1QFUL

Influenza virus hemagglutinin complexed with a neutralizing antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQTLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQNTHVPYTFGGGTKLEIKRADAAPTVSIFPPSKIQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords PROTEIN (HEMAGGLUTININ (HA1 CHAIN))
publication title A complex of influenza hemagglutinin with a neutralizing antibody that binds outside the virus receptor binding site.
pubmed doi rcsb
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1999-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfuL01
2YUZA 2HTLC 5EORH 1NCDH 4PP1D 1SJEB 2Y06H 3C6SA 4GRWH 4X5WB 3RGVC 4PD4J 3GSUA 3BDXA 5LBSL 4LFHD 2R4RL 1C7SA 4GW1A 4U1SB 3OG6B 4D0DB 1I8KB 1A2YA 3GI8L 3HPJB 4D8PB 1MRDL 2B1HL 1OSPH 4U0QB 5AG9A 5AYUH 1F3JB 2F5AH 1CDUA 2E9JA 5IVZA 1JZ2A 3T0EC 2Y06L 5DMKB 3QA3B 4GW5B 5FYKH 3QUKA 2O26U 3VD5A 3L3GA 43C9B 3UC0H 2G5RA 5I71B 1D5ZA 5CEZE 4I2XE 5E2TL 2WW8A 2VXUL 3GMQB 2C4FU 3CFEA 2F5AL 3BJ91 1T89C 4JY5L 1AGDA 1CCZA 4LSTL 4ZTPL 1YEGH 2WUCH 1HYSD 1FVDA 1G7QA 4EEEA 2CRMA 4NQSB 4HJ0C 3PJSA 4JHBA 3LN5A 5ITBL 4OCSH 2XKUA 1YEKH 3ARPA 1YECH 4ZPTA 1H3XA 1QSZA 2BOBA 4X6EB 5EPMA 4FA8A 1AGCA 2HLAB 1QD0A 5FUOL 5AG8A 4LRNL 2WUCL 3BPOC 1EUTA 2DDQH 2HJFB 1RI8A 3CLFH 4WUKH 1ZHNB 4Y4KC 2HVJB 3KXFE 4URTB 3B9KA 4IRSC 4N8VA 3BPLC 1RMFH 1YEKL 3VXME 5KVFL 1MRCL 4APQB 5T1LD 1XEDA 5JPNB 4LCCA 3C6LD 1JHLH 4P5TA 3OJ2C 5GS2D 4F7MA 1RJLB 3CLFL 4FN0A 2A6JA 3P4MB 3IJYA 3MUGB 5MEPB 5JW4Q 4EN3A 3O2WH 5E4EB 2VC2H 3GSXA 5IV2B 4WCYH 1U8JB 2EDLA 4P99A 1YMMD 2HT3D 5DJ8B 2FX7L 1U2CA 3P4NB 1OSZB 3MXVH 4M02A 5EU5A 5BV7H 1YMHA 2ARWA 2L4OA 3D3VA 3MODH 5D6CA 4LFHG 2H26A 4RMQA 1AO7E 4PB0H 3SDAC 4TVSa 4G5ZH 2H41A 1M05B 4I0PB 3P77A 3CDGB 5C0EB 1D5MB 3QQ9C 5D71H 1HHIB 3TNMB 2EO1A 3MXVL 1A4JA 5C07E 2OK0L 1U93A 5BV7L 4ZFOB 3BWUC 2AQ1A 1HCFX 2PR4H 2WP3O 5GRXG 1IQDA 1RULH 2WBJD 3L5HA 3MRMA 1PSKH 5I66A 1D9KC 4C55A 3MJ9L 5IB2B 3A67H 2YD3A 5IF0B 3RWEB 5HYFA 1RSFA 1J5OH 4ZUVB 5HYQB 3TYGL 3ALXA 4I4WB 2VNCA 4Z78A 1A4KA 2AJXH 4U1IB 5DGQA 5BZWA 3MBXL 2J6EA 2PR4L 4FFVD 1KJVA 1E28A 2PW1B 1ZANL 2DF3A 5GIRA 5ACLA 3OXSB 3G5ZA 3F6LA 4OCNC 3B8YA 3VWJB 3CCHB 1DSFL 4M3JA 5KSBA 3G6JF 4XMLH 3JTSA 1AFVH 5MP6H 4CN4A 3DETC 3BZ4A 3IDYB 5F3HA 1GIGL 4QHKI 1T0NB 2FL5B 1A5FL 3KPSE 4P2OC 3EYFA 3RJDA 5LGJA 3IFNH 5C0BB 1RAMA 4GKOA 3O9WB 3MJGX 1F8TH 4G6AC 4BK5A 1JZ7A 3HRZA 2NTFA 5CWSA 1OAZH 5MP6L 5E6YA 4Y0GA 1HHJB 3R1GL 1ZT7A 2HN7B 2XTJE 3MR9B 3UJTH 3TO4C 3GK8H 4JFFE 4FP8L 3VH8A 4PUBL 1J10A 2OP4H 2JB6A 2X4QB 5IBTL 4Z76B 4HG4K 3IFNL 1XGQA 3D48R 1F8TL 3B9KD 1NKRA 3ARDB 2AJVH 2B2XH 3FO2B 4TUOA 4AJ0A 1UACH 1T1ZA 2W07A 3UJTL 5KG9A 2R1XB 3ZDZE 5ID1B 2X4UA 3QBTB 4B41A 4B7LA 2XZZA 4MAYA 1P4IH 4X4ZA 5IEHB 1ZT4B 4XVTL 2UYLA 2AJVL 2B2XL 3O4LA 2X41A 1KSRA 4KROC 1JL8A 2EYTB 3MNWB 5D7IF 2OQJA 3MGOA 3RZCA 4MJIB 4X99A 5I8CA 4ODXA 3UTTA 1NC4B 3VXPA 4EI6B 1QLEH 2DIJA 3MLTA 2DQFB 3OL2A 3U48A 1FVEB 1ROWA 4LCWD 3WO4B 2RBLA 4PJBA 2VABA 5ILTH 5EBWB 2HJLB 4K8RH 5J9PA 5FDYA 2ENYA 5FCSH 5I8EB 3O6KL 2P43B 3VFRA 3TO2B 2P8PB 2YD4A 2VR5A 4G6FD 1QLFA 5HHOE 5ENWA 5HYIA 2IBZY 1R3JA 2Y36H 3NGBC 1CL7H 3VXRE 1OTUD 1VESA 1TVBA 4M6NH 1LO3L 4P9ML 4HFWB 1TZIB 4XB8A 5DK2B 5A2LH 2VISA 3T3ME 3VWKB 4NJ9H 1F58H 3FB8A 3BN3B 4U7SA 3MYZA 3ZKNC 4NQCB 1IQWH 2WP3T 2J2ZA 4UQ3B 1I3UA 2Y36L 4PV9B 4KI5C 5B8CA 2JCCA 1I85C 1SHMA 2ZPKH 4TSAH 3PABB 1CL7I 4NPYB 1J1XH 5GJTH 1QA9A 5DO2D 3RUGF 2IAMB 3C2SA 4OV6F 5C8JA 2DBLH 1PQZA 4N8VG 1KPRB 1UCBL 1BWMA 2YC1B 4UT6H 1NEZB 4NKDA 3VFTA 2CIKA 4U6XA 1EAJA 2E5EA 3BW9B 5FFLA 3HC4L 1J0YA 2ATKA 1S9KC 3HZYB 1AY1L 3ELAT 4YQXH 4ETQB 4JFDB 4R97C 3X11B 1I7UA 1JN6B 4U1GC 4P4KB 3CFCL 5HHXL 1MREH 1FO0H 2FATL 1OGAB 2HFFA 2L7JA 1FVCA 5KS9B 4WUUB 1HINL 3U7WL 1QVOB 3GO1H 5CBEB 2I5YH 2PCPA 4YQXL 2EE2A 3GB7B 4FG6C 1KB9K 1R5WB 3E6HA 3DUSB 1LE5B 4RGNE 4HG4J 3OV6A 3THMH 4YBLC 1N6UA 1MREL 4MAYD 4AMKL 3ESVF 4R4FL 1FE8H 4F2MA 4F58L 4HF5H 3JBG7 3P9LB 4YDLC 5EULV 3MJ9A 3MRHB 4ZXBC 4TUJA 5J3HC 5L2KB 1R3HB 2AJUH 4Y5YC 1XGYH 3RZCD 3KJ6H 1A21A 1WK0A 1IGYA 1N3NB 2ZOLB 3CMGA 1FE8L 1HKFA 1I7ZB 4QOKD 4LGSB 3QDME 2GW5A 4BQ6A 1R3LA 2ICWI 3LS4L 1B4RA 3DSNA 4Y16A 4UILH 4Q0XL 1GZQA 2AJUL 3PWNB 2JJUA 3TBSA 3SDXB 3KJ6L 5GGRB 5DMIH 5AZ2L 4NJAL 3CU7A 2ADGB 5ACZA 2E8YA 3FFCB 4LL9A 3D69A 1F45A 4M1GH 1EEYA 3OR7B 4OFIA 2AERT 4LLMB 2WIIB 3CU1A 3OKOA 5F6HI 5FB8B 5FYKD 3HCVB 3DHJA 4OD2B 5T3ZH 3INUH 3QDGB 5DMIL 4RA3A 1PEZA 4R96A 3V0VB 4JM4L 4MS8D 1T5XB 1Z0NA 1YC7A 1NCUA 5A2KH 4PJ7A 4DOHB 4QTIH 4YXKL 2EIBA 2FWOB 2G2RA 3PWVB 3EYOA 4PJHB 3VH8G 3TBTA 2FJFB 2EDOA 1T1XA 4MNHA 2LABA 3T65A 3L95A 4X6DB 2RCSH 4ZMAT 1DBKL 2JJTA 3EZJB 2H1PH 5HHVH 5HYJB 2P24A 4QTIL 5GRJL 1NAMB 3HZMB 3ZHLA 1TQBC 4JQVA 1VA9A 2CRIA 5L8KB 4KDTC 1YDPB 1QNZL 3WFHB 5J13B 5I16A 1QFHA 2CDEB 4KK9C 1INQB 4XWOC 3K46A 1BFSA 2RCSL 5SX5K 3W0WE 2H1PL 2LU3A 4Q74A 3KPQB 1VFBA 4JFHD 2BSRA 3VD4A 5EN2B 3FQTA 2ZCKH 1H9VA 2NX5E 5JW4R 1XCQB 4MD4B 4BQ9A 1OP5K 3TJHC 5T33H 3DVIA 1AE6H 1NGPH 4HIIA 5L88H 5JR1H 4LSQL 1IC4H 4XNXH 3BIKB 3L5IA 5MENE 3VGAC 1ZVHA 4JY6B 4ODVL 1C5CH 