHRB 4RISL 1FBIL 3MNVA 4ZOBA 3AM8A 3C8KA 2IQ9L 4HWBA 1WBYB 1UACH 1K6QL 1S9VB 5HHOD 1ORSB 2VQ1B 3PGFL 3TV3L 1X44A 2ZPKH 4M6ML 5CEYB 43C9B 3KJ6H 4Q9QH 5JA8B 2VXQH 3QAZB 1LO3H 1U8PB 2CDGA 1EEUA 3LEXA 4HXAL 5HGDA 4X7TB 3NGBC 2WK2A 3MA9L 5DRWB 5I74C 5F7DB 4AJ0A 1P1ZB 3HPLA 2CGRL 4LFHG 4NQCD 3UPCA 4L4TA 4EEEA 5E8EA 4QYOB 1YDPB 3VCLA 3BN3B 4OLZH 1CVSC 4XZUA 5DFTA 4X9FA 4UOJA 1S7SA 4Z18A 1L7TH 4D0BA 4P2YA 5JDSA 1JCKA 1LDSA 5CWSA 3LEYH 3DV6A 3W39A 3C6SA 2DBJA 2NX5D 1JUFB 4KRNA 5C8JB 1T7ZA 4M5ZH 5EDXA 3VI4E 5F1IA 2DYPA 1TMCB 1KPVB 1NDGB 4NRYB 3FN0H 3X3GL 4DKDC 5IJKC 3QEUB 5SX4H 1BP3B 1I1FA 1WQVT 5FA4A 2J5LB 1NMCC 2NY0C 4ZXBC 3QZWG 1N2RB 2CGRH 2NY1D 3MUY1 1GOHA 2XFXB 3QUKB 3DIFA 3MOAL 2B1HL 4LOUC 4APQD 1WUNT 4U3CA 5DT1L 3IKKA 3JBG7 3NA9L 3VDAA 2KQNA 2I27N 2IMNA 4F15B 1DN0A 2C1OA 2YC1A 3WKMH 2IANE 1UKTA 5MHSD 35C8H 3KR3H 3KDMB 3MXVH 4IRSC 1HOCA 1D6EB 1IFHH 4LCUB 1PW3A 3QHTC 5JIIA 1RV6X 5LGHH 4Q6IC 5E5MA 1AO7D 4G9DA 3UTTD 1U8HB 4WENB 1FLTX 4J1UA 1ZT1A 4IBLT 1YYLH 3T0AA 1JGLL 5SV4A 5T1KA 1EEZA 5J3HC 2PXYB 4PJ8A 1QBLL 1R5IB 4YHPA 4FTVA 1WEJL 1A7RH 4ZG1A 3MV8B 5IESH 3RY6A 4LLQA 1HILB 2OJEB 1A1OA 4NQSB 4PJIE 2HJKA 2IJ0C 3FT4B 3WDHA 2WIMA 3OB8A 3SKMB 1F3JB 4DKAA 3B2UD 3BVNA 4YIQA 2ZCLL 3GHEH 1YEFL 3BVNB 4YIQB 2QQQA 4NT6B 1U9KA 4C83A 3Q5TA 2F5BH 4HT1H 1MHEA 1NGZA 2CLVA 1CF8H 4QRPE 3DGCR 1OAKL 1FO0L 4UV4L 3BH8B 3B9DA 1BZ9B 4JM2C 4P2RD 5IK3B 1SYVB 4APQA 1I7TA 5JQ6L 4A6YH 2YEZA 1LEIB 3SE4C 2BVOB 2YD6A 2CLZA 4L3CB 4TQEL 1FE8L 2VXUL 2W0PA 2E8ZA 3FMGH 4LNVA 3S5LB 2A0LC 1D5XA 1L9MA 1IZKA 4XP4H 1KTLA 3QQ4B 4N9OB 4K23H 5DZNA 3D39E 4MSWA 3WS3B 4Z7WF 1NC2A 4NO0B 3L3OA 2X1XR 4IOIB 5AD0A 4WTWA 3CZFA 3HAEB 3HC0B 4MWFB 1LK3H 4KZDH 3PJSA 1Q0XL 1KCSL 1ZS8A 3HUJE 4KTDL 5DJ6B 4XX1G 2WINB 1X5AA 1ED3B 1NGQH 3WFBH 1BEYL 2MCPL 2YN5A 3MRNB 5EORH 3C5ZD 4GKNB 4K7PH 4PJAA 2VR5A 4OZGE 5DI8A 2R1XA 3HZKA 5FAAA 1H3PL 1A7PH 4LDLB 4PG2C 3IETB 5FUOL 3QUMH 1A5FL 3AVEA 1QQDB 3T0EA 2J6EH 4E41A 4JFYA 3CFIC 4JY4B 4JO2H 5EZOL 1V05A 1Y18A 5CIPB 3MMEA 5E8PB 5HHPB 1UH4A 5B38B 1MJ8H 1NC4D 3U83A 2VLKD 3TPUB 1EVUA 3O0RL 1BJ1J 3FQWB 1B3JA 2IG2L 1MCHA 1S8DB 2GTWB 4RCAA 4G43B 3I6GB 4I3SL 3V4UL 2EE6A 4PJAE 5CEZL 3U9PH 5HYSB 4LLAA 1CDJA 4LCIH 3LKRA 4XNYL 5IOPB 5DD3L 3RGVD 1TTGA 4PUBL 4YHKL 4NRZA 1D9KC 4ZPTB 2Z31A 3IRPX 4R9HA 4MXWL 1A64A 3L3KA 5JW5B 4G6ML 2C3VA 4P9HC 1CR9L 1VACA 3MUGB 1EGJA 1K4DB 3QEQA 2IH3A 1MJUH 2VDML 5A2KH 5DHXB 4QXGH 1BOGB 1FNSL 2V5TA 1I4FB 1QPPA 4FQQB 1ITBB 5GGRY 4PJ9B 5E99H 5HVHC 1WBXA 3IFOB 3MCLL 3D18B 1HQRB 5I6XC 1AQDB 1BZ7A 5MEPA 4HZLA 4YDLB 1WC7B 4CW1A 4ZYKB 2YK1L 4CADB 3ALPA 4X6DB 5DJYA 1YEHH 4JFDD 3ZHKA 5CJ8A 4WO4A 4RAVB 4OUUA 3ULUH 2R2BB 2UYLA 1NC4B 3LMJL 5BXFB 4Z77A 4X80L 3HR6A 1BVKA 1GL4B 3QB7C 1RK0A 3N85L 3IXAB 5FYKL 4KQ3L 2GAZB 5ALCH 4BSVB 1IGML 1GGCL 4PLJC 2ZJSL 4PV8B 15C8H 2VLJA 1UEMA 4RFNB 4YDLC 4U3HA 3KXFD 4U1KA 1PYWA 1R24A 3VXUA 2ED9A 1S7RB 2NXZC 4PJ7E 2VMFA 4NNXB 1KTDA 4M1CD 1X3DA 3MV7A 1MH5B 