1NMAH

N9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
EVQLQQPGAELVKPGASVRMSCKASGYTFTNYNMYWVKQSPGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAYMQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (hydrolase/immunoglobulin)
molecule keywords N9 NEURAMINIDASE
publication title N9 neuraminidase complexes with antibodies NC41 and NC10: empirical free energy calculations capture specificity trends observed with mutant binding data.
pubmed doi rcsb
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1994-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmaH00
2FSEA 3KYAA 3EO9H 1JTPA 4LNRB 3TGXA 1CDGA 4PJ5A 4XNQA 1CE6B 2X4SB 4OF6A 5T1KD 3QI9C 4YIQB 4IDLA 4Y4KB 1ED3B 3P4LA 3SDDB 1XF4A 5HYSA 3KXFA 1AGBA 2VABB 1UQSB 1YEKH 2X4OA 2F9BT 3O6KH 4G9DA 1YDPB 1TVDA 1U8QA 2YHGA 2HLFC 2Q3AA 3MUZ1 2BRQA 2IAMC 1KIQA 3CSGA 1BBJA 1RHFA 3F5WB 1RZFH 1YMMA 4PRPA 1UCBL 5D1QD 2GJJA 5AYUH 4XVSL 1I3UA 1LD9B 4UT7H 4J6RL 4NQED 1GXEA 1KCVL 3QDJD 3EYFB 4ODSH 3BIBX 3QXVA 3OR6B 4IRSD 4NQDD 4QTIH 1FZMB 2X05A 4P2OD 3RWDB 3P30L 1Y0LB 2V17H 2SEBA 4NM8L 5DJDA 3V8CA 3MRJA 6FABH 3AREC 1NCAL 4DFHA 1BQLH 1TJGH 2DBJA 4H1LB 4KFZC 5ISZD 1O0VA 2ORBL 1RZ7H 3FCTA 1MEXL 3E6FA 4L9LC 3B9KC 4D0BA 3MRQB 4AEIL 1J8HB 4YHZH 4GKZB 5DA0B 1W2KT 2QBWA 2R4RL 4NKMB 5HXMA 4TVSa 4WFGD 4H0GA 3RTQC 2YN3A 1PKQB 3L3OB 3LS5L 2AJ3B 1I8MB 4PGDA 3FZUC 3OKEA 4J7RA 2P46B 4GMSL 1ZLVK 1EMTL 3WFDH 1I3RA 4GAFB 2H1PL 3RU8L 3H9SB 4E41A 4X7SL 5FA3A 1IARB 5KS9A 4QT5A 1VSCA 1IM9B 1RK0B 1A6TB 4F7CB 3E0GA 4ORGB 1E28A 5GRUL 2EYSB 5JUEH 3ZKMD 3U4AA 4DGVL 1RIHH 1ORSB 2ZCLH 3C5ZD 1MAMH 3C8DA 1PZUB 1H3PH 1T1XA 5F9AC 3WJJC 2CKBL 1CFQA 2EXWC 5IG7B 4QYOA 3GMQA 4G8GA 4EUPG 3D9AH 1HIMH 1DL7H 4HLZG 1BJ1J 5DVNA 3VJ6A 5F70A 3QIBA 4HWBA 4LARL 4Y5XB 4L4TB 4RGNC 2HT3D 3CFKB 5D1XB 1MOEA 1FVDA 1IQWH 3I2CH 3W9EA 1X3DA 1TVHB 4XZUA 2F8VA 2HRPH 3QO1A 4JE4B 4XMLH 4M4RA 5BVPH 2FEEI 1OF2A 3VD7A 4CN6A 3RZCD 4LEOB 4WCYL 2OR7A 4P46C 3W5MA 3S37H 4LAQH 4KKCD 4XVTH 2CUMA 1A7QL 5JORA 2V2WB 3BQUA 3TO4A 1AE6L 1T80A 3IKCA 4HHAA 3KXFE 3QUMA 4NQSA 5SWZA 1WCQA 3PHQB 3PP4L 1QFWH 4QHKI 1Z9MA 1WAAA 1T20B 3G6AB 1DVFD 5IKCA 4Y5YC 2X4TA 2QLVB 2DTML 2CDEA 3KNBB 4NCC2 4G7VL 1YMME 4PRPE 4Z8FH 5DMKA 4XP5H 1W0VB 2BMKA 4ODTH 3GSXB 4AMKH 1A3RL 3GBMH 1X6LA 4XPGL 2NXYB 4NHCL 1NL0L 4EVNB 1N0LA 1MFBH 3WNNA 1NCDH 5HGBB 1IT9L 3DIFB 2VLKB 1CD1A 4JFOA 5ELIA 1BEYL 5ADPH 3OKNB 4NQCB 2Y1VA 2NY6B 1KIPB 3T1FB 5I1LA 2VDRL 1W0YT 4LCCC 1H3XA 3QIWD 1X5HA 2VDKH 5DDHA 3FQRB 1UWEL 3G04A 1UM4H 4BH8B 3BDYH 5IR1A 4L8BA 3BXNA 3BT2H 5I6XB 1K4CA 4EI5C 2G9HA 3PWNA 5DMJB 5J1SC 1UZ8A 2DYPD 3NN8B 3BP6A 3QUXB 1DFBL 2A6DB 4F58L 3IFLH 4M7ZC 1TJHH 3U2SB 5IV2A 4HUVA 2PCPA 3VXOB 4NO3B 4GXVH 5J9PA 1N26A 3SDXF 1LQSR 1WBYA 2UY6A 4P2QD 3P9LA 5L88H 2JCCB 4E41E 1QD0A 1XGYH 3F6LA 3VU2A 5KS9E 3NCJH 5LXGH 3SDAB 2Q87A 3HHRB 2VUYA 4TN9A 3LS4H 4N9OB 1R5VA 2AS5M 3MBXH 1LO5A 1NGXB 1YUHA 2HVKB 3RVVD 3BPCA 5IQ9B 3H7BB 4ELMF 2V2TB 1IM3A 4DN4H 2K7PA 3FN0H 4RMUA 1XF2A 4S11A 3SKUD 4ONGL 1PQZA 2PYEB 3MV11 1NGYB 2J8UA 4V1DD 2EXYC 3QPQD 4MZ3A 1JGUL 3MRLA 2EICA 5DK0A 4P57B 4G8GE 5FO9A 3OBAA 1BM3L 1XIWD 1NMAL 5DJAB 4N1HB 5GJTH 3U9UA 4ZFGH 1G9EA 1F3JB 4OZHF 2PO6B 5MHSE 4Y4FA 2V5MA 4LPTA 2IALB 5A2JH 1T66D 4MD4A 4MQTB 4CU8A 2ZUUA 3CK0H 3TJEH 2JIXB 3KWWB 4AEHL 1N5AA 3MR9A 5CFHA 1G9MH 3CU7A 5CJ8A 5IEHA 4C56D 5ID0A 1P7QD 1EPFA 4X8XA 4PJXB 2ED8A 5E00B 5EBLB 5E99L 4RRPG 2CKBA 1I9IL 1EFQA 2C26A 2XTJC 4G6ML 3G6DH 1S9YB 3VMOA 4EQ2A 4GBXD 5ALBL 5SWZE 1BFTA 4DZ8A 5FHBH 4KJYB 1Q38A 2PTTB 3VGDA 3RNKB 4J8RB 1MHPL 3MLZL 5DHYB 2BFVL 1MIEL 4M3KB 5JR1H 2COQA 3GHBL 4XPBL 1GHFH 2JJWA 4P5MB 1FAKT 1WWWX 3MRRA 4FS0A 3MRFA 4GG8A 2VLRA 1RZGB 5CCKL 4XPTH 4JDVB 5KVMC 3DMMB 3U46B 1YEJH 3ZYOA 1NAMB 5AD0A 1QTYT 3MGTA 4PGZA 5C0RL 4NWUH 1YEDA 1JNNL 1OT2A 3ECBA 1NEZB 4I2XB 5CZXC 5J4MA 1FFQA 4PYGA 1TZHB 5E8EA 3UBXI 4M7KH 3GMOA 3UTPE 4IRZH 1G7JB 3LQAL 2P5WD 3T3MF 3DURA 2XY1A 2PYFB 3HNVH 4MMXC 1KIRA 1ZGLA 1OL0A 4KROD 2WBKA 4NUGL 3O6FB 5KJRH 3O8XB 2X4SA 5TQ2L 4Z7OF 4YIQA 1HKLL 4Y4KA 1ED3A 2Y7QB 4F9PC 4HT1L 3ZHLA 1EBAA 1ZHKB 2LTQB 1WEJL 2VABA 3EYQC 3D48R 1GGCL 1UQSA 3T0DA 1CIDA 25C8L 3GM8A 1YDPA 3BEVB 5EOQH 5E9DD 1HNFA 3IFOB 1C5DB 4XX1E 3TYGL 1Q1JH 2F58L 1ZT4A 2Z31B 2G60L 4UIKL 1NGWB 2ZSWB 1FHGA 1FORH 1J1OH 1BAFH 5D5MB 2WK2A 1BLNA 3GIVB 3LQMA 3SDCA 4OM1L 3BW9B 5JW3L 4FZ8L 4YC2B 1HE7A 1E4XL 3LDBB 4G6AD 1U8OB 3QQ3B 3U0WL 2APWA 3EYFA 1IZKA 3OXSA 4HK3N 4OLXL 4HUUA 3OR6A 3RWDA 2J8UE 2YS4A 4R8WL 4ZPVB 4HZLB 1IFHH 4DN3H 3BUYA 3CXHK 3SE9H 3V52L 3TJHC 3VRIB 2LAGB 2QADC 5TDNA 3CNKA 4GW5A 3QDMA 5D96B 43CAA 1ZLSH 4XNYH 4B41A 4PJ9D 3MRQA 1DN0B 3Q1SH 3LEYH 1NCWL 4K7FB 2CLRA 3FN3A 1AXIB 1S5HB 3P77B 1BX2B 1PKQA 3L3OA 1I8MA 1RURH 3SOBH 4NSKB 4YXHL 5LGHH 2DICA 5IB4B 1NGZA 1MY7A 3H9SA 1ZHNB 2IJ0C 4ZD3L 4C57C 4IJ3C 4YDKH 4EBQL 4KI5D 1JGDB 1P84J 1RK0A 2WWKO 4N0UA 1YYML 3FB5B 4ORGA 3DO7B 2GW5A 2EYSA 4M9OA 5DJZA 5I15H 3S88H 5AZEH 2YZ8A 3WHE0 4JPWL 3MLUL 4LBEA 4TSAH 3RWFB 3WFEL 1ORSA 4YBHA 1A7OL 5DLML 4G42B 4NHUB 3VG9C 5IG7A 1BGXH 2FEDD 2BNQD 2R4SL 5D1ZB 5GGQH 4PP2A 4CMHC 