4FFZA

Crystal structure of denv1-e111 fab fragment bound to denv-1 diii (western pacific-74 strain).
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
YVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords Envelope protein E
publication title Structural Basis of Differential Neutralization of DENV-1 Genotypes by an Antibody that Recognizes a Cryptic Epitope.
pubmed doi rcsb
source organism Dengue virus 1
total genus 12
structure length 97
sequence length 97
chains with identical sequence X
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ffzA00
3J27A 1Z3RA 5KVEE 3N43F 2I69A 2V33A 1Z66A 1TG8A 4UTCA 2P5PA 4UT9A 5H37A 3UAJA 3UYPB 3UZEC 2JV6A 2R69A 3P54A 3WE1A 5LBVA 2HG0A 2R29A 2H0PA 5KVGE 1RERA 1OKEA 3UZQB 4FG0A 5LBSA 1PJWA 3C6EA 1OK8A 3N42F 4FFYA 4ALAC 5LCVA 1URZA 4X42A 4L5FE 5GZNA 4BZ2A 3UZVA 2JSFA 4UTAA 3G7TA 5IREA 4AM0Q 1ZTXE 2GG1A 5AAWC 5JHLA 4AL8C 2ALAA 5JHMA 5GZOA 3J2PA 5B1CA 5KVFE 1UZGA 4UTBA 4UT6A 3VTTA 3N40F 3N41F 4BZ1A 3MUUA 3IRCA 1OANA 1S6NA 3N44F 1SVBA 4GSXA 2JQMA 5KVDE 3C5XA 5AAMC 5IZ7A 4FFZA 4GT0A
chains in the Genus database with same CATH superfamily
2AV1B 4IIZA 1IAKB 4MJID 4NHCL 3N43F 5JNYB 3GSNB 3WIHL 5AOZA 4CU6A 5JPMC 3SE8L 2IG2L 3U30B 4H1LH 2AQPA 3AC0A 3H7BA 4JO2H 1V3JA 2E75C 4PJGE 3GB7B 1XX9C 1MRCH 3CSYB 3X12A 1E4KA 4GBXD 2XJLA 2XBDA 2FHBA 1ZEAL 4NPYB 1RZGB 3MGAA 4LGPB 4DW2H 2CJ3A 4LU5L 2XNAB 2Z4QA 2DQEH 4KZDL 4OBRA 3F64A 1U8KA 4NJAL 4LVHB 2FBRA 1X5MA 4BZ1L 1TJMA 5EU7C 4NWTH 5CJ8A 4BQBA 3QXUA 1AKJB 1F6FB 3BSZL 4HJJL 5CR8A 5EBWB 5KBLA 5GHWL 1RERA 3NGBC 1BYPA 4FA8A 1MDAA 5ABAA 3GTVA 4KPHH 2FO8A 3NSDA 2DQTL 4OD2B 1GGCL 4X4ME 2DQUL 3WKYA 4J1UA 2MPAL 4FHBD 2AMUA 3L1OH 1L6XA 3KL5A 2A9NH 3Q1SH 5LCVA 5E6IB 5I6PA 4L5FE 4BCYA 4F7EA 1J0YA 2Y3AA 4MZIA 3D2UD 3OB8A 2HFFA 4ALAL 1WBYA 1FCCA 4KOCA 4C4KO 4AE0A 3MLWH 4P4RA 