1NMAH

N9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
EVQLQQPGAELVKPGASVRMSCKASGYTFTNYNMYWVKQSPGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAYMQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N9 NEURAMINIDASE
publication title N9 neuraminidase complexes with antibodies NC41 and NC10: empirical free energy calculations capture specificity trends observed with mutant binding data.
pubmed doi rcsb
molecule tags Complex (hydrolase/immunoglobulin)
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1994-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmaH00
3DUUA 2B1HL 3QQ3A 3SE9H 4QHLA 3GSNH 5DI8B 2QKIA 3OAUL 4EKXA 1XH3A 1YPZA 2VZ3A 3FOMB 4GMTL 1FVCB 2OZ4H 4OCMC 1EFXB 3H3BC 2YPVL 1V7NL 1A7QH 3RVTD 4DK6A 4BZYA 3UP1A 1P6AB 2VZTA 4GH7B 1MFCL 1JZ3A 5CSZB 3WFHA 1C8PA 2BVYA 3MLYL 4HS8L 5CILH 4JFDB 3IF1B 4JJ5A 4OZFH 1TNNA 5LQBL 3HRZB 3V6FB 2NX5B 4IEFB 4M8QB 2HH0L 3TZVD 1GGCH 3RI5K 3MGAA 3ULUH 5D7SH 3HE6A 5LCVL 1QOKA 2YPKB 1IGJB 3LN9A 3T08A 3IDNB 2RHEA 3ARBD 2EXWD 3ECBA 4WNQA 3QIWB 3TIDB 2H32H 2MKWA 1NAKH 1BFVH 3BPNB 1JGVH 4C56A 5I8EB 1OSZB 4S11A 4I8DA 2G75A 2GTWA 1CDCA 1T66C 3FT4A 3BQUC 4I48B 2YD1A 1EGJL 4OLVL 5I17B 3T0EE 3LVEA 5ISZE 3N50A 1FFOA 4KPHL 2JELL 1KCRH 1JWUB 1DSFH 1J11A 4ZFGL 3R1GH 4KQ4H 4KY1L 3TCLB 5MERA 4G9DB 2V9RA 1YMMA 1ERNA 4MWFA 4YGVA 4XPHL 1SEQH 4ZXBB 2JK5B 3BIKB 2YHGA 5KSAC 2OXGA 5IROA 3LKSA 5MP6L 1KT2B 1U2HA 3LRSB 2DYPB 1E6OL 1EBAA 2VLLA 5HHVH 1F4WL 3N85L 4PRAA 2PTTA 3ZYIA 2KL6A 2BSRA 3DETC 4L1HA 4MZ3A 4L4VE 1CLCA 1D9KA 3HZMA 4OFPA 4PLKD 4HH9B 3BUTA 3EOTL 3B3IA 4P57B 2MCPL 4P4RB 1QSED 4BKLA 5SWZE 4JANB 3BH9B 1QRNB 1NLDL 1CLYL 4JFEA 4WW2F 3MNWB 3ZHKA 4YC2B 4PTTA 5GGRA 1UKSA 1BHGA 2VH5L 1NFDB 2FEDD 4NM4H 3A67H 4RFNC 5DURD 1V5JA 4K23H 1RUAL 1C16B 3I50H 4QYOA 4H20H 1IKFH 1YJDC 3P73A 1QA9A 3JTTA 3TNNB 5J6HA 2PW2B 5I19H 1MI5D 5BZWB 1HK6A 4CBPA 2BOBB 3HI5L 1CG9B 3SHSA 3QCTH 4E41D 4F7MB 4G6MH 3GJEB 4ZUWB 1TPXC 1CFBA 3DVNA 1A0QL 2GIYA 4FQHA 2DTSA 2D4DA 4LMQI 2AJSH 2OTUB 1M6OB 1H8OA 1GGYA 4RGNB 3UBXI 3NVQA 1U8QA 2DJSA 1INQA 2YPLA 3ARFD 2AJ3B 2DOCA 4Z0XA 2NY5C 5DD1L 2X70B 4MD4A 1L6XA 4PP2B 3GMMA 4HWZA 1CD0A 1IBGH 2BNQB 4KI1A 4E42B 3QFDA 1DBKL 2ZJSH 3BKCL 2P24A 1TITA 4HWBA 1YQ2A 5INDA 3MJ9A 1WT5A 4O5LL 4YHIA 1H3WM 3GKWH 1VFUA 3FZUC 1JHTA 5ILTL 4X6EA 5CJ8A 4Y19E 3REWA 3H0TA 3DSFH 1Y6KR 1OAKH 3EOAA 1CDHA 1K3IA 4G8EA 1ZLSL 2CO6B 3DX8B 2VDQL 4U6YA 3T0EA 1IGYA 4PJIF 5ISZA 5CD3A 3KLHC 1BFOA 4WI8A 4WFGE 1OB1A 2XA3A 2BSED 5KVEH 1ZLWK 3PWLA 1LVEA 4WHDA 4XWGL 5DRXB 3BH8B 5DHVB 1MIEH 3FHQA 4Z7NF 4OQTH 3M17A 1LEGB 2GTZB 5D6CB 4M7LT 5GS1B 3P9MA 3LQAH 3RWFA 5EPMA 3IXTB 3MLZL 1GZQB 4N1HB 2Q8BL 4JZOA 4JO2L 1YEIH 4DKDC 3FB5B 4OFYD 3I2CH 3HE6C 5AD0A 3CH8A 3ZE2E 3HZVA 5D71H 1XF2A 4LCWA 3U9UA 3K7UA 4DAGL 3VWJC 5F1NA 5KANI 1U92A 4XCFH 1PYWB 1E28B 4PY8J 1RURL 1TDQA 4KVNL 4EN3A 3MA9L 1KF9B 3STLB 4NC0B 1WAAA 5DMKB 2BY1A 4DVBA 1QTYT 4C59B 2H32B 1FN4A 4MGXA 3CFIC 3HC0A 3D18A 5EWIH 4U6TA 2P8LA 3PWPD 3RP1A 4GG8B 3L3HB 3OJ2C 4Y4FD 1P1ZA 3UYRL 3LDBB 5KN5B 3TJHD 1KLFA 1Q0YL 4P9HH 4S1QH 1FH5L 5I1AA 2NY6C 2WLYA 5ESVA 4NGHL 2MJWA 1ADQL 2B0SL 3A6OA 3S5LA 5FO9A 1D9KC 4PV9A 5IGXH 4G6KH 1HXMB 1G7QB 1YN7B 3GSVA 1A7BA 1QEWB 5EC1A 4UNVA 2VXQL 3D0VA 2YWYA 3VI4E 3SKJH 5C0DA 3ZE1E 1FZKA 4RMWA 4O51A 4NOBA 1IFHH 3IU4H 1AGBA 4JZJC 3EAKA 4YHKL 1CDUA 4JFYB 5ALCL 2ZSVB 1N5YH 2BY2A 1I1FB 1NCAH 5DJ6A 3CFJB 4Y19A 3RJDA 3WL9B 4DUWA 4LVEA 4PG9A 2VAAB 4Y4HB 3ZSTA 3ZKXC 3C5ZB 2DQFB 1DQQB 1AD0B 5CZVL 3VDBA 3QH3B 4HXBH 2DQJL 3E6HA 2JCCF 3HG1A 1LNUB 4LP5A 5A2FA 2JTDA 4YHLL 1Y18A 5IMKA 1BM3H 1MJUH 4LSTH 1BJ8A 3HZKA 3OKKA 4L4TB 3NA9H 1FLRH 4BQCA 4H88L 4JZNB 5DT1H 4WI5A 3FQUB 1KCUL 4OI7A 5GGRY 2BNUB 5IF0A 4LBEB 1IAOB 1FNAA 5EFIA 4MCZB 1TJHH 2OMBA 3T2QA 2BSSA 5JXAH 4YFDB 2DQIL 3B5TA 3P0VH 1TCRB 4HS6A 3SO5A 3QNZA 3O8XB 1BIIB 3QWOA 1RI8A 1C1EL 3ARYA 1GGIH 1SEBA 2JJSC 3I02A 3QRGH 3HR5A 4KKLD 3KYKL 2ZUTA 1Y0LA 2UWEF 5FYLL 4RSVA 5DWUL 4KI5E 1XGYH 2VC2H 3UTSE 1DBBL 5HHNA 3RDTB 3ZYOA 4G6FB 1RIUL 5E00A 3VFRB 3MLXH 1LP9E 3CC5A 3HKFA 3MLRL 4TSCH 1D3CA 5B8CB 1T3FA 3MA7A 3IFLH 3TIEA 1YYML 3LMJL 3O45A 4HCRA 4N1CA 4XRCA 3WS3A 1FHGA 5ENWB 5F89A 1Q1JL 1G6VK 1QR4A 3D2UD 2APWA 3IKCB 5IHBA 2YBRB 1M71B 1IM9A 3EIFA 1DQJA 5J3HD 2PXYD 4JFFB 4IOIA 1CIUA 4GG6E 3ARGC 3PGDB 3U46B 4HK3N 3T04D 3U7YL 3QISA 1T1XB 3JZ7A 1QZ1A 5K9QI 2D0HA 5IHZB 2J8UE 3U0WL 1A1MB 4HF5L 5CKGA 1F2XK 1IGMH 3MV7D 4NO3A 5JZ7C 5TE4H 3D3VE 4X5WB 1G6RL 3UBXB 4M48H 4C83B 4CVZA 4MDJB 2XTJE 4RQQA 1U36A 3DYOA 3L7EA 4U1KB 4EN3C 1W0VA 4LIQH 3GFUA 1DEDA 3O3DB 4V1DB 2HYMA 2EIDA 3V0VA 3GEWB 1DQDH 3BZFA 3CFKB 5A2LH 4AEIH 4S1SH 2BSTB 1RZGA 4N0RA 5CS7A 2DQDL 1P4BH 1I7RB 4EJ1C 3QB7C 4FXGA 4Z7UB 3EYUL 3ZO0A 4UT6L 1NUNB 5BRZD 5SV3A 1ZHBB 1CN4A 2PYEB 4RAUA 3S88H 3OGCB 4G80B 4NYLB 1BAFH 3U30C 1FNLA 4IDJH 1LEIB 1MCOH 3PL6C 2WK2A 4PJ8C 2CUIA 4XCNB 3OAYK 4XNMB 4QXUH 3O0RH 4MB4A 1ACZA 4HKXB 4PJHB 1WV7T 2YK1H 2Z35A 4Q74A 4XXCC 2I60L 1MEXH 3RVVD 1J8HB 1JGLH 2EDWA 1G1YA 4QRSA 1MCQA 1N6UA 1CGVA 3MRRB 3NMEA 2HJKA 5L9DL 1W0WA 2VLKD 1H15B 4HUUB 4FQIH 5GSRA 