1IGTB 5MENB 2GI7A 2VLRE 1LO4L 5FEBA 3O6LH 1E6JH 1P4BL 4L4TA 5DUPL 3VI3F 1Y6NR 3CFKA 3BDXA 5D1XA 1LE9A 4JFHE 3RL2A 4MAYB 1FIEA 4KK8C 5K9KB 1TVHA 2VDLH 1A6WH 3FRPA 4WU7A 4Y2OA 3EDJA 3ARBD 1ORQB 4XT1C 2X2YA 3WLBB 4LKXB 5EOCJ 2HFEB 1NAML 1ZVSB 4AT6B 2WWKT 1F4XL 3HAEG 5IVZA 4RGOL 4FQXB 5HHXH 2AEQL 5T1LD 4I9WD 2O61B 1RUPL 2V2WA 3VE0B 4U1SA 2XZQH 2D4FA 4Q2ZB 2R0KH 2ZCKL 2BRRL 3DSFL 3V4UH 4C83B 5C3LD 5C08D 2DBLH 3A6BH 3OAUH 1JTTA 3QNYA 2VDNL 1T20A 2O5ZL 3G6AA 4B0MM 2X9YA 3FO1A 2EKSA 4NFBA 2D4DA 4XNMB 5DD5H 4R9HA 4HS3A 1W0VA 4X80H 5TJWK 3GSXA 1H15A 1UWGH 1PD6A 3O6ML 1FNSH 4U4BA 2CMRL 3BGFB 1FNAA 1T21B 2ICWB 3GMRB 1JYWA 3KVQA 1RZKL 4NJ9H 3VFGL 2MMXA 1EX0A 3HZMA 3X13B 1F4AA 5GGSB 1XCTB 4NN7C 4TSBH 1QHPA 3FT2B 3DIFA 2VLKA 3JV0A 5HHNA 4IHOA 4RFEA 3OKNA 4NQCA 3TO2A 2W0FB 3KPNB 2VXSH 4U6VH 3T1FA 4Y8DC 5F8RC 4P3CH 4MX7B 3QG7L 4K07A 1EGJH 4TUKH 2VR9A 3OKLB 4BH8A 5E5MB 1DBAH 2XN9B 2B0SH 4U1IB 4R96B 4I3GA 3QYCA 4LFHG 4WI4A 3T3PE 3KPOB 4LCYA 4QCIB 3QXDB 3NN8A 4QRSB 3QUXA 3RX8A 3WEXA 1PKQE 2P5ED 1N4XH 1X44A 2D2OA 3WFCH 2ESVB 4I0PD 4HC1H 3NZ8B 3VXOA 5DHVB 2BC4A 2X4RB 1I3VA 2JCCA 4R7DB 1HINH 1XR8B 3H9SE 4S1SH 1F11B 3RA7L 1R3HB 3MXWH 4XCFH 4WNQB 4U2ZA 4N0UE 1FAIL 1NGXA 4ERSH 5IQ9A 3H7BA 3SDYH 1CS6A 3S8WA 4UU9A 1E4KA 4UOW1 4AY0A 1ACYL 3CVHA 2RJMA 1NH6A 5LCVL 3SJVD 1MCSA 1EHLL 4R97C 4XNXL 5IP4A 3HMXH 4N8VG 4XAKD 1I1RA 5FOBB 3V5KA 2OSLA 5DJYB 4R6UA 4ZUVB 4XNZC 5CMAB 3EDDA 4DK6A 1K8DB 4LLWA 5FFLA 1CR9H 3TN0C 3OSKA 1F3JA 1GL4B 4L4TE 2Y23A 2PO6A 1YYLH 4HJGB 1CF8H 2IALA 3TA3C 2HJFB 4X6BB 3V0VB 5EU6A 4XMPL 4FXLA 3TCLB 1QR1B 1TNMA 5CJXC 3HB3D 4NKIH 4B7LA 1RHHB 4JQIH 1BD2A 2JIXA 3KWWA 2R56H 1NMBH 3DSNA 5IIEB 2EIZB 5IROA 2W07A 4LQ1A 3WN5C 2B4CC 4JO1L 1N0XL 1QOKA 1QRND 4PJXA 4OCYH 4QNPF 5E00A 5EBLA 5HDLA 4NZTL 3SCMB 1PKOA 4JREB 5JQ6H 4PREB 3RUGB 4G6JH 4HIIA 1OSPL 3TZVB 4S2SB 4QXGH 2VQ1A 3VWKB 1IEAB 1KJ3L 5D7LB 1AGCB 5F6IC 2JB6B 2VISA 3HKFA 1WFUA 2ZKHL 3GNMH 2PTTA 3RNKA 2GJ6D 4PB9L 4J8RA 3GMMA 1EFXD 4YDLB 4FFVD 5DHYA 3OAYK 3UPCA 3MV7B 4P5MA 1NBVL 4P9HL 4GUPB 5L6YH 2BVYA 4JDVA 3DMMA 5BO1L 1X5JA 5CJOL 3U46A 3DVIA 4TRPH 4RMTA 1NAMA 1ZANH 2N56A 4OLVL 4WEUD 3RKDC 2VLKE 2R2HA 4M1CD 3CFJB 4NQCE 1TZHA 4LLQA 1K6QL 5F1IA 4JRXD 3VXRD 5IT2L 1G7JA 2A9ML 2YBRA 3T0EB 4PJIF 2PYFA 3CSBA 2ICEB 2AP2A 3SKMB 3QB7C 4MQXD 3IDNB 2NZ9C 4OQ1A 1A7BA 2ATKA 3VFWB 1AXSB 3MOAH 4LVHB 4F3FA 3SE4C 3KS0J 2Y7QA 5DJCA 1U95B 4Q7DA 4BH7B 5DRWB 1EO7A 2GSGB 3CC5B 2QJDA 3BEVA 5I8KL 1DP0A 2JCCE 2ZOLB 3X3FH 3MRCB 3IFOA 1N6QH 1C5DA 5SX5H 3UYRL 1MFCH 5IFJA 4ZOEA 4AH2B 5IMMB 1NGWA 2ZSWA 4MMZC 2FBOJ 2W92A 4EKXA 3HZYA 3GIVA 3BW9A 5KVGL 5C07D 4JHBA 5IK3B 1U8OA 2HTLC 3M8OH 5DFVC 2F5BH 3V5HB 2OR9L 1UM6L 5EBMB 2C3XA 1T2JA 5D9SB 3QISA 4U1HB 3WS3B 4XI5D 4ZPVA 5LWYL 1JIBA 4K9EL 3ES6A 4O4YH 3EO9L 4HZLA 3LD8C 2OMNA 3O11A 4Z77B 2PXYA 1A1NA 3VRJB 1AKJD 4E9LA 4Y1AD 2GK0B 1SEBB 3ZDYF 3BZDA 4AENB 1A5FH 3ARDB 1FFNB 4CJ1A 3DHJA 4ONOA 3NGBC 2HP4A 4BZ2H 1DN0A 2YPKA 1Z9SA 5EU6E 5FAAA 3EYUL 4K7FA 4ETYA 2C4FU 1BD2E 1S5HA 3ARGB 3P77A 1BX2A 3B43A 2EH7H 5DWUH 5GRXG 3UAJC 5J3HD 2ARWA 3D18B 3RIFK 1UGNA 1RZFL 1IGMH 2DQEH 4PJXE 5IB4A 1UH2A 1HXMB 5FXCH 4OZGB 2VO5A 4K3GA 1FVEB 1UT9A 2X10A 4UT7L 3R8QA 2EE9A 2OK0H 2IFGA 1JGDA 4ODSL 4G80B 3OQ3B 5C09B 3D3VD 1XT5A 3FB5A 4G9FD 4X5WB 4CW1B 4C55A 2J8HA 1NEUA 6FABL 3GSWB 5BZDA 1RJYB 4YAQB 1JYNA 1BQLL 1TJGL 3RWFA 5EZJB 1F90H 4G42A 1CQYA 1RZ7L 2L4OA 2X7LB 3IETB 2AQ3A 3QI9D 4P2RD 1IKNC 2IC2A 4WWKC 3DBXA 2XKUA 4YHZL 1IGTA 2XRAL 4WV1B 4UOJA 3FFCD 4LIQH 2CLVB 4TNVK 3PJSB 3TNMB 2BVEA 1QZ1A 2HLFD 2EDOA 4XNUH 4U3HA 2IAMD 2YUXA 1EEZB 4MAYA 3QXUA 2JLLA 3PWVB 5GPRA 3IDYB 5K9KA 1ZA3B 3WFDL 1UG9A 2NPLX 4OSUH 2D7TH 1T83C 5KW9H 1HSBA 4X4YA 2AAVA 1ORQA 3WLBA 4D8PB 3WIFB 3SBWA 4NRZB 1ZVSA 2DIAA 4LRNH 1YZZA 2JJUA 2K1MA 1YEEH 5JUEL 4FQXA 4G8FA 3VE0A 1XGPB 1RIHL 3VFSB 3ARED 1ZV5A 1H3PL 3ZE2F 4DGIH 4CRPA 4J12A 2H3NA 1L6XA 4OI8A 3B9KD 3D9AL 4BA8A 1HIML 1DL7L 2EYRB 2BNRA 2HKFH 3BEWB 4OGXH 1PZ5B 1BBDH 4KI5F 4NNYB 1CK0L 3QFJD 3C60B 3R8BB 5C8JB 4YQXH 3RTQD 1L7IH 1IQWL 2X89D 4HLZH 1BJ1H 3FZUD 3I2CL 1WBZB 1LO3H 2ICWA 5CJBA 2HRPL 5JDSB 3GMRA 3D2UD 4XMLL 2WLYA 1QPPA 4JDZB 4AIXA 3CD4A 2BSED 1QVOB 1U3ZA 3UJIH 3VFUB 2C3WA 4LAQL 3VD4A 2E3VA 3E2HB 3RGVB 4XVTL 3QXAB 3U7WH 4BK4A 1JHKL 4MX7A 2YSSA 1MRCH 5C3TA 5E5MA 2CH8A 3JTSB 2A77H 4U1IA 5J12C 3KPOA 3VW3H 4PP1C 4QCIA 2W9LA 1QFWL 3QXDA 4JO3L 3BE1H 2EXWD 4QRSA 5BZWB 4OUOA 2WUCH 4J3TA 3FQNB 2CGRH 4NQDA 4P2OA 1NDGB 2ESVA 1ONQA 3NAAH 3NZ8A 3VXUB 4J3XA 4XP5L 1JV5B 2PNDA 3MODH 4ODTL 4RGND 5DHVA 2X4RA 4NZJA 3MGOB 4R7DA 1WIUA 3U36B 3L5XH 5ISZA 3TV3L 1R3HA 3TF7C 1HHHA 1FYTB 3S35H 4UV4L 4WO4C 1AI1H 1MFBL 3V6ZB 2IPTH 1NCDL 1PFCA 4FQQB 2YWZA 1BJ8A 2NTSP 4KKNA 4LMQI 4Z0XB 1MREH 5HYSG 4HGWB 5EZIH 3LKQB 1JI1A 4HUKB 2XNAB 2EEAA 4JPIB 5KSBB 2NY3C 4P46D 4ZAKC 4LVOB 1VPOL 2VDKL 4NCC1 3RHWK 4URTB 1UM4L 5C9JA 2UUDK 3BDYL 5DJYA 4ZUVA 4ZUTB 3TIEB 3OX8A 5CMAA 3OGCB 5DC0A 1K8DA 3HE6C 4ODBD 4MQ7B 1IAOB 5MENE 5AG8A 1A14H 3IDGB 2X4QA 4AYFA 1YC7A 3RIFF 1W72B 4WI5A 4QGYA 2EEDA 2VAAA 5EA0H 1B3JA 1QR4A 2HJFA 4X6BA 3P4NB 2CDGB 