4GUOA 4PMFA 4P9HH 5IF0A 3KPSE 2NLJB 3SBQA 1YMHB 3I50H 4NO3B 3VTAA 3MV7D 1D9KC 4QXTA 2G0LA 2Y5TB 3HFFA 2LLGA 4XP9L 3EGDA 3L95B 4P2OB 4CMHB 1H3VA 3MA7A 3SHSA 4J8RB 3KDPB 1RZ7L 5SWZA 3P2BA 2G0KA 2HWZH 3VFVB 5GIRB 5E1AB 3KXFD 3MJ9H 3FCSA 3VFNB 4NUMA 2F53B 1IU1A 4F5CA 5FYLH 2XWDA 3RTLA 4X6BB 5BZXA 1C08A 5KBDA 4M43H 1NAKL 4D7PA 1KN4H 3PV6A 5D96B 4Z3TA 4L8BA 1WWWX 2AXJA 3WJJC 2R1WA 3ZIMA 5CIPB 4MS8D 4DN4H 1JRHI 4FLQA 4XODA 3PJSA 1T3FA 4UQ2B 2VWEE 1FSKB 4XNMB 2A9BA 2GEQA 1A7PH 1YEGL 3ARBD 4KX7A 8FABB 2I7SA 4FYQA 1HHJB 1PKQB 3GJFH 4ZYKA 4GBXC 3ZL1A 1CPUA 1EJ8A 3T6WA 4X6FA 1NC4B 1T1XA 2BLFA 1MQKH 2ZCHL 5HHNB 4OH2A 1JERA 4Y4FD 4YPGA 1G1YA 4B95C 4NQEA 4QRRE 2PPEA 1A6VH 4I1RA 4OM0L 5AOIA 3P2TA 2BJMH 2YSSB 5I1CL 1L0XA 5JORB 1FV1A 2FLRT 3ARED 2APSA 4FQJH 1EXUB 4XNYL 5DDHB 4L8CB 4BQ8A 1JNJA 3QDMB 1QKZL 3V0EA 4BUHA 1S7SB 4G9FD 3VXPA 4WEEA 1LE5A 3WIFB 4YEEA 3FH7A 5HHOD 2BNRE 3RDJA 5D5MA 5IWLC 1J88A 4PSPA 3QCUL 3GSNL 3NP4A 1FHNA 3L5XL 3TXAA 1K6QH 1XB6A 2M83A 2PR9A 1QO3B 1OWWA 3RDTC 2BS8A 5G4OA 5BRQA 4KROB 1OPGH 1MFDL 3HZVA 1JK9A 3VRIB 4CSTA 4FYSA 1WPCA 4LPTA 5D2NA 1EVTC 3DBXB 1PDKA 3GXNA 4PJFE 1BIHA 4WW2F 2BNUB 1RUAH 1MJJB 1PCSA 2F2HA 3LXAA 1M7XA 4FP8L 5FUOL 1OQXA 2C9QA 1CDIA 1JWUA 1ZWIA 2IXQB 3VQ1C 4BZ2A 1BVKA 4BSVA 5EEXA 3COOA 2YEZA 4JS7A 2LAGB 4A38A 1YEIL 1D7FA 3QFJD 4OCNC 1UUSA 4P23D 4WK4B 3OR6B 4PJXB 3T4AC 2YRLA 1BECA 2A38A 4NKDB 4QOKD 4HS6A 3C5SA 4PTTB 4X9YA 3UADA 3K80A 3ETTA 4XMXA 2VDKH 3JWDC 3AM8A 2N56A 2QQKL 4CDGC 2BCKB 4ZNCD 4M7JH 2ILLA 1KNOA 4KJYB 1HH9B 1KN2H 3LRKA 1NFAA 3ARBC 2YAHA 4ZMAT 1U8PB 4QF1A 1HN1A 4NCC2 1U58A 3DUSB 4UMGA 2DIJA 4XBGA 3F7PC 4DP0X 4R4BA 5DWUL 1JVOA 5I1KH 4S1RL 3AG4B 1QYGH 3QQXA 1FLRH 4Y4FC 1U8IB 1KBGL 4G1EB 4OCWL 4PGCA 1NFKA 4JMXA 3FCUB 1L9OA 4ZMWA 1P1ZB 3VGHA 5GRYA 4LSUL 5CWSB 5C0DB 1CGSL 1L7IH 2TSBA 1KFAH 1BQRA 2ZOKA 4KI5D 