1QFUL

Influenza virus hemagglutinin complexed with a neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCRSSQTLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQNTHVPYTFGGGTKLEIKRADAAPTVSIFPPSKIQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HEMAGGLUTININ (HA1 CHAIN))
publication title A complex of influenza hemagglutinin with a neutralizing antibody that binds outside the virus receptor binding site.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfuL01
5FUOH 4M7LT 1KGCD 3ILQD 1UCTA 4DW2L 5GGRY 3I3EA 4XMKL 2AK4D 3PGCA 3EIFA 4MA3B 2JCCE 2ZUXA 5IHUH 4JO3L 5IQ9A 4OAWB 3WYRA 1TVHA 5C8JB 5C09D 1SY6L 1AQDA 4LLAA 3VE0A 2XZQL 4G8FA 1WEJL 4XHJD 5ICYA 1ZT4A 2JCCF 4IOIB 3UAJC 3ESVF 4TQEH 1VKXA 4DGYH 1FH5H 3C6LC 5JA8B 4ZUUA 4GKZA 4D0DA 2P7TA 4O58L 2G5BA 2EO1A 1MI5B 3JV0A 2N4IA 3PHOB 1K5NB 4X98B 4XNYH 2B2XL 1B0RB 2VZOA 1RZGA 3DROA 4BSWA 4I4WA 5IBTH 4FQQA 3KYKL 1KJ2H 3EO9H 3EYQC 2XTJD 4LLUB 1I9JL 3H3PH 1EBAA 2J4WH 3DX7A 4Y1AD 4M4PA 3H9SD 2VDNH 1AY1H 3WUWB 2ATPB 4D9RE 1N2RA 5E6IA 5EN2A 3FO1B 1C5CH 1VSCA 2BP3A 3PE9A 4P48A 1JGUL 3WFEH 3GNMH 1UXSB 3QR2A 3AB0C 5DEFA 4R2GB 1G1YA 4FXGA 4NKDA 5HDOA 4NQCD 1EPFA 3UC0L 3L6FA 3O6LL 1HSBB 1ZA6B 4XWOD 4W6YB 1T5XB 3P0VH 2JK5A 5IFHH 2IPTH 1JJUA 3W0WD 5BS0D 5KANI 3UTSB 5CSGA 1CDGA 1T1ZB 4HWEL 4X6CE 5SWZA 1B2WH 3REVB 4UINH 1A4JB 2OZ4H 1JZ6A 2R2HB 1EFXD 4KRMB 4QRRD 1ZHNB 1IT9L 4FZ8L 1X5GA 3QUKA 3P4MB 5E8EA 3MCLL 3MGTB 4F9PC 1LNUB 2X4UA 5INCA 4X6CF 4FTVA 3WLBA 3QDMB 4MA7H 4N0YH 4PRBB 4ZDHB 3RWJB 1S7WB 1SBSH 4M8QB 5K33A 1LQSR 3X11A 3UTZB 5CD5D 2DB8A 3ARDA 5GGQH 2ZSWB 1RJZB 4GAJH 4U1NA 4LVHC 1YNLH 3RIAF 1H3PH 2P8LA 1IEAB 2XT1B 5EBLB 4Y2DA 2B0SH 4QWWC 5F44A 4P5KA 1VPOL 4P99A 4RWYL 4NSKB 4RAUB 3IGAA 1VACB 5MI0C 5J3HC 5BRZD 1R24B 4X0KB 1Z9LA 5JHLH 3HMWL 3BQUA 4BH7A 2A74B 2VL4A 4L3EA 4XCEB 5D2NA 3C5ZD 3QISA 3C6LB 5F7HA 1P1ZA 3QNXB 1A6AB 2KZ1B 3K4AA 3SGKA 3CXDL 4OCNC 1R3IL 2Y23A 1EXUA 3VXRD 4NKMB 5JQ6H 4U31A 4XCNA 1IL1A 4Z0BL 3CVIH 4KHXL 1WC7B 4M61B 1GHFH 1S7SB 3WL9B 1L6ZA 5C0NC 1DANU 5JNYA 1A3LH 1VERA 4NQDA 4WEBH 4CN1A 2VDQH 5DK2B 5EPMA 2A2QT 4P46A 1F4WL 2CLVB 2ZUVA 4M7JL 4L8DB 2A0LC 3L5IA 3NZHH 4ZD3H 3MJ9H 3RNQA 3STLB 4Z5RB 2HN7B 2EDXA 1I1AA 1MH5A 1T66D 5LQBL 5D9SA 3RVWC 1FCCA 1T04B 2HKHL 3D3VD 1EZVY 5IMKA 1ACZA 4NWTH 3IJYA 3UYPA 3GHBH 3KPLA 4N5UA 3OBAA 2CRIA 1KG0B 1R3JA 1XGTA 1BD2D 1Z3GH 3FQWB 1XCTA 4HGKC 4KK5C 4OLZH 4POUB 1MRCL 2VLME 2Z92A 2A83A 3OAYK 1KIUA 3QA3A 2ILLA 1JE6A 2C3GA 4QY8A 5DQDL 2FATL 5I17B 5E70A 4Y7MA 1T0NB 5EU6B 1IFHH 1I8MA 2BVOA 1F00I 3GO1H 4PRAB 2FO4A 3BE1L 5DSCB 1JZ4A 1G9NC 4PY8I 3LSOB 4XBEH 3IFLL 4XTRD 2DIBA 3QZWB 5AUMA 2XPGA 3O8XC 5E03A 3DGGB 5D5MF 1LE5B 2EYTA 1T1XB 3EO0A 3PDOB 1X7QB 1N3NA 2DLHA 2F5BL 3M8OH 5IK3B 4XI5C 3L95B 4YFLF 5ALCL 1FJ1B 4PRPD 3B2VL 2KPNA 3UP1A 5HHME 5JOPE 2LVEA 2VSCA 4G6AC 3VI4E 2E9WA 1G84A 1U8HA 2NTFB 3O9WB 5ISZE 4V2CB 3OAUH 4L1DA 3LS4L 1ZT1A 4LVNC 2X42A 4U1KB 5IMOB 2X4QA 3VI4F 1LEKB 1X5AA 4PJGB 4PRID 4M4RA 3C6SA 4R0LA 2Z0BA 1OAQL 2YPLD 3O4LB 3BT2H 2VC2H 4MD0B 1E6OL 5I19H 5F7YC 3L3JA 1DL7H 1EAPB 3JBG7 3L5XH 1EUTA 4Y4HC 4ZPTB 2Z31C 3LQAH 4Y5VC 1S9WB 3WKML 3AFLA 4JZJC 1HWGB 4PV8B 5HYJA 4MHHG 5F7UA 3B3IB 1ZWIA 4ZUSA 3BKMH 3T4YA 2O5XH 2ICWI 5D1ZB 3MV9B 1KEGH 1A6PA 4I9WE 4X99A 1XR9A 3GIVA 4FFZH 2VLRE 2N1KA 4YHMH 4N1CA 4O4YL 3B5TA 4LLWA 5F9WC 1ZOXA 4R2GD 5HI5C 5FKPA 3WDJA 5CKGA 3AROA 5C0CB 1DQLL 2WWMC 1T3FB 1NDGB 4LCCA 1MEXH 1I7ZA 4LLYB 2YA0A 5F9JB 2ZSVA 2R0ZH 4L4VA 4XGZB 4YHLH 1T0MA 3GB7B 4RWHA 3B83A 4LQFH 5ICZA 3GZKA 4O5LL 2Y7QB 4S11A 4HFUH 2XKNA 2ESVE 4JM4L 4FQJH 1LO0L 1L9MA 3QDMD 4K23L 1OW0C 1OF2B 5I1JL 2FIRT 2ZJSL 3MZTA 3IDMA 2FWOB 5DJ2A 3FO0L 1T5WA 3E2HC 3GRWL 2AV1B 3H6JA 1BAFH 2NLJB 3DNKA 1YEFH 1BBDL 4DVBB 12E8H 4JFOB 5JTWA 3SKUD 5AWNL 1AGEB 5B8CA 1JTTA 1FLTX 3ZDZE 2BHUA 1P6FA 1OTUC 3KHQA 3O41B 4LRNH 2E7LC 1JFQH 4P5MA 3TH2T 4LHUA 4L9LC 3NABL 4ZPVB 4U6YA 3ZDZF 3QUZC 2BNQE 3C6LD 4DCQA 3BP6B 4J3WA 3TC9A 1MCFA 4S0TD 5E0QA 4LBEB 4Y4HB 2XIDA 5KVEH 2H1PH 2Z31B 4B53A 5HHPB 5I66B 2X1QA 5FGBC 5BJTA 5FDYA 3H9HA 3H7LA 2WNGA 1KN2L 3DXAB 2H6PA 4MD5A 5TQ2H 2BFVL 4X83A 3VFGH 1A22B 3KPRE 3EYQD 3HAEA 1CFTA 3AU1A 1ORSB 3FB6B 2ADJA 4OCRL 1QSEE 2XY1A 1RV6X 4JDTH 4LKCA 4Z95H 1JWUB 5KOMC 3U7WL 5B39A 4X8XA 3WJLC 3V9FA 3WIHA 3D85D 3T0EB 5J11C 1ULVA 3ILPB 1ZGLA 2WWKO 1C1EH 4I18C 5KVGL 35C8H 2YUZA 3H3BC 4GO6B 4KUZL 5DUBA 2GTWB 1ACYL 1VGKB 2AXFA 3ARQA 1KIQA 5IVOA 5A1AA 3DO7B 4V1DE 4XPTH 4WWKC 3IDNA 4NO0D 4H26A 1Y6NR 4WU5B 5C70A 2EH8H 3KLAB 4NQEB 5EUOE 2HA1A 4L8SB 5J1TC 2IPUG 5EZIH 5GS2H 3LH2L 2AJVH 1LP9E 1XF1A 2OCFD 2BDNL 3AVEA 4RGNE 5EUOF 4X7TB 2EE3A 4O02H 2QKIA 4JQIL 4YNYA 1KT2A 1UXWB 1L0XA 2KL6A 1N5AB 3WNPA 3CXHK 1A6WH 1R3LA 3FFCB 4BH8B 1BECA 1LP9F 3E2HB 3X14A 1NCUA 3GGWB 5KOVC 1TJHH 2HG5A 2VXTL 1YEEL 1EO8L 3TCLB 3ARBA 3B6SB 5BO1L 5C09A 1KB5A 4XWGL 1FDLH 2JB5L 3L3GB 3OKDB 4QWWD 3T2PA 3D0LA 3LKSB 3IRPX 4KQ3L 3RWIA 1M6OB 4NZRL 5J3HD 1G7HB 4HV8A 2HVKB 5E2JA 2ED7A 1NLBH 4L9LB 4JFDA 4BYHA 1A3RL 1KYOJ 2X09A 1OB1A 5FA4B 1A9EA 5IR1A 2MOVA 3RFZC 3CFDB 1U3HC 3OF6D 1QRNE 