3L5WB 4NQTA 3QRFM 1KLFA 4GXVL 4WW2A 3TCLA 1CQKA 4KZDH 1QR1A 1UB6B 1GPOH 3F58H 1RHHA 1QLEH 1MY5A 2EDQA 4PG2A 3C5ZA 2YXMA 4OKVB 3NCJL 5EUOA 5LXGL 5IIEA 1F8TH 2WQRA 3LS4L 1MH5B 3MBXL 4M62H 1H9VA 2V2XB 4DN4L 2OS7A 2DMCA 2ZZUT 3FN0L 2I26N 3RUGA 1MCQA 5A16A 4KRMB 4Z0BH 5E2TH 2ED7A 4S2SA 1G84A 1BVKB 1IEAA 2WBJC 1W8NA 3EJZC 1L0YA 2JB6A 4WU5B 2HG5B 2BNRE 4HKJA 4LNVA 3FFDA 5GJTL 4ZFGL 4EI5D 5DGRA 3DXAD 4GQPH 4WI8A 3HUJB 3JVGC 2E6PA 4X4XB 1U8LB 5I1EL 3GSVB 5B39A 5CGTA 1BQHG 3NIDF 1GGUA 5DVLA 5DD0H 2OTWB 3VI4E 3CK0L 3D39B 3CFBA 3TJEL 3LY6A 2HTKC 3QJHA 1G9ML 5HTSA 1LO0H 1LNUA 4Z18A 1WIPA 3CFJA 3LHPH 1KENL 5BJTB 4YUEL 3VXSD 4HXAL 3B8YA 3BKYL 1UENA 1DVFA 1LO2L 3T0EA 4JFEA 4O51A 1KYOJ 4KQ3H 4L5FH 2ICEA 3G6DL 4LDEB 3SKMA 2AGJH 5CJQH 5EPMA 4JKWA 4PIRF 2NXZB 4NJAL 2KPNA 1YMHB 3NGBB 1WZ1H 2EXYD 4IM8A 1TPXB 3MYZA 1AXSA 2DI8A 5FHBL 5CEZH 4XAWH 2XA8L 3L3DA 2ESVE 4YDIH 1FDLH 4BYHA 1VFMA 5DRWA 1N5YL 2GSGA 5JR1L 4R7NA 1S9KC 2ZOLA 4U0RB 1GHFL 1CICB 1QA9B 2DI7A 4AH2A 5E5RB 1QKZH 4OZFA 4WRLA 3WO3B 4P2YA 2OL3B 5HD8C 3HPLB 1TMCB 3MRGA 4NWUL 3HR6A 4JG1L 4JKPH 1BZ9B 4OF8A 3KHOA 4WFGE 4M7KL 1KB5A 2PTVA 4G8IB 4IRZL 1MUJB 4DWHA 5JHLH 3V5HA 2KKQA 5EBMA 5D9SA 4U1HA 5EOTB 3HNVL 3O2DH 4JQXA 4GJTB 1B4RA 4XMKH 2D3VA 3QDGB 2XTJD 4P2QA 3LEXA 3LSOB 3TNNA 3VRJA 3MV8D 4BFGA 1SEBA 3UBXB 1FLRH 4W81A 4P4KB 5A2KH 5KJRL 3INUH 3ARDA 5ESVA 3LZFL 2O5XH 12E8L 5GGTL 3PGFH 3CX5K 1AGFB 4RDQF 5DRXB 3ZKSD 3OXRB 4TUJA 5EOQL 5CEZD 2YPLD 3GSUB 1RUKH 2FO4B 1Q1JL 4U1JA 3RWGA 5EUOE 3S34H 1W72L 1EAPB 1OQOA 2BSRA 1FORL 4V1DA 4JN2B 5JXEA 5F9WB 1J1OL 3D18A 1BAFL 4QHNB 5TGBB 3VXMD 2D0HA 4LLAA 3EOAA 1HXMA 2E7BA 3RUGE 1ITCA 5CZXD 4U1GC 4OLYH 4QY8B 4G80A 4X6DA 1P2CB 5C09A 4PJ8C 1BIIB 4WHDA 4XH2A 4F37F 4X5WA 4I3RH 4CW1A 1MLBB 2VJXA 1VADB 3GSWA 1IFHL 4N0YH 4DN3L 1RJYA 4YAQA 1ZK9A 2XZZA 1JGLH 3SE9L 2H41A 2EDNA 1A6AB 2OTUB 3BRFA 1FLTX 4UV7L 3ZKQD 1ZLSL 4XNYL 5JPMB 3HI6H 3OHXB 4R3SA 5D7LD 3MV7E 3Q1SL 3LEYL 4HPOH 4X6FA 1SY6H 3LIZL 2KUTA 2ITCB 3EYQD 5GIRB 5FUCE 3KYNB 5KSAC 3PJSA 2VMFA 2P24A 4Y8AA 5D2LF 4NT6B 1EEZA 3SOBL 3PWVA 4L4VD 4J4PC 4OCNC 3QQ9C 1ZA3A 2YKLL 2E7HA 2HWZH 5LGHL 4P59H 3RKPA 3UTTD 3T0EE 3KPSA 4JFEE 4YDKL 4GH7B 1J7VR 4Z7VB 3MPCA 1SJEB 4D8PA 1T89A 5D93B 3CLEH 1BWMA 2DQDH 4KUCD 1YJDC 5I15L 2IFFH 1F4HA 4TSAL 4S0TD 4ZYKA 4HKZB 3AVEA 1J1XH 5CEYB 4E5XA 3TJHD 2X4NA 1MWAH 3N1QC 5F7DB 2QADD 3ULVC 3MXVH 3N50A 1BGXL 4P9MH 4PJCF 5F88A 3SE8H 3K7UA 4KHXH 5J1AA 2YRZA 3O6LL 4NNYA 3V5DB 2JJVA 3C60A 3C5SA 2R2CA 2OZ4L 4WTZA 2YZ1A 4O2FB 1H3GA 1UA6H 3WFZA 1WBZA 2VDLL 1A6WL 2E9IA 3QUZC 4OZIB 5JDSA 1HYRC 1JWSB 5LGJB 5F8QC 5GRVK 3SGJC 4YHYB 4J3VA 3MOQA 5EZLB 4F9LA 1HQRB 1DQJB 3VFUA 2OL3L 3HMWL 3S4SB 4G6FD 4P2QE 1M05A 3SQOH 3QXAA 4LHUG 3A67L 1ADQL 3O2VH 3QUKB 2Y5TA 4GSDH 2XZCH 2GHWB 2XZQL 3UZQA 3O3BA 5EOCH 2R0KL 3JTSA 4QHUB 5MERA 1RU9H 4OGZA 3V4UL 2F8XC 3EYSH 2DBLL 3A6BL 2P8PB 3OAUL 4OTXH 3L95B 3EJYC 3MJGX 3D6GA 1P7HL 2KQNA 4Y2DC 3FQNA 5I30H 2JJSA 4V1DE 4PJAF 1NDGA 3WSQH 5I75B 2VB5A 1GJIA 3DX8B 1AXTH 1MCDA 3HS0B 1XGQB 3NCYP 3MGOA 1UWGL 3U36A 1FNSL 2DQFA 5F7YC 2X4PA 4FTVD 3O3DA 1JPFB 1RULH 4AG4H 4KK8D 4NJ9L 1YEFH 3EOBA 4HJJH 3V6ZA 3X14A 4X6DE 5C09E 4FQQA 4MXVF 4PJ9A 4Z0XA 5BRZD 2MWCA 1KB9J 4HGWA 5ETUB 3LKQA 5IB3A 3ULUH 2XNAA 4JPIA 4XVJL 2VXSL 4U6VL 2WBJB 4P3CL 5FM5M 5FO8B 3QEHB 2HT4C 4XGZB 4ZUTA 3OGCA 2ZOKB 1DBAL 2B0SL 4MQ7A 3QR2A 2I60H 4RMVA 5DRZB 3IDGA 4XC3H 1N2RA 3UJJL 3VFMB 4ORZC 1N4XL 1DUYB 5D5MF 3WFCL 5HPOA 1BF8A 3P4NA 2CDGA 4PJ7F 3L5WA 2APTA 3DGGB 3NFNA 4HFWA 2B1AL 2LU3A 2FHCA 1HINL 4S1SL 3KPSE 3O81A 1EEUA 2QQNH 4XXCA 2VNCA 4YHLH 3RWIB 1QLRB 5GSRB 4G8EB 4XCFL 1PBYA 1PYWA 2BNQA 4UBDC 3SDYL 1KN4L 5IFHH 2A74B 5KZCB 1RUAH 3GSRB 3B83A 3LV3B 1T7WA 1KLGB 5I74B 4I1NB 3UMTA 3OKMB 4G5ZH 4Z7UA 1M7IB 1BVKA 1KXQE 3GJEB 1T7XA 2HG5A 2ADJB 3T65B 3CMGA 5BS0D 1CR9L 3IAPA 5IWLC 2JJTA 5HDBF 1A2YA 4CVZB 5E2VH 4HG4K 3L7FA 1YYLL 3GIZH 1UKSA 1U8LA 1CF8L 3BN9C 4JHWL 4XPHH 2R0ZH 5T1LA 2OTWA 3BUTA 4NKIL 3AS2A 2B4CH 4JQIL 2NW3B 3D39A 2R56L 4ONFH 1NMBL 5JOPE 3P0VL 3IDMB 4U6XB 4PJHF 5E94B 1FBIL 4YFLI 5C08A 4KC3B 1JWMA 5BJTA 2A6KB 1RY7B 4OCYL 2Z9TA 1YNLH 4KRPB 3FT3A 5JQ6L 4KDTC 1KIUA 5ACLA 4G6JL 2GT9B 4KAQH 2ATPB 5FDYA 3TYFB 4QXGL 1YEGH 1NFDB 3HLAB 3TM6A 4F57H 3JV6A 1CFTB 1YMHA 1DEDA 3FRPG 2X1QA 5F7LB 3MJ9H 3GNML 5KTEH 4YEFA 1QYGH 2D31B 3OKOB 1B2WL 3P4MB 3TN0D 3SKJH 2OJZH 3TWCH 5L9DH 3VXUE 1OGAB 1U3JA 2J12B 5ECJE 1IGJA 2FIKA 1JHTB 1QSFD 1QA9A 3TA3D 2BXYA 1TNNA 1FYTE 3RJDA 4TRPL 1KBGH 3HPLA 4KDWA 4CDGC 4GMTH 3NBNA 2HYMA 3KYKH 4G8IA 4YE4H 2MPAH 4TUOB 3BAEL 4LPUA 3U0TB 4M43H 4HWZB 3RWEA 4NBYB 1VFBB 5EOTA 1ZVHA 3CU1A 4I4WA 3LSOA 3RL1B 5HHOD 3D87B 3UBXA 2ARJA 3MOAL 4N9GB 4ELKB 1S8DB 4EUPB 2R2BA 1AGFA 4L8CB 3SY0B 1F58H 4GKSB 1NGQH 1LK3H 3OXRA 4NFDA 5GGSY 1N6QL 3GSUA 4LSUH 3C08L 5E2WL 3SJVA 4R4BA 4A6YH 1MFCL 4RZCB 1G0YR 1ZAGA 4M4PA 1EAPA 1LEGB 4WTXA 1Z6JT 4Y5VA 4YGAB 4QHNA 3EW3B 3DROA 3K74B 3LKNB 4PJFB 3H7LA 4LSPH 1MHEB 1Q8MA 3RKDD 1A6ZB 2I9TB 1EGJA 4XBEH 2P8MB 2VXTH 3M8OL 5FGCE 4NM4L 4QY8A 3SQBA 2YEZB 2ZUYA 2F5BL 2DQHH 1R3JA 4GXUN 4Z7UE 4D3CL 1KELH 4UTAH 