3T0AA 4HUKB 4OV5A 2O6FA 5FYKL 1YPZE 2QSCH 4EZMA 2V5TA 3QZNA 5B22A 5I15H 5H94B 4DZBA 1F6AA 1BZ7A 2MSPA 4P46D 3GRGA 1C5DA 1QR1A 1D5BA 4R90L 2PCFB 4H1LG 1FGVL 1YMMD 3QUXA 3NA9L 4EIBA 3DVGA 4HOMA 2NYYD 1GR7A 4H1LA 5E2UL 2AK1H 1YEHH 4L48A 1PZ5B 1YYLL 2VLLA 3POCA 2HX9A 3UMTA 4FCHA 2J12B 1S7UB 1G94A 2Z35B 3QNYB 3JWOC 2MTAA 3F5WA 2OYKA 4PJDE 4HWBH 2EUVA 1ADQH 1G5GA 2XN0A 3MRBB 4YHOL 1V7NH 5DTFA 2ZKWA 1KPRB 1J5OH 1HHHB 1NUGA 3ARGB 5GS1C 3RZCC 4P23C 2ZWZA 1PIFA 3TCLB 4DP4X 3B9VA 3FKUS 5FUCC 4FDWA 3QHZH 3BC9A 2QGEA 4PW3A 3B8YA 4GRLA 3LKOA 4XBEL 2YPVH 5IBLD 1UT2A 5JOFA 2ENQA 1WG3A 4MMZC 3TP4A 4F20A 1VLXA 3EOBA 5DJ6A 5AW2B 2FL5A 1NL0L 5I6XC 5JW5B 1FN4B 2GK0B 5HDWA 1VCAA 4N1CA 3RX5A 2JCCF 4N2FA 2OJZL 3CZKA 4D0DB 5HHMB 5JOEA 2AHIA 1ES0B 5DYOA 2WLIB 1CTOA 4B5ZA 1HI6B 4RGOL 3WXWH 3CK0H 1OP3H 1P5VA 4NT6A 3CDGA 5KAQF 4RAVA 4LAJH 2DL2A 1RZIB 4UBDD 2LE9A 2RGSA 1AH1A 2YKLL 3J7HA 4KI5C 3AY4A 4ZODA 2WQ8A 1DDTA 1ACCA 3MJ9A 4MA8H 2Q2EB 1E40A 5CAYB 4JCLA 2G75A 4OBSA 3WFEL 1SNRA 4A1RA 2BRQA 4QTIL 4HEPA 1W2KT 3X1GA 1NCAH 3WY2A 2P5EB 1MJ7H 4TUKL 1U8QB 3MNVA 4MB1A 3IT8D 1BEXA 3IB4A 4P46C 4X6EB 3U46B 1W15A 1S78D 2WC7A 5HHXH 4OFQA 5ESAA 5F6IC 1XFPA 1P7KA 2ESVB 1AJ7L 4KXZI 2CK2A 3K6FA 5GRUH 3RA7L 2JQMA 3RQ3A 3WV0A 2NYYC 1F1DA 4XHJD 3DURA 1UKSA 1ZT4B 4NFDA 2PW2B 5TQ0H 3A23A 4LL9A 4RFNB 4LQFL 3LH2H 1CFTB 4PJ9D 1ROWA 3MLUL 4LLWA 2NX5D 4GXVH 4YSEA 5FFLA 2BSSB 1U42A 2MKWA 1XMWA 3S5LB 4RDQG 7PAZA 1FFNA 3B34A 1KGCD 3QHFL 1JN6A 4LPUA 3FOLA 5EULV 4Z95L 1OARH 2W60B 3EHBB 4XXWC 1MHCA 3IGAB 3W3BA 3MLYL 1GZQB 4ZMPA 3U0PA 4W6YB 3LVEA 3G6JA 2FK9A 2VITA 1DE4A 5IP4A 2TRYA 3AZUA 5T1JA 3KH3A 2PWEA 3HFML 3HBGA 3FFCE 3UAJD 1NFDB 1Z66A 5CEZE 3FDWA 2ZONA 4JFZL 2A77L 4N90E 2FYYA 4Z3FA 5IOKA 5KN5A 4V1DA 5IBLC 1ROCA 2XVGA 3FT3A 3IGKA 5JW4M 4FQXB 1RLBA 4JDEA 4R5XA 4Z8FH 1JRHH 5ETUB 5L2KE 2VTFA 