4FFZA

Crystal structure of denv1-e111 fab fragment bound to denv-1 diii (western pacific-74 strain).
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
YVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Differential Neutralization of DENV-1 Genotypes by an Antibody that Recognizes a Cryptic Epitope.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Immune system/viral protein
molecule keywords Envelope protein E
total genus 12
structure length 97
sequence length 97
chains with identical sequence X
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ffzA00
1URZA 5AAMC 2HG0A 2P5PA 2I69A 2JSFA 3J27A 5B1CA 5KVFE 3UYPB 4UT6A 3VTTA 5KVEE 2JV6A 3J2PA 4FFZA 3C5XA 5IREA 5AAWC 5JHMA 2R29A 3N41F 4AL8C 3N44F 5KVGE 4ALAC 2JQMA 4X42A 5KVDE 5LCVA 4AM0Q 3C6EA 3UZQB 1Z66A 4FFYA 5LBVA 4BZ1A 2ALAA 1OK8A 4GSXA 2R69A 3P54A 2V33A 4UT9A 5H37A 4BZ2A 2H0PA 5GZOA 3N42F 1S6NA 1Z3RA 3IRCA 2GG1A 4GT0A 1RERA 4UTBA 5GZNA 3WE1A 3UAJA 3N40F 1PJWA 3MUUA 5LBSA 3UZEC 4UTAA 5JHLA 5IZ7A 1TG8A 1OANA 3UZVA 1ZTXE 4FG0A 1UZGA 4UTCA 4L5FE 3G7TA 3N43F 1SVBA 1OKEA
chains in the Genus database with same CATH superfamily
2J8OA 1NDTA 5E1QA 1UA6L 4N25A 3Q8FA 5AW2B 4GG6A 4CADB 2VYRE 1FCGA 2ZAIA 1KCUH 3C6LD 1OGAE 4OZHF 4J3VA 4Q9RH 3QR1A 1U4FA 1FL5A 2HLAA 1O7SA 4LZKA 1DE4A 1VACB 1JF1A 5ICYB 4TL5A 3AB0C 3EJQA 1BBJB 4OZGB 3VM7A 1P2CB 4PBWD 3VM5A 1CMOA 3MRRB 4TQPA 4L8BA 5BCAA 3V79C 1JVKA 1S5HB 3NACL 2JKLA 4A2DA 1A6TA 1ZGLM 1ZT1A 2HKFH 4LSRH 1YN7B 2DQUH 4LCUB 1EJ8A 5CCKH 4R90L 3WXWH 4FXGA 4EAEA 2OJEB 2WTRA 4X5LA 3I3EA 4JFEA 2BRQA 4HXAL 1AXTL 2VSMB 5DLLA 4CW1A 1KXVC 3BO8B 3LAFA 2XNAA 3WHXB 3IDIB 3QDJB 4FXKC 2WHVA 4N8VG 4B9CA 3BAEL 2FE0A 1XGUB 4UT6L 3ZE1B 1BXVA 4L3AA 1OL0A 1PLCA 4K23H 4Y9FA 4YK4C 3BIBX 1DEEB 4ZPTB 1U93B 4MS6A 4HJSA 4OF0A 5DHMC 2NNFA 2C26A 2MOVA 4DVRH 1DQMH 1NCIA 1W0YT 3RIAK 3UMNA 3KR3L 3QDMA 4OBRA 3WO4B 4FFZA 4YHML 1IGTA 3FB8A 4NQEA 2E8ZA 2OSLA 3K2UL 2EUWA 3SY0B 5GGRY 3S5LA 3ZDZF 3GZQA 1IAIH 2UY6A 5GHWH 1HJCA 5F89A 3R4DA 4RMRA 2EDMA 3RDJA 3K2MC 3KWUA 3T2OA 4LEOA 5I6MA 1WBZB 4TS6A 5C0AA 5IFJA 3F05A 3SCMA 4X4ZA 2HRPH 3LMJH 4GEIA 5ILTH 2JKSA 4ANXA 3GZKA 4DT2A 4OI9A 1A3QA 5AW8B 1GYWA 2NLJB 4KHXL 3QIWC 1IO4C 2YOAA 4MXQC 2IPUK 1L9MA 4FKKA 4IJTA 5F9AC 4M4PA 3QA3B 5HYJD 3D3VA 3KLKA 1A7OH 2Y7QB 1OB1A 1UATA 4R4FH 4HZLA 1W72A 2ZSVA 4JFVA 3T71A 4E9TA 1KY6A 5KVMC 1PCSA 2O26U 2OMVA 4JRYE 5EU4A 1NCDH 3KXFE 1KDJA 4KTEH 5BQ7A 1H15A 3C6SA 1I1AC 5T5FA 3MSPA 1MCWW 1FC2D 5FOJA 4FI7A 2W8CA 1QLEH 1EUUA 5T3ZD 2H1LM 3VGHA 4JQIA 1KV7A 3UTZA 2D7PA 2FO4A 2VIRA 1S9XB 4WWPA 1AH1A 1ND0A 4N9GA 1YECL 5HDOA 4MJ2A 2Z35A 2AK1H 1R24A 2OULB 1TTRA 2PXYA 4H8PA 4PVMA 4W1TA 2NT0A 2PKDA 1GYCA 4JFHD 3VFGL 1D9KC 2XPGB 3U6RA 3NSFA 2HH0L 5I1LA 1IZJA 4J28A 3OHXC 5TDOA 1A4KB 1A6VL 1DBAH 1I82A 1HCFX 2DQMA 4AC2A 3D25A 5CZKA 1LM8V 2Y25A 4LRIA 4RIRA 3ELAT 3DX3A 2IMNA 4HPYL 1VGEH 1Z5YD 3ATAA 3NK4A 1KB5L 2V33A 2B1HH 2FEEL 4YO0A 3F2LA 5K33A 5CR8A 3S96A 3EYFB 1TJHL 1LDPL 3ASNB 3P0VL 3VXQA 1JOIA 3VD7A 3SD2A 3T04D 1V27A 2F7PA 4UINL 3U36A 3IRZA 3DSFL 3QB7C 4N0FB 4GKSB 3DXAE 5I73B 4B3EA 4ZMYA 2VMCA 2ZCHL 5E8PA 1V5JA 3D6GA 3Q05A 4PBVC 4TOYL 2P5WA 3MOBL 1FP5A 2UZIL 4JO4L 5DQ9B 1FJ1A 4GKZB 4FTVD 4K94H 4GXVL 2G2RA 4UM8A 1G9HA 2J8UE 3FH5A 4KI5F 2WQVA 2Y3NA 3GXTA 5HYJE 3DC0A 2XJKA 2WWOA 4FHBD 4YE4H 3UTTB 2NW3B 1DVFC 3L7FA 3F7KA 4NQDB 2AQNA 2GJJA 3LEYH 2XPGA 1FFOB 3U6RB 3V52H 4FQJH 1NWOA 2MHAA 3NIGE 2J56A 3TZVC 1AZBA 2A9MH 4WWNA 1Q0XL 5E9DD 4GIAA 2V9TA 5IOKA 3B2DC 3BEVB 3SDCC 1VERA 4B95C 2WKOF 4Y4HD 5I0XA 1AIFA 1NTDA 2DMGA 5IESH 3SGEH 2VC2L 2Q9OA 1O6SA 2ZCZA 5CJXA 4XPFH 2HP4A 1I1YA 4NENB 1R33A 3L7FB 3BGFB 4NQDA 2WC7A 3N41B 5TE7L 5FM8A 4D0CA 3AS3A 1Z9SB 4PB0H 1U8NB 3QFJB 3LXCA 4Q89A 1ET5A 4ODHL 4X98B 5F1IB 2VMJA 3BT2H 1TZOA 1X6NA 2P5WB 3BD5A 3HJEA 2F5AH 4Z0BH 3NEEA 2EIBA 3FB7B 4IGBA 4KZDL 3UC0L 1FRGH 3Q1SH 4QRBA 4RWYH 3MREB 1UCBH 4GG6F 1FFTB 3NQIA 2X70B 1RURL 5EPMA 2QKIC 2MCG1 4AC4A 2EC9T 2VH5H 4U49A 1O9ZA 2VB5A 2Y7SA 4MD4B 1UACH 4OLYL 2ZCKL 5EZJB 4FC3E 5HGHA 1VJSA 3AREC 1NGYA 1H3UA 3MLVH 3TYGH 4NQVA 3S97C 4OGYH 4N8VB 4PWJA 3B2XA 3CBRA 1N9PA 3CSYA 4M8VA 2WBJD 5IB4A 3WIHA 3ES6B 4HG4K 1RLBA 2FX7L 3ZXAC 2FSEA 3OLGA 1OY3B 3MJ7B 4HH9A 3IDGB 4LB8A 4UOJA 5DMYA 5CGYD 1EH9A 3IMTA 1QRKA 1UT1A 5FK9B 3T3MF 4DGIH 2OSXA 3T77B 3SE4A 4G8AC 3FU9A 5FYKE 1L6XA 2A6KB 1SF5A 1S5IL 3HRPA 3O3BB 2HLFD 4J3WA 1KJMA 3L5XH 2IXQB 5DJ0A 5HXMA 2HAZA 2K3HA 5JO5B 3DK2A 3G9AB 4HCRA 5BS0B 4N8VA 4K7FA 4MXVF 4JVPA 3DX6A 5EOTA 4BWTA 2JCCF 3SHSA 4KNSA 2OMZA 5CIPA 2VXSH 1F11A 3GHEH 3MRBA 5J11C 5BV7C 1EIBA 1U8OB 2CM6A 5LKNA 4AQAB 4XHJC 1JWMB 2CHDA 4FQCH 2ITDB 4HUXA 3RVUC 4LE8A 4BQCA 5AB0A 5B1BB 5D7HA 4ZOCA 4NFCA 3V0WH 4W9ZA 4FFVD 2ESVB 2B1AH 4PLNC 1R3KB 5ECJE 1QSFB 1YHPA 2Q76A 3VFRB 2APSA 1G0DA 2WSDA 2DH3A 2QDWA 3CXHK 1IFRA 3QUYA 4GT7A 1I8MB 3B2VL 4PRBB 5F7DB 2AJVH 3TBSB 1EEQA 3W9EB 3BISA 3N1QC 2X2IA 3QJTB 2AXHA 5C6WH 3G6DL 2DM3A 2WD0A 3G5XB 5E2WH 5CEXB 3KPOA 5F1NB 3C9NA 2J6EA 2NX5D 3OSKA 5C0AD 4I0CC 2LAAA 4ES9A 1V7NL 2C9RA 4FQ2H 3KD4A 4M7KL 4GXUN 1I9RH 1JYXA 1N3NB 1NM9A 