1QFUL

Influenza virus hemagglutinin complexed with a neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQTLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQNTHVPYTFGGGTKLEIKRADAAPTVSIFPPSKIQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HEMAGGLUTININ (HA1 CHAIN))
publication title A complex of influenza hemagglutinin with a neutralizing antibody that binds outside the virus receptor binding site.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfuL01
1S7XA 3CXHK 3QUZB 4OZHF 5IHZB 3GIVB 3QUXA 3GMNB 2YXFA 2Q8BL 3S4SB 2B5IB 4JG0H 1DFBL 3D18B 3MJ8B 1A7QL 1NAKH 5J12B 1YEDA 1AC0A 5DJZB 5ID0B 4MXWH 4NYLB 1FNEB 1FZJB 4MZ2A 4J3SA 3UPRA 3FFCD 5CZKA 1KFAL 1IZKA 1CGSL 3P2TA 4QXTB 5EOQH 1EV2E 1LDPL 1DDHA 1AD9B 2XI9A 1KXQE 4LRNL 3DX8A 4RMQA 5B8CA 4U1GB 3WCYA 4Z77A 3DARA 4OFKA 4A6YL 5KG9B 2OI9C 5GS1C 1KELL 3W39A 3PL6C 5CIPH 5FA3A 3K1KC 3UDWA 4NQSB 1QRNB 3GSQB 5B39G 3P3YA 1AO7B 4WGWB 1CDJA 1OGAE 3MRMB 3EBAA 4YQXL 1CIDA 1I7RA 4HXBH 4Q0XL 4DN4H 2WIIA 5GS2D 5DJ0B 1WEJH 3BRDA 5TDPA 1HILA 3E6FA 2VKXA 2H45A 3HFMH 3NCMA 2V5SA 5GGVY 4HHAA 5I1AB 1PKQB 1NGPH 4MXQD 5IP4A 4H25B 2VE6A 3W9DB 1DSFL 3GZKA 3UPCA 1DBKL 1JJUA 2AXGA 5BZDA 2EO9A 1TVDA 2NXYC 3RIFF 1CE1L 3SKOA 4Y4HD 3VXTA 3ARFD 1HWGB 3ARBD 3U4EA 3MR9B 3MZTA 4OZ4A 2FWOB 2PF6A 2H32B 1VGKB 2F15A 4YHIB 5GISL 3PE9A 1NUGA 3F62A 2PUQT 3HE7A 3QA3B 4I48A 5JHDA 1X5ZA 3TBYA 3A67L 3RWGB 4PJCF 4UT6L 3BXNA 5DK3A 3VXUD 3VU2A 4WU7A 4L8BB 3AS3A 5J56B 1J05B 3IDXH 5A40E 4MXVE 3E8UH 2A38A 2NY0B 5DQ9B 1SJHB 1WZ1L 3U79A 5KVFH 4JZNB 5JDSB 1QBBA 3CXDL 4PD4J 3HNSL 4D3CL 4X0KA 3KJ4B 1BAFH 1LMKA 3DETD 2APWA 4LPXA 1AJ7H 5I1JL 1NCNA 3LKRA 3DO7A 3RGVC 2ICWB 4XNUL 1B4RA 1Y6NR 2YXMA 5DFVC 4E41A 4DUXA 2NLJB 3QEUB 5HYJA 1FLTX 1T03L 1Q9WB 4M62H 5ICYA 1VFBA 3NFPA 5IJKA 3GKZA 2GJ6B 1DQTA 3SCMD 3NPSB 2APTA 2ZKHL 4NC1E 4JQVA 1EFXA 3G6AA 1HINL 4OCSH 3K81A 3R0NA 3VCLA 3K3QA 3R8QA 1CR9H 1RZJL 2A6IA 5GGQH 3GRWA 4ELME 3QXDA 1WBXA 2AP2A 2O5ZH 3GO1H 4JLRB 3RWIB 2E9BA 3NFSL 2DLFL 2VAAA 1ZHLA 3HC4H 1XAUA 1FV1B 4MQTB 3WJJA 1NH6A 3GMLB 1UB6A 4FHBD 1F4YH 1SEQH 5F44A 1N8ZB 4BZYA 4Z7VF 1UQSA 5IBTL 4JANB 4LCWA 1EZVY 4NJ9L 2VDKH 3U1SH 4WO4C 4KUZL 4ZUVA 5JW4N 5DD5L 3V6BR 1NC2D 5FYLH 2FDBP 4P5TB 1R6VA 4FQ2L 3BMVA 5DT1L 2DBLL 4E41E 2EO1A 4OCYH 5HYJE 2VLLA 2ESVD 4WU5A 4LAQL 4FQLL 1DUYB 2IADA 3LQAH 1QSVA 5F9JA 5IQ7H 2J5LC 4OLXL 2YA0A 5D7SH 3WFCH 1AC6A 5FHAL 4N9GA 3T4AA 3TGXA 4BELD 2EXWD 2GAZB 1DANT 4K3EH 2X1WL 1RZKL 1U42A 4JM2D 1GGCL 1A0QL 4OBSA 5FM5M 2CLZA 3C09C 4KHXH 5D1QC 3TO4A 5EOTB 2QKIA 4PG9B 4P46A 1F2QA 3BZ4B 4OI7A 4NKMA 1EEZB 3B6SB 4S1QL 2GY5A 2VXQL 4AEEA 2BFVH 3EYQC 4C58B 1J0HA 3B9AA 5D70H 2V7HA 3P4MB 4LCWE 5TE4H 1C8PA 2VDLH 3DHJA 3FCTA 1D3CA 4F7MB 4HT1L 1CGYA 3SDCB 5J3HD 4M7JL 4R7DB 3MROA 3TP4A 1HOCA 3VD9A 2IAMB 2P48B 5C07A 1I9IL 4NWUL 3O6LL 2BOBA 5IGXL 1MFDH 5FUZL 3SGEH 2QSTA 4HUWB 2P8MB 2QHRL 1L0XA 1C1EH 3LKSA 2X1XR 4WFHD 1MCHA 4JM2F 3VFTA 3CFCH 1NCDH 4N9OB 3TZVA 1FIGL 3MV8B 4YHKL 1R3JB 3IETB 3SE8H 4LIQH 3GSUA 1JZ3A 1RMFL 1GL4B 1KEMH 4FQHA 4HUXA 3TYFB 5IMLB 2NNAB 3LN9A 3WO4C 1C5DA 4RAVB 3FN0H 4YHOH 4TSAH 4NO0B 1BFOB 3GM8A 4TULH 4OGZA 1WFUA 3H42L 4G8FB 5FFLA 1NEZA 2VZVA 5KSUB 4FG6C 3MUHL 1F5WA 3ILPA 2DJUA 1JNLL 1FC1A 2HT4C 4U1MA 3OAYH 2CRMA 3RZCC 3VI3F 2Y4SA 4A2MA 3D2UB 1OGAB 4YZFE 3UBXB 4GXUN 4WI3A 4Y1AA 4Q9QH 2FD6L 2F8XC 3PHOA 3Q0HA 3PQYD 4X9HA 2OJZH 1QA9A 1V7NH 1DVFA 3WFBH 1LEKB 1N7ML 5IJVA 2X4NB 2DQCH 1QTYT 1BD2A 3DYMA 4DKAA 3LSOB 3NMEA 1S7XB 1ORSA 4ODHL 4ZFGH 5MHSE 1T2QH 2IFFH 2JJUA 1EXUA 5D7IE 1JP5A 3QUXB 4Y4FD 5DEGA 1MCEA 4U6HA 3TT3L 4LFHG 4LP4A 2R56L 4KZEH 1MHPL 4EI5D 3PP3H 4OAWA 4RIRA 4ALAH 1YEDB 5JOFA 3MLRL 3IDNA 4KK8D 2B1HL 3WNNA 9CGTA 2X05A 3CGTA 3UPRB 4GBXA 2OR9L 2X9WA 4KK6D 2K3TA 2VZSA 4KVNH 1DDHB 4M6NH 3DX8B 1MCFA 4OZFG 1YNLL 4QY8A 1YEJL 4Z77B 2EDHA 1M7XA 5FA3B 3EO0A 4MQXD 3H7BA 4J6RL 4HKZA 1MVUB 2DYPA 3W2DH 1I1YA 3GJFA 2X41A 4Y1AE 1I7RB 4R9HA 2WIIB 4ZS6D 1FRGH 4X6FA 5HDBF 1T2JA 2W91A 1PX3A 4KKBD 5TDPB 1HILB 3E6FB 5CKAA 1CFVL 2BXZA 3RHWK 5KTEL 1EO8H 2D0GA 1BD2E 3D1MC 5F9DC 1PG7H 1QACA 1LO5A 1ZTXH 3B2UD 3WXVH 5CCKH 1EK3A 2VE6B 4JDZA 1XCTA 1J1OL 5GS3A 5TH2A 2AXGB 3IXAA 1WK0A 5BZDB 3RVWC 1KJVA 1U58A 1ADQH 2AK4D 5EWIH 4HFUL 3EZJB 4XB8A 3SKOB 4GAYA 4HKXA 4ZS7L 3VXTB 3BD4A 3JTTA 3QIBA 3U4EB 3IJHA 4OB5L 4NT6A 4OZ4B 4D9LH 2EIZA 2N4IA 4CJ0A 3HE7B 4I48B 3TVMD 1KCUH 3ULVH 4AJ0A 5F1SA 1RZFH 5JHDB 1EJ6A 3SDDD 3DTXB 1QUNA 2HRLA 3TBYB 1UH4A 1RFDH 2WBJD 2WK2A 3BXNB 5KSBA 4QOKE 2D7PA 4WU7B 2I9LA 5HYSA 1D5BA 5DJYA 2D7QA 3I50H 3PWNA 5BCAA 4XAWH 1T66C 3BGAA 3VXNA 4AIOA 4KROC 4X0KB 2V9TA 3RL1A 5C0AD 4PLKD 2DIAA 5F21B 5I30L 4PTTA 3K0WA 1DBAH 3I75A 1G7LA 3DSFH 4H8WL 4W6WB 5C0ND 3RQ3A 4JAMA 1HK6A 4Q97A 3LKRB 3UPAA 5IM7A 4IDLA 3CD4A 3DO7B 1G7JA 3RPKA 4E41B 4XPAL 2WM0A 4BJLA 3R0MA 5HYJB 3I6LE 2R4SH 2FX8L 5ICYB 5AAWA 1OAQH 5ABDE 4G9DA 1VFBB 3NFPB 4UOW0 3P30H 1DBBL 1JGEA 4M1DL 3MCG1 1RIHH 1OLZA 3OF6A 5BRZE 1EFXB 3G6AB 4KJPC 1N6QL 3L3JB 4Y2DD 1RK0A 4Y8AA 4FQXA 3VCLB 5GGTH 2VWEE 5IV2A 4OIIL 2A6IB 3BN9C 3I2CH 1DQDH 4DGIH 4YE4H 