2HT4D 1XGTB 2XZQL 1QBAA 3EHBC 3RPIB 3SN6N 3ULUL 3DUHA 5KTEL 1N5YH 3A67H 3AFLA 2MTPA 3E3QE 3L1OH 4X6EA 3EJZC 4EQ2A 1CGUA 1GZQA 1I1AC 2M8XA 1NC2B 4ODSL 2QSVA 3L3JA 1OP3K 3FQRA 3VXQB 4AQOA 4UUJB 2ESVE 4JANA 2VISB 4LPWA 3HPJA 3QXAB 4JO3L 1FAIH 1AFVH 4AG4H 3GEWB 3BH9B 4X98A 5HGAA 1IGCL 1JNHA 5CIPH 3EOBB 2E7MA 3MRLB 4M6AA 4DCQA 5K59F 2JCCE 1MWAH 4OAWB 3DLQR 2MFNA 1ZT7B 1WWWX 4OFIA 1S3KH 4GKOA 4HWBH 3NIGF 5D1ZD 4QHLB 5DQJB 4BSJA 2NYYC 4JN2B 3O9WD 4UT7H 2PCPB 4ODTH 5IW6A 1D5BA 5DEGA 5T3ZD 3W9DB 4NKOA 4XVJL 4LSUH 4JFOB 5B3JE 4JPKH 1FG2B 12E8L 1RJZB 2YBRB 2FYYB 4NYLA 4Q0XL 3QCUL 3SJVD 2XN9A 3FOMB 1IM9A 4XP9L 2ERJC 4IS6B 5E94A 4P48A 3RQ3A 3V79C 1C5DA 4QRSA 3O6MH 1CBVH 2YN3A 2Z92B 3SGDH 1T2JA 4L8SA 5CLWA 1KIRA 2AGJL 4M9OA 2FEDC 1S7TB 1TZIA 2P5WA 3CFJA 3E8UL 4KROD 2R39A 5B21A 5A2JH 4NDMB 1PEZA 5ICZA 3GHBL 4MD4A 1MRFL 1UJ3A 1U8HA 4XVSH 5EORL 3BXNA 4DOHB 5SWQA 2D0FA 3M17B 3MREB 2XPGA 2E5EA 4H8WL 1IEBB 2E7LA 3GBMH 4HUXA 3QJFA 2Z93A 3NH7H 1Z5LB 4WDIA 4Z0BL 5AG8A 4X6CE 4HS8H 1YN7A 3VA6A 4Y88A 3QQ3A 4X6FB 2BSED 4OLWH 4XI5D 3IDJA 1N64L 5CFHA 2DTML 4ZOAA 1MJ7H 3O4LB 2NXYB 3V0VA 2DM2A 3AS2A 3QEUA 2NY4B 4QRUA 3TM6A 1A7NH 2DQFA 3VXME 4XVTH 3OJVC 3D85B 4ZUWB 3QDJA 2R56H 3EOAB 1AJ7H 3EOYG 5KSVA 5SX4I 2BSSB 5FUZL 3BPLB 5CJXA 1MCLA 5CMAA 3T2PA 4JO1L 2DQDH 2F53E 1CFBA 3MGOA 1INEH 3RRQA 1DBAL 1TNMA 2UUDK 3VRIB 5IT2H 1UT9A 1LE5B 3O11A 2O5ZL 3O3DA 2DQHH 2VDKH 1ZHLB 1CE1H 2K1MA 3LH2H 1EPFA 2AEQL 1MFEH 2UWEB 4DZBB 2CIIB 1KB5B 1MQKL 5FDYA 3REVB 3BAEH 1F6AB 2A9MH 32C2B 2BHZA 5D7IA 4ODHL 4KZEL 4JN1L 4UDUB 2VLRE 1I8MB 3DARA 3QUMB 1KTRL 1UEYA 3IFLH 5ICYB 1FZJB 2XICA 4BZ1L 1G9MH 4GRMB 5FYLD 3ES6B 2V2TB 2EH7H 1I8LA 1KIRB 4GH7B 4POZC 3ZDXF 3DO7A 1JPSH 3G6JE 3KPSD 2AEIT 4PRHB 1ZLSL 5C0FA 3R8BB 4U1HA 4UDTA 5DK0B 4J3SA 3HI1B 4OIIH 3CVIL 1HHIB 4PB0H 1IEAB 3JV6A 3O45B 3KYMB 4RFNC 4CMMA 2DQIL 2FCBA 2V7NA 4K9EC 1YYMH 3B9VA 3CFEA 5EOTB 4HC1A 5BVPL 4KI5F 4NKOB 3WIIH 1WBZB 5BJTA 3SY0B 2ZUQC 3QNXB 1UCBH 3VFOB 2Y6SD 1NFIA 3E6FB 3TNNA 4JPIA 1N3NA 3B9EA 4K8RD 2NY6B 3H9HA 3DUUA 3S98A 2D4FA 5KVGH 3T0ED 2XWJB 2LE9A 3DI2B 4F3FB 4PJ7B 1HHGB 1YNTB 2EE3A 3A0OA 3EOBA 4MD0A 3O3AA 2QSCL 5KW9H 3B3IB 2WUBH 2XXMB 1BQHG 1IARB 3SBWC 2C7UB 4X4ZA 2CDEA 3DX7B 2FJFB 3GSXA 2I60L 2OZ4H 1HI6A 5IMOB 4PRPB 5MP6H 4F57L 1YQ2A 4YXLH 2NR6D 3GBNL 4HIJA 4KHTL 4KKLC 4Y5YC 1QHPA 3PWVB 4QRPD 5DD6A 3RJQB 4XP1H 4P59L 4WFHE 4Z7WB 1AXSB 3RWEB 4LKCB 5HHOA 4LSUL 5TDOA 3ULSA 1HXYA 4TVPD 4PJEF 2O5YH 4NKIH 5HGGS 1NGXA 4FZEL 3I2CL 3FO1B 3GM0A 2QV2A 3DXAB 4X6CB 3CMOH 2ADGB 1QR1B 2GAZA 3T09A 2BK8A 3D3VB 4MAUL 1NANH 1KELL 2XZAL 2JCCA 1DBJH 2AQ1A 4JFFD 4YDIL 3D1MC 2IPTH 2EYTA 2F19H 5EOTA 4MAYD 5FYLE 2V7NB 3F7YB 3D48R 3TO4B 4DVRL 5F1NA 2CUIA 2OR7A 1WC7A 3RPKA 2VLRA 4L4VA 1EUUA 4WY7H 2GJ6B 3MRMA 3TO4D 3ZHDA 4ZTPL 1IEHA 1KGCD 1F3DJ 4ELKA 1PAMA 4M03A 5CD3A 5D7IF 1N5YL 3FB8B 2J8OA 3K4DA 4GAYB 1TJGH 3F5WA 2UZYB 5GGSB 1NBYB 1QFWI 5BS0D 2ZZUT 3MJ7B 4J3VA 5EU6B 1FVEB 5F21B 