1E43A 3QK0A 2CE6A 2AJ3A 4IBTA 2PXYB 3TEWA 4WHDA 1S9VB 1SXNA 2Y5EA 1TKWA 3D50A 1TJMA 3IFOB 5F9OH 1G1CA 4BV1A 5HDBB 5DK0A 2GK0B 3M6DA 3HN3A 3RTQD 5C7XL 3B9KC 3V6FA 5A6IA 1H3PL 3HW7A 1OAQL 1WEJH 4V33A 5FYKU 3UGUA 4U0QB 5I1IH 1GY2A 4JN1L 2AK1L 2CUIA 4PY7B 3MCKA 5DEFB 2W9EH 1E9OA 1NBVH 5J7CC 4AQ1A 2J6WA 2N1TE 1L7TH 2BHFA 1BJ8A 4JO2L 2WLLA 3BP4A 5KSAD 1M57B 4IS6A 4FG4A 4G7YH 3B9AA 4M3KB 4A1RA 4HUVB 3HZVB 3KPLA 4YN3A 2DD8H 3LZNA 5ESVA 4IOFC 1G7PA 1ADWA 4EQ2A 3ZE0F 3CFNA 2L7JA 3DVNA 5J6SA 4JRFA 4MMZC 5AWNH 5E2TH 1XCQA 2IQAA 1DJIA 1DBKL 3PAZA 4MWFA 4F57L 4AYBA 4CSZA 4UDTB 2VDPL 4YDIL 1UD4A 3TEZA 3SOBL 4EZMA 1WC7A 3PWNB 5AKSA 4NBZB 4DPAX 1S7VA 4YLCA 2E76C 4XP6H 2JH2A 5DK2A 1JPFA 1Y18B 4O2CB 3KVPA 4K5LA 3MX0B 3IETB 4EIBA 2FB4L 3M17A 4JDZA 5H94A 1OCOB 4GIPD 5HTSA 4XBMA 3U79A 2FK9A 2I07B 1BQRA 4TSCL 4TTDC 1QFUH 3VG0L 1OPGL 3PWPA 1HILA 3ZTJG 4TOYH 4LEOB 4M48H 3ZRSA 4B9KC 1EHNA 3LJ3A 5DJ2B 4M9PA 3P3YA 5F0MB 1JYWA 4MA1B 2J2ZB 1SDYA 3CU7A 1BZQK 3R4RA 5HJ3B 3ATDA 4L37B 5F1OB 3INOA 5DHEA 4OGXL 4CA4A 1NMCC 4IM8A 5C6PB 1K5WA 5JOPE 2X3AA 1VKXA 2DQDH 3FHEA 4E42B 4DZBB 5IVNA 2QZQA 2X89D 4NUQA 3HMWH 3EDFA 1LJMA 5D5MB 2WWMC 4CNIA 2H4EA 2O5NA 1U93A 4IIQA 3ULUE 3GDCA 1Z9NA 1CFSB 1QO3B 3T0ED 4IKJA 2D8KA 2AVFA 3SPCA 1S7UB 1ASPA 5FV1L 1UXWB 4QI3A 1HHGB 1OP4A 1NFDA 2ENQA 2Z91B 5GJTL 4EDXA 4ZX3A 4PW9A 2EP6A 2YPVL 3WHXA 5L2KA 1QLFB 3L17A 5GS1C 1B0RA 2FRGP 4PJGB 3ZO9A 2AS5M 1UM4H 3SE8L 1EWHA 1OO2A 1P7KA 2XXCB 4PB0L 3IU4H 4HWBL 3VXTB 1EDQA 3WLBB 5TGBA 3OLDA 1G43A 3H9SA 2JI1A 4R8WL 3HE7B 4IIQB 1U92B 3CFEA 3OR6B 4LVNB 2A83A 3WTTA 5FYJD 2CJUL 3APCA 2ZCLL 3HZMB 3OZ9L 4FQIH 2W80C 1FRGL 3JUYA 5KTEH 4MXQD 3GKWH 3SDXE 5KBKA 3FQ1A 3GMLB 5FA4A 3ERXA 4P07A 5EUOF 3AU1A 1KB9K 2HFEA 2EC8A 1QKZH 2QT6A 2JXMA 4MNQB 2YKLH 1CXEA 1ONQA 4K8RC 1Y6MR 3AG4B 1XAKA 3BH9A 1ZTXL 3PRZA 1P4BL 3MA7A 3QORA 4JPKL 3HR6A 3N91A 5EULV 5I1EL 1J9RA 4OV5B 2LGNA 4ZX5A 4ZTEA 2NUPB 4NHCH 3WUWB 1PAMA 4M4RB 1AO7A 1KB9J 2MWCA 2OX5B 3IFNH 3OC8A 5EB9A 1TYEB 5FUZH 3RVTD 3ARDC 3ECVA 2OAAA 3PU7A 2KLTA 1KXQE 3QG7H 4JMNA 4U6HA 4JRXA 4OIIL 1I3GH 4QRSB 3AWEA 2YWZA 3WG7B 3KYNA 4A7TA 1JG9A 4UV4L 3UJIL 4LL1A 5LAXA 4UTAH 1OTSD 4C4BA 4Z7WE 2R56H 3AMKA 4JHBA 4R96A 3JV0A 4PJ5B 3A67L 4PJIA 4XO9A 5GGQL 1I8IB 1UA3A 2W0KA 3DOIA 1RSFA 1ES0B 1SJEB 3QPXL 4QRQB 5EU7C 2JTDA 4QLWA 3TF4A 3BZDA 4HDIA 5DD3L 4F80A 1W9XA 4XPBH 1QFHA 4FQCL 4GMSL 2Y7MA 3HG1E 2IDQA 5FGRA 4WWKB 4WLCA 2JB5H 3P30H 3MCKB 4H25B 3A24A 4DKFH 2YPLA 4KVCL 2ZKHL 1AGDB 4C58B 1XGRB 1E6JH 1R3LA 4WTZG 4KY1L 5FUOH 2C9VA 3BH8B 3ZMNA 5JPMC 4IOIB 5TH2B 4CVZA 1CFBA 1JK9B 1WIUA 2YJQA 4QMEA 1BV8A 5AVUB 4YDKH 1IGYB 1FLTX 4PV8B 2X0UA 4JZJC 5HY9A 3CIQA 1SDDA 1GHFL 1HXMA 3S88L 1LO3H 4OR1A 2WV3A 3VXOA 2WBJA 4PGZA 3PIQB 4BWWA 4FA6A 3QUMA 3D52A 3NEOA 1G7HB 4U1NA 3U0PA 4HJGA 4EBQL 3U2JA 1T6BX 1A9BB 4E9LA 2W0FB 1O0VA 4Z7OF 5HYFA 4WFFD 4FQXA 3B9VA 4DP4X 1QSEA 1ZJAA 2C3HA 4PLKC 4PRDB 4HC1H 3WTUA 4DGVH 3AITA 4U1GC 1A2YA 2WBWB 6PAZA 2FH8A 3WSQL 2BNRD 2E7DA 1DSFL 4K7FB 4PD4J 4BK8A 5C2UB 2UZXB 4G7VL 3QO0A 3L5IA 2UXVA 2BSCA 4DZBA 1FFPB 3P4NB 4MB5A 4Z7UB 4N0YH 4YDVB 3VSTA 2M26A 5J3HD 4O51A 2CAKA 4WI6A 5DTFA 3FS9A 4YDIH 5HVGB 2F74A 2VDRL 1XCXA 1U95B 5I0ZA 2V9RA 1HT6A 3UIZA 2V17L 4LNRA 4G3YH 1QACA 1DZ0A 2ICWI 5FHAH 3HG1B 4HIPA 5BZWB 1L5GB 4F15C 1UHVA 1MHHB 1QX1A 1QQDB 3ARFD 3RBSA 2DLEA 1F4WL 3D07A 4GAGL 4NM4L 3ZMRA 1PQZA 3S6CA 4EIGB 3BZEB 2VERN 3VYPA 1UXLA 1AR1D 3KDMA 2QQQA 2APWA 3LPGA 3VGBA 1QTPA 2Z8VC 2UWEB 4U6YA 1WFNA 4I9XA 4HLZH 3FSAA 4G42B 4UZSA 3HBGA 4AQ8C 3VFUA 4MD4A 5EZJA 3NJLA 5HGHB 1KGIA 4UTCA 1X9RA 3S8FB 4E36A 2KZWA 2IBBA 3UFIA 2CLVA 2EIMB 4RBPH 3HC3L 1DSYA 1T66C 5D2NB 3B9KA 1FL3A 4WO4D 2ZPKL 2CLRB 3IXTA 4LSPL 1QR1A 4QHKJ 2DEXX 4Z78A 2NZIA 3LQAC 1AOHA 2YAMA 3ZE2F 4JDVB 3BAYA 2WLLB 3BP4B 5JTWA 2ZG1A 4J39A 2CD0A 1ETZA 4PWKA 3VW3H 4J4PC 4LOEA 3ZKMD 1U8QA 4IMKA 1AGBA 2X4NA 4P48A 3FO2B 2B0SH 3AWGA 4YSRA 2YPVH 3WIHL 4WIQA 3KPSA 1RK1A 3UG4A 4KKLD 3GUTA 1T5WB 2RGSA 3EJRA 3IFPA 3SY6A 5DHYB 1LEIA 3KPPA 2WYHA 3FYEB 3FB5B 4JPWH 4YFDB 1LD9A 5EV7A 3L7EB 1ECYA 2JQAA 1L3WA 4WJG3 1XH3A 1U8CB 2Z4QA 2WXJA 1TQUA 2HMIC 1LP9E 1W0VB 2ENYA 2JI2A 2QBWA 5FO7B 5DVMA 1G9MH 1FGVH 1C5BH 1HIML 4WV1C 3WTSA 3FQNA 2HUEA 4NPKA 1MUJA 2YUZA 5FW8A 5CEYB 2ICES 3VACA 2VDQB 3AJ7A 4H8WH 5DR5H 1ODUA 5HYEA 4MASA 3D18A 3LNFA 1ZHLA 4IBYA 4PRBA 4YHMH 4LAQL 4PN6A 2RCSH 3BKJH 5ERWB 4EZJA 3ALWA 2EDWA 1HQRB 5FCUH 5MEQA 4PFEA 2DQUL 3H54A 3FCSB 2ZUQC 4ZS7H 3K4AA 5FYLE 1SEQH 2G60H 4HS3A 3NZHH 4BGDA 2DQTL 4Q58C 1Q38A 4UQCA 4M1DH 1B3JA 4LKCB 4X8JB 1AG6A 3L16A 4C8XA 1JYNA 4ANWA 1CLYL 3PWUB 4H8WC 4HIXL 4A38A 3K5SA 3DRQB 4L3EE 4MNHA 3D2UD 3KBPA 3HZYB 1NIEA 4LNVA 5JO5A 4U1GB 3GFUA 5F1KC 3BKMH 5IVOA 1E5YA 3C87A 1Y6KR 3D05A 4PB9H 3RGHA 1M1XB 2MEJB 4OM1H 2B9AA 3STBA 3U4KA 5JQ6H 1B9KA 3VWKB 4ECNA 3GD1C 2FL5B 4HV8A 2F68X 1N4XH 5EF0A 4OZFG 3INUL 1P1ZA 1ORQB 2QEJA 3L1FA 4OCWL 1NQBA 5DUPL 3VCLA 1HXKA 4X6FA 3KGRA 2H3NA 1BOGA 3MNVA 5F21B 3W1ZA 3VI3F 4GMSH 1AO7D 2QKIB 2UXFA 4YHOL 3UZVA 1PZCA 4KMTL 5EO0B 5I76B 4GAAA 1NCDL 4XNUH 1UENA 4WVRA 2XCMC 4AIZB 2EVIA 2NX5B 