4FZEH 4Q6IA 5HYJD 4OM0H 1MCWM 5DQDH 4LL9A 2KL6A 1DZBA 2NZ9D 3OG6B 1A5FL 4HC1A 3H8NA 5J06A 5JPMA 5D7JB 3MNWB 1OW0A 2RCSH 3OHXA 3W82A 4NZDA 4U3CA 1ES0A 1QRNA 4LSVL 4APQC 4U31A 2DLIA 2ITCA 2IMMA 4Z7WB 3D39E 4TVPD 2EH7L 5DWUL 1KNOB 5IF0B 4NT6A 5DR5H 2KDGA 3L3IA 2AXFB 4IIQA 2CK0H 1OWRM 1FV1B 2H32H 1A7PH 5F9JB 3UXFA 2DQEL 1CG9B 5C0DA 4YXKL 4JRYD 2OK0L 1I85A 1WQVT 4UMGA 3HMXA 4RCAA 2GQHA 3OF6D 5T3XL 4ZUWB 4Z7VA 1SJEA 3GMPB 3ZYJA 1A7RH 2HTLD 4JB9L 5CSBA 5DFVD 4LCWD 5CAYB 3ZDZF 3IJHB 3V6FA 1WWCA 3B5HA 1WFNA 4DAGH 4M6OH 1VGEL 5LAXA 5CEYA 2GYSA 1B0GA 2I9LB 5F7DA 4D9QD 2AV1B 3PGCB 2IGFH 1II4E 2UWEB 4XP4L 5DVOA 4CVWA 4YK4C 3VG0H 4R0LB 3W0WD 2GAZA 1NUNB 5AAWA 3BPLB 4FABH 4EI6B 1BP3B 4XNUL 1P5VA 2VITB 4O2FA 4J1UB 5I76A 3UAJD 3K46A 2NTFB 1LE5A 1MLCB 3CX2A 4OZIA 1HCFX 5LGJA 1VACB 4OSUL 1MAKA 2D7TL 5D6DA 5I8EB 1OSZB 4ZXBC 5GQBA 1EUTA 3HRPA 3MACH 1HQRA 1RFDL 1DQJA 1T6VN 3QDGE 3S4SA 1ZS8B 1BOYA 4GRMB 3Q6FA 5H35B 3CFEB 4YHPB 1YEEL 5KANG 2NX5B 3MZGB 3RVTC 4ZTPH 3MRPB 1K85A 1KPVB 4DGIL 4QHUA 5BV7B 2P8PA 1B4JH 2BCKA 5C71A 1KTDB 2QHRH 2FX8H 4WWKD 1BBDL 4L3CB 3JWDC 4K7PL 4RQQB 3DX8A 1MI5B 1VDGA 5B21A 4KUCF 3HS0A 1XGQA 5J8OA 1L7IL 4KJQC 2YA2A 3IKKA 1LO3L 4Y1AA 5T5NF 3O2WH 4M93C 1TCMA 1J1PH 4H25B 4PD4K 2FB4H 3O45B 3VWJC 4RMQA 1GYAA 5I0DA 3CFCH 4MSWB 1XR9B 2FJHB 3UJIL 1IC4H 1NBQA 5BCAA 2Q7YB 9CGTA 5DTFB 3WKMH 3U7WL 1MRCL 4FQPA 3B4NA 2EIDA 2WIMA 4RFOL 4XGZA 2A77L 4PJDB 4M03A 1QRNE 1CLOH 2VLJD 3VW3L 5A40E 3GI8L 4DVBB 1MCHA 1BF2A 3BE1L 1GAFH 4UT6H 2WUCL 4CKVX 1DUYA 3V7AE 3R06B 2CGRL 3B5GA 3L1OH 4MA7L 1DQTA 3O9WB 3NAAL 3PHOB 4CNIB 3DGGA 4WHTA 2ICCA 3MODL 5DO2C 1G7MB 3KGRA 5JIIA 4XTRC 1PSKH 3L5XL 1UKTA 3ARSA 1S7UB 4O58H 3FO0H 3RWIA 3S35L 4DVRH 1QLRA 5GSRA 4Z7VE 1AI1L 1BWWA 2IPTL 5AUMB 4Q58C 3WUWA 4LPCA 4QRUA 1WK0A 1DTUA 3SO3B 3LV3A 3FFCA 5C0FA 1KLGA 4KK5C 3KPRB 1NGPH 3WS6C 1S5IH 1CT8B 4HQQH 3OKMA 5C92A 1IGCH 3CFDB 1S9VA 3HC0B 1S7SB 1VESA 5CBAA 1WT5A 5MEQB 3T65A 2ADJA 5HGDB 1RUMH 3OPZH 1EO5A 3HCVB 5CEXA 4J2XA 4DEPC 3N9GH 4DJMA 3WO4C 2NY2B 4PP1D 5EA0L 4OFYA 1YQVH 4GRLB 7FABH 1DEEA 2OI9C 3CCHB 3GRWH 1KOAA 4PRNB 3GK8L 2CIIB 5F89B 4EDXB 1MCRA 3PF2A 4OZGF 3RX5A 4OZIE 5E0QA 2DAVA 5DMGC 1GPOL 4KQ4H 3P9MA 3F58L 5ICYB 3AREA 3GI9H 1U92B 4NRXA 1F8TL 1CDUA 2F54B 3IDMA 4U6XA 5HVGB 5FGBC 2Z35B 1DUZB 4WO4D 1G7QB 3VFRA 2DWDB 5FV1L 3EFDH 4MJ4A 4WGVB 1PEWA 4I18B 1CDYA 5DK2B 3MRHB 3VGEA 1MJUL 2HJLB 5HYQB 5CSZB 1MFEH 2ATPA 4Z0BL 5E8NB 2NY3D 5E2TL 4ZAKD 3PABB 3RTQA 2X89A 5I1AB 3HLAA 5CWSB 2V9RA 1WBXB 1G7LB 1LK2B 2X70B 3PDDA 4H8WH 3HE6D 1RZIA 3OKOA 2D31A 1LMKA 2CRYA 3P4MA 4XBGB 1MQ8A 3QIUC 5HVHC 4WFHE 3NA4A 2X4UB 5BV7L 1HILB 1JHTA 3U83A 1MJ7H 4Y1AE 1ZGLP 1AHWC 5DD0L 5DD6B 15C8H 5GGRB 1XGRB 1D5ZA 4PV9B 3WXWH 4N90E 4PFEA 5EU7C 3NFSH 1LO0L 1FZOB 4MA8H 4UQ2A 3C09C 3LHPL 4OD2A 3T2OA 4N0FB 1JE6A 1I8IB 3WV0A 1RSFA 4TUOA 2F53D 4HWZA 3AS1A 1MWAB 4KQ3L 4LCUB 3EBAA 3UTQA 3ARFC 1OVZA 5IVNA 2AGJL 5CJQL 2YUWA 4DTGL 4XVUC 3RL1A 1WZ1L 4ZO9A 1D6EB 2WBJD 3RY4A 3EJZD 3P2TA 4N9GA 3ULSB 4APQB 1MCFA 1P7KB 1RK1A 1S8DA 4YDIL 1FDLL 1GC1L 1Z0MA 3SY0A 4L8CA 4GKSA 3KYMB 3JV5A 3P9WB 3F8UB 2HMIC 1NJ9B 5H8DA 2X44D 3QDAA 1NC4A 1F6AB 1VHPA 4K8RC 2ZUQC 1JF1B 4ZSOB 1IAIM 1QKZL 1LEGA 3KPPB 1FL3A 3LKNA 4PJFA 5C7XH 3HN3A 1P4LB 4X99B 1T5XA 1FNEB 2HTKD 3QG6B 1MHEA 1V8HA 1E4JA 1I1AC 5ABDE 2E8ZA 2P8MA 3O0RH 2YEZA 5H94A 1P69B 5JHLL 4LCIH 1T3FA 3FONA 2LAAA 3OL2A 1MCBA 4KKLC 1T1WB 2AK4B 3LPFA 4Y5YA 3TVMC 4XMKL 5KZCD 1UFUA 3LB6C 1TVBB 1HH6B 1FLRL 4O5LH 4PJGB 4AQ1B 2O5XL 3HE7C 3DUSB 3PGFL 4UNUA 1LP9B 5T3ZD 2X5PA 2XI9A 4UQ3B 4Z7WA 2VC2H 3U1SH 1TZGL 1FG9C 1KNOA 4ODXA 3S34L 5IF0A 1I8LA 5IW6B 2DM3A 3QCUH 4YHIB 1KC5H 4QLRA 1EO8H 2QR0B 4GRWB 4F7TB 5HD8D 5KSBF 1CG9A 4EI5A 3ZDXE 2W0LA 4NUJA 8FABB 3JZ7A 4OLYL 3RNQA 3PQYD 4TQEL 4ZUWA 1NQBA 2F5AH 3GMPA 1CTOA 3P4OB 5FYJH 3AM8A 4PLKC 1KJ2H 1TITA 4I3RL 3VFVB 3CFIC 4DUVA 2IPUG 4LIQE 2V5SA 4N0YL 3BD4A 1JGLL 5FO7B 1NFKA 4K3DH 2P7TB 4MYWB 1LGVA 1G1CA 1OGAE 3BMVA 2BOBB 2WMPA 3RI5K 4HX1B 3HI6L 3K8KA 1U3YA 2UWEA 1HWHB 4HBCH 1G9NL 4HPOL 1SY6L 4R0LA 2K9UA 2X09A 3I6GA 3IJSB 4EI6A 4HMDA 4RISL 1MVUB 2B2XH 3O4LD 3SGDI 2VITA 2NTFA 1OHQA 1MLCA 2HWZL 4F8QA 1ZHBB 32C2B 1VACA 3QUYB 4P59L 4OZ4A 5I8EA 1OSZA 1U8KA 4L8SB 3FQTA 3NVQA 2E7MA 5EO0B 3CLEL 1DBBH 2DQDL 5ADOH 5H35A 4YHPA 5B39G 3EDKA 1KEMH 4PJ8D 2IFFL 1MPAH 4BQ8A 5MI0B 3HUJF 4N8VB 3U4EB 3K3QA 1MFAL 1J1XL 4BFEA 2OP4L 5A2FA 2DLHA 4NP4H 4X6CB 1KCUH 1MWAL 3MXVL 4B50A 4JFDB 4P9ML 3SE8L 4QRQB 3D0LA 1KTDA 5JLZA 2GCYA 2OQJA 5L0QC 5B38G 4TTDC 2LQRA 2C7UB 4L3CA 1T04B 1MI5A 1BVLA 4K7PX 1RZJH 1QBML 4PJFE 3PL6C 5KSAD 1PG7H 2AJZB 4LVEA 4MJ2A 4JJ5B 4J4PD 3QQ9D 4U1KB 3ALXA 3BH9B 3G5YA 1H5BC 3C6LB 3VGAC 3O45A 1RIUH 2HN7B 3EHBC 1QEWB 4OLWH 2BHYA 4MSWA 2FJHA 1NC2D 2Q7YA 4RRPA 3RAJH 2YPLA 3SQOL 5DTFA 3O3EA 4ZFZB 4GG6B 1BIHA 4H0HB 2MJWA 3O2VL 5KN5B 1CLYH 1X5AA 1YNTA 4OQTL 2A2QT 5F7EH 5EOCL 4OZFG 4NYLB 3VXMA 1RU9L 3QFDA 4MJ5B 5D70H 3EYSL 3MLRH 4Z7WE 2Y36H 3ULVD 4OTXL 4QRRB 5EBWA 4EN3B 2R1WB 1UZ6E 3GMNB 3R06A 5I30L 1H8OA 3BYYA 1N6VA 3WSQL 3DJ9A 3O9WA 1AXTL 3GBNH 4S1QH 3ILPB 1SYVB 3EOTH 