2FEEI 4MNGE 1CGYA 3AU1A 3AMLA 1J8HA 2O61B 4H8WC 4P4KD 3OAYH 5T5NF 1LP9E 2FJFA 3C60C 2NY4D 4I9WD 4M43H 4NRZB 5IBUG 2HAZA 3RA7L 3B83A 2D03H 4HD9A 1V5JA 5E9DA 3W9EB 3V8OA 4F7TB 1KJVB 3MLTA 4YNYB 3MA7A 1XEDA 2K7QA 3QDJE 2EYRB 4FNLL 4N68A 3K46A 5C09E 5F1OB 3MGTA 2Y5TA 4PD4J 3OBAA 3ROLA 1RU9L 5BRZD 2C3WA 4WFED 4HH9A 4S11A 3EO1B 4EI5D 3QUXD 2Q7NA 4Q9BA 5GQBA 1BQUA 2VWEC 3H3BC 4W6YB 3S3PA 2WQ8A 5D6CA 5ID0A 2ZJSH 1XIWB 2Z8VC 5HHPA 4EJ1C 1WBZA 4K8RL 2QEJA 1HHJA 4Q6IA 2H8PB 1ORQB 4WI9A 1F8TH 4FZ8H 1LO2H 4WW2B 3SO3B 3KPLB 1FVCA 2H41A 2BJML 1TJHH 1GPOL 1S7UA 3GKWL 2YMXH 1MIEL 4FQHB 4PJ8C 3VFRA 5ITBL 3WD5L 5FYKU 2BXYA 2GK0A 1A7OH 4U6VH 4YZFE 1G7JA 3MQIA 4Y5XB 4XPHL 4R0LB 2CK0L 5ICYA 5L9DL 3OGCA 1DZBA 3QIUC 5C7XL 1BM3H 3P73B 5EWIL 2XWBB 1IM9D 5E1HB 2QKIA 4DFIA 2XN9D 4WW2C 3SO3C 2GSGB 3EO0A 1V3JA 1LO0L 1QACA 1AGDB 4M1GL 4P2QB 3PABA 3VMOA 2DD8H 3QHFH 3E2HC 3DUUB 4O4YH 3OKKA 2NY0D 3BDYH 1R3KB 3BKJL 4NCDA 4POUB 2IADA 3P0YH 1XGQB 1MI5A 2SEBB 3NACH 2EIBA 2LAAA 4QHKJ 3JVGC 3RZWA 2OSLB 4GUPB 1IRAY 2J7LA 5EU4A 4GG6B 1FO0A 4J4PA 5HI4D 4IS6A 4B7LA 5H35A 2X70B 3DVGB 3GO1H 4BSWA 3VMNA 3AREC 3K8KA 2BSSA 5J7CC 2X70A 3BD5A 1B0RB 4UDTB 5DK0A 3ZKMC 4ELMF 4LLMA 3QUYB 4WFGD 5FUZH 4PJHB 1INQB 2MQ0A 5DEFB 2X4RA 5TDNA 3OAUH 1TVHA 1V8HA 4YHNA 2PYEE 5DD0H 3RWHB 5BOZG 1OP5K 1KEGH 2PCPA 4L5FL 1JPGA 1GAFL 5JHDE 2OJZL 2HRLA 4M8QB 5ISZB 4IIQB 1WICA 5F6IC 3GSWB 4PRNB 5CGMA 3MLZH 3TP4A 4OCSL 4LU5L 1O5DT 1W0WA 1R5VA 2DQJL 4X7FC 4LSPL 3DURA 1MRDH 1ZVYA 1U6AL 1BQHB 2JKXA 2W9EH 3K8MA 5E5MB 3HPJB 4PTUB 5L2JA 1IKNC 3RBGA 4P23C 4YHYB 5E08H 1MIEH 1MCIA 4XNQA 3NAAL 3TO4C 4MCYA 1CF8L 4QEGA 3O3BB 2AXGA 4EI5B 1T6WA 3VFUA 4HF5H 1MY7A 5ILTH 2NY6C 2LABA 1LO2L 2E27L 2YPKB 3ZDZE 5D72L 4PP1D 5ALCL 4NJAL 4NO2B 3CXHJ 4JZNB 1PDKA 4U1KB 2G75B 2B4CC 1KPVA 3BJLA 5IW6B 1RZJH 1RI8A 4LCCC 1A7QL 4AY0A 3C60D 4ERSL 2X09A 3NCJL 2X44D 4ETYA 3WIHL 3IXAA 1OTTD 5BXFA 4U6TA 4TYUA 4Y2DD 5FKAA 1IAKB 1A9BB 4L3ED 5DHVA 4EDXB 2PR4L 4NFDA 5I75C 1KBGL 3VD3A 3M17A 2ZOKA 4JY5H 1NGPH 3KR3L 1ZV5A 4G8FA 1KCLA 1E4XI 1YNLH 4AIZA 4A2MA 2V5RA 1OSPH 3P0YL 1GPOH 4KRPC 4GW4B 3H7BA 1W8OA 4HK3N 5JA9A 2OLDA 4ODVH 4DVBB 1XGTA 1OTTC 4WNQB 1K4DA 4RGMB 3TJHC 1ZHKA 1LVEA 2LV4A 3UTSD 4MXWH 4PBVC 5I8KH 5JLZA 2H2SC 1IGYB 2C26A 2HJLB 2PN5A 3JSSA 4MX7B 3VXRB 3GSUB 2UWEE 4ZXBD 5F72S 3L1OL 4JFDA 3T0EE 5HYFA 2OP4H 2P8LB 5E6YA 2X89D 4ISVA 5IHBA 1U95A 4WV1A 4UOW0 3B3IA 2F8OA 4XPGL 3S4SG 1KACB 4ORGA 3BQUD 4TTDD 3TA3C 4U31A 1KLUB 2JB5L 4WEMB 3ULUD 2OL3H 1XGPA 4IRSD 4M8VA 3ORJA 4ERSH 5I1KH 4I0PD 5GXBB 2M2DA 1I1AB 2NX5E 3O9WA 4U1NB 1Y18B 1WJ3A 1FL3A 3U4EA 2HH0H 2I26N 3ZZ1A 5DVKA 1G9NL 3NCCB 3UTZA 1DBBH 1MFAL 3TBSA 3MV8E 5HPOA 1JK8A 3MLXH 5FYKD 1UVQB 4RISH 2GSIA 2AJVH 1KT2A 1VKXA 2Z8WC 4WUKH 5JHDA 4LLWB 5I1DB 2NY6D 1YNKL 1CGVA 4IEFB 3QUZC 1NSNH 4OCLC 3L3GA 2I5YH 4QY8B 3L5XL 2Y07L 4JREC 2VLRD 3DO7B 4R4FL 5IOPA 4XC1H 3EDEA 2ID5A 3L3OB 4IOIA 1FJ1A 2WV3A 4FS0A 2C3VB 1A1NA 1EV2E 4NNXA 4JZOA 3JWNC 