1NKOA 4U1SA 5TPWL 3ALWA 3O4LD 1L6XA 2KH2B 4FQIL 4NM8H 4OIIL 4XNUH 4ZYKB 1A0QL 2Z4QA 2WBJC 4DN3L 3HPLA 4U0QB 1VB9A 4Y1AA 5C0ND 4DWHA 3QUMH 2L4OA 1UM5L 1A6TA 2A0LD 4PG9B 3OHXB 5KVDH 2VDML 4XP4H 5J11B 5C0IA 3B9VA 1F6AB 1P7QB 5JXAL 3MV9D 3RVWD 4I18B 4JM2F 5KN5B 1JNNL 3WFHB 5I1CL 1K8IA 4UOJA 3IETB 2OL3H 3NCYS 4TSAL 1CQKA 3WIIL 3W0WA 3GMRA 2RHEA 4WWKB 1KOAA 1CT8A 3OKLB 3ESUF 5C0CD 4KK5D 1OM3H 5HHVL 4QRRA 3S9DB 1EJOL 2DLFH 5TF0A 5B4MC 4G80B 1B4JH 1OHQA 1S9KC 5F7WC 3PP4L 4OUUA 2J6EL 1U8QA 1YQ2A 2IF7A 4ODBD 3VFWA 5IT2H 3TYGH 1RZJH 1RZ7L 3WHXB 2XY2A 3U0PA 4OFVA 2VSDA 1N6UA 5DTFA 4I13B 4OZIE 2NZIA 4NZDA 3QWRA 4UAOB 4XRCA 3Q1SH 4XPBH 5J6GB 1A2YB 1SEQL 3CIQA 4P3CL 4OT1L 2HRPH 4XI5D 4YQXL 4OZIF 4JG0H 4FQPA 3PQYD 4G6AD 1G9ML 4JR9H 2NXZB 1RUAH 3QG7L 1JV5B 4DUWA 4P49A 3C5ZA 3HE7C 4K3JL 4K94H 1CXFA 5EZJB 3STZB 3K1KC 2CXKA 4UV7L 3SKNA 1CFSB 4GG6E 1QACA 2Q7YB 3RVXD 4S1QH 1Q8MA 2WBJB 2AV7B 1BM3H 3D48R 4F8TA 4XNQA 4Y4HD 2Z31D 3AREA 1IQDA 1ITCA 4G42A 5D1XB 4AM0A 4EVNA 4GG6F 3G5YA 1D5BB 3DXAD 3SKJH 4L4TA 1U8MB 4LDEB 2FLRT 3BEWA 4P23C 5BVPH 3IDIA 1XCQB 5FOBA 4ALAL 4YHIA 1AR1C 3OZ9H 4F7EA 3D3VA 1OT2A 5C0BD 3O3DB 2B1HH 2DIJA 1GZQB 2CRZA 4N68A 1UADC 3BDBA 4U7KA 3EOBA 3IFPB 2ZPKL 4AQOA 4AENB 4H88L 1KCRL 2QV2A 3WNOA 2GAZB 1BD2A 4KK6C 4K71C 4PJ7B 1F4YL 3QJHB 4DKAA 4GAGH 5HI5D 4PV9B 5JHDD 2WWMD 1S5HA 4G6FB 2R8SH 3Q5OA 4MXWL 2BK8A 4X5WA 2DWEA 2AI0H 4NQED 3S34H 3VWJC 2UY7A 4S1RL 3S88H 2ARJB 5EDXA 4DOHB 5DUPH 1BMGA 1HINL 3V6FA 3QQ4A 1E28B 3FRUB 4J6RL 5GGSA 3C60B 4QRSA 4YBHA 1ADQL 4HS8L 1UWXH 2A1WL 1F4HA 3FFCD 4KRPB 1XGRB 1P7KA 1YEKL 2EC9T 1OAYH 2X4OB 4IJ3C 5T3ZH 5ID1B 5I1GH 5HXMA 4MA3A 4JFQB 3N1FC 1DQQB 4OAWA 3NAAH 5E9DE 3VGBA 5C8JA 3BGMB 4ZFGL 4XZUB 3D1MC 3MBXH 1OTUD 5CINL 3RKDC 4FNLL 2DYPB 1NUDA 4IOIA 5IHBA 1PLGL 1CD0A 2V2XB 3SDXB 2A6DB 1GGIL 3QUZD 1MI5A 3PHOA 1HH6B 3DO3A 2E7HA 1K5NA 4X98A 2DF3A 1B0RA 4Z0XB 3S5LB 2BERA 2P8MA 4ETYA 1UB6B 4QCIB 5DHVB 1AHWC 1OT1A 2IANB 1QFOA 4LLUA 3VGHA 4P23B 2D7PA 4ZS7L 3WUWA 3I6KA 4UUJB 2FX8L 2ATPA 3P77B 3FO1A 5J57B 3WO3B 5I0ZA 1UXSA 3V5DB 4MSWB 4YWGH 4H5SB 4MCZB 5FM8A 2K9UA 4KY1H 4K9EH 4JJ5B 1T80A 4Z7OE 3IDYC 2A77L 3OG4B 3P9LB 1P7QD 1NQBA 4OJFH 3FB8B 1I9IL 2R2EA 3TEUA 4X7FC 1HSBA 1ZA6A 4F9LA 4R7NB 1J8HE 2APXA 4APQB 1CK0H 1T5XA 1X5KA 3V2AR 2VH5L 3EDDA 3HI6H 3QAZB 4Z7OF 4WWKD 3UTSA 4MJIE 1T7XA 1CGTA 3WNMA 1T1ZA 5GGTA 3H7BA 3VXOB 3REVA 4YAQB 1A4JA 1MIEH 2AJZB 4MJ6B 2R2HA 3HG1E 1MLCB 2YKLH 1ZHNA 1L4IA 1UCBH 3P4MA 5DD3H 5DEGA 3MGTA 4MQXD 4YHKL 3MO1B 3FN0L 4CMHB 3QIWC 4PRHE 1E0OB 4XNXL 4NCDA 4OQTL 1A6VL 4F57L 4M6OH 3T2NL 1GIGH 3QDMA 4PRBA 3G5ZB 3UXFA 2F19L 1ZANL 3RWJA 5C6PB 4NN5C 1JHLL 4M8QA 1EGJA 4NGHH 3LEYL 3OJDB 2DMBA 1UJ3C 3SE4A 5I75B 2BY3A 5ECJE 1Q72H 3UTZA 5IEKB 3RAJL 2ADFL 3NTCL 4UBDC 2ZSWA 1RJZA 3CNKA 3TV3H 1MAKA 5EBLA 3EOTL 1OAKH 1N7MH 3X3FH 3CFBB 3PJSA 3QIUC 1VENA 2IC2A 4NSKA 1ZHKB 4RAUA 1VACA 1T1YB 2D9CA 1R24A 3C5JA 4X0KA 1L7IH 3ALXA 2NY2C 2F53E 1FSKC 5CZVH 5F7FA 2R0WH 3C6LA 2W9EL 2VMFA 3QNXA 4OZFA 5DQ9B 1A6AA 3QHTC 3DV6B 4ELME 4OI8A 4HF5H 5JR1L 5F1OB 1D5IL 1I8IA 4NKMA 1U3HD 2HWZL 5C0DB 1OAXH 3MXWH 3NCEB 5CZKA 1WC7A 4M61A 1S7SA 5DT1L 3WL9A 3WNLA 4ELMF 1WV7T 3BWAB 5MHSE 2WBJD 3MSPA 1ZVYA 2JJVA 5DK2A 4TUJB 4I3SL 3DBXB 3ULVE 4M62L 4WFEE 4L8DA 4M48H 3V4PL 3STLA 4Z5RA 1JF1B 2HN7A 1F3RB 4ODSL 4M93C 4NN7C 2DDQL 1X4ZA 25C8L 4Q6IC 5I6XC 2VIRB 3TCXA 3ULVF 1INDH 2P5EE 1X44A 1HILA 4JKKA 3VXNB 2HT2D 4QTIL 4Q97A 4WCYL 2Y72A 5T3XH 2ZG3A 3MLWL 4NRXA 4MLSA 1KG0A 4N8CH 4IRJB 5FOJA 1AGDB 2DQUL 5E7FA 3FQWA 4QLRA 2J12B 3EYSH 1KIRB 5C0JB 3JV6A 3RU8L 2AQ2A 4G9FB 5TFSH 3TA3C 1DBJH 3UZEA 1W72L 4HGWB 1K3IA 2CMRL 2F5AL 3D39B 2NY6C 5I17A 4G6FD 5B4MD 1T0NA 5EU6A 3TT3H 4AT6A 3QIWB 1ES0B 4PRAA 5DSCA 4PGDB 1LO4H 4RBPK 3I3BA 3MA9H 3LSOA 2IAMB 3INUH 4WFGD 3HB3C 2H32B 4XP5L 5EO9B 3QZWA 5D7KD 1KENH 1INEH 2VXQH 2OJZL 3DGGA 1LE5A 5FYJH 1RI8A 1T1XA 3PDOA 4NN6C 4XPGL 1X7QA 2Q8BL 5F9AC 3DURB 5IK3A 3MLYH 4K07A 4NZUL 2WLZA 2PUQT 3BKCH 3TBWA 1RULL 3L95A 3THML 1FJ1A 5L7XH 2XYCA 3UJIL 1IQWL 4KVCH 3QIUB 3QDGE 1XFPA 2NTFA 3O9WA 4P3DB 4X7CC 3HC0B 3S8WA 3GSXB 1KCSH 2NY2B 1JRHL 3BFOA 3SDAC 4U1KA 5IMOA 3HNSL 2EYRB 5FUOL 2BNRB 1ZS8B 4YHNB 5F71A 1LEKA 4FQXC 4FABH 3MV7E 4PJGA 3WFZA 1KN4H 5IW3A 2IMNA 3RVVC 5AYUH 2C4FU 3O4LA 4I0CC 1QYGH 4MD0A 3T8XB 5IVNA 4YUEH 5DFVC 1NGXB 5I8OH 1EEZB 1EAPA 5L6YH 4KDTC 3JVGC 4Z77B 1N5YH 4LPCA 5K9QG 3VWKC 1S9WA 3RY5A 4DGYL 1A47A 1FH5L 2PR4H 3EOAB 4PV8A 3B3IA 2B4CL 2IAND 3HPJB 4P23D 2EEDA 4NN7B 4XNYL 4H8WH 5D1ZA 5AG8A 5CILH 1HIML 3MV9A 5FIEA 5I6XB 1AR1D 4BZ1H 4UT9H 1GGBH 4FTVE 5IBTL 3RNKB 1KJ2L 3EO9L 1J87A 3QDAA 3DUUB 4O9HL 3SDCC 3H3PL 3ZTJH 2VDNL 1AY1L 1BPVA 4KK6D 3NA4A 1UYWH 4MHHI 1C5CL 2EDNA 5C0CA 4UTBH 4DVRH 1K8DB 1RUPH 1WIUA 1T3FA 1NDGA 2QSTA 4APQD 5F7KC 1QR1A 4LLYA 1TXKA 4DQOL 2NY6B 5F9JA 1FYHB 1R3HB 2FEEI 4ZMAT 4XGZA 6FABH 3GJEB 1CLCA 2ZCLH 4YE4H 5I8EB 2NR6C 3GB7A 2V5RA 3BP7B 2DQGH 3VWJD 3P0VL 3NPSB 2Y7QA 4WI4A 5IFHL 3OAYH 2IPTL 1B4RA 3MLSL 5HHXH 5FO9B 3MRKB 1MCWM 3OV6A 4LSVL 4UINL 2OZ4L 4NN6B 1OF2A 3RUGB 2CKBB 3TJEH 3TFKC 