4QRPB 5IW6A 3DX7A 2EE9A 1AQKH 1TZHB 5FYLD 1VCAA 3F5WA 2XN9E 3UTSA 2P5ED 5CGYC 1BQSA 4WO4A 5MI0C 1KC5L 2ZUWA 2BOCA 1IQDA 3BKMH 1ZHKA 5D72H 3WDIA 4Y0GA 4G8IB 4ZPTA 2KZ1B 3RY6C 3SGDI 3QO0A 5I74B 4K8RL 4P2RE 1F6AB 2NXZD 4Y1AA 2E9JA 4PR5B 4EBQH 5HI5C 1Z2KA 1CWVA 1FGNH 1FZMB 4U6VL 1O7VA 3SDAC 1JNHB 2AXFB 5A1AA 2E8YA 4NQCB 1RFDH 2I25N 4QRQB 5T3XE 1VADB 4JPIB 5IFHH 1BQLL 3T3PE 3IETA 3LKRB 3BP5B 3MRMB 3BP4A 4HS3A 1YEFH 2J8UA 1BOGA 2FJHB 3VXOB 2D2OA 2EXYC 3Q5YA 4GXVH 3VGFA 1R3IH 3GUTB 4HUVA 4C57C 3PP3H 4PJFF 4BJLA 4POUB 5ACZB 4YBQD 5C6TL 1NMAH 4JGJA 3G5YA 2C1OB 1MJ8H 1JGUH 4BSVA 1A3LL 2FD6L 3PQYD 3SGDH 4KWUA 1KCKA 2DN7A 4P48A 5E6ZA 3PIQB 4U49A 2EDYA 4IM8A 1CGTA 1QQDB 3OKOA 4WHCA 4A2MA 5LGHH 4UIMA 3SDCA 4GAJL 3OR7B 2V9TA 2R15A 3MNVB 4P2OD 3MRIB 1XZ0B 3JVGC 4EI5A 5C2BL 4B7LA 4MQTB 2VZ1A 3JUYA 4KK6D 5IBLD 1YPZB 3RWJA 3ULVC 3VJ6B 5H2BA 4QRRE 4KRNA 3O81A 4ZFZA 3BGFB 1KIQB 4XAKD 5LKNA 5ANME 3VFWB 2MFNA 2ZKHL 4LVOB 2XWTA 4AYFA 1TMCB 2CGRH 1L7IL 3S9DB 3VE0A 2DAVA 4LLMA 1YMHB 5FYKE 5C0ND 3WKMH 3T3MF 1YN6B 5C07B 2ILLA 2ZUVA 5I1DB 4XP1L 4X6CF 4IRJC 4PJ7F 4NZRL 4JRYB 3ES6A 1PKQE 3EJZD 4XMPH 5DYOA 2HJLA 2NYYD 5CBAB 5FO8B 1KTDA 3T65A 4KV5E 5L2KB 3BKYL 5F9JA 5E8DL 2UZYB 2W60A 4PJEF 1CD1B 5F8RC 4OT1H 2R9HC 1DN2A 4UQ2B 4LCIH 1EV2E 1F45A 4HC1A 1HE7A 4FFZH 1UZ6E 4NQEE 4OD1H 4LSUH 2NY0B 4IRZH 4YHZH 4LARH 3CZFB 4HV8A 3CUPB 3MRNA 5CD5C 3D85B 1FNGA 4OKVB 1NBZA 1MHEA 1OARH 3W2DL 4K8RD 4M7JL 4HFWA 5F8QC 5LGJA 4P5TC 5IW1B 3WN5A 1DE4A 4ODVH 1J1PL 4AM0B 1UWEL 2ERJB 5JMOC 1MCWM 3ZTNH 4TPRL 3OB0K 3A6CL 5F71A 2AKRB 3LEYH 1EO8H 3NPSC 1II4E 3FO9A 4MWFB 1BZ9A 2XG4A 1P7QB 5FCUL 4FQ1H 2QSCH 5DDHB 5D7IE 4V2BA 1UWGH 3H6JA 2VLLB 4YDLB 2Z31B 3C2SA 1WEJL 4NO0D 3JXAA 5GGTL 3KPSB 3RGVD 2VE6A 4WO4C 4GKSB 2R4RL 3RTQD 4MNGB 4OF3A 3CCHB 5AWNH 1PY4A 3BKJH 1NJ9A 4YGAB 1U8NB 4Y16B 5CLTA 5GRJH 3U0TA 1HOCA 5TPWH 2F15A 2VLME 1DVFB 1QPPA 4LSQL 4JFEB 1FYTE 3RX7A 4WHYH 2Y06L 4G8FA 4I5BB 1F4AA 2RFXB 1ZEAL 2FECI 3CVHB 3L1OH 2X4PA 1NEZA 2DI8A 4EXKA 1J1OH 4F9LC 5FM4A 4KGLA 1BWWA 1WZ1L 5JPMA 3MBED 1X5JA 3K46A 4K9EC 4U3XA 4QRRA 1OAXL 2NXYC 4U0RC 1T1WA 3F7QA 4HUWB 1VEOA 4BH7B 4ELMF 3QUZA 1KEML 3L5XH 4MA3A 3RWHA 4NKIL 2LU4A 3RNQB 2IG2L 4NCC2 3RWCA 3FFDA 3DX9A 4KHXL 1HYSC 4ALAL 1REIA 4KDVA 5GPRA 1OGAE 2YD8A 1HDMB 1LQSR 4Y5YA 2QHRH 2X4RB 1X5GA 2JB5H 3PGCA 4A6YB 3SY0B 3KLAA 1MIML 3T0BA 2VR9A 3WJJC 4X6FB 4IRSB 4D9RE 3MSPA 5AYQA 1BLNA 3Q3GB 1J0ZA 5FOBA 4JHZA 4LLDA 3KYMB 3X12A 1N6QH 2XZCH 4EI5C 2HTKD 5GGVY 4FQXA 3DV6B 4FZ8L 1DL7H 5C71A 2CR6A 2O5YH 2E6PA 1ZWIA 3BPLC 3MRLA 2OQJB 1WWCA 5GS0C 3BO8A 3TM6A 5HYJB 1DFBL 2EIEA 3R06B 1T04A 3ZDXE 1LK3H 3QIBB 3GSQA 3IVKA 4AIXA 5F9OH 3QUYD 5JA9A 1OB1B 2A6DB 2OXHA 2AEWA 3HNTL 1S9VA 3RZCB 3GGWA 3BIBX 4NPYB 4JM2C 3S34L 5IVZB 3RU8L 2R2EB 3OQ3B 3GHEL 1PQZA 3TVMA 5A2JH 3OG6B 1MCRA 5I71C 3HI1A 3U6RB 5D7IA 3K8LA 4KFZC 3MLUL 1F5WA 1KGCD 3VXSE 1A7PL 2MQ3A 1IGCL 1HHJB 1LO0H 3C87A 2F19H 5AD0B 4OV5B 5FCSH 5I1LB 1TCMA 4MA1B 4OLYL 4LCWB 4P2QD 2ICWJ 3WEXA 2VXTL 1B3JA 2P8MA 1NC4D 2WIIB 1JRHI 3LQMA 1YNTB 4FTVE 2XWJA 4HMCA 4KK5C 4WW1B 4YFLF 1DEEB 3GSUA 1HH9B 2ZG1A 4N8VA 1MFAL 1ZAGA 4U31A 4R7DB 4NM8L 2E7LC 1KN4H 3LIZH 2X4OB 3W9DB 5DLML 1U3ZA 4ONFL 1FYTA 3L5JA 1R5WB 4KHTH 2YXMA 4R4FL 2HKHH 4LHUG 4NN5C 2Z92A 3WN5C 5E6IB 1KG0A 2XQBH 1FC1A 1SBSH 3VXQA 3IDYC 5J89A 4CADA 1VESA 4G8GB 3BDYH 3JBG7 1JNNH 2HRPL 1PX3A 1OAUL 3S3SA 5IBTL 4PGCB 4RZCB 1J0IA 1W72B 1QSZA 5D9SA 1JZ5A 5J1AA 3WLBB 5ESVB 5DVMA 5EORH 5DXWA 1JRHH 1UZ8A 3AUVA 4POZD 4PJGB 1X6LA 4LASL 4TOYH 3QEQE 4GRLB 1DQLH 4YHNA 1N64H 4G42B 1OGAA 4OF0A 2JB6A 1L4IA 4Y5VA 3TO4A 1G7MA 4P4KB 3GSVB 4GBXC 2NNAA 3U48A 2Y25A 2A73A 5HGBB 1MQKH 3GK8L 2A77H 3MFFA 1OHQA 4EIGB 4LGPB 3QRFM 5IMOA 5BOZG 2KPNA 4U1HB 1K9TA 1ZT1B 5HHMD 5DJ6B 1K2DB 1FG2B 3MV8D 3WO4C 4YHPA 3IFPB 4HJGA 4HKZB 5FYKU 1JYNA 4OUUA 3E6HB 3HG1B 2F53B 1N8ZB 3I6LD 1IVLA 2BNRB 3GMPA 3RQ3A 4E9LA 1NC2D 3ZYZA 1CFQB 4YBLB 1OQXA 5EH1A 4CVXB 4NC1E 3QHZH 2EKJA 1QHOA 2PNDA 1CCZA 2BSSB 3ZKMD 4Y5YC 4HS6B 3VXSA 5IFAL 4MD5A 1MHPL 2JE8A 3MV9D 4MJIB 2UV3A 4JO1H 1J5OL 4GFTB 4JDTH 1FV1A 1ES0B 5D2NA 2RGSA 3PJSA 1QR1B 5ESQA 4F7EB 4FQXC 3G6AB 1VACA 4HEPG 3VXRD 5D96B 4H1LB 2R0LH 1INEH 3W9EA 2UVFA 4ONHA 3HMWH 1A9EA 3LB6D 1CF8L 3QQ9D 4LVHC 4WW2A 3U9PH 5SWSB 4OZFG 1YUHA 4EVNA 4NO5B 1ZLVK 4P46B 4KJPC 3U4AA 2V7NB 1F4XH 5IB2B 4LLAA 1DQJB 4XP5L 5J57B 4NUGL 1RZIB 5ITBH 3KPQA 2AAVA 4HIJB 4KTEH 3AS0A 5KJRH 1MFBL 5DD0L 5HGDB 5D7JA 1CGUA 5GGQH 1RZ7H 5TGBB 5J12B 4NCDA 3CH1B 2VUYA 3QDME 1WBXB 4GLRI 3SDDD 3IAGC 5SX5K 4NRXB 3P11L 4LCYA 4DOHE 4BZ2H 1SQ2N 3TBTA 4RMTA 4HC1H 4NBXB 4WCYH 3RVXD 2WWMD 4K7FB 1LE9A 3PDGA 4FMKA 2COQA 5C0CD 5EDXA 1S7RB 3TPUB 2X44D 2B2XL 4IHOB 4MX7B 5FO7A 4YX2L 3PUCA 5E9DE 4TUJA 3JWDH 3TN0D 3ZDYF 5IB5A 3D25B 4UAOB 5DD3H 1GGBL 4ISVB 2J4WH 5J11C 4HXAL 5AAWA 1HSAB 3CFCH 3DJ9A 4PLJC 2VLRD 2AGJH 1UA6L 1F3JA 2D03L 1WFUA 3G6JE 1FO0A 1MOEA 4RDQF 1MCFA 3C9NB 4LAQL 1B0RA 3KPOB 1WF5A 2Y5TA 4DCQA 5LWYL 1TJGH 1CLOH 4GLRH 3B9KA 1XGPA 3HHRB 1TQBB 5CIPA 2GK2A 4X0KA 3KHQA 2ZSWA 3MRKA 2IC2A 1L7TL 4WFHE 1MNUL 1NUGA 5EU6B 4Z0BH 1UJ3B 