1AD9A 5KAQG 1FORH 2VXVH 3QFDA 4NRZB 1WBYB 1PFCA 1JVKA 2FSEB 4RDQG 1VKXB 5L88L 3MV01 3ETBF 1AIFB 3WIIL 1DUZB 4XNXL 3PWLA 1T6VN 1UJ3B 2FHBA 2WWKO 3MV11 4YZFF 3RGVA 3O6FC 5IMKA 5FO7A 4JPKH 2ZUQB 3R06B 2ZSWA 3MRGA 4AZ8A 1DBAH 3S4SB 1JGUH 2BCKA 4ENED 1O5DT 2DRUA 3DARA 1U8QA 1KCVH 2EDTA 3KG5A 5C0GB 3CC5B 3PWPA 3STZA 3ZSTA 5GHWH 3Q6FA 1Z9LA 1OD7A 4DK3A 4HIHB 4XVSH 4PJIB 3D39A 3SGDH 4CNIA 2FO4B 1T0MA 2BVUA 4PP2B 2A2QT 1V3LA 2B39A 2PETA 4TQEL 5D5MA 4HK3J 1NCTA 3PHQA 3NTCH 2NQCA 1OGTA 1RPQA 1Y0LB 5GHWL 4IMLB 2LVEA 3HS0A 3MCLH 4KZDH 5FGCB 4RMSA 4OM1H 1UADC 1U36A 3O41B 3WL9B 2R2HB 5F6IB 1C12B 3RAJL 5DHYA 4Y4KA 1DQLL 5E2WL 4P3WA 1IKFH 1ZT1A 3EFFB 4IRSA 3CSYB 3NTCL 1FO0A 2NR6D 4DZ8B 4MJ4A 2FNBA 3O6LH 3SGDI 4HV8A 3OKKA 1CD1A 4KUCD 1S7SA 4HDIA 2ED8A 1FLTX 2CR3A 4R7NA 2ZJSL 1UYWL 3U36B 5IGXH 2VUOA 4AENA 4LDOB 2ZZUT 3LHPL 4P2QE 1BGXH 4G8IB 3A6OA 5ERWA 1JE6A 3FTGB 5FYLE 2DLGA 5H35B 1N5YH 3PWJA 1KIQB 3CFKA 2QHLA 3P40A 1RVFL 4KJPC 3OAUL 3GJFK 5I73C 3KYOB 5GXBB 4XBEH 2D0HA 5KANG 4TRPL 3D25B 2JIXB 1X5JA 4GLRI 5C0CB 3SDAA 4OZGF 1IJ9A 5F1SA 3FQWB 4L5FL 3LV3A 4CMMA 3BPCA 2ADFL 5KN5A 4RMRA 1DVFC 3BKMH 1TJIH 3OPZL 1T3FA 5TDPB 1OT1A 4K8RD 1J86A 4BUHA 1GZPA 3VFPB 2AK4E 3LZFH 1BF8A 2A38A 4FXGA 3EYVA 3RA7L 5EA0H 3H42H 1MH5A 1CR9L 5C0JA 2OL3L 1TJIL 4FTVD 4GRLC 4K7PL 1M6OA 3QUYC 3VFMA 3UTSD 3H9SB 1QRNB 1JZ3A 3O3UN 1W0WA 2VL4A 4MNGE 1PX3A 4IRJD 5M7QA 4PY7B 1F11A 1A9BA 5J0BA 4JPWL 1P7KA 4YDJB 3QQ4B 4NKIL 2F54E 4TN9A 3VGBA 3HAEA 4G42A 2WINA 3PWPD 2ZNWA 3EAKA 3G6AB 2X4SA 3C09C 4GRMB 3LKPB 5DJXB 1TJHH 3EW3B 2Z31C 4U6VL 4JREC 4P2OA 3HFMH 3D39D 4BKLB 4J3SA 2X09A 5BQ7B 1LVEA 4AM0B 5H94A 5D93C 1OAUL 2X7LB 1CFVH 4KHXL 4HJ0D 4NUJB 4FXKB 3T4YB 4E0RB 5CLWA 5LXGL 3QDJA 1XGRA 2KL6A 3MSPA 3MV7A 3TO4A 2YBRB 1UFUA 4MD5B 3HFML 4NNPH 4PGDB 3RWFA 4IIQB 4PBVC 3VRLF 2P5WA 4Y4HB 1UM5H 3TVMC 4D94A 5DMJB 4IRSD 4UNVA 2OI9B 2Z93B 4N0FB 1BVKA 2KQNA 4KY1H 1KLGB 4HGWB 3NFNB 5E8EA 3LIZL 4E41E 2VE6B 4IRZH 2BY1A 5AD0B 2CUIA 4NO3B 1LK3L 3AROA 1RK0B 3BH8A 1FZOA 1UM5L 2QADC 3DV6B 3V8CA 3T09A 4WWKC 4F7TB 3R0NA 4Z6AT 3RWHA 4KY1L 3RVVC 1U8PB 3L3JB 4GOSA 1G7PB 1RJCA 2VH5H 2D31A 4XPFH 5EO0A 5EU6A 4J4PC 3TWCL 3ULVF 4EI5C 3LB6C 4KZEL 1ACZA 5DJ2A 5IB1B 4ODUA 1B0RB 8FABB 4PYGA 5HHMD 1W0VB 5MERA 2OTWB 3VD3A 1TZHA 4KTEH 3TH2T 2H2PC 2AJ3A 2VH5L 4F8TA 4JM2D 4XPFL 3C9NA 3QQ9D 4YXLL 1X5LA 4M8QB 4ALAH 3P4LA 4KRPD 1YPZB 1FRGH 4UOW1 1YEDB 2C9AA 2OJEA 4HBQA 5I76B 5DFVD 4I1NB 4KTEL 1PJ9A 1D6VH 1HH9B 4PJEB 5ISZB 1BP3B 4QWWD 1FRGL 3MUZ1 3V6BR 4CW1A 4YHOL 5FO8B 5DJCB 4OZHF 4QXGL 4HS3A 4L4JA 5T3ZD 4U1JA 1CFQB 3S35X 1S9YA 3MNZB 2X4NB 2HVKB 3NACL 4Q2ZA 4ISVB 3WFCL 1I85A 4MQ7B 4ZFFA 1J9CT 4S1SH 4RGNC 2VLJA 4OFKA 1JGDB 1U3HC 1ZK9A 4GKSB 1WAAA 3G5XA 3F12B 1FCGA 4F7EB 3DETD 4XVUC 1N8ZB 1TETL 5IMOA 2W38A 5DA4A 1CU4H 4P2OD 2V5RA 3N50A 3BT2H 4BJLA 3EJJX 4WHTA 2AJSH 5CHNB 5EUKA 5LGHL 4LIQH 1WGOA 4U3XA 4XRCA 4FQCL 2VLLB 3QDJD 3QJHA 1ETZB 4MCYA 2AKRB 2VLKB 1CU4L 3MV7D 4OBRA 3S6CA 4J3VA 2F53E 3WJLA 2H9GB 1HHGB 2P4AB 4HWBL 1HCVA 4HHAA 2FD6H 5KSAC 2OSLA 3KYKL 3SE9L 3DTXB 4ELMF 1NBYB 1F4YH 4YIQB 1ND0A 1S78D 2DTML 4KJYB 2B8OT 2BC4A 3DUHA 4XMPH 1NGQL 2CUHA 1K9TA 2D03L 1QFWL 2IPUK 1T22A 2XQBL 2W9EH 4Y5XA 4HH9A 2GJ6E 1VHPA 5I1AB 1N6QH 1FZKA 2E7BA 3O3EA 1ES0A 1LHZA 2EDKA 5DUPH 2OL3A 4ZXBA 5INCA 5D70H 4Y5YA 3QULB 3NABH 1RZ7H 4NWTH 2DI8A 1FFQA 1PY4A 3BWAB 1FIEA 3LS5L 1EPFA 3NMEA 4KI1A 3GSQA 3BZFA 4CMHC 3OJDA 2EE6A 2DTSA 4YK4C 1N7MH 3DPBA 3C5ZC 1YUHA 1A6UH 4MD0B 3MLUH 4ZPVA 3CFIC 5D1ZC 5EOQL 3NABL 1RHHB 4QRRA 4L4VD 4P46C 4YR6B 1F3DH 3BDYL 5JHLL 1A3LH 2VL5A 1FH5H 2FHFA 3O4OC 1AD0A 2CMRH 1ZV5A 1I7TA 1RZJC 1N7ML 4XBPA 1I1AB 4ACPA 4M7KH 1RHFA 2Q8AH 4ODWB 3MLUL 2A74A 4NN7C 1VPOH 2BXYA 3MLPA 4ZUSB 1FFRA 3OKNB 3OKLA 2YPLA 3NIFE 1FH5L 3ES6A 3BE1H 1WCQA 3TPUB 1GOHA 5T1LB 2IBZX 3FOLA 2IQAA 2P45B 4PG2C 5L0QB 3BHBA 2Q8AL 4KI5D 2ESVA 3M07A 2KKQA 3QEQD 1G7JA 4NT6B 3UEZA 1KN2L 4WW1B 1GOGA 2VLJD 3WLBB 3PHOA 4U3HA 3LEVL 4X5XB 3ALPA 4N0UB 4PRIA 4XCNA 2P7TB 5GRWA 3RWGA 4EBQL 4L4TA 4PJFF 1SJVA 4MNQA 1YMMB 3NCYS 3QPXH 5T3XE 2ADJA 3GSWA 2Q76A 4ZAKC 2AV1A 1U8KA 2MOVA 4N0CD 4NQEB 3LQAH 4KDTA 3D1MC 3QUZB 3F7YB 3NFPA 5TE6H 4DN4H 3QUXA 5B39B 3BGFC 4JFZH 1LWRA 4F15B 4P23D 4LPCA 3GMNB 4LAJH 1DQMH 2Z35B 1MJ7H 2FB4L 5CIPH 5EO9B 1NL0H 3M17A 4YEEA 1UZ8A 5K9JH 3O11A 2BNRE 3P0YL 2V17H 3MYJA 3ME0A 1FL5A 4I13B 1JHKH 2I60L 1R5VA 4OZ4A 4Y7MA 3SDCA 4U2YA 4C58B 1JZ4A 1OF2B 3U30B 4FG6D 4DN4L 1U3JA 3VFSA 1DCLA 4JPVL 5FAAA 1QBMH 4I2XA 3LQZB 3MLSH 4JZJB 4FFZL 3KHOA 4LNRA 3P30H 1FL3A 3UTPD 1PZUB 2NY5H 1FFNB 5ESVA 1II4E 2EIDA 1JHKL 3H9HB 4HK3N 1IFHL 1CG9B 1KTDB 5I75B 3IKCA 4NO2A 1U92B 3QJFB 1OPGH 4O2FB 4ZXBD 5J3HD 4GAGL 4ZOAA 4WNQB 3GSVB 4OB5L 1JV5A 3IDNA 3D87B 4GFTB 5I9QC 2LV4A 5AAWA 1ED3A 4RMWA 3AREC 3SKMB 2W0KA 1A3RL 4XC1H 1OPGL 5FO9B 2QSCH 2WWMD 2XQYK 3VXMA 3SJVA 1DDHB 2GFBB 4P5MA 2R0ZL 4XPHH 1XR9B 4FQXB 5IOPA 4G7VH 2P5EB 2CXKA 4YHLL 4KV5F 4YFDB 5SX5H 2HWZL 9CGTA 2BVPB 3UXFA 4XC1L 3WN5C 3BN9C 1AR2A 4I0KA 4K07A 1ITCA 3VJ6B 4EQ2A 2FEDC 2PF6A 1DUYA 2QSCL 3MUJA 3IF1A 3CMOL 4NDMB 2IADB 5E00A 