3QJVB 4L0PB 2VABB 1KCUL 1FNEB 4QYOA 1QP1A 1OTUD 2ITCA 4S1DD 1GAFH 4WY7H 2JE8A 1JDCA 4FQXC 3WL9A 4W93A 5D7LD 3LMJL 1DUZA 4X6CB 1HX0A 4DP2X 3C12A 4JRLA 3E6HA 1U3NA 5A7EA 1UJ3A 2F1AA 3FHAA 1FFRA 4ZZFA 3RAJH 3VFSB 2W0FA 2FZ3B 1CC3A 2OXGB 2YEVB 4OB5H 4O4YL 4YGVB 4ISVA 4R2GD 3RUGB 4CKQA 4AZ8B 1CGSH 3ARDB 1U91B 2KL6A 3CFBB 1QA9B 2CLVB 3MMEB 4JZJA 1NFDE 4PWIA 3QFDB 4GW5A 5I1AA 4XPTL 5A2FA 1T21B 2B4CH 5IB3A 4N4YB 1A1NB 4HUUB 1BG1A 4BK5C 5SWZE 4X5WB 4K7PX 5FXCH 2A6IA 4TVSa 3RWEB 3DUUA 4UIMA 1MCLA 4N26A 1BVZA 1F3JB 1IB5A 3AGWA 4FJZA 3G04B 3SB3A 2VZ3A 3SIKA 3T2QA 3BDYH 1PZ3A 2CO1A 3TIDA 4UT9L 4AJ0A 5JIMA 1BECA 4AVHA 5EO0A 3LHPH 1HYSC 1TCMA 1L5GA 2XVGA 4LPYA 2YSSA 2AW2A 4OH2A 4Y2OA 2WB1A 5F1SA 4NQEB 1M3IA 3D0AA 4GRWF 1UURA 3RA7L 4KHTL 1OGAB 1T2QH 1U8LB 2QADD 2FEDC 4ABWA 4WWOA 3SY0A 2DLTA 3TT1L 2BVPB 1JTPA 2ZYSA 3CZFA 3BFOA 3IN2A 3NRQA 5D7JD 4MA3B 3WEBA 4OU3A 4XX1G 4ODSH 1JXJA 1X9QA 1YUKB 4YSTA 2C7UA 3MI6A 5J56B 5GRYA 5C0IA 3O6FA 2AF2A 5DQDL 2C7FA 1DBAL 5D2LF 4XNXL 1TSRA 1FSKB 1F18A 5ID1B 4G9DB 2FEJA 1GJWA 4YWGH 1IIIA 4F1SA 5A6LA 3NIFE 4LPVA 4NPJA 5GRJL 1YMMA 4LAJH 1F86A 5I26A 1DBBL 3T2LA 3ZT7A 2F8VA 4OF3A 1CFTA 4FCAA 5I0WA 3VWJA 1K4CB 1ZEAL 4D0DA 5MEQB 1YEEL 5CGYC 2ZP8A 3QDMD 2K7QA 2GTWB 2P52A 1D9KB 4OSUL 2FQDA 4NNYA 5FFGA 2PNDA 2V3EA 4EI0A 4J2XA 2ZCHH 1F2QA 1XGPA 3HCVA 3ZZQA 4WNQA 4NI3A 2YQ2A 3RB7A 3UCQA 5IV2B 1YNLL 4N0UB 3HS8A 1ZA6B 4IYKA 3MRJA 1HSAA 5EU3B 1IGYA 3GSWA 3OZLA 3CVDA 1I1AA 4MQTB 1R3JB 2G5UA 3ISWA 1INDL 4KY2A 1L9PA 2MQGA 5TDOB 4DK3A 1M7IA 3GHBH 1H8LA 3JTTA 4EVNA 3ISYA 2HLAB 2Z4QB 5C0FB 3SDDA 3AFLA 3MJ9A 4V1DB 1UH3A 4MVBD 5CKGA 3IDGA 4NOFA 4X5QA 2K9FB 3HHSA 2BJMH 3DROA 1FFPA 1YECH 3P4NA 1HXYA 1UCBL 5FO8A 4NNXB 3I3BA 3T1FA 3G5ZB 5DJYB 3O3AB 2HT3D 4QKXB 1F1AA 2Q20A 4OD1L 1HQ4B 3SBRA 4GUPA 4OZHA 3ZIMA 2FGWL 4MJ6A 2K70A 3ARGC 2A73B 1UUNA 4PGBB 3RWIA 3HIZA 1UKTA 5T33L 5DS8A 3RZCC 4LCWB 3IJHB 5ICZA 2WY3B 3II1A 3S37X 4H5SB 2EACA 3V5KB 1IBGH 4ZMAT 5A3ID 3UBGA 5D4QA 1GPOL 2BXZA 4QXUH 1RIHH 2EE2A 5AKVA 2EAEA 4NZ8A 1BMZA 4WTXA 3FRPB 2FQEA 3AXLA 4XMUA 3TN0A 3ESNA 4LVOB 5HYSB 5T1LB 1VFMA 3IMWA 3NIFB 2AK4B 3VD2A 3U48A 3X3GL 1JGVH 4F8OA 2PTUA 1UYWH 2XWXA 5ECGA 2NW2A 2NLJA 4M1DL 3SYPA 5KS9F 1H9VA 2VH5L 4XC3H 3KL3A 3QULB 3GI8L 1RZKH 2KUTA 2UY6B 4IBLT 3QXAB 3K46A 1DLFH 3TYGL 2Y69B 4KXDA 4ACTA 2CA4A 2QKIA 1MG3C 4LHUB 4FNQA 3H7BA 2EH8L 3Q3GA 1DDHA 3BXNA 2KYIA 1WBXB 3Q44A 3TV8A 3WE1A 3KCPA 3ZTDC 3CE1A 4MRCA 1JGDB 1SXCA 1Z9OA 3EJUA 5EZLA 3QH3B 3DO3A 4TRPL 4YBHA 1DO6A 5BVJB 3TJHC 1YYCA 5IMMA 4KMTH 4ZSOB 3WNJA 3V5KA 2FUTA 5E8EA 1MJUL 2XQBH 2DI7A 2MTAA 4I4WA 1RZJH 1LO5B 1WD9A 4FQLH 4HUWA 4HULB 4ICWA 1Z3GL 4Q6YA 4JJOA 1KLUB 2CH8A 3O2DA 4Z8FH 3V6OC 4N5EC 4ZFZB 1GSMA 4GSDH 2HB0A 3HPJA 4P23C 3MRPB 3L3HB 4KK6D 4PHZA 4FS0A 3UYPB 1SMAA 2TSBA 4KJYB 3PP4H 1H3PH 2NY6C 5KWYC 3MUZ1 4Z5RB 3W3BA 4ZK8A 4KO6A 4OB5L 5HD8C 1G9EA 2K6WA 3Q43A 4ZAKC 3A22A 3BWZA 2OSYA 4NT6A 3SKMA 1RHHB 43CAA 3FO0L 4V2BA 3BH9B 3QORB 2CGYA 1TQCB 1PLGH 1GGIH 1EJOL 4KZ0A 2AJ3B 3KW8A 4A6YL 2QMKA 3EXLA 2V9QA 2G0LA 3SKOB 3GK8H 4N2AA 3OWEA 4Z3IA 1QEWB 1ZHKA 3LDBC 3MUY1 4NKMB 2XRAL 3O4LA 3HFFA 4GFTB 4RGMB 4NUGH 5E00B 4LHJB 4L1TA 2APFA 1A7RL 2QQKH 4UV7L 3NGBB 4F7PB 2AK4D 4PR5A 4ZW8A 2Q6WA 2QSCH 4FXKA 3EGXB 4U2ZA 3HVNA 3OD3A 4H25A 4L0YA 3SKMB 3DX4A 5H37A 1MLCA 5C08D 3HUJE 3QARA 3RFZA 3PLYA 4QRRA 1O5DT 4GUCA 4ZBJA 5LGHL 3QC5X 2ADYA 1SYVA 4HHAA 1D6EA 5JPMB 1HC1A 4HUXB 3TA3D 4AW7A 3LH9A 1LTXA 5T3XD 5J6GB 1Q9OA 3A6OA 1E5BA 1S7UA 2CKBB 2AC0A 3DXAA 4Z76A 4XVUD 4BINA 4DHLA 1KBVA 1IUZA 3DX8A 2G5BB 1LEGB 2GJ6D 4K5PA 5JW5A 1SM3L 3UZQA 3QJOA 2IDTA 2DQDL 4Y4FA 4UT7L 5T1KD 2Y7QA 2HJFB 4P5RA 3GWJA 1ZAGA 3G3LA 2CIKB 3FT1A 3A4EA 3L9EA 2K8MA 3RNKB 3DVIA 2DYRB 3RX9A 3KBEA 2P24A 4PJFB 2XG5A 3RKPA 1INQA 1DP0A 3ZDXE 4QRPD 3JWOH 2ATPA 1JZ6A 4NP4H 5DK0B 4R9HA 1A65A 1RJZB 3IGFA 4NKOB 3OAUL 5LBSL 1KFAH 2B59B 35C8L 1QFUL 3RP1A 1OPGH 3RRQA 3CZLA 5F9WB 1AY1L 4WEEA 2OL3L 3LQAL 4XC1L 3OSVA 3EDKA 3QULA 3RWEA 4ICXA 4NNPL 5LB1A 1XVSA 1F6FB 5AW6B 5JOFA 1NUNB 2YS4A 5B4MD 3AS2A 2X6UA 3QEQD 5AB2A 4O51B 1X7QA 1KJ2B 3FU3A 5ABDE 4LOFA 1D9KD 5CBEA 1RIUL 3KGUA 2NY2D 3CFEB 1IC5L 5GIRB 4B5ZA 1UA6H 3KH3A 5BZZA 3HHMA 3WFDL 2KPNA 4DIXA 2FTAA 1FYHB 5F1IA 5KVEH 2MPAH 1EXGA 5CN3A 2ARJQ 5C0DA 3B7UX 3VFNB 5JW3H 4ZX6A 3GRBA 5I5MA 3WS3B 1LO0L 2Q10A 3A3YB 2FJUB 3FONB 5DU7A 5BZXA 2VOTA 5GJTH 1NSNL 1KCSL 1SF3A 3ESUF 4FYTA 1ADQH 3AQYA 4FL4C 1A6AA 1BAFH 2CJ3A 4HS8L 4Z95L 3UO1H 1OHZA 3V6FB 3S3CB 3N42B 1OTTC 1ZSDA 4YHNA 3GSRA 1UWEH 3SE9H 1VA9A 3NA9H 4OQTH 2MNUA 3SDDD 1NCWH 5CWSB 3D85B 4HS6A 1BBJA 4OZGA 4J4PD 1MCHA 1JUFB 4TSCH 3VG0H 3VU2A 3BVNB 5IG7A 1FFNB 3D5OF 2ZG2A 2VN4A 4WNQB 1FL6B 3GBMH 3UPCA 4HEPG 1QKZL 5DFAA 5IQMA 1HSAB 3HZYA 4JR9H 2NY1B 2E47A 3B83A 2PPEA 3ML8A 1G7MB 3RWFB 3KPRA 1PD6A 1EHAA 3TTYA 2XZCL 8FABB 2ZOWA 1CGXA 5JHAA 1NA8A 4WUUD 3BGAA 3PNWB 5EIVA 3RNQB 4WSJA 3D39A 4UOZA 1MXGA 1FBIL 4AQAA 2OA9A 3OHXB 3KAAA 1E6JL 3RVVD 3OKKB 4FQ1H 3I6KA 3VXQB 3UP1A 5D93B 3WKYA 1KLUA 5HDRA 2XN2A 4OCSL 2YA2A 3RGBA 4HGWB 3SQOH 1AJ7H 4HKXB 1NMBH 1VFBA 3LTVA 5C0CE 2XWCA 