4YPJA 3QXDB 1WBXB 4L29A 3GSWA 4AQ1B 1FNHA 4ODSH 4GSDL 4YWGH 5KSBE 4I3SL 5CILL 2DLGA 2VAAB 1ZHLB 3HNVH 3ZZ1A 3HC3H 4D9RE 3MRIA 2JCCE 4OQTL 2XKSA 1BM3L 1OD9A 1UB6B 4KKCD 1INQB 4MA8L 1MHHA 4FFZH 4NKQB 4RA0C 5HHOD 1UQSB 4MAUH 4P4KD 1F4AA 4LCWB 3HMXL 4X7DC 1UWGL 1B6DA 4ZAKC 1JFQL 1B3JA 2R2HA 4ODUA 4ZUVB 2XN9E 4XXDA 2ZCLL 3QAZC 2QEJA 1TZGH 4FMFA 4JREB 4LMQI 1T22A 2VLLB 4X4MA 2Z31A 4WU5B 4ZUWA 2APXA 4EI6A 4DQOH 2YD5A 2IADB 4XWGL 5F9JB 1MCIA 2DQGH 3EUUA 4JKLA 4LLAA 3CLEL 4R4FL 1GRWA 2VXVH 5DSCA 3DNKA 2VUOA 1I9RH 4N9GB 3T4AB 4JN1L 3VRLE 1IC5H 3LEVH 3MBXH 4GQ9H 1MI5A 2G9HA 4NPYA 1LO0H 1JPST 3ILQC 4JVUA 3MBEC 2BHUA 4JPWH 3VI4F 1BBJA 5FYJU 2CLZB 2OX5A 5D7JD 3TO4B 5AD0A 4P46B 3OBAA 4NKMB 3FTGA 5E4IA 4WGVB 2MMXA 5F7YC 3GNMH 2V7HB 5C08A 1C5BH 2R8SH 4IDJH 2FH8A 1JGUH 1LD9A 3FCTB 3QI9A 2NW2A 5GIRA 1EHLL 2EYSA 3P9MA 4EN3A 4LSSH 5HVWA 1DN0A 2GITA 3MROB 1CFTA 1HOCB 1TTUA 2EIEA 1CBVL 5C07B 4X4ME 4JPIA 2CIKA 3V7AG 1I1AA 4HPOH 3MFFA 2BOBB 4RFNB 3W5MA 4I0PA 3PXHA 5F88A 3LKSB 1I3RA 3RAJL 1FPTL 1Y0LA 4WENB 4WHYH 3VFTB 3FAWA 3TA3A 3TZVB 4G6AC 1X5IA 1P2CA 1ZXQA 2L4OA 5FOJA 3RVUD 2X1QA 4PB9L 4JFPA 3GSUB 3BKYL 2FHCA 1ZEAL 2GI7A 4FQHB 1A6TA 4HUXB 4BFIA 1KCKA 4K8RC 1C5DB 5BS0A 4B41A 1AXTH 3EW3B 3BMWA 4PBVC 1X5XA 2DM3A 5E9DE 4KI5E 2BMKA 1NEZB 4K3JL 1RUPH 3CSGA 3ILPB 2A73A 1F4XH 4U1MB 4ZNCD 2AJUL 2XTLA 3V7MA 3UTTE 1FO0L 1G84A 4Y1AB 4WV1A 1MCOL 4Q9RH 2ZJSH 2R0WL 3PHOB 3BDBA 1CDBA 5B22A 1DVFB 1GGIH 1NFDE 4Z8FL 5IJVB 1VEMA 4ZTPL 5ACMA 2XTJC 1BD2B 1NCBL 1FORH 2BC4A 5DD0H 2FX7L 4TPRL 4ZO6A 1EXUB 1EAJA 2W0PA 1CICA 4G9FD 5IROC 5DEGB 5HYEA 4U6HB 1WWCA 2QQNL 5E6ZA 4U0QB 4OAWB 2DQEL 4RIRB 3T0EC 5JOFB 3FB7A 3IDNB 1MREH 5T33H 1FNSH 3FFDA 1G9MC 5C3LD 4P49A 3WLBA 4JRWA 1TVBA 3BPNB 5EZJA 5BS0E 1OAXL 4NQCD 3RX5A 4GBXB 4P2OD 1K4DA 1UJTA 3LOWA 3QEGH 2E7LA 4MJ2A 3V8CA 3TJHD 5M95B 4QY8B 3RVTD 2R0ZH 3UO1H 3PWPD 1OT1A 4Z78A 4ZXBA 4KV5E 3EO0B 3H7BB 4PRHD 4HKZB 1OPGL 2DYPB 3FONB 1UWEH 1I1YB 3GJFB 1F13A 4FRWA 3S6CA 3IKKA 4XVTH 4Z95H 5H37G 3V52L 4X6FB 2CD0A 1AD0A 1CD9B 1R5WA 2XFXA 5EB9A 1CIUA 3QCUL 4PJXF 4Z7WF 5FA4A 3FZUC 2OP4H 4P3WA 1LO5B 8CGTA 5J06A 2B2XH 5I75B 1OCWL 1GPOL 4RGNE 4JDZB 2EH7H 5T3ZD 5GRZA 1NDGA 1XCTB 5TH2B 1QVOA 4MVBD 5JZ7D 1KJVB 1U58B 2OM5A 4M6ML 4UZGA 4QHNA 4HKXB 4P4RA 3JTTB 3LKQA 4HIHA 3A6CH 1U8QA 3IJHB 2ITDA 4KJWC 4NN7C 4NT6B 3EDDA 2EIZB 4PJGF 4PJ9A 4B7LA 1ZS8A 1NMAH 4OD2A 4XNXH 1DANU 3QP3A 5SV4A 4F7PA 2FH6A 4R97C 1H5BC 3VFGL 1VB9A 1I7UA 5KSBB 5HTSA 4F15B 3RKDC 1V8HA 2I9LB 2XY2A 5HYSB 1D5BB 4ONOA 5DJYB 2GTWA 2DQDL 4YBLB 3VXNB 2NY5L 1KPVA 1QO3B 4XCYA 3Q5YA 4PV8A 3RL1B 4PTTB 1IAMA 2FX9H 3I75B 1G7LB 2G60L 4DFIA 4HGKC 4JAMB 4XC1L 2RIKA 1JHKH 1OF2A 5F6HJ 3BAEH 3VD4A 5IM7B 3W82A 1CL7L 5DMGD 3HS0A 2GYSA 4UAOB 1G7JB 5B38G 4K23L 4M43L 2ZSWA 5JW3L 3SE3A 1RULH 1A6UH 1TJIH 4G9DB 4JB9L 4WW2C 3VG0H 1JGEB 1RIUH 4WFFE 4UB0L 3PP4L 4MNHA 1BQHA 2PNDA 4CRPA 4LSVL 4D0DA 1RK0B 4ZSOA 4FQXB 4RISL 5ADOL 1MRFL 5L7XL 2ORBL 3ZDZE 5IV2B 3H3KA 3U4BH 3E3QE 1B0GA 2AGJL 1HHJA 5FGBC 5C8JA 5E99H 5FYJE 5I1GL 4NO2A 4L29B 3I85A 4M5YL 2H2SC 3GSWB 2YKLL 1RUQH 1MJ8L 1CG9A 1UXSB 4IRSD 4KRPC 4D0CA 4DWHA 3FFCA 1FJ1A 3MRIB 2H3NA 3Q48A 2LU7A 2VDMH 4P99A 1A7NH 1MHHB 3E6HA 3SDXF 1YQVH 3S34L 2XZAL 4EXPX 1F6FB 5L88H 2A0LC 4GLRH 3SKJL 1ACYH 5TJWK 3DHMA 5GRUH 2R2HB 4ODUB 4S1SH 4HLJA 1U93A 4XXDB 3WFZA 1QBMH 2F54D 3LV3A 4FQIH 1EUUA 1T22B 4PJCA 2Z31B 4ZUWB 4PTUA 5I15H 4EI6B 1KCVL 3N50A 3MGOA 5IMKA 3CX5K 2GQHA 3MRFA 5F7DA 5HGHA 4APQD 5C0JA 3AM8A 2BRQA 3MACH 2MPAL 5DSCB 5EOCJ 1X9QA 4Q58C 1LO3L 4ZSOE 4L8SA 4AENA 5INDA 3HI5H 1MI5B 4ZMAT 5I0DA 2G9HB 4NPYB 3S5LA 4Y16D 4XP9L 1AQDA 5I74B 3L5IA 4ODTL 2ICWJ 2NX5D 3C60A 1BBJB 3BGFC 3LKPA 3ARFA 4G7YH 2Y07L 4HS8H 3ARBA 2IMMA 3DWTA 5AD0B 3FFCE 1XGYH 4N0CC 3BPOC 3FTGB 2OL3H 3GI8L 5E9DB 3L6FA 1B4JL 1P4BL 1LQSR 3VWJD 1MEXH 3T0DA 2VXTL 5J1AA 2CKNA 1JUFA 4OCRH 1LD9B 5CBAA 4RRPA 3VXUA 5CP7B 3QI9B 2NW2B 5GIRB 4CDHA 2EYSB 3P9MB 1BFVL 1G0YR 4EN3B 5DMIH 3PIQB 4PJIA 1DN0B 2BERA 2GITB 1CFTB 1DL7H 4XNYL 4FS0A 1P1ZA 4NNPL 4PJCE 1A1OA 4JPIB 2CIKB 1U3HA 3D39D 1NCTA 5BVPL 1I1AB 1OP3K 4R90H 3MFFB 4LGPB 2YR3A 4PRAA 2J4WL 4I0PB 1ZHKA 3BWAA 4OUUA 4RDQG 2X4OA 5HJ3A 5F88B 4DZBA 4HW6A 3UJJH 32C2A 3C5ZC 1I3RB 2UV3A 5E2VH 1Y0LB 1KTRL 3LH2H 1IE5A 1KC5H 4JY6A 3KJ6L 3TA3B 1TQCC 3DXAD 3JVGA 1P2CB 3RBSA 2DTSA 4JFPB 3KGRA 1M7DA 1A6TB 4BFIB 2D03L 3GBNH 1QFWM 5BS0B 3SCMA 3WUWA 4X99A 1HHIA 3FQUA 4YHYC 2VC2H 2IBZX 2BMKB 4KZDH 4YDLC 2Y6SD 2YUZA 2P5ED 4K7FA 2IF7A 3BJLA 2DWDA 2A73B 3VXUE 4BFBD 4HIJA 1V7ML 3G5ZA 4XNZC 4FFYL 4PJIE 4X80H 4WV1B 5C7XL 1XFPA 4JDVA 3RNKA 3MNVB 4MLSA 4XCFH 1YEEH 3Q2CA 4K9EC 5BW7C 5IW3A 3WD5H 3CZFA 2QHLA 4LLYA 1U8HA 2OZ4H 4O5LL 2BC4B 3RZWA 4FNLH 4QHLA 1CICB 4RGNB 1NC2A 5EOCL 4PY7A 4MD0A 5E6ID 5K59E 3QQ9D 5LGJA 4KDVA 2BOCA 2ESVA 3O2DH 2L0DA 3FB7B 1CU4H 4S1DD 3FFDB 3IFLH 1TETL 3WLBB 2VERN 3VFUA 5HI4C 1TVBB 4E9LA 4OT1L 5EZJB 4PGEA 2APFA 3RI5K 5IFJA 4LVEA 5HSFA 3KYKH 1K4DB 1LK3H 2YPVH 2XWTA 1MPAL 2DKMA 1AGBA 1QLFA 2EDWA 1JGVH 2Y06H 1WVZA 5CSGA 1KPRB 4ZXBB 4Z78B 4JM2A 3T2PA 1ITCA 2J1KA 1I85C 