3TBWA 5IJKA 4PJFB 2E6JA 2F8XC 3A6BH 1PYWB 5EPMA 3A6CL 3TZVC 2GY7B 3MV8D 3QXDA 1F11A 1VSCA 3BP6B 1E6JL 3GI9H 4PRHD 4UQ3B 1A7NL 2KQMA 4J3TA 3LPWA 3SY0A 3QZWA 3OKYA 2ZUWA 5JW4N 4PJEB 1BZ9A 4Z76A 1C7SA 4J6RL 4IRSA 4P59H 2WBKA 3TPUA 1UWGH 2XOTA 4IDJL 1Q72L 1U8LB 3OKLA 5ISZE 3GB7A 4OM1H 4PTTB 5BRZA 4PJGF 4F57H 3GK8H 5FO8B 2ARJQ 4U1IB 2ITDA 4OD3L 1JNJA 4ZUWA 4YE4H 3PP3H 3IETA 2HT3D 1EO7A 4S1DC 2CIKA 5L2KB 2CJUL 5C70A 3JWDL 3EKCA 5GSRB 3MRNA 8FABA 3BPCB 5SX5K 3MLVH 3E8UH 3L3IA 4TVSa 4DJMA 1DQJA 4W4OC 1OB1A 2X41A 5BS0A 1RFDH 1ZA3B 4JRYA 4QXWA 5D2LA 2VYRE 2CUHA 4LSSH 1M71B 1J8HD 1JMZA 3AROA 1ADQA 3OF6D 2Z93B 3TPKA 1EMTL 2BHYA 3SE8H 4E0RA 1ZWIA 2HT3C 2IQAB 3TBVB 4NZTL 4Y4FD 3GSNB 4YO0A 1F5WA 4HLJA 3OXSB 4N0YH 3T0BA 3FZUC 3RVUD 5SV3A 1X7QA 3DX9B 2H6PB 5FM5O 3BYTA 5E6ZA 1U3HB 5C86A 2Q8BH 3G5ZB 3TNMA 3ZE0F 3EDFA 1NGZB 2CLVB 3PWNB 1T3FA 1XIWD 5B39B 4OTXL 2GHWB 3NOIA 5I8OH 1F8TL 5KVEL 4YWGL 1P84J 1W72B 4NKMA 1S3KL 3D25A 3HZKB 1HEZB 4EDWL 1R3LB 5F1IB 4KK5D 1LO5B 4JKKA 4N0YL 1JWSB 3P4LA 1MVUA 4X4XA 4M7LT 1MHPH 3BKMH 3PV6A 4FTVB 4CNIA 4UILH 1PJ9A 1XR8B 4NIKB 5CWSB 5DD5L 2HJKB 3EUUA 3VXNA 2CRIA 2BNQD 2FHCA 1ZTXH 4E41E 4MA1B 1Q9WB 6FABH 3RVXD 4JRXB 2UVEA 5HVHB 2VZVA 3QJFB 3WFCL 4C58B 3S4SA 4PG2A 3H2WA 4U1GC 1I7RB 4PJCF 4F7EB 3TBVA 2BOCA 5I73B 2Z0BA 5E6IB 1D6EA 4R6UA 4YUEH 43C9A 2ICES 3FAWA 4Y2DC 3CFJB 4X98B 1ZA3A 3WUZA 4L3CA 1L6ZA 3ZT5A 4YHZH 4WI3A 2VISA 3EFDL 3L3IB 3P9MB 1B6UA 1ZXQA 5K9KB 1YJDH 3CCHB 4P46D 5E0QA 3JV5A 3BGMB 1YEGL 4QO1A 3VGDA 4I4WA 1ZVSA 1HN1A 2FLBT 5EO1A 1G7LA 4S0TD 5F9WC 5CCKL 3ULVC 1JUFA 1RUPL 1EGJL 1I1FB 5FA4B 2DYPD 3UZQA 5LCVH 1VFUA 4XHJC 4D9LL 3SBWA 3ARBD 2Y06L 1HILA 4OIBA 2DYPB 2JB6B 4O2CB 1U8MB 4NCC1 5BZWA 4R7DB 4I48A 3S35X 4Z8FH 3I2CH 1MWAL 3SKJH 3L3DB 4LNRA 4NM4H 5F9WB 3SGEH 2FX7H 4XZUB 2HFEA 1H5BB 1HHHB 1SEQH 4JCLA 4TRPL 4I13B 2AERT 3QHZH 3OHXA 2APBA 3RGVB 1P4IL 5DJ2B 5FO7A 4E0RB 1NDMB 4RDQG 3VFGL 1LNUB 3MLPA 2RB8A 4X6EB 1BBDL 4Q9QL 5IP4A 3W11C 1HHKA 4JPKL 1UM6H 4N8PA 1T0NB 2VXVH 1MCOL 3DIFB 4AH2B 1OARL 1FH5L 3GMRB 4HCRA 2NZIA 1XGUB 4AQ1B 1JZ7A 2HRPL 2YRLA 3TJEL 3ZL4L 5HVGB 5TGBB 1T66C 4O02L 1YEKH 2VNCA 4RIRB 5KANI 1EAPA 1YUHA 3IJYB 4L29A 4NJ9H 3V6OA 5B22A 2J8HA 3W39B 4XHQA 2FBOJ 4NZUL 3PWJA 5HVWA 1I1AA 1CE6B 4P2OD 1IC4L 5E8EB 3LHPL 4MJIA 4ZFOB 1UM5H 3LCYA 2HJFB 4PREA 4Q9RL 3V0AC 5HHQB 3ILPA 1KJ2A 1I7ZA 3BIKB 1P4IH 4KKBD 1S9VA 4FQQA 2DI9A 4KMQA 2N4IA 4XXDB 2P49B 2I9LA 5I1GH 3UYRH 1WFOA 2AJ3A 4BZ1H 5E2UH 3SCMB 1HYSC 1JN6B 2HTKD 3FQXB 1LHZA 1IGMH 2R0KH 4JPWH 4OQTH 1X5GA 5FYJH 1U91A 3I9GH 1DBMH 2CUMA 3CZFB 3MROA 2CK0H 3LKRB 4D3CL 2CKBL 3I84A 4JDTH 4NHCH 1NGPL 5INDB 3O2VH 4Z7UE 4PJFE 3W0WB 3QQ4A 1F02I 3Q3GA 2QQNL 2V6HA 5ACZB 3UBXA 1U36A 4HJ0D 1DBKL 4HWZB 1KN4L 1LE9B 2NY3B 2D7NA 5IROC 4RFOL 5B38A 4OFYA 3U4EB 3MMEB 5E8PA 1TCMA 4XCNB 3QIUA 1ZLUH 4JY4A 1RUAH 2DF3A 5IMMB 2HH0L 2B0SH 4JFYB 3BKJH 1VPOL 4ODUA 4DN3L 1BQSA 1UJ3C 1A7QH 4RGNB 4BQ6A 4NOBA 5I19L 5F3HA 1TQBC 