4IMLB 3MROA 3KYKH 1U8NA 4IBVA 3KCWA 4GFXA 4YXKH 4LOUC 2VM4A 1PVHA 2XA8L 4RGND 4E41E 3TWYA 4EE2A 1G7LB 4YE0A 5AYUL 3RL2A 1KF9B 5CJOL 3T2PA 3OAYK 5J06A 4ZNEE 2JCCE 4FFYH 4KXCA 2R1WA 3TZVA 5ALBH 4KXZI 3MO1A 1YLBB 1KEGL 5F7KC 4PJEB 4LRNL 3VXUB 5J1SC 2HRLA 4L4JA 4OCXH 4Q6IA 1LE5B 4OV5A 3Q3GB 4QTIH 4TNFA 1YEHH 1QPKA 4Y4KB 1CG9A 3TBTA 1TZHB 1LO4L 1VSCA 4KVCH 3RWDA 5DEGA 5KSVA 1WV7T 3OB0K 2RA1A 4FQIL 3C09B 5T3ZE 1PIFA 4NQVB 3EKCA 3GSVB 4GW1B 4P3CH 3VI4E 3CAFA 4AMKL 4IQHA 2BO0A 3E3QC 1ROCA 3OKEB 5CEXA 2YD3A 1MFUA 3NJHA 1TJIL 3FQ2A 5FA3B 3MDJA 1AOZA 3MREA 1UKSA 1CXFA 4YPJA 3VI4F 2YWYA 4JPKH 3L5WA 3T0VA 2BP8A 4B60A 4P59H 4I1PA 1DVZA 2F53E 3IDNA 3CLEL 3SPIA 2JJVA 5D4HA 1U4EA 2FR4B 2A38A 1A4CA 4FG0A 5AW4B 3QHZL 4NIKB 1HEHC 5HVHC 1S78D 4RSVA 1RZFH 4GRWE 2FLMA 4S0SD 3PGFL 2FBRA 3QAZB 1WH0A 1JYVA 3UBXI 3LPOA 3QE5A 3QAQA 5I1GH 1E4HA 5B8CC 4PRPE 4FQQB 5DJAB 4RRPA 2EXSA 4PGCA 4N2LA 2ITCB 4MNQD 1XIWD 3W81A 3OKEA 5AVXB 1U3HD 5KBNC 1F58H 1AZNA 1TPXB 2OMUB 4WI0B 2CO6A 4QJ3B 3WN5B 3SDAD 3KM1A 3RVWD 2ADFH 3UH8A 3DETC 4HJJL 4G8GD 4Y4KA 5CCGE 3ECUA 3MRLA 2QGBA 4TVPD 3MLTA 5I6OA 2OFQA 3UTSE 32C2B 5IBTH 4Y2NA 3MV7E 1CLCA 1IAOB 3GMPB 5DD6B 4XI5D 5C08A 1EGJH 3KBHE 3MYJA 2D3VA 2EYTA 3US9A 3BT0A 1G1YA 2DMKA 3RTQC 4GG6E 4PJGF 1TFHA 3HLAA 3T8MA 2CUHA 3JTTB 1A6WH 1JHKL 2VUKA 4FGMA 3I84A 3MJ7A 3C6EA 5DMKA 5CMAB 2W88A 2OTWB 2P8LA 4NO2A 4ZUVB 5GGRB 1SHSA 4G3YL 4LLVB 5E6IA 4LVEA 2NXYB 2G4EA 5FUOL 3RY6A 4JPIB 3ULUL 4HWZA 4N2EA 2VLJD 5FAAA 2TSAA 3MUJA 1GR7A 4HPOL 3R06A 5L4MA 2BSRA 4P5MB 1R1CA 2HG0A 2GJ6A 1TTBA 4LGPB 5BQ7B 3PGCB 3BKCL 4YEEA 5TJWK 3F8UB 3QORD 3QYCA 3VH8A 2NY6D 2FWUA 5I6NA 3PNWA 1RIUH 1E5CA 4RCAA 3JQOB 2DWEB 3JUZA 1CK0H 1OB1B 4CSSA 2KHAA 5KVGL 1ICTA 2BNQD 4Z7WB 1A6VH 1S5HA 4YHLL 1A6ZB 3FQNB 3V4UL 3P3TA 4M7JH 5CEZD 1EVTC 3GSXA 3V4VL 3QRFM 1MUJB 1JN6B 5CEYA 4Z0XB 3HZ3A 4M6NH 4FLQA 3EGDB 2OTPA 1QBML 5KVEE 3WSQH 4ZOBA 3CCHB 5DD1L 2W5PA 4AQEB 3K81A 2EDBA 2FBOJ 4NP9A 1DJZA 5JHMA 3CHRA 2QVKA 3WYRA 1CVSC 2P8MB 4JRXD 1OGAA 4OUUB 2B0SL 3ROLB 1SBSL 1CT8B 2WSPA 2YD6A 4URKA 5KBMA 4JX0A 2VE6A 4PGDB 4ZS7L 4BXVA 3BQUB 4HGMA 3RPIB 5KBDA 1R47A 1JZ3A 1ND0B 2A4CA 4XB7A 4RZCA 4EEEA 5L0QB 4JGUA 1BYOA 3HI6L 5B7FA 1R5VA 2FJGB 5JMRA 1Z9MA 5C6TH 4NRXA 3IGAA 1DVXA 4N5ED 5D70L 2IAMB 5CZXC 4XOCA 3MXVL 3NAAL 1E8WA 4G7QB 1P53A 3JTSA 4PJHF 1IGIH 3WEOA 1YDPA 4ADIA 2G3XA 4FZ8L 1OB0A 5C70A 5D7KD 3R8QA 2V4LA 3U4BH 2ZX8A 3PUCA 4MCZB 2YAQA 3F7PC 5DJ8A 5DJXB 3CFJB 4LCYB 4PJXB 2QELA 1G6RB 4WUKL 2XVBA 3IJEA 3OJ2C 1HZLA 3AMLA 4NRYA 4NI6A 2WVTA 3SPJA 2VDOB 4DEWA 2GFBA 2ZOKA 4UQ2B 1OZUA 3HUJA 5DUPH 1Z7JA 1JNHB 5EO1B 1GJUA 5I15H 1W72L 5GZNA 2BP8B 1R9FA 4JZOA 1NIFA 4MA7H 4Y16A 3MA9L 4Z3GA 3ARVA 1IZKA 1IVTA 2CM5A 3HBQA 5C0CB 2L7QA 3BQUC 3DSFH 4I0KA 2IDFA 4LVHC 3OR7B 4M5ZH 4ZMZA 2DQTH 3QI9D 1SFDA 4LSPH 1XSOA 4MNGA 1MSPA 1BVNT 4GRMA 2IH3A 2ZXBA 2OZNA 3SPVA 4L8SA 1M4KA 1U3JA 1DQTA 3DNKA 5F89B 1YMHA 3GJEA 1QEXA 2C3XA 3I6LD 2C9UA 4K55A 2VAAA 1JUFA 5SX5H 2HFGL 3UZVB 3S8WA 2JKWA 3MJWA 3P73B 2DYPA 2A83B 2F58L 2YFNA 1NPNA 3HZKA 2AFNA 4X7DC 2JJTA 4LKXA 1BM3L 2R0LL 3PDOB 4KMQA 1HJBC 3TV3L 1J0HA 3ILEA 3IJSB 4FXLA 3RZWA 4FABH 4WFGD 2J88H 3P4MB 2UZXA 3NJFA 2VM9A 2HVBA 4YSDA 2BWIA 1AG0A 2K45A 3K6SA 3MLWL 4XMPH 3HPLB 2YLHA 4HA1A 5G4OA 3SQBA 2G30A 2EUZA 4YVNA 5A6MA 5CLZA 5EU4B 4IBWA 1LNUA 4L1LA 4U1HA 4JHAL 1ZGLP 1RQ5A 2R69L 1QD0A 1HZHL 2IV8A 2YOCA 2LOEA 2R0KH 4JQXC 4OIFA 1BREA 3CN2A 4PP1D 3QZPA 2Y9RT 2X1WL 3C60C 3VXOB 4AL8C 5D55A 2XFGB 1KZQA 1U2YA 3HN8A 1UGNA 1MNUH 5ERWA 1EA9C 4HJGB 1B4JL 1DFXA 1X5GA 3UTTE 3QEHA 1VADB 1KACB 5HPOA 4ODSL 1NEZB 4MAYB 5EC1B 4LLYB 3H4HA 4NQUA 4MMXC 3WIAA 4WO4A 3LS5L 3TCTA 5CLWA 8CGTA 4MJ5B 5IM7A 3S37L 5GS0H 2VNCA 3RWDB 5GZOC 5EZOL 5HHOD 1TEFA 3B9KD 4F2MB 4CU8A 4K3EL 1P4UA 5D7JB 5F9JB 4E41A 3MNWA 4WWKA 5EU6A 3BRDA 1EQWA 2PYEB 2RB8A 1JZJA 3HE6D 5DK2B 2YPLB 2OBGA 4ONGH 5DRWB 1BAWA 2GC4C 1HSBA 1N8ZA 3LB6C 1YVLA 2CUAA 3H9HA 5IT2L 5EFIA 3FUIA 2ZP0T 1I8IA 4PJCF 3P9MB 5C07E 4NX0A 4Y4KC 4X5RA 1H8NA 4ZFZA 2Y22A 3VFMA 5C0BE 1RJLB 5TPWL 4I7ZC 4IOFD 1ES0A 2F0CA 2A9DA 2F6AA 2CDGB 4X2UA 3VGAB 1ODAA 3QJSB 4P2QE 2OMNA 4ZPVA 2P5WE 2WXHA 3Q01A 1WGVA 4FFZH 1K72A 3UXFA 3RIFF 2VXTL 3ULVH 3BQVA 3QJXA 4NN5C 4ZSOA 4XBPB 5DFTA 2IEPA 2OKMA 3IMVA 3M1OA 3QR0A 1WP6A 3VI3B 1KZYA 4P5KA 5EC2B 4AH2A 4N85A 3VFTB 1C1EH 2BJML 2JJUA 2PN5A 5E9DB 3EJZD 4UNTA 4ABVA 4G6KH 3UTQB 3VFUB 3MUGB 2CPCA 4K3GA 2WIMA 3EHBD 2GBVA 4GXUM 2JKRM 3TH4T 4HEMA 2MNJB 5FYJH 2OR8A 3VTTA 3E6FA 3HNSH 1BPVA 3RX8A 3KGTA 4Y1AD 1I8LC 4IU3A 1M6OB 4XPTH 1OCRB 3ABKB 4FERA 1UQSB 4B7LA 5GSVA 5HHPA 3V4UH 4MCMA 2CR0A 1P69B 2JCCA 1NBCA 3LN4B 1Y0LA 4QRAA 1R3IH 4BZ1A 4MNQA 1MW3A 2W60B 3B3IA 2Y06L 3N6YA 1NEZA 4MAYA 3TJEH 4HWBH 3NJJA 3X12A 5I66B 4QEGA 1T5XA 1GY1A 4KOBA 1NDGA 3RDTC 4ZO9A 5AVZB 1CJYA 2PTVA 3IJYA 1SBSH 3KVQA 2V5MA 1ZTMA 1P7HL 1JMXA 4WFFE 5JQHC 3DIFA 5ANMA 1CFMA 5BZDA 1AHMA 2IANE 4M6AA 4MCYB 3EO0A 2EQDA 1MRCL 1IBHA 4M48L 1KPRB 1T0NB 1N67A 5C09D 3NCYP 4RAVB 1Q9KA 2YKLL 4UNIA 1HCZA 1D6VL 4U4BA 5CBAA 1MCNA 1ZXKA 3RYMA 3STLB 4WCYL 3NFPB 4ESKA 4Z3FA 5FYKD 7PAZA 1EXHA 