3QUXB 2FL5B 3GMNB 3LEXB 1IRAY 4WV1B 4IJ3B 5IMMA 4Q9RH 2V7HA 4FABH 1G9MC 3M8OH 4PJCB 1KFAL 3NN8B 4OCWL 1RK0B 4Y5VC 1OSPH 2VXUL 3TO4C 2HN7B 3SO3B 1EEYA 3KPRA 4JO4L 1KB5A 2AV1A 4ZS6C 2XRAL 3F58H 2Q3AA 4I3RH 2R1XA 3MRFB 1GJIA 1EFXD 3EYSH 2I5YH 4HIHB 1MH5A 3NFSH 4OLEA 2AXHA 2VKXA 1CK0H 5D7LB 5I1EL 2IQAB 4LHJB 4P23A 4TQEL 2H1PH 4GXUN 4LNRB 4OCSH 3ZSSA 4X6BB 5I1GL 3N9GH 4F33B 4JFDD 4ENED 2NY3B 2OX5A 3RKDD 1PSKL 4JR9H 4OLXL 3HC3L 5DC4B 43CAB 4K2UH 4M93C 5EB9A 4L8SB 5FYKH 2H45A 3LKOA 1CFNB 1TETL 4OSUL 3ZL4L 1URLA 1HHHA 4OZ4B 3QIWD 3FN0L 2ARWA 3VXMA 4HG4K 2XNAB 1R3HB 2R23B 4RX4D 1J7VR 2OJZL 3QDMA 4M4PA 4R0LB 3U0PB 2IBZY 3LN5B 3Q5TA 2MHAA 2F74A 3C60C 3LAFA 5F44A 1TIUA 4Z7VB 2GJZA 25C8H 4I3SL 4YQXL 3TT1H 5GHWH 1U2CA 1JFQH 1QSEE 1CGYA 3SJVB 2EZ0D 3C6SB 3WNKA 2X40A 3GMLA 2EDKA 3QXVA 4M6OH 5E9DA 4ERSL 1PVHA 3EYVA 1H0DB 5D5ME 2VJXA 2EEBA 1MLBA 4B7IA 5EBMB 1XIWC 4ZXBD 1C5BH 2D7PA 4ONGH 1A3RH 2YRLA 1YY9D 1PLGL 2QBWA 1B0GB 3G6JA 2DYPD 5T5NF 2OTWA 1NUDA 2EYTA 1A7QL 4JFOA 3TEUA 3SKUD 3T0AA 3LHPH 3BEWA 2OR8A 2JCCA 1KYOJ 1NGXA 5E2VH 2ARJQ 3JV4B 5CILL 1Q9KB 1LO2H 4E41E 3GMRA 4O02H 3WD5L 1SYSB 3L5WA 1A1NA 5GS2H 1QRND 2LFGA 2WBKA 3E6FA 3MMEA 2OL3B 4JY6A 2VDKH 3AXLB 1RD6A 1TVBB 5GGSY 1GGCL 4FRWA 3V9FA 3ULUL 3TZVA 3AM8C 2VERN 3QZWB 1V3JA 3ARBA 2AJYH 5DS8B 1ZSDA 4KUCD 5J7CC 3MODH 1KENL 3ROLB 1NCDL 3MLVL 1IC7L 3LY6A 5CEXA 1IC5H 2BFVL 3KNBA 1JGVL 1FDLH 3QDHA 3HCVB 3MRJB 5D1XB 3IDXL 1EERB 4ZUUB 1UXSB 1EVTC 2X4TB 4NNPH 4KTDH 3L3IA 1G9NH 3C09C 1WZKA 2DQEL 3DLQR 4QHNB 3SOBH 5A16B 3TBWB 5KVFL 3V6ZA 3MLTB 1U91B 4RGND 5KANG 1VEMA 5DJXB 4M5YH 5JXEC 2GSGA 3SGEI 1CBVH 2IH3A 4YUEH 2EDNA 3HUJB 5DJCB 3LN4A 3BN9C 5B21A 4LRNH 2X6MA 2QADC 2YRZA 3TBSB 3L3OA 1A1OA 2OM5A 1JHKH 1LO3L 2B1AH 3OJVC 4X7DC 1INDL 4ZFOA 3FHAA 1YNKL 4JQIL 4NO2A 4UQ3A 2IQ9H 1NBVL 1RZKH 3WHXB 3IDIB 4G7YH 3GNML 3F65A 3OR6A 2H8PA 1LE5B 5ETUA 5CEZL 4IS6B 3IGAA 2Y6SC 4GQPH 1EMTH 1QSEA 3G9VA 5MENE 5JIHA 3FCTA 4K3DH 5IVNA 3FN3A 4YHYC 3FB6B 5DQJA 3SGEH 3RWIB 3EYQD 3A67L 4KQ3L 2ICEB 1S8DB 3B5HA 2M1KA 1RJYB 1Z9SA 5DC0A 5BMFH 2CRIA 3DV4A 1P6FA 4H20L 3VFMB 4M61B 1W0YT 1ZMYA 1JPTH 4QTHA 1PZ5B 4J3VA 4OZIF 4X6DE 3WFEH 2IALA 2X4SA 4HJJL 5I19L 3WCYA 1ZS8A 2AQ3A 4WTWA 1UC6A 1MI5A 4Y5XC 1JZ8A 1WC7B 4G6ML 3BT2H 4E41A 5JPMB 2CLVA 3MRHB 1B88A 4H26A 4OZHF 1SY6L 3MUGB 4GRWF 1UB6A 1S5HA 1T1WB 2DQCH 4WDIB 3TC9A 4TUKL 4RFOL 1T1YA 3ARFA 3KR3H 3RWHB 3BPCB 1IBGL 4LKXA 3ULUD 2QJDA 3RWEA 4OCRH 2ZJSL 1TQCB 2XA8H 4OIIH 4R8WL 3LKQA 3P30H 4WFEE 4AMKH 3N06B 1Q9OB 5KBNC 1Q94A 3HPLA 3IJYA 1V8HA 1ZLWH 1WTGT 1RHFA 2WP3T 3DSFL 2VXVL 3MNZB 1BLNB 4R4ND 4X8JA 2GJ6B 3C08H 3VD7A 2X41A 4PJ5B 4BELD 1Z3GH 5FUZH 1AO7E 3D69B 4ZSOE 1EGJA 5IT2H 2H26A 3NIGE 2R69H 5K9OA 3D5OF 1QVOB 4WEBH 2B4CL 1WSST 4MAUH 4KKAC 3V5KB 4LVNC 4AIZB 1H5BB 3INUL 3VXUB 1BEYH 3LQAL 3LH2H 3HRPA 3AS1A 3QHTC 2LQRA 3P77A 1F8TH 3Q0HA 3RNKB 1OTSD 4S1DC 4OFYA 1U3HB 4Z76B 3FB7B 4LCCA 3VD3A 4XXDA 4D0CA 1T20B 3TH4T 3ARBC 2EXWC 4OFIA 4QGYA 2XYCA 4Y4HD 3C5ZD 2R2CA 1RUQH 3MRPA 5C3TA 2YEZB 3MOAL 2W9LA 4XCFL 3WJLA 5DZNA 1OT2A 3SGKA 3SEPA 1CD8A 5KTEL 1BPVA 5ID0A 4MQXC 5CEZD 4HZLB 4PJFA 1B0WA 3VFGL 5KSBB 1FO0H 1BGXH 4J6RL 1X5XA 4FQLH 4MMXC 2ZUYA 3UTTD 5HPMA 3ZE0F 1T0MB 3MGTA 3FT2B 1QUNA 3UC0H 2FIKA 3ARTA 4J3TA 3LRGA 2ARJA 3UPRB 1EXUA 3DX6B 5CIPH 4APQB 4WI9A 2A9MH 5IEHB 1KIPA 2ADIB 3QG7L 3O8XD 5F88A 1FNEA 3KG5A 5EA0H 3X14A 3F7RA 3PWPA 2C3WA 4X6DA 2DTMH 5E95B 1KN2H 4MVBD 4Y4FA 1T5XB 1OWWA 1OPGL 5JLZA 1KB9J 2DL2A 2GT9A 4MD0B 1KB5H 1RY7B 4CW1B 3RDTD 1WBZB 2YOCA 4G6FD 3Q6GH 4Y8AA 4ELME 3MV7E 4G6KL 1S9YB 5FKPB 3VG0L 4PLKC 4H25A 1FFNA 2DQTH 2ZCHL 5DJAB 5INCB 4EUPA 3NIDE 5F7EL 3SKJL 5IMLA 5ITFB 1MQ8A 4U1JA 3B2VL 4Z78A 2DM7A 3SGJA 4PGEB 3SCMC 2BC4A 5EIVA 3PV7A 4NWUH 1MRDL 2VDLL 4M6AA 1OCWH 2DD8H 2XZZA 4MXQD 4ZNEA 2XKUA 1A6PA 3FRUA 4ZSOA 5F7FA 3G9AB 1BM3L 1MJUL 5L8JB 2UUDH 5BRZE 3NA9L 4QHMA 1A4JB 1A5FH 3U79A 1P4IH 4URTB 4LOUC 4D0DA 4F2MA 5F96H 1IJ9A 3B2UC 5I1IH 3EGSA 1TJHL 5EO0B 4BM7A 2WBWB 2EKSA 4LFHG 5JXAL 4ORGA 1QFPA 5J13C 3GMPB 1I4FB 2UZXB 3T4YA 4RFEB 1WWAX 4P9ML 3IDMB 3S4SA 5IJVB 3RFZC 1JN6B 3O3AB 4PJDF 3K2MC 2EEDA 4V1DD 3B8YA 3UYPA 1A6TA 1I1YA 3QCVH 3QFJB 4JHWH 3RL2A 3G6DH 5ICXA 1H3PL 2D4FA 5FUOH 5EBWA 4N8PA 4F7CA 5JHLH 1FYHB 1YQVL 2PYED 4KDTA 4YIQB 3TF7C 4ZD3H 2NPLX 1MJ7L 3IFLL 5JPNA 5MEQA 1XGUA 4X9BA 4NOFA 3TP4A 2HT3C 5CWSB 5KVGH 4L9DA 5EU5B 1D5XB 5DJDB 1JGDA 4U1MA 1AXIB 4HPOH 4JG1H 1AE6L 3RZWA 1JUFB 3D2UA 4LEOA 1J8HD 3V4PL 5CAYB 1IC4H 4CMMB 3PGFH 2CO7B 2PXYA 4U05A 3PXHA 3BXNA 2IPUK 4Y2DB 1S7VA 1L9MA 4N8CL 5ADOL 2NZ9C 3Q1SH 3KPPA 4N9OB 3HE7C 1MFEL 4Z7OF 3EBAA 4EVNB 5GRWA 4QRPD 4F15C 1NGQL 1HI6A 1U42A 5I73C 3FO2A 3RVUD 3BQUB 5TE7L 4ELMA 1ADQA 3MV7A 3E2HC 4FQCL 3LCYA 2EYRB 2VZUA 1KNOA 1HSBA 3TNMB 4QXTA 1MHCB 3WLWD 4OAWB 5HXMA 3VD4A 4JN2A 2ITDB 2GK0B 5IVXF 1IM3B 2Q7NA 1QO3B 1YYLH 4LIQL 1CFTA 3VFNB 4O4YH 5C6WH 3OX8A 3QNYA 2M26A 3CMGA 3BD5A 4XPGH 4NZTH 3S5LG 3BVNA 1QACA 3IFOB 4NQCD 3JWOC 4AEIL 3ILQD 1FJ1A 2AJVH 1HNGA 1CVRA 4OD3H 5IJKC 3O6FC 1W8NA 1XF5A 5JORA 5TDOA 3MJ7B 3TT3H 3FO0H 5EBLB 3QJHB 3RWGA 1PZUB 4WGVB 3AAZA 