3BKJH 5I1DB 4AG4L 3QUZD 5F7WC 1IJ9A 3O2DA 1R6VA 1YEFL 4HJJL 1CLCA 1EK3A 5AUMA 2XKNB 3JWOH 3DRQA 1AO7D 4F9PA 3PXHA 4ZUUA 5CJ5A 3ULUL 2IPKB 2P43B 1JFQH 5C0AB 2FX7L 4L8DB 2VE6B 4TNWF 3CFDA 1NBZB 1UACH 2YRLA 3VD3A 1CWVA 3HC0A 3Q6GH 5D72H 5MEQA 2UWEE 1MCPH 1J05A 3T4YA 2I60L 3HCVA 3TT1H 3T2NH 4A6YB 3UO1H 1WITA 4WUUD 4G7YH 4XC3L 4KZEH 3BVNB 4N1EA 2OCFD 5SX5K 5DVMA 1OAXH 3MV9D 5EUKB 4WFFD 1HZHL 4LKCB 3EJYD 1L4IA 4KVNH 1AHWB 4OCXH 3ESUF 3VDCA 4Y2DD 1I9JL 3PNWB 3DI2B 5JOEA 4Q9CA 4PRNA 2I07B 2CIIA 5F89A 4EDXA 1FYHB 1DJSA 1H0DB 1OAQH 5CGMA 4K71B 1ZLWH 4N8CH 5C86A 2FJFB 5ICYA 3AGVA 4HPYL 2QQNL 4YHLL 3TESA 2F54A 1YNKH 4OGYH 2BY1A 1G7QA 2DWDA 3GMLB 1MIMH 1OM3H 5CLWA 4HK0B 2HJLA 5CSZA 5DVKA 5E8NA 4G5ZL 3QIBC 3FO9A 3PABA 4EIZC 1SY6A 5CWSA 3SGDH 2E8YA 3D85B 3BMWA 2HT4D 1WBXA 1QFUH 4Y4HD 3S5LB 3ARUA 4W68A 4WEMB 3K8MA 3VFNB 3U30B 5C2BH 1E6OH 3MRDA 5D6CB 1DLHB 5E2VL 4XBGA 1EXUB 1U0QA 1MI5E 3GIZL 5I19H 2H32B 3WNPA 2BNUB 2X4UA 4MB4A 3EIFA 4XPHL 5DD6A 2G75B 3TBYB 1A02N 3CDCA 4JFFB 1S7TA 1KFAH 4EOWH 4ONFL 3U7AA 4WTWA 1S7WB 4LHQB 3I3DA 2QQQA 1FZOA 2RQ8A 4XCEB 5GS0C 1RJCA 3TO4C 5CEZE 4N0FA 2YPLE 2VLME 5K9JH 1I8IA 4M8QB 3WIHA 1YNLL 5K59F 3IDXH 4HH9B 1MWAA 4YHMH 4PJEF 2DQJH 3FOMB 1V3KA 4HZAA 5FGRA 3VXME 3FHQA 8CGTA 1YEGL 3GSNH 1QUNA 3SKOB 2Z92A 4PGBA 1IGFL 1C8PA 2X41A 4FTVA 4L3ED 1XGTB 2W60B 4KI1A 5I1GH 3ULSA 1QBLH 1TQBB 2EE3A 4WJ5B 5KTEL 1QYGL 3IDUA 1TTFA 3H3BC 1PAMA 3SKJL 2OJZL 5CZVL 3TWCL 4AQOA 4WFED 3KYMA 4Y0GA 3H9ZA 3CSYB 2HAZA 1NJ9A 3BN9D 2AQ2A 4C4KO 1I3GH 1A9BA 1RJZA 1IGIH 1F6AA 3IVKB 3GBLA 1JF1A 1EHAA 2ADFH 3KPPA 1KBGL 4X99A 5KANI 3DV4B 3MBEC 3QG6A 4YZFE 3UTSB 1U8NA 2ERJB 1FL5B 4GMTL 2PF6A 3MLVH 1V3JA 4U05A 1QHOA 1CD9B 4G3YH 4R26H 2ADIB 3I50H 4YE4L 2MPAL 4M43L 1NMCB 1A21A 1A4JB 4LMQE 2AK4A 2CO7B 4YR6A 1X4ZA 3KLHD 1TTGA 4BQBA 1JUFA 1QQDB 4Y19B 4PJGA 4D0CB 4P23B 4JG0H 4BFIA 1UJ3C 2WV3A 4H5SB 1X5YA 4POZC 1KGCE 2VDOH 1F58L 4FFYH 5SWSD 1NGQL 1LK3L 2R9HC 1EIBA 4LSUL 4QXTB 2H2SC 4A6YL 1WUNT 1D6VL 5IW6A 4C4KT 4IMLB 2F54E 4YHIA 2NMSA 1H3WM 2FGZA 5BS0A 4M6MH 5I9QB 3LQZB 4LSPL 2IQAB 4XBEL 5DJ0A 5JW4Q 5EU4A 8FABA 2VXTL 4NC2B 2C4XA 5HI5C 4PRAA 4E42A 3P4OA 4YBQC 2DQHL 1KELL 4DUWA 2ZG1A 4UTAL 4FZEL 2GITB 4Y4FC 4OM0L 3L3GA 4WEBL 5DQDL 1RAMA 2P7TA 1FN4A 3QA3B 1MF2H 4BSJA 3ZO0A 3RWJB 2BHZA 1CDBA 2BOBA 4WI6A 4HX1A 4UDUA 2RCSL 1FFRA 3BGAA 4EXPX 2BSSA 2H6PB 5SX4I 3IU3B 3AS0A 4HFUL 2UV3A 3ABZA 4YFDB 4Z7NF 3T0BA 4HDIB 1JNLH 3IJSA 4NC1E 3SGKA 2P48B 1MVUA 4P99A 3ARPA 4Z7QE 1CFSB 1KPRA 1IAII 1NSNH 2FSEB 4ACPA 5DR5L 3E8UH 2CK0L 2APFA 1A7PL 32C2A 4Y16B 2LVCA 4PJ5B 5KOVC 5DFTA 1P9MA 4PLNC 4LOUC 4X9BA 3TN0A 1U6AH 4L8SA 3ZSSA 5K9QG 5HYSB 5HHMB 1A7RL 4G9DB 4LPVA 1FFOB 1E4WL 1BFSA 4CN4A 2YK1H 1DSFL 3UDWA 5IVXB 2EEBA 4FTVE 1KIQB 5DRNB 4DAGL 4M6OL 1BBJB 3U4EA 4N8VA 4PTUB 4X6CA 4PRPB 5IHUH 4OGAC 1CGYA 1F3DJ 2D9QB 3RX7A 4POYA 5ILTH 4QRQA 2HH0H 1OP5H 3MJ6A 4ZQKA 2DKMA 3VG0L 4GKOA 4OCSH 1H3TA 5J56B 1YPZB 2C7UA 4HIHB 4FABL 2WINA 5C0JB 1T04A 4JKLA 5D2NB 5FHAH 1OLZA 3GKWH 5J6GA 4R2GC 1G7IB 2X42A 5DJDB 1KLUB 3MRJB 4JM2B 1NBYA 1EUUA 2VDPL 1G7HB 3BH9A 1S3KH 3FCTB 1AY1H 2Y07L 1HI6B 3C6LA 2QHLA 1CTNA 2HN7A 5C6TL 2AK4E 1NFDF 4JY6A 3BP4A 3FB6B 4Y4KC 3MJ9A 5E2UH 3SDDC 4GG6A 4PRHB 4ZTPL 1B6DA 4PJGE 3CH8A 5LG1A 3GGWB 4MB5A 1CU4H 4Q9QH 3DUUB 3OKEB 1T0NA 2QSQA 4NYLA 1LP9E 4MJ5A 2OXHA 3U9PH 1B4JL 3O4OB 5B22A 1PX4A 2V9QA 1NCCL 4WENB 4EN3A 2K3TA 2QHRL 3GMNA 2FX8L 4QT5B 3SDCC 5B3JE 3PV6B 5AG9A 4IDJH 4KU1A 4RX4D 1BQHB 3ULUE 4H20L 5ACMA 4X8JA 3WHXB 1OOAA 2B8OT 4OCRH 3O2WL 3UBXG 4MCZB 4MS8C 1J1PL 4CMMB 2AEWA 3B5TA 1HHKA 1NCBH 2XKNA 3CXDH 3JBG7 1F42A 4QYOB 4K7PY 4X0KA 2AJUH 4ZXBD 3CFCL 1IC4L 5EU3B 3VJ6B 4LSDA 5C0AA 3WKML 5F7NC 5J11B 2VE6A 1G0XA 4KHTH 3PGDB 4M02A 4GXUM 3QPXH 1U58B 1EEQA 1NBZA 3RVTD 1FVDB 3I9GH 3JUYA 2DJSA 1I7RB 1R3IH 1FGVH 2K7QA 3W9EB 1N6UA 1RQ5A 1WF5A 4A6YA 1PG7W 1ZKAA 4JRYA 3MUY1 3QEQB 3BVNA 4RAUA 4GFTB 3I6LD 1GAFL 1FGNH 4UT6L 3OF6A 5L2KD 4AK1A 4LKCA 3ZHDA 3L1OL 5BXFA 2AEIT 2WUBH 5D7IB 1H0DA 4MJIB 1AIFA 1I7ZB 1M7DA 5JORB 4FA8A 3V6OA 1Z0NA 2FJFA 3HI5L 5FYKD 1PSKL 3BQUB 4KJQD 4O58L 4BQCA 4NN5B 3IKCB 1ZT1B 5CSGA 3S36H 5BOZG 4JM4H 5E4IA 3J7HA 3M45A 4NKOB 3ULVF 3VWJD 4HK0A 3W0WA 5SX4H 3BPOB 5MEPB 1NGPL 3GDBA 1ZGLM 1S5IL 4HWNA 4HQQL 3VH8G 4X6CE 4YDJB 5DMKB 1BZ7A 2BMKB 4JFDE 1IAIH 4ONHB 3S5LA 5D1XC 1RUML 3OPZL 3VFNA 4N0RA 1JNJA 3EZJB 4P5TB 5D71H 3G6JF 3BZEA 1YQVL 2HKHH 4O2CA 2H32A 7FABL 4JFOB 2BNUA 3KPQA 1CL7L 4WHYG 3GRWL 2EDDA 3MRMB 3FRUB 4OLZL 1V7NH 5TF1H 2W59A 4AZ8A 3RPIA 4LP4A 4KQ4L 1ZHLB 2G75A 4M7LT 3TBYA 3W11C 1VA9A 5DO2D 2IANB 3G04B 4TPRL 1KJ2B 5HJ3A 4O9HH 1KCSL 3GI9L 1S7WA 4XTRD 4XCEA 3WYRA 3X12B 3KLAB 2G9HB 2NQCA 4RDQG 5K33A 3EFDL 1NLBH 4BFBD 4OKDA 4GG6E 4M8QA 3QRGL 4YXLH 3VD5A 1IKNA 4UT9H 4WWKA 4O00A 1UJTA 3WNKA 4OLUL 3GFUA 1MFEL 4KV5E 4A2MA 2VXUH 3FOMA 1Q9OA 1WISA 3BGMA 4KK5D 4U6HB 4KY1H 1D9KB 2YA0A 4RFNB 2VLLA 1FJ1B 1HYSC 1WBYB 5C0GA 5I0ZA 3P9LB 2W60A 4BZ1H 2XYCA 4H8WL 2H8PA 3DYPA 3LQAC 1EBPA 1LO5B 2F74B 5E6YA 2NXYC 3DV6B 2Y6SC 1IM3B 3S4SG 5C0BD 1MJ7L 2X9XA 5GJSH 4QRRD 3IVKA 15C8L 1PQZB 4AEEA 