1NMAH

N9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
b'EVQLQQPGAELVKPGASVRMSCKASGYTFTNYNMYWVKQSPGQGLEWIGIFYPGNGDTSYNQKFKDKATLTADKSSNTAYMQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTLTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N9 NEURAMINIDASE
publication title N9 neuraminidase complexes with antibodies NC41 and NC10: empirical free energy calculations capture specificity trends observed with mutant binding data.
pubmed doi rcsb
molecule tags Complex (hydrolase/immunoglobulin)
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1994-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmaH00
4Z7WB 4YDLC 2M26A 4LKCA 4KKAC 4JQXA 3S3PA 2JJVA 2NYYC 1S7RA 1UWXK 3V5DB 2X9YA 4QXWA 5ADPH 2VDLL 3HUJF 4MDIB 1DEEB 4XMLL 1WZ1L 3MUZ1 1JV5A 3GSVB 2VN4A 4G6FD 1TENA 4R0LA 1L7TL 3HS0A 1YPZB 3MLZH 3MOAH 4YHOH 3G04A 3QHTC 4HJGB 4QRRE 1KIQB 2ZUSA 1ZVHA 1JWUA 2ZCKH 1EUTA 5D2NB 2PETA 3CLEL 2VL5B 3K0WA 4HUXB 1QRKA 1DBKH 4YPGA 4YO0A 4AT6A 5IB4B 2X7LA 2H8PB 4NKQB 4NZUH 4HCRA 1S7WA 5F9WB 1DLHB 3UJTH 1N2RB 4XPAH 1JF1B 1MFDH 3G6JF 5BZDA 2DBJA 3AS2A 4GRWB 5D4QA 5E6IC 3P77B 4RGOH 3DI3B 1MFBL 4F15C 2ZZUT 1RUML 1NBZB 2WUBL 1BHGA 1LK2B 4JY5H 5MI0B 1SJEA 3GSQB 4LHJB 9CGTA 5MENB 4PJAF 2IPTH 2WINB 4JM2C 4Q2ZB 1A64A 3QWQB 5HGHB 4PRPB 1E4KC 4F3FA 2E9BA 1WIOA 3JTTB 2FX7L 4WFEE 3QIUA 3BO8A 4MD4B 3ZDXF 3ZT7A 5GGTH 2MQ3A 4G7YL 4NQDB 2W0FB 4DUVA 1TIUA 1LE9B 3V6ZA 1PGRB 5K59F 1H3PL 4OCYL 2UV3A 3SGKC 3LRGA 4LOUD 5L0QC 5HPOA 2DLFL 3AS1A 1FZJA 3MRBB 4GXUM 4BZ2L 1NKOA 5FYJU 5BRZD 2P8MB 4AYFA 1T2XA 4NOBA 3SCMD 4MD0A 1J8HE 4UOW1 3SGDI 5BCAA 3FFCA 5FGSA 3EJJX 2EDDA 5KVEL 3T0EC 3EDDA 3OXRB 4PRDB 4I0CC 3WUWG 4PGCA 4WUUB 4IHOB 4D2NA 5JORA 3HUJE 4EOWL 4I3RL 2R9HC 4TSCL 5DS8B 3OV6A 3G9AB 3OR6B 1P5UA 1MI5E 4MNQE 2FWOA 1AXSA 1MWAA 3L7EB 4OCXL 4EVNB 1FNHA 1JGVH 2J4WL 4GW5A 3T3MF 1D5IL 1RFDH 3OKYA 4BQCA 4JPVH 3FONA 1HOCA 1FN4A 4ZNEE 1TZHB 2DM4A 4K9EC 1AJ7H 3C2SA 1JBJA 1OTTD 3EOTH 4EN3D 4OLYH 4EI5D 2VXTH 2B4CH 4OLWL 4LCWA 5F1IB 3Q1SL 1IQDB 1BQHB 1UKQA 3C60C 3ULUD 3PWPB 5FYJE 3G6JE 3MUJA 4P5TA 4N0UB 4N8PA 4OSUH 2YC1B 4HBCH 4X6BA 2DMCA 4HFUH 1NFIB 2E8ZA 3WDIA 1I1FB 1IZJA 1KBGH 2V2XB 4NKDA 4KV5F 1QBAA 1IFHL 2CPCA 3JUYA 3QIWB 3P0GB 4ONGH 3QEGH 1DL7L 1ORSA 1LO5B 1FNEB 4MAYB 4PJAE 3BVNB 4H8WH 3WD5L 1DVFD 2PO6C 4HPYL 3JVGC 3LRSA 5CP7A 1YEFH 4N8VG 4AZ8A 5EIQA 4HIXL 1XGQB 5CUSL 1JIBA 3RI5K 4J3OC 3I50L 3ZDXE 4EQ3A 2R1XB 4S0SD 2VH5H 3WV0A 2E7MA 3FZUD 4AH2A 5K59E 1P69B 4OLXH 1FAKT 1H3WM 3MJ7B 2HVJA 2FO4B 1ZHLA 1CDUA 3VXME 1U92B 3FRUA 4M1DL 5D1ZA 1P5VA 1MJUL 5BVPH 5C2UB 4UBDD 4GAGL 3QEUB 5DD6A 5LCVH 2XTJE 2MHAA 1BQLH 2FJHB 4GG8B 4RSVA 5F7EH 3LHPL 4P59H 5I2IB 4UOW0 1OCWH 3QQ9C 2CR6A 5C71A 1VKXB 3FO1B 5I15H 3M8OL 1BGXL 1FNGA 4Y2DB 5MEQA 5IB5B 1HILB 1G7JB 1KCRL 1RZ7L 1OAZH 4KJQC 1CVSC 1KJ3L 3ROLB 1P2CB 5LGHH 2NY7L 3T3ME 1EZVY 4XAWH 1Q72H 5HY9A 4HAFA 2DQJL 1KEML 1NCDL 1MCKA 8FABB 1CDIA 4NWTL 3BEWB 1IM9A 3VDBA 2HJLB 3T1FA 1GC1C 4PGBB 3TN0D 2HKFL 3MGOB 3SDXF 3GB7B 5FK9B 1UC6A 4PTUB 1NMCB 2FLBT 3DIFA 1AQKH 4DAGL 3K7UA 4XP6H 2Z4QA 4CDGC 4NHCH 1IAIL 3SE3C 4LFHG 5KW9H 1MIEL 2P7TB 4JREB 3HZVB 1B0RA 3QDME 2R0WL 3BPOB 3TBVB 5IFHH 4LSSH 4ZS6D 1ZGLB 1W0YT 3K1KC 4RQQA 2JCCA 5DK3A 3DX7B 3KPSB 4ORZC 1UENA 3BE1L 5KSAB 5TE6L 4E0RB 3WEXA 2EDQA 4G8GD 2EXYD 5H94A 2H9GB 4XXCA 5EWIH 2M2DA 3GMQB 2FBOJ 1UZ6F 4YJZL 4J6RH 5GRVL 1CDHA 4IRJD 5CGTA 1AGFB 4QHNB 5F7DA 1R3LB 1I7TA 1FRGL 1KLUB 4N1EA 3WXVL 3GSWB 1P7QA 2J12B 3MO1B 5DSCB 1GAFH 4XNMA 3V0WL 4XPFH 2X89D 1GH7A 5KS9A 4XC3H 1FGVH 1RIUH 4KK8D 5D7SL 1CGWA 1J87A 1FO0A 4XWGL 5TGBA 3HE6A 2C5DC 1Y0LB 3PUCA 3U36A 4ONOA 4F37F 4NP4H 2IANA 3GSNH 3ARGB 4HFWB 2ARJQ 4H1LH 4M3JA 5D1QA 4L3ED 4Y1AD 1S7SA 4P2RB 3D18A 4FXLA 5JPMB 3WFCH 1T21A 3B2UC 3HI1A 1JZ4A 2CO6B 3MNVB 4YQXL 1PY4A 1X7QB 4U3XA 5BOPA 1D6EB 5INDB 1MWAL 1VFUA 5HI4D 3O45B 1PG7W 3STBA 3U4AA 1EBAA 4AG4H 2PKDA 5FM8A 1BZ9B 4XZUB 3FQXA 2QR0A 3KG5A 1ZLSL 4AEIH 4XPGH 4LAQH 2WK2A 4GXVL 2G2RA 4I5BA 1IEAB 1AKJD 1KJMA 2AJZA 4KTEL 3VFUA 4KUZH 4HZLA 4APQA 3QCTL 1G9NH 3O2DA 5EOTA 3F7VB 2EDRA 1JRHL 3REWB 3KPTA 5CBAA 3PABA 2YRPA 2PCPA 2QHRL 2XG4A 5I1JL 1LE5A 4QXTB 4YIQA 1PX3A 4MXQC 2EYSB 3QUMB 2NY2C 3FO9B 4U6HB 4LVEA 3LQZA 4FQXA 3TFKC 2VQ1A 3SBWC 1Z3GL 2Q3AA 4FFZH 1XH3A 1C5CH 3KXFE 3QAZB 5IQ7L 3CIQA 4G42A 1WISA 5HYJD 3KYOB 4XNYH 3CLFL 1ACZA 1DQDH 2PXYD 5F9OH 1NCNA 2ICWI 4OGXL 1UJTA 4IDJL 1JZ2A 3G5YA 4XAKE 5FUZL 4PB0L 3CXHJ 3SDDA 4OB5L 1A7RL 3VFRA 5CZXC 3TH3T 5E4EC 5DMGC 1LP9F 1CE6B 2E7LA 3H3KA 4S11A 1R5VB 2BRQA 2D4DA 1UZ6E 3IDJB 3VFTA 1I3VA 1RZFH 3GHEL 4F7EA 5IWLA 2HT4C 4V1DA 4DZBB 4FOMA 2HTLD 5D5MB 1VACB 1A47A 1KJVB 1QQDB 7FABL 5IOPA 4WY7H 3WN5B 1W0VB 5I8KH 3LDBC 2FHCA 5AZ2L 3DPBA 3KYAA 3CMOL 4ELMF 2JJTA 1NFKA 1GGBL 2DQUL 4M7JL 2DQCL 2B1HH 3OJ2C 2YN3A 4CAGA 4HS6B 2ICWA 2Z92B 4P0DA 3MRLA 5L9DH 4QRRA 2DQDH 4JM4L 3V6FA 2P5WD 1QR1A 1MVFA 2G75B 1XCQB 1UKSA 5A2LH 1A3QA 4L8SB 5HBBA 3HNSH 1H9VA 1CFTA 5IK3B 3QXUA 1T7WA 1F11B 1CD0A 5FB8A 3IXAB 4MAUH 4QRTB 4EIZC 1HK6A 3S4SG 3T2NL 3O6FA 3BD3A 2CJUL 4HLZH 3B6SA 4Y4KA 4MJ5A 2AJUH 3WNMA 5T1DL 