1UWXH 1YNTA 5IKCA 1N26A 1XR9A 3LS4L 3O9WC 5ILTH 4UU9A 3MRRA 5F7NC 5E03A 1AD0B 3H6JA 1R5WB 2XFXB 5FA4B 3KHQA 4BQ9A 1AR1D 1GCFA 4LU5L 2XICA 4N68A 1F45A 1JGLH 4Y19D 4XB7A 1N4XH 3TT1L 4MSWA 4P59L 1QVOB 2I26N 5TQ0H 2ESVE 1UCBH 1P53A 2ADJA 4QHNB 4ZG1A 1EBAA 2YWYA 4P4RB 3LKQB 4HIHB 1R5IA 1U8QB 3WSQL 2ITDB 2D7MA 4M7LT 4H0IA 5J1SC 4UT9L 2N1KA 4PJ9B 1ZS8B 4NQVA 4F7PB 5T5FL 1BGXH 4GXVL 4LPWA 4LSQL 3BSZH 1YEGH 1N64H 5EC1A 1I7UB 5IB4A 5A3ID 3DI2B 1IFHH 1A3LH 4NQUA 3DPBA 2GTWB 5GJSH 4O00A 5DF0A 3D25A 4JO2L 3LMJH 4OM1H 1KPVB 3O2VL 3O11A 4XCYB 1BEYH 4PV8B 2WZPD 4BUGA 2LTQC 1HIMH 2EDOA 2V2WA 3WO3B 2XZCL 4WCYL 1OF2B 3GSNH 1ZLUH 2BHZA 3PHQA 2VLKD 5CJOL 3HS0B 4FFWD 5GRJH 1FP5A 2SEBA 1OAZL 3QHFL 1RJCA 3PQYA 4MA7L 2ZSWB 43CAA 1ZLWK 2VH5H 3HE6C 3BIKA 3QDMD 2BNQD 4PG2C 2YD1A 3SGKA 3H9YA 4MNHB 4PGDA 3BEVA 1BQHB 5C0FA 1DLFH 4D0DB 4K7PX 4ZSOB 2HFGH 1CZ8H 4QKXB 4IRZH 4Y4FA 4WI4A 3RWFA 1B0GB 3FJTA 1HHJB 4NQTA 2ADFH 5C8JB 3MJ9A 1IGFH 4NO2B 3RKPA 4EI5A 5FYJH 4Y5XC 3CDYA 2P5WD 2YUWA 1N3NA 1CG9B 1BREA 5IR1A 1A9EA 4JDTL 5CFHA 1I8LC 4YIQA 5B3NA 1LK2A 1MRDH 3FFCB 1FJ1B 1BQLL 4GRLD 3KLHD 2H3NB 3RDTC 1Q72H 5D6DC 5ACZB 1LP9A 1FZKA 3E6HB 4IHOA 3QYCA 4N5EC 5AUMA 2Y36H 1J1XL 3G08A 2NZ9C 5IEKA 1CXHA 4MNGA 4MD4A 5GGVL 2X44D 2DQUL 3KJ4C 4KTEL 1U93B 3F5WA 3PV6A 5BMFH 3LV3B 4QHUB 1NQBA 1ZVHA 3GBMH 3G9VA 4PJCB 3PQYE 1TZIA 3TV3H 2FATL 1R3HB 3MGOB 5IMKB 3MRFB 5F7DB 5HGHB 2KH2B 1D9KD 5C0JB 5HDBE 4KJYA 3LQAC 1QR1A 1KJ2H 1JIBA 3VGAC 3CVHH 1IT9L 4L8SB 4GMSH 4MB4A 4AENB 4K3GA 5INDB 4ETQA 3GI9L 3L3GA 3S5LB 1AQDB 2YMXL 5D7KE 4U6XA 5JMRA 2AK4A 1ZT7A 1A5FH 3NA9H 4LDLB 5D72L 5BV7L 3C60B 4Y4HB 3LKPB 3ARFB 1ZT4A 2ARWA 5JIKA 3X3FH 3ARBB 3UTQB 2O61A 4XC3L 3X11A 1KENH 2VDNL 2XZQL 3CH1A 2RFXA 2F5BH 1LP9E 4KDTC 3L6FB 4HQQH 3TVMA 1RUML 5J1AB 3JWOH 2QSCL 3JTSA 1JUFB 3SDDA 1GAFH 3BP6A 3DVIA 3CK0H 5CBAB 2WBJA 1RU9H 3VXUB 4MNGE 2CK0H 5MEND 4PJIB 5DRZA 4XPGH 1P1ZB 1VA9A 1A1OB 1CF8H 2JB5L 1U3HB 5GS2H 1MJUL 4H1LB 1EO5A 4WEUD 4GXUM 4P9HH 1NMCB 2FIRT 5C0AA 1ZHKB 3BWAB 3KVQA 4OUUB 5FGRA 2X4OB 3RP1A 5HJ3B 4L4VD 4DZBB 5D2NA 3LS5H 2BVPB 32C2B 3UJTL 1V3JA 3M1BA 2M1KA 2CLRA 3TBSA 1JTOA 4JY6B 4JG1L 3NCEB 1D5XA 1OP5H 4N0RA 3RVXD 2JJWA 2AK4E 5D4QA 4X9IA 4U3XA 4DKEL 2NMSA 4UILL 1M7DB 3EYFA 2AEPH 4LRIA 2IG2H 3MUGA 4RCAA 3ESVF 3SCMB 3WUWB 4X99B 3EAKA 5HY9A 1HHIB 3FQUB 1NCCL 2B0SL 2WV3A 5FEBA 4Y2DA 4I1NB 4F7TA 2QSQA 2NY1C 4DW2H 2X89D 3O81A 4ZUTA 4PLNC 2BCKA 2HRPL 4Z18A 2R9HD 3WNPA 4K7FB 5IHUL 2DWDB 2QQLH 1T2XA 2O5XH 1P4IH 3PWVA 1I3GL 1J5OL 1W8OA 4HJ0C 4JHBA 3LB6C 3FRUA 5MI0C 2XWJA 4HIJB 3G5ZB 5CLWA 5KBNC 4Q2ZA 2NTSP 3ZT5A 4JDVB 3RNKB 1T20A 1MNUH 5I8CA 3QXTA 3QUMA 4H1LH 3QBTB 5HHOA 5C0AE 4P4KA 3RWCA 3CZFB 4XWOC 4LLYB 1U8HB 4IMLA 3SO3C 5D2NE 5H8DA 1QYGH 2XV6B 1L7IL 3VA2C 4QHLB 4Z7NF 1NC2B 1JK8A 2J8HA 4TSBH 1BIIA 4BQ6A 5LGHH 3EYVA 4MD0B 4PY7B 4G6KH 1IQDA 4FQ1L 2XRAH 4WI5A 5LGJB 2BOCB 2ESVB 5T5NG 3TNNA 1J8HD 1CGTA 2UZYB 2PN5A 4PJEA 2HJKA 2H2PD 1WF5A 2HA1A 3RWHA 3VFUB 2YUXA 3GHBH 4PGEB 4DUVA 5IFJB 1ZT1A 1EMTH 3RA7L 1IEAA 2XWTB 1MCLA 3P0GB 3SGJC 3TIDA 1AGBB 3IXTA 1QLFB 2B1AL 1F3DH 1EZVX 4FFVC 2A9MH 4H20H 4NZRL 4EIZC 2QV2A 4MHHG 4JM2B 4TUOA 2Q3ZA 2IPUK 1G6RL 1HN1A 2ENSA 2ZG3A 1YNTB 5D7JA 1WIPA 5IKCB 4JFQA 4YHML 2DQIL 1XR9B 4UU9B 4IOIA 1MWAL 2EEBA 3MRRB 5SX4I 3VI4E 2HLAA 4LKCA 4LAJH 3ZDYE 1CK0H 1PDKA 2VDPL 5DR5L 2E7MA 1OAYH 1OAKL 5HHOE 1MUJA 4UTAH 1Q38A 4PJAF 3ZKNC 1EO7A 5CJXC 2X9XA 4MSWB 1P6AB 1K6QH 1MQ8A 3OJVC 3N85H 3SKUD 3QUXC 3U46A 4PJEE 1NAMA 5F7EH 2ADJB 4KMLB 3B2VL 2VUYA 1R5IB 4PJBF 5IQ9A 3F7YA 3CSPA 4NQVB 2EDEA 3SBWA 5E00A 5EC1B 3O6MH 5IB4B 1PZ5A 3ULVC 4YFDB 2V2TA 4OM0L 4BKLA 4KK9C 4PV9A 4G3YH 3VH8A 5MEQA 3D25B 2KQNA 3HZYA 3O11B 1OSPH 3R1GH 2JJTC 3A0OA 1PYWA 2DLIA 3CAFA 4OCXH 2MSPA 2V2WB 1UACL 2O5YH 2ZCKH 4X6CF 4ZO9A 3V79C 4F2MA 3PHQB 1CLYH 2CDFB 5EORH 3MA9L 3WJLC 4PJFA 3VXOA 2SEBB 1MAKA 5B4MD 2W1NA 3SPVA 5CZVH 4LVHB 3BDXA 4DAGL 3PQYB 43CAB 3BIKB 4MLIA 4OLVH 4EUPA 2BNRD 1SY6H 3V4PH 1HQ4A 3ETBF 4PGDB 3BEVB 3O4LD 5D1ZD 5C0FB 1YNKH 5I19L 4AM0A 4G9FA 4Y4FB 2CIIA 3RWFB 4NC1C 1LGVA 1MCWM 3MLVH 4EI5B 5LKNA 1BPVA 1NSNL 3HE7C 2ICCA 1N3NB 5F1IA 4ELKA 4ZOAA 3SDAD 5IR1B 1A9EB 4QTIH 4YIQB 1XCQA 1LK2B 4NQCA 3SE9H 3HLAA 4P2OA 4LLVA 1LP9B 4LHUG 1FZKB 4IHOB 1X5AA 2UVEA 5AUMB 1A6VH 1TFHA 2ZCHL 4JRXD 5C2BL 4L9DA 1HDMA 3OSKA 3PWPA 5KZCD 4ONGL 3G08B 5IEKB 2Y5EA 4PRHA 4MNGB 2P45B 1T0MB 2ZUQC 4LL9A 2AABH 3ALXA 3F5WB 3PV6B 2DIJA 4QRRD 4X8XA 4JVPA 1TZIB 1FLRH 4CW1A 3OAZH 4X6DF 5DMKA 2BVEA 4KJYB 4K8RL 1QR1B 5HPOA 4HMDA 5I9QC 4JCMA 4XP1L 4YH6A 4G9FE 4MJ5A 4OJFH 4XVJH 3CLFH 3MLZL 4ETQB 5DHYA 3NZ8A 3L3GB 2DQTH 2GSGA 1X5GA 3MJ9H 4U6XB 2AK4B 1ZT7B 2DAVA 4OFYD 4ENED 3S35H 5BVJA 2DD8H 4XBEL 3QCVH 1ZT4B 1XGUA 1MIEH 3KYNA 4HEPG 4RZCA 1IGML 2O61B 3X11B 1IAII 3QPQC 4NQCE 4F33A 3TC9A 3V6FA 3CH1B 3M8OL 2RFXB 3EFDH 1J0JA 3PGFL 3TVMB 2X2YA 1B0RA 2XQYK 1YY9C 5FCUH 5FM4A 2MTPA 5KJRH 3PWPE 3JTSB 1I9JL 3SDDB 2F5AL 1QLRA 5AYUL 3BP6B 2WBJB 1EEUA 4PRHE 3HHRB 5I71B 5CGMA 3U0TA 1CDYA 3KG5A 4MAYD 4PRBA 5DRZB 2WUCL 4BH8A 5DQJA 2J6EH 4FZ8L 5CEZL 4A6YA 