5BRZA 3QG6A 1BAFL 3DRQA 4IDJL 5HI4D 1MCOL 4HPYH 4QWWD 3O0RL 2NW2B 1MCHA 4LGSB 3O2VH 3V52H 3KDMB 1VHPA 2W0FB 4PTUA 1QHPA 5DO2D 1BOYA 4PJIB 3ZKNC 2ZP0T 1A6AB 5DK2A 4K7PY 5CIPB 2CPCA 2CDFA 5BXFB 3WKNA 4RFNB 5KSUB 1SJEB 1D5IH 4PD4K 3MBXH 4RNRB 1A2YB 1MF2L 4FQIL 1NGPH 2O5XL 2VLKA 2IAND 5HGAB 1AQKL 4J12A 2B5IC 1DLHB 3WHE0 1FNHA 3CVHL 1MLCA 3BFOA 3SGJC 3HR6A 1G9EA 1KB5B 1QRKA 3TFKD 2B1HH 2P5EA 1TPXB 3OAUH 1X6NA 2Z8VC 4GMTH 3MACL 4L8BA 2YPVH 1V7NH 5C86A 1P5UA 1MFCH 2WQ8A 2P1YA 1HKLL 4L8DB 4LPYA 2A83A 5EOQL 4EBQL 3CX2A 4HS8H 5EIIA 5HYQB 5C07D 1FGNL 5DUMH 4YLQT 4TNVK 4BQ8A 1S7TA 4U6HA 4TSAL 3WFZA 3VFVB 1RFDL 3G5VA 5LQBH 1ZGLM 2H2SD 2NY4C 5L2KD 3QJFA 2HH0H 1C08A 2LAGB 4A6YL 4OQ1A 5CZKA 2PYFA 1DLFL 4GW4A 5LCVH 4R26L 1ND0A 4GXVL 2PCPA 4LNVA 1R3IL 4KKLC 5GZND 5E24E 5FECA 3KPMB 4AEEA 1VEPA 4L3AA 5BOPA 2C4FU 3QQNA 5AG9A 1OP5H 2NY0D 3L3GA 1VGKA 1NMAL 2NTFA 4P5KA 4CNIA 3HAEA 1MJ8L 4G6JL 1JGUL 2C4XA 1FL3A 2X4NA 3FQRB 4KROC 3MR9A 3D85D 3DTXA 4OKDA 3CMOL 2BMKA 3PQYA 5JOFA 3IT8D 4N5ED 1EGJH 2VR4A 1X4YA 4WY7L 4OLVH 3FO1A 5LGHL 1FBIL 3RL1A 1S3KH 1T7ZA 4TVPE 5I8CB 5B3JE 1JPGA 5E5UB 4KPHH 3U36B 1XCQB 1K8IA 4P2OA 3VG9B 4ZFGH 3VWJB 4UTAH 2DLTA 4KY1H 3MGOB 1P7QD 2FHCA 1DN0B 3MRBA 4XPHH 4DUXA 3BX7C 3DROA 3ZT5A 5MP6H 2EDOA 2Z31D 1E6OH 3GIVB 4C4KO 3KPSD 4PJBB 3X11B 2W91A 4KKBD 4WTXA 1A14L 2ZUXA 4XPAL 3BESR 8CGTA 1JPFA 4DN4L 3CLEL 1F90L 3P4NA 3DXAB 4Y16D 3EOTH 2MCPH 2Q87A 1FL5A 4XP4L 2DI7A 1DVFD 4XMPL 2AK4B 2VISA 3KYNA 2G2RA 1B2WH 1NLDH 4LPTA 5IQ9A 4ZAKC 1CLYH 3P2TA 5DC9B 4F57L 3C5JB 4JB9L 1MY7A 1ONQA 3BN3B 1TVDA 2VH5H 3T2NL 4IBLT 1PG7X 1UQSA 4R4BB 4YE4L 4IRZL 2UWEB 1HQRB 3BGMB 2NY1C 1HHKA 1W72L 1SMAA 1DUZA 1YEDB 4F37F 4XI5D 5JIIA 1HNFA 3VD5A 3L3IB 2OSLA 1HHGB 3HI5H 3ARPA 4LRIA 5KAQF 3ULSA 3ZTJG 5EZJB 3IJSB 5ERWB 1IAII 3MO1A 1A0QH 1BQUA 3KPLA 3ZTNL 1U93B 2Y72A 4JZJB 5FIEA 2FO4A 3FQNB 5DD1H 1ORQB 1YEHL 3DRTB 4EUPH 1F4YL 1T7WA 4KK9D 4IRSD 2QSCL 4OGYL 3LQZB 3RBSA 2ADJB 1UM4L 4Z7UF 1XGRA 4ZFOB 4ZQKB 1JGEB 2GSIA 4NT6A 3DSNA 4UQ3B 1BFTA 4NO0A 1S9XA 3Q5OA 3RGVA 5ILTH 1A7RH 3DI2B 4FNLL 3RTQA 4YNYA 4ZUVB 1CXFA 3BKJL 5HYJD 1I8LA 4QF1A 1ZLSH 4PJHF 3QIBD 3GSOB 4M1GL 2VDQH 5TPWL 3TBYB 1IAIH 2JIXB 3VFSA 1S78C 4WHTB 5E0QA 3FCTB 3CPLB 5EO9B 2F58L 3IXAB 3RZCD 5IOPB 2X7LB 2EH7L 3B9EA 4JY4A 4W4OC 5J8OA 1JPSH 1EK3A 3DMMC 5FM5M 1LO5B 2VO5A 3MLZH 2A74A 3MBEA 3QIUC 3OKDA 4LL9A 2APBA 4LK4A 5DMGC 4G3YH 3VFUB 4PY8I 3L5XL 1YNLL 6CGTA 3LS5L 3OL2A 5EOTB 1M05B 5IK3B 3KYOA 5CMAA 1U8LB 4RMRA 1DUYB 2BVQA 1RMFH 4ZOAA 5FM5O 2X4UA 1GOGA 3O9WB 3HS0A 3C8KA 5KSVB 1H8SA 3CIQA 1CQYA 5E6ID 3QI9C 5BZDA 3VXPB 3QQ4B 5LVEA 5DHYA 4G8GD 5DEFB 4HIEB 1WK0A 5TDNA 2WINB 2XZCL 4R7NB 4P2OC 3DO7B 4L4VB 1BJMA 1DL7L 1Q0XH 1P2CB 2O5YL 1NLBL 4PRIE 3CSYA 1DDHB 2O5ZL 1JWSB 3MV8E 2G9HA 4LLYB 5GISL 5EOCL 5SWZB 1LK3L 5SWQA 1Q0YH 1JHLL 4LLVA 1FH5H 4NGHH 4GRLD 4LEXL 1ADQH 3QUYA 4HDIB 1KIUA 2D9CA 5K9OB 4CJ1A 1CE6B 4CKVX 5F9WB 1CLZL 5DJYA 4P4KD 4UDUA 1KLUB 1Q9LB 3UJTL 3RPIA 4BSJA 2OI9C 4XNYH 3BI9X 2NYYC 4C54A 3SKMB 5IR1B 1XR9A 1LO0L 4MNHB 3MV9E 2BVUA 4M6ML 2J5LC 3H3KA 3I3BA 4YHKH 3CLFH 3U30B 3H9SD 2K7QA 5GGTA 4P2QA 3PL6B 3DIFA 2ICES 4PJ8B 5A3ID 1NC4A 5CJXC 5HDBE 5FF6A 5EU4A 1I8IA 3M1BB 5CZVH 2F53D 5HI3C 2BNRD 2DQJH 2WSKA 2A0LC 4YHLH 2QQQA 5HDOA 3EUUA 1TZIB 4I2XE 4YFLI 1WBYA 4PV8A 2EDJA 1M7DA 4H88H 4L5FL 1NGZB 5GRYA 4JDVA 2XQBL 1EHNA 5I75B 4X7FC 4GMSL 4OLWH 4WI2A 15C8H 2ARJB 43C9A 3IDGA 4WJ5A 4X4MA 2DQIH 2EICA 3IKKA 2HFTA 4KC3B 1FIGL 2P42B 3CX5J 3KS0H 4MJID 4LPCA 1FVDB 2VDMH 1C1EH 3PWJB 3KYKH 2MNUA 1JRHL 4JKPL 4FQJL 5FYLH 1U8OA 3D39E 5DWUH 3MREB 1JF1B 1MCLA 3V5HA 1J86A 2CKBB 1N64L 1NEZG 2HFEB 3RIFF 5D2LE 4D0BA 1DBBH 5FA4B 5C0FA 4Y7MA 2H9GB 3SDAB 3MLRH 5C0CE 1RZJL 1Z0MA 5SWSD 1NBYB 1YYMH 3V8OA 1MQKL 3RWDA 4PRBA 1KUMA 3WFBL 3V79C 3LPFA 4P46D 4Y4KD 4X6CB 4PJ7B 1Q1JH 4Q97A 3SE3C 2WLZA 1TTFA 4P3DB 1IZJA 3QAZC 4PJEB 5HHXH 3L3KA 4FFVC 1GOHA 1CTOA 1ZHLB 3MV8A 5DSCA 3QYCA 3U7YH 4YAQA 1QLFB 2X89D 4Q9BA 5GSVA 3HLAA 3X3GL 5DTFB 2WMPA 3QPXL 4I13B 4Z9KB 2W9EL 4HK3J 1HKFA 3DARA 2AQ1A 3U0WH 4HF5H 2OJEA 1H3GA 1NC2A 4WRLA 5HHQA 4ZG1A 1P4LA 1GVIA 4CDHA 1O7SA 4YDJB 4XPTH 4JGMA 4WUKH 4OF7A 3UX9B 1HQ4A 2ESVE 3T4YB 3W5NA 5EN2B 2DBLH 1N2RB 5GGUA 3MV9A 4JKMA 5IQ7L 4ZDHA 1I1YB 3OWEA 3RL2B 5IM7B 3GMQB 2CH8A 4N0FB 1RJLB 3I9GL 1T4KA 4M3KB 2HTKC 3OAZH 2WBJB 3OGOE 5L0QC 1D5BA 3EYUH 5C0JA 2R0LL 4MAYB 3VWKC 3VXRA 4U7SA 4I2XA 2X4QA 5C1MB 4M7ZB 3UTQA 4IRJB 5EU6D 1GGTA 2OL3L 4PRHB 4X5XA 1B9ZA 3QUXD 4PPTA 4CVUA 1B90A 3V5DA 4U1MB 1KLGB 2FGWL 4JRXD 2NX5E 1F4XL 4LKCA 2I60H 3P9LA 4N8VG 2ICWA 4OZIA 4JFQA 4PJ9C 2J1KA 4KTEL 4PRDA 2LE9A 5KJRL 1I8MA 5E1AA 3MXWH 4NKQB 5D7LD 4IDLA 4H0HB 1EEQA 5T1LB 3K80A 3SDDA 4OZHA 4BZ2L 2C7UB 3F6IA 2W07A 3HMXH 4WCYL 1OWRM 2NY3D 4U1GB 2GCYA 4JM4L 1X5FA 1CDIA 5C0CA 4CVWA 1SJHA 2VZOA 2EIZB 2A9NL 5DEGB 5FHBL 4KGJA 3JWDL 2A6IB 4MQ7A 2ZCLH 3SQOH 3KHOA 4K8RH 1E27B 3TN0A 5C0IA 5DD3L 1NFIA 1T22A 1RPQA 2J4WL 1HH6A 3ILPA 5BJTA 1C5DA 4H8WL 3CFCL 1T2QL 1TFHA 2EYSB 4I77L 3V0AC 3PHOA 3HB3C 4HMEA 4U6VH 4L8CB 2VLRA 3PP4L 2O61B 3FQXA 4HK0A 4AEHL 1GIGH 1IGTB 4FZEL 