2X9WA 4PVLA 4I4WB 5EN2B 1X5AA 2ESVE 2WYIA 1DR9A 3N9GL 1BPLB 1VPOH 3MFFB 1QI5A 3CUPA 4A7SA 1JBJA 1DN2A 2IGTA 3T8XB 4F2FA 2A6KA 5AWNL 1DL7H 1WHPA 5GRJH 4H1LG 4XP9L 2NMSA 5FC9A 3HZKB 2IO5A 5CHNB 4DP5X 1FNHA 1Q1PA 4H20L 3LZLA 2NCMA 1N70A 2IH8A 3ZGHA 3MRMA 3T08A 2CLZA 1XXFC 4ZQTA 1E27B 3L9RA 4PRNA 3VRJB 3X12B 4E9WA 4APXB 5AB1A 3X1FA 1X7TA 4L3CB 4RQQA 2XIBA 4YOKA 2ED6A 4BCZA 4MA1C 4ERSH 1PIGA 5IV2A 4DOHE 2EH7L 5JDSA 4KKQA 1M7XA 1CGTA 1WE5A 2LU4A 3U4EB 4N2NA 5I2IB 3EJYC 5JW4M 3UTSA 4YVUA 3HJ0A 1TO4A 4Z5RA 1ULVA 1SN5A 1MJJA 1Q8MA 4F24A 3WXVH 4CDGC 4JPVL 2FECL 4HIJB 3BAJA 3EYUL 1E8XA 3UJJH 2ZKHH 4G8IB 2EDJA 2F58H 5DRZA 5BRZA 1N2RB 5A2BA 5CZRA 1V55B 5C2BH 1LO5A 3K2IA 2GCYA 2PO6A 3N0PB 3QCTL 5JHLL 5LUMA 1BM3H 1HH6B 2XTSA 5IMOA 4FEMA 5KYUA 4E9YA 1K4DA 1DN0B 2ED8A 4U6VL 4HK3J 1RJLA 2FGWH 4F3FB 1PPIA 2Y5TA 1GGBH 4MCZA 4YDKL 3V0FA 5E1HB 1MEXL 5CJQH 5I9QC 2EKJA 1PFCA 3MJGX 4HFUL 4WO4C 5DJXA 2OYKA 3T5WA 2RQEA 1MFDL 4DN4L 5TTRA 1DBMH 3RY4A 5IROA 4DQOH 4AQ1B 5DMIL 2E7LA 3UYOD 2A99A 2AJYH 1GXEA 2FWOA 3WI9A 1NL0L 1SOSA 3BMWA 4OVVA 4UQBA 3RVTC 5F7AA 2FQFA 4AJVA 3Q9QA 1KGXA 3DX7A 4HBCH 3RJDA 2P8PB 5DD0H 3U7YL 3WUWG 4G8GB 4PW3A 4F7MA 2B20A 1VFOA 1NCTA 1U8MA 1YEIL 5CUSL 3EBIA 3NJKA 5BXFB 1JF6A 5IGXH 5E70A 4Z7OB 5GS0D 2QDVA 5L7XL 5D1XB 1SM3H 1PSKL 2YRLA 3MVSA 3RU8H 1FZKB 2VZVA 1WSST 4TL4A 3H9SB 1E9PA 1J8HA 3C60B 4L29B 1YEJL 2IALB 3F7YA 2PP7A 2EEDA 2A9NH 3DTXA 4K3DH 1YMMB 1K85A 1MCQA 4BQ8A 2G2NA 1I1AD 3GSUB 4KMLB 2YXMA 5E9NA 5EOTB 3QFJD 5D1ZI 1ACCA 1F11B 2VWEC 4F1ZA 4FZEH 4RZKA 4JLRB 3CXHJ 4QTHB 3U0WH 3PPEA 1MHEB 1XH1A 1A7QL 1AQHA 3QUXB 3MLUL 2VKXA 3CFIC 2YD0A 3O3BA 4G6MH 1IC5H 1JS4A 2PYED 3VWJD 4GRLD 2E75C 2XKUA 3JTBA 2R0ZH 3KPNA 1AKPA 4U6XA 1KCRL 3ZL4H 1NPJA 3NIDF 2FL5A 4RNRA 1NCAH 5KSAA 1NKRA 1XZ0A 3AS1A 2QGDA 5E08H 3S3PA 5JA8B 2VXUL 5LAPA 4KY1H 5CJBA 4WI0A 2NXZB 1A3RL 3QXDA 4QY8B 1XGPB 1DVSA 1D5BB 3OAUH 1ZV2A 5LBSH 4PS4H 4UTAA 5CEZL 4UQ3B 2ZUVA 5HHXL 4PJIF 1K2DB 3KLLA 4MD5A 3K72B 1KENH 4LSTH 4P23B 5ISZA 4H8QA 2FO1A 1QTSA 3Q6GH 3JWNE 4FTVB 4IDJL 3ILDA 4HHGA 2E56A 3QUKB 2GAZB 2DQHH 4ONFL 4JDTH 5I9QB 4RMUA 5F6HJ 4X4MA 3X1EA 5D1QD 4IGBD 1XTMA 1HQRA 4O5LL 1UKQA 4MGXA 5SWSD 4LU5H 3FB7A 4L4TE 3L3OB 2RTTA 4J5VA 4UQ2A 4X4XB 3TM6A 3WJJA 5FKPA 1AIZA 3KM2A 4JPQA 1P9MA 3ZKMC 4K8RL 4PWEA 2XN9A 3E8UL 4E9VA 4PJBB 4WU5A 2C3WA 1MFAL 5EUKB 4YSEA 1CYGA 4ZTOL 4G72B 1Z5HA 4XH2A 2D31A 2W95A 4RH4A 5CGTA 5DEFA 5AFAA 1TUPA 3TESA 1KPUB 4KK8D 1ZS2A 5I82A 1I3RA 2WSKA 4UU9B 3VRIA 3R19A 1MCFA 1H3VA 3D85D 5KEZA 2V7NA 1XCTA 3TEXA 5CXPA 3TFKD 2YN3A 5J13B 1HL9A 1RP9A 1ECZA 3K6OA 2AQ1A 4J6IA 4CSPA 1UFGA 1IKFH 5F70A 2OYPA 3GSXB 3OKNB 4C54A 1UOKA 3L3GA 1MJ8H 3SKNB 2IANB 5A16B 4EVNB 2ZTBA 3FTSA 3GQFA 1P84J 4YXKL 4N9OB 2DAVA 2IH1A 2WIIA 5HVWA 1RSYA 2LLLA 1P5VB 5SX4H 4ADGA 2ODIA 2UZYB 1N0XL 3VVWA 5TQ2H 4KOCA 3KLQA 4KGLA 3INUH 3TH2T 4YBLC 2PABA 3QIBD 3G9VA 4LLQB 1CICD 1OLLA 3OQ3B 4HWEL 5CZXD 5D7IE 1DVYA 3WNPA 1JTOA 3VXRB 3JSSA 1KY7A 4JRYD 4B50A 2Q3ZA 2OJZL 4IJ3C 1F4YL 4BHUA 1J5IA 3ZVVA 4YFLF 4X9IA 2BP0A 2AJSH 1G9ML 1FNEA 2IPTL 3QZMA 5KVEL 4X7EC 1ID5I 2MPAL 4NFBA 1R3HB 2WVVA 3DX6B 2ARWA 5A3IC 2H5UA 3J7HA 3FUFA 2CSPA 2RHEA 3AY4C 3HBPA 4V1DE 1EXUA 1TT6A 2IAMD 4DO6A 4FQHB 1SMOA 1BZ9B 5MENB 3LKQB 3BVNA 5IG7B 3DOSB 5AYUH 1CDGA 4O2EA 2Q86B 2NQDA 1PG7X 3R1GL 5IMKB 1FSKC 3MLTB 4KKAC 3GB7B 4TNWF 3FU7B 3O3UN 3WE6B 5DD6A 4OF6A 1DCEA 5HGBB 3Q5TA 4JBSA 2VL5B 4AXWB 1LD9B 4Y1TA 4I3SL 3W11C 3AM8C 4MSWA 4MJJA 2XXGA 5CILH 4YHIB 4DGYH 4DP7X 4LO9A 3W57A 3VJ6A 2YD9A 3EZJB 1PEWA 1HHHB 1UB6B 5T1KB 3ME0B 2FO4B 1JNJA 1TU2B 2PETA 3A6BL 3FN3A 4IKLA 2CO6B 4Y5VC 4HBCL 4QOKA 1MFNA 1I9JH 2OMUA 3CK0H 2R7EB 4U3XA 4WGWB 1WDAA 5AKRA 5E5LA 4PJIE 3WFEH 1OT2A 1YJDL 3Q0HA 3H9SE 2ID5A 3OJDB 3Q13A 3FSWA 3O41B 4BCXA 1NUGA 1M53A 3Q1EA 1AZUA 1ZE3C 2I85A 3F7YB 3VFOB 1CF8H 1QA9A 2R4SH 5LG6A 4F8PA 4Z7QF 3TA3B 2J43A 1BQHA 4J8QA 3QJHB 3WLWD 1R17A 3OMZA 4AQ8A 1MH5A 4YHOH 4BFFA 3CLEH 4DFIA 5GRWA 3LKSB 2ZX7A 3QQ9D 1JHKH 1UT9A 2ODHA 4P2CG 3OKMB 5FGBC 3ZTNL 1YEJH 2FX9H 3QGVA 2YR3A 2F53A 3RWJB 3ZKND 2UVEA 4Y88A 3JZYA 5TFSL 2P47B 2CDEB 3QQ3B 4Y5YA 5AD0A 3U4EA 4WGKA 2WAHA 3F58L 4X4YA 3LXAA 4M9OA 3RL1B 3SKJL 5EEWA 3MQIA 2CO4A 3PP3H 4EOWL 1FNAA 3L4CA 2Y3AA 5FKAA 2B59A 1BGXH 5I16A 1BYNA 5EF2A 1XBRA 1U30A 4KI1A 3OM3B 1VRSA 2FECI 3GLEA 4OCWH 3T3MB 3O4OB 4M5TA 4DJMA 4F5CA 2A1WL 5A2JH 4PGEA 4IRJC 9CGTA 4ZUTA 3GF8A 3G6DH 1CLOH 1HYSD 2D2OA 5MI0B 1NKOA 3CN1A 4JG1L 5AVWB 4UDUA 1XIWB 1ACZA 4RISL 4YHKL 3U46A 3UROR 4PREA 2GKIA 5C09E 3UPAA 3OJMB 1HOCB 2VDNH 3O2VL 2CLRA 3QRLA 1NCHA 2CBQA 4CVXB 2D0GA 3QDJA 1U58B 2W07A 5DZOA 5F0LB 2WB7A 4XO3A 2AZUA 2VQ1B 1RU9L 2VUYA 4FKHA 3MLPA 1E30A 2DWXA 5ELIA 5GRVK 4JQIH 1RK0A 3PQYE 3PXLA 1J5OL 1TOXA 1NAMA 4L9LB 2NQCA 4NQXA 4P57A 1N8ZB 1IC0A 5IB2B 5KYYB 4HJIA 1X4XA 3UAJC 4HHAB 2KDGA 4FQPA 2ZWSA 2YRBA 2YAPA 1FV1A 4PJBE 5MEND 3TT1H 1L7TL 1IE4A 4R5TA 1WFOA 5GGSB 4IJ3B 3QORC 3RWFA 4BFGA 5DJ6A 1QFPA 1PLBA 2CXGA 2EIDA 5E00A 4BSWA 4NJ9L 4X0KA 3LQZB 1D5ZB 1HL5A 4XMXA 4HS6B 2E7MA 4PUBL 1GW0A 3F83A 2R4RL 4K2UH 3S5LG 3GGWB 4A2GA 4U7MA 1S9KC 4JO3H 