1OP5H 3T0AA 3D6GA 1XAUA 1N5AA 3CH1B 1EA9C 4BFIB 4G7VL 1AR1D 2K3TA 2YPLD 3MLRL 1Z5LA 5I1JH 3Q6GH 4HWBA 2EIZA 3UZEA 5CGMA 3VG9C 3OKMB 2O5ZH 4UI2A 4PGCA 1RK1A 4PV8B 5FEBA 1R3IH 2ATPA 4LEXL 5HD8D 5CBAA 4LPTA 5EIIA 5BZDB 2UY7A 2XWJB 1F4HA 4MNQD 4H20H 4YPGA 1MCPH 4PJCB 2Z91A 4YJZL 3I2CL 4JFPB 4ZG1A 4V1DE 4LCWB 1A6VH 2AK1H 1TJGH 1CGYA 1SQ2N 2XRAL 4RFNB 3MLXH 1C16A 1X5XA 2P1YA 3QUXD 3TIEB 3Q48A 3T1FA 1I3GH 1MSPA 3HPLA 3GSRB 1MHPH 1I1YB 2ED7A 3MA7B 4U4BA 2O5XL 3PGCB 4ZUUA 2IPKB 1U9KA 4Y19E 1W2KT 1DANT 1A47A 1MFAH 5BRZB 1R3KB 5ITFB 3SDCD 3DXAA 1E4KC 4RISH 3FONB 4NRXB 5DJZA 1B2WL 1H0DA 3X3FL 4LARH 2CLRB 1I3GL 1TQCC 3NAAL 2GEEA 2FGZA 5JDSA 3PGDB 1DVFA 4OKDA 4CVUA 4CVZB 5K9QI 2YD6A 1CICD 4K7PY 4LHJB 3HA0A 1MFAL 1S3KL 5FUCE 4Y88A 2ORBL 3MFFB 2NY7H 3K4AA 3NOIA 4KJQC 1MCSA 4PTTB 1NGYB 3BZEA 3GGWA 4CRPA 3S37L 2W60A 1A7NL 1R5IB 12E8H 1FDLH 4HUXB 4PJ9C 5DSCA 4S10A 3IXTA 5DMGC 2M1KA 1SYVB 1DJSA 1S9VA 2L7UA 5ANME 4GRLA 2GAZB 3HC3H 3I75A 3QUYA 5DZNA 4RAVA 3U4EB 3FN9A 4A2LA 2DQCH 4HZAA 3FFCE 2ADIA 4JDVA 4NO0D 3TESA 3H7LA 3WYRA 4EKXA 1MVUA 3D18B 1U0QA 3SO3C 4AEHH 1Q0YH 4J8RA 4QTHB 3SJVD 4YGVB 3UJJH 4G9FB 25C8H 5CUSH 4WGWB 3HC3L 1NMCB 1JK8B 2DQCL 1VEPA 2GSGA 5C09A 4NN5B 3FAWA 5E99H 1FG2B 4OIBA 2PYEA 3AY4A 3P73A 4AEHL 5I19H 1CXKA 4TUKH 1RZJL 1P84K 5KSVA 2BNUA 3GJFH 3IGAB 2W1NA 1RIVL 4I9WD 3GSOB 1HILA 3FQXA 4F33A 4MVBD 1KT2A 2WUBH 1A1MB 3N85H 3PDOB 3T0DA 1U8NB 1TVDA 4WFGD 4EDWH 2UZIH 1IZKA 4ZNEE 4XCFL 3DMMB 3KVQA 3FRPA 4BQCA 5I19L 1X5ZA 1XGPA 4MSWB 2BNQA 5KW9H 5HYJE 3IAGC 4ZYKA 3PGFH 1J05A 3N85L 1ZTXH 4LLQB 3TVMA 4WW2C 3GUTB 2B1AH 1G6RL 2KH2B 5E9DA 5CIPA 3PNWA 1MELA 4EDWL 2R56H 5HHOA 4XNMA 2CKBB 2KZWA 3G9AB 4IS6B 4XC3L 1MHHB 2MKWA 5IVOA 2EDQA 1T20A 5F7DA 2B4CC 4GAYB 2X4RA 1CFNA 4CN6A 1ZTXL 2WV3A 3QHFH 4NFBA 3KPNA 5GRZA 5DRZB 1UB6A 1BZ9A 2VLME 1RZIB 5ETUB 5HGHA 5I71C 5LKNA 4PJGA 5H2BB 3ULVH 4EI5A 1HZHH 4D0CB 4XTRD 4M6MH 4G6JH 4KJPD 5IG7B 1IL1A 3WS3B 3U83A 2P46B 1YEEH 1QRKA 1IM9B 3U0PA 3DXAD 1T1WA 3B8SA 4G7YH 3VXOB 4I48B 5IW6A 1IAOB 3MOAL 3STBA 3GMMB 3PQYD 4BH8B 5TDNA 4RZCB 2AW2A 3QO1B 1H8OA 4I77L 3ULVL 5D2NE 1KIPB 3TYFB 3TBYB 5A16B 3U4AA 2L0DA 4X7TB 5F8RC 2V2TB 5E6ID 1S7XA 3NBNA 5ADPL 4PRPB 1WIOA 1JIBA 2NY0B 1CVSC 4PRBA 2UWEE 4BSVA 4M48H 5A40E 3AB0C 3LEXB 1H3PL 2Y5TB 4ONFL 2SEBB 3MNVB 4XH2B 3BXNA 3QUYD 4APQC 2A6DA 2VZUA 4JJHA 4DTGL 4KK8D 3B5GA 4DVBB 5EBLB 3LD8C 1FNGB 3RDTB 3OQ3B 3ZYZA 3AUVA 1QEWA 5C0IB 3IETB 3Q5YA 3VMNA 4M48L 4QHUA 4O2CB 1FZJB 4H8WC 5E8NA 5KS9F 3L5XH 3EDDA 5E4EC 4DW2L 1BFTA 3AAZA 3RWDA 5IFAH 1U3HA 2EYSB 4JAMB 4U1NB 1HQRA 4YEFA 5CD3B 5C09D 1NGWA 3MRKB 2PYED 5SWQB 2C1OA 4JFXB 5ICZA 4XB7A 1XCTB 2RFXA 3L5XL 1AXIB 1LNUA 3SKNB 3QNXB 4LKCB 4I0PC 4UIKL 5ESAB 2UUDK 4X6FB 2DLFL 2EDHA 1BVZA 1BD2A 4X9FA 4DQOH 3L5WB 1P84J 2V2WA 3RU8L 3ISWA 3BPNB 3WXVL 3RHWK 3TA3C 2BNQD 2YMXL 2P49B 4Z7WB 2HFTA 5KSAA 3QISA 4J6RH 3IXAA 1LE9B 3VI4E 4N1HB 4ZUTA 2ZNXA 1JYVA 2DLIA 2LAGB 5E9DD 3ECBB 6FABH 3I6GA 3D85A 1IEAA 3MBEB 4UTAH 2OM5A 2XY1A 5SWSE 5FK9A 3SDXF 5B4MD 3HUJE 4Z0BL 4R90H 5IVXE 3NPSC 3AMKA 2LAAA 32C2A 3D9AL 3U7YH 3HE6B 5DFWH 2ZUXA 1AHWC 5JQ6H 4ESKA 4Z9KB 2HRLA 3FO0H 4IOIB 3RVVD 3PL6B 3DNKA 3U1SH 5GJSL 4UTAL 2GSIB 2CK0L 4QHLA 5C0CE 3P11H 4OCLC 4RWYL 1RQ5A 1P7QA 2GUOA 1FNSL 1G9MH 2F5BL 5L7XL 2BRQA 2BY3A 2OXGA 4CVXB 1EZVY 4NQVB 3G04A 1DQTA 3MQIA 1M7DA 1BQUA 3MREB 1QO3B 1EFQA 2JB5L 2VIRB 3C5ZA 3H9YA 4XHJD 2BHYA 3DBXA 1ZVYA 3O9WC 4GBXB 3JWDH 1RJZA 4M03A 2AVGA 5D1ZA 2R9HC 3P11L 3DUUA 4D9LH 1T7WA 4P46A 3RY6C 1H15B 3RVWC 1H3UA 2EXYC 2ITDB 2YD7A 4X6DF 2HMID 4DGIH 3RHWF 4OZFH 1LEIB 4ERSH 4YHNA 2AGJH 5C9JB 5TF1H 3FO9B 3HNVH 4QF1A 4WHDA 4NYLA 1AI1H 4MLSA 3W0WA 3H2WA 4Q97A 2VXTL 4XPTL 2V9QA 4RGMB 2PW2A 4WTWA 1NBZB 3K2UH 4RA0C 2NX5A 2EO9A 3HE7D 4QRPB 3GJFA 4DGIL 4PG2A 4NNXB 3RNQA 3ROOA 4XAKE 4EUPH 2AGJL 2I07B 4GG6E 2WAHA 1G6RA 3I02A 1LO5B 1AI1L 1T1YB 4N5ED 3FRPG 5EDXA 2APXA 3TNNB 3EYSH 5E8OA 1IGMH 5MENA 2PO6B 3QCVH 4N9GB 5KVDH 3T8XB 3SDYL 2XWBB 2Y5EA 1I3VA 3OSKA 4ZO9A 2OZ4L 4KPHL 3O8XB 5D7LA 5C0AA 3MLVL 4ZAKA 3VXSB 1A0QH 1MI5B 3V4PL 4WU7B 1BD2D 2EDEA 3LN4B 4PJ5E 3KYMB 4NKOB 1HSAA 4HSQA 4LMQI 4OZIE 2G9HB 2Z4QB 4CDHA 1E0OB 3LKQB 1QG3A 4HPOL 3S36H 4ODHH 3G9VA 1A0QL 3FB6B 4WENB 3A6CH 4K3JL 3U2SA 3QI9B 2NY1C 4FQ2H 2VN7A 2HRPL 3D85D 4P4RB 1P4BH 1QPXA 1B4JH 3RKDD 4FTVB 2VXSH 1ZHKB 5SX4H 2FR4B 1GGTA 4L29B 2X6MA 4Z95H 1ZEAH 4TPRL 4G8EB 4ODHL 5AYQA 3A6CL 4IRJB 5GGUA 1QP1A 1FNFA 1KPVA 3G08B 4YC2B 2B4CL 2OBGA 5DRXB 4PJIF 1OHQA 4HIXL 1HK6A 3U9PH 2CDGA 2XA3A 3MJ7A 4B7IA 2IAMC 2AEQH 1H8NA 4LRIC 2CJUL 3KLAB 1H8SA 1UB5B 5I0DA 5D7KD 3AREA 2OX5A 2BRRH 5FCUH 5CZVH 4RMUA 4AL8H 2E7HA 1U58B 3C5ZD 3E8UL 4PIRF 3OHXB 1MLCA 5HHNB 5SX4I 3UTZB 4M43L 5D1ZD 1JZ5A 2EECA 3RTQA 5FF6A 4FNLH 4D2NA 3KPPB 4WEBL 5E5UB 3REVA 4P2RE 2MCG1 3L9RB 3LCYA 4F3FA 1NUGA 4P4KC 5EOCJ 1MAJA 1EEZB 1K3IA 3DYPA 4OGAC 4AL8L 5CZVL 3ULSA 3IFPB 1X7QB 1KF9B 3IKKA 5KBNC 5DUBA 2XKNB 4F57H 4FNLL 3MV8B 5GRVK 4OD1H 1XGTB 1EBAA 2FH6A 4NHUA 3PV7A 3CXDL 1QHOA 1DEDA 4QRQA 4HJGB 3BOVA 5CJBA 3BQUB 1MJUL 3H7BB 4QRSA 3GNML 4DEPC 3SHSA 4HKJA 1HKLH 