2FWOA 3T2OA 1NCAH 3CSBA 1BVKB 4WEUD 2XQYK 1AD0A 1KJ3H 2AV1A 3DWTA 2NLJA 3BXNB 1OSPL 4DAGH 2X70B 4MB4A 4NQDE 3WE6B 4JFOA 1FIGH 4N0YL 2Y4SA 1SBSL 2D7NA 4N0UB 5J1AB 1AGEA 3RY6C 5KSAC 1KELH 1H8SA 3V7AG 4F7MB 4OBRA 2ITDB 1YEHH 3LRSB 4GAJL 4O00A 3RKDD 4GXVL 4ZPVA 1H3PL 1I1YB 1RMFH 3VXQB 2W65B 3BP6A 1EHLH 2MFNA 1G1CA 1EMTH 3B2UC 2FGZA 3BD4A 1FL3B 2DLIA 4Y4HA 2Z31A 1NKRA 4QT5B 1LDSA 4TVSa 3T0AA 5HHPA 5JHLL 1EHAA 5CJOH 4KPHH 3DXAA 1H8OA 4XCYB 2R1YB 3K46A 1ORSA 3FB6A 2Z35B 4FG6C 2OYPA 5JQ6L 3UMTA 3CVIL 1FFOB 1JWUA 3HAEH 3RPKA 4MQSB 5FYJE 1A3LL 2LTQC 5F7MC 3T0EA 4WEBL 3ILPA 3PWLB 1FN4B 1KPUB 5IHZB 4DGVH 2GTWA 1VGKA 3NZHL 4ZD3L 3WIHH 3MJ9L 4P4RB 3DO7A 3FT4B 1EEQA 3C08L 4IRJD 4HS6B 4RMQA 1DE4B 2YXMA 1RZ8B 4LIQE 4YXLL 2QADC 3PIQB 4U1GB 4WU5A 1CXHA 3GMOB 2QQNH 3KLAA 4NQEA 5FA3B 2DTSA 3GHBL 3ULUC 4L8SA 4G9FD 3P73B 4KH2A 4WTWA 4NYLB 3DI2B 1G6RB 2IPUK 3D39D 3BPOB 1F3DH 5J06A 4OLZL 3QIWD 1R3KB 3LKOB 3QIBC 4X7TA 2IAMD 15C8H 1RUKH 2VLKB 3CD4A 1UXWA 1N5AA 2MWCA 2X9WA 4BH8A 1IFHL 5I18H 3GO1L 4XB8A 4HJJH 3GGWA 5IGXL 1P4LB 1NPUA 2VUYA 3TCLA 4UBDD 4QGYA 3B6SA 2X41A 4ENEC 3ZYZA 1RZIB 5KSAB 1YNTB 4AH2A 3KPOB 3L3GA 3OKDA 4BM7A 4JN2B 3LKSA 3QIUD 1M6OA 1A1OB 3DHMA 1G7HA 1X5JA 3M8OL 1TJIL 2HVKA 4JO1L 1KB5H 2V5MA 4L1HA 2NY2D 3ZTNL 5ILTL 1FNEB 5T1DH 4L9LA 4P2OC 5D71L 4W4OA 5FA4A 2VDRH 4PJAE 2YRPA 1X5YA 5DMGC 5JO5B 3WDHA 3CSPA 3CFDA 2R1XB 2A38A 3K2UH 3WSQH 4ZYKA 3GEWB 3ZSTA 1DFBL 3E3QC 2E6PA 4YBQD 4PJAF 4FA8A 1LK2B 2I60L 1AIFB 4YC2B 3RTQC 1H3VA 2YUWA 5GJTH 1K3ZA 2PCPB 4PJ8B 2QSQA 5I19L 1EX0A 4RNRB 4PG9A 4UT6H 2RIKA 1DL7L 3AY4C 5ID0B 3OHXA 4NJAH 3HI5H 2JB6B 3LQAL 2H2PC 1F6AA 1P7QA 4WDIB 4I18A 4R7DB 1JTPA 2P1YA 3WFHA 5KN5A 1CF8L 2YSSB 3G08B 3IETA 5FV1L 2A73B 4KGJA 1ZLUK 5CFHA 3BKML 3QEGL 4RMUA 3TYFB 4WWKA 2O5XL 2GW5A 1YPZE 1KEGL 4FFWC 1LVEA 1ZV5A 3OKLA 3WFBL 5LGJB 2QADB 5L8JB 3SGJC 3V6OC 1P9MC 4YHML 3F7YB 3VI3E 2Z91B 2VQTA 4HIIB 4G80A 2HJFB 3HUJE 1YPZF 2NY6D 4U0RB 1MVUB 3BZ4B 1RJYB 2NPLX 4E41B 1K4DB 3VI3F 4LNVA 3QIBB 3WHXA 4POZC 5T5NF 3HUJF 3HB3D 3VFVB 5F6IC 2R0ZL 4Y16C 3LZFH 2VL5B 1UZ6E 4AL8H 3ZHDA 4LQFL 5GRYA 4XVJL 4PLKC 4JY5L 1A2YA 5J6GA 4NPYB 5JPNB 1XT5A 4ZTOH 1SBBA 1UZ6F 5FV2A 4FQJL 5GJSH 1HNFA 2I07A 1JV5A 2XTLA 4MB5A 5M95B 3RX7A 2BOCB 3V6ZB 3JWOH 1KFAH 5EZJA 3STZA 1NGPH 3MV8B 3EDFA 2XN9D 4ORGB 3QRGH 5IG7B 2Q7YA 3RVVD 2WAHA 3GSWB 4AEEA 1MCWW 4DUXA 2E9JA 1GGUA 1P4IH 5DFVD 2WBJA 4MNQB 2RB8A 1JFQL 5D7JB 3MLRH 5D1XA 2EEAA 1OWWA 3PGFH 5JIIA 1D5BA 1U8MA 3S35L 4OLXH 1UACH 2H3NB 3RZCC 4TULL 1XCQA 1EZVX 1EVUA 3OB8A 3PWUB 5KVEL 2H1PL 1YJDC 1CDUA 3O3DA 4WIQA 4KMLB 1GZQA 3N1GC 3N50A 4AMKH 4Q9CA 5L2KE 3VFGL 4CN4A 3IFPA 1PY4A 4AENA 4E42B 5FM5O 4QHKJ 2GAZA 3VH8G 1IC4H 4HT1H 5EORH 1I7UB 3SDCD 5IJKC 4PJ7A 4JDTL 3QJHA 2X7LB 4OGAC 3OKMB 4PV9A 5B22A 1BQHG 3ZL4H 1D5XB 4MCYB 5ACMA 2X5PA 2XWJB 2PW1B 1C1EL 4FFYL 35C8L 3VXUE 3QBTB 4ESKA 5TE7L 1KPRB 2NR6D 3CK0H 5HDQH 2ARJA 4XPTL 4JFDE 3L5WB 1VA9A 1E28A 4NNYB 5F6IB 1X5FA 3FRUA 5AYQA 2BOBA 5JW3H 3CFJA 2DBLH 3C60A 5CBAB 1MCOH 5EZIL 4XXCA 5ESAB 3O45B 4DTGH 5FAAA 3TFKD 3LS5H 1XGRA 2AJVL 1K9TA 4EBQH 2X4OA 2VWEE 5ID1A 3UZVB 2KDGA 4P4KB 4HJGB 2GQHA 1D5ZB 5CWSB 4EIGB 4JFQA 1K6QL 1FE8H 1DQQA 5HVGB 4ODTH 2VKXA 4RGMB 4HW6A 3BGMA 5KSAD 4OD3H 1OOAA 4XZUA 2SEBB 1TJHL 2DYPA 1CDYA 3MNZA 2V2XA 5TJWK 3SDXA 2A6DA 4GFTB 4L5FH 4HQQH 1FZMB 4X9HA 2X40A 5GSRB 1MFNA 2ED8A 1LK3H 1FDLL 4MZ2A 1HH6A 3B2UD 2DIAA 1FLRH 4NBXB 3BYTA 3I6LD 4ELKB 4Z0XA 3S5LA 2A6KB 3UTTD 1NLBL 1UB6A 4QCIA 5DHVA 2IANA 4Y4FC 1OLZA 3P0YL 4P23A 3FOMB 3RWCA 3RZCB 4UUJA 3P77A 1P5VA 3ELAT 4MB3A 4PJ8D 4FG6D 1TDQA 5D1QB 3S96B 4M1DH 4NM8L 4XNUL 4MSWA 4M6NH 3V5DA 4H5SA 2DD8H 4MCZA 4OFYA 2NY5C 2PO6B 4JQXA 2WM0A 2X4SB 4A2LA 2V2TB 1Y0LB 4JJ5A 3U36A 3B9DA 4P2CG 1NBZB 3P9LA 1DANT 2FX7H 3FB8A 3QUML 3VH8B 2DS4A 1AGFB 4R7NA 4RA0C 2DI7A 4APQA 5KVDL 1FZOB 4WHCA 4XP4L 1KNOB 2IALB 1BQHB 3RWEB 1J0ZA 2DM7A 4NT6B 1QSZA 4HIJB 3VXOA 2QADD 4YAQA 3MR9A 2AJZA 4MJ6A 1JWMB 1JTOA 1VADB 2OL3L 4J4PC 1MLCA 3ULUD 3G9AB 4OCYH 3ZT7A 4U1IB 3MO1A 3BZDA 3T3PE 5GGTH 1PEZA 2Y9RT 1BZQK 4CJ0A 2W0FB 4PP1C 1HHKB 1QFWI 4U05A 5IB1B 1C7SA 3G5ZA 1OM3L 4E41D 2F54B 3QIBD 2DLFL 3OJDA 2UVFA 1B4JL 2YS4A 3MCKB 3T3PF 4F37F 5JIHA 2CXGA 1ZXQA 1A8JH 5IEKA 5IT2L 1U95A 1EGJH 3AM8A 2X05A 1RZJL 5DRZB 4HKBB 1RUQL 4YK4C 4JZNB 4NCC2 4L4TE 4ENED 3LDBB 3TIEB 1ZHKA 2DQIL 1T1YA 1KJMB 1IKNC 1I8LC 3VFTB 1HK6A 1BQSA 1I85A 3WNKA 3OKYA 2HRPL 4OLWH 3AXLB 4P2OD 5DQ9A 1RJCA 3MZGB 3VFUB 3DV6A 3OKEB 5E8DL 4JG0L 1OP3H 1HYSC 4JR9L 3MV8D 3F8UB 5GS3A 1Q38A 2GY7B 1RUAL 2CRYA 5DMGD 5C0DA 1MF2L 4OF8A 1TFHA 5DGRA 4MNGB 5E2WH 4RISL 4K94L 1M7DB 3BWAA 3O2VH 2HRLA 1SJHB 3RTQD 4TUJA 4EJ1C 4O2FB 4S1QL 4Y19D 1YN6B 4QOKD 1JF1A 4HKZB 1UG9A 1NC2B 2VIRA 5DRWB 2H2PD 1CLZH 3VXNA 5JMOC 3SOBL 5D70H 3SKJL 1MCPH 2WQ8A 4IRJA 1AGDA 1DSFH 3SDYH 3TN0B 2XA8H 1IAKB 3OZ9L 1YYMH 2O93L 2FO1A 1J5OH 4Q74A 2B1HL 5D7LB 4FFWD 3QQ9D 1PZUB 1BIHA 5E8NB 4HGWA 1S7VA 3DMMC 2XA3A 4GAGL 1GPOH 4IOFD 3QIWA 3TPUB 1MJJB 2FX9H 4PGDA 4Y2OA 2Z93B 2FR4B 5FUCC 2IAMA 5BQ7B 1ZE3C 2H32A 1NAMB 2Y5TB 3JWDC 3P11H 3KXFB 