4MB4A 5B1JA 3AADB 2XOTA 2R1XB 3LKNA 1E2WA 3TGXA 1FNFA 2YD4A 4XAKD 5AW5B 4OY9A 1R24B 3SOBH 1KB5A 1FV1B 1IFHL 1K6QL 2A77H 3GRWA 4I9WE 1ZGLB 4W70A 2AI0L 3U9PH 1PS3A 5IOPB 4TLKA 4CBPA 2I60H 3WENA 4XMLL 1G7QA 1CDBA 2B14A 3H9YA 4XC3L 4HSAC 3T3ME 2HX8A 5CGBA 3IJ9A 1D2PA 1RI8A 1MQKH 3K80A 4G80B 4J23A 5D1ZA 7FABH 2C1OB 3F7LA 5I6LA 3KEHA 1IQDB 3T2NL 3I9PA 1NGPL 3U7WH 1HHIB 1T3FB 2WWKT 4R6UA 3ZKNC 5H8DA 1HESA 4Z77A 1W0WA 4DEPC 2XBDA 3SDAA 4URTB 2OMWB 4DW2L 3F6JA 4XNBA 3DX1A 3L2MA 1MFEL 3MBEC 4RA0C 3I50L 4Y4HC 4MZ2A 3QVAA 1M1SA 5E6UB 5JZ7D 1DJGA 3HNTL 4C59B 1F6AA 4TULL 2J8HA 3LD8B 3GS0A 4EIZC 3Q7JA 1OQXA 2J8UB 4WW1A 1K3ZA 4Y2DD 5E0QA 1ZHBA 4AJYV 4S1RL 1I75A 5GGSY 1P5UA 3G6JB 3EH4B 3F7VB 3TO4A 2CRIA 3ALPA 5D96C 4FQLL 4D7BA 1JL8A 5DJ2A 2C4XA 3V6OA 3ZO0A 1P4IL 1HWGB 1ID2A 1YUHB 2VDLH 3CDZA 2C4FU 2EADA 3Q8CA 1RH8A 4JL1A 4NC1E 5E6ID 1G9MC 1PLAA 3MV7B 2X4RA 1GPOH 4EN3B 1BD2A 2FLRT 4YUEL 2QADC 4XZ4A 4NO5B 3R8BB 3ZHNA 3BIKB 5AZ2L 5L8JB 5L88H 5K69A 1TYJA 2DJ4A 5LBGA 4Y1AE 3GUFA 4MBRA 2XV0A 4KVNH 2FUQA 2YMXH 3B9EA 1IGFL 4U7SA 1HHIA 1GZHA 3L08A 4H88L 3KDPB 2F54E 3EJYD 4U1HB 4LGRB 4ONHB 4PM1A 3FTXA 3NBNA 3APNA 4KKPA 3CN4A 4KK9D 4NYLB 1J9CT 3AAZB 5DS8B 2AZAA 2ITEA 3ARWA 5IHBA 4GO9A 3N0AA 3EGXA 5DRWA 1MJ7H 1CF8L 2R4SL 2EO7A 3WO3B 1GGCH 1QW8A 2E3VA 3DHMA 5BMFH 1L4IA 4GI8A 3EZ8A 4UNVA 7PCYA 4OIIH 4UBDC 3QUXD 5DJYA 5IY5B 2ZOLA 4EN3D 4DGUA 1S9VA 4YDLC 2APXA 4P2OD 2PW2A 3N40P 4X80L 1Z9PA 2G9HB 3QNZB 5IW1A 4LHUG 3QWOB 2WBXA 4ZUSA 4AYFB 1YN6B 4WEBL 5FA4B 3ARBC 1WS7A 3CHOA 4H13C 2VDNB 3G5XA 2J72A 1WHOA 4OJAA 4XCNB 4JFUA 3LSOA 1AE6H 3V8OA 4PJDF 4NNYB 3TLRA 3BZFA 2R39A 4J3TA 4S2SB 1AMYA 4ZMNA 2R23B 4NZUH 4LCCA 5I8CA 2VC2B 1TEYA 3DV6B 1OP5H 4GRWH 4WTZA 4BDVA 5ACLA 4XCEA 1Z5LA 3L48A 4G8EB 4OW6A 3FN9A 3K0YA 2ZWNA 1A9EA 1Z6JT 2B08A 1VFAA 5AVYB 3U9WA 5L8KB 2DQJL 4NYLA 4PI2A 2EEBA 1A4JB 4LLDB 4HKBA 1GZPB 1I9EA 4WHCA 2O6FA 5KS9A 3D69B 4HOZA 1KIPA 4CU6A 5A2IH 2A6JA 4M6MH 4FTDA 1MJUH 4RISH 4YHKH 3MV9D 5D7IA 3U30B 3EIFA 1UWGL 1GHFH 3MV8E 3GT6A 1TO5A 3CFKA 3SGJA 4RVBA 2X2UA 2DM4A 4JL2A 5DZJA 1XZWA 4JHAH 3P9LB 3WFBH 1JHTA 1IT9H 1GW6A 2J25A 2MPVA 1SEBB 2X1XR 4FYQA 4GP5B 1BMWA 1FGNH 4G6KL 2DQIL 3WIFA 5D7JA 5F9JA 1I3RB 2OCCB 4UU9A 4QPEA 5BO1L 3BYYA 5EORH 3SDAC 1ZLVH 3QAZC 1QBBA 3HA0A 3ZT5A 5E4EB 5AENA 3RZCB 3VDAA 3QQNA 1P5UB 1E0OB 1OTSC 1OHQA 4AGMA 3AXIA 4B27A 1JN6A 1PG7H 4K4KA 3WD5H 4AMXA 1MAMH 3D2UB 4HS8H 2HG5A 5DFVC 1X5ZA 3TJHD 1J8SA 4ZMLA 2WLYA 5AW0B 3BKYH 2VR7A 4PRPB 5F96L 3EDEA 1BVKA 3GBNL 3GMOB 1XCWA 4NRYB 2AI0H 4HCIA 1MWAL 3C8KA 3V4LA 2ITDA 3T65B 2DEYX 1KFAL 35C8H 4NQDE 4PVNA 5IK3A 3MPCA 3R0MA 3SZ6A 4QHUA 4OZHB 3BC9A 2CNZA 2UV3A 4FYSA 4W9EC 4HCFA 1GCYA 2AV7B 2BSRB 3E0GA 4G9FD 1T1ZA 4P5MA 1I7RB 4U1KA 4PGBA 3WCYA 4EXKA 4IRSC 4F91B 2PP9A 3WJMB 4U1MA 3CHPA 3HKFA 3HMXA 2ZNXA 1YYMH 1CYWA 2XETA 3IRPX 2WXPA 1E4KC 3TNNB 4RNRB 5I1JH 3QDJD 2P8LB 1L9QA 1OK8A 5CCHE 4ODTL 5DT1H 3P4LA 4KXBA 5AOMA 2PPAA 4X6EA 5FB8A 3G5VB 4ZMQA 3HB3B 1ORQA 1I3VA 2YSTA 1E2VA 4XXWC 4YDMA 5C2BL 4DEUA 1DVFA 5PCYA 1BZ9A 4YBQD 4JAMB 4CMMB 7CGTA 1L3NA 3N1MC 1E28A 4KDWA 2Q86A 5LO7A 2WLMA 1FZMB 4PRHA 3OGOE 2GTQA 5ADPH 1CQYA 2X3CA 2AP2A 3ARXA 3V4VA 4BIKA 1I85C 5DYFA 1M1XA 2DBLH 4I87A 1SXBA 1ACYH 4PJ8B 2EEFA 5FFOA 5AVVB 5GGUA 2RALA 3E80A 2DWEA 2X41A 1AKJD 3MX0A 1OCWL 2IPKB 2OXHA 2UUDK 2BVQA 4P2OB 3I6KB 4CKVX 2X70A 1KEGH 5A1AA 4ODHH 4ZODA 1H6FA 1X5FA 1PJWA 3GHPA 4ZXBA 3O8XD 1NC4A 4E5XA 3UMTA 4QNPE 3DX9A 1FPTH 2IDCA 5M7QA 3UC0H 2JSFA 3MBED 3QIWD 4OT1H 1H6UA 5FWQA 4G1EB 2VGLM 4AMKH 4XRCB 3C5JA 3EDJA 5B3NA 2Q7NA 5A2LH 3ZRCC 3F12A 3QFGA 1G6RA 3RVXD 5MEPA 5D1XC 4XCNA 4PJ9A 1E7UA 1N7MH 2EIEA 2CU9A 2WM0A 4JO1L 3S36L 4E9RA 4PG9B 1IAKB 2NT1A 3LEXA 5E9DE 3W5NA 4GYBA 2HKHH 2P5EB 3NH7H 1KTRL 1X5MA 4JAMA 2WXFA 5J1AA 4LIQH 1B88A 1LILA 6FABH 5A43C 5EEXA 4QRPE 1DBML 4PI0A 3MLYH 3D06A 4R0LB 4YDJA 3VX1A 32C2A 3EHBC 4AGNA 5EHFA 3QRGL 4PJDB 4YHNB 1YEGL 2YEZB 5C7ZA 4DGIL 1ZCRA 3SDYH 5I5RA 4KK5D 4B7IA 2XWBB 2YRPA 3KLAB 3L7EA 4YX2L 4CVUA 2GY5A 4ETQB 5ABZA 2FX8H 4U0RB 4LSSL 1NANH 3MXWL 3LS4L 3BKML 4MKMA 3EYOB 4K9EL 1CE6B 5D96B 3VXME 5I74C 4Y9CA 2EE0A 2EIJB 1QSFE 4OJDH 2CK0L 3VRLF 5JXED 1VFBB 5IBTL 3V7AG 4AYID 1KTBA 1PSKH 3HE6B 1XWVA 4RLDA 3QQ9C 3DUHA 2HRGA 3ETBJ 4X98A 1WBYA 4NAMA 5FIEA 5I6XC 5M94B 4JFOB 4NZUL 3D3VB 1WA0X 3PGDB 4GUOA 4W9GC 4Y1AA 1MPAL 4JY6A 5AALA 3WAKA 4P2OA 3PHQA 1R75A 4WU7A 3B2VH 5JOFB 3MRFA 3QCTH 3KJ6H 5J12C 1M7UA 5CEZH 3T6ZA 4P5TD 5C0RL 2BVYA 3CDZB 3JBG7 2QLVB 2Y2YA 5HDBE 3X3FH 2ADGA 1GGBL 2CBPA 1KJMB 2VR6A 4G5ZL 1G1OA 5BZWA 4PJDA 1QVOB 1A4KA 2ENSA 2VL5A 4AXWA 5EDXA 3GXFA 1DBJH 1B2WH 4ZAKA 2COVD 2P44B 3MZTA 3FTZA 2MOGA 4WFHD 1BP3B 4PIRF 3KPTA 4CC0A 2C1PA 1P1ZB 1XFPA 3CTTA 3X13B 2Z35B 3DJSA 3EF7A 4G43A 5DTFB 2F8XC 2JIXB 4FA8A 4R7LA 4F58H 3QQ4A 1Q72H 3BH4A 5BRZD 3DVFA 3QJQB 3Q5OA 4OFPA 1A6AB 1MFAH 5F3BB 4DKEH 4TLSA 4OI7A 4YH6A 4M6NL 3JV4A 3C2SA 4MMXB 1S3RA 3NZ8A 1KXVA 5E8PB 1A4JA 1T0NA 4ZG1A 3PGDA 1T20A 3CVHB 4FNUA 4C56B 2A74B 3IDMA 3CFDA 1RUAH 3WKNA 2WANA 5IQ7H 4R2GB 1NLBH 2GG1A 5FCSH 4MX7A 2IG2H 3B8SA 3TN0D 1FZKA 4LCCB 