2WV3A 2PTUA 4LKCB 3W5NA 3OKNB 2LTQC 3SCMB 3P9MA 5SX4I 1JHTA 3VFSB 3DI2B 4OZFH 5F93C 2YD5A 4FQ2L 5INCA 1JV5B 2E6PA 1CG9A 2VDLH 2H6PA 4XMLH 4GRLD 1WZ1H 3DYMA 5E0QA 3G04B 1CGVA 1EHNA 1L7TH 1T04B 1Z9OA 3TYFB 5LQBL 1JPGA 4HWBA 4DEPC 2DLEA 5KZCB 2ZSWB 4RNRA 5HGDB 5IT2L 4BH8A 1EK3A 4AT6B 1ZXQA 1T3FA 2R15A 1RHFA 2VERN 1S7WB 1WWAX 4KGLA 1G7QA 4E42B 1HXMA 4UT7L 1RJYB 3AY4C 4NN5C 1J1OL 1FLTX 2UZXB 4TUOA 3CGTA 4OFYA 2OYPA 4EI5B 5A2IH 4BUGA 4HXAL 1KB9J 1LP9E 4KZEL 2AJVL 3OAYH 4I18A 1YEIL 3Q5TA 1MFBH 1FO0L 1RUMH 1J8HA 2J6EA 2VLRD 1T22B 4AJ0A 5JLZA 2WUBH 4E5XB 5FYLL 1YYMH 4JRYD 2J88L 2H3NB 3HUJA 3MV7E 5E99L 4ELME 5ADOH 1KTDA 4K3EL 1MCCA 1DVFB 3QIUB 3BO8B 1MI5A 3FT3B 4MNQA 4NGHL 2FX7H 3SKNA 3TBWA 1PZUB 3SQOL 3L3KB 2ENSA 3B9EA 3NPSC 1PKQE 4G7YH 5I74C 1H3PH 3MBEC 4ZNEA 4OCYH 4Q6YA 3RWCB 4D9QE 4DUXA 1IKNC 4BSWA 3ZKQD 3UPRA 3RL2A 1GJIA 2DLFH 4JFOB 1Y6KR 5J1AA 3NGBB 3KR3L 5HYSB 5ILTL 4BZ2H 1ZWIA 3LN9A 4YBQD 1WT5A 2IWGA 2E8YA 5K93A 4LSRH 1WAAA 2GK0B 1VPOH 5IMMA 4FTVD 4PGCB 3C09C 3BRGC 2GCYA 5CZVH 3G6JA 3OZ9L 1T0MA 2I26N 4N0RA 5HVHC 4E9LA 3VGDA 4I3RH 5IUSA 2FWOB 3V79C 1AXSB 3L3IA 2XZCH 3DNKA 3N1PC 3ZKNC 4TSCH 4ZD3L 3L3OA 4RIRA 1NMBL 4OF6A 3ARDD 3MNWA 4GW5B 4U1KA 1U8NA 4OCXH 1MFNA 4YDIL 4X83A 1DTUA 5C6TL 1D5IH 1JF5A 2I07A 4U1LA 1A9EB 5C0FA 2AXJA 2F53E 3U0TB 1MHCB 4GBXC 1ZE3C 3X17A 1HQRA 1LHZA 3RTQA 4LCWB 2BVYA 4HUWA 3SPVA 2NY6C 1UH4A 2FRGP 4UT6L 5KVMC 5DJZB 3Q1SH 4PYHA 2O5XL 4LIQL 5B39G 3SGJC 3VXMA 3TT1H 4NKDB 1KF9B 4ZUWB 4R4FL 4KZDH 1D9KC 1ZVSB 4FG6C 3LEYL 3T0WA 1IFHH 1NGYB 5E00B 3FQRA 4O51B 5CIPB 4JZNB 5DUML 3LKOB 3TJHC 2BNQE 4G8GB 2VLJD 1FVDA 3AVEA 3LRSB 4HPYH 4WWKC 3MOQA 4HK0A 3IS1X 1MCIA 4HIXH 4IRJB 5CUSH 4CMMB 3I50H 4AH2B 4K71C 5GS1C 1FZOA 1Q9WA 5GGSA 5IKCB 3I75B 3NCMA 4J3WA 4NQUA 3P73A 5FO9A 5DMKA 4E41A 3RNQB 2V9QA 2VLME 4L3AA 3VH8A 1CXHA 5D1ZB 3CD4A 2AI0H 4F33A 1OPGH 4M1DH 4Y1AB 4HIHB 1U36A 2NXZD 3CVHA 2YWYA 1UM4L 4R96B 1MJUH 4GAGH 3BP4B 3CC5A 4NQCE 4G6ML 3OB0H 1HKLL 3L7FB 2HFTA 3QDMA 3LHPH 3AGVA 4HWBL 1NL0L 4Q6IB 1D5MA 4ZYKA 2H2PD 5JOEA 4BQ8A 3WIIH 1FNGB 5B38B 2HYMA 3BESR 2XG5A 4AEFA 4NSKA 4OFDA 3UYRL 2APTA 4HJ0C 1BGXH 2KL6A 3W0WD 5LGKA 2GQHA 1G7LB 4N0CC 1KCRH 1HYRC 2YBRB 1W8OA 3EOAA 3QUYD 2NY7H 1BEYL 1KEMH 1IM9B 4BSJA 3JXAA 2VABA 3JWOC 1AKJB 5DI8A 5E7BA 5C0ND 1U3JA 4ZOAA 1LO3L 1WTLA 2HKFH 3QCUH 5DMYA 3R8BB 2FL5B 2P8LB 2QQQA 1P84K 5B3NA 1ZHBB 2J6EL 4MQSB 1WWCA 3TO2A 5CEXA 2GJZB 2A0LC 2DJSA 4RQQB 5DJXA 4L3CA 3T0EE 2XTJD 3SOBL 1N59A 4EDXA 5HYJB 3BWUC 3RX5A 4XHQA 5H94B 3UTOA 5TE6H 2PXYB 1ZANL 1U8QA 1YN7A 3G5XB 4MB5A 5FO7A 3VD9A 5B8CB 3TBYA 2HKHL 5KAQG 3CJJA 3TPUA 2Y4SA 4PJ7F 4U6YA 1BWWA 2A9ML 2UWEF 3N9GL 5F7DB 4C56D 3SE4A 1VGEL 3ME0A 4LVOB 3HCVB 1JL8A 1P7QB 5E94A 3LIZL 4X8XA 2YK1L 1FRGH 4GG6F 5D7KD 5J6HA 3T65A 4M3KB 4CVZB 3V0WH 1TJHH 5TGBB 3V52H 5E6YA 3HE6B 4S1RL 5DR5L 4DOHB 1YUHB 4NQSA 3BPCA 4IMLB 5D7SH 4JLRB 2R2CA 3VXOB 1S7SB 3D18B 5GJSL 1J0KA 2FX8L 2ZOLB 2E3VA 5HHNB 3SKMB 3CSBA 4NM4L 1D5BA 1OL0A 5DFWH 4P2QE 2DMBA 1T21B 2MNUA 2VTFA 3HI1B 3QZWG 4HKXB 4NQED 4JRXE 4K9EH 1UM5H 4NHUA 5JHLL 1ED3B 4YQXH 5TQ2H 3KXFA 3MOBL 3V7MA 1MWAH 4NN6B 4IDLA 5F44A 5CEZE 5L8KB 1MHHA 5CHNA 4I1NB 4JO4L 3RWHA 1CQKA 1SEQL 2Z31A 3HN3A 2Z91A 5LWYL 3I3DA 1M7DA 3FQWA 2NCMA 5CD3A 4QF1A 2X1XR 1ZTXL 1XMWA 3K2UH 4I5BB 1ZLSH 1JNLL 4N0YL 2COQA 1MHEB 1HH9B 4GXVH 1H3XA 2AV1A 5JOFA 4APQB 5EOTB 1LO2L 1IAOB 3BKML 4KTEH 3VA2C 5CBAB 3QCTH 3KNBB 3GHBL 5B4MD 2L7JA 1LE5B 3LOWA 4YIQB 3DJ9A 4GRLB 5ICYB 2QHRH 2G5BA 4GAFB 5I1JH 4FQXB 1ZGLM 1SYVB 3ZDZF 1W0WA 2VQ1B 4QOKE 3WO3B 5DMIL 4P46C 1ZA6A 4OFIA 4J8RA 3T0DA 1U95B 1G0DA 4G42B 1QRNE 5JUEL 2XQYK 3WIHA 1XGTA 5IQ7H 3WUWA 1OSZA 4I0PA 4U6XA 4WW1B 3CLFH 4LLDA 3EO0A 5TH2A 3SDDB 4X9IA 1LD9A 2VAJA 1UA6L 4MXWL 5D70L 3DETD 3Q5YA 4LVNB 4PB0H 5E8PA 5FUZH 5GHWH 3AREA 4OB5H 4HIEB 1F02I 2M1KA 1F8TH 1A7RH 1RPQA 4JZOB 4TUJA 4PJ7E 5GGQH 3PWJA 4LPCA 2UWEE 2OJEA 3B9KD 4V1DB 3BN9D 5IB1A 5E1AB 2CRYA 3GHEH 4PRHE 5D2LF 2GK2A 3CDCA 1MREL 5HHQA 3V2AR 4GG6E 5TFSL 5EOCJ 2VLRB 5FYKH 1ZT1A 5DUPL 1NKRA 4P2OA 2O61A 4Z7UF 2BOBA 2QQLH 1IC4L 3QUZC 3CVHL 5F71A 2FIKB 3CMOH 4JFQA 2XKSA 3HI6L 1GGBH 5FCUL 4L5FL 2ICWB 3T04D 1S8DA 4JGJA 2DQUH 4QRRB 4M7JH 3OL2A 2DQCH 1QR1B 3PGFL 1U3HC 4YWGH 3RNKB 4JM4H 1GC1H 3HC4H 4WCYL 3QQNA 4NKOA 1U2HA 3QIBD 3SKUD 5I1GL 3TCLA 3B8YA 4Y4KB 5GRUL 4MJ5B 3D69A 3FB6B 3T2NH 3FKUS 1Q0XL 2CJUH 2AXHA 4OM0L 2I9LB 4RFEA 5T1DH 1HQ4A 5I76A 1JHTB 4N8VA 2MOVA 1AO7A 1JGUH 5ESQA 4L4TE 4KRPC 4P4KD 2VUOA 4L8DB 2IADA 2IG2L 4FQ2H 4FTVB 1LP9A 1S9YA 1RSFA 2H6PB 1QLEL 3IKCA 3ILQC 1FL3A 5HVGB 2W9EH 1BQSA 2OCFD 2YMXL 3C5SB 3W2DH 5DVNA 4R2GB 1BLNB 1BM3L 3FOLB 1F3DH 2IGFL 1JPGB 3VXRE 3OXSA 3UTPE 3RPIA 2FEEI 1SM3L 3ESVF 2VOTA 5LQBH 4PLKD 3ZDZE 3S3SA 3V8OA 3KDMA 4KJPC 3O8XC 4ELMA 4HUUA 5IVXF 3PHOA 5IT2H 3O9WC 1DR9A 1QBBA 2JB5L 5EUOB 1G7QB 1QA9A 3IDIA 5HI3D 4U1GB 4QKXB 5KAQF 1HXMB 3ARED 4QHUA 4WI5A 3G5ZB 4PR5A 3JTSB 5CCKL 2CRZA 4ZQKA 1OSPL 3O3EA 4NN7C 1PKQA 1RQ5A 4UT7H 4W81A 1CU4L 1OGAE 3MLRH 4GAJH 1LO4L 5EDXA 3TA3C 4KDTC 1T66D 3ZYZA 2XI9A 4KZEH 3C5ZD 4OF8A 4RMRA 1J8HB 1NUDA 5I8OL 2EICA 2EDKA 