1AHWC 1WICA 4GW5A 1BQLH 3NCFB 2GUOB 4RMVA 4NDMA 6FABL 1TJGL 1LP9B 1LEKA 1CLOL 2DWDA 2HLAB 5TH2B 4EI6B 5IHUL 2Q7YA 4D8PA 5KG9B 4ODUA 1WFOA 5LAXA 3BZEB 4B50A 1IQWL 3SJVD 1NDMA 5BVJA 5AZEL 1EEZA 1EZVY 1DBML 3GSRA 5C6TH 3EYFA 5IB1B 1F6LL 4GG6B 2CDFB 4GS7C 2FD6H 5DJ0B 4ZYKB 3FFCD 1NFDE 2Y36L 2ATPA 3F58L 5FGBA 3ZDZF 5I1JL 3LSOA 2I5YL 3FOMA 5C0AB 4DZBB 1FVCA 2NXYB 4GAJH 3WNLA 1EFXA 3OKNA 4Z7QE 1T21B 3IDJB 3D3VB 4KXZH 5C2BH 5CSZA 3A6BH 1Q72L 3DBXB 2J3SA 1R0AH 3MRQA 5DFVC 1EHAA 3GKZA 1NCTA 4JFDA 3MROA 1FZOB 1XF1A 1ORSB 3HRZA 4K2UL 4H5SA 2DKMA 5DF0A 3CNKA 1U8MB 3V6FA 4OBSA 2Y5EA 4M8QA 1L7IH 2FR4B 2NXZB 2BNQE 2YPKA 1IGJA 3IDNA 5DD5L 4PGBB 3QIWA 4XP1H 3TIDA 3OBAA 1JF6A 1R24B 4NZRH 5D1XD 5CZXC 3BKYH 3VFOB 5E8DH 3EZJB 1OSZA 5I8EA 3SDYL 3WXWH 3BPLB 5HVFB 2PCPB 4YK4B 5E03A 5D1ZD 3TT1L 4I48A 1RJZB 2D7MA 4X7TB 4GAYB 3EYOB 5HY9B 3KPNB 4PJXF 1NCCL 4CAGA 4UZGA 1FORH 1OLZA 2RR3A 1FL3B 2PUQT 3H9ZA 4M6OL 4K71C 1JWUA 3QPQD 2Z93B 4JM2B 4GKNA 2E7MA 1JYXA 5HVWA 2ZOLB 1N7MH 2UVEA 4KJQD 3TCLA 4G9DA 1C5BL 1QG3A 1A3RL 2YUVA 3MYZA 4ZXBA 5I71B 2JK5A 3BIKA 3UAJD 1J1PH 5JHDE 1UWEH 1Z5LB 3S8WA 3LRSA 4Z5RB 1C12B 2IGFL 2DYPA 2XN9B 3A6CH 5GQBA 3DHMA 1U8IB 4X98B 1NL0H 1LO2L 4XH2B 4HH9A 4P57A 2FATL 3O4LB 3QNXB 3QUKB 4P4RA 1I85C 1WEJH 1IC1A 4IMLB 3BH9A 4P2RB 3VRIB 5GGTH 1QRNA 5IVOA 4U2YA 1A6ZB 4HIIB 4GRMB 2R4RH 4NN5B 4JQXA 3MNWA 3PHSA 2A6KB 4X4XA 1KCSH 3ULUE 4Y89A 1NFDA 3HC4L 3IDYB 2Q86B 2DIJA 4N0YH 4PJDA 2C3VB 3WBDA 3AS3A 3DUSB 1G7PA 2IMNA 1MUJB 4GSDH 4LSQH 4JPVH 5L8KB 1C16A 3AREC 4QHUB 2Y06H 4LCUB 1ZEAH 3MRDB 2PW2A 4KTDL 5BZWA 4LF3B 2BOBA 1CG9A 2BVPB 4F7MA 3GJEA 4ZUWA 1WZ1H 1WITA 2OTUA 1M6OA 1OAXH 1HHKB 1FFPB 1WGOA 5HD8D 4K3JL 1CBVL 2AJ3A 2IBZX 4YUEL 5EUOB 2X70A 3I84A 3EFFB 4GBXB 4PP2A 4MNQB 3MO1B 3U1SL 4E42A 1BF8A 2P5WE 4KHXH 3BZ4B 1JV5B 3BDBA 3QEUB 3K1DA 1OAQH 3FONB 3K4ZA 1P9MC 3IAPA 4U1IB 4XP6L 3MCKB 2QTEA 3L5HA 4LLUB 2XKSA 3UPCA 4NQVA 1UADC 3WO4B 4G7YL 4ZTPH 2HP4A 3ZKQD 1CE1H 3B6SB 2GJ6D 3BUYB 5ANMB 4PJ5D 5FYJL 1LDPH 1WISA 2IAMB 3DX8A 2QSVA 4BSWB 3RUGF 4JDZA 2NTSP 5CEZE 4X8XA 4ODXB 4FZ8H 2ORBH 4L4TE 5FM8A 5GJTH 5T3ZL 3EKCA 5DRXA 3BH8A 5DHVA 4ENEC 1LEGA 2GTZA 5D6CA 1ZXQA 1DFBH 2ZUQB 3QXTA 4L3CB 3VXUD 1PKQB 3KLDA 3VFSB 1PD6A 1KJMB 5BMFL 1M4KA 3R0NA 2MMXA 4PJCF 2E5EA 3IXTA 2N56A 3C6LC 1GZQA 3MRCB 3H7BB 1U3HD 4PB9L 2Y4SA 3EDKA 3HNTH 3S34H 1FRGL 3RU8H 4LDOB 3ALXA 2HVKB 3GHEH 1JMXA 2JJTA 4NQEB 2VQ1A 3AMLA 1G7IB 3BPNC 1CU4L 1PYWA 3MLUH 1E28A 2DQCL 1YEGL 1A7PH 1IGCH 3MV01 4LVHB 1EEUA 4OLYH 3GJFK 2VXTH 3KYOB 2D9QB 1GZPA 3TO2B 5J1SC 1XGTA 1AJ7L 1CS6A 1GC1H 3STLA 3L3JB 2XA8L 3ARSA 5DMKA 2X4UB 2BK8A 4NN7C 1CXKA 3T1FB 1MFAH 4HFUL 4N90D 4NM8H 5KS9E 1YECL 4APQD 2H32A 5DLMH 4AMKL 5DUPH 4ONFH 2H2PD 5TQ0L 4GG8A 4JFFE 4R4FH 2AVGA 3GO1L 3L3HA 5MHSD 3IFNL 4YPGB 4AL8H 5B4MC 5IB3B 5KN5A 2VDPL 3FQTA 5FUZL 1OP3K 3AY4A 1IAKB 2HRPH 3D87B 3WFCL 1OAUH 2CRMA 2CLRB 2R69L 2YD3A 3GRWH 5D70L 5HHOE 2FYYB 2HT4D 3PXJA 1HXMA 1G7QA 2YC1B 4L3EB 4W4NA 4PJAF 1IEBB 5JO5B 1GHFL 1YN7A 3W81A 1QEWA 4GRWH 1I1AC 1AR1C 4XBGB 5F7DA 4ACPA 4LASH 5K9KB 4NNYB 5HYSG 1UEMA 3SE8L 1O5DT 5B38G 1CGSH 4YC2C 3ARVA 4U7KA 5J11B 3NIFF 4OGAD 3TLRA 1E4KA 5TF1H 4JFYA 2ZSVA 1I1FA 4V1DE 3CFJA 4XPFL 3T0VA 5J9PB 3GBNH 3F7PC 2VAAA 4Y4HA 3I6KB 3C5ZA 3GK8H 2DQFA 1DQQA 1AD0A 2EC8A 3QH3A 2WNGA 5FYJD 4R9HA 4DFHA 1LNUA 3RVWC 4XBPB 2FCBA 4QNPE 4L4TA 2APXA 4FQLL 4RBPH 4JZNA 5JW4M 2HMID 1DCLA 3NCJL 3FQUA 2IMMA 5T3ZD 3UTTA 5C09B 1JTPA 2BNUA 4LBEA 4YJZL 1IAOA 4MCZA 2YUWA 1K6QL 1JK8B 2A9ML 4HW6A 1TCRA 1ITBB 3E1F1 4PV8B 3O8XA 3JV5A 1BIIA 4YHOL 4EEEA 3QFJD 2XI9A 1YJDL 1LK2B 4PFEA 2OR7A 4QRPE 2VL4A 4WJ5B 3RHWF 3VFPB 2MSPA 2BRQA 3QWQB 2APVA 4RGMC 1MHPH 1AFVH 3V0WH 1SY6A 3RDTA 2QQNL 1O0VA 2VWEE 3J8F7 2ADFL 5B8CA 2NY5L 4JFPB 1ED3B 2LVCA 4XNUL 2AQ2A 4M93B 2WM0A 1RK1B 2LVEA 5ENWA 2VQTA 3H9HB 2E7CA 2W9DL 3IKCA 5JDSA 2YBRA 1M71A 2BVTA 5E8EB 2P49B 1P7HL 3EYQC 3OXRB 4Y2DD 5GS1C 4NWUL 3U46A 2ATKB 4N0CD 5C6PB 4UIKL 3S35X 1FNFA 1T1XA 3MOBL 3C60B 5IHZA 1T66D 4XP5H 1QBMH 3BQUD 5DK0A 3ZHDA 1A1MA 4FTVB 3VFTB 1P4IL 1JMZA 1M1SA 2J6EH 2JJTC 3PDOB 4X5WA 1FNSL 3UBXA 4C83A 1AGFB 1MFBH 1K5NB 5L2JB 2X09A 2Y7QB 2K7PA 1I9IL 2K3TA 4GW1B 4MDJA 2IPKB 3P11H 1KPUB 1XIWB 5CLWA 1VFOA 1LD9B 4NQXB 5E2TH 4J4PD 2JKXA 4DFIA 3ULUC 5GGSB 3O3DA 3RPKA 3QCVL 4V1DA 3RHWK 4JFXB 5FUOL 3CFKA 2BSTA 4YX2H 3DETD 5TDPB 4LSVH 1I7RA 5JHLL 4Z7UA 2P43B 3OKEB 5T33L 3A0OA 1GGBH 4XVUC 1S7WB 1ZHBA 2PYEA 4XCCH 1EUUA 4ZD3L 1YPZE 3W39B 4YWGL 3OGCA 4G80A 1UA6H 4NYLA 4CMHB 2D03H 4R4NC 1LEIA 3D0LB 4KJWC 4XCNA 4XNMA 3CU1A 1KJ3H 4UINL 4HKXA 4NJAL 1SM3L 4PJHA 1XGQB 5LWYH 3JSSA 4NHUB 3VXRB 1CICB 2GAZB 4MXVF 1IC4L 2X4QB 1J8HA 1MAML 4OGXL 3H9YA 1MNUH 5C07E 3MRRA 1CZ8L 4IIQA 1BQHG 2QSQA 2YD9A 4IOSD 4OCXL 1I8KB 4JRYE 1H15A 4HUUA 3ALWA 1FIEA 4QRPA 5L2KE 1NQBA 1AY1H 5SV4A 2VXUH 1A6UH 1ZLUK 3PABB 4JO4H 2C3GA 4PRDB 3D9AL 3C5ZC 4UTBL 1LMKA 4NQDB 2D7TL 4HHAB 4WIQA 1V3MA 1NKOA 1BVLB 3ZZ1A 4R2GC 3DWTA 1C5CL 4G8IA 3LV3B 4C56E 4HJ0C 3ETBF 4GRWB 1YYLL 4TQEH 4ZO8A 1F6AA 4HUMB 2R2HB 2QADB 5I1GH 4PR5A 4LIQE 4WENB 1A7NL 4NZTL 1MCDA 3UROR 1FZMA 