4D3CH 4YPJA 3BUYA 5JLZB 2D7NA 2V2XB 1UQSB 43CAA 5DURB 4F57L 1X3DA 4D9RE 4OD1L 1BFVH 1UWEL 2NLJB 4OSUH 1O7SA 2ICWB 3ARYA 2CD0A 1G9EA 4H8WL 5E1AB 5EUOB 2FYYB 3MX0A 5FUCC 1AP2A 2AK4A 2NY4B 4GUPA 4WU5B 5D7LD 1NLBH 5C0AD 4ELMA 1BFVL 2AQ3A 4ZAKD 1L7TL 1DQJA 2QEJA 4ZS7L 2DWEB 4HJJH 4I18B 1L7IH 3DX8B 2EZ0D 3DX9A 1HEZB 2FX9L 1EFXB 3W9EB 3O2DH 4XGZB 1YY8B 5AUMB 2W65B 2ERJB 3RVXC 2BVOA 1R0AL 1NDMB 3CXHK 3B9DA 5D7JB 4QXUH 3VMOA 1BX2A 2VLRA 1D5BB 3DRTB 1E4KA 2F54A 1B9ZA 2WZPD 3PDGA 3ULVD 3AU1B 3AS0A 5J6GB 1VDGA 4YHMH 1IC7L 4Y8AA 3WHXB 2X4TB 4HC1L 1IGJB 3S5LB 1B0GA 4XPAH 3UDWC 5H37G 4QXUL 4DUWA 3ZE1E 1JF6A 5DJYA 3OKEB 1D5XB 3DROA 3O3BB 1Q1JL 4Z7VB 4PLJC 5DTFB 1C7TA 3OBAA 4F9PA 3HG1B 3BZDA 2VXQH 4KKLC 4YAQA 3STLB 5HI5C 5EWIL 1WCBA 2JELH 4HUVA 4OZFA 5CJOL 3EOTH 4MYWB 3ARED 1QFOA 2V5MA 4LEOB 3KWWA 2B0SH 5T1KA 3DURA 1NSNH 2IFFH 3MRLA 3ILPA 3MRNB 4H88H 3NIGF 3RTQD 4KRMB 1XFPA 1JMXA 5J13C 3OX8B 2P48B 3L3KB 4JZNA 5AAMA 3ZSSA 1A7OL 1FNAA 2JELL 4FQJL 1LILA 4XCYA 5J11B 4NQXA 4V2CB 4QHNB 15C8L 4MXWH 1HHKA 4M93B 2EC9T 5T3XL 3SOBL 1DBMH 2PXYD 1GH7A 1JPSL 4WV1B 3V4VH 3P0VL 3UMTA 2I9TB 4PJFA 2GCYA 4JO2L 4PTUA 2C7UB 2I27N 2AJZA 4FQLH 1JMZA 1NGZB 5IHUH 5C2BH 3BKYL 4QKXB 3VFUB 3OGCA 1LP9F 4GQ9H 4NN6B 5CZKA 5I8KL 1YMME 3ZKXB 4Q9QH 4F7CB 3V4VL 2NW2B 3QEUA 3MV9D 4U1HB 5EC2A 2R1WA 4KKNA 3HR6A 4OCWH 4FQLL 5D2NC 2XN9B 5JW3H 3TT1H 1JRHL 1UJ3C 4X5WA 4LKXB 4MJ6B 4RQQB 3FB7B 4GQ9L 1ZVSB 4XMKL 3EYUH 2ZUQC 1YEHL 4U1SA 1KBGL 3T3PE 4L8CB 2DM3A 3SCMC 2J8OA 4OLEA 2VTFA 1YPZF 2VKWA 3HPJA 4D8PA 4MMZC 4YDVB 4C56B 2QQQA 2J88L 1F3JA 4XNZB 5EU4A 4UUJB 5DMKA 1V3KA 3WFBH 4GW5A 5LJYH 5TH2A 1A7QH 4PJEF 43C9A 5BVPL 2J8UF 2CO6B 5FV1L 4R2GD 1RY7B 1V7NL 3HI6L 1S7QB 3JUZA 3QWRA 1KEGL 2VLRD 3GMQA 3L3OB 2NXYB 4ZTOH 3ZDYF 4NQUA 5I18L 2HLFD 5MEOB 3ARGB 1CK0H 2QLVB 4LHQB 4RFOH 3CXHJ 5A2JH 5J56B 2IGFL 4Z0XB 3VDCA 5IFJB 5EU3B 4X6EA 5GS1B 2QSQA 2HLAA 1CK0L 4FZ8L 4HT1H 3TM6A 5F6IC 2HJFA 3DIFB 1ZHNA 2K1MA 2HVJA 4IOFC 4M9PA 3H3BC 4CU8A 4TOYL 4EXPX 5DMGD 1Z3GH 2VAAB 5B3JE 4K94H 2WLZA 4K7PX 4APQA 5CD5C 5JPNA 3LRHA 3JWOH 3EO1B 3ZYOA 1TTFA 2F19L 2AJYL 2R0KL 1J18A 4LVHB 1RJLA 5FYKU 3VGGA 1IBGL 5JQHC 3S88L 5EBMB 3P4MA 4X6CB 3MUGA 1XR8B 5MEPA 1TZGL 1E27B 2F58H 1CLYH 3BYYA 1S7WB 1U8JA 2V5TA 3K2MC 4GXVH 5CJ8A 3TCXA 3UO1H 3J7HA 5IB4B 4ZOBA 5DJ8A 1P9MC 4P23B 3P4NA 2GJ6A 1I8IB 4EIGB 1OSZA 3GSNL 1B6DA 3MRRB 4TTDC 2FLRT 1U91B 5DUMH 4LSPL 3V2AR 2GI7A 5T1MB 3Q1SL 3U7AA 4AG4L 2OTUB 2F58L 2ZSVB 4U6HB 1A6WL 1M05A 4I0PA 3E6FB 2APFA 5C0EA 1HHIA 3TNMA 4E5XB 5EOTB 3IRPX 3EZ8A 4RGOL 3U4BH 4PJCE 2IF7A 1U8OB 1CGSL 5F9JB 5IESH 4LCWE 3ZL4H 4S1QL 3V0AC 5IM7B 2XZCH 5IB2A 4HC1A 2BMKA 4YUEL 5C0RH 5F7KC 5IF0A 4HKBB 3RWEA 1UWXK 4MZ3A 4ZUVA 5HYQA 1MWAB 3UJIH 5JNYB 4I4WA 1WT5C 4U1IA 5DQJB 2R23B 4PLOB 1I9JL 2AABL 2W91A 2BDNL 1T66D 3L3IB 3ZLQC 2PW1A 3ZL4L 1U8MB 3OXSA 5F72S 5L6YL 3CCHA 1S8DB 4MA7L 3UJIL 5F89B 2H32A 1RZGB 2X4PB 4X4YA 3G5YB 1T0NA 2FL5A 1QSVA 4ZO7A 2A9ML 3KPRB 3ARFC 4EOWL 3T0BA 3LKOB 5CILL 3NCYP 3QCUH 1CXHA 4OZFG 5IVNA 3O9WA 2BHZA 3G6JB 4HIEB 3HC0B 1MNUL 3JV0A 4DGVL 1GGYA 3GBNH 4ZDHB 5CLTA 3B43A 2EDNA 3UCRA 1HHJA 2UUDH 2YK1L 1K5NB 3RY6A 5KSBE 2HN7A 3MR9A 4WWID 4Z7OE 1JCKA 5I1DB 4OFPA 1DFBL 3DSFL 1MCBA 1XF4B 1ORSB 2ID5A 2X4QA 4Z76A 5DYOA 3S8WA 3IFLL 1KXTB 1AGFB 4EUPG 2VRAA 4Y4HC 1NAMH 2DJ4A 3GBNL 2OI9C 3ARDA 3T0WA 3ARZA 3MO1B 4PS4L 3IU4H 5HHQB 2R1XA 5C08B 5ID1A 4BSWB 4X8XA 5I1LB 3NIDF 4PJ8C 2HT2D 1EVTC 5CGYD 5IEHA 1ZT4A 4OF7A 1NAML 5FV2A 3DGCR 1T7VA 4R8WH 4R0LB 5C3LD 5JIPA 3ZTNL 2Q7NA 2BHUA 4NM4H 1V7ML 5DLML 1YEFH 2EYTA 3EJYC 3MNWA 2C4XA 3QIBC 1P4LB 4I3SL 1P53A 5ESQA 4KHTL 1NC4A 1IAIH 3FJTA 4EI6A 2DQFA 4QNPF 1ZGLB 1FVEA 5BOPA 2EXWD 1MCEA 3TT3H 5EBWA 1JHTA 1KJ2H 2HJLA 1I9RL 1SY6L 1EHNA 5D7IB 3NVQA 4PJAE 5I8EA 3ZKMC 4PBXA 5EOCH 4I0PD 1WIPA 1JI2A 5TE4H 3QEGH 2X1PA 3TO2A 2ZCLH 1CZ8L 4BFGA 4M7ZC 1QSEB 1NMBL 2ZOKB 1CICB 1KPUB 4BH7B 2Q6WB 3GI9L 3HR5B 2EYRB 4PY8I 4QOKE 3U9UB 3FHAA 2GJZB 4HFWA 2X70B 1FQ9C 1IAII 5HDQH 4GRWE 3VWKA 5B38B 3VG0H 3ZE0F 2NY2B 3ROLB 2ZCLL 4NQCA 3K3QA 4PGBB 4PV9A 5JOFB 1BREA 1PD6A 3W2DL 1YYLH 4NO0B 5SWZB 3U82B 4LCUB 1GPOL 4K71B 4H25A 3VWJD 4OT1L 5C7XH 4NO5A 5FYKE 3PABA 1KV3A 2DQDH 3EIFA 4NPYA 4LSUL 1U8LB 3O3DB 3SQBA 1JPFB 3L7EA 2IAMA 5DEGB 2YPKA 3OJVC 4WI3A 4KDWA 4FZEH 4LRIA 3K0WA 1YYLL 5FGBC 3CNKA 1KPRA 4GMTL 2YC1A 1NEZA 1WWCA 2COQA 5C7XL 4P57A 3BW9A 4LASL 4GT7A 2C26A 4TVPH 5C0BD 2JCCE 1F3RB 3HZYA 3O9WD 3ARWA 3OG4B 3RUGB 1BOGB 4JFDA 3ILQD 1I3RB 1NCAL 3MZGB 1JN6A 3GSNA 2J3SA 1KEML 3I9GL 3RVWD 4P4KA 4WGVB 3DGGB 1EZVX 1ZOXA 3QRFM 1OGAA 4W4NA 4JN2B 3C6SB 4RAUB 3ULUF 3GRWH 4HX1B 4TVPL 1KCSH 5BOZG 3WNKA 3EBAA 1EBPA 1QVOA 2DIAA 3ARQA 5HGBB 1GC1C 1YNTB 1OP9A 4NQDD 5I1HH 3ARDD 3GB7A 1BM3H 1R5WA 3DUSA 4PP1C 4BZ2L 1KN4H 3VRIB 3O2VH 2ITCB 1MCOL 5DF0A 2J4WL 3BX7C 4GXUM 1UM4L 4JFHE 5DA0B 3QO0B 3P9LA 2VDQH 4LSDA 1D5ZB 4HW6A 2FECI 2GTZB 3MRHA 2XTLA 1CD0A 5DJ0A 5L2KA 1SMOA 1S5IL 3TJEH 5DJ6B 1FL6B 4NBZB 4MJID 2XQYG 1CXFA 1N3NA 1NC4D 1MFBH 1QBLH 3DJ9A 1FVDB 2ZOLA 4UV4L 1JJUA 1I7ZA 4OUOA 5CSBA 5FOBB 5J6HB 3QAZC 1BFOB 3PJSB 