4QY8B 5D2LE 1FO0H 2LU4A 3MRRA 2ESVE 1X5GA 3T1WA 3LN5A 5FYLH 3FQNA 3HUJB 4Z7UE 1EEUA 1YEEL 1FL6A 4TNVK 1AGCA 2EC9U 3ZO0A 4D0CB 3NTCL 4YXKL 1U93A 4Y4FA 5LXGL 4GMSL 5E99H 2VLJB 3L1OL 4K3EH 2VC2L 3SKNB 2EDHA 1FHGA 5IW6A 2FZ3A 1MCBA 3CXDL 5FA4A 4P57A 3RWEB 3FL7A 1S5IL 3WNNA 4EUPH 3ULVE 2F53A 1GCFA 1V5JA 3SKJL 1ZWIB 4KDWA 3KR3H 4Z95H 3GNML 3HMWH 3QR2A 4ZUSA 3HMXA 2QJDA 3HPJA 3BI9X 5ANMB 2NY1D 4TTDD 4NJAL 1UKTA 2GCYB 2H1PH 3G6JB 3LPFA 2NXZB 1AGDA 4Y4HC 1T0MB 5D71L 2AEQL 5ENWB 1F58L 2YOCA 1M7IA 1U42A 3L3IB 2WLZA 2FYYA 4JFYB 3T0XA 1UM6H 3L3OB 2B5IB 4MXVF 2NR6C 5DJDA 3MNWB 4U1KB 3MV7D 4ZD3H 4KUCF 3L3HB 1O7SA 3WIHL 1NMBH 4PJAB 2F54A 3W0WB 4N1CA 4YDIH 1N64L 2I07B 2OTPA 4K7FA 2BNQA 5C6TH 3ZKMC 5DZOA 3VJ6B 2Y6SD 1NANH 5IVXE 1M6OA 1G84A 1HQRB 5TDNB 4OIIL 3RTQB 4XGZA 4NO5A 1Z9MA 1IAIM 4FRWA 2PUQT 1AP2B 3FT2B 4X5XB 3LKRB 3L5JA 5D1XA 1AC0A 2O5XH 3BH8B 3W9EB 1Q9LB 4XPTL 5EN2A 3X13B 5C0IA 4HGMA 1IEBB 3N1GC 2CLRB 4R4FH 1DBAL 4RCAA 5HHOE 3NAAH 2XTJB 5FAAA 4UQ3B 3FQRB 4YXHL 3HR6A 4DKEH 4O2FB 3LEYH 4CDHA 4NQCA 4LFHD 2BDNL 1T1YB 4QRQB 1RUAL 5DUMH 3QUXD 1WJ3A 4QEGA 4PGDA 4HK0B 4YUEL 4BFBD 3ZL4L 1DANT 1FL5A 1FZMA 3BZ4A 4GS7C 3EJYD 4RMUA 1OAQH 5ALBH 4QWWC 5T3XL 1IGML 3TZVD 5GGSB 1QBLL 2A1WH 2ZG1A 3LEXA 4AL8H 1AY1L 1MRDL 4TN9A 5HYQA 3O4OB 5DMKB 5L7XL 1EHLL 5D7LA 1J1XH 3BQUA 4BK4A 1A0QL 1CFBA 5AAWA 3BEVB 2MWCA 4F33B 2OMBA 1MFEH 1RIVL 5EA0L 4WU5A 5DVOA 1RMFH 4KKAD 2NYYD 4G6MH 1HKLH 1D5MB 1T7YA 3D85D 1EJ6A 1EGJA 1IGCL 1XEDA 3S7GA 1NL0H 2GY7B 3O4LD 4ZAKC 1YQVL 1A3LL 3QXDA 4U31A 2OXHA 4MXVE 3PP3K 4Z7OF 3LKQA 4JPKL 3VWJC 3EOAB 2DRUA 3PXHA 2C1OA 4JFXA 2X4UA 1T0NA 4HX1A 1MCNA 5CKAA 3HHRB 1NGXB 3FTGB 1N0LA 5TF0A 2F5AL 4FNLL 4XP5L 4XNZB 3PG2A 1UG9A 1QOKA 1LO3H 3PJSA 3S4SA 1B0GA 2VLMD 2GUOB 4URTB 1SJHB 3HC3L 5CEXB 1QYGL 1UWXH 4HEPG 3ZSSA 1IAKA 2J2ZA 2J6EH 3L95A 5E6ID 3RIFK 1TNMA 2DQEL 1FFPB 1N59B 2EZ0C 4P2QA 3SOBH 2N1KA 4Z18A 1EZVX 5C3TA 3WFDL 4JRXA 1ZGLP 1YN7B 5TE7L 1QEWB 3GSUA 3D2UA 4O4YH 3TV3H 4Z78A 3ARBC 1L0QA 2CXGA 3TPUB 2OI9C 1PZ5B 1ZANH 4JM2D 3EDFA 2HKHH 4RGNE 2CQVA 3TVMA 5E94B 1X5LA 2A9MH 3L5WA 3N9GH 1VGEH 2PR4L 2DIAA 2L4OA 5FA3B 4LCUA 3LIZH 2D31A 4RWHA 2YK1H 1FFOA 1ERNA 4CNIA 5C0AD 2GTZA 1BVLA 4ZG1A 5DR5H 4S1RH 1UH2A 4RISL 1T7ZA 3HMXL 3VU2A 2XNAA 4XNUL 1U91A 3U6RB 3GSOA 5T5FH 5GJSH 4WW2C 3SDXB 1FC2D 2IFFL 4HUVA 4NO3A 3MC0A 5CS7A 4YR6B 4Y8AA 1UB5B 2LVCA 4NHUB 4QOKA 2VDML 1A7OL 1B0WA 4RGMC 3P0YL 3ZKXB 3LS4L 3T0ED 3KXFB 4CJ0A 3EGSA 5H37H 2NPLX 2V5TA 3PDGA 1QRNA 2DL9A 4LLUA 3MRJA 1MHHB 4NZTH 3MOBH 3RWHB 4HULB 2Z31B 3VMNA 3QIBB 3CDGA 2OSLA 3MLWL 5DURB 2R9HD 1M7DB 3FOMA 3FQWB 4JO4H 1SEQH 2B39A 4M48H 5CD3B 4Z7OE 4B0MM 3WL9B 2MTPA 2HFFA 4P3CL 3CH1B 1NGZA 1ZTXH 2YA0A 3LQAC 1JNLH 4N0YH 3I3BA 1HIMH 1YJDC 4PJ7A 1G9MC 1NBVL 2MQCA 2UWEA 2HVKA 4WHYH 4P4KB 5F1KC 4YHZL 4GKZB 1YY8A 3BKMH 4PRHA 5EU6D 1FIEA 3NZHL 3GHBH 3W82A 2G5BB 2VYRE 3CDFA 1W0WB 4PTTB 1F90L 3QDJD 5D96C 5DXWA 3GMMB 2OTWA 2YXFA 5JIHA 5DMIH 3C60D 4IIQC 1RZKL 1FV1B 4PY7B 3V5KA 2X4SA 1GYAA 3OGOE 3WUWB 5JUEH 1OAYL 2E5EA 4U6XB 2ZUTA 1NAMH 4PJBA 1KOAA 3P4LA 5TH2B 2CIKB 2HMIC 1CGTA 1LD9B 1QSFE 1YMHA 4POYA 4WI4A 5E8PB 2JELL 1U8HA 3AREB 2CLVB 3C6SA 5CEZD 5D70H 1UA6H 4MXWH 2UY7A 3HG1D 3U7AA 4TUJB 2V5YA 3KPRE 3PWJB 2OJEB 1XF4A 2PO6D 5HYIA 2EDXA 4M8QA 1N5AB 2P42B 7CGTA 4BZ1H 5T1LD 1UCBL 1WBYA 1NUNB 5SV4A 2YD7A 1MREH 3HZKA 5T33L 1ZT1B 4ODVL 2O61B 4L4TA 3QI9A 1JPTL 5JZ7C 3CFCL 1MAJA 3IETA 1KG0A 1I7UA 5DUPH 2ZUUA 1J88A 3IS0X 3KPLA 3MLTA 4JFQB 1IC4H 3CVHH 2EDTA 1S8DB 1V05A 3NIGF 4JGUA 4RMQA 3VXRA 3CFBA 5B39A 5FCUH 4L5FH 3H3PH 1DQJB 5MHSE 1BWMA 4CVUA 3PGFH 1EGJL 2HTKC 5DMJB 1KN4L 2LAGB 3JWOH 4WFHD 3HI5L 4NO0D 4NKOB 1DSFL 4F8QA 1TJGL 1FSKB 1BFOA 1FNSL 4WCYH 2EECA 2VLLA 4ZO6A 1UXSA 5C0GA 3QPQC 5MEPB 1OT2A 1FVCB 3QQ9D 1H3GA 3IJSA 2RB8A 5I1GH 3BJLA 2MQ0A 5GRUH 5FYKD 4RFEB 1HQ4B 1G7HA 1EHAA 3KPOA 1Q0XH 1Z2KA 4N8VB 4PJ5A 5F7MC 3T08A 2D7OA 3HC0A 4KJQD 1XFPA 1LP9B 2UYLA 1FL3B 4Q74A 4PGEA 4PFEA 1XGYL 2IG2H 1E27A 2NY3B 2WLYA 2Y06L 4X4YA 2YMXH 3OXSB 4X8JA 5C6WH 1BM3H 5I1CL 5D2LA 2VZ3A 2IGFH 2YUWA 2ESVA 1WF5A 2D0HA 1SM3H 4Y5XC 3KDMB 2W0PA 4FQJL 3MV7B 4Z7UA 3CH8A 4ODSH 3ZHLA 4U0RC 1NANI 4KTYA 4RFOL 4JY6B 3IDIB 4IOIA 4F7TA 4RWYH 4CN4A 2JB5H 4OLVL 4JFFE 2ZJSL 5CZKA 4ZQKB 4M7ZB 4MHHG 1PKQB 3KPPA 1G7MA 2ATPA 3MFGB 4RAVA 2QADB 1OSPH 5IESL 1MJJB 3MTRA 1B9ZA 4XCFL 2LQRA 4KVNL 3VGAC 1CU4H 2UZYB 4K07A 2V17L 3B5GA 2VKWA 1LO4H 4LCCC 5DEGB 2N7BA 3L3GB 4NZRL 1MCJA 4R97C 3DO7A 5K9OB 2AK4A 2H26A 3MRRB 4OM1L 4PY8I 2FH8A 5I8OH 3WFEH 5IVZA 3LN5B 5J3HC 3FQNB 1JZ8A 1S7VA 2OM5A 3V6OE 1FL6B 1AGCB 2AJYL 3EBAA 3MR9A 1U93B 4KKLC 4U33A 2H2SC 3NMEA 1YEEH 5JIIA 3QB7C 1YMMA 4RX4D 1QO3A 3NTCH 4YXKH 3I6LE 3QUXB 1L9MA 4GMSH 1OB1B 4X0KA 1NBYA 3ZMRA 5IW6B 2VC2H 4ZFOA 1YJDL 5FA4B 1IKFL 1I9EA 3DVNA 1JP5A 3CXDH 3B2UD 4ODXA 5L8LB 3TZVB 3VXTA 1NCAL 3PDOA 5IVXA 1HI6A 3BN3B 1TTUA 4M93C 4L1DA 2I5YH 4ZUSB 3SKJH 2R0KL 3DECA 4FQQA 5FYLD 1OGAD 3GNMH 3KYMA 1KELL 1GZQA 4NC0B 1CFQA 1KGCE 3VRLF 4J2XA 4JKWA 1AGDB 4NJAH 2XZAL 2AQ3A 2BSTA 5J9PA 1NC2A 3E0GA 4KC3B 5BVJA 4YDLB 5J4MA 1JMZA 4Z8FL 3RFZC 4ZODA 