5EO9A 4CGTA 4POZD 1YYLH 3PV6B 2NZ9C 1QSFA 1MI5E 1Q94B 2G9HB 4N8VG 2P49B 5CEXB 1LEIB 4JO2H 2K7PA 3RDTB 3S34L 2G60H 4Y16D 3DURA 4PP2B 1M7IB 2C1PB 3S88L 5LGHH 5DUPL 4FXKB 4U1LB 1JYNA 1KEMH 4L3AA 5I8KH 1MCCA 3QRFM 3LKNB 3F7QA 1CL7I 3QIUA 1GSMA 1QPXA 2WUBH 5EA0L 4YXKL 3HC0A 3GSXA 1NBQA 4FRWA 4J3XA 3U82B 1FPTH 2DQJH 2EYRA 2BNRA 2LQRA 1ZS8A 4YHNA 1C5DB 1OAYL 1AO7A 4W6XB 4XBPB 3VA6A 5T3ZL 4M8VA 4PTUB 3QUYC 2ZKHH 3NIDE 1YECH 3T8XA 2JELL 3NAAL 1KUMA 5CEZD 1NGXA 3DVGB 4X5LA 3WN5C 1EEZA 1S7TB 2MJWA 4Z77A 3MBXL 2E8YA 4LVEA 1QFPA 4WY7L 2A9ML 3UTSE 4L4JA 3NIDF 1UWGL 3MRJB 3EOAA 4PLJC 1DTUA 2J88H 4HPOH 2VABB 4WW1B 1NFDE 1QD0A 3BIAX 3HPJA 3D0VB 1S7UB 3RZCD 4P5TC 3ARZA 1T21B 3NIGE 5HVHB 3RNKA 1JWSB 4P2RD 3RGVC 5K9QI 3BPLC 4RMSA 3DUUA 1A6UL 2PO6D 2VLLB 5DD5L 3U4AA 3Q3GB 3O2DH 2O5ZH 2QQLH 4JKMA 5DMJB 4AIZB 1BZ9B 3I2CH 5I1IH 5C92A 3M1BB 5E2UH 2AJYH 1K8DA 4YWGL 4OGAD 3RJDA 1ED3B 2DAVA 1X5IA 2LV4A 4S10A 4I3GA 4K9EL 1DQDL 3DMMB 1R3HA 4OJFL 5GGUB 1RK1B 5I8EA 4YHPA 1U8IB 3LEVL 4K2UH 5DRNB 1LGVA 3BP7A 4WENB 3PWNB 1CK0L 1YN7B 2MQCA 5J1SC 4NO5B 3HI6L 4G6KH 3VDAA 1ETZB 1G9NH 1QLEL 4KMTH 1MIEL 4YX2H 3CAFA 3Q6GH 3RUGA 2F54D 2CKBA 4ONHB 2YKLL 4RBPH 5HGDB 1UCBL 4LCWB 5DD3L 2DI9A 4N8VB 1BVKA 4PGZA 1VEOA 2O5YH 4LAQH 1PYWB 3BXNA 5C2UB 5DZNA 4DGIH 2X70A 4RCAA 4M6OL 3WE6A 1GIGL 5GZOC 4N0UA 1DQTA 1OGAA 5J1AA 5EIIB 4NGHL 4O2CB 1OPGH 1RZKC 4CVZB 4MVBC 2OI9C 3KS0J 1Q72L 3UEZA 3P4OB 3NCFB 2ITDA 1BOYA 1IC1A 5HYQA 4KI5C 4R3SA 3PDGA 4QXUH 3WD5H 1W2KT 1MNUH 4OLVH 5E5RB 1OAKL 1I1YA 3QT2A 3VXQA 3X3FL 1G0DA 1OWRM 4QT5A 1L7IL 1U8NB 1JF6A 3ARFB 3EYUH 3QXUA 4KTDL 4U4BA 2E6QA 2HFFB 4HF5L 1S9VB 4XCYA 1J0IA 5F9OH 1UH3A 2Z35A 4Y4FD 3W11C 1C08B 4D8PB 5EU6E 3QI9B 5BW7C 1FFOA 1OAXL 2RQ8A 3MXWL 1MCBA 1DLFL 4X6EB 3PXJA 3SGEI 1NC4D 1CR9H 4CU6A 1HNGA 4NWUH 2VXSL 5GRWA 3BPLB 5C0AB 1XGUA 1TENA 3PWLA 1NC2D 1FN4A 1KPUA 5IHZA 3IU3B 1IC7H 1MHCA 4XNMB 3GMNB 1E6JL 2MPAH 2YHGA 4PIRF 1F02I 5KS9B 2XG4A 4P4RA 4LSUL 3GSNB 3FT4A 5IIEB 1WFOA 4HS6A 2I5YH 1IZJA 1DE4A 2EDOA 1RZ8A 3PIQA 3P30H 1INDL 1I1CA 3GMOA 1BBJB 5FF6B 5D7LD 5FA3A 3P73A 1MHHB 4MJ4A 2IMMA 1G6RA 4N8CL 4OGZA 4IOSD 2AAVA 1H0DB 3VMPA 4JY6B 1ZHLB 3BGFB 3G6DH 1R3KA 4GRLC 4PRNB 3LKOA 4S1DC 5TFSL 2PYED 2EKJA 4MMZC 2VLKA 2CLRB 1OP5H 5D72H 2E8ZA 1I3GH 3KXFD 4FQHB 4GW5B 4NDMB 5D6DC 2Q8AH 5C0GB 3TT3L 4EN3B 4X4MA 4PJGF 1SJEB 1LO4L 1P4LA 3RP1A 4C56B 5EUKB 3MA9L 2BVQB 3ABZA 5DD6B 1OARL 2JJSC 5HJ3B 4BK5A 1RZIA 5KSAA 5D7SH 3KPOA 4GSDH 2FB4H 1KENL 1INEL 3RHWK 5IESH 4JN2A 5FYJL 2BZDA 4KZDH 1A1OA 3MJ8B 4ZUVB 4WUUB 1FNEA 2R39A 3BKCL 4GMTH 4YJZL 2YD4A 1T7ZA 3BISA 3EYVB 4KVCL 5JO5A 5L88H 1NJ9B 5HDBE 2R1XA 1HYSD 4Z8FL 2CO6B 4LIQL 2Z8WC 4NUJB 4ERSH 2BC4B 3BPNC 1LK2A 4FABL 1KTLA 2FECI 1AIFA 1KN4L 5HDBF 1CXIA 4X4ZA 4YHOH 3UTPE 2PCPA 3PWJB 4PJ8A 2H41A 5AYUL 3A0OA 4W6WB 1QYGL 1RVFH 3L3IB 1IM9D 1D6EB 5KBNC 4YUEL 4CL7A 4RNRA 5ID0A 5L6YL 4X4XB 1NEZB 2JB6A 1N5YL 1UENA 1EIBA 3A6BH 4WDIA 4R7DA 2CDGB 4RRPG 4P2QE 2PR4L 2FZ3A 2WV3A 2YSSA 4NBZB 3G08A 4XCCH 2A73A 1UKTA 5EIVA 5F97E 3TYFA 4LSPH 1IM3B 4H8WL 4BZ1L 3B9KC 1GGBL 2DQCL 5L0QC 5CJBA 5LGJA 2NY7H 3G04B 3W2DH 4OD1H 3F7YA 4PJFB 2Z91A 3ET9F 4HIIA 1MPAL 2HJFA 2OTPA 3DMMD 1MVUA 3BZ4A 5EWIH 1RJYA 4CN6A 4UTBL 4N0CC 4H25B 1K4DA 4E41A 1RUPL 5IB2B 4GRLB 4P9HC 1MFDL 3QIBA 4RZCB 3QEQB 4OFDA 2GFBA 3VFVA 1I4FB 2AKRB 3ZMRA 2VL5A 2NZ9D 2ZCLL 5LCVH 2AXGB 2DQGL 4OKDA 4NPYA 1XEDA 1F5WA 4IRSC 4PRDB 3U4BL 5CGYC 5HHXL 5JPNA 1MQKH 2EZ0D 1YEGH 1N6QH 3WKNA 1UZ8B 2QHRH 2YPVH 5K9KB 4QRTB 1NCAL 1AR2A 2BOCA 2HFGH 4JE4B 3V6ZA 2NXYC 4FP8L 1KJ3L 1INQB 3FHAA 4BFEA 3KDMB 2P8PB 5C9JB 4DAGL 4HLZH 3T0EE 4ORGA 4WI6A 1IAIM 2R69H 5IG7A 3VGEA 3QUYD 5JZ7C 1KELL 3UX9B 4LK4A 1V3LA 2R2CA 5HVWA 2O61B 4MNQA 4J1UB 2Q1EA 5I73C 5D7JA 4H1LG 4HKJA 2AABL 1TVBB 1J10A 3ARFD 1VFOA 4GKNB 4XBGB 4CRPA 4PD4K 1RMFL 4UILL 1EHLL 3QWQB 4PLJD 1EMTL 1G7JB 1K2DB 2H3NA 4WFFD 3PWUA 2AJSH 2MQ3A 1B0WA 1SEBB 3MGOB 3QEUB 4L8CB 3CU1A 3QI9D 4OZHB 4KPHL 1B0GB 1NSNH 3L9RB 1JYWA 4F7PA 3RGVD 4E42A 5C08B 5C0AD 1IE5A 2NX5E 3JTTB 2GJJA 5I1KH 1I7UA 1CLYH 1MFBH 3OKMA 3B9KB 4U1HB 5L0QB 2QJDA 1CZ8H 1D5XA 3OQ3B 4MCYA 3V6OA 2XWJA 4XAWL 1A6ZB 5A2FA 2PW1A 3S3SA 1ZLUH 4DGVL 4JGUA 5TGBB 4HPYH 2DJUA 3V4VH 3MRDB 4JFED 3WIHL 5EZLB 3KJ4C 4S2SA 1KPRA 3NN8B 4XAKD 3L5WA 1NMBH 4RQQB 2HVJB 5C7XL 4NNYA 3H8NA 5FO7B 3IXAB 5ESAA 3O45A 2DQDL 4IRSB 1RIVH 4LCUB 1H5BB 1M05B 3HMXA 4P4KA 4C56D 4HJGA 1D5ZA 5CWSA 3FT2B 2GITB 15C8L 1Q0XH 1RUKL 4FS0A 1G7LB 1MJ7H 3WFDH 2NY4B 2AJUH 2SEBA 5B3JE 5I18L 3O6FC 4HJJL 4JB9H 1JZ8A 1JMXA 1WICA 4FMFA 1T7YA 3PXHA 2XOTA 4WUUD 2CDFA 4KI5D 3P4LA 3ZHLA 2OS7A 1FZMA 2OSLB 5FHBH 5GSRA 3WXWL 3MXVH 2NTSP 5B3JF 5D8JL 3HN3A 3ZKSD 3QUXB 1B6DA 4ELKA 1KB5L 4DN4H 4Y5XC 2A6KA 4X9FA 5T1DL 4QXWA 3G6JB 3QCUH 2OMNA 4H1LB 2W91A 3FOMA 3MYJB 1SM3H 3WLWC 2R0KH 2D7QA 3CZFB 3K2UL 5F7EL 5D1QA 3W11D 1U8KB 3S96A 5KJRL 4JHAH 1BX2B 4JFFB 1OL0A 2PO6A 2X4SA 4PB9H 2V2TA 3QXAB 1Y0LA 5JORB 4QNPE 5GJTL 1QG3A 1NBZA 3EDEA 5CAYB 5AAWA 3VH8A 5HD8C 1AGFA 2QQQA 2W9LA 1A9BB 4NJAL 1FZOA 3QULB 3WS6C 5JDSB 3ETBF 4JRXA 4QNPF 1KNOA 4OCWH 