4WHTB 5AAMA 1FL6A 5IKCB 2DJMA 2XV2A 4IRZL 4L3CA 2G5RA 3UIZA 3B2XA 3TPKA 3HI5L 1A2YA 3GMLA 2Z92A 1DANT 3BUIA 3STZA 1UEYA 2CLRA 4UBDC 1WAAE 2FX7L 1W91A 3IFOA 3VU2A 2UUDH 3CSPA 3AWGA 5LQBL 4I5BB 4FS0A 5I8OH 4KTDL 4R96B 4TQIA 4G8GE 5LN8A 3PL6B 4YXLH 3DOIA 5AB1A 2X70B 4DKTA 5D72L 3AQZA 2B0SL 1Q9OA 4HJTA 1XR8A 4KWUA 2ADFL 3GXIA 3O4LB 4W9HC 1J8HB 3LNFA 5D7LE 4LCVA 1DQML 4XHJC 5DD3H 2H6UA 2EVJA 2CO6A 3HNSL 1NWOA 5JPMB 2NOYA 2F53E 2UX6A 1UD6A 3F7YA 3E6FB 1RJZB 3BKYH 1A7RH 2Z0BA 3GMPA 1IGYA 2WIIA 5GGRA 5E9DA 2WXKA 4JDVB 3F12B 5IHZA 3WN5C 2MOGA 3EJCA 3M45A 4Y5VA 1LQBC 1WD8A 4B9IA 1IEBB 2F0CA 3QCTL 2C8NA 4BFIA 4Z7QF 3US1A 4E68A 4TRPL 3X14A 5I1DB 3VD0A 5IHHA 3UAJC 1K2DA 3H9SE 2C7UA 1ZSDB 3IJ8A 2FO1A 3NJIA 4R5TA 5FGBA 1X5KA 2VQ1A 1TQCC 2FQDA 3DTDA 1KBKA 2R2BB 3QNXA 4LE8A 4ABQA 3HAEH 5I71C 4WI8A 3NGBB 3GC3A 3LZRA 4NP4L 3ZKXC 4WNQB 5KVEE 3ELQA 3I6GA 1YC7A 4YDVB 4ZUSB 2WGXA 2FD6H 1DBJH 4HJIA 1Q1PA 4AIEA 4D0BA 5T3ZD 1S9VB 3BWAA 2D31A 4EN2A 1MJUL 2J1KA 1SQ2N 4JFFD 3NBNA 1J12A 4ERSL 4XMTA 5FKPA 3B7UX 4NEHB 4U1LB 1N9PA 4FGMA 3K0YA 5C2BL 1INEL 5DK0B 1RUKL 1S9WA 1XGRB 2PO6D 2OMUB 5IB1A 5E6ZA 4YDKL 1KXHA 1D9KB 3GF8A 4DPBX 5AWNH 2QKIA 2MCAA 4HWBA 1EGJH 5B39G 1ADQA 4LPWA 3R1GL 2P9RA 3L17A 3WE1A 1EHKB 3PRZA 5DMKB 4MNQB 3S96A 1AO7E 2Y69B 1RU9L 3C08L 1GSMA 2J44A 3NDZE 3U4KA 2AK4B 1PJ9A 1WIPA 2QVMA 2XN9A 2CDFB 5C0IB 2UWEB 3OPZL 1ZXKA 1S7WB 5AW5B 3CXHJ 1OE3A 2YPVA 3QIWA 4XAKD 4CC1A 1HXMB 4HF5L 2UZIL 4MJIB 1EJOL 4IBWA 5E08L 1FVDA 2I07B 5BNXD 4JRYA 1IV8A 2R2HA 1G0XA 5A1AA 3MCKB 2ZG2A 5HDQH 5HYJD 3GSQB 4HJGB 3GS4A 3IMTA 3BZFB 1FZJB 3C60D 1UCTA 2VE6A 4YHKH 2FB4L 3LH8A 3R19A 4GBXB 4QD2E 3MTRA 3F58H 1G7PA 1UM5H 2A4ZA 5JHAA 2LU4A 2EDXA 3ARQA 3CVHH 1R5VB 4EVNA 3EGXB 3UXFA 1CF8H 2XKNA 4LZKA 4AUYA 2WGNB 2QVFB 2WSDA 3KW7A 3NP3A 1SEBB 4AQZA 3GRWH 4F8TA 3VSTA 1I4FA 1Z9SA 1JNHA 1MJ8H 