4S2SA 1M7IB 5D71H 1T1WA 3WS6A 2PTTA 4JAMA 2A77L 1F58H 3D85B 5J12C 4NM8L 3U7WH 3KLHC 3O4LB 3MZTA 1F4HA 2AK1H 4MXQD 3WIHH 2NY2D 4M43L 4YHKL 3LY6A 3TFKD 1N64H 1EO8L 2D03H 3U2SA 1TPXC 3QZWA 4HDIA 4R7NB 2X4NA 3OQ3B 2KQMA 1GOFA 3O0RL 2XY1A 5DYOA 3BP5A 2Y36L 1HE7A 1INQA 4NFBA 4Q97A 3AS3A 4J1UA 1JK8A 1PD6A 4PJDF 3Q6FB 3QEQE 5J6GA 5CZXD 4QGYA 5EN2B 1EH9A 5DMGD 4X6EB 5H35B 4HLJA 5T3ZE 1KPVA 1UVQB 4J4PA 4LLWA 1CFVL 4XPTH 1PEZA 2HT4D 1H5BC 3FO0L 4X98B 1DANU 2VUYA 4M6NL 5JNYB 5I1DB 4F15B 1T1XA 4YHPA 4I9WD 4YXHH 2A74A 1NSNL 3DV4A 3AMKA 1DN2A 4PGDB 5EBGA 5GISL 1RUAH 1YN6A 2VZTA 3WJLC 1FL5B 1SBBA 2FJFB 4YUEH 3TBSA 3ZL4H 4XRCA 4PV9A 4MVBC 4YEEA 2L7UA 1OHQA 4U3CA 4XVTL 1ZHNB 5C0BE 1T83A 3LEXB 5T3XH 2NY4C 3MLXL 1IGMH 3BQUB 4ERSL 1AY1H 1MRDH 5C0AB 1C1EL 5L7XH 1EHLH 4NDMA 4R3SA 1C16A 3DO3A 4WU5B 3ZE2F 1SY6L 1F13A 5JQ6L 3VXQB 1IVLA 3OKLB 2QQKH 1RIVH 5EA0H 3GO1H 3DUHA 4AIXA 1GGCL 2CMRL 4LDEB 5F70A 4PJ9A 5HHOD 3T0EB 3MACH 3PQYE 2YRZA 3MRNA 2IPKA 3VGFA 5ID1A 3RZCA 3ARRA 3QXDB 4EJ1C 1IGCH 4QRUB 1BFSA 5D6CB 1A3LH 3H8NA 4IBLT 4HK3J 1IC7L 2C1OB 2OJZH 4I13B 4X4ME 5E9DD 4JFXB 2WZPD 4JPKH 5BS0E 2YUXA 4HX1B 3BDXA 4CMHC 4JCMA 3FCTB 2V5MA 1CBVH 3R1GL 3TO4A 1T89A 3OB8A 3CFIC 3ULVL 3TNMA 2F5AH 3PJSB 1NCCL 4XP5H 3S4SB 1B0GB 1FYTD 1ZKAA 3AAZB 4IRSA 5C0JA 4GBXA 4AEEA 4QNPF 2XY2A 3S35H 4PJDE 4HKZB 3L95B 3NFPA 5KSUB 3RGVA 3HC3H 1NPUA 2KQNA 1KB5B 1QYGH 2JJWA 3QDJB 2R0LL 3WIFA 3C60B 2DKMA 1JN6A 2FR4A 4HS3B 5IROA 3ZZ1A 5CD5C 2DQEH 4JRXB 4P9HC 1ES0A 3GSUB 4Z78B 5DHXB 4ZPVA 4XBPA 1CLYL 3WFDH 1ZS8B 5TE7H 1A6UL 1BQHG 3ZYJA 3OR7B 4ZFOL 2VE6A 4CN1A 4DGYL 3HG1B 4YDJA 4ZPTA 1M05A 2WUCL 4L9DA 3A6OA 4LCUB 2PO6B 5DHVH 2ICES 2PR4H 5EIIA 1FFOB 3DV6B 4LQFL 3SDCA 3IFLL 4F9LA 3MRHA 4O2CA 1BVLB 2XNAB 1U91B 5DQDL 5CFHA 2CDFA 3MBED 4U7KA 2B7DT 1BVKA 3D48R 3LEVL 4RISH 3HMXH 4HPOL 4PLJC 3UXFA 5GGUA 4H5SB 1BECA 4HUVB 3A6CH 4G6JL 4NO3B 2RAMA 3QA3A 1X5HA 3QSKB 4LKXB 3ZE2E 5AUMB 1R3HB 3AS0A 3D6GA 5SWSE 4QOKB 4K2UL 3N1MC 2JIXD 5DJ8A 2CUMA 1A7OH 3P0YH 1QRNB 4AEHL 3MRJB 5FGBA 4NO0B 4NKIL 2DS4A 2OSLB 3CDGB 1HYSC 3NOIA 4UB0H 3UTTD 4MWFB 2E9WA 3FOMB 2ID5A 1EVTC 2APXA 3GSXA 4M03A 3HLAB 3MLWH 2C1PA 1QSFA 2NX5A 1H0DA 1JWSA 3ZKND 5EU4B 2HFFB 5I75B 4CJ1A 1PEWA 4S1QL 2DI9A 1YPZF 4P3CH 3KPRA 1U8PA 2UWEB 2HVKB 4YAQA 1YY8B 5IEKB 1JPST 2VISB 1NBVH 4GBXD 4YHZH 4GG6B 3MJ8B 1MJ7L 3NZHH 4MX7B 3PDDA 3NH7L 3P4OA 1B88A 3GDBA 5C08E 2OTWB 1F90H 3BP6A 4QNPE 1CD8A 2NY6D 1KCVL 2DAVA 2AJSL 1FQ9C 2EXWC 2VIRA 4JO3L 3IDMB 5IBTL 2Z8VC 3V5KB 4M5ZL 1ADQA 2X4SB 4I4WB 3O6KL 3UEZA 1RZKH 1NC4D 2FBJL 3QDGD 1XZ0A 1OAYH 3KJ4C 4F9PC 2X4TA 5ICZB 1D9KD 4G43A 3T8XB 4FG6D 2JELH 2X4OB 4KH2A 3LKSA 5HDBF 2VKXA 4D9RE 4HH9A 2Q76A 1T1ZA 3GMNA 1XF4B 3WNKA 3KPMA 4JZJC 3TJHD 3F5WA 4QXGL 5AD0B 1KCSH 1F6AA 4WWKD 3SN6N 1FJ1A 4KMTL 1WVZA 1RULL 5F9JA 3N50A 4OCRL 1UCBH 3VXUE 4L4TB 3CFDB 3W39B 1FZKB 3S37X 1KG0B 1I7UB 4ODVH 5L2KE 3KPLB 1RUQL 3MLTB 1JPTH 1XF5A 3CFCH 4GAYA 4OF5A 1OAUL 32C2A 4U0QB 1UGNA 2CRIA 4KI5C 5ID0B 4YBLB 2OL3L 1KLGA 4PJGF 2XKNA 3CFBB 5B39B 3TF7C 5I1KL 4P9ML 5DGRA 1J12A 1QSZA 1IL1A 5A2KH 4OZHA 3RWIA 3WLBA 1N6UA 2LFGA 1BFOB 1KN4H 2QBWA 2VLLB 3HI5H 1DSFH 4MGXA 1TJGH 3QWOA 4UQ2B 1FNSH 4Z7WE 5BXFA 4R7DA 1G1YA 3FAXA 3N0PB 4JFFA 1G7HB 3KPOB 4JY4A 5I8CA 1TTFA 4HJ0D 3KJ6L 4N0FA 4U1HA 4ZS7L 1OGAB 3RJQB 4N0CD 4ONHA 1NGQH 2VDRL 4PGEB 1YPZE 1QNZL 4RRPG 4NT6A 3VFGL 4X4YB 3U0PA 1XGYH 4X8JB 1QFWI 1U8KA 5D2LB 3DX9A 2Y06H 2ESVB 5I1CH 3DUSA 4Z7UB 3V6OA 1XIWA 5DJYA 5JIPA 1G6RL 1XF1A 4OFPA 4HWUA 1MRCL 1IC5L 2YUVA 3P3YA 2NZ9C 2A0LD 1T03L 1G7MB 1U58B 5IHLB 4RAVB 1IBGH 2DLTA 1UEYA 3GUTB 3LN4A 4JHBA 1XGUA 1EEYB 5HDBE 5IESH 5HSFA 4XCFH 5HHMD 4X6CB 2V9RA 2RJMA 3EDEA 3BRDA 3RHWF 2Z35A 1KULA 2V17H 3DO7B 1CQYA 1J7VR 2H26B 1J0JA 3PL6C 2AEPL 4NZRH 2AVGA 3GMOB 1WFUA 5BQ7B 3BGFB 4JKPH 1S7VB 1X4YA 3K2MC 4OM1H 4FQLL 3TPKA 2X2YA 2D2OA 3OG4B 5EO9A 2A6JB 4JO1L 2CUIA 2AJYH 4NQDE 2DWDB 5GSVA 4ISVA 4X0KB 5BV7C 3W9DB 4PJGE 5JR1L 3QRFM 3GMPA 1GIGL 3X14A 5I9QB 4I48A 1N3NA 4ODWA 3DVNB 1YJDH 1G9MH 3H9ZA 3G9VA 2X4PB 4K55A 3VXTB 3PDOB 1OWRM 4ZFZB 5IVXB 1I8LA 1JMXA 4OLZL 2UY6A 1EUUA 4JFPA 5C8JA 2I60H 3KYMB 4QGTA 1FP5A 1NDMA 1R6VA 4LEOB 1S9XA 4WUUE 1CFQB 3HPLA 2R0KH 5DRXA 3DRQA 1CT8A 1LQSR 2DDQH 1NC2B 4PG2C 1KV3A 4A6YL 2BJML 4LPVA 1I4FA 3QEQA 3WCYA 3GMLA 3BGAA 3QO1A 1A6TA 2LTQB 2PTTB 4Z8FH 2OR7A 4KJWC 4W68A 4R6UA 3NCYP 4NPYA 5HHOB 1F3RB 1RK1B 2A77H 3SO3C 3GJEA 4GUPA 1ADQL 3MRMA 3S36H 3SEPA 4D94A 4NM8H 2BVPA 4YE4L 1YDPA 5F3HA 3UJIL 1AD9A 2WIMA 3U2SB 5DC0A 1HZHL 4M43H 4P46D 4YHKH 2X4NB 1BREA 3V95A 5DYOB 3EOYG 12E8L 4KROC 1RHHB 1JI1A 3O0RH 4JG1L 1VADB 4J1UB 2Y36H 3SY0A 1JK8B 3LB6C 4WFGD 3DYPA 5C0BA 1EFQA 1IGIL 4MQ7B 1FYTB 5J6GB 2Z9TA 1F97A 4NN5B 5BW7A 4LLWB 2BRRL 1GGTA 1KGCD 2XWJA 4L9LA 3RY6C 1T20A 5JXEC 1CFVH 4MJ4A 3HRZB 1A7QL 1CLCA 4K8RL 4UMGA 3NFNB 3DV4B 1MHPL 3C6LC 4KKNA 2VDNH 1NSNH 3UTQA 3PGCA 5E2JA 1YN6B 1S9WA 5IMLA 2RQ8A 5SWZD 3PQYA 4JQVC 1CXFA 3WE6B 3QUZD 4IEFB 1BX2A 3LMJL 4XRCB 5GISH 3TBSB 2VZ1A 4MJ6A 4PV9B 4HS8L 1TZIA 2YKLL 1TJIL 4PIRF 4U2YA 3C08H 3HE7C 2K9UA 1CL7H 2M8XA 4X4MA 5KVDL 1U3HD 4XVTH 