3QDGA 2C9AA 1V7NH 5JDJA 4RMUA 1QSFD 2PNDA 1IAIL 5MEND 2AXFA 2AEPH 5FYJE 5IMLB 2VC2L 5BW7C 4YHMH 2DQEH 4MWFA 2YUXA 4NFBA 1VA9A 1QLFB 1CXLA 1JGEA 4KI5E 4ZS6C 1N7MH 4HCRL 4NKDA 5IKCB 3OPZH 3LHPH 5KZCD 3V95A 4YHPB 2YZ8A 4EN3D 3CLFL 4IDLA 1TTFA 1BFVH 3MRHB 1QFWL 1LDPL 1EEZB 1D5XB 2B1HH 5FFLA 4G8IA 1KCUH 1R5VB 1F42A 4D9RE 2ITCB 4XH2A 3QP3A 1QR4A 3MLZL 5EU7E 3U9PL 3GSOB 5EO0B 5JOEA 1CFTB 5EZLA 4YC2B 1KNOA 3ZE2E 4B0MM 3D2UD 2JLLA 5LWYL 3WHXB 4U1JA 1UB6A 1E4KC 4PS4L 3V5KA 5BZDB 4OZIF 2VR4A 4LLMB 3S35H 1EX0A 4PGEB 1QRND 4U1LB 2X1PA 1LO5A 3QUML 3REWA 4AIXA 1Z6JT 1R3LA 2IG2H 2R2EA 3IKCA 5ID1B 2YRPA 4KAQH 2X4NB 2OJEA 5AYUH 5IKCA 1N8ZA 5D7IE 1URLA 3QCTH 3EAKA 4PGCB 1F58L 4N0UB 4P9ML 4WUUA 4F9PA 2NMSA 3I02B 5EU4B 2HKHL 3ULVD 4LGRB 2J8UA 1A3RL 3CDCA 2M26A 4P0DA 4MXQD 2V7HB 1I1RA 1OTUD 3HR5B 4KVNL 1T03H 3QDGB 1KENL 4JO3H 4NM8L 3PNWB 3VGGA 5CP3H 1A7OL 1CT8A 1OPGH 1PFCA 1RURH 2BZDA 4HKBB 2YUWA 3PHOA 1J8HE 2GSGA 5J8OA 3U46A 2FX9L 5KSAD 5CBAA 1MRDL 4PLJD 2AJZB 4XHJD 4WCYL 2XWBA 5BS0B 4JGJA 4PJBE 3SKJL 5IB4B 3MNVB 4KXZH 1TPXB 1KFAH 5E6IC 4KK6C 4R90L 3VFWA 4TRPH 4WI8A 5F89A 5ADPL 4OCYL 2A74B 3QCVL 1IAIM 5TFSL 2VDOH 4G8GB 1ORQA 5IBLC 1DEDA 5E8OB 3C60B 4FFVC 1JGLH 2CQVA 3GMMB 1X5YA 4HHAB 2DQGH 5I0ZA 3VFTA 1U8LA 3OKLB 4XMPH 1S7SB 5HD8D 1FCGA 2R0WL 4RGMC 3SDYL 1IAOB 3VD7A 4OLVH 3PV7A 3DMMA 2AV7B 4WFFE 5LGHL 1RK1A 4L4TB 2J6EA 3HZMB 1I85C 3VXSE 1K8DA 1WEJH 2E6PA 1J10A 2PYEB 1ZAGA 4NQDD 2ZOLA 5DMGD 1YJDC 3QEHB 3IDGA 2D31A 5IW1B 2EC9T 2DL2A 1NMAH 1P7KA 1G6RL 3BW9B 1MFEL 1ZA6B 3PG2A 5D7KE 5E1AB 3ZE1F 3RNKA 3OX8B 1T0MA 4NC0B 3EYFB 4JEGB 4KXZI 1QO3A 2EXWD 4MZ2A 5IHZB 2ZCKH 4P2QA 5AG9A 5DQDL 2EKJA 4KJQD 3S3JA 3VGBA 3WJJC 2XTJD 4RAUA 4DAGH 4PV9B 2AK4E 1AGCB 5I73C 5DDHB 3MUJA 1WZLA 4YHKH 4BH7B 3VGFA 8CGTA 2LFGA 3BZDA 4IJ3C 4PJGA 5F9JB 4G8GA 1OAQH 4NHUA 2AV1B 4PBXA 4NQCB 4G6AD 3S36L 4E41D 4I2XA 1YQVH 3WD5H 2R15A 4Y16C 3JWOL 5I1CL 2RHEA 1U8IB 5T1LD 3OKMA 1H3GA 3DI3B 2F19L 4OM0H 3MOAH 3OXRB 2FX9H 1CL7H 4IJ3B 1JNNH 1FL3B 3FOLB 3CGTA 5E95B 1NCBL 4L1HA 4K07A 4MA3A 2G5BB 3O2DA 3WNKA 5HTSA 3D0VA 4NM8H 3VXRE 1A4JA 3DMMD 3TO2A 4NC1C 5KZCB 1FQ9C 3U9UA 1DQDH 1OGAD 2PO6D 3MV9E 1T0MB 1OLLA 4FFWD 4XBPA 2WSKA 2AGJH 4WO4D 4MZ3A 4BFIA 3ULVL 1IGFH 2XQBH 3BRDA 1LK3L 3BIAX 4KZDL 5J4MA 1MCQA 5KG9A 2IBZX 4K3DH 3G6AB 3MLYH 5KJRH 3WO4B 1B4RA 2HJLA 1EZVY 5EA0L 3VXRA 5FGSA 1YY8B 3RA7H 1RK1B 3U0WH 3RIAK 2P7TB 2KUTA 4JM2B 2QSTA 3UZEA 4RWYL 4MCZB 5C0GB 2MPAL 4JFZH 1DBAH 1HKFA 3CLEL 4O9HH 4RGNC 1MVFA 4U1SA 3KS0H 4Y1AD 1F3RB 5D8JL 4OV6F 3CFKA 1TCRB 3P4NA 3NFPA 5GZOC 3OR6B 2H26B 1G0YR 3MRMB 5C0BA 1QYGL 3VWJA 4F58H 5ALBH 3S5LG 5HSFA 1NMBH 3T4YA 4G7VH 3EW3B 4XNMA 4QOKA 4N0CC 1KNOB 4K3HA 3KJ4C 3QNXA 1G7MA 2VLKB 3ILQD 4ZSOB 1CLCA 1RZIA 4LRNH 3GI9L 3C5ZB 1IGCH 4LAQH 4ZUVB 1BFVL 3RU8H 1H3VA 4KMLB 4UT7L 4F2MA 3KPMB 2Z91B 2ADGA 1Y6NR 4NZRL 1BGXH 2V5SA 4L4VE 3U6RB 1XIWC 3OKDB 2WZPD 4W6XB 3UPRB 2I9TB 4NO2A 3TVMC 4JB9L 1I1YA 1JWMA 3D69B 4PRDB 