1DCLA 2IALA 1BQHA 3RWEA 4NT6A 2Q87A 4HIJA 4UV4H 4H20H 4WTZG 3PABB 1BJ1J 1JWMA 4JKPH 1VADA 5CLWA 1LILA 4U1IA 1FYTB 1PQZB 2W0FA 1HHKA 3LPFA 5IB1A 2F54A 4GRLD 5A2IH 3BSZH 1FCGA 3MCKA 1JZ7A 2YRLA 4ODHH 4TVPH 3EJJX 1N6VA 3V52H 5DRZA 5TQ0H 4HKBA 1UC6A 4JZNA 4U3CA 3KGRA 3TIEA 3LZFL 1KJMA 4AL8L 2UUDK 4HEME 3VFTA 3VXSB 5IKCB 3NGBC 5F6HJ 2QHLA 3SJVB 1F6FB 3AXLA 3UDWC 1CWVA 1JNLH 2G5RA 4U3HA 3VFUA 3OKEA 3R8QA 4ZTOL 2FBJL 3N1PC 4JDVB 2VO5A 3SN6N 4M9PA 3QO0A 4PJ7E 5GHWH 4YBLB 3MV01 3JWOL 4MNGA 5JQHC 3MLPA 1M7DA 2WBKA 1F13A 2BRQA 1NGPL 4OF5A 1T22B 1SJHA 2DQHH 5C6TL 4PJ7F 5E8PB 4QRPE 3QRGL 4O2FA 4X7EC 1PG7H 4JPVH 9CGTA 4OQ1A 5JW4R 1M4KA 4WO4A 2GI7A 2X9XA 2C4FT 4HKZA 4JQVC 1IEBB 1Q9WA 1NC2A 2OJEB 4G8GE 3VD9A 3MLRL 1W0WB 5DRWA 2NY0C 1LD9B 3PGFL 3T0XA 5I1LB 4M7KH 4Z7WB 5ALBL 1U93B 4ZNEA 4OLXL 1UACL 5C08D 3C9NB 3CX5J 3L3DB 4ONGH 5C3TA 3TN0A 1A4KB 4BKLB 2R29H 5D7LA 4AMKL 3BVNB 5I15H 2CGRH 2NW3B 3F65A 3B9KD 3JTSB 3CFKB 4HD9A 5E8NA 1OVZA 2DKSA 3IU4L 4XP9H 4XMPH 3S4SA 1IC4L 4HT1L 1KYOK 2CIKA 4PY8J 4WTXA 1HI6B 4UB0H 1QFWH 5MP6H 3WV0A 5FYLE 3TPUA 4LVOB 1MJJA 3TO4B 2Z93A 1D6VH 3ZL4L 4N0CD 4KMQA 2FR4A 5BQ7A 1PSKL 1X9QA 2VZ1A 1NAMA 2Y5TA 4E0RB 5IJVB 1AXTL 3KXFA 1A1MB 4M7ZC 4NOFA 3HR5B 5AZEH 3PV6A 4GBXC 5C2BH 5DFWH 2G9HA 1LEIA 5CEXA 3T1FB 3RDTA 2H32H 4PP2A 1M7IA 1G6VK 2C1PA 1YC8A 3SDXF 1VFBB 1C12B 4FXKA 4U1LA 3O6MH 1WAAA 4G3YH 4IRSD 2XWBB 1ZMYA 3L5JA 4Z7UA 5CGYD 3SE3C 1QBLH 3LKNA 1KXTB 5JW3L 3BIKB 2JIXA 2JCCB 3ARGC 1MCOL 1IKNA 2CLZA 5IB4B 4FQLL 4HJ0C 4OCXH 2NXYD 1C5DA 4XBPA 3HE6C 1IGTB 1N0XL 1U8OB 4X4YB 1PZ5A 1FE8L 1DEDA 4OGYH 2H26B 1S7TA 3VW3L 5JZ7D 1ZGLM 1WT5A 1CFNB 5E1AB 4P0DA 1DBBH 2OLDA 2IEPA 5I74C 4LP4A 3VFRA 3MRJA 4HQQL 3KPQB 2VABA 4WW1A 1LK3L 2BCKB 2XRAH 5TDNB 4H0IA 3D0VA 1FLRL 1S7UA 5C6WH 1T21A 2A9NH 4KQ4H 4TSCH 2UV3A 1JWSA 3QFJB 2CR6A 5T1MB 3WEXB 3MYZA 4JFFD 4TVPE 2VLLA 2VDLH 3EHBC 3Q3GA 1B9ZA 4JN1H 5GISH 4AIZA 1BZ9A 3OKNA 1NBYB 3M1BA 4X6DB 4M1DL 2DD8L 5I71C 4PJDA 1MCKA 2WP3T 5E2VL 3CFCH 3HZKB 1NDMB 2OQJB 1KXQE 2FX7L 3CDGB 4X6CB 5GGUA 1RK1A 1U8IA 4B5EA 5I76B 4PGBB 1OY3B 3TBVB 1YN7A 5HGBB 3LMJL 4PJCB 4NO5A 2YN3A 4HZLB 3GJFK 3OX8B 5FUZH 4NC1E 5HI4C 4IIQB 4CVWA 1AE6H 5ADOH 4GBXB 1CLOH 1ETZA 2B4CC 4GW4B 4LDLB 3VG9C 2I24N 1I3VA 3MFGB 4HX1B 4ONHA 1ZSDB 3C09C 5HGDA 4LCWA 3KVQA 2AGJH 4N8VA 1O5DT 5GGTL 1CL7H 2ZCKL 1PYWA 3VGGA 1J0JA 1H3UA 1FNFA 3SCMA 2CKBH 1F11B 5EIIA 4O2CA 1J86A 4UDUB 4CVZA 2XZZA 5F96H 3P4OA 4PJHE 1QKZL 5DJDB 1EGJL 2EDHA 3O6FD 3QPQC 3VXSD 4A2MA 4Y8AA 3L7FB 1GGCH 1FNSL 3SJVD 4HWNA 2DBJA 1IGIH 1CGVA 3S36H 3VFOB 4LPXA 4JRYD 4G5ZH 5HYSG 1U8NA 3MUZ1 3ARFA 1RHFA 5DA4A 4OLWL 4LEOB 1WWBX 3U1SH 3QYCA 4LU5H 2HFFA 1S9VA 4X9BA 3UO1H 1QEWB 5LBSH 2BSSB 2D3VA 4Z7VE 2QBWA 1C08A 4ZXBC 4D8PA 2C3VB 3QI9A 1DN2A 1S78C 4OCSL 4X6EA 3BP4B 4KRLB 3O2VL 1KLFA 3NPZB 5BVJB 1L7TH 4U1MB 3EYOB 4KHTH 5CJ5A 3IU3A 1QSFE 4XNMA 3GMNA 2J2ZA 3KWWB 5KS9A 4KJWC 3QPXH 3GSNA 5HD8D 5I71B 1J0KA 5IIEA 5BOPA 3CDFA 3DVIA 3I02B 3AAZB 1YDPB 1CLZL 3BPCB 1S7XB 2PXYB 1BBJA 5FF6A 5D70L 5I16B 1MIMH 1MCPL 4LARH 1MHHA 3B4NA 2ICCA 2X4NB 1DSFL 1KC5H 3EO1A 3SDYL 3ALPA 3BAEL 2BNRE 1RIHH 1H0DA 1N4XH 1YYML 4JY6A 1ZHLA 1AO7E 2GJ6A 4PRNA 5HDLA 3TO4D 1G6RH 3WFCH 1MCRA 1A64A 4QTHB 2BVYA 4PGEB 3VG9B 1TQBC 2HTKD 4YPJA 2CLRA 2V5SA 1KJVA 4LNRB 3HR6A 2FH8A 4FQHA 1IAMA 4GW5A 4NDMA 2GUOB 3SKMB 1U58B 4EN3A 1GPOL 4MA1C 3VD7A 4LAJH 3U0TB 5EG6C 4C56A 5EUKA 1V05A 2BVQA 2YN5A 5DYOB 5DD6A 5E5MB 3IJSB 3P11L 5CLTA 5HHMB 4ZTPH 1YYLL 3AS2A 2V17H 4JO2L 2G60L 3MJ8A 4ZUVA 1TCMA 4WUUA 1J1XH 5LAXB 2MSPA 3BJLA 1NGZB 2AK4B 3LKPB 4BZ2L 1HHHB 1KEML 5I8KL 4M9OA 1NCTA 5DRXB 3EYVA 1NJ9A 2DLEA 2WUBL 4MAUL 3O0RL 5SWSE 1VESA 5GXBB 1GRWA 1QP1A 5CJ8A 4KKLC 2DQJL 1KCUL 5HYSB 3C8HA 4NUJA 2BC4A 3WCYA 2P5WE 3ROOB 1GOHA 3EYFB 3ZYIA 3PWJA 3SGEH 2ZKHL 3L3IA 1WZMA 1J18A 1D6EA 2MKLC 4TOYH 3PWVB 4X4XA 4BQCA 1NEZA 2IBBA 3R1GH 4XMLL 4D9RD 2ENSA 1YQVH 4EUPG 2R0LH 2CDGA 2D9QB 3OXSB 4EIZC 3H9SB 3LIZH 3T1WA 2VLRB 2NY0D 3WXVH 4ZO6A 3PF2A 4HPOL 3RUGE 1C8PA 4RMWA 5I30L 1Q0YH 1IM3A 2E7MA 1UQSB 5IOPB 1E4WH 3IVKB 3G04A 4NQCB 1LE9B 3CMGA 1XH3B 4PJFA 3RUGF 3VFMB 3FL7A 1O7VA 5IW1B 1OGAE 5HVFB 2O5ZL 2OTWB 4UQ2B 1KCVH 4FQ2H 4JAMB 3I2CL 5I1IL 2DJ4A 1X5XA 5BS0B 2X4RB 5E2UL 2AJYL 4H25A 5IB2A 4GRLA 5DC0A 5FEBA 1BEYL 4RZCA 2HLAB 1DBAL 1Q9LB 3QNYB 3QEQA 4FHBD 1EFXB 1I4FA 5BXFB 1F2QA 4RGNC 2AKRA 2ZCHH 4GBXD 2ESVB 1KF9B 1NAKH 4JCMA 4R26H 1MREH 4PRDA 4G6KL 4PJ9C 1NFIB 5FCUH 2C26A 1NFKA 3UJTH 1UZ8A 1G9NL 3GK8H 4YX2L 4IRZH 3GDBA 5K9KA 4QRTA 3ARGD 2AVGA 3ARSA 5CMAB 5IF0B 4HS3B 3H42H 2O5YL 4RDQF 5BV7C 1INQA 3KDMA 2P8PA 4HJ0D 5D93C 5C9JA 3RA7H 2ZG2A 4X7SH 4PJ5A 5CJQL 5DFTA 3HE6D 1J88A 5BRZB 5DC4B 5GS0D 2BNQB 1OPGL 3D5OF 2O61A 5F8RC 1XZ0B 4J1UA 3NACH 4Q9QH 1TVBA 4XBGA 4GKNA 4QXUL 3WD5L 3VXRB 3O4OB 1MNUL 2Q6WB 3MTRA 4NNXB 2CJUH 2XQBH 2VJXA 3KPRB 1K2DA 5J4MA 3WIFB 1SEBA 3MGOA 1V5JA 3CVHB 3QEUA 1QSEB 4HC1A 3QEHA 4JM2C 4L8CA 1ONQB 3EYUL 4OZHA 1B0GA 3FHQA 3MLUH 1JN6B 3L9RA 4EI6B 2RGSA 4EUPB 2EO9A 1CG9B 1F58L 2VLKE 3JTTA 5ITFB 4LRIC 5F9OL 3EHBD 1JPST 5EO0B 4Y8DC 2LE9A 