3PHQA 4NQXA 3MLXH 4WUKH 4NDMB 4YDKL 4TNVF 1T0PB 4R3SB 1C1EH 2C4XA 4Y19D 5J89A 3MBEB 3WHXA 2EE9A 3BFOA 2WWKT 1CYGA 2MFNA 4JFZL 4U2ZA 1SY6H 5JQ6H 5DC9B 1Q9KA 2R69L 1JTPA 4PJDA 4PJ9B 1FNFA 4KRPD 5FF6B 5DD1H 3FO2B 3A0OA 1RJLA 2CMRH 2IPKB 4HWEL 5ID1B 1QPPA 3RZCB 1XGRB 2A9NL 1MOEA 3C09B 4LP5A 3ILQD 3ZSTA 1PQZA 3C8KA 5HYSG 1JNHA 1HCFX 3SDAC 4LPTA 5T3XD 2X42A 2IEPA 1M71A 1EEQA 4DCQB 3NACL 1QTYT 3STZB 1IC7H 4DKDC 1KCKA 1HKFA 5CJXC 4ZO9A 5EO0B 1DEDA 2AABH 4KJPD 1KPUA 3CU7A 3O8XD 5F8QC 3TO4B 5I6XB 3O9WD 3TNMB 1P4LA 4KHXL 4IRSB 3ULVH 4GBXB 5MERA 1GXEA 2NTFB 1NCCH 3DHMA 3ABZA 4MHHI 3KPSE 5F1NA 4BSVA 5T1MA 4TSAL 1IZKA 2NY6B 3WIFB 1P9MC 1FVEA 3HB3C 2YD9A 3TA3D 5JO5A 3MRQB 3CCHB 2KH2B 2Q7YA 4JN1L 5EZJA 1QZ1A 4NKMA 2R0LH 5TDOA 1ZT7B 4L29A 1CDBA 2C3GA 3UDWC 1F3DJ 2NY5L 3P4MA 1JUFA 1S7UB 4XBPB 4ZPVB 5SWSA 5JDSB 2VLKD 5DHYB 3DLQR 5HHPB 1CLYH 3NA4A 1D9KB 2VE6B 4Y5VA 5A43C 2B0SL 3MCLL 1WC7B 3DMMC 3VWKA 1UH3A 4DGYH 3HZMA 2HG5A 5GSRA 2WUCH 5BS0D 3ARXA 4WWKB 4LQFH 4U1IB 4BJLA 4P2RE 2XRAH 3IFLH 4WI9A 1BOGB 1PYWA 4HIIA 2RIKA 5J8OA 5DQDH 4XTRC 1NAMB 5HDLA 3LEVH 5GS1B 1DE4A 4HPOH 4PJHB 1L9NA 4L4VE 2AJXL 4G6JH 2P5EE 2BK8A 5ETUA 3CUPA 5HPMB 5K9QG 5T3ZL 1OD7A 2UUDK 5F6HJ 5C08A 3FMGH 4LU5L 4O58L 2UVFA 1SVZA 3QWRD 1KXVC 2JB6A 1X5JA 4Y4HD 4AEHH 3S34L 3GSXB 1U3YA 1WCBA 1QSFB 1S3KL 1H0DB 1CWVA 5IR1A 5C0DB 5FKPA 2R8SL 3MRGB 4WGWB 2EDFA 2NR6D 1YEDA 5J06A 3DYOA 4JCLA 5FHAL 3V5HA 1KEGL 1N4XH 3L5IA 1I8MA 4Y0GA 4OI8A 1OF2A 1II4E 3GIVB 3IDGA 5DT1L 5DJAA 1CZ8H 3VXPA 4FP8L 5CP3A 4KRLB 1PDKA 2OTUA 2LV4A 3ZKMD 2PF6A 2ADJA 4N1HB 2X44D 3DX8A 5B38G 3GI9H 3LH2L 5HI5C 3MV01 4OQTA 2HJFB 3VXUA 3P4OB 2Q8AH 3IF1A 4PJ8A 3BP6B 1MJ7H 2VIRB 1CDYA 1OW0A 3NH7H 5L2KA 1CICA 4OZGF 4CADA 2A83A 1KCVH 2AJSH 4G6AC 4JO3H 1MLCB 4QTIL 3TNNA 1N6QL 3D0LA 4GSDH 4GW1A 5IBTH 3BIKA 4M5ZH 5T1KA 3TWCH 1XZ0B 3O6KH 3QJHA 3RDTC 4EI6A 2X4TB 1OAXH 2FBJH 3FB7A 4WO4C 5DQ9A 5I71C 4IJ3C 5JMOC 2DWEA 3MLUL 3IU3A 4G43B 3O3BA 4PRBA 4F7MB 3ULUF 4NCDA 3LKSB 5DFVC 1QSED 4HH9B 2Q76B 2XKUA 1T1ZB 5I17B 3GMNB 4NRYA 1C08A 3ARQA 3KPMB 2X1WL 5BO1L 1I7RA 1VGKA 1MPAL 3OKMB 1S5HA 1F6AB 4Z7WA 1VHPA 4NBYB 1FJ1B 5HHMB 2IALB 4UT9L 4LCIL 5F9JB 3F7PC 4JFDD 3MX0A 1RULH 1K2DA 1EAPB 4OCRH 4XWOC 4RMVA 2IPUK 4QWWD 4PJXB 1XF5B 1MUJB 1DQTA 1IGFL 2HT3C 3FB5A 1YPZA 4BFEA 4KMLB 1RUQH 4XNQA 1KLGB 2N7AA 1JPSH 1OAUH 3DRTB 4ZNCD 4NQVA 2OL3H 3B9DA 3BP7A 4PGJA 4GJTB 2FD6L 5I1KH 4P9MH 2DQIL 3WLBB 4HUXA 2XV6B 4RA3A 3JUZA 4C54A 4AMKL 2NZIA 5IB4A 3QWOB 3VMOA 5SX5K 3UTSD 5BRZE 1UJ3A 5BXFB 1DLHA 1YEKH 4JFFB 1JF1A 4MA7H 1I85A 3E2HC 2BSED 4OZIF 4JY4B 1IGJB 5I8CB 4UU9B 3QP3A 3DROA 4U1HB 5D2NC 4K94L 4ZAKD 3P77A 5DFTA 4ONHB 5F7KC 5E2VL 3VWJD 4ZS7H 2VDRH 1KTKE 1FH5L 4P9HH 1LK2A 3EZ8A 4MNGB 3DX9B 1EMTH 3VFGH 1CLOH 4NRXB 4Q2ZA 1CICD 3TYGH 4H88L 3DUSB 2FHBA 4WTXA 3ARFA 5T1KD 1XIWB 3VXSD 4YX2L 4OZGE 1HWHB 4NQDA 1QHPA 2W0FA 1G6RH 1LE9A 1MRCH 3T0BA 1IC5H 5MI0C 4P46B 4PJGA 5LAXA 3RQ3A 1T03H 2EZ0D 3PP3H 1XGUB 3C5JB 5A2FA 3ULUE 5KVFL 3WYRA 2ARWA 3ARBD 3I6KA 4HJJL 4OAWA 2BC4A 2VN7A 2Z35B 2Q8BL 5ESAB 1JCKA 4PRDA 2AAVA 4MQXC 2EYRB 4WUUA 4IHOA 3E6FA 4OCNC 2E27L 2AEPH 2MCPL 3WDHA 3RKDD 5DS8A 2Q20A 2FX9H 4R26L 2FJGB 4RFNB 5GSVB 4ISVB 5I1AB 1NLDL 4EVNA 1M7XA 3ESUF 2W38A 3X14B 4I48B 5SWZB 4MMXC 5E8OA 1FNLA 4OBSA 2D4FA 5JR1H 2A73B 3TLRA 3SE9L 1CL7I 2BXZA 1TZHA 1EEZA 5I1LA 5JW4N 2Q7NA 2Y5TB 3VD3A 3N06B 1OM3H 4P23C 3SJVD 3MJGX 3CU1A 3UX9B 5FOBA 1U3HB 4X9BA 4OF7A 1T5XA 3IU4L 5F1IA 4OLZH 1IQDA 1NDMB 1BQHA 4OZIE 4WI8A 4XCCL 5IJVB 1AE6H 4Q58C 3O3DA 3QJFA 2YC1A 3L5HA 1I1FA 2V2XA 2C4FU 3O3AB 4A6YH 5DK0B 5CJBA 4PV8B 5D6DA 4OQTL 2EDYA 3RVVC 5E2WH 3O3UN 1HEZB 2ZKHL 2O5ZL 3QISA 4HT1H 3OGCA 4KRPB 1I1AA 4V2CB 5J11C 5DWUL 1LO5A 1FNEA 3STLB 3UAJC 5FGRA 3BVNA 3VCLB 2WBJC 3MRMB 5I19L 1E4XL 2BVPB 1YDPB 4OCSL 4YGVB 5DQJA 4P3WA 2F9BT 2IH3A 3JWDC 2APWA 2V2WB 1XGQA 3MFFA 3W11C 3PWUB 4FZ8L 3QIWC 3DGCR 1MCOH 1W72A 1X5KA 12E8H 4UIMB 3SY0B 4MAYC 3MJ7A 2HMID 3O9WB 2FO4A 3WHE1 4LRIA 4OT1L 5DVKA 1U92A 1Z9SA 4PRNA 1IGIH 2J1KA 4IMKC 2PYFB 3Q2CA 2XWJB 4L9LB 3QEUA 1T20B 5CSZA 4HKJB 2BRRH 4X80L 2V7NB 4GG8A 4JG0L 5I2IA 3TA3B 3WNOA 5CJOL 4G8GE 1MAML 1MCPL 1JFQH 1CDCA 1HHGA 5B3JE 1P4BL 1VKXA 1A7QH 4PJIF 2X05A 3LSOB 3PGCB 2VLKB 2VDQL 5JZ7D 5IMLB 5IJKA 4Y2DA 3WMSA 4D0BA 5IB5A 1BX2B 3IGAB 1G7JA 2CR3A 3RWDA 3QPXL 1K8IA 1TZIB 3ROLA 1P2CA 1NMAL 1Z6JT 3LMJH 2KZWA 1WFNA 2J7LA 1BJMA 4ZXBC 5CAYB 2YKLH 3NA9H 4NNPH 3TP4A 8FABA 5IG7B 5BS0B 2X10A 3PHQB 2HTKD 2HJLA 1QD0A 4I3SL 5FIEA 5KVDH 3GB7A 4TVPD 1C12A 4L3EE 1HHJB 4K3DH 3WHXB 2VDOH 3AU1B 3QPQD 1CTNA 1X6LA 5DTFB 3TBVA 1Q9KB 1J8KA 3VFWA 2QL1A 2D7TL 3MXWL 1S7QB 1WZLA 4PJDB 1I8IB 5F72S 1I3UA 3H7BA 2R69H 3KPSA 5ISZD 1F00I 4I2XB 4E0RA 3C8KB 3UBXG 2IAMC 1JNHB 4PG9B 3H6JA 5JW4M 1FE8L 5C2BL 2H9GA 1M71B 3GMQA 3H3BC 4L8CB 3B9VA 2YRLA 1AQDB 4DVRL 3P11L 3A6BH 1WLHA 4QHNA 3NACH 1R3LA 4KVCL 1KLUA 2B1AH 3GSWA 4YC2C 1KPUB 4EKXA 1P7KB 3EHBC 4HC1A 5KSAC 3TIDA 1ULVA 1P4LB 3ARUA 1RIHL 4P3DB 5MERB 3LAFA 3EO1A 4KPHL 1Y0LA 4NBXB 4KHXH 4JN2A 4HFWA 3VD5A 1DBJL 4P2RA 5BV7H 2IBGA 5F1NB 3RL1B 3DVGB 2QKIA 4YNYB 5JPMA 5C07E 