1X9UA 2JELL 2WLHA 1UVQA 5KUMA 3I9GH 4U1JA 1YYCA 4MA1B 3HMXH 1UACH 4YSAA 3WS3B 4AENB 5E70A 1Q8MA 1AD0A 4X4XA 3CCHB 3QQ4A 4EZKA 1TJGH 4GP4B 3CFNA 4WEUD 3EZ8A 1C12A 4TQEH 4WHYH 1UXMA 3SPVB 3FT1A 3JTSB 4Y89A 5DJDA 1CD1B 4NO0D 1AIZA 4PS8A 2A6IA 3RDTB 2VSCA 5E8NB 1XSIA 4HH9A 1N3NB 3MBWA 2H3NA 1CGYA 1X9QA 1YUHB 4WO0A 3B8SA 5C3LD 3QORA 2PO6C 4UU9A 3VXUA 1TKWB 3BFWA 3MV7B 1RP9A 3OTTA 5TH2B 3SGEI 3D30A 4N8CL 1HKLL 1R3KB 4O2CB 4AH2B 1RHFA 1Y6NR 5F96H 3RY5A 5IIEA 5C0EB 3SB3A 2GIYA 1N5YH 3PLYA 3N1FC 3RX8A 1SBBA 1DVFC 5T1LB 4ZQKB 5EZJA 2NMSA 3D52A 3LS5H 4OFYA 2D2OA 2D0FA 3TWCH 1RUMH 3H3PL 1HU8A 2Y2YA 2W80C 1Z9NA 2B14A 4AGNA 3T4AB 2KPWA 1USZA 3U4BL 1YECL 4Y2NA 3WFHA 2EKSA 3LQAH 2PP9A 2OTUA 5DFAA 4AM0B 4KXZH 4Q2ZA 3BH9B 3RWEA 4YHPB 3SYPA 1L9MA 4JJOA 2C3VA 4M56A 4UYPA 4D2NA 2OQJA 1T83A 1KCUL 3ULVH 1Y1UA 3C60C 2OULB 3ARBB 3W0WD 3QP3A 1FHGA 4DKAA 5F9DC 1EO7A 4UUJB 4Z7WF 35C8H 4K2UL 2Y07H 4LOFA 1WGOA 3LZFL 1ZK9A 3PWUA 1A47A 1I1YA 4K8RD 4NWUL 4Y4FB 5AUMA 1BAWA 1L7TH 2W9LA 3U25A 1CL7I 5GSRA 2DL9A 3C8HA 2F15A 4UINH 5FIEA 3EJYD 3O0RL 2ZKHH 2DQMA 4HUXB 2CCLA 3HEIB 3O3AA 3OKLB 4EI0A 3D87B 4XCEA 4M9OA 5B7FA 1OAJA 1TUPA 4AYSA 5GGUB 1BZOA 3EFOA 4R4FH 5SX5K 5DS8A 2P28B 3CC5A 4NUPA 2V3EA 4G9FB 4N0YL 2FT8A 3T2QA 1VDGA 2FAUA 5HHOB 2VGLM 3BYYA 3VGEA 2YXMA 1TZOA 1NEZG 1WYJA 3IDGA 3KPLA 2V4LA 1QFPA 1NAMH 2VW7A 3N41B 2IH9A 4R0LA 5LAPA 3SOTA 3N6YA 2V3FA 3FO0L 3QVAA 2DWXA 3RZWA 3EDFA 1NEZA 5E4EB 4JY6B 1IMHC 1CLYH 4U1SA 2WAHA 4HPYH 2WLLA 4KNTA 4PRNA 1TIUA 4P07A 5JQIB 1L6PA 2YQ3A 2XZCL 3MQIA 1OCWH 2D7PA 3LIZH 3QEQE 2FX9L 3TA3B 1UWEL 5BJTA 1SN2A 4NUGH 4FADA 4L5FH 3UTTE 4MJ5A 1JCVA 3BP4A 2X0UA 3IRPX 3VDBA 1XXFC 1CI3M 1M9SA 4GG6A 2LU3A 2J4WH 5JOPE 4AQ8C 3SKNA 2YD9A 5C0BA 5INDB 5D1QE 3HAEG 3ORJA 5J06A 2LQRA 1NGXA 3RZCB 1XV8A 4MGXA 5GS1B 2ICWB 2IDSA 4P23B 4KNQA 4QOKB 4HGKC 3TA4D 4YDJA 