1OSEA 1T2QL 4A04A 2FR4A 2F54A 3L95A 1YZZA 1CFVL 4QCIA 4WO0A 5G5DB 1F56A 2WMPB 1ZT4A 2VW7A 4JREC 4N1HB 4RDQG 4UT6A 2A9NL 3V4VB 2I9LA 1MFVA 5CLTA 3O4LB 4E5XG 2IH1B 1U8MB 2FYVA 4M62L 3CX2A 1HXMB 5E7FA 4WJKB 4F8QA 2YZ1A 4NKQB 2Q1EA 1FL5B 1G9NL 5KVFE 3NZSA 3GNMH 2PYEE 1F58L 3UEZA 1O6SB 1BEYL 1AGCA 3H6AA 3ML9A 1W0VA 1J1XH 4EKJA 1JK8B 4OVUA 3KLHD 1CGYA 4IOIA 1P9MC 3ZYOA 3BDXA 1J86A 3L2NA 3ZHFA 3BLKA 4F7CB 5BVPH 4OD2B 2AJZA 2X6MA 2H1PL 5E03A 3VWKD 3NK3A 4QHMB 4ELKB 1CTMA 1IL1A 3RL2B 3MGOA 3SZKC 5IFHL 4ZFFB 4MYWB 1F97A 4RRPM 4BQBA 3MLXL 2VXUH 5CZVH 1PZ5A 1T03L 1H5BB 4LPCA 1A5FH 3ZMEA 1H0DA 3JWNG 4WEMB 1H3TA 3LCYA 4F8NA 3ASOB 1KPVB 4HGWA 4TLUA 4RMBA 3WOVA 3FBKA 1YO4A 2DMCA 3R1GH 2ZOUA 4P0DA 3WXWL 4FFVC 2D7OA 1UM4L 3BPOC 3CDGB 2CHZA 1MW2A 2IH9A 2XN1A 1WUNT 1OV8A 3C60D 2G9KA 2VSCA 1MJJB 3VD0A 2WLHA 1RL1A 4JRXB 4C56E 2WXRA 3C6LA 2GJRA 4O00A 1BWWA 3KDMB 2HVKB 1IEHA 3SGJC 4ZFGH 4Z7UE 4A7GF 1CK0L 1SNRA 1N0LB 2X6CA 5CP7B 2UWEA 3W56A 1DVFD 2J3SA 5BUAA 1NLDH 5I19L 2W9DH 5LGJB 3D08A 1IBYA 2D0FA 3VAEA 3TWCH 4QXVA 1NEZG 3WIIL 1J8HD 3ETSA 2WXIA 5FHBH 2WVSA 4Y5YB 5AD0B 5I18H 1RZ7L 2VMFA 2EYSA 2RD0A 5DRXA 4F7EA 3QWOA 4AGQA 2ZSWA 5IBLD 2YBRA 1IGTB 2VT0A 1AGEB 4MA7L 5K9OA 2Q8AL 5TF0A 2VLLA 2XKNA 5DHDA 3QR2A 3Q8AA 3P3RA 4WWID 3FDWA 3K6NA 3O11B 2BSSB 2P46B 4Q8BA 4PJAA 1M6UA 3MRDB 4HQQL 1EEYB 4L1DA 4ZPTA 1RLWA 1I3GL 1PF3A 3AQDA 1DQLL 2DLIA 1AQDB 3MFFA 3NVQA 4DUVA 2EDRA 2NNRA 3EGSB 2X4TB 4FZ8H 1JZ5A 4PJ9D 3S34L 1T83C 3UJIH 1GGYA 3GIVB 2F19L 2GJ6E 1NDMA 3UAEA 2GY7B 4BGLA 5C0EA 4K23L 3B5HA 3AY2A 2ICWJ 1AKJA 1NMCB 2SEBB 1KTDA 1G7HA 4U1NB 3U0PB 4L8CA 2QR0B 5CSZB 3MBWA 5IB1B 2OCFD 3ZT6A 4P46D 2X2YA 3BZFB 4Z7QB 4LMQI 1E8YA 4FNLH 1NC4D 1HCVA 3MRDA 2GT9A 2HWZH 3C5SB 4DK5A 1PKQB 5KVFH 5MI0C 3KLHC 2NUTA 2VWEE 4PJHA 2CQVA 5DFVD 4DKFL 2EYSB 3ZTNH 1WWAX 2BIIA 5C08E 5D72H 4DAGL 2AQRA 3AT8A 4PV8A 4PY8I 2Z31A 5HY9B 3NCYS 1OTUC 3MV7A 2ZSWB 2VKWA 3OX8B 1E4WH 2PXYD 3QIUC 2AGJL 4LSVH 4BSWB 5G4MA 4ILDA 3FPXA 2IH3B 4W9KC 5FYLH 5DMGD 4Z7WF 3UBFA 1KIUB 3NDYE 2R69H 3RJOA 5ADOL 3O6LH 2WCGA 5JORA 2BLFA 1YNKL 3MBEA 1P7BA 4RGNE 4FF9A 4EDWH 4Q6IC 1WFUA 2X88A 1OANA 5C0CA 4ZS6D 3EJTA 3IPEA 4WNSA 4MB1A 2I9TB 5AAMC 4WK2B 3LH2L 2IQAB 1XCQB 2VXQL 1HK6A 3KPQA 1FVCB 4I3SH 3W39B 1MWOA 3BUPA 2ZUWA 3FT4A 4W9CC 1FHGA 4C4KO 4KNUA 5IQLA 3S37H 2O6DA 3KYNB 2F5BL 4WW2F 5E8EB 3RGVA 4HIEB 1G6RH 1M05B 4NUJA 4XPAH 4XGZB 1Y1UA 4YIQB 4LMQE 4HUVA 1LK3H 1U8JA 3KWWB 4XCFH 4F93B 4KPHH 4ZMWA 2CGZA 2GIYA 5JXEA 3FU5A 1QLRB 3JTSB 3HEIB 4GO8A 4TKWA 4UINH 4Q4IA 5D1QA 3IDYC 4PJFE 4AJWA 3VXPA 3W9DB 1EHXA 4GINA 4A2HA 5SWSB 3Q8EA 1JXKA 1Q9LA 2EILB 1BFVL 2FT7A 3P11L 5KVDE 1PYWA 1UXSA 3WBDA 1IAIL 2ZXDA 2DIJA 2ZUXA 1CGWA 3NT0A 3UG3A 2MCPH 4GBXA 3CQPA 1I85A 4NHUB 4R5VA 3W38A 3QQ3A 2XPZA 2J55A 1T2XA 2X2HA 4M8RA 4WF7A 1JMZA 2NXZD 1A02N 1OAKH 4OZFB 2A74C 3WUZA 4QF1B 1T0OA 1FVDB 1GOFA 4BWUA 5JIPA 1JRHL 1PZUB 4M1GH 4XBGA 1T21A 3K5RA 4XMKH 3ZDZB 4OLWL 4ZTPH 2KZKA 1BGXL 2ZJSH 2CRMA 2YIHA 4RBPK 4UTBL 3HNTH 3TBBA 1A21A 1NAML 1UB5A 5BVPL 2BIOA 5IQ9B 5E1IA 3BP7B 4FFYA 1PY9A 1QNZL 2ALAA 1YEFH 4UB0H 5INCA 1KELL 5SWZA 4BH7A 4CC4C 1YG9A 5HHQB 1AZRA 5E5MA 4Y9BA 3F01A 2PP8A 4L05A 1ORSA 3OMIB 3LIZH 1K8IB 2GI0A 2HJKB 1AD0B 4KXAA 3FJTA 1TLMA 3LEVL 5F3BA 1E4JA 5AVQB 2JF1A 2ZYHA 1MQKL 7FABL 2J1ZA 5GJSH 3A4FA 4JHWL 2VDNL 1EMTH 2FQGA 1JD9A 3F64A 4MSWB 3NJMA 1TXKA 2VLLB 3WIHH 2FCBA 1UFUA 2BVPA 3EAKA 3V52L 5E5RB 43C9A 5JHDB 1NBYB 3Q1SL 4RWYL 4PRID 5KN5A 1HOEA 3VCLB 3ZL2A 4JKPH 3W0WE 3DOSA 5E8DH 3LKQA 1JPGA 1S3KL 2J4WL 1C7TA 1KBWA 5AW3B 4OLYH 4O9HH 4KK6C 4NS0A 2ZQKA 2CZNA 2OJ1A 4H26A 3CMOH 3TT3H 2BWQA 5C0NC 2XZZA 4FTVE 1G94A 4QLRA 1BVNP 5DJ6B 5DC2A 1EAQA 3AT9A 4N24A 3N9GH 1VPOL 1PX8A 4KQ0A 4QRTB 3ZDXF 3MV01 1OAUL 2GTWA 2PCYA 5DMIH 2VR3A 1AYOA 4DGWC 3IETA 3SGEI 3T65A 1CO1A 3PWPE 3C8KB 4HD5A 5EOQH 5C9JA 5IJVA 5AZ2H 3U25A 5FCUL 2A77L 2XN9E 2E7BA 3GMQB 1D5RA 2BHYA 3MLRH 4L29A 1W0WB 5KSUA 5HVHB 3O8XB 4YZFE 4ZUUB 3CD4A 1QW9A 4L4TD 3ZDZE 1KCBA 4TQEL 5ESQA 2YMXL 3BVXA 4XMLH 3NIGF 3VH8G 4P2QA 5CFAA 4NO0A 1RURH 3VMOA 3TIEA 2WIIB 1B0GA 1VESA 1S7XA 3IJHA 2VDQH 1IL1B 3A4AA 1W8OA 5D1XA 3L1GA 1MCSA 3ECWA 1F3DJ 4WCYH 5D1ZC 1ZS8A 4WGVB 4YHYB 2XJLA 2CBOA 3COOA 3T6WA 3IGAB 1KGYE 1A1MB 2B16A 3EYQD 3I75A 1ZGLA 1QHPA 2B1AL 2B3IA 4AIZA 3BAWA 4R4NC 3ZQWA 4PJAF 2GK0A 2VLMD 1Q0XH 3RL1A 4R83A 4WHTB 2IF7A 3D33A 4QWWD 2ERJB 1D5IL 4C83B 2A6DA 4U0RC 2WP3O 2J5LB 1T04A 1TSHA 1URLA 2L04A 5GS0C 1NFDF 1FH5H 1IAKA 4NXSA 3IPBA 5HI4D 4HUNB 3TO4C 5T3ZL 1T0MB 3MAWA 3QI9B 1JGEA 4DN4H 2LQRA 2VITB 3UDWC 2Q76B 4LSDA 2EICA 4NM8L 1K4DB 4XPGL 1T22B 4K7PY 2GSIA 5C7XH 1JPSL 4I1NB 5E8OB 5F0JB 3RWGB 2CO2A 3B43A 4B96A 1C5CH 3CZSA 1LWJA 3A0OA 2LFEA 1BLIA 2ZKMX 3VE0B 4W4NA 1YQVL 2WLJA 5DZAA 3K4ZA 2IPKA 1JSYA 3AZUA 3FCSA 1N6QH 2A74A 5GQBA 4EN2A 5DMGC 1BBDH 4LLQA 3ZGIA 3ZKQD 4APQA 5GSRA 4IBSA 1PKQE 3L3IB 5E4OA 3SYQA 1GTFA 5F9DC 4HWZB 3RPKA 3E1ZA 3QQ4B 2LAGB 3ZKXC 3R06B 2MJWA 1TZGL 1KN2L 1PMYA 3S3JA 5JMOC 3PE9A 2Y1YA 5IBUG 2Q8BL 2JFCA 2P7TB 4Z7AA 5KOMC 4ZMOA 3LZFL 3DMMB 1LVEA 3ISRA 1MHHA 1MOEA 1H19A 2BMKB 3BGMA 3OKLA 