2BJML 5HVHC 5HHPA 3NCJH 2R4RL 5C0AB 2IBBA 1R24A 1G9ML 4JREC 2UZIL 4N1EA 1KV3A 4FOMA 4XP4L 5D2NB 5TDNB 1QFUH 3M1BB 1T3FA 3BKCH 2CLRB 2VNCA 5HHMD 2WLYA 3ROOA 3TBSB 1ODAA 4CVUA 3SO5A 5T3ZE 3V5HA 1N0XL 2AJZA 5DC0A 1CGWA 1D5XB 4LBEA 3AVEA 5E2TH 5K93A 2JJVA 4JFED 1M05A 2EZ0D 3S88H 5I1DA 3EYFB 3T2NH 3GKWL 1T89A 3MUGB 5HY9B 3D0VA 4YHZH 3L5XH 5KVDH 5H37H 2IH1A 4N8CL 4Y2DB 4YC2B 4E42A 4F7TB 1HHHA 1FN4A 1UG9A 4ZUTB 3TO4C 2BCKB 1A3RL 3T0WA 4P46C 1L9MA 6CGTA 1QKZL 4IRSA 5EU7E 1QFPA 3FRUB 5IBUB 2XWJB 3JWDH 5FM8A 4YXKL 4BZ2L 4L3CA 3ZDXF 4XVSL 4Q2ZB 3DX9A 2DKSA 1RI8A 4J3UA 3O2WH 1T20B 4N90E 4G7VH 4M7ZB 3X13A 5I8CB 5T1KD 5F8RC 4HF5L 4OSUL 3QUMB 5FM5O 1VFUA 3T3PE 4WJ5A 5HHOB 4P4KB 5F89A 3RWCB 3FRPA 4IMLB 4JKPL 1FGVL 2EECA 1IGIH 3G6DL 4X6BA 1E4WL 2CJUL 1JK8B 5DGQA 1BIIB 4ERSL 4RWYL 1QRND 3EYVB 2F54A 1GGUA 1OTTC 3EJZD 5CSZA 2MCG1 1IQDB 1MCDA 5IHBA 1CLZL 4L4TD 3TNNB 3NGBB 4PJEB 1OTSC 2HJKB 2N7AA 3U4AA 4AL8L 3LD8C 3RWHB 1B2WH 4APQA 2C1PA 4F9PA 1JPSH 3MJ7A 1ZT1B 1IEAB 3MOAL 3TIDB 1KCSH 3IXTB 2F9BT 3PL6D 2M8XA 4MA1C 3L95A 4Y16A 5E8NA 1G7MA 5EBLA 4LQFH 2R2BA 1V3LA 4ORGA 3VXRD 3F12A 3NAAL 4TUOB 3UYRH 1A14L 2NX5A 3J8F7 5CAYB 3OR6A 1CD8A 4U3HA 5D7JB 4JFQB 1JF5A 2VZ3A 3LZFH 4IOIB 3K4DA 3MXWH 5AZ2L 2HLAB 5TE6L 4LKCB 3U7YL 2LV4A 3VWJA 5TFSL 5FIEA 5CBEA 2QBWA 2HVKA 2JE8A 5BOZG 2OJEA 3MJGX 1KB9K 3ELAT 4NP4H 5F9WB 3WDIA 5GJTL 2GTZA 2NXYD 1MSPA 1YYLL 4NUJA 4O9HL 5ITBL 1G0XA 4YPGA 4NOBA 3D39A 4PJ5E 4HD9A 2IQ9L 2XXCB 3U46B 1NAMB 4U6YA 3CFKA 3L7EA 5GSRA 1IC7H 2JJSA 2IWGA 1K2DA 2X5PA 4WI9A 5F97E 4H88H 5IQ9B 3F7YB 3VGEA 3T0XA 1I7TA 3LIZH 2Q86A 4GBXC 5E00B 1L7TH 2OYPA 1QBLH 3RPIA 1GHFL 1PZ5B 1TVHA 2OTUA 4N5UA 2DL9A 2NX5E 3WLWC 2V2TB 4S0SD 3WIHL 3P0YH 3SOBL 3UTSD 1S3KL 3FO0H 4PV9B 3K74B 3EHBC 3VH8B 5MEQB 1KYOK 3Q6GH 5I16A 1IEBA 3HZYB 2UUDH 3DIFA 4LOUC 5AWNH 4NZTL 1F8TH 2P5EA 1BOYA 1PYWB 5I1HH 2AJVH 5C09D 3RGVD 1B6UA 5DFVD 4F2MB 1GGBH 1MAML 2C1OA 4PJFB 1MCSA 3IS1X 3VXOB 5E24E 3OKDA 3NA4A 3ZMRA 3MRNA 4NJAL 5I75C 25C8H 2H41A 3D39E 3SHSA 4EQ2A 4WUUD 4EUPB 4KHTH 1JPTH 2XIDA 2ICEA 5IBLD 1HQ4B 2E27L 3OKNA 2F8OA 2WANA 1K9TA 4AM0B 4P5KA 4G9FB 1M4KA 2CIIB 4K2UL 3DXAE 4KPHL 4KY1H 5E6IA 3H9HA 1RURL 5E4EB 4GS7C 4P5TD 4AEIH 4GW5A 5F1IB 4ELKB 4PGBA 1IVLA 2NR6D 1XCQB 3NH7H 4KKAD 1FH5H 4NQCB 1ZANH 3MA7A 3MLXH 3HLAB 4P2OB 4LLVB 3IVKA 2B7DT 4UQ3A 2P5EE 4WO4D 1ITBB 1MCPL 3EDKA 3QNZA 3WFDL 1HDMB 3PWPB 4YFLF 4Q6IC 3X3GH 1TPXC 2VDRH 4PRHB 4WEBL 5IT2H 2G75A 4IIQC 5JXAH 4KI1A 3P11H 2AJ3A 2HG5A 2LE9A 5FOBA 5T1DH 4EOWH 2CKBH 1U8IA 3SKMA 2ZSVA 5EZIH 5JIIA 3OHXA 4CW1B 2HT3D 1FFPA 3GMQA 4PB0H 3DV4A 4J23A 1IBGH 5DMKB 2GJJA 5A43C 1MCRA 1KEGL 5SWSD 5DUPH 1IL1A 2LABA 1AXIB 2M2DA 3EOTH 4KKLC 4QO1A 5D71H 3KPSD 4NQED 3QHZL 4MJ5B 4UIKL 2D7TH 1YMHA 5DHYB 1KLUA 3NZ8B 2Z4QA 4RMSA 2GSGB 5DMYA 1R3KA 4X9FA 4FQXC 2VZ1A 5BVJB 1FDLL 4XPHL 5K9JH 3C5JA 3VGGA 1XGUB 3KYNB 4RZCB 3JV0A 3L3OA 3EYQD 3K2UL 3ES6A 1R3LA 3U9PH 3QQ3A 1U8LA 3CIQA 4QRUA 4F33B 5E2WL 5FHBL 3V6FB 2DKUA 3L5HA 35C8H 1NL0H 4RGMC 3TWCL 5I76A 1A9BA 4K9EL 1B0RB 5I1CL 4CU7A 1QLRB 12E8L 4OLZL 4UTBL 3U0TB 5FGCE 4CAGA 2LVEA 4KRMB 1S5IH 3MGAA 4PRBB 2O26U 2W38A 4BH8B 5DQJB 2I60L 1QNZH 4EKXA 4A6YB 3TYGH 3MV9D 5D5MF 1R24B 1X5LA 4JG0L 2Y25A 3QZWA 1K8IA 1DUZA 5EPMA 1CXEA 3S4SG 2WMPA 3DI3B 1T3FB 1GOGA 4MXWL 4Y19E 3ROOB 2E6JA 2V5MA 2VLKA 5GZOD 3V5HB 2AJZB 3D2UD 1FYHB 3EOYG 4LBEB 5EOQL 2ZPKL 1M05B 1H3PH 5I1DB 4YXHH 3QDMA 2BNQA 1DEDA 2AXHA 5F9OL 5CHNA 3D0VB 5I74C 1DFBH 3ARRA 4FG6D 2IH1B 4E42B 1HHHB 1FN4B 4Q9BA 2HT4D 4J4PC 3OG6B 2LU4A 2UVFA 4QWWC 2JTDA 3QWQB 2P5WA 1KFAH 3HRPA 3H3BC 4OZFA 4IRSB 1WEJL 4NC0B 4OI8A 4J3WA 4L3CB 3EJYD 5DA4A 1S5HA 3DX9B 3HZMA 4LRNH 3HFML 4OLWH 43C9A 4GRLA 5CUSH 3T3ME 3X13B 3PG2A 5EN2A 1GOFA 2CQVA 3U82B 1JTTA 4WJ5B 5F89B 3LPGA 1CT8A 4UV7L 3D0LA 1JRHH 2R29H 3UZEA 4X6BB 1T7YA 4I0PC 5JW4R 4F7CA 2WWKT 1A2YA 2IALA 5HYIA 4LLUA 2F54B 5CSZB 4WTZA 1WC7A 4XZUA 3LKNA 3AS2A 3QDME 2BNQE 1JYVA 3AREC 1IKNA 1OL0A 4APQB 2C1PB 1D9KA 4ODXA 4P57A 5I6XB 1DSFH 3MJ7B 4JR9H 1FL3A 1DBKH 4EZMA 3IDXL 2YN3A 1S9XA 3L95B 3E8UL 1L6ZA 3NN8A 4DEPB 4Y16B 3K4ZA 1J0KA 5GZNC 5E8NB 1G7MB 1T7VA 2JB6A 2R2BB 5EBLB 4ORGB 2P5WE 1TENA 4IMKA 3F12B 5EUKB 5ALBH 5K9OA 2NX5B 3F8UB 3OR6B 4IOFC 1BAFL 3QIWC 2VTFA 4QGYA 4ETYA 3CUPA 3VWJB 4UT6H 1BJ1J 1IRAY 5CBEB 4AH2A 1J11A 2HVKB 5DS8A 4B53A 4M62L 2OJEB 4OQTA 2WQRA 5D8JL 5LBSH 5JW4Q 4M93B 3RVWD 3QB7C 4MXVF 3CXDH 4CVWA 5MENA 3HNSH 3LPWA 1YPZA 3OAYK 3PWJA 4NUJB 3BD5A 3Q3GB 3HMXA 4YPGB 3OPZH 4HZLA 3D39B 1HCVA 2NY4D 1HYRC 4U6YB 1CR9L 3QCTH 3T0VA 2ERJB 4X5WA 5I1JH 2F19L 3CFKB 5GGQL 3L7EB 5GSRB 4CKVX 4L4VA 1K2DB 4LPCA 2O5ZL 3GO1L 3OGCA 2AEQL 4AEHL 1I7TB 4M1CC 4X6EA 3HC4L 2X4PA 3DX7A 5DZOA 2Q86B 3DXAB 5DZLA 4UBDC 1W72H 1CGUA 5CD3A 3RPIB 4G8EA 4C59B 1TVHB 2OTUB 1SEQL 2FEDD 1NCAH 4KROD 4L8DA 1WAAF 3CVIH 3INUL 3U1SL 1IEBB 3OKOA 5I16B 2FB4H 3DIFB 4DK3A 3G5YA 2X89A 2P5EB 2J12B 3NFSH 4OCYL 3RIAK 1IJ9A 4XPBH 2VR9A 2H1PL 5MERA 3LQAL 3TF7C 5A2KH 1ROWA 1YMME 5IQ7L 1JYNA 3O8XC 2C1OB 5MENE 4R0LA 2W0KA 3OKDB 1MCNA 3MRNB 1A02N 4NJ9H 2MCPL 4EBQH 1TTGA 2VDOL 