1C1EH 1PEWA 3HAEA 5I8EA 3VVWA 3B9AA 1KTKE 4JRFA 5EIQA 5EOQL 5L2JA 2ROYA 5E7BA 5FA3A 3OKMA 1IL1A 1QFUL 1E27B 2K9UA 4S0HA 2CXKA 4QAWA 3CSFA 3VWJD 4IDLA 4MMZB 3WBDA 3QJXA 3G5VA 4PV9A 3BOVA 3LRSB 4P5RA 3DUUB 2RCSL 1I8KA 4ODSL 4WWKA 4G6KL 3VFWA 1SJEA 2PR4L 4WSKA 4GSUA 1V05A 1TG8A 3UPRA 3HG1D 1MREH 1E9OB 3LX9A 4JN2B 4K8RC 2ZXDA 5EFIA 3STBA 1DVTA 1LNUB 1KSRA 1UH2A 2APXA 5KJ4A 2OTWA 1EGJA 2OXGB 3EJYC 2ZYHA 1I9EA 5CJQH 2CJUL 4OGXH 5B3NA 4AZ8B 5LGJB 1Z9PA 4WAFA 2CJSA 5ECGA 1A4CA 1NLDL 3ECQA 2XC8A 4XMWA 2FYVA 4N0UA 4Z5RA 2BP8A 2J55A 4W9CC 1FO0B 3JWDL 3TEYA 5KSUA 1JK8A 5EWIL 1M05B 5DHDA 3W39A 2X6VA 4ZFFA 1DJHA 4N20A 3KLAB 1MKFA 4AQAB 5F6IB 4MCZB 3ZYIA 3QULA 1CU4L 3H85A 4PLKD 4X8GA 4PG2A 5CO1A 5T3XL 4B3EA 1HEHC 1NWPA 1BAFL 2J1XA 3QBTB 2L8AA 3NTCH 4TNVK 4EIZC 3VXRB 4AV4A 1S2EA 5AG8A 5EG6C 5EZIH 5E2WH 3OHMB 1EEZA 1AG6A 4RMWA 3FB8A 5TPWL 4DGUA 3CVHA 5CGMA 5F7DB 1OP5H 2ZCKL 4H8WH 1L9QA 2WQSA 3FUFA 3O6KH 4U05A 4X5LA 4FZEL 5EPMB 2B4CL 2EYRB 2L3BA 3SE9L 3GRWA 3SBPA 3QB7C 3QT2A 3N40F 5FDWB 1D6VL 2P8MA 5DGRA 2J56A 4G7VL 3INUH 4N5UA 2GTWB 1CFVL 1NBQA 3HMXA 5CSBA 2R29L 4JPKH 4LCWD 3WLBA 2OI9C 4WHYG 2E86A 3MRKA 5MI0C 1IKFH 3HNTL 1D5ZA 3IETB 4G42B 3ZRFC 4FLRA 4NYLB 1O0VA 4IMLB 3PAUA 5E2TL 4NJ9L 2ZUTA 3UYRH 3FN3A 2CM6A 1WIOA 5AAPA 1MRDH 1PZSA 3VFUA 3JWOL 3OKNA 2Y7LA 5F0PB 3V6ZA 5CN2A 3F6IA 3QDJB 4RISH 3F00A 3ARRA 2OMVB 2EDKA 5HBBA 4JJHA 3MZGB 3WDHA 3UX9B 1BQ5A 3BI9X 4YHZH 3MKKA 1LMIA 2AV7B 3IXAB 4N0FA 3L3JA 4AITA 3LTVA 3L3GB 4O00A 4G8FB 3SDXA 2BS9A 4PW4A 4C83B 4G59C 5BVPH 4X98B 2P5WD 4RSYA 2WZ0A 5E7FA 1FPTL 2WBXA 2AJYL 2P52A 4NHCH 3U36A 1A6WL 3S4SG 3MLSL 4BKLB 1QTPA 1UD3A 4RWYH 4ES8A 1AQKL 1TDQA 4PLKC 2HG5B 3QIBB 4GSQA 5I16A 2DQCL 3S4SA 1YA5A 3T1FB 4GW1B 2NSXA 4LRNL 4K5OA 2BNQB 2BP5M 5C9KA 3IJHB 5FO7B 5F7UA 3IDNA 5HSFA 3IAPA 2X2IA 4HFUH 4OZIF 2NX5B 3VG0L 3EYVB 