4D8PB 4TSAH 4M6OL 1DQLH 4NKMB 2JK5B 2JJSC 5C09D 2R56H 2K3TA 4L4VA 1X7QA 2GJJA 4JN1H 4RRPA 5SWSB 2J8UF 1D6EA 4M62L 1Q9OB 3O45A 1DZBA 3ARGC 4PJIE 5J3HD 3AM8A 6CGTA 3PGDB 1QSEB 2VDPH 4XZUA 3HZMB 2WQRA 4KKLD 1B4JL 5DRZA 2H2SD 3MCLH 2XZZA 3MUGA 3MUY1 5IMKB 1PVHA 4W4OA 5FGCE 3CK0L 3BAEL 3F7VA 4HIIB 4ZTOL 4Y16C 1JYWA 3REWA 1DLFL 5CLWA 5DJ0B 4QXTA 1DE4B 3MUHL 4FQIH 3REVB 1VEMA 1MCEA 3JV6A 4JE4B 4UDUB 1CF8H 3CUPB 2P5WE 3B43A 5C08B 2AJXH 2ZSVB 1UCTA 2YUZA 3TIEA 4G7VL 3QQ4B 1TXKA 4O58H 3AC0A 4OCMC 4QLRA 1JPFB 3S34H 1TITA 1OTUC 4OLEA 2ADGA 4JFED 3VD7A 1S3KH 5EZLA 4B7IA 1CE6A 2R8SH 3L3JB 3V5HB 3BYYA 3IDJA 3QAZC 3KLHD 1OF2B 4LPYA 5DJAB 5FHAH 3CZJA 4DZBA 4KGJA 1KJVA 1QQDA 3VWJB 2ADJB 3DX8B 3CPLB 3VMPA 1W0VA 2IC2A 4X7FC 3VXUB 3IF1B 3LH2H 4PJ8B 5CJ8A 5L2KB 1CICB 5EUOF 3Q5OA 3D3VD 2DBLL 1T6WA 2XT1B 4GKNB 3TNNB 3BIKB 5T1KB 4QO1A 2Z92A 4H1LG 2P5ED 3VXSB 4QTIH 4QRPE 1N6QH 1T2QH 3DVFA 4EI6B 1XCQA 2BFVL 1B6DA 4L8SA 4MDJA 5I18L 3WN5C 1EIBA 2DWEB 3O3BB 4PRBB 5IK3A 2K1MA 2J8UE 2QV2A 4WHCA 1A6AA 3IXAA 3MLUH 1U6AL 3UYPA 3UP1A 3R0NA 1VGKB 1S5HB 5BRZA 5BO1H 2G5RA 3VG0L 2I9TA 4XCNA 2F5BL 5F7NC 2X9XA 3IJYB 4ORGB 3OKNA 2OI9B 5DD0L 3SCMA 3VFSA 1S9VB 2VLRE 4UT9H 5JHDE 2BY3A 1K2DB 1BBDL 1CGXA 4UNUA 4MVBD 1YECH 2BCKB 4LASL 2E9IA 4K7PL 1HDMB 4JRYE 3FB5B 3VW3L 3RP1A 2NY4D 4U05A 1A3RL 4XNQB 1T04A 4YHNB 3TYFA 4OCWL 2DQHL 4NQVB 4XMKH 4JQXC 1JZ3A 3BP7B 3X12B 2ZSWA 1IC1A 1FBIL 4DN3H 2FH6A 2XXCB 2JF1A 4W6YB 4BQ6A 5HGDA 3MV8D 4GO6B 3VDCA 1D5ZB 5KSBF 5I16B 4R0LC 2DQIH 3IFPB 3BDBA 5K9JL 4OZGA 1UJ3B 3DHJA 4E42A 2R1YA 3U9UA 2EEBA 1RJYA 1V3LA 4RGMB 3E3QE 4EN3A 4M9PA 5FM5O 3DROB 4EI5A 1IT9L 4YHML 2P48B 2XQBL 4F7PA 4BK5A 4FTVE 4UI2A 5TPWL 4K94H 4HC1L 1HHIB 4MJIE 4KK9C 5E8EA 3MRIA 1JNJA 5E2VH 3HFML 2OP4L 1AFVL 4TRPL 4TSBL 1T22A 1JI2A 1FH5H 1L0XA 3AB0C 4E5XA 2ZG3A 1HCVA 3VD4A 1KJ2H 2E7HA 4NRZB 5DVLA 2KZ1B 2IJ0C 3ARFB 3ORJA 4AY0A 2R23A 3H7LA 2H3NA 4H88H 1VFMA 4OKVA 1DVFA 1RZJL 4FXGA 4Z7QF 3WKML 5EUOE 1ACYL 4U1MA 1VSCA 5LJYH 1A6ZA 3FT3A 5C0CD 4YX2H 4KQ4L 2AERT 3L3KA 4PJGB 3OPZL 2PW1A 5D96B 5LAXB 1LEKA 4EIGB 5HHXL 2Y7QB 1CXEA 1ZA3A 2DI8A 4IIQB 2WSKA 3RWCA 2ORBH 5CD5D 1KTLB 2AKRB 4PLOB 4JFOA 2HFGL 1J11A 3I6KB 5HYSA 3V4VL 3QIUC 4OAWB 2BC4B 2VMFA 4HJJH 3BWAB 5IFAH 2YS4A 2GK0A 5C70A 3WSQL 4PB9H 4OZIA 4HSQA 4LGSB 1QLRA 3E6FB 5EPMB 1N6VA 5EU7E 1HWGB 5DEFB 3QUML 4OZFG 1QKZL 2VLJE 5DRNB 1FG9C 4CRPA 2BHZA 3I2CL 3RIAF 5E8OB 1NLDH 3EOBA 4PLJD 4KTDL 4LLYA 4FQCL 1EEZB 5I1LB 1T5WB 3VRIB 1NGPL 1A9EA 3K4ZA 3DARA 3U0TA 1MHCA 3DURA 5KSBE 5F7YC 5FOBB 3NVQA 1T5XB 5K9QI 4MLSA 4Z76A 3BXNA 5ANME 5E4IA 3TN0A 3BD4A 1O0VA 3MLSL 1HYSD 3O3DB 5DJZA 3QJFB 4J3UA 2EO1A 2YPLD 4ZOEA 4X99A 4LDOB 4XCCH 1BPVA 4ZUWA 3SHSA 5DJCA 4HV8B 4G3YH 4XNXL 3AFLA 5DEZA 3OGCB 1I1AB 2ED9A 4I0KA 4OQTH 1ZVSA 4S1SL 1NGYA 5ISZB 2ZKHH 5GIRB 5E00A 5D93B 4O51A 3W0WE 5CIPA 4JZNA 1K9TA 2CD0A 1HHKB 4P5TC 3LKOA 5I1EL 4I77L 1X4ZA 4G8GA 5DQJB 4X7DC 4OD3H 1V3JA 2IH3B 5I19H 3BT2L 5EUKA 4O00A 1MH5B 4Z7QE 2XPGA 3MFFB 4R9HA 2W91A 2EXWD 3BZFB 4IRJA 4CMMA 5C9JA 1J86A 1W72B 2VZVA 5EC2A 4C57C 2NNAA 4FZ8H 3VFMA 2AQ1A 5IKCA 4U0RB 3I75A 2X89A 5DLML 3OF6D 1KENH 3KGRA 1QFWM 3RNQA 3PWLA 4PRNB 4OT1H 4MA8L 5L2JA 3VE0A 1RV6X 2CH8A 2XN9D 4L3EA 4HIHA 4Y1AA 5CSZB 4GMTL 4ZDHB 4R96A 3CVIL 3BP4A 2N4IA 1HHGB 3E6HA 3L7FA 4X80H 4LCCB 3WJJA 4JG0H 2ILLA 1G1CA 3R8QA 1R0AL 4Q6IA 5CJOH 4DWHA 1MAMH 4XVJL 2YEZB 4FMKA 5E8DH 1P4BH 5B38A 3ARPA 4D0BB 5D1ZC 1KIPA 2W07A 3RWDB 4G80B 4C56E 3I84A 4J3XA 2VDQH 1K8IB 4J3TA 1EAJA 3ZHKA 1G7LA 2CKBA 4KI5D 2C7UA 4J12A 1A1OA 2YBRA 3QPXH 4HCRL 1KN2L 1NCTA 5D7KE 4OF0A 1NMAH 4WU7A 3PWVB 4JANB 1FIGH 1V8HA 4HW6A 1AKJA 2AW2A 1D7FA 1C12B 4Q7DA 4I3SH 4OV5A 5K9KB 4GRWH 3RWGA 1KCLA 3NIDF 4LSDA 2FL5A 1FLRL 2P8LA 3VFWB 4NQEE 1ZHBA 4KI1A 4LLVB 1DDHA 1ROWA 2GJZA 4WEBH 4M93B 3S3JA 5BJTB 2QQNL 3H7BB 3ZE1F 1SHMA 5TQ0H 1X6NA 2Z8SA 4KV5E 4MYWB 3MROA 4JDZA 1P6AB 4OZ4A 4M4RA 4DK3A 5KSVB 5HYJA 4X7TB 5DZNA 2HLFC 2PXYA 3MRKB 1GHFH 4MA3A 3G5XA 5B8CA 1FE8H 2DF3A 4I3GA 5C2BH 1E4JA 3QFDA 5J1TC 4UV4L 4PJIA 3HCVA 2ADFL 3LKNB 3WNPA 4UZGA 4MCZB 4Y5YA 2FECI 3P11H 4XXDB 4HMCA 5C92A 3J8F7 1JWMA 3TIDB 3BKYL 4NC1E 2P47B 2ICEA 3S88L 5IBLC 5E95B 2NZ9D 4CVZA 3GRWA 4XXCC 3EO1B 1YUHA 1TPXB 1LVEA 4IMLA 2CDEA 4JN2B 2VXQH 3CNKA 4JLRA 3VXOA 1TCMA 4NUJB 4KPHH 2GAZB 3ZE0F 1L7IL 1D3CA 1HHHB 2ZOLA 2QKIB 3U30C 4LGPB 5HHNA 3SKMA 1DBJH 1V7NL 5IP4A 3K80A 1Z5LA 4F37K 5C0EB 4HXBL 2X6MA 1CLZL 4HKXA 1UXWB 4L4VB 1ETZA 5CEYB 5FFLA 2P5EB 3B2VL 3FJTA 2VWEE 1ZEAL 2HWZL 4G6KL 4QYOA 2P5WA 3HE6C 1ED3A 3PL6D 3DXAD 3QNZB 2WIIA 5D1QC 4BA8A 4RZCB 1H5BB 4ZOBA 3BHBB 3ARWA 2RHEA 5DRZB 3FT4A 3MUGB 4ZO8A 1KCUL 4XMPL 1YNTA 5ACZB 1B4JH 4G8FB 5E2UL 5I0DA 4OQ1A 4HIJA 1MHEA 1HH9A 4M7KL 4GLRH 4G9FE 4KKCC 2XFXB 2P46B 3CZFA 3THML 3RZWA 1IAOA 4NN6C 4K3GA 4G6FB 5GQBA 3KNBA 2VR4A 3CK0H 3RBGA 3SDXE 3ZLQC 2EE2A 4XPBL 4H0HB 4ZTOH 4L8BB 3UPAA 1AR2A 4GRLA 1MCSA 5ICYA 3JV6B 1YYLL 1SYVA 3NIDE 3JWDH 2BHUA 3GK8H 2D7PA 5C07D 1U95A 5EBWB 3TIEB 4APQC 4BQ9A 4O5LL 1RURL 1ZT4A 3ZE1E 5ITBL 3MV8B 2F8VA 1AD0A 4WW1A 1P84J 5J7CC 4QRPA 3RAJL 3O2VL 3GBLA 1LNUB 2W9DL 