5IB1A 4TUJA 5LGKA 2ICEB 3RY4A 1HHKA 5EDXA 3B8SA 4L4VE 4K3EL 3BN9D 1R0AH 3OKNB 4WI6A 3VFOA 4DOHE 1P84J 4P5KB 4AYFA 2ADIA 3MX0A 4KHXL 4LKXA 1Q9OA 1JZ7A 2Z91A 1YEFL 2Q7YA 5E6IB 3H9HB 3IFPA 4L1DA 2ARJA 4Z7NE 1J8HA 3EO9H 4GW5B 4YDJA 1P5VA 4PGBB 5TE4L 3MA7B 3A6BH 4KTDH 4F8QA 5ESAA 3IVKB 4NO3A 3F7VA 2OQJA 1NC4D 3O6FC 4HXAH 3U7WH 3ZKMD 1NCWH 1GGCH 1A0QH 2NW3A 4UQ3B 4QGTA 4ZAKD 3QNZB 1YUHA 1DTUA 4CVXA 2G75B 5DHXB 5FGCB 3S36L 2VXQH 3PDGA 1MFDL 2AJ3B 2HG5B 1MOEA 5FOBB 5F71A 3KPRD 1U8IB 4KRNA 4TNVK 3SKMB 1C1EL 3CZJA 2ZSVB 3OHXB 1FFPB 1IM3A 3GMQB 2BHYA 3Q1SL 3DV4B 5CWSA 1CDCA 4Z5RA 3CFCL 1FO0A 2NZIA 3MMEA 1RUAL 1O5DT 3WFHA 1IL1B 4KU1A 4Z0BL 3IFNH 3HZKA 1YMHB 1NUFA 4YHOL 1KLUB 4TSAL 2Z4QB 5ISZD 4X6CA 5GRWA 2JK5A 1MHEA 1R3KB 4M7LH 5E56A 1J8HE 4LARH 2Z93A 2EDKA 5C07D 3C5JB 4F8TA 3L3OB 3LRGA 1WIUA 3ES6B 1R3LB 3QQ3B 1U8LB 4QRUB 5INCA 1G0DA 1FIGH 2CRYA 4NM4H 1G6VK 5I76B 1F00I 4S1RH 4X83A 1A9BB 4I18C 4TSCH 3PXJA 1FSKC 3VFPA 4Q9QL 3WEXA 5IWLA 3QIUA 4ZO7A 4D9QD 4AIXA 4PJBE 2OJZL 3UBXG 4BA8A 3TZVD 3WFBL 3JWOC 3MPCA 2QJDA 4HC1L 2DQCL 4FQJL 3IU4H 3H42H 3BZDA 1QPPA 4ZFGL 4LEOA 1NCUA 2IFFL 1CS6A 1JNLH 4NKIH 2WLZA 3QZWB 5JXED 4KZEL 2VXUL 1K8IB 2EYRB 3TIEA 1DUZB 4ALAL 4GUPA 5EPMB 2FD6H 4X8JA 4P9HC 3RVVC 3SQOL 4B5EA 2VLKB 5I1KH 3AM8C 1TITA 4D0BA 2NY3D 2V17H 4X6CE 2BY0A 2J8OA 4BFGA 3C6LC 4OCWH 3I02A 4K8RD 4KVNL 3SDYH 4AG4H 4M6NL 1YC8A 3QDMB 2BNQB 2VJXA 3HNTH 3MRBA 4HWNA 1LO2H 1EEYA 4KUCF 1C5CH 2BNRA 3G5VA 5CHNB 5E8OA 3O4LA 4ODWA 5D1ZA 2HLFC 1P7QD 1MHPH 4Y4HC 4X7SH 2B1HH 3CCHA 1FRGL 1JNNH 2P5WB 4ZQKA 4OZFB 3SDAA 3FT4A 1EO8L 1S5HB 3HZMB 43C9B 4GRLB 1WFOA 1F97A 3DUUA 3BKMH 3MODL 1YEJH 1ZTXL 1S7SA 1RK1A 3OKKA 5EN2B 1Z0MA 4JO1H 1X5YA 4O2FA 5CCKL 5GS0L 2HKHH 4J6RH 2R69L 3QPXH 3GB7B 1DQLH 3DRTA 3U30C 1CT8B 5DK0A 1ADQL 3UC0L 3D0LB 4HUNB 2Y72A 4CDGC 5CEZD 4JPKL 4U1IA 1GIGH 3T0ED 3O0RH 1W0YT 4F7CB 1A2YB 2IALB 4O4YH 4LLUB 1SYSA 3VFSA 3DETC 1CFVH 5KTEH 4TVPH 4D9LL 1WC7B 4XZUB 3LKNB 2BDNH 1RZGA 3SE4C 3ULVL 1RZFL 3G9AB 2BNRE 3V5DA 1D9KB 2ATPA 3IRPX 3IKCA 4ODXB 4P57B 1SQ2N 1WTGT 5DO2C 1EVTC 1J1OH 2HFFA 1FL3B 1RFDL 4EVNA 3LHPH 2MJWA 2NY7H 4HFUH 4EQ3A 4C56E 1S9XB 3NN8B 3I50L 4ONHA 4XAWL 2JB6B 1OW0C 4G8GD 5JQ6L 4OFYA 5K9OB 1U9KA 1PG7X 1SVZA 4J3VA 2YRPA 1DP0A 4AMKL 2WQ8A 4MD5A 3QIBD 1TJGH 3CUPB 1LDSA 1IGTA 5I8OH 4JRXE 4AH2B 5DS8B 3N1GC 1E4KA 2R4SL 3ZKQD 5DJXA 2A83A 2RR3A 2DMBA 3PUCA 1A7PH 4XRCA 4GOSA 5MENB 4MAYA 1YPZB 1Q0XL 3PWJB 4ZTOH 4QRRE 5I30H 1QLEH 4HZLB 5B38A 1CWVA 3K2MC 4KJWD 5GGTL 3TCLA 3DJ9A 2DMCA 3BPLB 5F7UA 4JRYA 1T4KA 4X5WB 3I2CL 4OKDA 1DQDL 3RY6C 4DGIL 1TXKA 4YE4L 4L4VB 3OKMA 4XPAH 3OGCB 4ODSL 4YWGL 1BQUA 4DOHB 2FX8H 1RIVH 1X5FA 1UEYA 1C08A 4X6EB 5KSAC 2X4PB 3HNVL 3DX7B 3HC3L 3HB3C 3VG9B 1DBBH 1UC6A 4GKOA 5CD3B 4TOYL 4G8EB 1DQML 1Q1JL 1I7ZA 4JFEA 5EA0H 4MAUL 2GIYA 2K1MA 4OZGA 3BE1H 4L8DB 4OIIH 4JM2C 1BZ9A 3OKOB 3G5YB 1TQBB 5DQDL 1CL7I 1ULVA 2AVGA 1DLHA 1TZGL 3F58H 4U6TA 2JELH 1W2KT 4DQOL 2YRZA 3FO1A 5MERB 4PY8I 3U48A 2DQGL 4P23A 3QQ4A 4R0LB 5JIPA 2V5TA 4G6JL 1JYWA 2VDQH 2C3WA 4UNTA 4G5ZH 4LASH 2V6HA 4Y5VC 5T1KA 3ZDXE 1CFSA 3QDJA 1IC5L 5J3HC 3MLUH 2JF1A 3MBXL 3LEVL 4TUJB 5IB1B 1HHKB 1JNHA 4NFDA 3DURB 3IDIA 4OTXH 2ZCLH 1Z9OA 5HHME 3BRFA 1IAIM 1OB1A 2H2SD 2X7LB 2ADIB 4LKXB 4XX1E 1Q9OB 4WY7H 5HDLA 2Q7YB 2DN7A 2E9JA 3IFPB 2ARJB 4LCCC 4HWBL 4JCLA 1J8HB 4KQ4H 4LK4A 4R4FH 4JFEE 3ZHKA 1KCLA 3GNML 4JN1H 4OZGE 1MCWW 4X9GA 4IDJL 3ALPA 1JGUL 2HVJA 5ESAB 3VRLF 4DVBA 3REWA 4NO3B 3F7VB 2OQJB 2X4UA 2A0LD 4MB3A 5GS1A 4LDOB 3PL6A 4XMPH 2NW3B 2VN7A 5D93B 1CFQA 1YUHB 4GT7A 4PJBB 4CVXB 3VXRA 1HHGA 4HPOL 2VSDA 2C4FT 4KVCH 4ZYKA 2G5RA 3C2SA 3BKJL 5L0QB 3TJEH 3MXVH 2CXGA 1IM3B 5CWSB 2DM2A 4Z5RB 1FO0B 3MMEB 3MQIA 2KDGA 3WFHB 3P73A 2KBGA 3VDCA 1S9VA 3GGWA 1SM3L 2CDGA 1NANH 2ZG1A 2CO7B 3B9KC 5C08D 4JEGB 1GC1H 1M6OA 1A1MA 3S97C 3HZKB 4U2ZA 5L9DH 1QRNE 4X6CB 2JK5B 1ZGLA 1AO7E 1MHEB 2PTUA 1Z3GH 4L4TE 1T7ZA 4C4KT 5H35A 2VLJD 1BZ7A 2Z93B 4LPVA 2Y7QA 1JF1A 2EDJA 4XBGA 5DVMA 1I1AD 2YK1H 3CU7A 1WJ3A 3VFRA 1XMWA 1F4XL 5INCB 2FEEL 4KK8C 4TNWK 3NABH 5ENWA 1EERB 4PJDA 3VFPB 3WEXB 4Q9RL 1AI1L 2ZJSL 1JZ5A 3VXRE 1VKXA 3RTQC 2GEEA 3KXFD 3UTSA 3AS0A 4Q7DA 3TN0C 2FYYA 4KI5F 4LEOB 1OVZA 3MYZA 4NQDA 3EYSH 4PJ8C 3C5ZD 4MS8D 1XF1A 4OF8A 4U0RC 1FO0H 3TIEB 3VRIA 1MF2H 4ZS6C 5C09A 3AB0C 3RGVA 1IEHA 4GUPB 3WN5C 1MCOH 4KKBC 3WHE1 4X8JB 1MREL 5T33L 3L3HA 1FNSL 1FNFA 5ECJE 3NIFE 4XP5H 4D0BB 4MA3A 1KLFA 4EXKA 3ARUA 1YYML 4Z8FH 1C16A 1YEIL 2Z8VC 3HUJA 4ZTPH 3I02B 5GRVK 3QEGL 2IMNA 4WUUA 3V0WL 2FX7H 4TPRH 3U7AA 3ZO0A 3MRBB 1EEYB 2BNRB 2R0ZL 3UO1L 1U8PA 3G5VB 3RFZC 5E8OB 3O4LB 1PLGH 4ODWB 5D1ZB 3D9AH 2DQEH 4DGVL 3T77A 1UWEL 3H9SD 1GGTA 4LPUA 4PJDE 2YN5A 3CCHB 4ZFFA 1CICD 3MOBH 4TUKH 4Z95L 1OAXH 5ETUA 4ACPA 2QQQA 1NMBL 4ZQKB 4JFYA 5TE7H 4W6YB 1ZVYA 3SDAB 1E6JL 3TVMC 2I07A 3FT4B 3UTSE 1ND0A 2OP4L 3DUUB 3JWDC 2GJ6E 1S7SB 1RK1B 3OKKB 4R8WL 3W81A 4O2FB 2FGZA 3HAEA 4FN0A 2EH7L 3GUTA 4WO4A 4KV5F 3DRTB 1KB5H 5KZCB 5C09E 1EUTA 2N56A 2E9WA 5DK0B 4QF1A 4UV4L 2AAVA 1VEOA 4U1IB 3N1QC 4Y5YC 2CK2A 5ADPH 1SYSB 3A6CL 4HIXH 