3WXWL 5EULV 5DMGD 2J8UB 2NY6C 1WV7T 3NFSL 3MRLB 5DK0B 3DV4A 5FYJU 3UTSA 5FO9B 3ME0A 2CKNA 5C0AE 5I6XC 2ADIA 1SJHB 5IJVB 1OAUH 2FJGA 1A4JA 1K4DB 4MLSA 1H8SA 3QUXC 1KJMA 4KPHH 3BRDA 5HBBA 1QQDA 4JRYE 5H2BA 4Y19A 5F44A 2D7NA 3LPGA 5FM4A 5TE4H 4D0CA 4P23A 1N5AB 3E3QC 3MR9B 3U79A 4H5SA 5ID0B 4LHJB 3MA7A 5I17A 5D7KE 4ZNEA 1KCLA 3SDAC 5JMOC 3T4AB 3QIUD 5HGGS 5FYLD 5I1IH 4QXTA 3V6OE 5DEZA 4B53A 3KLDA 4NO0D 1OQXA 4IMLA 3VA2C 2GFBB 2NY0B 4YHOL 1AD9A 3PWUA 5GS1B 5C7XL 3CVIL 1C7SA 2ZG2A 3LQZA 4P4RA 4DZ8B 3BISA 2IQAA 3K81A 3TT3H 5DJXB 1TJIH 3O0RL 4F33A 1QLFB 4LCIL 5B8CB 4PJDF 3RVWC 3QHFH 2OXGA 3RY6A 2A0LC 4NRYB 2YD2A 2PO6C 3NPSB 3OV6A 4MHHG 4LHUB 3ARFD 3I75B 4ODVH 3QA3A 4O5LL 4XVUD 3RWJA 1UC6A 1LDSA 4NPYB 1YEDB 5ANMB 4WO4A 1J18A 2H6PA 4QEGA 3IU3A 3WUWG 2BDNH 2NY5L 5IROC 1LEKA 4H0IA 1XCQB 5F93C 3F7RA 1QRKA 2VC2L 3HG1D 4NKDB 3ZE1E 2HMID 1CFSA 5DGQA 4ZAKA 2EE6A 1INDH 3QCUL 1KIRB 1KC5L 4K8RD 2VKXA 1ZGLB 1EO8L 1DANT 1JPTH 1Y6KR 4HS8L 4Y16A 2RHEA 3HA0A 1FL6B 4LPWA 3VFTB 3RY5A 1C5BH 1I1AD 2YD8A 3BH8B 5FYJL 5DSCA 1KJ2L 1ULVA 1F4YL 4FHBD 3PWPB 1FFOA 4KKLD 3V0AC 4S10A 5IVXA 4WW1B 5DRNA 3TVMD 3RFZC 1ZT4B 3GZKA 4K3DL 3LB6D 5EBGA 2Y9RT 3NH7H 4N1CA 3T8XB 4PTUA 5KVEH 3GRWA 1BLNB 1HXYA 3BKMH 3DMMC 3SDCB 4JPVH 4MDIA 1C12A 3HE7D 3JV4A 5GRJH 1CXIA 5I16B 1CLZH 1Z5LA 5KSUA 3OXSB 3LRHA 3UTZA 5GXBB 5GGUB 1YPZA 4HIHA 4HUUB 5C0JA 4KVCH 4HAGA 3AAZA 5D2NA 2B2XL 3M07A 2Y06H 1S9XB 1G7IA 4YHNB 1KLUA 3UTSE 4JM2A 2XWBB 2GK2A 2DN7A 2Z8RA 3BUYB 4PJBB 1EHXA 2RGSA 2ZP0T 4ZG1A 4FQ1L 2EO1A 1JGVL 5TDNB 1G7HA 4GW5B 5GGVL 3QDMB 43CAB 1F2QA 4JQVA 1HI6A 1A6UL 3O6FC 3O8XC 1Z3GH 1OD9A 1DBBL 4XPAH 3EUUA 4CADB 3FB6A 1CGSH 2CLRB 4PLKD 1KEML 4Y19E 4PRHA 2LTQC 3GGWA 1EA9C 4RBPH 3DUUA 1RZKC 2WANA 5GGRY 4NP4L 5I1HH 1KCUL 2Z31C 4ZNEE 4Q9RH 1AR2A 3G08B 3K4AA 4HF5H 1NGZB 4YC2C 3GO1H 3MRKA 3PV6A 3LDBC 4N0UB 1BQHA 1RZJL 4PRIB 3WHXA 1PG7L 3DGCR 5DJZB 5TDOB 3T0WA 4LBEB 4MCYB 1T03L 1CDIA 4FFZH 5F3HB 1KXTB 4MCZA 4CMMA 3ELAT 3GSNB 4DOHB 1RIUL 2ENYA 4OLWL 4PP2B 2FHFA 5D96C 5EU3A 1UM5H 3G9VA 2GY7B 4N5EC 5JIHA 5FECB 2C3VB 3PGDA 1GIGH 1CLYL 1U58A 2D03H 1LE9B 5FUOL 1NUGA 5F7EL 3RL2B 4F7EB 1I7RA 5GSVB 4WU7B 3QEQA 2BERA 4PV8B 5CS7A 3GB7A 3PWJB 3PQYA 2YRPA 3FKUS 2EC8A 4OZFH 5D7IA 5MP6L 1NCTA 1PY9A 3FB7B 1MCJA 1TXKA 3GBNL 4TTDD 4MJIA 4UAOB 1I7ZA 5IVZB 4PJ5E 5J13B 2RR3A 3PL6D 4K94H 4U1SB 3EOTL 1KB5H 3BKJL 1GZQB 3V0WH 1VEPA 3WNMA 1JPST 5EIIA 1ZT1A 5HHME 5CD3B 5TE7H 1YEIH 4MJ6B 3ARWA 3JWOL 5IEKA 1V7MH 4NKOA 3QNYB 3NIGF 2Q8AL 5IVXE 2VOTA 4PLOB 3EHBD 1MRDH 1JFQL 5E8DH 2PR4L 3FO1B 5MEPA 2EKSB 2NY1B 4GAGH 3DHMA 5D1ZC 2R23B 3O4LA 5JHDB 3KXFD 4YDJA 3TIDA 1FNHA 1UACL 1E0OB 4HS3B 3Q6GL 4QXUL 1H15B 4ONHA 1JP5A 4OJFH 3QWRA 4XPFH 1F5WA 5IFAL 3LKOA 3T2NL 4P5TA 3UO1L 2WIIB 1VEOA 4G7YL 4MAYC 3NCEB 4X6EB 3UPAA 1YPZE 4HV8A 1O7VA 1OAXL 3HZMB 4NBZB 2C9AA 2HRLA 5D2NE 1YMMD 2CRMA 3D0VB 4OCXL 4QOKB 4PYHA 4GRWF 5HHNB 4IHOB 5C1MB 4RFEB 5FK9B 1GGYA 3LH2H 3TO2B 3MRMA 3FRUA 3Q3GA 4JY5H 1M6OA 1OAQL 3OB0K 1ZHLA 5C2UB 3IU4H 1KG0B 5TPWH 2EDXA 4WY7H 4XB8A 2IANA 1KJ2A 3V95A 3S7GA 4FQXC 3X12A 4M3JA 3V8OA 4OGYL 3KLAA 4LCYB 1MIML 5BMFH 2ZUVA 4PRHE 1OM3L 3MRNA 3WEXB 4P9HC 4P0DA 5T5FH 5DZOA 3GEWB 3RDTB 4U6HA 1K8IB 1D9KA 3VRLE 5KSAA 3BSZH 2I5YH 1FJ1A 1R5WB 4YBLB 3UJTH 5J89A 2BC4B 2NY7H 3MCKA 5DJ6B 1SEQH 4NC0B 1QFUL 2XTLA 4RA0C 2UVFA 5DA4A 4LVNB 3LKPB 5C2BL 4CUCA 1E6OL 1JPGB 4XCCL 5C0CB 3BGFC 1X9QA 3AS3A 2F74A 3DV6A 2ZPKH 1Y18A 4UU9B 4UDTA 4FNLL 3CVHB 4E41D 2F19H 5K9QI 5GS0H 1FFPB 7CGTA 2XWTB 1OTUC 4PR5B 1KFAL 4EOWL 3V5KB 2OSLB 5LQBH 4UB0H 3FJTA 4LLWB 1CXHA 4L1DA 2YPVH 5IHZA 5K9JL 1UADC 1SJHA 2V5RA 5IJVA 3IDXL 1TENA 3IAQA 4YHML 1G7PB 3VXPB 3TH4T 2V7HB 1K4DA 2DQJL 4JZJA 3H3PL 4G8GD 5EU6B 2XKSA 3VA6A 3GSNL 3TP4A 4JY4B 4MXQC 2VSDA 1JMXA 3T0VA 3QIBD 2DLFL 3QEQE 1OPGH 1BD2B 3G5ZA 5I1GL 2MFNA 1K9TA 4X9FA 4OCWH 3PQYE 3QUZA 1QBLL 4YHKH 5MHSD 2MCPL 3EO0B 1ZLUH 2Q7NA 4JKKA 5D7IE 2DS4A 1E27B 4MJIE 4HIXH 3T4AA 4K9EC 4MVBC 1F97A 2W0KA 1JBJA 1IGIL 4MNQD 4U7SA 4HIIB 1ZTXH 1A1OA 3SO5A 2ADFL 3ILQC 2VQ1B 2GFBA 5GS1A 4HD9A 1SM3L 2MKLC 2VISB 1WICA 1WAAE 3MJ8B 3MLVL 1MCLA 4R90L 5GS0D 1UH3A 5DJXA 4G3YL 3TO4D 1R24A 1QLFA 3I50L 4R26L 3DRTA 2VL5A 3GMMB 2BSTA 4JANA 5B8CA 3GHEL 2E27L 3O4LE 5ESQB 4OFDA 3QSKB 5SWZD 3STLA 4NRYA 3K2MC 3SDXB 4S1RH 4LHUA 3I75A 4MNHB 4D9RE 4HUNB 2AW2A 2DLGA 1XF3A 1Q72H 2H2PC 4FN0A 4JG0L 5DEFA 2GTWB 4NPYA 5ANMA 2R2HB 5E8OA 3W81A 2EDBA 3L7EA 4LLQB 3DVFA 2RFXA 1EZVX 5F1IB 2DQIL 1XCQA 2CJUH 2YBRB 5D8JH 1GGIH 1MEXH 2ZWLT 4NKDA 2EDYA 2IANE 5FYJE 2NNAA 3GJFH 5DMYA 1CFNB 4GAJH 3OKYA 3SCMC 4JREC 2QQLH 4HGMA 3A0OA 3IB4A 4Y4HA 3TZVC 2ATKB 2XACC 4QF1A 4M6ML 1FL6A 3UYOD 3VWKC 3MBED 2JTDA 3LS5H 3VFTA 3WMSA 5JNYA 4OZHB 4F3FB 1N59A 2BVQB 3AUVA 5DJCB 3BH8A 2J4WL 3ZT7A 2CRZA 5DYOA 3PWPA 4YDLC 1DR9A 4X7SH 4JRWA 4WW1A 5FA4A 5IFJB 3WHE1 3M17B 5HHPB 2BY2A 1A22B 3T8XA 4IRJB 3HZYB 5I66B 5GRUH 2ZSVB 5FUCC 4G43A 1PW3A 5I16A 3MLTB 1JZ6A 4POZD 5GGUA 1JNLL 2IQ9H 2DB8A 3L5HA 1LEIA 5DJ8B 2R9HD 5KG9B 1S9XA 2H2SD 4XRCB 1NSNL 4YHNA 1B6UA 3ES6B 2BJML 4AM0B 3T0EC 3E8UL 2XWBA 1FZKB 3O11B 4PJBA 