1JNLH 4H25A 3BRGC 4OCSH 4J4PC 1HXMB 3BWUC 3EBAA 3NTCH 4KKAC 4NP4L 3O3BA 2FO4B 2GJZB 3W5NA 4JFZL 1G9ML 4JDZA 1UC6A 1D5ZB 4K94L 2DDQH 1NAMH 3QUMA 5F3HB 4Z7UB 1QVOA 5EZIL 2R1YA 4LSTH 1IJ9A 4KZEH 4Q58C 5CZKA 2E3VA 4QOKE 1NCBH 4HIXL 5D1ZA 3DSFH 5L88L 3HRPA 1Z0NA 4KHXH 5J11C 1IGFL 2BOBB 5TE7H 5A3ID 3V4PH 4G3YL 1ZOXA 3VWJD 1EXUA 3CFCL 4KPHL 2XZCH 3WHXA 1DQDL 2CDFA 4Z95L 4PJDB 3E2HB 3GMLA 5GJTH 3C6LA 1PSKH 5TH2B 3MRCA 3IXTB 5K9QG 3C9NA 1KXVC 3RKPA 5INDA 2GUOB 4IRJA 2QBWA 3EOAA 5DGQA 2HWZH 1W2KT 3C08H 2MHAB 5DJCA 4XRCB 5SWSD 5D2NE 3FB5B 1D5IL 1PX4A 1RUKH 1YNLL 1PLGL 2Q1EA 4U3XA 5DA0B 3WS6A 4MLIA 3OAZH 1QRNA 3T77B 2P5WD 4HCRH 4LASL 5GS0C 3IJSB 5I76B 1A1MB 5IQ9B 3LPFA 5KS9A 3UPAA 3K81A 3ECBA 1OL0A 4V2BA 1A0QL 3MRQA 3CLFH 4FOMA 1I7UB 1QRKA 3RX8A 1OVZA 1A6VH 2XIDA 3HNVH 2ZUVA 4YHIB 3EYOA 1I3VA 4HS6A 4M61B 3WXWL 3Q2CA 1E4XL 3BPOC 4ONFL 1RUKL 3BXNB 4PIRF 4O2EA 2J88L 5FYLL 3MLVL 4PRIA 3PXJA 4OZHF 1JFQH 2VC2H 5F7WC 1NC2D 2FH6A 4JN1H 1NCTA 4FZ8L 5I15L 1F6AA 4FABL 1MJJB 2CR6A 2EECA 4YXHH 2R4RH 2NW3A 3BAEL 1F11B 2XWTA 3X14B 2WW8A 4G8EA 3E1F1 4CVXB 2NXZB 1M7DA 4LKXA 1DBKH 3QCVH 5TFSH 4X6CF 1OAXH 5DR5H 5CP7B 2VUYA 1Q72H 5IMKA 5TE7L 4M3KB 3TCLA 1A1NB 3SE3C 1J1XL 2D3VA 1MCPL 1LEKA 4KQ4H 3VH8B 3ZHLA 1AP2A 1KC5H 4QY8A 3MNWA 3L5HA 4WW1B 3TESA 3G9VA 3V2AR 3V6FB 5IGXL 1FC2D 4JN2A 4W6WB 1FVDB 4MD5B 3RVWC 4LHQB 4XAWL 4Y5VC 2YPLA 4XP4L 1BHGA 3L5JA 1JIBA 4FFZH 1FYHB 1F90L 3U7WH 1KENH 1UFUA 1UVQA 3BIBX 2DJSA 4DCQB 1I7ZB 4MNQE 5ILTL 2DQCH 5D7SH 3M8OL 5E2UL 4JGMA 4YNYA 3QIWC 4K8RC 1YECL 5GHWL 1G6RA 2QQLH 1RZKL 4ONOA 2Y07H 1JBJA 1T89A 2CRMA 3FQRB 3NABL 4PFEA 1GZQB 1G7IB 2XV6B 2O61A 3O9WC 4V1DE 3AREB 1CS6A 3AU1B 4M7ZC 5C0JB 1T6VN 2X4OA 4KAQL 2EDOA 1HSAB 5ESVB 5EU6A 1X5JA 4PGDB 5HJ3A 4C4KT 1NFDF 2VN4A 4QRTB 2X4PB 1YA5A 5GGSA 2ICWB 4U7SA 3ULVE 3HB3C 1FFPB 4M1DL 2HFFA 3I6KB 2G2RA 4X4MA 4WV1B 25C8H 1GSMA 4CDHA 1TDQA 2GI7A 2G60L 4R7NA 3B9KB 5C0CB 4Y19D 5KS9E 5DJXA 2HRPH 3TJEH 3DXAE 4GKSA 5DUPH 4NZUH 4UB0L 1KEGL 3CC5B 3ARTA 1JGUL 2VSCA 3VU2A 1EEQA 2JJSC 1T0NA 5EUOB 3FJTA 4DVBA 3HG1E 1ONQB 3BE1L 5T1LB 3WMSA 2EEDA 3OTTA 4HXBH 4IM8A 5DJAB 2BVQB 1D9KB 4ACPA 1F45A 4D2NA 4Y16B 1U8OB 3O6LH 3GMPA 4HLZG 3KXFA 1NDMA 5GS1C 5TE6H 2HLFD 1FIGL 1SJHA 2VXTL 1DP0A 5JIHA 3TZVA 4MNQB 1G6RB 4G6MH 4PRPE 3FT3A 2XNAB 4EDXA 1Z2KA 5IEKB 5GRVK 5EU5B 2KZ1B 2QQLL 3JUYA 2ICEA 3QNYA 1UA6L 3GGWA 3QFJE 4Z5RA 4TNWF 3L3DA 1HK6A 3MRGB 2IPUG 1OGAA 3CDFA 4DW2L 3G04A 4UUJA 1MVUB 2EC9U 4X4XB 4U4BA 1YEEL 1P2CA 4DGYH 3L3KB 3AXLB 4ZUUA 5HHXL 5BCAA 3T3PF 5IMOA 3DROB 2A77H 2IF7A 4OCWH 1I3RA 1EHLH 1JI2A 3DVNB 4M00A 4KV5F 4MA8L 1MCJA 3MLSH 1JZ4A 7FABH 3JWOC 4LIQE 4PRBA 4Y5XC 3IF1A 1DL7L 2AJYL 5C0IA 1B0WA 1UYWH 4QRTA 4RFOH 1YPZF 3QI9A 4G9FD 2F54A 1YY9D 1DLFH 1G9EA 5HI5C 4P57A 3J7HA 2HTLD 4M5ZL 4P4KA 2DQUL 5IB2B 4JQXA 1QOKA 1B90A 4N1CA 2ZPKL 4IHOB 5EC2B 4K94C 3RVTC 5I1LB 2D03L 2R4SH 5JZ7C 4JFFB 2B20A 5HHME 5K33A 2ICCA 2UZIH 3EYOB 3UYPA 5GJSL 1B4JL 2ADJA 