2V6HA 5DD0H 4X4ME 1V7ML 5IWLC 3SO3B 3B9KA 1EBPA 4U1HA 4WW2B 3U83A 1P69B 2F8VA 2OK0H 4DKDC 3OGCB 1GGTA 1FC1A 4KDWA 3E6FB 5TGBA 1IC7L 3K4ZA 2VLMD 3MRDA 4DKEH 3PUCA 5EUOB 4GS7C 3MBEC 5EZLA 3NN8A 5IBUG 1CE6B 4XH2B 3CUPB 4RQQA 2FEEL 1CXKA 4N9GB 1FBIH 2HVJA 3KHOA 3P30L 5HI4D 1F90H 1DQMH 4RGNB 1WFUA 3L1OH 1BFTA 4WHDA 5FO7A 2QL1A 3IXAA 4U2YA 4J12A 3BKYH 1L0QA 5JW5B 3OR7A 4IRSA 3BHBB 4LCUA 1LDPH 1H5BA 4PJ9B 1UA6H 1M05A 5IB5B 1WLHA 3G6DL 4FXLA 1MCQA 1S5IH 2C4XA 3FT2A 2GITA 1PEWA 1PKQB 3DSFH 1G7LA 4HEPG 4XCFL 5D72L 1I3GL 3HMXH 5HHMD 5JOPD 5KTEH 1MOEA 5BV7B 3D18B 4Y4KC 3FQXB 4I2XA 5ISZD 1IBGH 3QPQD 2HYMA 4LSTH 4ODXB 2BJMH 2UZXB 2CIIB 5KZCB 2OSLA 5D7SL 3RGHA 4GSDL 2FB4L 3QDHA 5IESL 4ZG1A 1WCQA 3V4UH 3QUXA 1MWAB 5JPMB 2VDPL 3QG6B 4PRIB 5DXWA 4GMTL 4R9HA 1AQKH 3G6JA 4MAYC 2YPLB 4H1LA 5L88L 3MYJA 3UROR 4UMGA 3CZFA 1FO0B 1U8KA 4ZXBD 3GI9L 3KLHC 1S78D 3IKCB 1IKFH 1I9EA 1BX2A 4JFFA 2EIDA 1ZLWK 4KUCF 3ZKQD 2YMXH 2WINB 3QXAA 5JORA 4N5EC 1AC6A 3OPZH 4YHOL 3QHFH 5K9JH 3QO1B 1KACB 1P4BH 4I9WD 2VRAA 3RZWA 2VLRD 1MCDA 2C3WA 3L3KB 3K80A 1D9KC 5ACZB 1H8NA 3QHZH 4WI2A 4KJWD 1A9BA 5GS1C 5JDSA 2PYFB 2K3TA 3ZKXC 1E27B 1C5BH 4MQ7B 1HSAB 1KIPB 2OXGA 1QOKA 2WLYA 3PABA 3WO4C 1G9EA 4DK6A 2D0FA 1JGVH 2D7MA 1FYTA 3BESR 2HT3C 1PQZA 5IBUB 2D4DA 5I1DB 3S37H 2NY7L 4M1GL 1CFVL 3IS0X 4BQ6A 4OD1L 2OTUB 1MUJB 5FYKH 3N1MC 3PNWB 4G7VH 3DV4B 1KCLA 2DICA 2Q3AA 1BFSA 4MNQE 2ESVD 4N90E 3STBA 3Q0HA 1YMME 2CUHA 5C07E 3VFNB 1KBGH 1CTNA 2VDKH 1HOCB 1TCRB 3GMMB 5FGSA 4C4KT 5LCVL 3VXSA 5IKCA 4AY0A 5GRXG 4PB0L 5C86A 1I8KB 3SJVA 4LMQE 4YDLC 1MQKL 2EDDA 1YEGL 4JDVA 4M7LH 1YY9C 2BRRH 5CSZB 4F3FB 4K7FB 1F97A 2BY1A 3VXME 4GG6B 5CHNB 2HFGL 4U6VL 2BNQD 1QRKA 3KPSE 4KKLD 2IGFH 1CFBA 4N0FB 5DK0B 1MVFA 4F58H 1T7WA 1T22A 5SX5H 1S7QB 2EDBA 2R69L 1F4XH 1HZHH 1FFQA 7FABH 1RZJC 3KPRD 3X13B 1IEBA 4G8IB 4M03A 4YDKH 1MCSA 2OJEA 1MCHA 4XP6H 5ADPH 1QSED 1W0WA 4L9DA 2E7BA 4GT7A 4GRMB 3RIFF 1LD9A 4C58B 4DW2H 1BIIB 2BXYA 5I1LA 3SGDI 4XMKH 2CR3A 4WV1C 1U93A 5F21B 2NY5H 1LHZA 1HE7A 3C9NA 3L3DA 2AJSL 5D4QA 3UPCA 1A4KA 4BKLA 1U92B 4K3DL 3WS6A 3AB0B 3ZKXB 3D85B 1UEYA 2XZQH 4WNQB 4YPGB 1TETH 3BVNA 2NW3A 1NSNL 1CGYA 3JTSA 1BVLB 2KBGA 3CFKA 4V1DD 5I1KL 2J3SA 4WTZA 3BMVA 4O58H 4C83B 1HI6A 4BFIB 1CLYL 3X12A 2OR9H 5HYEA 3TO4A 4NO0B 4BFBD 3BGAA 2D0HA 1CZ8L 3NFPB 2HTLC 4EQ3A 4E0RA 5IJVA 1A1MA 3HR5A 3CSGA 1K4CB 3RIAK 4HPYL 4ZQKB 4RGND 3T1FA 1JHTB 1NAMH 3FFDB 3CH1A 2ZWLT 5D5ME 1VFBA 1C12A 2X1PA 1NMBL 4IMKC 1MLBB 4PD4J 3JV4B 2XWBA 3U46B 5IB3B 4PJ9D 1R5WB 1A7PH 4PFEA 1G7MB 2YUXA 3BIKA 2EDTA 3O6KH 3MJ7B 4NQXB 5FGRA 2Z8SA 3QDJE 5IB4A 3ARUA 5H35B 1ORQA 3TWCH 1HHJA 1T83A 1EK3A 3MFFB 4LVHB 1IGTA 3SEPA 3VGFA 1U8OA 5DF0A 4X4YA 1IEHA 3RIFK 3FB7B 2A6JB 5MI0B 1MJ7L 5LXGH 1AGCB 4M5ZH 2H26A 5KZCD 2EYSB 2AJUL 1R5VB 1CFNA 5E1AA 1TMCB 4JRXE 1JP5A 4PLOB 3L3OA 1QRND 1WBZB 3KPQA 5H94B 5FYLL 5FHBL 2HFEB 1SJXA 3ARPA 3MXVL 2BCKA 4X5XB 5TDNA 1MFCH 4PJIB 5SX4I 5FYKE 3ULVC 4DN4L 4R96B 4LDOB 5MENE 2BY0A 2BXZA 3QFJA 5T1MA 3WEXA 3QCUL 2GIYA 4WV1B 3ZZ1A 2VAAB 3BMWA 1SM3L 2FJFB 3HI1B 3LV3B 2R0KL 5I0DA 5DVLA 1VPOH 1NBYA 4X6DA 5J13C 4PG2A 2X1OA 4JHAL 5E00B 1J1PH 1JPTH 5HPMB 3I50H 3HZKA 4MJIB 4IS6B 2OQJA 3LKQB 4X6CA 3CDGA 3CXDH 3IFOB 1R3IH 5I76A 1LO3L 4PGBA 4TUKH 3TBVA 4Z0BH 3MBED 4KHXH 5HGBA 4PJCA 4U33A 4HZLA 3OX8A 4OCWL 5MEPB 4IIQA 4PRHB 2Y5EA 1FNAA 4GBXA 1P6AB 4UV4L 4H20L 2J8UB 5IFJB 4GW4A 2X1WL 5F7LB 4XPHH 2M8XA 2RCSL 4PPTA 4NRZB 3P40A 4HX1A 1F4WH 1ZSDA 3JWDH 3P2TA 4M7JH 2VZUA 3LVEA 5TF1L 5A3IC 2WK2A 1NCBL 3FQTB 5FK9B 5M94B 5LQBH 1HCVA 3TPKA 4OZGB 3O8XB 3HC4H 2HKHH 4YFLI 4UDUA 5IROA 3BSZL 5KSVB 2MCPH 4HXAH 1MFAH 4TVPL 1FC2D 4OSUH 2XQYG 5DJDA 3CFEB 4K9EC 1IGMH 3V52L 5KAQF 3PQYB 3F7PC 3L7FA 1SYVB 2WMPA 5F3BB 3HHRB 4KRNA 3WHE1 4LEXH 4ZNEE 1V7NL 4BZYA 3VFOA 5E5UB 3PWPE 4DJMA 4LVNB 2FATH 1EO5A 3RBSA 1JZ5A 1TNNA 4PBVC 3TP4A 4LSRL 1QO3B 4GAYA 2VQ1B 4DZ8B 1JNLL 4LEOA 1Z2KA 3WDIA 3BH9B 1XF5B 3UAJD 4MAYD 3VXPA 1QEWA 1JYVA 2BSSA 3TO2B 2P43B 2EC8A 4MGXA 3O3EA 2C3VA 1OGTB 4KDVA 3BP4A 4LKXA 2ICWA 1KB9K 3BWUC 3KLHD 4Y5VB 1XF3B 4QKXB 3ME0A 1U41A 1JL8A 4JZJB 4U1MA 5ALCH 2DQHL 4YHZH 2MMXA 3EYOA 1C16B 4N5ED 2DMKA 4AQ1B 2BSTB 3KWWA 4JPVL 1CQYA 1FIEA 4KK9C 5C0BB 3HNTH 3VDBA 3LS4H 3VGDA 4LHJB 1D9KD 3KYAA 3DRQB 2EEBA 3P9WB 1S9YB 1WAAE 3AAZA 1YDPA 3BPCA 2EIZB 4Z7UE 3KLDA 1S7XA 2PXYA 5F9WB 5DMYA 2PTTB 3GSNH 5I16A 1OAQH 3AC0A 2X4NA 2B1AL 4Y2DC 4ONGL 1MAMH 5AZ2L 2VLJE 1WAAF 3O2WH 4ZO9A 5JHDB 1AQDB 1Z5LB 4Z7UF 1MJ8H 4QRUB 2EDFA 2V2WB 2CGRL 2HT3D 3BQUC 3MRQB 4QTHA 4PGEA 5TDPB 3WKMH 4XP9L 4KJPC 1MQ8A 4XMPL 1JI1A 4LNRA 5D6CB 2P7TB 2GUOA 4KU1A 3BRDA 4UB0L 1QFWL 1W8OA 1JMZA 1U58A 3SGKC 3SKMA 5CGMA 4RFNC 1HQ4B 3GJFH 5EFIB 3U0TA 1S9XB 5E08H 5EOCL 2F74B 5DYOA 5E5MA 1RZGB 1HHGA 3IJSA 3S97C 3QCVL 2YPKB 1ZLVH 4HUWB 5AZEL 4ZS6C 3UCRA 4E5XB 1IGJB 2YRZA 5C2BL 3QDGB 2VISB 2Z9TA 4HMEA 1OQOA 4P46C 3ARWA 2APWA 5LAXA 1IGCL 1RZKH 1NGZA 2AK4A 4W81A 3LKPA 5E9DD 1PBYA 5KANG 3O6ML 1HHHA 4J3SA 1DQLH 2Y1VA 4G3YL 1QBLL 2VERN 3MV7B 1X5ZA 5DJYB 1YY9D 1AP2B 5JDJA 1W8NA 3GFUA 4OCXL 4RX4D 5HYSA 4PJDE 