1AI1L 3LKPB 3W0WD 1JNHA 2AXFA 3UYOD 3VI3E 2AJVL 4NQCA 4QRQA 3FZUD 5HVGB 4OLXH 2ID5A 3HC3H 1VADA 4JPIA 5F7LB 5EO1B 4D9LL 4CJ0A 4I4WB 3LKRA 3FO0L 3BP5A 3MRMA 2PETA 1TETH 4OSUH 3ZL4H 4WUUB 3P3YA 3RI5F 2Q3ZA 2FJHA 3VXOA 4MVBC 4KZEL 3FN0H 4M02A 4ZFOL 4HPYL 4BH8B 3GUTA 5D1QB 3VMNA 3SDXF 2IH1B 4DKEH 2X9XA 5ACZA 3EO1B 2OJZH 1LEKB 3RDTC 2C1OA 4YHYB 5KSBF 2AP2A 2IWGA 4WTZA 3F12B 2CDEB 1NPUA 3UEZA 4AH2B 1A22B 3PIQA 4I3SH 4YQXH 4AQ1B 3BW9B 1QQDA 4CN1A 3T77B 5FEBA 3OR7A 4JFEE 3O6LL 1OM3H 1HWHB 2AABL 2IANA 5DHVH 3MNVA 3MRIA 2KBGA 4Y5XB 1F13A 4WI3A 3VWJD 4B5EA 2ATPB 2DL9A 3WHE1 5I16B 3LSOB 1PLGH 1VENA 4F58H 5SX4I 3VJ6A 3S4SG 1KXQE 3OKNB 1A47A 1JNLL 4XP9L 1JYWA 2J2ZA 1KIQA 3VFWA 4JVPA 1S7QB 3VGAB 4HD9A 3CVIH 1KJVB 3MRQB 1YMHA 3O3EB 5DUML 3VXTB 3DXAD 1G7HB 2B4CC 3MROB 3WD5H 1YN6A 5C07A 1KYOK 5I1DA 2J88L 2WZPD 5KVDL 2AK4D 4H5SB 2YPLE 2NLJB 3LQAC 5KZCD 1I9RL 2NW3B 4JRYA 3PF2A 4K07A 5FO8A 5CBAA 5L2KA 4GAFB 1CD1A 1GOFA 4D3CL 4G9FB 2W65A 2CMRL 2HTLC 4UQ2A 1IZKA 1CR9L 1KENH 3IS1X 1NCDH 3VU2A 3MLVH 5J06A 1IC7H 2Q6WB 2BFVH 5SX4H 3WS6A 3CZFA 2FBJH 1J9CT 1MPAL 1XR8B 2ZOKB 3CUPA 3IDXH 4ZS7L 1AGDB 1UFUA 3D85A 4OKVA 2DIAA 5TF0A 2E8ZA 2DQEH 5HYJE 2VSCA 1Z9OA 3B8SA 5KVFH 5IW1A 1S3KL 3EDEA 4F9PA 2IFFH 4AM0A 2P44B 1N0XH 1A7OL 2RB8A 1HCVA 2AKRA 4WU5B 4XCYB 5CJOL 3OJDB 4K7PX 3K0WA 4UTAL 1YEJL 2V5SA 2OK0H 1P7QA 1QFWL 2MKLC 3QUMH 5BVPH 5M7QA 1F97A 5DDHA 1LO3H 2Z31A 4P9HC 1INDH 4X80H 4L9LC 4MS8C 3AS2A 1YNKH 3KPSA 5HYSB 4PYGA 4EDWL 4JQIH 5B38B 1P53A 4GKSA 4LCWE 2VWEC 2XWBB 4MNGA 4PIRF 1NBVH 3CCHA 1JZ7A 3S96B 3EFDH 3F62A 4MLSA 1NKRA 3F7YA 3GNMH 1TVHB 1A21A 1S7SB 4HLZH 5CEZH 4I0PB 1U8NA 4Y16A 4LPXA 3S6CA 2JIXD 2Z4QB 1EHXA 1B2WL 4UI2A 1DVFA 5I74C 1X7QA 4X99B 4MCYB 2L0DA 4I5BA 2RFXA 4X4XB 4F8TA 2D0GA 3BYYA 5DRWB 1WAAE 3CVHA 4PJDB 4KQ3H 4TTDC 2CIKB 1F6FB 1G7PB 3ILQC 3RGHA 4NHCL 3T4AA 3U4EB 4LFHD 4X9IA 1NCNA 3UTZB 3FKUS 1ZK9A 1KULA 4HUWA 2KH2B 4BH7A 1VGEL 4HJJH 3MFGB 2XPGA 5HI4C 1EAPB 5HJ3A 3RNQA 4M1CC 2XG5A 5K9JL 2CKBL 1AGCB 4PJGE 1SY6H 1M7IB 5I0DA 3O9WD 5FHAL 4U1SB 5CCKH 5D5MB 4OZGB 4TUKH 4RFOH 1EAJA 1HDMA 3I75B 3SCMB 3ARGD 4GO6B 3EHBD 2X4RA 3EJYC 4A6YA 3SY0A 5AAMA 2F8XC 1ULVA 1GYAA 4X6FA 4IRSA 3VGBA 4R8WH 4JRWA 3Q3GA 1EPFA 5EIQA 3KYMA 4OIAA 4YXKL 4L4VD 5JZ7D 3UTPD 1A7RL 4NQVB 3TH2T 3DV6A 4X4ZA 4ZFFB 2PTUA 3WYRA 2OQJA 2VXVH 4RAVB 5SWZD 2NR6C 5C0BB 5HYJA 2K9UA 3R06A 3QIBA 4EN3D 3HG1E 2F53E 1IAIL 4JDZB 3S37L 4ZTOL 4D9QD 5DEZA 2W0KA 2A6DA 2V2XB 5IVXB 3OMZA 3RZCA 2B4CH 4KKCD 4NPYA 3ZLQC 5IVZA 3HAEG 1KTLB 1JPSL 4UV7H 1A4KB 2R2EA 3INUH 2GI7A 3I6GB 5B39G 3U6RA 4E5XB 2Q1EA 3WIFB 12E8H 1XCTB 1HHJA 2ZG2A 3CFBB 4Q6IB 3ULVL 4OV5A 3FOLB 4G3YL 1PEWA 5I1LA 1OD9A 3PL6D 4PJ8D 3VRJB 2VQ1B 3AROA 2WIIA 3OF6D 1YNTA 4X83A 3MOAH 4WW1A 1RMFL 1DEEA 3NH7L 1HH9A 5J56B 5KTEH 5CHNB 4R7DA 2PO6B 2X4OA 3D48R 1DBJL 3W9DA 2IJ0C 4QT5B 3HPJB 5H37G 4HUNB 3UTOA 3VFGH 1R5WA 5I30L 2HVJB 1E6JH 1GZPB 2XZAL 1XGTB 4YEEA 2RJMA 4J6RH 1D6EB 5E6IA 3HE7B 5E4IA 2Q8AL 5SWSE 4UUJB 4RWYL 2ERJC 4B41A 4G8GA 1X5AA 3QWRD 3QG7H 5F1OB 3BWUC 4P5MA 1MRFL 1Q0XL 4PGCA 1T89A 3P4LA 4RZCA 3E2HB 5L7XH 1W72A 3V6OA 5IROC 3CDCA 1CVSC 3FQTB 2Z31C 3WLBA 1BQHB 1OPGH 1T83A 4PJGA 5DRZB 5CJQL 4GRLA 1KB9K 5DJ8B 4HGKC 4G42A 1F58H 5HI5D 4C4KT 2SEBB 2ITCB 3BPOC 3SDAD 3VG0H 3MCG1 2K1MA 4P4KA 4Y16C 1HZHL 5F97E 5F7DB 1OVZA 5IB4B 4QOKB 4XNYL 5HGBA 2EECA 2ZCHH 2YD6A 5F7EH 3QUMB 3PWUB 5A2IH 4AK1A 4PY7B 4U1HA 3B2VH 3VRLF 2EXYD 3CLFL 5K33A 4YBHA 1ZT1A 4JE4B 3KS0J 1K2DA 3H9SA 1FG2A 1MRDH 2VDLH 2R8SL 3IFPA 4UDTB 4HKZA 1NMCB 2WUCL 1HN1A 2AJXL 4PJBF 5ACMA 3DVFA 2F53A 1N8ZA 1C7SA 2BNRA 4PJXA 2B8OT 3QDGB 3V2AR 2XKNA 2D7NA 1CFQA 3NACL 1DANT 3AFLA 4CVXA 3UTTB 5CBEB 5EU6E 4Z7WF 1IAMA 4OLWL 15C8L 4HQQL 5IKCB 2B5IB 2N7AA 4W70A 1G7JB 5IP4A 4P9MH 2BJMH 4MJIA 2VDML 4AY0A 5FGCB 2XY2A 3SBWA 3PWVA 3ULVD 3BP6B 4KK9C 2MPAL 2A38A 1AIFB 1W2KT 1AO7B 1EIBA 3L6FB 4R96B 1WT5C 1H3PH 1ES0A 1T7VA 2FEEL 2WBJD 4N9GB 5D7LE 1U58B 2P7TB 1KJ2B 1QR1A 4F7EA 5GGVL 2NZIA 4M1DH 2I9LB 3G6AA 4MAYD 1BP3B 4H1LA 1YQVH 3E8UL 2BVOB 2YWZA 4IRJD 1MJ7H 2QR0A 4RIRB 5HPOA 4PRHD 4Y8DC 3T0EC 3FAXA 5SWSA 2YS4A 5EZLB 1YA5A 2E6QA 4P59L 4WI4A 3QDJB 1EJOH 4NO5A 4P46A 4Y4KA 1DQML 1I9EA 5JDSB 2V7NA 1AE6H 5IB2A 4Y1AE 3V4PH 2R9HD 4KTYA 1J12A 1RUML 1VPOL 5HHXL 1RZIA 4R90H 5D93C 2YA0A 4XNXH 5ADOH 4N8CH 1RIHH 1UCBL 4HIJA 4YO0B 4M43L 1MFEH 5HGDA 5TGBA 1AGEB 1DZBA 1R3KB 3CH1A 1NGQH 1WBXA 5T1LD 4KROB 2X89A 4BFBD 5CD5D 5GS0L 2XV6B 4NRXA 5DK0B 2PF6A 4O00A 4P5TD 5TE7H 1CXLA 4Z7VE 3IYLW 1BVKB 4HKBB 4K7FA 5K59E 4FQCH 1S7RA 1DBAH 3TPUA 1KPRA 2PN5A 3SJVE 4XPTL 1RIVL 1MHHB 2VQUA 4QKXB 4WUKL 4IHOA 4MX7A 2B39A 4DW2L 2GJJA 1QLRB 3RY5A 1ZANL 3DUHA 2DBLL 1L9NA 3CFEB 2M2DA 1IMHC 3D25A 5E6IC 4ISVA 3DO3A 3UJIL 1HSAA 3CXHK 3ARUA 3QXDB 3BRGC 2EDBA 2VN7A 2XFXB 3VD9A 3C9NA 5IFJA 3C5SB 3KPOA 2FBOJ 1T89C 4JG0L 1AXTH 3RUGA 1DR9A 4HMDA 4HWEH 4NUJA 5C9JB 2E6JA 5EU6A 4LLWB 5JQHC 1UJ3A 5DHXB 4ZO6A 4ZAKB 3QUXA 2FL5A 3GMNA 3LEXA 4WV1A 1NFKA 4JRXA 2VDRL 4PJCA 1A9BB 3NN8A 3QBTB 1RK0A 4AG4L 1NGWB 2HN7A 1K4CB 4IIQB 2C1PB 2V2TB 4AENB 4LGRB 5C0AD 3MRFA 1MF2H 2NXYD 