5I6PA 3O0LA 5AZUA 4HOMA 3QEGL 4DVBA 1NGWB 2BSTB 2WNXA 2H7WA 2QFRA 3M88A 5HPMA 2YPKA 1RZFL 2AJYL 2PCPA 2OW6A 3QPKA 3QUYC 3DTUB 4N9GB 4FQHA 2WGNB 1CD1B 1KJVA 1WAAA 1EBPA 3KPMB 5JR1L 1GTNA 3PUUA 2ZP9A 1RZIA 2VLRD 2I5YH 4X80H 2V5SA 4PJHE 4K5MA 3U7YH 2Y07L 3QFJE 4NAJA 4AK2A 5EBLA 3Q2NA 3LKRB 5MP6H 1U36A 4ZSOE 3T4AC 5HBBA 2VLME 3QS2A 3GYRA 1KBPA 2WUCL 4KC3B 4ALAC 4RAVA 5GGVL 3ZTEA 3EJJX 4Y1AB 3S9DB 2UZPA 1LWRA 3DO7B 2IWKA 1YQ2A 4BFBD 5HYQB 3WU1A 3LN9A 3CGTA 4I85A 1REIA 4MAZA 1A9BA 3IDNB 3ZDYE 4MQXC 4OLWH 4ZTPL 1V3MA 4KJPC 3D8MA 2ZWLT 5B38B 1I7UA 4N0UE 2DI8A 2O5YH 4D0CB 3WTVA 3OXSB 2B2XL 1MJ8L 1EDYA 3MRQA 4BYHA 2EUVA 4KUZL 2DQJH 4FG6D 4EN3A 4OQTA 1P84K 4FNSA 1HYRC 4QIRA 4JFDE 4BFEA 3MKGA 4EO5A 3VSUA 1V7NH 4FQ2L 2DJMA 3TBWA 2YXWA 1FIGL 2W94A 1WGOA 1FORH 1CD1A 1NCCL 2Y36H 4HCGA 1GYVA 4UOW1 5TDPB 3FQXA 2Q5BA 4UBDD 1UWYA 5F3HB 3V0VA 4P9HL 1KC5L 3GRWH 5IMKA 1U95A 1X7SA 1IT9L 4LDEB 3GM0A 3POCA 1OD9A 4KKBD 1SEBA 2DL9A 1FUNA 4IMKC 4S0TD 4Y9GA 1TCRA 4Q9RL 4KWUA 5KAQF 3QZNA 4NFDA 3F12B 2VL4A 3OPZH 1HKLH 3NJNA 3G6JF 2R8SH 3HC4H 1JD7A 4JFTA 3ARPA 1NEPA 4M1CD 5EF3A 3ILPB 3L4UA 4ETYA 4NC0B 1BX2B 4HZ1A 3PWJA 2A7BA 4OD3H 3CZEA 3HAEH 1UGKA 3TBVA 1HH6A 2V8MA 1DEEA 3AACA 5IMOB 4K0OA 2EC9U 5GISH 3MGTB 4LVNC 4MAYD 4IDJH 5E2TL 3BP5B 4GY4A 4Q4EA 1WS8A 4N0FA 4NWTL 1HH9A 4QXUL 1P6AB 1SVCP 1BDYA 3FQUA 4YX2H 1QZ1A 2VAJA 3RNQA 4WFHE 2O30A 2BZDA 3FCGA 2HPTA 1C5DA 4PJ6A 3RWCB 4JVWA 1OP9A 4NIYE 2VRQA 3S98A 3ZYZA 5GZOA 4QGTA 2R56L 2FAUA 5C8JB 3REWA 4DFHA 4JY4A 3X11B 4DZ8B 1I1FA 3FO9B 4MJ5A 5IM7B 4BKTC 4ENED 2Z31B 1XGTA 5HP5A 4S1SH 1J5HA 4ZUSB 1L9SA 3ZSSA 2BNQE 5F7FA 2XFXA 2J1KA 4TUKL 3QG6B 4J3OF 1NPUA 2FT8A 5I1HL 4AEFA 3SGDH 2DRUA 1CI5A 2Y6SD 4XVSH 4LLMB 1RZGB 4A7VA 3BCDA 3NRFA 1B3IA 3N85L 3FONA 3FFCB 4MD0B 5GRXG 2APBA 4MMYB 4OLZL 5ILTL 3AY4A 3BEWB 3KS0J 3B5TA 5DDHA 2VDLB 1SJHA 1CL7H 1H15B 4BZ1L 1MIEL 2OTUA 4G1MB 4JFEE 4NKDB 1ACYL 3FZUD 4Z78B 5IROD 3C08L 5E6SB 1INEL 3BX7C 4B9FA 2EE3A 3BPLB 5EUOE 4QWWC 1MN4A 4NM8H 4EPSA 3U2SA 2GJZA 4JGNA 2QTVA 2BSSA 3FYIB 4GW4B 3VD4A 4UILH 3X1NA 1R0AH 3G5YA 5CILL 4DGYL 4NQCD 5JIIA 4K7PL 4AIEA 3DA0A 3PWPD 2DQCL 5C07A 4FABL 5I17B 1Z1WA 3K72A 5I24A 2NTFA 4BE5A 5CIPH 4AE0A 2R0WL 4YMPA 3RDTA 2HPOA 4IRSD 4YK4B 3WFHB 3RG1C 1SZNA 2XX1A 2AJXL 3IGKA 3WIFB 3D4ZA 4F2ME 3GK8L 1PYWB 1UXSB 2MQCA 4S1DC 1WG3A 4DVRL 1N0LA 4LLUA 2DJUA 4NRZA 4OFQA 3O2DH 1H3WM 5CCJA 2ADIB 3H6JA 3K2UH 3MUGA 3S88H 4DO4A 4FNPA 3V95A 2XG5B 1ZTXE 5CCKL 1N26A 2OMTA 3FUHA 2RQ8A 1OE3A 5C07B 3P9LA 2CKNA 3VFGH 4MJHA 1XDTT 2IFGA 1D7FA 2F18A 1PW3A 1CR9L 2QKSA 3GSQB 1C8PA 2ZG3A 3WDJA 3THMH 1G0YR 3ZK0A 4N0CC 1YNTA 2NY3D 3RBGA 1H6TA 5D2LB 5EA0L 1FG9C 1G9NH 1FVEA 1XR9A 1KIQA 2R4RH 2Q7YB 3RVWC 1KB5H 1U0QA 2B1HL 5I75C 4NN6C 5BQDA 4KHXH 5FECB 3FFCE 4NN7C 4JM2A 2PCFB 3AQXA 1ORSB 3FFCA 4MD0A 4I0PD 3OJVC 2R2CA 3SPHA 4G71B 4LARH 1AP2B 4X7TB 1DEDA 4ODUA 2WXNA 2ZUUA 4GRWB 4ONGL 3FQRB 1Z5LB 2NY2B 1WQVT 3DIFB 4JFEB 1OT1A 3HC3H 1EDHA 4H0GA 4I48A 4JHZA 4XXCC 3PDGA 2EIZA 1KGWA 2MKLC 1JFQH 2V7HA 5E6RB 5FDWB 1THAA 4F2MA 2WBJC 1PGRB 1XH0A 1CFVH 1F42A 4JG1H 3GGWA 1KBBA 1A7NL 2NDFA 3FUDA 5T3XH 3GEFA 1T03H 2IC2A 1KXTB 3FQTB 4L1HA 5DRNA 3VRJA 5JIQA 5DC0A 3T2NH 4KUZH 3U7WL 4JM2C 4M62H 2VZUA 5TH2A 3REWB 2VLRA 4PJHB 4NZTH 3JWDC 1G4RA 1IEBA 2TAAA 1ZVYA 2AANA 3W11D 4GG6B 1V8HA 5E8NA 4EOWH 1I8MA 4E0RA 3BPCB 3I50H 1FORL 2IAAC 1IE5A 1KNOA 3S7GA 2IOIA 4X42A 1QFWH 4IBQA 4BQ9A 3UERA 1G7IB 3NGBC 3RWCA 4GRLA 5FYJL 4YJZL 3P40A 1CURA 4Z3EA 4JFQA 5D1QC 4B9ZA 1B0RB 4PJGA 3IK2A 4U7KA 3CFDB 3NFPA 1EZSA 4P4RA 3VFTA 5FECA 1RJYA 2W92A 4X6CF 3EYQC 5DJZA 4YIQA 2Z7ZA 5C0JA 5C0BA 1ASOA 1XT5A 4BFOA 4PS7A 4WI4A 1OGTA 4O02A 4FRWA 1VGEL 1XIWA 3CFMA 1KEMH 1MG2C 3SCMD 1KSRA 1H6EA 3ARSA 2VDRB 4PREB 4M29A 4JJ5B 4EUPA 1LDPH 3P0VH 4LKXB 1DJHA 2E0PA 2NZ1A 5IMMB 2L7UA 4RGOH 3B2UD 4M00A 5CMAA 4KAQL 2C1PB 1RUAL 5BO0D 3EOBA 1HSBB 4GSRA 4GP4B 3GMMA 4HQQH 4G59C 3FTVA 3VMNA 4RX4A 1UWEL 3SE9L 3IWVA 1BMGA 1UM6L 4KTDH 3SYAA 2C34A 1R5WA 4FX5A 2VDML 1TZIB 3QJFA 2QSVA 2J2ZA 3HI1B 5I6KA 2HH0H 4PJDE 4DOHB 1U8PA 4IU3B 3CSYB 2GUOB 3GEWB 5I8OL 5J5EA 5L2JB 4QAWA 6PCYA 2OW7A 3TWCL 1KCVL 4FD0A 3LZQA 4N8UA 2IDUA 1JPFB 2DTMH 3MBXH 4O2CA 1GS7A 4JO3L 4JY6B 5I73C 4GW4A 3ULAB 2UWEE 5EU5B 2RCSL 2YD5A 3BKJL 4JRYB 4XNMA 1ETA1 1TJGH 3CXDL 5DJCA 2WKOA 4KQ4H 3MN8A 3VXUD 4AZ8A 5I1KL 1BFOB 1MKFA 4NPYB 2CUMA 3LPPA 1QSFA 4XVJH 3ULVC 2BM3A 2E6PA 3F3HA 3QDAA 5IVZA 2GAZA 1H9DA 4RFNC 3QIBB 2LFGA 2ICEB 4WEBH 4CN6A 4Z7VE 4W9IC 3NZUA 2BNRA 3KL5A 4HLJA 4XVUC 3ZTCC 5T5FH 1Q9KB 4ZFFA 2NY7L 3OF6A 1B0WA 3FAWA 1TU2A 2GBTA 4QXGH 4U1SA 4PJ7E 3K6SB 4P9MH 4MS8C 1BLNB 2Y0SA 3FUJA 4R97B 1YNKH 1I8AA 4AT6A 1SYVB 2IAND 2IAMA 3NPZB 2WZ6A 1FWXA 5D5MA 1J0KA 1F41A 1TZHA 3MCG1 4PYGA 2P49B 1VFUA 1FNSH 4M43L 2H6PA 2JLPA 3OKOA 4D8PA 2J44A 4JFFD 1JPST 1E7VA 1AVAA 3IN0A 1M7IB 1IV8A 1WFJA 4LHUD 1ITCA 2BPBA 1YC8A 4DK6A 4DVBB 1NC2B 2VDOL 1ACXA 3ARZA 3ZKSD 1YEHL 2Y1AA 4RDBA 5E2WL 2HSIA 3LRSA 3LZOA 3MLVL 4N1CA 5F1NA 1G6RL 5IEHA 3ULVE 4LLYA 4QTHA 2N0MA 1RUPH 2YEQA 5IJDC 5B8CA 2Y7LA 2F7QA 3FL7A 3M8OL 2FX7H 4WZ9A 2BOCA 3CX5