3Q6GL 2ADGB 3MRCA 4KJWD 4FQXC 3ARVA 5FUCE 5EZLB 2DTSA 4HIEA 3BPNC 2J8UA 1CR9H 4JZOA 4D9LL 3G6AA 5HGAA 4WTWA 3IFOB 1SJXA 5E1AA 3EDKA 1E4WL 5CBEA 3SDDC 3RPKA 2AXGA 2VLRA 4LVNC 1VFOA 4KROD 5GS0C 2E7LC 4ACPA 4FABL 5DRWA 2FIKA 4JRYA 3ZE0E 3GEWB 3LB6D 5GS3A 5IWLC 5DUBA 2VSCA 2DBLH 5KTEL 2OMNA 1TQBB 4PRID 3CSPA 3QUKA 5HGBB 3QDHA 4MDJB 3RNKA 5E6ZA 2BFVH 2HJKB 1A6AB 1BZ7A 1WUNT 1OVZA 5JXED 2JJTC 4JHAL 2CKBL 3KS0J 2CDGB 2V5SA 3ET9F 3FB6A 5BRZB 5CJ5A 2HRPL 2I9TB 2CK0H 4XCNB 3C6LD 2I9LA 3P40A 3MSPA 4O2EA 5CKGA 3VG0H 3ARYA 2F5BH 2WM0A 4M61B 3RVUC 2W9LA 4Z5RB 2B2XL 4FXKA 4L8DA 4WENB 4FTVA 3QXTA 3HE7D 1BBDH 1DJSA 1K5NB 1UEMA 4PJFB 3O6FC 2J8OA 1KIUA 3C5SA 4LASH 4K7PH 5GGTA 1BLNA 1PAMA 3FOLA 4TNWF 4Y4KC 4BKLB 2MKLC 2XA8L 4LSPL 3S37L 4XB7A 4PBXA 1A3RH 2BVQB 3NCJL 5KJRL 4OCWH 2DQFB 2DQHH 2O5YL 1DUZA 5I1IL 1MJ8L 3ARDA 2HN7B 4KRMB 3CLEH 1HSBA 1L6ZA 1ONQB 4QRPD 3O11A 4OZGB 3ZTJH 5I66A 5EUOA 2VQUA 5IFJB 5FV2A 2R1YB 5E1HB 4R2GC 4M02A 3U9UB 3MXVL 1OLZA 5K9JH 3G5ZA 3JTSA 1J9CT 4EN3B 1CDGA 1XCTB 4S10A 3EYVB 3CDYA 4F7PB 2AV7A 3SDAD 4DN4L 1IT9H 4YHMH 5E8EB 3UBXI 2NY0C 4X9GA 5I1HL 3MRIB 4U6TA 4HG4J 4Y8DC 5TPWH 4HC1H 3ULSB 4HGWA 4U1GC 5JHDD 4QY8A 2OP4H 1AFVH 1YZZA 1JHLL 4TSBH 1ZOXA 4JDVB 3V4PL 5J1SC 2R23B 4KXZH 5CMAA 4OKVB 3MA7B 4I18C 4FXGB 4D0CA 4G9DA 3OHXB 4U1MB 1A6ZB 2VLJA 3BW9B 1MLBA 1ACYH 1LEKB 2PW1B 4HBQA 4IRZL 1ZA3B 1TCRB 3ARTA 3HB3D 3Q48A 1SBSL 5J56B 3RWEA 3OPZH 3TH2T 5HHXH 4ODHL 2VB5A 1F4XL 4FFWC 4OD2A 4AIZA 2B20A 5E7FA 4H25A 3UBXA 5KSBA 2FCBA 1U8JB 4MMZC 3O2DL 5ANMA 4M8VA 4OZIB 3HAEB 1QLRB 2XN9B 3C9NA 5KVEH 4MJID 3DMMD 4YZFF 5KN5B 3IDXL 3WSQH 1OARL 1OD9A 4JZJB 1WFOA 4EOWH 5KBNC 3FQTB 5ENWA 4ODUA 4JM2F 1AXIB 5AWNL 2OK0L 3QUMH 4JFYA 2X70A 1YC8A 1WT5C 4HWNA 3O6LL 3I2CH 3EOBB 4IOFC 3L3HA 4KHTL 4UTAL 2J4WH 4PJAA 4LGRB 4XTRD 4LLYB 3W0WA 2F19L 2IMNA 1B90A 4DGVL 1EFXD 4KTDH 2XYCA 3DURB 4FQCH 3VJ6A 1NGPH 3KHOA 3QUYA 2IMMA 3GJFB 4OI9A 3MMEA 5TDNA 5GS0L 4Z76B 3BXNB 5JXAL 3TN0B 2ARJB 3D25A 3CFKA 4OLWH 3QT2A 2BOCB 3MLSH 4YHOL 4WJ5B 1AP2A 3FT2A 3MGTB 4X5XA 4X99B 3LKRA 4FFVC 1LILA 2EDBA 5D72L 3BH8A 3W9EA 4M00A 1Q9LA 3X13A 5DJCB 4CL7A 4WI6A 1IEBA 4BH7A 3RTQC 3QXAA 2CLRA 4XNXH 4UQ3A 2Y07L 3O4LE 4NZUL 4O2FA 43CAA 5IF0A 1DL7H 1TLKA 3OWEA 25C8L 4LLMB 3WD5H 5HI5D 4LLAA 1P1ZB 1T1YA 4XPAL 5EUKB 4QRQA 3CX5K 4I77H 2UUDH 2XPGB 2ERJC 1JE6A 4C56A 4YHLL 2Y1VA 3X3FL 5C9JB 1JYXA 4G6AD 1A14L 1OLLA 1QLFA 2NNAB 5EC2B 3VFMB 3WXWL 1XGPA 2APFA 3RDTD 5BMFL 3BD5A 1RZIB 1Y6NR 2AP2A 4WO4D 3PWLB 4GKOA 2LU7A 5DLMH 3K4DA 1C8PA 5L2JB 4ESKA 5DFVD 3BEVA 3VE0B 3PIQB 3D39D 4EUPG 5E5UB 4L3EB 2Z8WC 5IBUB 5GGVL 3NCCB 3VFOB 3ES6A 2C26A 3F7RA 4RAHA 3L9RA 2BNRD 4NYLA 4GMTH 4YH6A 3E6HB 3VFVA 4YZFE 3P4NB 4N9OB 3CVIH 4NQEA 3LKPB 2YD3A 3O4OC 1NEZB 3OKEA 3U9PL 2VO5A 3M8OH 4XWOD 1A6WL 2BSSA 1R0AH 3PL6B 4XVJH 1KIPB 3DXAB 4PD4K 2HT3D 3KWWA 4KAQL 2CKBB 2C7UB 1A1OB 5CJQL 1RZ7H 4LVHB 1CDJA 1KJ3H 3TC9A 4WU7B 2EH8L 4HCRH 1KN2H 2DQJH 1NCDH 4GLRI 4H1LA 2B8OT 5BV7B 1YEHL 5C0AE 4NWTH 1NGXA 3FTGA 2GSIA 2Z93B 4OV5B 3TGXA 3RWGB 4BFGA 1F3JB 3IKKA 4DAGH 3HKFA 1MCLA 1IAIH 2GUOA 1SJHA 1MIEH 1FLRH 1DDHB 4P48A 2R0WH 5HGGS 4KU1A 1TVDA 2W1NA 1RFDL 3EYQC 3MROB 4JDZB 4OZ4B 5C07B 2QQNH 1FFPA 1ORQA 1F2QA 3BE1H 2YHGA 2QSQA 4XNZC 1KXTB 4MA3B 1QEWA 3EOTL 3GI8L 3QFDB 1PZ5A 2A6DB 5D7JA 4PJIB 4UV4H 5AYQA 5KANI 3R06B 4OGAC 4Y5YB 3SO3B 4PREA 5EO1A 3WXVH 2ADFH 5FA3A 1JWMB 1A4KB 3B9KA 2ICEB 5SX5H 5IB3B 5EC1A 3CMGA 2R2HB 1PKOA 5EU6E 3UPCA 3S88H 2CDEB 4LDLB 4XWGH 5MEND 5FGCB 3QDJE 3L6FA 4G5ZL 3SE4C 3U6RA 4KROB 2X5PA 5FYJL 2E6QA 4XI5D 1L7IH 1MCQA 3SDXA 4HMEA 1Z5LB 3U83A 3NCFB 4F7CB 1V7NH 1IGTA 4YR6A 2C3VA 3BKCL 1ETZB 1UB5A 4HXBH 2DKUA 5A40E 5FXCH 1CLZH 1G7PB 4QYOB 4LMQE 2P5WB 4XP1L 4PRIB 5M7QA 3S8WA 3B2VH 2FGZA 5FYKU 1ZEAH 3UCRA 2HWZH 5CWSA 2WIIB 4MQXD 3FB8B 5TDPB 4KKBC 3HG1E 3UC0L 2BY1A 4OLXL 3QIBA 2VXUL 3IJHA 5HYFA 3SKOB 3FT4B 4GQ9L 2Q6WA 1AGEB 3Q3GB 5C86A 1YNTB 4ODBD 4PRAA 2CIIB 4X6FB 5IV2A 3ILPA 4OD1L 4ZSOE 3WL9A 2JCCF 3C6LB 5D7IF 4HIJB 3CH1A 1KCUH 4XMPH 3WFBL 3ZKXC 4WTZG 3CZFB 4YEFA 3SGDH 1GZPB 4Y7MA 4LSVL 3M17A 3WLWC 4P4KA 2H32B 1A1MA 4GKZA 1H3VA 2Z31C 1JRHH 3GIZL 1WBZA 2GJ6D 3AMLA 4P23D 5EU3B 5I15L 2QEJA 1I3GL 4GW4B 1I3RA 4PTTA 1KUMA 4MD5B 2W65A 3MNZB 1OY3B 3VI4F 3GMMA 1U8MB 3CFJA 1Z3GH 1ZT4B 1FV1A 4PY7A 4WFHE 5LGHL 2ENYA 4HH8A 3RX7A 3VDAA 4TQEL 1VESA 1QFOA 3WO4C 1AD0B 4N5UA 3KLDA 4UNTA 2E7CA 5ITBH 3S97C 2CIKA 4QRPB 3QNYB 2K7PA 3KPNB 4OGXH 4IDJH 4HG4K 5D7JD 3RVVD 3MRCB 4OZFA 5FYKE 3RAJH 3PNWA 2CLVA 3O2VH 2V2TA 1Q94B 2J8UB 2X09A 3Q6GH 3B3IA 4JKLA 4X6DB 3S35X 3UAJD 3G6AB 5HGAB 2WBJD 4XP6L 3PWPD 4NHCL 3SDAB 4XCEA 1BJ1H 4WNQA 1N5AA 4I0PC 3FHAA 2PYED 2A2QT 3I9GL 5CBEB 3C5ZA 4G9FD 7FABH 2K7QA 3RA7L 1E4WH 2AXGB 3W11D 5FDYA 5JHDB 3AREC 3RY5A 1FG2B 3QIWD 3V9FA 5DRWB 1NQBA 5AZ2H 1RUPL 4JRYB 1TVBA 3EKCA 4MAYD 1TVHB 3W5MA 4FABH 3LRHA 5DUBB 5GJTL 5EWIL 4R4BB 5IM7A 2VITA 1JGDA 3QG7L 4KQ3L 1TZGL 2FATL 1K8DA 1R5IA 1WBXA 3QUKB 1SYSA 2CGRL 4J6RL 3KYKL 1DQJA 4DJMA 1BP3B 5KTEH 5M94B 4YDVA 1XF3B 1WIPA 1BZ7B 4P2OC 1Z0MA 4PLNC 1FNAA 4X6CF 4DTGL 4LLQB 5MEPA 1FGVL 1FVCA 1RIUL 