2WAHA 5A2IH 3QWOB 3L3HB 1DDHA 3WFBL 2CH8A 5L2KD 2NTFB 3VGAC 1Q0XH 2AJSH 3VXNB 5HYSG 5KOVC 1E4KA 4E5XA 5DHYB 2APWA 1LEKB 4PLNC 5FHBL 1CDYA 1XCTA 1ZHNA 4WWKD 4Q2ZA 1BD2E 3LDBB 4Z7NF 3RVWD 4K23L 2VIRB 1INEL 3KPPB 3ARGD 1I8MA 4HUWB 3C8DA 3SHSA 5D7JB 3ARSA 1S7WA 2VDQH 2NCMA 5ANMA 4YDJA 3WYRA 2FX7L 2EDXA 1RZ7L 1T3FB 4PJHE 4ZTOH 1JRHH 4J2XA 2J2ZA 1DBJL 4NJ9L 3CIQA 1HIML 4HKXB 1QD0A 3TYGH 3QXDB 3QWRD 5MENA 3FCTA 1N64H 1A6ZA 3QDGE 3UO1L 1QLEL 4X7CC 1OF2A 3QI9B 1S9XB 2A2QT 2XZCL 4RSVA 1K2DA 1VFOA 4KI5C 2EIEA 2GFBB 3H42H 1JRHI 4LVNC 5IB1B 4CN6A 3RZCA 4LCWD 3EDDA 3PHQA 3B9AA 3QIWB 4G7VL 2IQ9H 3IJSA 5GJSH 1AQKH 1PKQB 5E4EB 3CU1A 5FYJD 1YEKL 1JTTA 5BV7C 5GS2H 4K9EL 4NWUH 2AAVA 5MP6L 5JW4R 3WNMA 1WCBA 2J4WH 3CVHH 4YXLL 2E7HA 2PXYC 2R0ZL 2P45B 4YQXL 5L2KA 1ZHBB 3VG0H 2VXVL 3MNZB 2D7QA 4JQVA 3V5HB 3PQYA 2WM0A 2VO5A 5D9SA 3MCKA 4OFVA 3UPRA 1KJ2L 4L8CB 4H5SB 3MODL 4AZ8A 4Q97A 3DVFA 4QRQB 3U7YL 3B9KC 4D9RD 1A6ZB 5H8DA 4KKAD 4NZRH 5ITBH 4QRRA 1IAII 1FN4B 3GIVB 4H20L 2W0LA 3QZWB 5I66B 4LHUG 1FE8H 1SVCP 3U48A 1CFNA 3QO1B 2IAMB 1QEWA 4P4KB 3KPSA 4Z0XA 4O51A 4QWWD 3MACH 3DNKA 4YDJB 2VDQL 5TJWK 4HWBL 4YPGA 5D7JA 3OJ2C 1TZGL 2DQIH 3QULB 3CVIH 3U7AA 1N5AA 4MX7A 5J0BA 4PJFA 5T3XD 3EFFB 5A3IC 1GC1H 1FPTH 2FYYA 3S88L 2DLHA 3UMTA 2LVEA 2DAVA 1F3JA 4FQ2H 1H3XA 1YEFH 5KN5A 1U8KB 4WFHD 4D0BB 4M6MH 3V52H 1CGSH 1UM4L 5DFVC 4ZO8A 4HIXH 4BFEA 1I1YB 2ENYA 5F7KC 4ZUUB 4DUWA 1TIUA 5I17B 3VFMA 1YEGH 1N7ML 4LLVA 1YJDL 1MLBB 4ZAKB 1GXEA 1UGNA 5TPWH 2J3SA 1HZHH 1ZGLP 2I5YL 3F7YA 2WBJD 1ND0A 1NUNB 4Y16A 4KDTA 5J11B 1QSFB 3MRRA 4Q7DA 5I16A 5IG7A 1YYLL 1PY9A 2UZXB 3VXOB 4U6YA 2RCSH 5C3TA 1M4KA 3HE7C 1UWEL 3RWFA 3L3JB 1UKQA 2FBJH 3BZEB 4R0LC 2N1KA 2V2XA 3KPRD 4FA8A 3QBTB 1NCWL 1MJ7L 5IVXB 5CJOH 4WW1A 2O26U 1DE4A 1UYWL 3MACL 4HLZH 3WJLC 4HUVB 2FGWH 4PLKD 4G6KH 4GT7A 4R96A 4U1SB 2XY2A 4NQCE 1UJTA 2EKSB 5BO1L 1U92B 1NJ9B 3RWEA 4TUKL 2J1KA 3S88H 3B8SA 5C0CA 3ULUE 1T20A 3HE6A 3DWTA 3HTLX 3O6KL 5I8KL 2VLJB 2JB5H 4RA3A 3IT8D 4G80A 1L7IH 2E8YA 4U33A 4PJ7F 1FYTA 2AK4B 2GTZB 3WN5B 2EDLA 1FV1B 2FGZA 2H9GB 3WNOA 4U2ZA 3UTSE 1UXSB 3BPOB 1H3UA 3BPNC 2Q8BL 4QXUH 2Y4SA 2BFVL 3ZYOA 2O93L 5ENWB 1P9MC 3FFCD 1OSZB 1WAAF 4XBEL 3VG9C 2YZ1A 2B5IB 5DRXA 2YPLB 2Z8RA 1SJEB 2BSTB 3IDGB 4HDIB 5DQ9A 3U0WL 5I17A 1RPQA 2P42B 3IAQA 3P2TA 5GS1B 5HHMB 3S35L 1MPAL 3BUYB 4V1DA 4MNHA 1YNKH 3MUGA 3HRZA 4HIHA 3X13B 4GQPH 4YQXH 3BO8B 2BDNH 3WNNA 3RWCB 2NY2D 3CSYB 4XT1C 3VE0B 2FECI 1D7FA 3RX7A 2B5IC 2NY5C 3WUWA 2VOTA 4GMSH 1INDH 3DYMA 1J1OL 4LLUA 4CVXA 4PJGB 4WU7B 5CEZD 3NIDE 4GG6A 2XWTB 1EVTC 5D7LB 4BH7A 5CP7A 4Y8AA 1MI5B 2SEBA 5F89B 3UAJC 4G43A 3GMLB 2E6QA 4YHYC 3TBTB 2IBGA 4PR5B 4X4YA 4CN4A 4Y4HA 3F12B 2V9QA 4LHUA 3SQOH 1QSVA 4PRIB 3JV4A 4EBQL 1KSRA 4EUPG 4F8QA 3SQBA 4NSKB 4YFLI 3WFHA 3WFEH 4PP2A 2DMKA 1QQDA 4FFYH 2D31B 1GVIA 4TSCL 3WIHA 3T0WA 3QUZB 5L6YL 3RWIB 4IOSD 4NQDE 4DZBA 4YH6A 3ARFB 1RURL 4X6BB 3TIEB 3I3DA 3O3DB 5D7KD 1CG9A 1HINL 2FO4A 3T65A 