2PXYB 1A1NB 4L3EA 3ZE0F 3QZWA 3CVHL 3STZB 1U6AL 3TBWA 2KQMA 2YPKB 4LVHC 1Q0XH 4CADA 3V7MA 5HI5D 4YBQD 2YK1L 4GW4B 4JHAL 2AJSL 4Y4FD 4FXGB 3QJFB 4L29A 3CH1A 2DMBA 3KDMA 2J5LC 5IHUL 3G08A 1A7QH 5ILTL 4M7LH 4C59B 1T1ZB 1EAJA 1M1SA 3S3PA 4OCSL 1M71A 5E6ZA 5FHAL 3GKWL 3DI3B 1AGDA 3PP4H 4PRIA 4LRIC 1F3DH 5TDOA 4YX2H 5BZDB 4MCYA 3LCYA 1T7VA 2DTMH 2QSCL 5F3HA 1QSEB 3GSOA 5HGHB 4AL8H 1OT1A 1S3KL 5JZ7C 1J5OL 1AY1L 2XQYG 3GSNA 4HMCA 1BMGA 1IEBB 4LOUD 5SWSA 3DBXB 3ARDC 5FB8B 3U4BH 5E2UL 2Q86A 5FECA 5AZ2H 1DE4B 3ARTA 5L7XH 2C3VA 5IB1B 2DQGL 1CU4L 1IT9H 5C70A 5ANME 4F7EA 3ARGC 4NNXB 2GJZB 5GSVA 1C5CH 3DX9B 4KMTH 4LSSL 2VLRD 3U9PL 4OIAA 5JXEC 4PV8A 5E6IB 1U2CA 1JN6A 3PWJA 3NCBB 4OGAD 1HSBB 5JO5A 4X4YB 3GUTA 3L3KA 1E4XI 4JGMA 4IDJL 3B8SA 3IDJB 4JFHD 5TF0A 2EYTB 1HN1A 3FB7A 5EORH 1A8JH 3DARA 4LPXA 4M48H 4G8FB 2WW8A 2VERN 4R2GD 2Z91B 3T0XA 1ZOXA 5DC9B 4H1LH 1GZQA 2NY4B 5CD3A 1FE8H 2H3NB 1VERA 2AXJA 2BOCA 1NCBL 4MJ6A 3PWPE 2AJUL 5ALCH 1N64L 2BNRB 3TBSB 4HUMB 3BP5B 3FN9A 1JYXA 4QRPB 2R23A 4Y4KD 4KHTL 1U3HB 3CZJA 3SDDD 4WV1C 5JHDA 2E7LA 3I9GL 4X98B 2UYLB 1UB5A 1FGVL 1WZKA 2WIIA 5T1KB 3P11H 1KV3A 3IDYC 4X6EA 1FGNL 5DFWH 1CVSC 1DBJL 2HVJA 1JGUH 3D0VA 4QOKA 3LVEA 1L6ZA 4WVRA 2WUBL 5FK9A 5DT1H 1BM3H 1QO3A 1BZQK 4PJBE 4Z6AT 1T89C 2YSSB 3JTTA 1KG0A 3JUZA 5FOJA 3QDME 3NOIA 2BVOB 2WSKA 4MHHI 4PRBA 4WFEE 3S36L 4JM4L 5D1QB 4FQHB 4MS8D 4ZMAT 4NQEB 4PGJA 3QDJB 1P5UA 4HW6A 3I3EA 2D7QA 1T4KB 4NQDB 4IRSB 1QFWM 1X6NA 4P2OB 3RDTA 4EDWH 1ONQB 1K8IA 2EE2A 1J8HD 1R5WA 4HIEB 3NABL 2FL5A 1G9MC 5DJ6A 3C60C 1I9IH 5ISZB 1HHHB 3QXWA 4B5EA 3LKPA 4G6MH 4CGTA 5J6HB 2JELH 1JPGA 5D71L 3HC3L 1YECH 5C0CA 2YD4A 2C1OA 4FMKA 4LK4A 5IBUG 4PRIE 1FVCB 3H9SD 1V7NL 1XF5B 3BYTA 5TF1L 3U7YH 3V79C 1FFPA 4KRLB 2XWTA 4JVPA 1IM9D 3E2HC 1AGEB 4PR5A 3RGVC 5C9JB 1MIEH 2FYYA 3EYOA 4O9HL 2DL9A 4PUBH 3OX8B 4DOHE 1JZ4A 4WHYH 5SWSE 2V5TA 4IS6B 3RPKA 1OB1B 1PDKA 3MYJB 2X4QB 5E95B 2FATL 3IAGC 4UT9L 3HNTL 1OWWA 2VAAB 1FIGL 5JQHC 1G7PA 5C0RH 3VXPA 2MHAA 2V7HA 2AERT 3VDAA 2VXUL 4KY1L 2APBA 4WW2B 5GISH 5HHQB 3BD3A 3MROB 4JY4A 4MAUH 2JJSC 2OJEB 5T1DH 3LQAH 5HHVH 3B9VA 3C5ZB 4L4TD 4BZ1L 4DKAA 1FO0H 5EUOB 5D1XD 3EO0A 5EWIL 3ARZA 4E0RA 2GTZB 1E27A 4NZUH 5DC4B 3B9AA 4NUGH 2DIBA 5CP7B 3CZFB 5GRVL 5SV4A 4X7TB 2E9JA 5GJSL 5A16B 3L3JA 3UTOA 3TEUA 2AXGB 1WEJH 1GGCH 3W11D 1MFNA 4XCYB 1S7VA 4LVOC 2XIDA 4HKJB 3MJ8A 4QHLB 5BW7A 3FFDB 4LP5A 1JZ7A 4HXBH 1OAUL 3EDFA 3RZCB 1WWBX 4FQIH 5JHDE 2B1HH 5ESQA 5IMOB 2IG2H 4FZ8H 5B39B 2FECL 3AY4A 2BY3A 1MFDH 3SDXA 4HKXB 4MNHA 4KPHL 1C16B 1I1FA 2EDHA 3X11A 1TQCB 5KS9F 4OLXH 1HYSD 3CFBB 4LDOB 5TE4L 1JGEB 3QJHB 4NN6B 4QOKE 2GTWA 1LNUB 1QBBA 2E6QA 2J7LA 5A43C 4ELMA 5ICXA 2OM5A 3V52H 4P5KA 1N8ZB 2NXYD 5B38B 1UVQB 2Y6SD 4JDTH 1DVFB 1WIOA 3OR7A 5I1IL 3BRGC 4JFEB 4O51B 1X5LA 2B5IC 1CFNA 2VLKD 1T6WA 2CXKA 5EH1A 5EPMB 4NQCD 1WGOA 5HYEA 2VIRA 1Z9OA 2NY6D 1CFBA 1Q94A 1KTRL 1R3KB 3QHTC 4ZODA 1FRGH 5IM7A 4OZHA 3TT3L 1KPUA 1TJIL 2BVQA 3L3DB 3MCLL 1T0MA 4FOMA 4HH8A 4CU7A 2JJTC 3O3UN 2RBLA 3ARYA 3QHFL 4M5YH 4R7NB 3QCTH 3UYPA 4FQJL 3MMEB 3QUXD 3QIWB 3M17A 1AFVH 5HHPA 2J5LB 3NCMA 4ODVL 4OZFB 3VGFA 5C0CE 4X7FC 3HI1B 4IRJA 1AR1C 43C9A 5I66A 3MRGB 2ZSVA 3ZTNH 1I9RH 2CQVA 3MLUH 1NLDH 2DYPB 3GSQA 3MLTA 1KB5B 3VMNA 3SDAD 4NQUA 1JPSH 5DJ8A 3VXNB 5KG9A 4XRCA 2FO1A 1U91A 2R4SH 3WS6A 1INDL 4AM0A 3UEZA 1FZKA 4P2QB 1LO4H 3LEXB 3TNNB 1JPTL 1WAAF 4HMEA 1EZVY 3S5LG 4JGJA 2PYED 1UYWH 2Y25A 5ESVB 3STZA 2NXZC 3KJ4B 3TC9A 1C5BL 1TPXC 4JFXB 1YEKL 3O6KL 1KB9K 4PS4H 1R5IB 1H8NA 4QTHA 4TUJB 1IILE 3BJLA 4DCQB 4H26A 4F2MB 1GRWA 4GW4A 2A0LD 3H3KA 2PO6D 4U1JB 3RWGB 4FXGA 3QJFA 1A6PA 2AJYH 2BSRB 4U6YB 4U0RC 4V1DB 3NH7L 1NAKH 1CICC 2D0GA 4JFZH 5KVEL 1R0AH 1F4XH 4JPVL 4RGOH 3EOAB 5AYUL 5HI3C 1XIWB 3ZSTA 1T1ZA 2EDEA 2EIEA 3MGAA 2JIXD 3B6SA 1ZLWK 2E7CA 4Y88A 4QTIL 4X6DB 4DK3A 3C2SA 1A0QH 4XH2B 4J3WA 2V17L 2Y06L 5DD1H 1HOCA 4XHJC 2ED9A 4ODWA 4YO0A 3BI9X 5F7MC 4CAGA 1QSEA 5HGHA 5FCSH 4JLRB 4F8TA 4C56B 4YFEA 1P7QB 1U9KA 1IEBA 4P4KC 4R3SB 4ZDHA 1Z3GL 2XZAH 3SDXE 4XPAL 4X6FB 5FB8A 1DE4A 5IB1A 4NO0A 2P24B 2BVUA 5C0NC 5GGVY 4GBXB 4NNXA 2GJZA 2AKRB 5I1HL 4ZO6A 3DX9A 4RWHA 5F9WC 5E6IA 4EXKA 4HF5L 2XOTA 3DMMD 3KPSB 3R4DA 3IF1B 1YY9C 5DEGB 2J8UF 3V4PH 3IDJA 1N3NB 2EYTA 4P48A 4RGMB 3DO3A 3REVB 2Z0BA 1JZ2A 3ARFA 1S9WB 1L0QA 2Z91A 3WDHA 4OZHE 1FZJA 4FFZL 5F1NA 4ZYKB 2ZCLL 2VYRE 1MAML 4E5XB 2FBJH 1J86A 5KAQG 2X4NB 4HKBB 5DJ2A 5F88B 3CDFA 3TBSA 4OD1H 3O6FD 3BP5A 1UM5L 4TOYH 5J1AB 3O8XD 3PDOA 2P5WB 3HG1A 1KTLB 4QRPA 1U3HA 3C5SB 1FAIH 1K2DB 2D03L 3MNZA 3OGOE 3R1GH 4X98A 4KROB 5ITBH 2UYLA 1A3LH 4PBXA 3NMEA 1H3VA 5DF0A 2CRIA 3D25A 5LCVH 2LVEA 4RSVA 5L2JB 1EHLH 2Z31D 5T1KA 4XNXH 5BVPL 1F13A 4D0DB 2I24N 1I85C 3S37L 1M05B 5EC2B 4FQCH 5E9DB 5I8CA 5D93C 3TVMA 4K94L 2Y5TB 1KB5L 2BVOA 3O3BB 3V0WL 3VD9A 5MERB 5D1QA 5J57B 3QEGH 5F1KC 5J0BA 4FQHA 5I1KH 1V7ML 1DCLA 4NQEA 3QAZC 3QDJA 1MRDL 4U7KA 4GAYB 4RNRB 1JHLH 1T4KA 4GAGL 4IRSA 4N5ED 4Z8FL 1N0XH 4HIEA 4AMKL 3P0YH 3GBML 1SJVA 5CGYC 2DQFB 5HSFA 4XPFL 1IC7H 1OAKH 2X4PB 3O3DB 4CL7A 2XY2A 3LAFA 4FP8H 5J6HA 3T3ME 5HVWA 3GJFB 