5C0NC 3VFSB 5J11B 4PJ7A 4I4WA 2VMFA 3LEYH 4HK0A 4WUUE 1KJ3L 1KACB 4WRLA 4XNXL 1RZGB 4CN6A 3V5DB 2ATPB 1GPOH 3OG4B 3IKCB 4NC2B 1NGZA 2HFFB 4HBCH 4XP6L 5D5MA 5SWSA 4EVNB 4NM8L 3D48R 4OD3H 3R4DA 3KPSA 3WMSA 2D0FA 4NQEA 4LHJB 4LEXH 1AGCA 4ONHB 4YC2C 4Y2DC 4JZJA 2J88H 2PTVA 4XTRC 5HYSG 3O9WD 2X4SA 3BGMA 5E70A 5T1LD 2MQ3A 3QNYA 3IU3A 3JSSA 1JHKL 4ISVA 5C9KA 1WT5C 2NCMA 1PKOA 1ZOXA 4WHDA 4OGYH 3UP1A 1WWBX 1E4JA 5DJ2A 4D2NA 4KKCC 3SGDI 5DJXB 5LWYL 1TJIL 2A83B 3VG0L 1G1YA 3V0AC 2Z92A 1RIUL 4MAYB 4WVRA 1CFNA 5GHWL 3OKEA 4CVZA 1X6NA 2YZ1A 3IGAA 4DCQA 2G60H 3FO9A 5B38B 3MV9A 5D96B 3TCLB 1QOKA 3U4BL 4JQXA 1T4KB 4YDIH 5E99L 3OKMB 5SWSE 5D5ME 3T0BA 1EA9C 1RUQL 5HHMB 3KPSE 3ULUL 3ARDD 2R0KH 2YWZA 4NQEE 4EJ1C 1C08B 1YDPA 3ZSSA 1T0PB 1I8KA 3STBA 4UB0H 2OCFD 1LVEA 3OV6A 5IB3B 1I7ZB 2VDML 4JFEB 3CJJA 1HEZA 1A7NL 1S7TA 1Z9LA 3KS0J 4LSVH 4R2GD 1YQVL 5DURB 4OZGB 5ADOH 5L88L 1MRFH 5L7XH 2D9CA 1XF5A 1H3VA 5D7LD 4M6AA 2AGJH 1W0WB 1BZ9B 4KMTH 4BQ8A 5GRUL 3ZDZF 5GRVL 3IFOB 4M5YH 1SBSL 4Y7MA 5L8KB 4LDEB 1AP2A 4DN3L 1DLHB 3RZCA 4FQIL 1RVFH 3ZHDA 1BHGA 1EJOL 5LQBH 1I8IA 3F7PC 4TVSa 2FRGP 3MV8E 4U1KA 4W4OA 4P23B 3QQ4B 2EDNA 3G6JF 3HE6D 3IAPA 2IQAA 2XZAH 3HR5A 5T1KB 2PW2A 5FF6A 1CFSB 3QDJB 3MV9E 1B9ZA 4XGZA 2YA1A 5IW1A 1JNHB 5BQ7A 4HV8A 4GMTH 3IDIB 7FABL 2VZUA 3CXHJ 2FO4A 4ZUSA 1OB1B 4G7YL 2C3GA 4J2XA 1KCVH 5DVNA 4MQ7A 1XGYL 4L4TB 2OL3L 3VFWA 3EDEA 5DJCA 4K3DH 1RV6X 2D9QB 3FB5A 3RDTD 2GKIA 3O41A 4NIKB 1FBIH 2HVJB 4LCIH 4N5ED 2APVA 4DVBB 3REWB 2X4UB 1QBAA 2OI9B 6FABH 5GS1B 1LEIA 3PL6B 5DMIL 4ODTH 2NZ9D 2F58H 1CFQB 4OGAD 4MJ6A 4LCYA 2Y07H 1CYGA 4LLMA 3FOMA 3VXRB 1XIWD 1HHGB 4R90L 3CSYA 3QDGD 1RUKH 2Q8AL 3HN3A 4Z6AT 5A2IH 3C60D 2VXTH 4ZYKB 1ONQA 3UJJL 5FO8A 1IGYA 2C4XA 3ZYOA 2VZOA 5E2VL 2YHGA 2XYCA 3LH2L 2E5EA 4IJ3C 3KAAA 2Z35A 1WAAA 3P73B 1S9VB 2VB5A 3GGWB 5DD6A 2CDGB 4HPYH 4NNPH 1M6OB 2IFGA 5BVPH 4P5MA 1A1MB 2NXYB 3IB4A 1ZGLB 5HD8C 1ZLUK 1MCBA 4OFVA 5H35B 1BZ7B 2VC2L 4HUMB 3GSVA 4YGVA 2Y7QB 1JF1B 5MP6L 4XBGB 4QRPD 1U3HD 2X4TA 5E4EC 3CMOH 3VFRB 4QRQB 2XKUA 4U1JA 5DEZA 1PW3A 5ENWB 2W9LA 1XGQB 3QUYC 4F80A 4X80L 4PJDB 5KN5A 3BESR 3C6SA 5E8PA 4P2OC 3DGGA 4XCFL 1YEEL 2IBGA 1VKXB 3TJHC 4HCRA 2YSSA 3WD5L 3UTSB 2IPTH 1EHXA 2OZ4L 1INDH 2FYYB 1HKFA 4FNLL 1V3KA 1TJHH 2EE6A 3FQTA 4PRPD 1G6RA 1WAAE 4PGJA 2H32H 1V7MH 3VRIB 5C09B 3RGVB 3WNKA 1D5IH 1CU4L 4X4XA 4AZ8A 1MWAA 3L3HB 3IFLL 4I8DA 1NGYA 1IC4H 1L6XA 4PJIF 5JHDE 1MRCH 5FUCC 4MA3B 1C16B 3KYKL 1A6ZA 1LK3L 2YPVL 1WBZA 4O5LH 4WUUB 2V9RA 1CVSC 3VRJA 3I3BA 1JGVL 1NBYA 5DVOA 4QXUL 2NY1D 1U8PB 5EOCH 4C4KO 4MJID 4CL7A 5DK2A 5F8QC 3T08A 1EAPA 1AKJD 4HGMA 3T77B 5K59F 4HJ0D 3LB6D 4Z9KB 4ZFFB 5ILTL 5ETUB 4XMLH 4JFYB 3WKNA 3VDBA 3REVA 4YDKL 1T5WA 5DLMH 2I07B 1MPAH 5F96L 1ND0B 3ARXA 3C08H 3K1DA 5EU7C 2AK1H 4UMGA 1NC4A 1JGLL 3KLDA 2WUBH 1KJMA 1N4XL 2OXGA 3HAEB 5HGGS 3GUTB 3QUKA 1MJ7L 4WO4B 4ZAKA 2LU3A 3RIFK 3GHEH 2P43B 4QF1B 2DLEA 3TEUA 5LXGH 4Y8DC 1IZJA 3KPRA 4PJ7B 1UKQA 3F7RA 1UH2A 2J5LB 2XG4A 4QYOA 4I4WB 5TF1H 4QHMA 5B3JF 5T3XL 1HNFA 3ZYZA 5FYKL 4DUWA 3ZKXC 5DI8A 3PF2A 1NGZB 3BSZL 1CXFA 1N64L 4JZOA 5SWSB 5KW9L 1FCCA 1OWWA 1EHAA 5D5MB 1OP9A 2BP3A 4FFVD 3STLA 4WFGD 5I1LA 4N8PA 3R06A 4P2CG 1IFHL 3KPSB 2EE2A 3S37L 1T89C 4NQEB 2RHEA 1A3LL 1FVCA 2IGFH 3MBEA 5ISZA 1AGCB 1X6LA 5GJSL 4JZJB 3LMJL 3QDHA 1BEYL 2X4SB 3BGMB 3LAFA 4XH2A 1KULA 3EYOA 4GXVH 3QNYB 3IU3B 1TCMA 4ISVB 2GT9A 3GSNL 3ZKND 3E2HC 1J0IA 2CUHA 2IEPA 5DJ2B 2B4CH 3QFJD 2C4FU 2VH5L 4YBQC 4GRMA 4BM7A 2Z92B 1ZSDA 7CGTA 5GS0D 2FR4A 1CFNB 3OKEB 1RD6A 3KPRE 4L3AA 2EICA 1G1CA 4CVZB 1DLFL 3IGAB 4DCQB 3FO9B 1AY1H 4GRWB 1Z2KA 2AEWA 2HFGL 3MV9B 1CZ8L 4WCYH 4IRZL 1BQHG 5JXEA 4MHHI 3RIAF 2ADFL 5CJOH 4J12A 3BVNA 4Y4KC 3S37X 3HA0A 1OAZH 4WI7A 2DICA 2GFBB 4MA7H 3C8DA 4X4YA 2Y1VA 4F9PC 2AV1A 1YDPB 4CBPA 3ULVD 5ISZE 1I8KB 1DBMH 1J87A 4CU6A 1Q72L 1A6PA 1H0DA 4HK3N 1T83C 1HEZB 4GW1A 1S7TB 2YEZA 5C07E 4DEPC 2A2QT 1XF5B 4FQCH 1P7QA 3BH8A 4DGYH 1T80A 3H7LA 1HCFX 4ZPTA 5BV7B 2Z9TA 2DB8A 3BJ91 1AP2B 2FNBA 5BMFL 4JVWA 1QFWH 4JDTH 3GBML 4D9QE 4Q6YA 4XMKH 1W0VA 1I8IB 1HWHB 5FK9A 2NTFA 4U1KB 4Q74A 1WV7T 2RJMA 2QQKL 2IQAB 1J1XH 1KJ2L 3V6OA 2PW2B 5FF6B 3CVHL 4G6ML 2P24A 4GMSL 4M1GH 4XGZB 4JO4H 2Z0BA 5EIVA 2FO1A 4JPVH 1FVDA 5IW1B 1SEBA 5BQ7B 4KTEH 4HV8B 5IROA 1JHTA 3THML 1LE5A 5B8CB 2FCBA 1TCRA 2EIDA 2ERJC 5GQBA 3T0EA 2FO4B 4ZUSB 3AFLA 3S7GA 3W39B 3X3FL 1T1YA 4O2EA 3NVQA 4MQ7B 4IRJC 1KENL 5E5RB 3VFWB 5DJCB 1G9EA 5JLZA 4NN5C 3FB5B 3L7FA 1KIRA 3O41B 3JWOL 3OB0H 3TFKD 2AI0H 1GAFL 1WZLA 3GI9H 3EZ8A 1RU9L 3L1OH 4HG4K 5EIIA 5DHVA 3V4VH 1LEIB 4FABH 1NGXA 5BV7H 4HHAB 4F57L 1A6WH 4XPGL 4MJ6B 4LCYB 4LLMB 4RRPG 1DEEA 3FOMB 4G8GA 5ESQA 3VW3L 5I1EH 1NBQA 3EJJX 2OTWA 4R96A 5I73C 1G9NH 3PWUA 1II4E 3KYAA 5E95B 2VISA 1LP9F 3LS5L 1ONQB 4H1LG 5FO8B 1IGYB 1MY5A 2RB8A 1AQKL 3V6OE 3N1PC 4RA3A 3BOVA 4IM8A 3LPFA 2Z35B 1T0NA 3ECBA 1JI1A 4HG4J 5DD6B 2W0FA 5CEZE 2ZP0T 2JB5H 3T0EE 2AEPL 2IG2L 1HKLL 4P5MB 5F1KC 4DKFH 1SVCP 1IQWL 2YD8A 1ZHNA 2D7NA 4JO3H 1CD0A 2NY4B 4DW2L 3QPQD 3GSVB 4YGVB 1UM6L 3WUWG 2CGRH 4U6VH 1U8JA 4F58L 3JWNC 