3EO9L 4M7LH 5DQDL 2VDQL 1TPXB 4HXBH 2A77H 3N1PC 1OAQH 3PWNA 2C3WA 5ANMA 3SDXA 5JIHA 4XP4L 2ADGA 1QBLL 4WY7H 4XCCH 8CGTA 3FFCA 1OW0A 3K4DA 4AEIH 1CF8L 1JPTH 4MX7B 4RWHA 2AXGB 3IDIB 4NUGH 5E6IB 1OTTC 4LLMA 1JF1B 2WIIA 5FB8A 2A77L 3HCVA 3RL1B 1OAQL 4OD2A 4DKFH 5CP7A 1JYWA 3VWKD 3HI5L 4N8CH 2LE9A 3V0VA 4WY7L 4GW4B 5FECB 1UXSB 2X2YA 1UWGH 4NQCD 4OKVB 5GSVB 1OAYH 1T5XA 4AEIL 2Q8BH 3K1KC 3IJYB 1WWWX 5L0QC 3CPLB 5BO1L 4NUGL 3UDWA 4EN3B 2FEEL 1FYTB 5C0DB 4YDKH 5DHVB 4DKFL 5F1OB 5FKPA 4LU5L 4K9EC 3PWVA 4QHMB 4PJHA 4HBCH 3FO1A 3DECA 1I9IH 3BH9B 5EU5B 4X6DA 4AK1A 4ZNEA 1YMHB 3D3VB 2HT3C 5C0ND 3NN8B 1IT9H 1NCBL 4OLZH 2H26B 4C4KO 5HYJA 1KGCD 1D7FA 1K8DA 4YDKL 1NAMA 1KC5H 5DT1H 3HZMA 1MIEL 1CD8A 4PJ7E 5C6PB 1AKJB 1KJ3L 4OLXH 1YDPA 3QUZC 3WFHA 2VR9A 1I9IL 4JFDD 4OCYH 2CDEA 4S1RL 1INQA 4HUMB 3TGXA 4EJ1C 4FRWA 1RFDH 4P4KD 3P9WB 4WI4A 2HT4C 1HH6A 1I7RB 2AEWA 1OGAD 1UM6L 2KBGA 5EN2A 5LGKA 4WUUD 1XCQA 4MD4A 1VFAB 1DANU 1SY6A 2Q7YA 2WBJC 4M1CD 3DVGB 4ZFGL 2C3HA 3ESUF 4Z78B 1A4KB 3E0GA 5IMLB 4DUXA 5KVMC 4OI9A 1T2JA 1A14H 1D6EB 3V6OE 4OCXH 5E08H 1NFDE 1T7XA 1FGVH 3BIKA 2X10A 5GIRB 5IIEB 4KUZH 4B50A 1CI5A 3RX5A 4PRAB 2XZQL 4FFVC 4NRZA 2B20A 6CGTA 1WFTA 5EZOH 2FSEA 1A8JH 2UVEA 1A14L 2BJMH 5L2KD 5E08L 1MJ8L 1AIFA 1BAFH 1DUZA 1YQ2A 2AXFB 2RGSA 5D2NA 1GL4B 2QV2A 1UJ3A 1N0XL 3P9MB 3U0WH 5LGJB 4JANA 1PW3A 2F8XC 5JPMB 3WDIA 3R06A 1NFKA 2NY3B 2PN5A 5I1KH 1SJHB 3U46B 4U1LB 3NA9H 3S4SA 1BAFL 5D96B 1G0DA 3T77B 4JZOA 1UH3A 4IJ3B 2APBA 3U0WL 3DRQB 3FFCD 4DCQA 1MAMH 1XGQB 4KWUA 5C0GA 3CC5A 2XA8H 3IS0X 4FTVE 2GITB 1JUFB 1XZ0B 2APVA 2UV3A 3UTSE 3BRFA 3NA9L 4HIHA 2HFGH 4JRWA 4PJIA 3QDGD 1IAIM 3F7VB 3L6FA 4PP2A 2WNGA 4M61B 4LDLB 2YD1A 5BS0B 1NEZG 3VI3F 4PRNB 1Y0LA 2VDPH 3O4LB 3WFDH 2VO5A 3PWPE 2BY0A 5JDJA 1OWRM 3AXLA 3DV4B 3O41A 3WL9A 3QEHB 2R2HA 4PJDB 4BA8A 2W92A 3UTTB 2BSSB 1MFDH 2VKXA 1C8PA 3MLTB 4WDIB 1CQYA 1AQKH 3KJ4C 3S37X 3CSYA 2VOTA 2GQHA 4KKLD 2DL9A 2VABB 2X40A 5HI5D 4DZ8A 2NTSP 3GRWA 1MQKH 5HYJD 1OAKH 1GGUA 3SGEH 4JRYB 3NH7H 5TPWH 4WJ5B 3U36A 1K4CB 3P4OA 2XOTA 1BIHA 4FQ1H 4UOW0 5J12B 1RZFH 4Z7WF 4RFNC 3LKRB 1QLFB 5ENWB 1NC2B 2IQ9L 2K9UA 5CZXD 3W5NA 4G8IA 4C4KT 2C3VB 4K23L 1T5WB 5EO1A 3UYRH 3GKZA 5H35A 1ZGLP 1MPAL 1WTLA 2CXGA 2FIRT 1P9MA 5TFSL 1KIQA 3NZ8B 2VISB 5E03A 3KYOA 1OTUC 1RZFL 3QG6B 1L9MA 3EOYG 1MFEH 3D25A 2JIXA 2OMNA 1DR9A 1A64A 3TBVB 5C0CA 3SGEI 4Z7UF 5E56A 5FKAB 4OUUA 1HNFA 3VXNA 5DZLA 5IK3B 2OR9H 1JNJA 1MOEA 4X7SL 5TDPA 4ODTL 2Y25A 3MTRA 3W82A 2J5LB 3VFPA 4MAUH 4MQXD 1N2RB 1QOKA 4UINL 4PLKD 1FV1B 4QT5B 1B3JA 3C08H 4OZGB 5HHME 5F7UA 4RCAA 3W11D 1OAXL 2VDMH 1PQZB 3JSSA 5IJKC 4Z7QE 3WEXB 2CIKB 2F8OA 5DO2C 3L3HB 1QRNA 1ZS8B 4MAUL 5DVMA 1WT5A 1WBXB 3DHMA 1HI6A 4ZO6A 4PY7A 4OD3H 4GAJH 1N4XL 3BDBA 2VDML 3SE8L 4KKCC 2CUMA 5FYLH 4YDJA 3QQ4A 35C8H 2IBGA 1J8KA 3F58H 1UJTA 1NMCC 2IWGA 4XP6H 3G6AA 1Y6KR 3LKPA 4NN5C 5TQ0H 4LBEB 1FPTL 4HKXB 4BKLA 3ARFA 3ZE2F 4WFHD 3CVIL 5BQ7A 5T3ZE 35C8L 3C5SB 4AM0A 1ZWIB 2X7LA 3LVEA 3F58L 5ICXB 4NUJA 3QRGL 4FXKA 4E0RA 4XP6L 1U8HB 3CZJA 4O02L 1RUKL 4K9EH 3HG1E 2D7TL 3AS2A 2YBRA 4TVPD 4MD5A 1XF1A 1MRFH 5DD3H 2HYMA 1ADQH 3T0XA 4PGDA 1BQHB 3T2OA 3ZTJH 1T03L 3TCLA 1FIGH 1OQXA 4Y4HA 2RB8A 4IOFD 4AY0A 5A43C 2E27H 1RU9L 2Z93A 1VENA 4K9EL 4OZIA 1R3LB 2RHEA 4HGWA 3NFNA 4XPGH 3MGTB 4Y16B 2R8SH 4HMDA 5IW1B 4HCRL 3VXUD 1ADQL 1UWXH 2N7BA 2VE6A 2IANB 4LNVA 3QDJE 3FFDB 5AD0A 5ID0A 4PJ8A 3WKMH 4NO3A 3MV7E 2P42B 1RK0A 4YWGH 2LU7A 3DV6A 1C08B 3D69B 2E27L 4F7TA 2XACC 1IE5A 4HWZB 1SYSA 1U8PA 1G7PA 2P8MA 3QIBA 2AEPH 4OIIH 4Z77A 1S9XB 5F21B 1MHEA 5D9SB 5IB1A 8FABA 4YWGL 1W0VA 4DAGL 1S7TB 2OTWA 3GMLB 3JTTB 3OAZK 5D2LE 7FABH 2JIXD 3QG7H 1BQSA 3BVNB 5JHDB 1VFMA 4Y1AB 4NOFA 1CLZH 4QXWA 2CGRH 5C0FB 2DOCA 3QFJB 3S4SG 2G2RB 4LLAA 3EYOB 1G7IB 4NHCL 3TBTB 1YEDA 5I76A 4Y2DB 3CLEL 3L95B 3WIFB 1IRAY 2NY0C 3QG7L 3WNNA 3V7AG 1HH9A 4OGYL 1Q9WB 4PJEA 4C56E 2EH7H 4JN1L 3A0OA 3KR3H 1JI1A 1NAKL 3B3IB 2HKFL 2OCFD 3H9SD 1QRND 4L4VE 3IS1X 4BFEA 5FO8A 3RDTC 5DJCA 3UX9B 2DQHL 1CFQA 1KENH 3HKFA 5CCKH 2X4NA 2HVKA 4ISVA 2FGWH 5B22A 1G7HB 4ZO8A 4N68A 2DWDB 3D2UB 3FQTB 4M8VA 1JGDA 4GKSA 4O2EB 2MPAH 3IDJB 3F12A 1QR4A 4R26H 4F7EA 5IFHL 4OLUL 4AEEA 1EO5A 2VDOH 5M94B 5FGBA 5E6ZA 2Z0BA 4YXHL 5JXAH 5L9DH 1J0KA 5JW4N 2A6IB 3QEQE 4N0YL 4YX2L 3OAYK 3QFDB 2VLLA 1NJ9A 4R26L 2VLJE 2M26A 1ETZA 3VA2C 4OCRL 2AKRA 1BLNB 2H3NB 2VLKA 5BV7C 2UWEF 1UA6L 4FQIL 4LAQH 4TSCL 5IP4A 2AI0L 2H9GA 5EUOF 3PWLB 4PD4K 2ICEB 3RGVB 3ULUH 3QWOB 1YNKH 3DTXA 4Y4HD 5F9OH 5E94B 3SDDB 1NBYA 1HIML 4KJYA 1ACYL 2Q20A 3IT8D 3WD5H 4LAQL 5MHSD 3LEYH 2LU4A 3VW3L 3T0EB 1AQDB 3AMLA 4HUWB 3D5OF 3ULUL 5I1AA 3REWA 1Q72L 3BMVA 5F9OL 4L8SC 5E2VL 1T0PB 4MWFA 4JG1H 4GAFB 5C70A 1OCWL 2HJKB 4OLYH 3PL6C 4ENEC 3AC0A 4W4OC 4JO1L 3BWAA 3MUHL 1SMAA 2G60L 5GGQH 1YYMH 4M5ZH 4OGXL 2QHRH 3CVHL 1CXEA 4P59L 5F7MC 5F96H 3UTPE 2VZTA 3TN0D 5JIIA 4PLNC 4MD0A 4R3SB 3F7PC 2FRGP 1LO2H 1RHHA 3QQ3B 4YR6A 5GGQL 3VFOB 1YYML 5CKAA 3BPOB 5IT2L 3ZDXF 4Y4KB 2BOCB 2Y7QB 3VE0B 4YHZL 2PTUA 1I1AA 3BGAA 4LP5A 1FAIL 4UTBH 4G8FB 4ODWA 3EOAB 2VQUA 3MRBB 3NCJH 4K2UL 1C1EH 