1UYWH 3HI6L 4HIHA 2O5XH 3MXWL 3PDDA 2ENYA 3D3VD 3CVHH 5D7LA 4G6AD 2IQAA 3HMXL 4LNRA 2YZ1A 1CDBA 5A3IC 4X6BA 1HYSD 4F33A 3MACH 3G5ZB 3OKYA 4WEMB 4U4BA 1RV6X 43CAA 2ZCLL 3SQOL 4XBEH 4PLNC 4HKJB 3HUJE 1QBBA 4L8SA 5DQDL 1HKLH 3PP3K 4RA0C 1CFNA 5EOQH 4OZ4A 5HVHB 4PB0L 3MTRA 3SKNB 5J0BA 2W0LA 4RRPG 1GIGL 4TSAH 3HNVL 5TE6L 4HZAA 4PGJA 2XNAA 1R3HA 2IF7A 2R23A 5CGTA 5FKAB 2YD2A 1EHLH 3K4DA 4R0LA 2VLJB 3U0PA 4A6YH 4F80A 3LN5A 1DLFH 5GS0D 4R26H 1UACH 3RX8A 4Z7VA 5JMRA 2ZUUA 2DM3A 3WV0A 5BO1H 4NBYB 3LPGA 4K3HA 3SJVA 3C6SA 4J7RA 5T1MB 5D96C 4G6JH 4PREB 4J2XA 4JM2D 1IKNA 1H0DA 4YDVB 3CMOH 5EBMA 2HLFC 3P4MB 3FFCA 2F5AL 3DMMB 4MJ4A 4WY7H 3RBGA 1FBIH 3QIUB 1B0GA 4L4JA 4CU7A 1FVEB 4XPBH 3KYAA 4TSBH 2XN9D 2IANB 1S7XB 4JGUA 4NRYB 1OAYL 4UBDD 2RCSL 3UDWA 3BJ91 4M6NL 4RISL 3A6BL 2L7JA 1AP2B 4KK5D 3IU3B 3JV4A 1NMBL 1R0AL 1NSNL 1Q9KA 1VKXB 3O4LD 1SYSA 4P2RD 5C7XL 2VABB 1CXEA 3GHBL 2OL3A 3AXLA 4L29B 1TVBA 5I6XC 5I9QC 2CK2A 1A14H 3B5GA 5DK3A 4XC3L 4XPAH 3QZWA 2V6HA 4DN4H 4OM0H 2H6PB 2QQKL 3CLEH 1F90H 4JFZL 3M45A 5DS8A 4X4YB 4XP4H 1JWMB 3ROLA 1QNZL 4M7KH 3WXWL 3HCVA 4ZODA 4UAOC 4F57H 3MRJA 5D1XA 5JOEA 3VW3L 1OAZH 1UT9A 4JB9H 2J12B 2A1WH 4LQ1A 4ZUUA 1UXSA 2W65B 2X4TA 1QLEH 3T2NH 4KZDH 3GM8A 3TBWA 3P4OB 4QHNA 5A16A 5C08B 5HGHB 4PJ5E 5D1ZA 1RU9H 4OB5L 3LS4L 4LLQB 3MLTA 3UO1L 1FORL 4YE4H 5EUKB 1U91A 2IEPA 1AD9A 5DJXA 2OR9L 1W72H 1CT8B 3F8UB 4NSKB 1S9KC 4YZFE 1N59B 1OLLA 3JTSB 1T80A 3ARZA 5E2WL 4GBXD 3HUJA 3TV3L 1N7ML 4OM1L 5DJCA 4MNQD 4DN3H 1F3DJ 5E2JA 3VXUE 3TBSA 3BOVA 2CXGA 1EZVX 1I3RB 3X17A 2AEPL 1ZVSB 3SO3C 1OQOA 4D2NA 3ULVF 1Z6JT 1YEHH 3BMVA 1NL0L 5MEPB 1F4YH 3WHXA 5DGQA 2LU3A 3BZDA 3IDIA 3NGBB 2FJGB 4OGYH 1LE5A 2IAMD 4ESKA 4KI5C 1UM4H 4IS6A 3Q48A 5JIPA 4O2EB 2HWZL 3BWAB 1PX4A 2EDEA 3P9WB 4KU1A 4F7PB 4FNLH 4C58B 3FB6A 3K2UL 2NY3C 1KCSL 3F7YB 3VI4F 3RWIA 5ABDE 1DTUA 1IL1A 4J3OC 1N5AB 1G9ML 4N0YL 1R3JB 5FDWB 2ICEA 1S8DA 4M1GH 3NFPB 4OCLC 1RJYA 3QXWA 1I7TB 4GSDL 5H35B 4N90E 4JPVL 1T1ZB 1X7QB 3VFMA 4M61A 2F58H 3WDJA 1QBLH 1PZ5A 4XWOC 5F7MC 1WIOA 4R3SB 1N6VA 4EZMA 3NOIA 5IW3A 2EH7H 4LSSL 3NABL 3AU1B 1WC7A 4NQED 1W8OA 4MSWB 4MYWB 4J3SA 1NANI 3MRHA 5DJZA 3T4AB 3PV6B 4R0LC 3MUGA 3ZHLA 4XCEB 1GXEA 4GUPB 4WDIA 5BS0B 3G08B 2XPGB 1YNLH 1D5MB 3LS5H 3BPCA 4BA8A 5HJ3B 4RCAA 2EDFA 4F7TB 1OL0A 2G5RA 4I3GA 3DVIA 4O58L 2XTJC 4H1LH 4JEGB 1OAQL 5F7UA 5JNYB 1IKNC 3MJ8B 4QCIB 3QAZB 1Q9OA 3PG2A 3OKLB 5DJ2B 3QEHB 4ZTPL 4KI5F 1HEZB 3MNZA 1CE1L 1PY9A 3SDCC 4A2LA 1LDPL 4UMGA 2GJ6A 3V7AE 4PJ5A 1SYVB 3QXAB 2VL5B 2OBGA 1LP9F 1ETZB 1NANH 1J1XL 3D69A 2NCMA 1HYRC 4QEGA 2ORBL 2H3NB 5GJTL 4OTXL 1HHIB 4S2SB 2FGZA 1NLBH 1QVOA 4L3ED 2O5ZH 3BD3A 2FZ3B 3WE6B 2HJFB 5GISH 2VLMD 5EOCH 3V5KA 4AIZA 1H5BA 3S7GA 4S1RL 1JHLH 3VXUA 1V7MH 1KCVL 4LEXH 4GG6F 3L7FB 1ZA6B 3RNKA 1BJ1J 1CLZH 3N1MC 1U3HA 4Z76A 3FB7A 4PLJD 3SKOB 4FA8A 4JFHD 1T20A 4OD2A 4UU9B 3QFJE 1YEKL 3UJTH 1BWMA 4MJ6B 3W11C 4UILL 5I1KL 1SJVA 3KXFB 2YEZA 2I07B 1ZVYA 5FV1L 5L0QB 1XT5A 4UT9L 5D1XC 3L95B 3VWKB 4HZLA 3SDXA 2DQGH 4M6MH 1KPVB 5KSBA 1WVZA 4YDIL 1GC1L 1CDJA 1I7UB 3MRGB 3OKMB 3STZB 5D7KD 4I18B 5C09D 5D2NE 1T0MA 4BZ1H 3IJHB 3FT2A 1YY8B 4P3CH 3PE9A 5E7BA 2V5RA 4U1LB 4LU5H 3UPRA 3DX6A 1KBGH 5DUPL 4APQA 4V2CB 4WWKB 4QRUB 5IEHA 5E1HB 2ADIA 4XTRD 4ZS6D 3JWDC 5L88L 4PJ9B 4LSRH 1HILA 4KJQC 4L5FH 4D9RD 4NQSB 4OBRA 3PNWB 1U8HB 4AL8L 1T5XA 4K94H 1PKOA 4GMSH 5T5FL 4UB0L 4HX1B 2R29L 4MD0A 3WMSA 1MFNA 1TXKA 5IESL 4BFIB 4P5MB 2ZNWA 1FIGH 4CW1A 3TA3B 1WBZA 3GRWL 5TFSH 4XNQB 5F72S 1ACYH 3CX5K 2FNBA 4BQBA 3ARDB 3T2PA 2DLFH 5FK9B 1S9YA 2QL1A 5FKPA 3K8MA 1BBJB 4S10A 4JKPH 2HAZA 4FQJH 4IMKA 5DJAA 5INCA 5FGRA 1MWAB 3HTLX 1NDGB 4YR6B 4JM2F 5ITFA 1CGSL 3VCLB 5ICYB 4FN0A 2QLVB 5TF1L 4ZUTB 4PGEA 5HDLA 1UVQB 4PRNB 4QY8B 3S36X 3GBNL 1RZJH 2A2QT 3MZTA 1AHWB 3WFBH 3O41B 5AUMB 1ROWA 3C2AH 1HIML 1FSKB 3C60D 3UZQA 3MYJB 1R5VB 5FA3B 5E94B 4FTVD 3H9SB 5FDYA 1A4JA 1OW0A 5E8NB 3Q6FB 2G60L 3O11B 5ID1B 3TJEL 5EC2B 5HDQL 5EO0A 5HD8C 3ABZA 4PJXB 3X3GH 3UJJL 3QPXH 4PJIE 2Z8WC 2XKNB 2W9EH 3GM0A 3QUZC 1I4FA 1XIWD 2XIDA 4KJYB 4RFEA 3IDMA 2E9IA 2GEEA 4QXWA 5IJVA 1JN6A 3O3AA 1NAMB 2R56L 4Z7NE 1TQCC 3W82A 3QFJA 4I9WE 3TYFB 4M5ZL 1B4JH 5GIRB 3VH8G 5GXBB 1U3JA 4KDWA 2NY2B 4PRIB 1BBDL 4ELKB 4P2YA 3KPRE 1AFVL 3V0WL 3VGEA 3PWVB 5IQ7H 4B53A 1IEAB 4YIQA 4UV4L 2DMCA 4YHMH 2R1WB 3FQWB 1MCKA 3QEQD 4BUGA 3I9GH 35C8H 5CWSA 4FS0A 2NQCA 1R5IB 3P0YH 5EU5A 1D5XA 4PBVC 5DJDA 4KUZH 1CICD 4XAWH 4NKDB 5EUOF 5FB8A 1JUFA 5GRVK 3IRZA 2Y07L 1ZGLB 1KCLA 1M7XA 4CMMA 1CTNA 5T1KB 2QR0B 4MDIB 4Y2DA 2E9BA 4NJ9H 1RZ8B 4FFWC 2OL3H 2VDOH 3FL7A 2KUTA 1FZJB 1YDPB 3FTGB 3BRDA 3S35L 5CP3H 4Y4KB 2FGWH 4ONOA 3QEGH 1QBML 5AZ2L 1ZKAA 4FXLA 3NZHL 4NN6C 3BQUA 5E70A 2J6EL 3TVMC 4YXLL 4NQDD 3VXME 1AXSB 4JHAH 2EYRA 3TNMA 5JXED 1X9QA 4MQSB 2AK1L 4K71B 1MHCA 4OAWA 2ITDA 1P7KB 1ZA3B 2GK0A 3GI8L 1IM3A 1NUFA 3BN9D 5DGRA 1QO3A 5E2TL 2QADD 2VITB 4PBXA 4UOW0 3VFNA 2BXZA 4J4PA 5JW4Q 1BD2B 4JM4H 1RZFL 1KPRB 1CXHA 3O3UN 4KV5F 4KVCL 4IOFC 2A9NH 5ICZB 3IFOA 3GJFB 1S9WB 5FHBH 4APQC 2A6JB 4P49A 3L9RB 4HUXB 4LSVL 1N4XL 2H2PC 1U9KA 3MJ7A 2GYSA 1T5WB 