4NCC2 5E6IC 4AT6A 2O93L 4QT5A 5KAQF 2X4TB 3U0PA 2QQLL 2O5XL 3E1F1 1P4IL 3FO2A 4HJGA 1YY9D 4U1JB 3WNOA 5T1MA 4NBXB 1BJ8A 2NXZC 3BZFA 1CFBA 2BVOA 3W11C 4UILH 5KN5B 3C6SB 1BX2A 2Q1EA 5E8PB 3DGGB 1MNUL 4G8GE 1ZE3C 3GDBA 3V6ZA 2V5RA 2YSSB 1HI6A 2P8LA 5EU5A 4KROB 4XPFH 5EU3A 3MRLA 4OF0A 5GPRA 5IHUH 2A1WL 5E2JA 3K4AA 5DVKA 3RWDA 3NBNA 3FQTB 3Q5OA 1G6RB 5DWUH 5LGHL 4GAFB 2XRAL 3DVGA 4X4XB 1MWAB 1NGYB 4LMQE 1RY7B 2VITA 4L9LC 1K8DA 2A74A 3KPNA 2CSPA 2R2CA 1EMTL 1A6ZB 1IGJA 4CMHC 3EOAA 1WBZB 4PUBH 5JA9A 3QULA 3VRJB 1NBYB 1WSST 4H20L 2A9ML 3PNWA 1Q9LA 3UZQA 3OAZK 5L6YL 4FQ1H 5FGBA 4XXCC 5DK2B 3UTPD 1EAPB 3JV6A 2VR5A 5LAXA 3GSXA 2EDQA 1FG2A 4XNMA 2CUIA 1CK0L 3REVB 2C26A 1T5WB 1O0VA 3RA7H 4UTAL 5KVGH 1NEUA 4YLQT 1NC4B 4NKOA 3RY5A 3WIHA 5E2UH 3QUKB 5HGDA 4J8RA 4ZAKB 4PGZA 4JHAH 2UWEA 3N85L 15C8H 1OTTD 1FFQA 5F7EL 1MWAH 1PD6A 4P2QA 3GRWH 3O3DA 4PREA 1IKFH 1OTSD 5DR5H 2HTKD 3KPRB 3ZDYF 1B90A 2AQ3A 4OFPA 4QYOB 1WUNT 5I1IH 3B5HA 4QHMB 2E8YA 2QKIB 2YA2A 3FQWA 3MFGB 4GG8A 3IDGA 2HWZL 3EGSA 1IAOA 4O58H 1A64A 5DI8B 1H8SA 2EH8L 4JE4B 4JZOB 3O6ML 3RGHA 3STLB 5I1LB 3R06B 4CU8A 4MMZC 1FVCB 1UXWA 2I25N 4G3YL 1F58L 5ISZB 3ARZA 4WUKL 4C54A 4PJEF 3M17A 1X4YA 2IH3A 2VLJA 3SEPA 1OSPL 3R1GL 3O6KH 1E4XH 4X7EC 4XH2B 4OCXL 1FL6A 4JFFD 3EYOB 5E94A 2ZCKL 2O5YL 2GT9B 5E8EA 5EORL 3BZEA 1ZLSH 4W68A 5CZVL 5IVNA 1UZ6F 2UWEE 3DROA 1MI5E 4GRMB 2FHBA 1ZSDB 3KXFA 2VL5A 3FMGH 2FR4B 1SY6L 5ANMA 3V4PL 1EHNA 3TBVA 1G7QA 5ACLA 2CUMA 1UACH 5K9QG 3C5ZA 4L3ED 1CQYA 1QRKA 4POZC 3BVNB 3FN9A 3P9LA 1H3GA 1JWUA 3O3UN 5C08E 2OMNA 3LEXA 4KGJA 4DAGH 4K07A 4X4YB 3HCVA 2AV1B 2NY3B 2QLVB 3WLWD 1A4KA 2IANA 3Q6FA 1H0DB 2VLJE 4GW1B 3EHBD 2HMID 2YEZB 5DFTA 4I3RH 1QA9B 1LO4L 4I5BA 4LOUD 1SMOA 1QZ1A 3BIBX 5SWQA 2ZUVA 1P7QB 3BH8B 3ROLA 4LSUL 2MHAA 4ZPTB 1ORSB 3H9SA 4J3OC 2H26A 5I17A 1W0VB 3QR2A 4HMCA 4PY8J 1FLRL 1OARH 1TDQA 5FK9B 2NTFB 4OQ1A 1VSCA 5BW7A 3NIGE 5C2BH 1OOAA 2XTJB 5FV1L 4Z7UA 2UZXB 3O4OC 4IBLT 2P24B 5DC4B 1DZBA 4OJFL 3LY6A 3CLFL 1FVDB 1SEBB 2DQTL 1JHTB 5BRZD 1LE5B 4O51A 1TCRB 3BPLC 4PJFF 1A7OL 1F90L 1U6AL 2DD8L 3T0EB 3QCVL 4NRXA 1T1YB 4O2EB 2HN7A 2GSIA 1RZIA 4W4NA 3EFDL 5L8JB 5JLZB 2EE3A 2PR4L 2PXYC 4O02L 3ULUD 1BFSA 3L7FB 1KIRB 4XP1H 5FCUL 3VG9C 3F7QA 5KJRL 3RVXC 3MLZH 4D9RD 1RHHA 4JN2A 2AERT 5EIIB 5DHVB 5IMOA 2VQUA 1BVLA 1NGXB 3MLWH 4NN6C 4XBEH 5FO7A 5J13B 4NZUH 2J6EL 4S11A 1DEEB 4G8GB 5ESQB 5CIPA 5DTFA 3IXAB 3NCJL 3O9WA 4KK5D 2OTWB 1QQDA 4HAGA 5TQ2H 3MTRA 4R96B 3KLSA 2XN9D 3PWUB 4M6OL 2HKFH 4GAYB 5T1LA 2VISB 3VXMD 4TNWF 1PQZA 3QIBB 3BKCL 4Z7UE 1I9JH 4OKVA 5AYUH 5CJBA 5E8DL 1N5AA 1AGEA 2UY6A 3MREA 1T0NB 4XCNA 5M94B 4OLYH 1CE6A 3ECBB 3S35X 4P48A 2UUDK 5E2TL 2W0FB 1JHLL 3S88L 5CEZH 2KKQA 3T2NL 1GZPA 2BJMH 5J8OA 3WNLA 2R4RH 3ULUF 3STZA 3L5XL 1GC1C 5KVDL 3T4YA 3UAJC 1ZHNB 1CLOH 4ZFZA 3GJFH 4XP4H 3PWNB 3KYMA 4ONFH 3G6JA 4KDWA 1U8JB 4AT6B 1MY7A 4QT5B 3U0PB 1FE8L 2LQRA 3V4UH 3ARTA 3FO2B 2HJFA 3QJFA 4HJGB 1R5VA 2H2PC 2JLLA 5T1MB 3VMOA 5I2IA 3JWDL 3BZFB 1ZGLM 3ARDA 3QSKB 2BVOB 5EO0A 4WEMB 3ZE0E 3V2AR 1HZHH 1ED3A 3O2WL 1BX2B 2PO6D 3GKWH 4KXZH 5MEPA 2LAGB 5IBUG 4G7VL 1IM9D 3FAXA 2R0LL 2MQCA 5D93C 3V6ZB 5J6GA 4HUVA 1O7VA 1HI6B 1Q0YH 2P8LB 5EU3B 4U1NA 3MRLB 2Z8SA 4OF5A 5D7LA 5IESH 4P2RD 4MB5A 1IGIL 4H0GA 1J8KA 1NKRA 4DTGH 5J9PA 1J0YA 2Q20A 4WHTA 1FG9C 4YXKH 5C1MB 1R3IH 5L0QC 4JFHD 3FQRA 1KN2L 3DVGB 4JY5L 1BECA 3OZ9H 4MX7A 2VITB 4FXKA 4OSUH 1K8DB 4XHQA 3HE6A 2A74B 4OUOA 5FV2A 3KPNB 4X7FC 1IGJB 3T3PF 4JKPH 4X9BA 3WS3A 4F37K 1KCSL 3QULB 3G6JE 3G6DH 3KPQA 4XPTH 4GFTB 1E4WH 4L5FH 4BK4A 4J4PD 3PNWB 1Q9LB 4ERSH 5HYFA 1T6VN 1KGCD 4KC3B 4J1UA 1HQRA 3JV6B 4QWWD 4Y5XA 5LAXB 3IYLW 1F4WH 2GK2A 1ZLVH 3WIIL 3GSXB 4LPTA 1A47A 2FZ3A 1FG2B 2A77H 2XY1A 4XNMB 1ZHBA 2YZ8A 3NCYP 1F2XK 5HHXH 2VXSH 3RDTA 4EDWL 3MOAH 1WCBA 4HIIA 3UTTD 5CGTA 1MH5A 1GH7A 5C0GA 1ZKAA 2GCYA 2V5YA 4NKOB 5CD5C 3ZTJH 3I9GH 1S8DA 5FDWA 3QHTC 2IBZY 3KR3L 3QNXA 4J8RB 5HGDB 1A22B 2UWEB 1K3ZA 2ZOLA 4ZO8A 1XIWA 4PREB 3O3DB 3QDGA 4F3FA 4H5SA 1T5XA 2DL2A 3MUY1 2J2ZA 3ARED 4IOSD 4H88L 3FQWB 4GG8B 3IDGB 3EGSB 1IAOB 1XGRA 3B5GA 3CX5J 4U1LA 2V7NA 1I1FA 3ULSA 4LSRL 4NBYB 1YEHH 5C08B 4NSKA 5GZND 2WNGA 2IQ9H 4HGWA 1UXWB 4GAGH 5CGYC 5DGRA 3BGFB 2XZZA 1H9VA 3M17B 3Q6GL 1C7SA 1UT9A 2IH3B 2VLJB 3BHBA 4N8VA 5E1AA 5AWNL 4KTYA 4QRPA 3VH8G 5I1HL 3DYPA 4KDTA 1LHZA 1FL6B 5E94B 2X40A 2G5BA 4E0RA 4HJJL 5E8EB 2GW5A 2YRLA 3BZEB 3ESUF 3D3VD 3VGDA 3SOBH 4JANA 3DBXA 4HX1A 1WLHA 25C8L 3DROB 2XOTA 1FGNH 4LVNC 3QDGE 4B50A 2ZUXA 3KXFB 2VL5B 4MDJA 5ANMB 2PETA 2EDTA 3TBVB 3MV11 1G7QB 4NNXA 2ENYA 3AROA 3SQBA 1KIQA 5D6CA 1DUYA 4PRPA 3C5ZB 4J3XA 1D6EA 3EYUL 1MAMH 3FHQA 5DRWA 4M1CD 3P9LB 4QNPF 1BOGA 4AEIL 1JWUB 1TQCB 2DM7A 4UBDD 3LEXB 5T3XD 4NDMA 4CADA 3HCVB 5EIQA 3NH7L 1FH5L 2A6KA 5FYKD 1G7PA 4OLEA 3MLXL 1I8MA 1GOHA 1A4KB 1A21A 5DUMH 2XNAA 3Q6FB 4RBPK 2E27H 1PSKH 3MSPA 2FSEA 4XCCH 5L2KD 4JHWH 4YHYB 4I5BB 5SWQB 4ENEC 4MJIA 3ROLB 5IT2L 1FFOA 2MHAB 1UGNA 3B6SA 5JXAL 4RMRA 1AKJA 1VFAA 5T1DL 3BDYL 3BP4A 3H9SB 4QRSA 2CKBL 3BQUD 3TLRA 1UYWH 2H26B 5EBWA 4I9WD 3O8XD 5DUBA 5I17B 