2NY3C 1OLLA 3P9MB 4YFEA 5T33L 3ROOA 4N1EA 2Q20A 3QUZB 3EYFA 5JW4N 5DJ6B 3FRPA 4NKQB 4NQVA 1PAMA 4PJXE 4PJDF 3PWVA 4KK8C 4XP1L 1MFEL 2ZJSH 4C57C 1DBBL 4JFZH 4X6BB 1Z9OA 1I3UA 4WU7A 1WZ1H 2X4UB 1IAOB 3F7VB 5IV2B 1JNJA 4P57B 5JXEC 3OXSA 1ZEAH 3HCVB 3H9SA 2VLRA 4PJXF 4UNTA 4Q0XH 3OXRB 4V2BA 3ZE1E 4LCWE 4AG4H 1UQSA 4KQ4L 5DJ0B 2E27L 4TSCL 5IOPA 3IVKA 4NQCA 1LE9A 5IW6B 1XH3A 1J8HD 3VFMA 3ZE1F 2VDLL 5IW1A 4OIBA 3VD5A 1FQ9C 1PX3A 2CSPA 2OTWA 4UQ2A 5GISL 5E2TH 4MJID 2H8PB 2OR7A 1HKLH 1A7OH 5BS0A 3HZMB 1KV3A 1U8PB 4TNWF 5K93A 3H3KA 3NOIA 3KNBB 3HG1D 5ACLA 2BX5A 3CFCL 2HLAA 1QZ1A 1Q9LA 3QNYA 2F15A 1EFXA 5BXFA 4PRHD 2NQCA 2FBOJ 1MELA 1WUNT 3MRLB 2ESVA 2BMKB 4R0LC 4RFNB 3DETC 4U7SA 4OCRH 1G7PA 4XCNB 2F8OA 5D2LA 1RU9H 5K59F 6CGTA 3BP5B 1U91B 4D0BB 1NFIA 1YEJH 5FUZL 2E7CA 1AE6L 1MRDH 2M26A 5ADOL 3DX8B 4MNHB 4NQDB 4ODVL 3KPPB 4KUZH 1F3JB 3O8XD 3VCLB 1ACYH 5CMAA 1R5IB 5IF0A 4HS3A 3NH7L 1PGRB 4JY4B 1BZ7B 4HDIB 4PLNC 4ZUTB 2FD6H 2CKBL 1RY7B 2JJWA 3OMZA 2F53D 4UQ3A 5BRZA 3GSUB 2HMIC 1PG7X 2BNQA 1BFVL 5C0RH 5KS9E 3MRRB 3ORJA 3S6CA 1XZ0A 1C7TA 3LH2H 2JJTC 1KXVC 1E4XI 5FYJU 2AS5M 1GGCL 1P84J 3VXRA 2Q6WA 5KS9F 3MRNB 1U3HB 4NNXA 1IGIL 2FJGB 3S36L 5DMKB 3BZFB 3KPRA 4D9QE 2BSED 4JQIH 43CAB 5MHSD 1AGBB 2IG2H 4QY8B 4EEEA 1IGFH 3WIFA 1ZA3B 3CVHA 4G5ZL 1QSEA 5ETUB 1ONQA 3ULVD 4HGMA 3LHPL 4WFED 3T09A 1OCWH 1A21A 5E4IA 2GJ6E 4OFPA 1I7RB 4TNWK 1JN6A 2VXTH 3U1SL 5CUSL 1EO8H 1TTGA 4LU5L 4EI6A 4EUPA 1AC0A 1CG9A 4HC1H 4S1SH 2G2RB 5ITBH 5ITFA 2HH0H 5E56A 1BOGB 1I9RH 3B9AA 2Y36H 5EO0A 4QHMB 4K8RL 1EHXA 4ZFOB 2JB5H 5EU7E 2P5ED 2X9YA 2EYTB 3HC3H 4NZRH 1GOFA 3MMEB 4WW2A 3LRHA 1L7TL 2EDWA 4EI5C 1DUZB 4R97C 3E6FA 2ICEB 2GJZA 5GGVY 2VN7A 5T5NG 5EUOA 1F42A 1EHNA 3QPXL 3ES6B 5B8CC 1CE6A 4XH2A 4LLDB 5GGVH 4FQIH 3CUPA 1A0QH 4N9GA 1J05B 2C1OB 3W5NA 3F7RA 1J8KA 4P9HH 4XC1L 1VFAB 5JW5A 1UM5H 1KC5L 3BHBA 4HKXB 1RIHL 4PJ9A 3ZE2E 1CU4H 5IB5A 1WQVT 3BD3A 5A3ID 4P9MH 2X10A 3LB6C 4R4BB 1G6RL 3WFCL 4G6JL 5JXAH 1PKQA 2DQTH 1JNNH 4XX1E 4NNPH 1CDIA 3CZJA 2W0PA 3Q6FB 3ZE2F 5TE4H 1ZWIB 4PRPA 1U8LB 3QDGD 3FQXA 4RSVA 5B39G 1FVCB 4ODXA 1H3TA 4X99B 4HAGA 4M3KB 5J56B 2CIIA 4ZTPL 4PJAB 1EJOH 1Y6KR 2AK1L 3MV7D 2V17L 3MOBH 2WUCH 3HE7B 4MYWB 3VXTB 1MWAA 1J1XL 2J6EH 5JPMA 3QG6A 1GC1L 4PRIA 3UJJH 2NYYC 2ZOKB 4PJEE 1CE1L 3JV5A 2YPLA 4PJFE 2GK2A 4DK3A 3W9DB 3U48A 5ICXB 1FO0A 4PY7B 3X3GH 4H1LH 4DFIA 1SYSB 3IKCA 4PJEF 5INDB 4PJFF 2WINA 4UNUA 4NZTH 4P3CH 1A1NB 2QEJA 1FNGB 3QEQE 4YQXH 3QO1A 4Q58C 1R0AL 5KVFH 2FYYB 4FTVD 3GMLB 4P59H 1NANI 2YZ1A 5IWLA 3L3KA 5ACZA 4TOYL 4KK9D 3R1GL 2PYFA 1AH1A 1YQVL 1YPZB 3D2UB 1E27A 2R4RL 4EI5B 2R0LL 2BVEA 4R97B 4MQ7A 1HSAA 1KIPA 2XKSA 3LIZL 4UV7H 2AEPH 1S7RB 3HZYB 3PGDB 4K71B 3ARBC 4JPWL 3NMEA 4QXTB 4TNVF 3IDXH 3HUJB 4U3XA 4Y2DD 3OTTA 5I1DA 3WJJA 5EOCJ 1Y6MR 4PJ5E 4PUBH 2OTUA 3B5HA 1MUJA 3BQUD 5GRJH 4AIOA 4KJPD 3PNWA 4RAVB 3DV4A 4FQ2L 2FGWL 3VWJB 4DCQB 4Z76B 4F7CB 1LNUA 4FFVC 4HIXL 5F1NB 4UTAH 1ZHBB 4F15C 4ZDHA 1S7WA 1RK0B 3S36X 1HOCA 1TCRA 2VWEC 2ZPKH 3GMMA 4ZS6D 1KCRH 1I1FB 3MJGX 4NQDD 5EO1B 2VZVA 1NAKL 3KPNB 4P46D 4KJYB 4R26L 4F33B 3TM6A 1I8KA 3LPGA 4IJ3B 3ARRA 1TQCC 1X4YA 2VR5A 5MEQB 1IEAA 3UJTL 2IWGA 5CSZA 4F3FA 4KTEH 1U6AL 3GK8L 4K7FA 4WI7A 4IRZL 4GG6A 1CD1B 5CHNA 4OZHF 2X6MA 3QJFB 4XWOC 3H42L 2A74A 4XCEA 5FXCH 1B3JA 1BHGA 1CGSL 4N0FA 5DK0A 4X7SL 3RA7L 1S7QA 5H8DA 3EJZC 1AKJB 5EU3B 4G9DB 3IAQA 3U0WL 2FECL 2YA2A 3QH3B 4D0CB 3X13A 4TNVK 4G8IA 4KK8D 3NACL 5EBMB 1RZFH 1AHWB 1YEKH 4OZ4B 1BIIA 5TE6H 5L2KB 3MLZH 5JXED 3T0BA 2CJUL 2XQBL 5HHOE 2CLVA 1RUML 5FYJD 2D31B 3MOAH 1U92A 3D85A 4WNQA 3TNMB 4YPGA 2IBZY 3MLUL 5CINH 4FNLH 1BVLA 3IDYB 4OD2B 1PLGH 1T04A 3ARBB 4JVWA 3K8KA 1GGIH 3JWOC 4C83A 2R1WB 4BFIA 5T3ZE 1FG2B 3VXUB 2DL2A 3TH3T 4NO0A 5FM4A 5CJXC 4I2XE 3NFPA 3C5ZC 4AEHL 3L3HB 3BIBX 1IGYB 2OK0L 4GLRI 3LN9A 4OLUH 1K4CA 5CCKH 4ZQKA 4LGSB 4DKEL 4ZS7H 1JHTA 4F9PA 1EEUA 3FFDA 3DETD 3CU7A 4F15B 1MLBA 1FBIL 3JV4A 3U46A 5IB3A 4NN5B 4KAQH 2D7TH 3AREC 1G7MA 2J5LC 1UJ3B 4HUUB 5I9QC 2EXWC 3ZKMC 3MJ7A 4NQXA 4Z18A 3BKYL 1I9IH 4K7PY 3DSNA 5A43C 4OB5H 3ZE0F 4TTDC 5H35A 3G6JF 1TQCB 1LDPL 3DJ9A 3MFFA 4K7PH 1H15B 1S5IL 4Y89A 2GEEA 2O26U 3DSFL 4HK0B 2A6JA 1JGLH 3HMXL 4X9GA 1AGCA 2HMID 1SQ2N 2EYSA 1JBJA 1R5VA 1FSKB 3NFNB 2V9RA 4JPIB 3FN0H 3HE7D 5B21A 1WBZA 4X80H 4XNXH 1J1OH 2BJML 3OF6A 4Y88A 5H94A 2HFEA 4M5YH 5IHUL 1JHLH 3DLQR 4WI5A 3LEYH 5CP7B 2L0DA 4PJIA 3V4UL 3SGDH 4ZPTA 1FYTE 4R96A 2UWEB 4FOMA 2ADFH 1AQKL 1XR8B 4ZSOB 3K0WA 1UWXK 4TQEL 4WV1A 3DUSB 1MCEA 5F1IB 4X8JB 3TBTB 5SWZE 2VAAA 4OLEA 2LABA 3SE9H 2FJFA 3EOTH 3LV3A 4XC3H 3TT1H 1BREA 3H0TB 4M93B 4PR5B 1DUYB 3O2DA 4Q6IB 4XRCB 5E00A 2YMXL 1HCFX 5F89B 5HPMA 3MRFB 3QHFL 5K9JL 5KW9H 4MJIA 3D2UD 4IS6A 4PS4H 3LKQA 4ZO7A 4EI5D 1JUFB 1P4BL 3IFOA 4YFDB 1FFNB 2J4WL 2ZP0T 5DQJB 3QHZL 2HWZH 1CIUA 3WFEL 5A2JH 4A6YB 3GNML 4D3CH 2EE2A 5DT1H 1G7IB 5MEPA 4PRHA 3TA3B 5EULV 4B7IA 1C5BL 5IFJA 2J8UA 5FFLA 2PF6A 3GBLA 4NRZA 4K3GA 4I3SH 4M62H 2XNAB 2E3VA 3BDYH 3FT3B 1JGVL 2E7LA 4CDGC 4L3EE 5E6YA 5D2NE 3FQTA 2ARWA 3JWNC 4TSBH 3S37L 5FK9A 2MKWA 25C8H 