3C8HA 3OKKB 5ISZD 2DJSA 4ZUSA 5IVXF 3GMOB 5KSUB 2HH0H 4R7NB 3OKNA 4RGMC 5EZIH 1YEJH 2NR6C 3CD4A 4MLIA 5D1XD 4I3RL 3TPUA 4PB9L 4I5BB 5T1LA 5MEQA 4KJWD 3NCJL 3OKYA 3VGDA 4JQVC 4HXAL 1KUMA 3LPGA 5DC9B 3V6OC 1RIUH 4WW1A 1NBVH 5EH1A 2W9DH 3WLBA 2PO6C 1BJ8A 2GY7B 4HS6B 4N0UA 4X5XA 3WO3B 2P7TA 3C87A 1KLUB 3L1OH 5EZJA 5EC1B 4HCRA 1ADQA 1HSBA 3KYAA 7CGTA 3V5DB 1YMMA 5LQBH 4JHAH 3O8XC 1YZZA 3SDAB 3HB3C 4CMMB 3BPCB 4UQ2A 5HJ3B 1NBVL 3W81A 5IBUB 4NQEA 5C86A 2ZUYA 3QUZA 3F7YA 4N90D 5EB9A 3B6SB 5B39A 5HDLA 3BAEH 5J1AA 2VLKD 2DIBA 1Q0XL 4JHAL 3GMNA 2KZ1B 3HNSH 4X7CC 3DLQR 1MH5B 1D9KB 4K8RC 4MNQE 5EO9A 2DM4A 5AZEH 2DL2A 1FJ1A 5C0JB 4DFHA 5ECJE 3VXQB 4NZUH 5I15H 3VFMB 5HBBA 3EFDH 4JO4L 3FOMB 1WZ1H 1F11B 3L3DB 4GG6F 4GSDH 3LQZA 4BQBA 2KPNA 4JZJA 5AZEL 3QCTH 2CKBL 1BEYH 1FFNA 5DR5H 3SBWA 1WJ3A 3LKSB 3H9HA 5JW5B 2YPVL 4IRJC 2R1YA 3HAEB 1KTDA 1KB5B 3OZ9H 2WINB 3EFDL 2WQRA 4HFUH 4NGHH 3QJFA 5EORL 1OY3B 3MLWH 1NCDL 1WZ1L 3HI1B 2C4FT 4BK4A 4WNQA 1S5HA 5D7IE 1VFOA 1EV2E 3K1DA 5LCVH 3MRCB 3S3PA 3QCTL 5H94B 1JNLH 1BEYL 1PKQB 4JHWH 3SKMA 3OZ9L 1OSPL 1EGJH 1TIUA 4G3YH 5AYUL 4BZ1H 1BQLH 5FO9A 5I74C 1XGRB 4ZD3H 5CS7A 3TBWA 5J89A 2GFBA 5FYKL 5ACMA 5GISH 5GSRB 2MMXA 4FQXA 3UC0L 3VGFA 2E9WA 1LQSR 4TULH 2GT9B 4XZUB 5DK3A 2BVPA 1I1AD 2EC9U 1QUNA 4DZBB 1BQLL 1OTTD 2VDLH 3VJ6A 4X7EC 4Q9CA 2ZG3A 2NXZD 4ZD3L 4NDMA 1YEGL 1MCDA 2IADA 1CDIA 3CH1A 1G9NH 1V8HA 2Z92B 3OF6D 4QXTB 4OCSL 3MCG1 3SJVE 1YECL 4X6CF 4PREB 3WS6A 1VFUA 2HAZA 3QZWB 3BQUC 1FZOB 4NM8H 1LEGB 1K3ZA 4ZSOE 4C57C 4RMVA 4U1MB 3OKMA 4G8GB 4KROB 3L7FB 4PJXB 2DDQL 4PV8A 4O58H 4WUKL 5EU6B 3UBXI 4KVCH 5BJTB 1RMFL 4ODUB 1DLFH 1GGIH 2DQTH 4M7LT 4ETYA 5BZDA 4I9WE 3SY0B 5MERB 3LDBC 1T21B 4WO4D 4POZC 1TZHB 1JHLL 1FN4B 4GG8B 4PJCA 4S0TD 2UVFA 2AJ3B 1MQ8A 4WFGE 1ZA6A 5DVOA 3WIHH 4JFPA 4LCWA 5L2JB 1XH3B 5I8OH 1AC6A 1L0XA 4NQED 4LIQE 3O2WL 4I18C 4JR9H 1YEIH 2BP3A 3QUZD 2VC2L 1KG0B 2DQEH 4WCYL 2VZ3A 3NGBB 4JM2C 4YGAB 3MPCA 3GSRA 3MLYH 3MA7A 2ERJC 3CVHA 3PGCA 1PYWB 4KRPC 3EJZD 2HT4D 3SN6N 2IPKA 3WIHL 1CLCA 3R0MA 4HQQH 4JQIH 3MODL 4XAWH 5I8OL 5DFVC 5BRZA 1R3KA 1YN7A 5ITFA 4AH2B 2E7CA 5HHPA 1J8HB 4PB0L 4NRXA 4XWGH 4G5ZL 1ZHBB 2CLRA 3IJSB 5D71L 3V4UH 5DD6B 1EIBA 2BSTB 3PGDA 4QWWC 2VWEC 5JA8B 5BMFH 4UIMA 2VSCA 2QQLH 1O7VA 2WANA 1RULL 3MFFA 1T4KB 1OB1B 4PTTA 1PSKL 2ZP0T 1NGYA 3TFKD 3KGRA 5IMOB 3JUYA 3DXAE 1ZLUK 1ITBB 3A67L 1R5IA 4HUXA 1DN0B 2OMBA 5IJKA 1WSST 2YEZB 1IM3B 1J5OL 3PQYE 4JKPH 2GAZA 5K93A 2AJXL 4WHTB 3MRDB 5DI8B 1OVZA 3LRSB 4EXKA 2IG2H 3MRFB 1WFOA 4R97B 2A83B 5K59F 3ORJA 4UBDC 4YGVA 5I1CH 1CDCA 4G9FA 4OBSA 4FQXD 4XMLL 2P5ED 3CH8A 1AFVL 5J11C 1JK8A 1J7VR 3CSGA 2IG2L 3ARBB 4M93C 1ND0B 1FG2A 3BEVB 3RFZC 3BP4B 1GHFH 4LSSH 4WV1C 1A7BA 1NCCH 1FYTE 3IGAA 5F9WB 5KVGH 3GSOA 4XP1H 3ZTJG 1NEUA 4NQDB 5IROC 1OAZL 1S78C 1A1MA 4HH9B 3ZE1F 3PDOA 2R39A 1U8NA 1KTKE 2R2EA 2CSPA 2X89A 2YZ1A 3GK8L 3V0WH 1ES0B 2ZUWA 4NN6C 2OL3B 1PG7X 2OP4L 1MIMH 3DMMA 3CK0H 1GHFL 2HKHH 4MSWA 4Y5YB 5C09E 1NCCL 5B39G 3BKJH 2PYEE 4PJAA 1NBQA 5D6DC 1ORQB 4AQ1B 2IH1A 4LLQA 5JMOC 3GUTA 1UACL 1ZAGA 5GS0H 3V0WL 1VGKB 5GRUH 2CKBA 3CFBA 5DVKA 4AEFA 2MHAA 3ULUD 1P4IL 3KNBB 4ZPVB 3RPIA 5TDOB 1RJYB 2X4OB 4QOKA 4GAYA 1TDQA 4CUCA 4XNZC 2BNQE 1HHHB 3RWCB 3CFJB 3GM0A 4Y5VB 5F71A 2Y72A 5DRZA 4M9OA 3C60B 4U33A 4YFEA 1E4XI 1RZIA 3T2PA 5AEAA 1EJOH 5E9DE 1QLEL 4ONGH 5H2BA 1X5GA 2BY2A 5IG7A 3WS3A 3VD7A 2NXYC 5ILTL 5BRZD 1IM9A 4K8RL 2Q3AA 4HUKB 4C59B 4RBPK 3ES6B 4I48A 1UKQA 1IAOA 3WXWH 3GMMA 3FOLB 2IQAB 4BH8A 3O0RH 3ARRA 3EOBB 4OLVH 4RZCA 2ESVB 2YKLH 3QO1A 2BVQB 3EYQD 5JA9A 4MDJB 3UYOD 1KIPA 3FCTB 5IKCA 3TYFA 3TBYA 3N1MC 5A16A 3QUMB 1CL7L 5GS1C 4X7TA 2V2TA 3MCKB 3BP7B 4PJGE 1IKNC 1Q9KB 1LO0H 4PRPA 4M6NL 4L4TB 3WXWL 5BVJA 4NZDA 1JWMA 3PIQB 4H1LB 4HS8H 4OLVL 4NJ9L 1F58L 3LEXA 2YKLL 3S34H 4M3KB 3GSWB 4YZFE 1IQWL 4U31A 2SEBA 3MNVA 2Q76B 2OXHA 4XH2A 3AFLA 4OGZA 2AV1B 4R4BA 1KYOK 4DVBA 4X0KA 5EBLA 1FNGA 3RDTA 1QKZH 3PP4H 5C0IA 3K4ZA 5C1MB 4HS8L 4KKCD 1FZJA 2ZPKL 5GGSB 3X14B 4FHBD 4N0CC 4TSAL 2OJZH 3GKWH 4G9FD 4H0HB 1FCCA 4L9DA 4EVNB 1J1XL 1UZ8B 4L9LB 5GJTL 2RIKA 5HVHB 1FL5B 2EYSA 4JAMA 1B0WA 5M95B 4P23C 4U1NA 5CINH 5CD3A 2DBLL 3PP4L 5DVLA 4M6AA 4U7KA 3WJLC 4DUVA 4UT6L 5SWQA 5KJRH 4JFXA 1XCTA 2OJZL 1J1OH 5HGAB 3OAZH 4XXDB 3QNXA 4LKCA 5ESAA 4WFEE 4X6FA 5CINL 2X89D 4L3CB 3L5WA 3WIHA 1FO0L 4ZUWA 3DMMD 4Y5XC 1G7LB 2BERA 4Z7WA 4BELD 3CZFB 2E9IA 1XMWA 3GO1L 2I5YL 3KS0J 3HNTH 4P9HC 3O6FB 5JUEH 1OP3K 3ECBA 1B6UA 3THML 1JNNH 2CLZB 3HHRB 4KTDH 4LCYB 5JZ7C 3KXFB 4CADB 2DQGH 1XF5B 1Q9LB 3VXMB 1BD2E 1XF3A 3HE6A 4HF5L 1ZSDB 3HNTL 2EEAA 2X9YA 2E6QA 3BISA 1U42A 4L8SA 1SM3H 3KPLB 4IOIA 2WWMC 5F7FA 1XGYL 1JNNL 3PL6A 2GSIA 1MLBB 4W4OA 2QKIA 3QNZB 5K9OA 2NYYD 4F7PB 3TV3H 3LH2H 3ZT7A 5I30H 1G0XA 4CVXA 3HLAB 4NQVA 1IM9D 3GMPB 3MREA 4UT9H 4UILL 4JG0H 2CDFB 4Y8DC 3TZVB 4OZGE 2QBWA 3UTQB 1WEJH 1AR1C 3LSOB 1RK1B 3U6RA 2Y23A 3OAYH 1AO7B 1M7IB 1H15A 3WUWB 5CBAB 5FHAH 4M1GL 1EEUA 2ITDA 2VSDA 5DD5H 4UT9L 1WF5A 4PRPD 4JG0L 2KUTA 2NY0D 1DLHB 4D9QD 5DRWB 2LVCA 1LEIA 5C07B 1W72H 3INUL 5T3ZL 5D7KE 5C9JA 3HN3A 5HD8C 3FO9A 