3EOBB 3X14B 2CR6A 2A6JB 4PJ9B 3V4VH 1MCNA 5D6DC 5IB3B 5ADPL 4YHYC 1FVCA 4JY5L 4OT1H 1XF5A 4I0KA 2VTFA 5EU5B 3N06B 2JF1A 3IU4L 4Z7OE 4N0CC 1QSEE 5TPWL 4WY7L 1AGEA 1ROWA 3PIQA 4LU5H 1UWXH 5B4MC 3BT2L 1D5BA 4KTEH 1NBVH 4IS6A 1OB1A 1G6RA 3E1F1 3MYJA 1JL8A 2XV6B 5CJOH 5DUBA 5H37G 1N2RB 1B90A 3UZVB 2D7OA 3RBGA 4Q9BA 2O26U 4IMKA 4PGCB 1T1YB 1FSKB 4OI9A 3IFLL 3N1PC 5I71C 1TJHL 3MLXH 3QQ4B 4FFWC 3TLRA 5D1ZD 5FKPA 3BSZL 3NFNB 5HHQA 3MROA 3UJTL 2WM0A 5MEND 2OJEA 4LASH 4HFWB 5I75C 5L88L 2V5YA 2R39A 1FNFA 1HK6A 1XGYL 3LEVH 3P0GB 4LQFH 2GTZA 4MAYD 1PYWB 3MUJA 2BNQB 2ZPKL 5CP7A 3CZFA 2B5IB 1TETH 1HHIB 4PG9A 4X7TA 2CXGA 5TE6H 2W9EH 2F19L 5FGCB 3U82B 2AXGA 1UKQA 4Z7UB 3MOBH 4XCYA 2KBGA 2HFGH 4UB0L 3T3PF 2VN7A 4JCMA 2VH5H 4KKAC 4TNVF 5HPMB 5C9KA 4FQXD 1SMOA 4QHLA 5AAMA 4MA1B 3DYMA 3HG1E 1A2YB 3QH3A 3ARBB 2UZIH 4QRPE 2VUOA 3L7FB 3RZCA 1J0ZA 5IMOA 5KVGH 4GKNA 3RWHB 1T7ZA 2N1KA 4HKXA 5T1LB 1C16A 4L4JA 1OP5K 1NKOA 2VWEE 5SWQB 3VMPA 4YHKL 1JGEA 4OCWL 4K9EH 5C08B 4JR9H 1MSPA 1JWMB 4Y7MA 1H5BA 4HIXL 3H9HA 1N8ZA 5B38A 1UVQA 3FT3B 1ZTXL 1QBAA 1VFOA 2OTPA 5HDOA 3EYUH 3GM0A 5I74C 1I75A 1OTUD 3JV6B 3TBVB 4NQEE 4GT7A 1R3KA 3QDJE 3VI3E 1WT5C 4NQDE 4GW1B 2FEEL 2XN9D 5C0IB 5B3NA 3UPRB 4BELD 4S0SD 3MMEA 1IGJB 2FIKB 4S1RL 1PEZA 4XPTL 3ZKXB 5ISZE 1U42A 3QIWA 3MSPA 3MUGB 3FOLA 4MXQD 1YEJL 3HI1A 5IBLC 1Q72L 2ESVD 4DZBB 4DKDC 5F3BB 4RA3A 3N0PB 3HZVA 1DQQB 3ARXA 2DYPA 2EDLA 3MJ7A 5DQJA 2YD7A 3WLWC 2P5EB 2CJUL 5D8JL 3I6KA 1GGIL 3RWEB 4ZTOH 3VXNA 2Z8VC 1KTKE 4I0PB 4MVBD 3FQUB 4GAJL 4KRPC 3E6HA 3WXVH 2XRAH 5EIVA 2QQLL 4I4WB 4UZGA 1PX3A 5LWYH 5CKGA 3ILQD 3AB0B 2ARJQ 1NUDA 2ARJB 3BFOA 5I2IB 1HDMA 2R1XA 2R2BB 4JFXA 1NANI 2OLDA 1DQDH 1R5IA 1FG2B 4DCQA 5JXAH 5CKAA 3WKNA 2I25N 4F2MA 3SJVB 4R4BB 3PP3H 5I73B 3BPNB 4U6YA 3VFPB 3F12B 4RWYH 5HVFB 4Y5VB 1C08A 3QXTA 3DROB 3FQWB 4F15B 4WI2A 2DL2A 3EZ8A 5T33H 4AEFA 2H2PD 2G2RB 1RV6X 1XIWA 3RHWF 2AI0H 4XHQA 4U6TA 2EC9T 5GS2H 4PJIA 1AC6A 2IQ9L 2DM2A 1MHCA 1R3JB 2EDFA 4HCRH 5A3IC 5KSVB 5DMIH 5AEAA 5D4QA 2OYPA 1MHHB 4Q6IB 2E9BA 2ZG3A 5JW4N 3SCMD 1CK0H 1IQDB 5JPNB 3TZVD 5LJYH 2AK1H 4JLRA 4RMWA 3VWKD 4C56A 1P7QA 2ID5A 2H9GA 4HK3J 1ES0B 5HGAB 3RRQA 3DWTA 1Q0XL 1QRNB 5IB2B 2JCCF 2MKWA 4IOIA 4GS7B 3IGAB 4MNQA 3VH8B 1RURL 4GBXA 2BX5A 3L3IB 4RAVB 4IIQB 2AKRA 3MV7D 4P3DB 4U7MA 1UXWB 1QSZA 1JHKH 4EEEA 3Q5OA 5C0DB 4OFIA 4M7LL 5BVJA 2M26A 3IF1A 2GJ6B 4BZYA 1EFXB 5DEGA 2MCG1 1EHNA 5GS3A 1N3NA 5A2IH 4R4FH 3REVA 1QNZH 5KVFH 3FO2B 4JO3H 2O93L 5LGKA 1AJ7H 5AZEL 3V6FB 1S9WA 3S88L 2Q76A 4FQ2H 4YX2L 5GS2D 2ZUTA 3T0ED 4JFED 5LAXB 3HTLX 5FDWB 3WIHH 4OV5B 1B0GB 4AL8L 3QAZB 4HKBA 2KZ1B 3FAWA 4RAHA 5GGQL 2DIJA 1HEZA 4JRXB 5D7JC 1SHMA 3VXRB 3TV3H 1CD8A 3U4BL 1FO0B 4UV4H 1E6JL 2GAZB 2P5WA 5AZ2L 1KTLA 5L7XL 1K2DA 1QFHA 2CO6B 4BQ9A 5IUSA 5I76B 4M00A 2MQ3A 4PJXF 1DANU 4QNPE 1LE5B 1CDJA 1C5CL 1I8LC 2M1KA 2O5YH 5CUSH 4KMTL 5L2JA 3MBEA 1PLGH 1VPOH 4LLDB 2XXMB 3CUPA 4F7PA 4D0DA 3U6RB 2NZIA 3BHBA 2E9WA 3Q6FB 3S37X 3MC0A 5EC2A 5E4EB 5E9DA 5EORL 4M48L 5HHXL 3AM8C 3O41A 3P40A 4UINH 1FE8L 2FR4A 4OF5A 4F80A 5C07B 5JZ7D 1HQ4A 1UJ3A 5ALCL 1QACA 2BCKB 5I71B 2D7PA 4GAYA 4RNRA 3ARDD 5D2LB 4R0LC 5DD5L 4X80L 4ZS6C 3VXTB 3BPLC 4JAMB 1XMWA 4BKLB 1AKJB 4Y1AB 3ARGD 2P8LA 4JZOB 3FB8A 4PJIE 3GJFA 3P11L 5FM5O 1OTTC 2A6JA 5JXED 4TSBL 5C0EB 1Q9WB 5DT1L 4G6KH 1NANH 5FF6B 5EU5A 3SE3C 1GOHA 1S7RA 1IVLA 1EGJL 4TUKL 5I1EH 5C09D 4C56E 2LU7A 4PJCB 3EGSB 5BV7C 5E1AB 4MNQE 5ENWB 2YN5A 4PGCA 1T1YA 4KRNA 5EC1A 2C1PA 3D3VB 3EAKA 2J6EH 4G9FB 4HC1L 4EDWL 3MLSH 3QQ4A 1KENH 4YUEH 4HXAH 4WHTB 5F71A 3BKYH 2FH8A 1LO2H 2HFTA 2Q8BH 3MXWL 2JELL 3QZWG 4OBSA 1YECL 3QI9B 4P2RB 3WUWB 4ERSL 4NJAH 5AWNH 4LLUB 1T7YA 1G6VK 3THMH 4QRUB 1MRFH 5EG6C 1HHIA 3FFCB 3ZDYE 5C0FB 5JW5A 3KPSD 2XA8H 3U7YL 4O2EB 2GSIA 3WCYA 1AP2B 4NQXA 3HMXL 2IAMB 5C6PB 1N5YH 1S9VB 4PUBL 5CBAB 5HPMA 4X9GA 5TQ0H 1GC1C 5CEXB 2X6MA 1IBGH 2DKUA 2P5WE 4R4NC 3ARBA 4J3SA 4WI9A 4PJAB 3RVXC 1WZMA 1DEEB 4HWUA 4U1LB 3S96B 3NFPA 4JG1H 2JE8A 5TH2B 3STBA 3RWHA 5GISL 5E56A 4Z76A 3DVGA 4MAUL 3CPLB 3QT2A 4OFVA 3P9MB 3T09A 2IPUK 3O9WC 1UH4A 5T1DL 5SWQA 4LPYA 5HHVL 3V9FA 3AREB 1FO0L 3C60D 3NCFB 3WJLA 2R15A 4NRXB 3RBSA 4IEFB 2DQCH 4F7MB 4LNRA 5GZNC 1TDQA 4L9LB 3B9KB 3VFRB 4NZUL 5E9DE 1CE6A 3BWAB 4HJ0C 3LZFH 4U1NB 3QFJB 12E8H 1RMFH 5GGTH 3SDDA 3NPZB 3SO3C 5JOPD 3RTQB 3IFPB 3D69B 4RMSA 1TIUA 3TBVA 1MCOH 4W4OC 3RGVD 4AIZB 3D2UB 3SN6N 2X1WL 2B39A 1W72H 1RZIB 5IGXH 3F5WA 4HXBL 3L9RB 4Y89A 4GW1A 4FQIL 2B1HL 1MCKA 1VCAA 4RBPK 5C0IA 4QO1A 2IG2L 3UPRA 4PJ7B 2NY2C 3IFNH 4K3EH 4QWWC 1MFDL 1LD9A 2H26B 4GRLC 5L6YL 3W2DH 3WL9B 3CMOH 3MUGA 1D5ZB 2VZ1A 1FZMA 1P1ZB 5J1TC 2FGWH 1Y0LA 4DZBA 3VXUD 4KDVA 5F3BA 1ZANL 4UQ2B 1DQQA 3MV01 1U36A 4OD2B 4L3AA 4BUGA 4H1LA 3IS0X 1FYTD 2P5EA 4JDTL 4UV7H 3ZE2E 2FZ3B 3UTQB 1BVZA 5F9DC 4I0PA 2DM4A 4I18C 4OV6F 3FQUA 1J8HA 4MD5B 4RGNB 4GKZA 3LIZH 4K2UH 4NKMA 4NNPH 3B9DA 2ITDB 4KI5E 2N7BA 2NCMA 1FRGL 1G9NC 2D9CA 2AJ3A 3IRZA 1HHGB 1J88A 4TVPH 5ESAB 5I2IA 1RK1B 5EFIB 2YKLH 5DHXB 1CGUA 4H88H 4M5YL 1FG2A 3QCTL 3QP3A 1OLLA 3X3FL 4P46B 4Q74A 1NC4B 3VI4F 1AH1A 4X83A 3KS0H