3QFDB 1HXMA 3MRQB 3ZT7A 2XZQH 3Q6GL 3HAEA 5IQ9A 5I1JL 3A67L 5I76A 1YN6B 5EOQL 1PD6A 1Z9MA 3QDJB 5AD0B 1YPZE 2LQRA 4NO0A 5DA4A 3SDAA 5D2LE 4KK8D 5I75B 1MUJA 4LAJH 1J1PL 3M1BB 2IH1A 1OTSC 3UTOA 3MRCB 2MKWA 3QDAA 4JKMA 4LSDA 2Y72A 4J3OC 5IB4A 1RVFL 4MGXA 1NUFA 4HH9B 1EXUB 4KQ3H 1MCPH 2I24N 4GG6F 4ZAKC 3MZTA 5B8CA 3DSFL 4UINH 4KGJA 3MLRL 2Y25A 1MY5A 4KY1L 3IDNA 1N26A 3WIHH 2WWMD 2QL1A 3NACL 1UB6B 1MJJA 1YN7B 2B7DT 5IK3A 5GGVY 3Q6GH 1RUMH 3IGAA 3GO1L 1W8NA 4O4YL 3VFNA 5CAYB 4KMTL 3BMWA 4JM4H 1CQKA 1OAUL 2IEPA 5EO0A 2Q7YA 3MYJA 3UP1A 1KIQB 4BK5A 5D2NA 5DYOB 4JDZB 3ULUC 4DGYL 3P40A 2OL3L 5CSZA 2OL3B 1EIBA 1RHFA 2ATKA 1I7UA 2VDRL 4N0CD 4FTVE 4OCXL 5HY9A 1OGTA 5E99L 1I9IL 3BD3A 3V8CA 4AM0B 2J8UB 4KRMB 3RP1A 2ADFL 3HFML 3S3SA 4JFEB 4Z7QE 2GK0B 5AZEH 1YY8A 2DM4A 3ZMRA 1KBGH 1MQ8A 3OKDA 4Z78B 5H2BB 2CKBH 3G6AA 2X4NA 1T2XA 1S7UB 1MAKA 4PJ9C 5DD5H 1RIHH 3RDTA 1NL0H 1FSKC 4H25B 1TVDA 4BQ8A 4XVUC 3CDGB 4HKJB 4J1UB 5DMKB 4J23A 3I50H 4HKZA 3IDIB 3EJJX 3NIGE 4XMLH 5T1DH 3VFNB 5KSUB 1FNHA 3SQOL 4YX2H 3OR7A 1FZOA 1T1XA 4LQFH 1NBQA 3QCTL 4G8GE 1ZLVH 1QYGH 1KUMA 4MHHG 1CFTA 5EZLB 5EZOH 1T83C 5CILL 3OMZA 5C0BB 2CLRA 3OG4B 4NKQB 4NJAH 1HXYB 4DK3A 3HE7D 4JJ5B 5L88H 4G8IB 4DUXA 4XNMB 4NQEE 4F7CB 3G5VA 3MLTB 5CGYC 3PXHA 1CDIA 5E9DB 1AXIB 5FGBA 5F7MC 5LG1A 1V3KA 5L0QC 4OZGA 1XF3A 4OV5B 4FXGB 3OR6A 4XBEH 1UXWB 4N1HB 1KN2L 1DVFD 4NHCL 2IALB 3ETBF 4XPAH 1DSFL 3ZKNC 3B2VH 4WU5B 3KLAA 3HUJA 4F80A 4N5ED 3DV6B 2EO9A 1DQML 5HHMD 1OGAB 5FUOH 1SQ2N 4LK4A 3ARGC 3G6DL 1MAMH 3M8OH 3T65B 1UKSA 1SBBA 4WFFD 3IU3B 4QCIB 4XWGL 3QIBC 1KTDB 1CZ8H 5IFHL 5IHZA 3R4DA 3ARFA 4GQ9H 3TIEA 3EYFA 4M1GH 1CQYA 2VLRB 4RAHA 3TT3H 3FMGL 3KXFB 3MFFB 3WSQH 4HULB 4M3JA 3E6FA 5FGCE 1EFQA 3RU8L 2HVKB 1ORSA 2PYEA 2JJSA 2EH8L 1UQSA 5T33H 1IAIH 5F71A 4HJJL 3W81A 5J6GB 1F97A 5JZ7D 1QR1A 2YXMA 5HI3D 3V6ZA 1NMBL 5D5MF 3W0WA 4GLRI 1M6OB 1AO7A 4O58H 2BP3A 4NPYB 3K8LA 5DMGC 4ZXBA 4NQCA 4G6JL 3FQNB 2H1PL 5J1TC 4TNVF 5C0FB 3P4NB 2F5BL 1A21A 3PDDA 3F7RA 1A9EB 4NCC2 2W60B 5DLML 3BFOA 3OKEA 1OAKH 1XGUA 5DQDH 1HSAA 1EHXA 4ZOCA 3MC0A 1BBJA 4PGBA 2ICWJ 2W65B 4YK4C 4PJAF 2I60H 5HI3C 5CKGA 2F53A 4EUPH 1AKJA 1Q9LA 5F1SA 4HDIA 3CX5K 5DQ9B 4JDVB 5KOMC 4BFIB 4U6HA 2NY2C 2NY3C 2AW2A 1RD6A 1U8QA 4XBPB 1TETH 1HH6B 2H45A 4DGIL 4HWNA 4NQTA 1H5BA 2R4SL 1AC6A 1OP9A 2L4OA 4OF0A 5EU7C 2BFVH 3IU3A 4QCIA 3X11B 2V9TA 3VRIA 5AYQA 3QEHA 4P5TC 4B41A 3QEQD 2QSCH 3MGOB 2W0FA 5KW9L 3TFKD 2VERN 2GEEA 4YFEA 3WKML 3VI3E 4P4KC 4JQXC 2EICA 2QR0B 5ESAA 2JCCF 1Q9OB 4RGNE 3MJ9H 4Z8FL 4FQ1L 4XCCH 1YPZB 3X3FH 5EOCJ 5LVEA 1YYML 5ADPH 3QH3A 3L7FB 3MRDB 4MJ6A 5D96B 4PJ8D 2VZOA 4WRLA 1GIGL 5BV7H 2JJTC 3GMRA 4MXQC 4AH2A 2DIJA 3DVIA 4KK9D 4S1SH 4YGAB 4APQC 4JAMB 4G8EB 3UDWC 1QKZL 5D93B 4CJ1A 3RKDC 1VADB 4XCFH 3VXSA 4KHXL 2HWZL 3RTQA 4LSSL 2ZUSA 4OZFB 2V2TA 4GRWH 5DF0A 4HK3J 3VXPB 1LK2B 3LPGA 4QTHB 4FQ1H 3EDJA 4S2SB 4PGJA 4YAQA 1Q38A 4OD2A 3BN9D 1A47A 2OXHA 4NDMA 1FH5H 4JVWA 3UJIH 4BUHA