4JHAH 4TYUA 5A16A 4H20L 1K4CA 2X4RA 5H37G 2VZOA 4MSWA 4Z77B 4O2EB 4QHMB 3OJMB 3QG6A 15C8L 2BP3A 3MJ9A 5D7IE 4FXKB 3MZGB 4MJIB 1AHWA 3DMMB 2B2XH 4ZXBD 3K74B 2XWTB 4PPTA 2DTML 4NQTA 5GS2H 5IW3A 4WHYG 2XA8H 1DUZB 4LSPH 3S37H 1K4DA 3ARDB 3NCJH 4UAOC 5KJRH 4YLQT 5I1IH 3VI4E 3S5LG 3MV7A 1LEIA 1DQQB 4JVUA 1HSBB 3TT3L 1EERB 1AR1C 1MJ8H 4WV1A 4LEXL 2IQAB 2OR9L 3O11B 5I66B 1NDGB 1EFXB 4JY6A 4PP2A 5C7XL 2NY3C 3GMRB 4U49A 2D7NA 5IIEB 2FSEB 5GGRY 3MCG1 1L0YA 3R4DA 1J1OH 4WGVB 2IAMD 3B4NA 1MJJA 2AV7B 5FYLE 4D0DB 1BD2D 2Z8RA 4HXAH 3ZKSD 4DN4H 1AGBA 4QRSA 2AJVH 5EBMB 1YEIH 4PP1C 5DEGA 2EYTA 4HGWB 5I1HH 3L3GA 5IB2A 3QBTB 5FDWB 4CVWA 5K9OA 5IHZA 4M7ZC 1GOGA 2YD2A 4M6ML 4U3HA 1JHLH 3EHBD 2QADC 5KSAD 1I1YB 1WFTA 5E70A 5CMAB 1CFNA 3V4PH 1CD9B 4G9DB 2J88H 3T2QA 2VR9A 2DKSA 3VH8G 1MLBB 3QUXA 1OB1A 4NGHH 1QR4A 3PV7A 2GKIA 3O41B 3SQOH 1U8IB 4IRZH 3VI3F 4OD2B 4AIZB 1IARB 1KC5L 2MMXA 4H25B 3SQBA 4ODHH 2PNDA 3UBXB 5KSBB 3TZVA 1F4XH 3MREA 4X6CE 3TCXA 2J3SA 4Y4FC 2F8OA 1NCUA 5ILTH 4WO4B 5I71B 3ARGD 3ALXA 5AAMA 3IVKB 5JW5B 4JR9L 3C9NB 4M5YL 3O2DH 1RVFL 5L9DL 3IDXH 5IVOA 1OARH 2BNRB 3OZ9H 2EDEA 4NCC1 4ODUB 2GT9B 4I9WE 4OKDA 3LV3B 3HNSL 4X9FA 4LSTL 2X70B 3F62A 2EIEA 4HHAA 3D85A 3WBDA 2OK0H 3BMWA 3VGBA 5JQHC 4Y16D 4MAUL 1Q38A 5DVMA 3O4LA 3O6LH 1BIIB 4KHTH 2D9CA 4UTAH 2F19H 1U8OA 3QUYB 3EFFB 4DGVH 4R7NA 3FQUA 3MMEB 2R39A 1HN1A 2ITDB 3F7QA 3D25B 3BISA 3CFKB 5GS0H 1R5WA 3QH3A 3H9SD 4YFDB 5JXAH 5F3BA 3EZJB 1IAII 4UT6H 3F7YB 1OTUD 3Q6FA 1B2WL 4LIQH 1V7ML 1PG7X 3E2HB 4TPRL 3OTTA 4X6EA 5H35A 5D72H 4BH7B 1UVQA 4HUKB 3QXAB 4HKBB 5E6IA 4FA8A 4X98A 2DIBA 5JNYA 2ZP0T 5I1DA 5IF0B 43CAB 2Y07H 5JMRA 1RZGB 5FHBL 4Z0XA 2QSCL 5D1XC 25C8H 3MA9L 5E9DE 3T09A 4ETQA 1WAAF 4X4XB 4JM2A 2FJFA 4C56B 5IW1B 2EKJA 1QLFB 4X7SL 1E4KA 1RZKC 4JFHD 1XGPB 4UILL 4YHLH 3X3FH 2IBZY 1ZHNA 1A14H 1BF2A 2I25N 1HH6B 3WXWH 1V3MA 4WI2A 3VI3E 1FYTE 4F57L 4DVBB 1G9EA 4LCYB 5A3IC 5BMFH 2BSRB 2YPKA 4OF3A 1YYML 5C0AA 3MODL 5GPRA 2NW3B 3MJ9L 3SGKA 3U4EA 1EHXA 3ES6B 2VXVL 1WV7T 4Z7VF 5ADOL 1ZLVK 3VXQA 5EOQL 3L9RB 3OKLA 4NYLB 5GGVH 1JYNA 1UM4H 3DOSA 2IBBA 2X4QB 3VFVB 4NQEB 2EH7L 3RUGF 4F2MB 3BQUC 4P5MA 1BFTA 3OKEB 4HWBH 4Y2OA 2BSSB 4FQ1L 3T0EA 5ESVA 3BH9B 2YD1A 4K23L 3U9PH 4QRUA 1A6WH 3KWWB 3UYRH 4DKAA 1JNNL 5D6CA 1OT1A 1HNGA 5JOPD 4GFTB 4KAQH 2Q86B 1O7VA 1U8LB 4LMQI 5CJQH 2A6IA 5EBLB 3GSNB 4H1LB 4LSRL 2EH8H 1VPOL 1BEYH 3FCTA 4P49A 1P53A 3TBTA 2GSIB 2CRMA 1YEHH 3EUUA 1WEJL 5CZVL 4PJHF 5SX4H 1JRHI 1QG3A 1RJZB 3S36X 2EC8A 2AXFA 3AAZA 1QPXA 5EU6A 2GJ6B 1A22B 2GEEA 4N90E 4P23B 2XZCL 3ROOA 1EDQA 1TETL 4KFZC 2J8HA 2FEEL 4KRNA 2EIBA 5KZCD 2NLJA 4HKZA 5KSUA 3QDJA 1KB5A 4AM0B 2F74B 1ORQB 3C60A 4KK9D 4OFKA 4CW1A 1PLGL 4HS3A 4QCIA 4FQHB 4ZFFA 3D1MC 5HJ3A 3UTTE 1KIRA 4J3SA 4V2BA 5E5RB 2R4SL 5F96L 4MA1C 4KWUA 2J5LC 1ZS8A 5D7JB 3OR7A 1EO5A 3GI8H 4U1SB 2QSTA 2VAAB 4HWZA 1CFSA 5DO2C 1WAAE 5J11B 3HG1A 4PREB 5EO1B 1SMOA 2WBJB 4NNYA 2P44B 3B9KB 2PO6A 3S9DB 3TT1L 1PJ9A 3MPCA 5EC1B 3JVGA 2DB8A 3DV6A 1LEGB 3EAKA 5T1LA 4ZSOA 4KZDL 2PYEB 4ZO7A 4G9FB 4PS4L 5FECB 1BF8A 3TESA 3OX8A 3L6FB 3TVMC 3NCEB 1G0XA 1DN0A 1U3ZA 2FX8H 4G5ZH 5EZOL 4H5SA 4L4JA 3RI5F 4NM4H 5FYJH 1IGTB 2C3VB 3QIUD 4Z7VE 4LKXA 5AUMA 1R3HA 3QDGE 3BKCH 5JHLH 5CWSB 3RUGE 4XP1H 1VB9A 4NO0A 5ICXA 3JZ7A 3IJHB 3RVWC 4MWFA 3UC0H 1ZSDB 4FZEL 2Q6WB 3HLAA 2VXUH 5LWYH 4PRAB 5IV2B 3ILPB 5JW3L 5EU4A 4GQ9H 5FO8A 3G6DL 3FFCD 2AI0L 4POZC 1OPGL 4PJXF 5LKNA 4OD1H 4PYGA 3DBXB 4Q0XL 5D8JL 3WFBH 3M17B 5B21A 1A1MB 1LO2H 5FOJA 5IEKA 2VISA 4LSVH 1WBZB 4PJHE 4ZXBB 1DFBL 4NNXB 4GG6A 3MJ8A 1I3RB 3GIZH 3WIIL 4MX7A 5CILL 5IQ9A 2W65B 2R4RL 1I3GH 5I75C 3CFJB 3P9LA 3IDMA 2DM2A 4I4WA 2XA3A 3SGEH 3SE3A 3BZEB 2DQTL 4TQEH 3RWJA 5ICZA 4OZFB 5ALCL 1CGUA 3PF2A 3PNWB 4E41E 2V2TB 3T8XA 1LK3L 3B3IB 2X4OA 4LCWD 1KTRL 1XF2A 3QCUL 2IAMB 4DZ8A 2Y25A 4P5TD 5MEOA 4XCEB 4WNQB 1BD2B 5AD0A 3MGAA 3C5ZB 5F6HI 3P0VL 3CFDA 3I9GH 3W39A 1FZKA 5TFSH 3C2AL 3PHSA 5D7IA 3RA7H 4YHIB 4YC2B 1TVBB 3QRGL 1S7TB 3EYOB 1RUPH 5ID0A 5IM7B 2VITB 1JGDB 4UDTB 1X5AA 3HI6H 3C87A 1K8DB 1R5IB 1WBXB 4GRMB 1SYSB 5GJTH 3QG7H 4KQ3H 1TZGH 4RX4A 2FATH 4YDVB 1VENA 4N5EC 2CGRH 1KFAL 3KYKH 2ITCA 1Y18A 1MNUL 3QI9C 1BFVL 1BAFL 5A16B 4ELKB 4UQ2A 1TJHL 3V52L 4DTGH 3R0MA 3G08B 1K4CB 2X4RB 4YBLC 5HHME 3GKWL 4EZMA 4MSWB 3OKDB 1KPRB 4H20H 3QG6B 4OM0H 5D1ZD 3K1DA 1AIFA 4EXKA 1B3JA 2NY1B 1OGAA 4BM7A 4PJXE 15C8H 1AHWB 4LBEA 2ZUQB 4K9EL 2XTLA 1QLEH 3RVXC 1UM5L 5JTWA 2VSDA 1OP5K 5D9SB 5TQ2L 3EW3B 3BZDA 2DTMH 1KB5L 1H3TA 1K4DB 2WNGA 4Y16B 2ATKA 1LEIB 4NWUL 3KLAA 4EUPA 1HINL 4JDTL 4WV1B 4KK6C 3TT3H 4GT7A 3K2UL 1CXIA 4PP2B 4LEXH 1IE5A 2OR9H 4YFEA 3SBWA 3IRPX 1IM9D 2IH1B 2X9WA 4QHLB 5C7XH 1U58A 2XZQL 5CEZL 1JTTA 5CCKH 4RMWA 1I8KB 3GUTA 3DSNA 3IT8D 2XWBB 1FORL 2HLFD 1NJ9A 1EEYA 3H9SB 1DUYB 1WZMA 1AGBB 4QRSB 4X6CA 5GS2D 2EYTB 4K7PY 1RJCA 4WDIA 1JJUA 2DN7A 4MNGE 5IB2B 3MYZA 5IHZB 2YZ8A 3H9HA 1OQXA 3FN9A 1X5YA 3GMOA 2QLVB 5BQ7A 3HNTL 4M6MH 1CFNB 5IBLD 4OIBA 3ULVC 3TJEL 2AJ3B 1F45A 3ALWA 3NIFF 5F88B 2A6JA 5GHWL 2ZNXA 1PSKL 1PFCA 2DWDA 5LXGH 3NIGE 1F8TL 3L1OH 3W9DA 3VXNB 1Z9LA 5GGQL 1P7QD 2I24N