3HVDA 4F7CA 2FGWL 1AXSA 1MVFA 3QA3B 4S1DC 5DFWH 3RHWF 1JGLH 3SGEH 3IGFA 3NIFE 3BEVB 1FDLL 5IFJB 1J8KA 3K0WA 3QCVH 5EEWA 2I5YH 1X7SA 3C5ZD 4NQCE 3L5WB 4KJWD 5J12C 5AB0A 5DQDH 4NKOA 4PJGA 5HPMA 4IGBD 1NANI 3SKJL 5I17B 1IGFL 3T0EE 1PLCA 5FGRA 1F56A 3SCMA 4E5XB 3QE5A 4KRPD 5DGQA 1FO0L 2GTZA 3TX4A 4E9RA 4Y7MA 2A0LD 1VKXB 1TQCB 1YZZA 1ZTXE 2DQUH 2MPAH 1S7QA 5DA0B 1OCOB 1KTDB 3IFPA 3TPUB 3S35L 4PP2B 3BAKA 4U1NB 1NAMA 3I2CL 3LV3B 3D8MA 3ZKXB 4NQVB 2XRAL 5BS0E 3NJXA 1CTMA 4HCRA 3LZLA 4BWWA 5KYUA 1FYTD 5AB9A 2ZXBA 1HZHL 2YPLD 6FABH 1QLEB 1XCQA 4FHKA 3QO1A 1JI1A 1JZ8A 4F91B 4MA3B 4HXAH 3PGCB 2VXVH 3ZYJA 1AD9A 1NC2D 4X4MA 4PRHB 3LIZA 1BM3H 5GRWA 3TESA 3ZR6A 5IJVB 2EC9U 3GM8A 1RZ7H 3UBXI 1UZ6F 3V5HA 1CL7H 2FNBA 3SDCD 3SDDB 2P7TB 4UNUA 1JZ5A 5AW7B 1JPSH 1Z9MA 3QGVA 2LOEA 5K1JA 3AS0A 4NAMA 5IB4B 2WLJA 3KPSA 5CU9A 2R23B 4AL8H 1X7TA 2E9JA 2PPDA 3IKCA 4XP5L 3U7AA 4X4YB 2AKRA 2K1MA 1XZ0B 2CRMA 3GMRB 3S48A 4ELME 5DMJB 1B90A 3OXSB 5ANMB 1OAYL 3L45A 1PX8A 4U1GC 3EF7A 3MLXL 4CUCA 3C2SA 2JKWA 3ARFA 2E9WA 4OLVL 5IR1B 1KIUB 3IFLL 3K81A 4FQIH 3OKKA 1Q94A 4ORZC 4OZHE 5EU3A 3VXOA 4KK6D 4AT6B 1NBYA 2E74C 1C5CL 4TLTA 4U3SA 2CGZA 2WY3B 3AAZB 5I1IH 3C5ZC 2GJPA 1PBYA 4MD0B 3RWGA 3GMQB 2CKNA 3GFUA 3MRRA 3AQXA 3FYIB 5GJSL 4BK5A 3BP7A 4IGBC 3ARVA 4X6CF 4YSTA 1MCSA 1QPKA 4EBQH 5EF2A 4U2YA 1AXTH 1DEEA 2FE0A 2WBJC 1F3DJ 2A0LC 2VB5A 4KKAD 4FFYH 2KDYA 4FQ1H 4S2SB 1ZJBA 3TN0B 4QRRA 5MERA 1F3DH 3UAFA 4FA6A 4HUWB 5DJZB 3WMPA 4HOWA 3NN8B 2WXGA 1IBDA 3MBEB 4B9GA 4WFEE 2EYSB 3F7KA 4YFDB 2AFNA 5B8CC 5CEZH 4I48B 4B53A 5J3HD 5JDSB 2P80D 2TRHA 1HQRB 4MB4A 1RK1B 2XZAL 3MMEA 2HLAB 2BNRA 1MY7A 4G3YH 4X5RA 4E9YA 1Y1DA 2HFEA 2ZWNA 1SHMA 2O6PA 1XGUA 3IS1X 5KVFL 2PO6B 2WTRB 4DHLA 3BZEA 4BWUA 3SDCC 3KE0A 3BDXA 4YDLC 2R2CA 3AB0C 1U8LA 4AGMA 4QXGH 1FFPA 4O58H 3WSQL 1KEGL 1AG0A 5EU6B 3VRLE 1YEIH 1DLFH 