4XNZB 5EZIL 3BWUC 3VGBA 4PB0L 3M07A 3SKNA 2P1YA 3QRGL 1IBGL 4BH7A 1PY4A 2CR6A 5HGAA 3U0WH 5DUPL 3EOTL 4Z7UB 1MCJA 4PRPE 1Q9KA 4HC1A 4B0MM 4NNYA 1NUNB 1CGXA 4HDIA 4O51B 3GEWB 5K9JL 4NRXB 3O3BA 2D0HA 4A2LA 2HN7B 2WP3O 2GSIB 3U9PL 1RZIB 4NGHL 2WSKA 4HMEA 2DI9A 3T04D 5TPWH 3O6FD 3V8OA 2EDYA 1EFQA 3SGJA 5B3JE 5F6IC 4UIKH 2XPGA 4O2CA 2EZ0C 1RHHB 3HG1D 4JN2B 1PZUB 4YAQA 5IMOB 1A7RH 1S5IL 1FNAA 4HIEA 5FKPA 1FDLH 3LDBB 3AY4C 4XPHH 3SGEI 5FO7B 3MGTA 1QNZL 3NCFB 4I13B 1MQKL 5KSUA 2BVUA 2EC8A 3TYGL 3VWKD 3MLSL 5CIPB 1NDGB 5DTFB 5GSVA 5E2WH 4JGUA 3O9WB 3QUZC 1QQDB 4LLDA 1DBJH 4NRZA 4JM4H 4UNUA 2B5IC 5T1LB 1MAJA 4U05A 5I1CH 1PAMA 5J12C 5HI3D 12E8H 3DVFA 4PJHF 1N5AB 3OL2A 1AGEB 5SV3A 1QSZA 3MREB 1KNOA 4XCNB 3WXWL 5CJXA 4OD2B 1AFVL 1CE6B 1VGEH 3QFJA 3RUGA 4YEFA 1MLCA 1HNGA 2CR3A 2I60H 4K7PL 1H3PL 4YXHL 1GZPB 2YD6A 1H3TA 3F6IA 3HTLX 3STZB 3T4YB 4QTHA 4U1GC 1ADQA 4ZFZB 1VADA 5ICXA 1BIHA 3KYMB 2FLBT 3G6JB 3EJZC 3BT2L 5D1XD 2QADD 4XVUC 4J7RA 4FXGA 2IJ0C 3QJFB 2HJFB 1R5VB 3WS6C 4AY0A 3ET9F 4FMKA 4WFGE 5I2IB 4PP1C 3ARDB 2ZPKH 5EO0B 1VERA 2X42A 1ED3B 4OLWL 5MEPB 5CUSL 2CMRH 5F9OH 1K5NA 2P4AB 1QFWI 5J6GB 4HUVB 1KTLA 4R2GB 1MIMH 2XQBH 3G5XA 1MVUA 5AYQA 5CJ8A 2HTLC 4LFHD 4U1NB 1J7VR 4LSTL 5D7LB 5F7LB 1JRHL 2JJTA 2LTQB 2HT2C 2R29L 2H6PA 4GAJH 4ZDHA 1SJVA 5J9PB 4WHTB 3FRPG 4C83A 3RVVD 3RX7A 1KN4H 4WFHE 1Y18A 4BZ1L 4OD1L 3WJLA 2NYYC 3FQRB 3QFJE 3RUGE 5I8KH 3C6LD 3C2AH 2HP4A 5J6HA 4MX7B 4FXKB 1ERNA 1MCCA 3T3MF 2A6JA 3HE6B 3VXPA 3N1MC 4D0CB 1HH6A 4JR9L 1INEH 4QXGL 1KBGH 2DQJH 3FOLA 4UV7H 3WS3B 5ERWA 2HLFD 2VN4A 4LCUA 3KPQB 3UBXI 1IGCL 3B9VA 4PD4K 2AXFA 2XA8H 4OIAA 3LRSA 1TNNA 4GH7B 2NY0C 4J1UB 5ALBL 1HQRB 2BX5A 1TIUA 3T1FA 5GGTA 4Y5XB 2Z8WC 2VAJA 3ULVE 2FZ3B 4R26H 4ELMA 2B20A 2ZUTA 1QSED 1ZHBB 3DTXA 3RDTB 3QQNA 4F9LC 4PTUB 1WCBB 4HIIB 4OZIA 3P4OA 1H8OA 3JV5A 1MH5B 5C0GB 1OM3H 3QO0A 5LBSL 2GCYB 4M03A 4NCC1 5CJQH 1S8DB 4RFOL 3JUZA 5FDWB 2MNUA 3QNXB 3H0TA 1NLBH 3NPSC 2ZOLB 3OPZL 1XIWB 3QCTL 3QDGB 4M48H 2MKWA 4JQIH 4YK4B 4F3FB 4H5SB 1T5XB 3BEWA 1AGFA 1SJXA 4Z7QE 3ARGD 5AZEH 3NACH 1YN7A 1JMZA 5D8JH 1JN6A 1JPFA 2R1YA 5DO2D 4HFWA 1XGRB 3VGAB 2MWCA 4U1LB 2V7NB 1I1FB 3ULSB 3H3PL 1W72L 2OR7A 1L9NA 4UNVA 1Q8MA 3MRPA 5KVEH 3BP5A 1NCAL 4NSKB 3B83A 3L3JA 1Y6MR 5IBLC 4I77H 4HGWB 1M71A 3DGCR 2F19H 3CVIL 2FIKA 4BQBA 2FB4L 3BHBB 3CDGA 4N8VB 2BZDA 5E1AB 4WWKD 2AEQH 3OKYA 1G7HA 4QRPB 4OZIE 4AEHH 5GRYA 1NFKA 4P5TC 4PRAB 3ARQA 4XPBL 1X7QA 2YS4A 4HWBA 2G5BB 5JW5A 4E0RB 2NR6C 4KKAC 1INQA 2EXYD 5I66A 4P9MH 1GYAA 4IEFB 3DBXB 4LPYA 1WIOA 4HX1B 4P3CH 3INUH 4EBQL 1N6UA 1AE6L 4MDJB 2B4CC 3MLYH 1R0AL 4NNXB 5LCVH 5EZOL 1S7QA 4K94H 5EU6D 3ZLQC 1KIQB 1MJJA 1NPUA 2H1PH 5D6CB 4G6FD 4PRPB 4KJQC 3SJVD 4HSQA 1BMGA 1D6EB 4PRDA 5DRWB 2HT3C 5KSAD 1BOGB 3EO9L 4Z0XA 3HB3D 1AHWA 1JE6A 4NDMB 1YPZF 4BSWA 4CADB 1XH3A 5CINL 1ZGLP 1WTLA 2B8OT 1RZ7H 4JY4A 2A6KB 1G7PB 2MCPH 4MDIA 2H8PA 2VDOH 3A6BL 4KTDL 4NHCH 4N0YH 1I8MB 2VOTA 5CMAA 4HWEH 2XNAB 1JNJA 4HXAL 3U7WL 5EBMA 2FSEB 3BO8A 1NCWL 3VJ6A 2ARJQ 3KDMA 3QG7H 2NY1B 5BXFA 5HXMA 3SDCC 4JZJC 1YEFH 4MJIB 1FFOB 2IAMC 3ZTNH 3GMRA 1AKJB 1VFAB 3BP4B 4QRSB 5ID1A 5MI0B 5EBWB 2KPNA 5DUBB 5GRXG 2ZUYA 4HK3J 1AIFA 2AW2A 2OR8A 4WTXA 3SKNB 1PFCA 1GJIA 3RRQA 4BH7B 3RHWF 5HGAB 2MOVA 5HVFB 2VR4A 3SO3B 3CC5A 1BJ1H 2X1PA 3KPLA 1Q9KB 3IFNL 4NNYB 2A9NH 4HCRL 3S36H 4UINH 4M7LL 1S78C 4NUGH 4HDIB 4YXLH 4LARL 4R4ND 4RGOH 4JQXC 5D7IA 3FL7A 3O3BB 2EDRA 1EIBA 3RU8H 3Q1SH 3ARVA 1RUAH 3K8KA 5EO1A 4NM4L 4YHPA 5DD3H 4S1RL 4N0FA 5GZOC 4Z0BH 5DJAA 4TSCL 3T1WA 4W81A 2E9IA 3IDYB 2HJLA 2XPGB 1ETZA 1QPXA 4Z7OF 4O2CB 4U1SA 1E4XI 4YAQB 5IFAL 3EIFA 3UTPE 1NLDH 4HIEB 5FKPB 2Q6WA 3IU4L 2AJYL 3MGTB 5C0EA 5E08L 4KAQH 4NKIL 3I6GA 5GSVB 5BV7C 1MFBH 2MFNA 4LLDB 2JIXD 4NRZB 5JQHC 5C6WH 4JFFA 4YUEH 3ISWA 4KQ3H 3UJIH 3L3IA 3QEQD 3EJYC 3QZWG 1G9NC 4W4OC 5I1KL 5KOVC 1KNOB 3B9KD 5A2JH 2V17L 1T1XA 3DUSA 4HC1H 4FQJH 4HBQA 4OCWL 3QFJB 3RUGB 1MLCB 1EH9A 3SDYL 5J57B 4AG4L 3QIUD 3HNTL 1LO2L 1C5CL 1UZ6E 2RCSH 4QTHB 5B8CC 3P0VH 2VXUH 2FEEI 2HFTA 5F70A 5D7KD 1VADB 4X7SL 5ICXB 4JKKA 4M9PA 3UDWC 3SQOH 2KUTA 3NFNA 4L3EA 5J7CC 1N6VA 3HZVA 4FXGB 3NTCH 5BO1H 1JNNL 1VEPA 3RWEA 1MLBA 1TTFA 3RTQD 1P5UA 3BKML 3FB6A 1RQ5A 3TN0D 2DQFA 1K5NB 1YECH 4JO1L 3MCLL 3ZL4H 2HKHL 5FO9A 1KTLB 3QPXL 4QOKA 3QXWA 4V2CB 2EKSA 3G5XB 1DQLL 4NHUA 4PJ8D 3FONA 4JFFE 1BJMA 4PLOB 3VD7A 1BF8A 1DJSA 2H6PB 4ZDHB 1GIGL 3O0RL 1AH1A 4O4YL 4C83B 5EZLA 1Y18B 4TVPL 2X70A 4JFDD 3GMPA 1OGTA 3ZE1E 1KIUA 2BDNL 3MODH 1VPOH 5J6HB 4M02A 4WTZG 2NY2D 3DECA 5GS0H 2A6JB 2R69H 3VXPB 2D3VA 4ZFOL 1HH6B 1D5MA 3FOLB 3LHPL 3TM6A 3UC0H 5ERWB 4JPKH 2NY7L 4JFXA 5IFHH 4L3EE 4LCUB 3GM0A 2ZZUT 1K3IA 2J8UA 2AXFB 1IMHC 2NY4C 3LRSB 5BRZA 3HI6H 2W9DL 3T1FB 3MRDA 4MD4B 2WWMD 1WQVT 4ELMB 4PJFE 1TJGL 2W60A 5E7FA 2AXJA 3PDOA 3WFEL 5I8OL 1XZ0A 4YHLH 3P4OB 2YOCA 4OZIB 2L7UA 4YNYA 1RHFA 2JCCA 2FEDC 3LN5A 3QO0B 2VABA 1A7PL 2HAZA 4Q6IA 5JQ6H 1I4FA 2KQMA 4OGXH 5C9JA 1QO3A 4ZTOL 2AJXH 3SN6N 3X12A 4IIQA 2ZUQB 3H0TB 5IJKC 3BP7A 4AMKH 2LAAA 1QLEL 4JQVC 5JUEH 2DQHL 1YC7A 4NWTL 1JBJA 2XN9A 1MFEL