1H3WM 1WEJL 2OS7A 5IHZB 1J88A 5C71A 3RGHA 1NBZA 5TF0A 3RDTD 4QGYA 1VADB 4NNXA 4M5YH 4XPBH 2E7LC 2IMNA 4FQQB 3T1FB 2I07A 1MFCH 1RUQH 1BF2A 4ZUUB 4R0LC 1KYOJ 1T1YA 2DS4A 3V6OA 5T5NF 1NFDA 3TF7C 4H26B 4IEFB 2PO6A 3QUXC 3T8XA 2HA1A 1H5BC 2XWBA 3SKOB 5HHVL 4TNVK 4XPBL 4M5YL 5E8DH 4V2BA 2YWZA 3O8XA 2QQNH 4RSVA 4J3OC 3K7UA 1RUQL 4Z8FH 5E5MB 1DVFB 3SDCC 4GO6B 3KAAA 5KSBF 3KPSB 2FLBT 4WU7A 1I9EA 1KJMB 3CFDB 3LN4A 3KYMA 4NKOA 2G9HA 2J8HA 2W60B 2ZCKL 3SKJH 1A7RH 1CICC 4QRTB 2QQKH 1KJ2B 4Z8FL 5T33L 2NY6B 3RBGA 5HI4D 1SBBA 1GAFH 2XTJB 4GRLB 3ZT5A 1AE6L 5D7LE 3IJHA 4JFFB 3FB6A 5GGVH 5C0AE 1NGPL 5JR1L 4J12A 2XY2A 3W5MA 1MEXH 5D8JH 1IC4L 1QTYT 4P4RA 2NY2C 3MBED 5DC4B 1AGEA 4FTVA 1ZHKA 5FGSA 2FR4A 4O51B 3N1GC 5MI0B 3W39A 2P8LB 1C5CL 3UTSA 1FORL 2VXVL 5HVGB 4G8EA 3HE6D 5EG6C 1FBIH 2NMSA 3Q3GB 1AXTH 4IRJA 1M71B 3G08A 4ZNCD 2DM7A 2EH8H 4DN3H 5KTEH 2VR4A 3PL6D 5DRXA 4LLVA 4JPIA 5F7YC 2DN7A 2Z31B 4PR5A 4LSRH 5KSVB 3ULVE 3IVKB 4JPKL 3KLAA 1UB5A 2YSSA 4TNVF 1UXWB 3SGKC 1DBAL 2IH3B 2XWTB 2D9CA 2D2OA 2R69H 4P3CH 1JGUL 5IB3B 1U58A 3OHXA 2I9LA 4JKKA 4ODBD 5HHNA 3UTZA 4GBXD 1IMHC 2YA2A 4AIZB 4Q9BA 4QGTA 1EERB 3IAQA 3C5JB 4MVBC 4PJDF 3KPPA 4LSRL 4JB9H 1KCVL 4K7FA 5FM5O 4ZYKB 1P1ZB 5I0ZA 1EEZA 1QYGH 3TVMB 4PJBF 2M2DA 4XVSL 3IFPA 2R69L 3IAPA 1IGTB 3BP6B 3E1F1 3K74B 2XKNA 5KAQF 4I0CC 3MV8A 1XGTA 4WFFD 4JB9L 3VXRB 3CUPB 1RIHH 2EKSA 1JGLH 5ADOH 4O4YH 3VRJB 4HJGA 1JTTA 1CFNB 1QYGL 3BQUA 2QADB 3H7BA 3MCLL 5ICYB 4OZHE 5JIKA 4QRPD 4WWKB 4KZDL 1LK2B 4GLRH 3VXUB 4OM1L 5IQ7H 5JLZA 3MC0A 2V2XA 1UQSA 2ZG1A 1FLRH 1TXKA 2NLJA 1YY9C 1IKFL 2ICWA 5DD1H 4DJMA 1PGRB 1C5BH 5CP3H 1LMKA 5CJXA 5I1EH 2PO6D 1UVQB 5ALCH 3O6LL 3VFNB 5DJAB 3LRGA 2JCCF 3O8XD 4KK6D 2AAVA 4WU5A 4PRHB 3RL2A 4XTRC 5IGXL 3HB3D 2EEBA 1EHXA 1C5BL 3VXSD 5GS0D 3KPOB 1BGXL 1MI5D 2NNAA 4I18A 5I1EL 1INDH 3DX8A 3TEUA 5ALCL 1HEZA 3W9EA 1EFXA 3MV9E 4P9HH 4XGZA 4JM2A 4ODSH 5AUMA 1F4XH 1HDMB 1N5YL 2W65A 1QQDB 1NDMA 3HMWH 5D7JA 5E6IC 4XBEL 1MWAH 4Q7DA 4BSJA 1D5BA 5C6TH 3DRTA 1INDL 4ELME 4P9HL 2WBWB 3QI9D 1IGFH 3OGOE 3GHEH 1KIUA 4X9BA 1QEWB 5J6GA 3BKML 4MA8H 5E7BA 1P6AB 3HMWL 2X4TA 3WHXA 4HLJA 1IGJA 3S5LA 5E8NB 2XICA 4KK8C 3LZFL 1MWAL 4RGNB 5DWUH 2D7MA 5C6TL 3OKEA 2ZCHH 1D5XA 3O3BA 5IBLD 1HQRB 5D4QA 3V6ZB 5EA0L 4Z7VA 2VLRE 3H42L 3F65A 3RBSA 5DTFA 5DD0H 4MA8L 4PRDA 1WC7B 2C1OB 2LTQC 3HG1A 4IM8A 2CIIB 3P3YA 4U7MA 4W68A 3STLA 4C83B 5DWUL 4IMKC 2CRYA 2ZCHL 4LSVH 2MCPH 3ARXA 3AY4C 5GPRA 4LEOA 5TE7H 4U1KB 5FA4A 3QDMB 4UB0H 3OX8A 2GKIA 3S35H 4OF6A 2FH8A 3GIZH 3IXAB 1OTSD 1TJHL 4HWNA 4QHNA 1TVHB 4ZUTB 2ARJB 5TQ2H 3LQAC 3I6GB 3RVUD 2V5SA 3IDUA 4IHOB 4HUNB 2A9NH 1CFVL 4WV1A 3MV8D 2I9TA 4UB0L 1CFTB 5IROA 2C7UA 4KQ3H 3BEWA 4LLWB 3EDJA 1RURH 3BQUD 3RZWA 2YUWA 3VFUA 3JV6B 1VACB 2DLEA 5B4MC 4NNPL 3NCCB 3T2QA 5D2LA 5DURD 4F7CA 4LMQE 2NW2A 5F88B 1VB9A 4U1HA 2GYSA 5D6DA 5FYJH 3MRIB 2XN9A 5GGTH 1CLOH 4LKXA 4MJ6A 4PJFE 1ZLUH 2NY5C 1LP9B 1A1NB 3BUTA 1KFAH 4YK4B 4POZD 3FB7A 1G0YR 5DK0A 4PJ7F 1ZVSA 4IRZL 2NY4D 4LVNC 4GJTB 2PTTB 2NY3C 3UPRA 3M45A 5CEXB 5EU7E 4NCDA 1K4DB 4P46B 2ZUVA 4Q6IC 4YDVA 4C56A 4H0GA 3TN0B 1TENA 4K3DH 4XHJC 1JGVH 1EFXD 3EO0B 1CLOL 1D5IH 3O4OB 4UUJA 1KFAL 3VDBA 2XG5A 4L4VA 2ZKHH 3X12B 3WSQH 4YHNB 3P0GB 4KUCF 4XT1C 4NN7B 5AWNH 5D7JD 3V52H 3W0WB 3GBMH 1VERA 5F7EH 2HMIC 5MEOA 2PW2B 1J0HA 4U6TA 2NCMA 2NX5B 5DRNB 3QIUD 1JWUB 2J8UB 3B83A 1HXYA 3ROOB 3D0VB 1MCLA 1EUUA 4ALAL 2FDBP 4O9HH 1MCJA 4Z0XA 3I02B 4MA1B 3KS0H 1RUMH 5D1XB 5IFJA 5EU3A 4LHUB 3HE7C 4M62H 4RIRB 5GS1A 3MOBH 1IKNA 1PKQE 1D6VL 5F7HA 3QEQA 1FFOB 4JGJA 4QRUB 1C5DB 3HG1D 4N5EC 2EDRA 2VAAA 1QBAA 2QR0B 4GS7B 1MFNA 4PG9B 2WIMA 4G9DB 2G5BB 3BGFB 3S3SA 5J12C 2WM0A 4KGLA 4S1SL 4UBDD 3QXWA 1XR8A 1E27A 1S7WA 1JWSB 4MB3A 1S7VB 2CLVB 4KV5E 4P23A 2KDGA 4P2YA 3WLWD 5IWLC 4LVOB 1I8IA 1IARB 1GXEA 4OJFH 3MRRA 1WFUA 4HKZA 3QPQD 3BT2L 1U91A 4DVRH 2AJSL 2YA1A 5T1MA 3JV4B 4LIQL 2OTUA 4RBPH 4U6HA 1NFIB 2MQ0A 1AH1A 1JNHB 3E6FA 4NZTH 1OARH 1EMTH 4JFED 5GGUB 1NPUA 3RKDC 5EOTA 2R2BA 3N9GH 1T2XA 1CFSA 2FD6L 2FX8H 2FBOJ 4L8DB 1XGUB 3BYTA 5I9QB 3EGSB 1F4YL 2IFGA 3G6DH 1DQQA 3QXDB 5D5MF 4XMPL 2XN9D 1EMTL 5IM7A 3NFSH 1CE6B 1B88A 1I1FB 4HPYH 1PY9A 5I2IA 1MWAA 2W9EL 4MQTB 5DQJA 2R23A 4NP4H 5HPMB 1N6QL 3OR6B 4X83A 3PXJA 3LN9A 3G6DL 4ONHB 3L3IA 4C56D 5EIQA 5DUPL 1U8MA 3S5LG 5D70L 3ULSB 4R4NC 2FBJH 1RZ7L 4NWTL 2DD8H 3WN5B 3EHBD 4HPYL 1KCRH 1S8DA 1UENA 4Z18A 5FXCH 4NRYA 4P2QB 5F89A 5F1NB 3EDEA 1MCKA 3DI3B 2VERN 1RZGA 3S96B 3Q2CA 2R0WH 3G5YA 4LLDB 4NHUB 2NXYD 1IC5H 3ARGD 3S3JA 1A6UL 2NXZB 2FBJL 3G6JA 4HIEA 3HC0A 4ZS6C 3VG9B 5DHVH 4LPWA 2ED9A 2V7NB 4ZDHA 1A3LL 3RY5A 43CAB 4JLRB 1K5NA 2CMRL 2R0WL 2Q86B 1T2QH 2H8PB 4M7KL 4JDTH 1XF4A 3ZO0A 2CKNA 2XPGB 4A2MA 1AGFA 1VPOL 1L6XA 2JTDA 3V5KA 4FXLA 3BSZH 2IBBA 3MACH 3QIWD 3MO1A 2O5YH 1DBBH 5C0BE 1OP3H 5HHQA 3BE1L 4F9LC 4WO4B 5C08A 1Z9OA 5SV4A 1NDGA 1JGEA 2VDNH 4G43A 2E7LA 1H3GA 5DS8A 1J1PH 2AXHA 1T6WA 2EDDA 1G6VK 1P7HL 3LKNB 4MNGB 4HK0B 1PAMA 4R0LA 3EDFA 4QCIB 2EZ0C 4NQDE 4LF3B 3LMJH 1P4LA 1IAKB 3WNPA 1H5BA 2J6EH 5CSZB 3QPXL 4XVJH 5C92A 3O45B 1ZGLA 1TQCB 3EKCA 