5DQ9B 4WUUD 5EBLA 3QJHA 4XCCL 1K4DB 5GZOC 2PW1B 2AV7B 4H8WH 1UZ6F 1T2QH 4I77H 2X5PA 2Y6SD 2XQYK 3D39B 3H3PH 3PP4H 4ODTL 5D1QD 1G9NC 2AJZB 4AEHH 4FZEH 2NW2A 4X9FA 1KJ3L 4ZNCD 5IFJB 1T2JA 2YXFA 5D2LB 3KDMA 2OMNA 2YUXA 2W0FA 2JCCE 6FABH 2BCKB 3RUGB 4PJIA 3MCLL 5IHUH 3G04A 1AKJB 1A6AA 2FJFB 3NAAL 4DGYL 4U33A 2I26N 1TTUA 4FOMA 2HT4C 1Y6NR 3BP7B 5BXFA 4NUJB 3DXAE 5KSUA 1KV3A 1SJEA 5J6GB 4IMKC 1IQWH 4RNRA 1QYGL 5AZEH 1A2YA 3AREB 1DBMH 2AK4E 2P47B 4JRXB 5HGAA 2OLDA 1AY1L 1OTUC 4Q6YA 4QTIL 1MVUB 4XZUA 1DLHA 1MY5A 4EDXB 1A6UL 5JW4N 2Y36H 2AEQH 3CSGA 4XHJD 5BV7H 1RZKC 4ODWB 3QDAA 2HT2C 5I1JH 3THML 4AT6A 1BZ7B 3ELAT 5BQ7B 2UWEE 5T1DL 3K81A 1J88A 3DI3B 1OW0C 1Q72H 4L8DA 2HMIC 2Z91B 1IAIM 4FP8L 5HYQA 5JW5B 2ESVB 3W0WA 3VFVA 4O2CB 4N0UA 5E2UH 1BECA 1QSFB 4Q7DA 4KRPC 4G9FD 5C0GB 5DD5H 1JZ6A 5I1HL 2DWEB 3DURB 3KPMA 2EDQA 5C8JB 1J05B 4DKEL 2X1OA 3SDYH 2P46B 3EO9H 3FQRA 4WFHD 4KKAD 1RVFL 1AC0A 5TQ2L 5I66B 5D2NC 1UXWB 2AJUL 4PJAB 3CFDB 3C6LB 1NCCH 5I8CA 3H7LA 4S1DD 1OM3L 1A02N 3U36A 3UBXG 5IV2B 4WW2C 1XCQA 5KAQG 4XGZB 3FFCB 4Y2DC 3VWJA 3MGOA 1BMGA 1DN0A 5C9KA 4N0CC 4F58L 3G5XB 3SQBA 4MQXD 2IGFH 3BIAX 3GIVA 4M00A 3BHBB 1CDGA 4PJBA 3X11A 3ZDXF 1T2XA 3DYMA 2APTA 1EBPA 1MI5E 3WUWG 3V4VH 3U7WH 3CVIL 2FSEB 5D7JC 1T03H 3T8XB 3JUZA 4NN7B 5L6YH 3QA3B 3DXAA 4I0PD 2FATH 2M8XA 2CIIB 4NP4L 2UZIL 4Z7WA 2AK4A 4U6XB 3NCCB 1U41A 3C8HA 1QSVA 4KMLB 3RY4A 3C5JA 4J4PC 4M62L 1X4ZA 1UM5L 4JAMB 3HC4H 2ADGB 3NCEB 3ROOB 4R4BA 2UWEA 1HQRA 3BGMA 1MJJB 2FBJL 3UTPE 3WNOA 1YEDA 3DGCR 5DUBB 3OXSA 4LHUB 4Z77B 2I9TB 4DGIH 1HHGA 1I1AB 5EZJA 5D1ZB 3IJSA 3KLSA 5ERWA 3GI9H 2IFFL 5JR1H 1AD9B 1N0XL 1CFVH 2QQLL 4D9QE 1U93A 4Q2ZB 2AXGB 3B9KC 4JZJA 4K3JH 3SCMD 5JQ6L 2X10A 3FQNA 4K7PL 3JWOL 4NC1C 2FWOB 1ORQA 3U82B 2OK0L 3DRTA 3KGRA 4KAQL 3U1SH 3QUML 5BVPL 1MCCA 1OTTD 4NKOB 3LQZA 5F1IB 2ADJA 4O2FB 4F3FB 4X80L 4ZQKA 1JGEA 4XP6H 4TUOB 2RIKA 4NZUL 1UENA 4LOUD 1ZHNB 1CGXA 4ZUVA 3B2UD 3EFDL 5C0BD 2JJVA 4X7EC 2IFGA 5FYJH 3GSOA 5IHLB 4MLIA 2W0PA 3TBYA 4PJFE 2CQVA 2JIXA 3FJTA 4P23C 4WHTA 2VSDA 4WI6A 3CPLA 5EO9A 4BUHA 3IXAA 5T3ZH 5IOPA 3EO0B 3S97C 2X7LA 1IL1B 2JJSA 4WVRA 3WFDL 1NCUA 3OHXB 5BV7B 1LO5A 4WTZG 4RGMB 3PWPE 5JDJA 4PB9H 5DMIL 4Y88A 4PP1C 3LD8C 3VFUA 1CL7I 3NTCL 1JF5A 2FX7H 1FRGH 4GKZB 5EOTA 5IK3A 1M05A 2HT3D 1I1RA 3NZ8B 1GGUA 3O6ML 5DJZB 1KJ2L 1U8LA 1DUYA 5CEYB 5E8OA 3NCMA 1CU4H 2PO6D 5CCKL 1VFAB 1XF4B 1YEGH 3VH8B 3O9WA 5F6HI 3WIHH 4YFEA 5KSVA 1ZGLP 3BE1L 3ARGA 3GSXB 2NZ9D 3GMOB 1AJ7H 3GSNB 3HE7D 5JHDB 1V3KA 3VXPA 1NGYB 3TBVA 4WU7B 3T3ME 4JY5L 1Q9WB 3QQ4A 2FH8A 4HFUH 3NA4A 4HIEA 4ODSH 4X6CE 5DEFA 1PEZA 4PJ7E 1YECH 2WINA 4R7NA 1SVZA 4JREC 3VG9C 3DO7A 2AEIT 5TQ0H 4L4VA 3FAWA 3GO1H 4PJEE 1P2CA 2EH8L 1GPOH 3IFNH 1DDHA 1JWSA 3VXNB 1CL7H 3SN6N 1H8NA 4LLYA 5I2IB 4HGMA 5SWZA 5MEND 3FT3B 4OZFB 4DGVL 2VDPH 4ZNEE 2WW8A 3RVTC 3WFCH 3OTTA 4HDIA 4OGZA 1CE6A 5FV2A 2GITB 3LPWA 4J1UA 4LQFL 1MAJA 4OUOA 5D70H 1KLUA 4UV7L 1Q9LA 5DA0B 1GHFH 1NCBL 4QOKD 2F8OA 3O6FD 5LGKA 5IEKB 1KTRL 3SE8H 3SKMA 3TZVC 5IR1A 12E8L 4MNHA 4QRTB 3V4UL 4FQQB 5E6YA 3NBNA 4OD2B 4XPFH 3ULVE 4MB3A 3PL6A 1QP1A 5I18L 2F5BL 4PJ8A 2XTLA 3ARRA 2F54B 3EZ8A 3OF6A 3X13A 3M1BA 5DVLA 3ZKND 4XXCA 4FXKB 3SDXB 1P5VA 1XF3B 4JKWA 3QDGD 5K9QG 4MJ5B 1XMWA 4MJ2A 1E6JL 1TZIA 2Z0BA 2P5WB 1FFQA 1NGZA 2CUMA 3NCJH 3PWNB 4PRHE 5GRUL 4WFED 4D94A 1ZT7B 1J10A 1X3DA 3FRPA 1K6QH 3L3DB 3ZT6A 1VERA 3HZYB 1U8KB 3QWRA 3G6JF 3LZFH 4J3XA 1HILB 3REVB 3O3BB 4UNUA 1FVDA 1UH4A 4YHOH 5L7XL 5GJSL 4BYHA 3MLWH 3JV6B 1YJDH 2BDNH 4R2GB 1AO7D 3PWJA 3QO1B 3KWWB 1VSCA 1FGVH 5EZOL 3RY6A 3MREA 1JF1A 2XY1A 4P0DA 2CKBA 2HFEA 1F11B 1F58L 1MVFA 2QQNH 5FA4A 2H9GA 2ADFH 3SDAA 3V8CA 1Z9LA 5I8OL 1UB5B 2NY5H 1NBYA 2D7OA 2NY4D 4MA8H 4XNUH 1QD0A 2UUDK 3QDJD 1T0NB 2P8PB 5F3BB 4X6CA 4PJ7A 2W9DH 1A6WL 4P3DA 4E0RB 2FEDC 4PJEA 3DVGB 3BEVB 5E08L 1ZHLA 1SMOA 4JPKL 4UIKH 2YKLL 2FX8L 4KROD 1QLFA 3MOBH 4LDLB 4W6WB 3VGGA 5DTFA 1U95B 2HA1A 2MCG1 3EOBB 4R6UA 2CDGB 2Q20A 2LTQC 5E8PB 1FNSH 1WFNA 4ODHL 4PRPB 2WQRA 5KS9B 5F7YC 4YDJA 2V2WB 3B9VA 1I9IH 3O9WC 1WIPA 3ARFC 3JVGA 3N1QC 4DZ8B 3MUY1 2BJML 1SBBA 5JTWA 1RHHB 2C5DC 3EHBC 5EN2A 4ZOBA 5MEOB 1G0XA 3DECA 3K3QA 4ZPVA 1N2RA 2EDTA 3EOYG 5IM7A 3GMQA 2VLKE 4N0FA 5C0AE 1RJLA 3U2SB 4PGZA 4M1DL 2WBJA 4M9OA 5FYLE 8FABB 5HHOB 4O9HL 3K74B 2P5EE 4MAYA 5T33H 2ED9A 4DQOL 3RAJH 2OS7A 5DRNB 4YWGH 2YSSB 5DFTA 4NZJA 32C2B 4IRJA 2V5YA 2FLRT 3P40A 4PRHA 2HG5B 4ZAKD 2G5BB 5D5MF 4UINH 4OZGF 1EJOL 1SM3H 4NJAH 1KLGA 5FB8B 5F9WC 4UT7H 3GB7B 1R3LB 5DFWH 2BHZA 4KKCC 4R90L 3IAQA 2YZ8A 1MAMH 4OGXH 3WUWB 3MLPA 4XNXL 5AYUL 3I3DA 1RIHL 1CZ8H 1A3QA 2CLZB 2R1YB 2NY1D 4OCXH 3HN3A 4DWHA 4GAGL 3CDGB 3LEVH 4LCCC 2AS5M 5T1LA 4GQ9H 1K8DB 5I1CL 2P48B 1CFSB 2C7UA 3QSKB 2VZSA 4P5TA 3D9AH 4UTBH 3WJLC 2D7TH 3ME0A 3SGKC 1DBAL 3MOQA 1KELL 1KIRB 3CSBA 2EIZA 3MPCA 1C5CH 5DEGA 4KRMB 4DTGH 3Q2CA 3ORJA 2A6IA 1JL8A 4FQ2L 5F93C 2XZQL 3PQYE 1E27A 2QSTA 3X3FL 2VDNL 5KSAB 1JNJA 2EYSA 1A7NH 5I75C 1UWXK 1AI1H 3EJJX 4L8CA 3NFNB 2O61A 4HBCH 3OAYH 4L9LB 1IGTA 4TNVF 4D9LH 3HFML 5HHPB 2VLJD 2C3XA 2GUOA 2VN4A 2C9AA 1AXTL 1LP9A 4EI6A 2