3GKWH 2J5LB 4FQCH 3LB6D 4KGLA 4OZGA 4AM0B 3O8XA 5FYKL 4WFHE 1B2WL 3RPIB 1BJMA 4WCYH 3MGAA 4G7VL 5KSVA 3RX8A 3HRZB 4RGOH 5FOBB 2DQUH 3CFEA 3D25B 2EE6A 3PQYA 4XPFH 1H3GA 4DFHA 4DVBA 1SYVA 4MA7L 5JA9A 5F3BA 1KBGL 2VDKL 1EV2E 3EOBB 4R2GC 2CMRH 2AEQH 2F9BT 3SDAB 5GS0H 3QFDB 5T3XE 1B90A 1WBXB 4FQXB 3O41A 1GZPB 3NCMA 1IAII 2XN9B 4F9LC 5GGQL 1QO3A 4DZ8A 2VQ1A 3BRGC 2NYYD 3FN3A 3BH9A 3CCHB 1YNLL 1QBAA 4JANB 2YOCA 5SX4H 4L8BB 3N06B 4M7LL 3TO2A 2BRRL 2B0SL 4CDHA 5E95B 1OGTA 4LBEA 1AKJD 5ANMB 1XF2B 2F8XC 5I66A 2DWEB 2ZUQC 3DTXB 4Y5VA 1XF3A 5AEAA 3VWKB 4C59B 2IGFL 4PREB 4TYUA 1U2HA 3LEXB 1LEGB 4F58L 4JZJA 1C16A 4ZODA 1F4XL 2CRMA 4GH7B 2BSTA 5CP3A 5GGSB 3OG6B 5L2KD 2UZIH 1A7NH 1KULA 3MQIA 5C0BA 7FABL 4NHUB 1GHFL 3DRQA 3SHSA 4YDKL 5ADPL 1S9YA 2XXMB 4U1JB 5IEHB 1P7KB 2EIZA 4LQ1A 3SDCB 2PTTA 2NW2B 2VDQL 2NY5L 32C2B 1P2CB 4MJ5B 3ARBD 2VN4A 4AIXA 5JHDA 1Z5LA 2MHAB 4QRUA 3VXUD 3E0GA 5IQ7H 2IH3B 1TETL 2V2WA 3CJJA 5IFAH 4OZFG 4ACPA 3QP3A 3MRQA 3IDUA 5D96C 5TDPA 4MDIB 4YZFE 5A16B 1J12A 4NWTL 5DD1H 4JFDD 5D6CA 4Q9RH 2GHWB 2B4CH 1HQ4A 2OR9L 1Z3GL 5EFIA 1FGVH 1VFUA 1S9XA 1HIMH 2F74A 4YZFF 4FFVD 5BZDB 2P8MB 2YPKA 4NBYB 4HUWA 4X6FB 1OW0A 4E5XA 1IGJA 4MA8H 4O9HH 2DQEH 3CFIC 3QDGA 2VISA 3FFCA 3W81A 3I6KB 1NAML 3O11B 2BVUA 5EU4B 1ZLSH 5ELIA 1Q1JH 3QFJE 3IJHB 3I3DA 2C5DC 4XBEL 5F9DC 3GUTB 3MV7A 2Z8VC 5KVMC 1A7PL 4HCRA 4JPKH 3O6KL 5DJYA 5HYJE 4DQOH 2EH7H 1OQXA 1AP2A 3PL6C 5IVXB 2R2EB 4X6DE 1WWWX 1IC5H 3TWCL 2FRGP 3P9MA 1UGNA 4E9LA 2H9GB 2GTZB 3JXAA 3QUZA 5DJ6A 3MLSH 5HY9B 5E1HB 4X6DF 3H7BB 4LSVH 1U3YA 3EJZD 2I27N 5LXGL 4M5ZL 3OAUL 4KTYA 3UTTB 5FGBA 1NFDB 2ZUQB 1Y18B 5DEGB 4PJCE 4X6BA 2KQMA 3F7VA 1IAOA 5IV2A 5D7IB 1TZHB 4P57A 1OSPH 3HCVA 3QZWG 4K55A 1O0VA 3OXRA 4L4VE 2M2DA 4BJLA 1MFCL 3BT2L 5IP4A 2VC2L 5JIKA 4PJCF 3L5XL 2VUOA 2A6IB 1CDJA 5DJ0A 3VG0H 3WJLA 3S37X 2LTQB 1QBBA 5IW6A 3P3YA 3QWRD 1FGNH 1QBMH 4EXKA 4GXVH 1G0XA 1MJUH 1NUFA 2Q76B 3PJSB 1UT9A 2H8PA 4ISVB 1QA9B 2ZUYA 4UOW0 3HZMA 3O9WC 1U8PA 3C5JB 5JLZB 1A7QH 1DN0B 1JPTL 1J1PL 3KNBA 5D96B 2HLFC 4FFZL 1QLFB 4JFHE 2QSVA 5I2IB 4GQPH 1EERB 2IFFH 4OZFB 2AEIT 3I50L 3TA3D 4RFEB 5F6HI 3MRLA 2BMKA 1TTFA 1I8IB 4TUKL 4JZOB 2CDEB 3RWGB 3BP5A 1U91A 2RR3A 4D0BA 3GHEH 3QNZB 5C3LD 4LPTA 1MEXL 3DX8A 4WRLA 4MNHA 2YC1B 5LKNA 1JPGB 4XPHL 3ARED 3KPPA 1U0QA 4YHLL 3JWDL 1F3JA 3VCLA 2EXWD 4I77H 3ZKMD 1R5IA 4JY4A 4L4TD 1BZ7A 3NZ8B 4HDIA 4TTDD 3CX5K 1T89C 4ZUTA 3C08H 4HFUL 5D1ZC 4NUGH 1CDBA 4YXLH 4UU9B 3HC4L 3GSUA 4NHCH 1HILB 3PL6B 5F1SA 2MCPL 4HXAL 3MRRA 4NRXB 1MFAL 5FECB 4OSUL 4P2OB 3SDAD 1IGML 1BAFL 2UZYB 4OF7A 1YEFL 3JV6B 4BFGA 4FQXD 12E8L 5HGHB 3MRNA 1CFSA 1U3HA 2FJGA 5DMKA 3BZFA 4LEXL 3QXTA 43CAA 4M02A 1AGBA 4ZOAA 1ZA3A 3AS1A 5ESVB 5ETUA 3MRHB 2AV7A 4AT6B 1NGWB 3K1DA 1I1RA 4LRNL 4F7TB 4BUHA 5IGXH 5JXEA 4YDJB 3RTQB 1I7RA 4ZFZB 1DR9A 3CVHH 3VWKD 2LU7A 1T03H 4Y19B 2G2RA 1UM4H 3FMGH 5AG9A 1NH6A 5LGKA 1BOGA 4QOKB 4QHMA 4ZFOA 4JCLA 4EUPH 2EICA 4CU7A 4JO1H 1TJIH 3MMEA 4Q6YA 5TH2B 1FNHA 2ZG1A 3CH8A 3ZTNH 4CUCA 3TBWB 5ILTH 5TQ2L 4YHZL 1JNHB 4OLYH 5D71H 1DUZA 3DX9B 4PGCB 2ICEA 3VMOA 1FZKB 2MNUA 1KGCE 3ES6A 3RY4A 4LLDA 3HNTL 4WVRA 3MJ6A 4Z95L 2X4TB 2AK4E 1DFBH 4U2ZA 3RJQB 1J05A 2C1OA 3E6HB 3J7HA 2FSEB 2I60H 5C09E 3GSNL 5LWYH 3RVXC 4IBLT 3V0WH 1VFAA 1MHEB 1MAML 2GSGB 3P4NB 3O2WL 4HKXA 3MNWB 1MJ8L 1MI5D 3VRLE 2W0LA 4R4BA 2LFGA 3RRQA 2EH8L 1CF8H 4Y16B 1KB9J 3F58H 1B6UA 3Q6FA 3H9YA 1EJ6A 1U8LA 3VRLF 5IHLB 3QEGH 2XTJE 1FVCA 4PYHA 3Q2CA 5E08L 3WFBH 2ADIB 4Y1AE 3FO9B 3H9SE 3OR6B 4L3CB 5FKAB 5BV7H 2R4SH 4O02L 4OBSA 1QUNA 3G5VB 2JJUA 4LPYA 1WIOA 1YMHB 4PJAA 3T0EC 3G6AB 3EDKA 3QWOB 1E4XH 3IFNH 1A6WL 2XKUA 3HE7A 3VXTA 4KKNA 2JJTA 1XIWC 3HNVH 1CD8A 4BQ9A 1RZKL 2G75B 4GMSH 4NQCE 2ZOKA 4ZAKC 3O3UN 2AEWA 2NCMA 2AJXH 3FB5B 5IBLC 3ROLB 1NCCH 1MWAH 3EJYC 1G7QB 1QR1B 3W9DA 2EDQA 5ICXA 4M6MH 1PVHA 1ZK9A 4PY7A 3UTSD 1NCDH 3W0WE 5BS0E 4L8SC 1SYSA 1T4KB 2DQFB 2ED9A 5DDHB 5INDA 3N1QC 4XVJH 3LD8C 4JY5H 1DEEB 5BZWB 1FO0H 1A1NA 1FNGA 5JUEH 4QRRE 1WCBB 2FYYA 4P2QB 3GMLA 4KZEH 2COQA 3OJVC 4P2RB 5D2LE 2BVTA 4JFZL 1AD0B 1WZ1L 1YPZA 2IPKB 3D2UA 4EI5A 5F70A 1KCKA 4HFWB 4DZBB 1FV1B 1ZEAL 1WVZA 3HZYA 1S7RA 3PGDA 1BJ8A 1HEZB 2F58H 4Q0XL 3RKPA 3F6IA 2VAJA 4QXTA 5D2LF 4AG4L 3HUJA 3TGXA 4HUXB 1QLRB 4BELD 4UZGA 2ZOLB 5BRZE 4W68A 2ITCB 4RAVA 4W4OC 5E2TL 1EH9A 4YO0B 4I1NB 5IM7B 3VWJA 3S35H 1HKLL 4Z76A 1A7OL 4TULH 4F7CA 4HK3N 5FGCB 5JW4Q 4Z78B 5F1NA 1T1WB 1ZHBA 4ORZC 3VXRE 1QNZH 1YUHB 3DVFA 1RK0A 2HAZA 4GXUN 1I1FA 4D9LH 5EO1A 5DZOA 3KPNA 4KJYA 1RU9L 4F33A 1K85A 3TYGL 3ZYJA 1FZJB 1YEJL 3W82A 3BUYB 3NIFE 4UT7H 1WZLA 1MRDL 5MEQA 4J2XA 5E8OB 3CFBA 3GM0A 5JMRA 4FFYH 1CD1A 3A6OA 1XIWB 3QJFA 5TE7H 3PL6D 4LPWA 1XMWA 3NIFF 3Q1SL 4BQ8A 5DVOA 4ZAKB 4XPBL 3D3VE 2V7NB 5DJCB 4I48B 1DVFC 2FD6L 1MAJA 3EUUA 1F45A 1SHMA 2YD2A 1AKJA 5EU3A 1BD2E 4G9DA 5C0RL 3PV7A 1EAJA 4XT1C 2XWTB 3QH3A 1UVQB 4D0CA 2ICES 4MQXC 4WW2F 3LD8B 5EBMA 1AHWA 5EU6D 4Q9BA 4OZ4A 1NANH 4MDJB 4XB7A 1JYXA 4Y4FB 5L2KA 4U6HB 5E24E 2CK0H 3DBXA 1K6QH 2VZ3A 2D31A 2NX5B 2IG2L 2MCG1 1IGFL 1NC4B 5GSVB 1BGXH 3LN4B 1BM3L 3TNMA