1UZ6F 3LQAL 1A02N 3PDDA 1F6FB 2E6JA 5TE6L 5D7IA 5F7LB 5J57B 4JFZL 3ULVC 5DJYB 3VFWB 4UU9B 4G6KH 1DQML 1MJ7L 1NL0L 5JMRA 3DX6A 1TCRB 1QSEA 2EIEA 2ZOKA 3F5WB 1CICA 2GTWB 2V17L 4MJIE 3TIDA 4BH7A 5K9JL 4PJ9B 2Q6WA 4DKDC 4Y2DC 5DEFB 4LDEB 1GGCH 5A3IC 3HR5A 2EYRA 1T04B 5GGVY 4HUVB 3X13B 1CD9B 2X70A 5HVFB 1F02I 1NMAH 1QBML 4U0RB 1Y6MR 5JZ7D 5T1KB 3KWWB 3FMGH 3Q0HA 1JFQH 5K33A 3ROLA 3MLSL 3MGAA 3P30L 3SO3B 1DZBA 3UZVB 4XX1G 2NY5L 4Z5RB 4PGBA 2YWYA 3CDYA 1GGCL 4NSKA 4OI8A 2A73B 4NO0A 5SWZA 4E41B 4LCUA 3CX5J 1NGXB 1MAKA 3DVFA 4JE4B 3RTQC 1YJDH 1WWBX 3DO7A 4FABH 1JPGA 4ZSOA 1U8LA 1UKSA 3O3DA 2YN3A 4G6MH 5HGDA 2WBKA 2P47B 5DEGA 1ZGLM 4NQCE 2GCYB 1FSKB 3KPRD 3SGKA 2PXYC 3F62A 4HGMA 2W0LA 1DQDH 1UH4A 4CU7A 4CJ1A 5LBSH 1AXSB 4PJXF 2R4RH 4FABL 4XPHL 3RUGA 4G6ML 1CDHA 1I3RA 1BJMA 2R1WB 1MRDH 2B1HH 3DGGA 4WW2B 4JN2A 3X17A 1DQDL 4RAUA 4HX1A 1PX4A 1KGCE 5HGBA 3SDDC 1YNTA 4Z7NF 3UTOA 4NFDA 3MROB 2D7QA 5E2TH 5I1JL 4S2SB 3T08A 3VRIA 3MOQA 4D0BB 3Q6GL 2ITCA 2VXUH 5C08D 4JFDE 5J7CC 1MCNA 1XIWD 2QSVA 4JY5H 5EU4B 2O5ZL 4LSTH 4ZTPH 5TH2B 4TSBH 1R3IL 5ITBH 1OGAE 2VUYA 3QO0A 5KS9E 4WUUE 1BVLB 2GTZA 1X4XA 1T7YA 5I6XB 1MUJA 4H20L 5DJ6A 1FL6A 4RRPG 5GS3A 1MCPL 1RZKH 5FUOH 4LRNH 4KI5F 5JXEA 4R2GC 5FOBA 5J6HA 4TSBL 5BCAA 1BFOA 5FYJD 1A6VL 1F00I 2AK1L 2C3XA 2NW3A 1TJGL 1JBJA 2HLFC 5KVFH 3U0TA 3VCLB 3MLXL 1MRCH 4KDVA 1WAAF 1G9MC 2H6PB 3PQYA 5LAXB 4YBQD 4F37K 1MHPL 1RZKL 4QY8B 5L2KE 4HAFA 3VMPA 2DKMA 4TTGA 5A2FA 1QSED 4MX7A 3AB0B 5F1IB 2AXGA 5GZND 3IDIA 3JWDC 5E6IA 1JF1A 4RISL 2NPLX 2F53B 1KCKA 3RL1A 4LARL 1HXMB 3LD8B 2FX7H 1K2DA 4GKNB 4F9PC 3FRUB 2BX5A 4GW4A 2NY2D 1UXSA 1YN6B 4OKVA 4UT7H 5GSVA 5FECA 2YD8A 3SDXE 3CPLA 4NZRH 3ZKSD 2NY7L 2PTVA 5SWZD 1FYTA 5C0DA 2Z8RA 1QFUH 5DHVA 5IEKB 2GJ6B 1A6ZB 12E8L 1FDLL 4QHMA 4KH2A 1A1OB 2C1PB 2PYFB 4UT7L 2EDJA 3SE4A 1DP0A 2OK0H 5E7FA 1FFPB 5HDBF 3QDGE 4L3EB 3BH9A 4OAWA 3NN8A 4NZRL 3VU2A 4IMKA 4RFEB 4HLZH 2A1WH 1QFUL 4CU6A 1X5AA 4EIZC 3MJ9H 5F70A 1QFPA 1PEWA 1Q0YL 4DOHE 3UJJL 2XZAH 1DE4B 1AKJA 4IBLT 25C8L 5CUSL 3TYGH 1CT8B 3TA3B 3MBXH 4PJHE 4NNYB 4F37F 5JOPD 5EU7C 5E99L 1ZANH 4X6DE 1I7RA 2A1WL 1Q9OB 2BMKB 4TUKL 1VFAA 2XZAL 1DSFH 2NZ9D 5F1KC 3DVGA 2WUBL 3RVTD 5IMLA 1I1RA 5EIVA 3FB5B 3NPSB 4ORGB 1D6EA 2F74B 1AHWB 1GIGH 1LD9A 1A5FH 2UZIL 4PGEB 5IIEA 4KK5D 5HYSB 1OOAA 5KW9L 2H2SC 4PRAA 5KANI 1ZKAA 3E2HB 1T66C 3PGFL 1YY9D 1G1CA 2EE3A 2B1AL 2H32B 3R1GH 1Z6JT 2AV7A 4X4YB 5IQ9B 4J3TA 1N59B 1CXLA 2AXFA 3PWUB 4FP8H 3O6MH 3SPVB 2R56L 4PUBH 3P9MA 5IBTH 4FQPA 5JPMA 2YXMA 5JXED 1WFNA 3VXTB 5B38G 2GK0B 1SJHA 3AGVA 3U46A 1JTPA 4U1LA 4Q6IA 3BP5B 4KKAD 3QHFL 3HZVB 5CMAB 3O6ML 3T77A 1O0VA 3H9ZA 3J8F7 4MXVF 5DYOB 1PZ5A 2GIYA 4JY4A 4L8BB 3DRQA 5ABDE 4XVTH 1HZHL 3RPKA 4M6ML 4G6JL 2Z8WC 2GITA 1YEEL 1I8MA 1JUFA 1XZ0A 4ZFZB 4G7YL 4S0SD 2K7PA 2O61B 1A9EA 4GKZB 2FIKB 1NCWH 1BBJB 1W8NA 3F7VA 5BXFB 2BNRB 4P5TD 5HSFA 3UBXB 3IDMB 4M61A 5BS0A 2N4IA 4X9HA 4PRNA 4PPTA 4EN3D 1MCCA 1G7MA 3V7AE 3HE7A 1FYTD 2HT2C 5CGYC 1NCWL 3DV4A 1IGCH 3QEHA 1FHGA 1CTNA 4PJDA 5ESQB 3O6KH 4KKBC 4ZQKB 2N7AA 2BSSA 3QDAA 4PJIE 2FCBA 2WMPA 3CSPA 4WFHE 4WDIA 5E2UH 1RUAH 1KTLB 3T0VA 3BO8B 3D3VD 3IU3B 1Y18B 1JHTB 4M7JH 1LO3H 4P9MH 4LOUC 1IGCL 4JRYA 1J11A 4WJ5A 3QQNA 4ORZC 1ZHLB 2EXWC 1K4CA 4TVPE 1CFBA 5FGCE 5CEYB 1AKJD 1F2QA 3MA9H 3LKRA 5E2UL 1RUAL 1NC2A 5IFAL 1AGBA 2C3VA 3WDHA 1T5WA 4LQFH 4OFYA 4M7JL 5F9AC 1QHPA 3IFOA 4NCC2 3QH3B 3NZ8A 5IWLA 4YHPB 1ONQB 2NY1B 4F80A 3NCMA 3VXUE 3QG6A 3MA9L 2Q3ZA 4NFCA 3TBVA 5FKAA 4LQFL 4DQOL 3WV0A 5IK3A 1UCBH 2DYPB 1HOCA 4H25B 3HC4H 3RNKB 4NO5B 3TPKA 3ARVA 4J6RL 4JRXB 4DK6A 1N2RA 4X5LA 1AY1H 4LLUB 4PRHE 1FV1A 4QT5A 3L7EB 4OZGA 2YPKB 4Z7UB 4JFQB 3VWJC 5IB5B 1PVHA 6FABL 4XHQA 3CFCH 5HHXH 1VGEH 2FATH 3WEXA 2ZUUA 2F15A 4P57B 3L3HA 1HINH 3U7WH 1TTGA 4R90L 2AP2A 3IDYC 1ZS8A 3U7YL 2NY3D 2HTKD 1WBXA 5JQ6L 2XNAB 5DGRA 5FGRA 4Y4FB 3FO0L 2MQ3A 3GSNB 4CKVX 2X1QA 2EC8A 3U1SL 4V1DB 1VGEL 5F7NC 4A6YB 2Q87A 1PKOA 4AMKH 4UV7H 1G9ML 3ILQC 4R4FH 3X3GH 4F58H 3H6JA 1MY7A 2Z9TA 1X9QA 4MMXC 3ARBC 3LY6A 4LBEA 4HKXA 1MJJB 1OWWA 4Y2OA 3H9SE 1QRNE 1H3TA 5F9WC 3C5SA 3JWDL 4Y19B 1ZWIA 3VFGH 3ARDC 4DEPB 4D9LL 4UV7L 5ICXA 3X3GL 5BS0D 1U8HA 4WI7A 4NZJA 4H0IA 1EJ6A 3LS4H 3O4LD 3CIQA 5DJ0B 4Q0XH 3MRJA 4ERSL 1BQHA 1WQVT 5AZ2H 5TF1L 4NJAH 3HNVL 3UTTD 4WFED 3VFGL 5EFIA 3B2UD 2IALA 2W0FB 1PBYA 1F6AB 3K2UL 2DKUA 5T5NG 1MF2H 4F9LA 3MGTA 3KLHD 1K8IA 4QO1A 1ZXQA 5IW1A 3K8LA 4JRYD 2DKSA 2IANA 5ANMB 3FFDA 3WO4C 4OFDA 4UAOB 2R4SH 4JM4H 1CGTA 1C08A 1J0IA 3NIGE 3QXAB 1Z0MA 4Y5VC 3V6FB 3EYSL 1NC2D 1IGML 4HWZA 3QCVL 5KVDL 1MF2L 3C60C 4OFYD 1S9XA 4YXKH 4W6XB 5D9SA 5CP7B 1J12A 4WEUD 2R4SL 3KPMA 5DJDA 5MHSE 1S7TA 4KTYA 3GMLA 4JDZA 3JTTA 4MCZB 5GQBA 3ZDZF 3BVNA 3HAEH 5JHDA 4Y1AA 3VWKC 1DBKH 1KB5H 3T2NH 3CAFA 5C0FA 4ELKA 5GRJH 3FZUD 3QFJA 2IEPA 1BZ7B 4HIJB 2X9WA 1LP9E 5FKPB 3FT2A 1G7IA 2PUQT 3S36L 3FO1B 5C9KA 1QNZH 4JFOB 4Y2DA 3RIFK 5SV3A 3WIFA 2GY5A 1A22B 1KB5L 1Q9WA 3T2NL 4FQ2L 4W6WB 1K8DB 1P4BL 1I1CA 1B4JL 1L4IA 2VXSL 3B3IA 4XNYH 4H5SB 2EDFA 2EKJA 1S7UB 4Z95L 3ZYJA 1ZEAL 5INDB 3QHZH 2UZXB 5C0NC 3R8QA 1MHCA