1DVFB 4IQHA 4L37A 4YQXL 2WO2B 1OAQL 4PJFA 1UB6A 5AKRA 1N2RB 4ELDA 2ZYSA 1ZA6A 1PLGL 5C3TA 3UZVB 1RZPA 4A2GA 1J8RA 1G9NL 2C9AA 4RGNE 1EZUA 2CKBH 4MAYD 3RWJB 1UH4A 3NJGA 4G8EA 4PR5B 5GGSB 3IKKA 5EN2A 1AZNA 3AGWA 5B3JE 4OI8A 2DKMA 4PJCE 4K7PL 2YJQA 2EH7H 2X89D 1QLEL 1JUFA 3BPNC 5I1HL 5EEVA 2VYRE 4KK6C 5DWUH 5HYJB 4CVWA 3KEHA 1YNKH 2BVPB 5FX3A 3C60B 4NNXA 4YHIA 2BSBA 1BBDL 2WJ7A 3UTPD 3SE3A 4FI7A 3TF7C 1IBFA 5D4JA 3CMOH 4IJ3C 1GTFA 3HS0A 3U9UB 1IT9L 3NABL 1IC7L 4QTHA 3G5XB 4CNIB 3KLSA 1SZNA 3BD5A 4LSUH 3OAZK 3TV3L 4HAGA 4P9MH 4QEGA 2CUHA 3K4DA 2F74A 4XN5A 2WXOA 1Z5LA 3CX2A 1QABA 1RH8A 1KWKA 5EO9B 5EO0B 4JRXB 2FJFA 3EGSB 5I5IA 2WCGA 4OM1H 1XBDA 3NFPB 5ESVA 4PGZA 2PYFA 3I74A 3DA0A 3Q8BA 1WTLA 4KKAC 5E51A 2OSXA 2XX0A 2VAJA 4WW1B 3VUAA 3WFBH 4OI9A 1OSPH 2XQBL 3S34H 4R90H 1RPQA 3P54A 4HUUA 3OHXA 4KZ0A 4AEFA 3FONB 3SIKA 3IAGC 1FZOA 2PYEE 1IAII 1NGQL 2Y5EA 3ME0A 1YPZA 5J3HC 2C9SA 1KZYA 5AENA 3WNJA 4HLJA 4OF5A 1EBAA 4NO0B 3L3HA 4HGWA 4YDIH 5E8PB 1ZDQA 3F6LA 3TO4D 3UJJL 1GJIA 2X6BA 3UMNA 5I6LA 5HGBB 3D0VA 5KVEH 4XC3H 3JYCA 4AK2A 3S3CB 4P4KD 3ULSB 4XH2B 5DHVB 3ZJAA 4P5KA 5FO8A 2JXMB 1QLFA 3QIUD 4HC1H 2C1OB 1EEYB 2AZAA 3FB6B 5KSBF 3DX9A 1ETZB 4DEWA 3WU1A 4QT5A 1MNUL 2XJKA 1UOLA 5IBUG 2WYIA 3MLTB 3TM6A 1T4KA 1OTUD 2XWJB 2FO4A 3V4LA 4PJDA 4MAYC 5FPIA 3MXVL 4PWFA 1NUDA 3GXFA 5E8DH 1Z0NA 1KACB 3K6IA 3U0TB 1EXGA 3Q9PA 1ND0A 3QRGL 5FUZL 1KGXA 2CGRL 5T3ZL 1I7ZA 3SY0B 1QASA 3U0WH 2FJHA 4EDXA 1FORL 5E5UB 1YNTF 3KLDA 1C5BH 3EH5B 4HDIA 3CPLA 2H0JA 3MCLL 3WY3A 3H6JA 1IGML 1QSEB 5GRJL 3ZU8A 3W0WB 4HLEA 4AJWA 1KCVH 3MX0A 1T66D 1IM3A 4X99A 3VYOA 1F4YL 1L5GB 1L9TA 2CIKB 2YN5A 1E4WL 3D39D 3QJQB 2WWKT 5I76B 5T1DL 5JDJA 1ERNA 3TURA 3KYMA 5CJOL 1DQDL 1N8ZB 1VPOL 2VLME 3GSXB 2EILB 1NANH 4AJVA 5I74B 2FH8A 1G9EA 1KDIA 5I8KH 2H4EA 4RAUB 4FL4C 4JVPA 2O6EA 3W82A 4OSUL 4AEIL 1KLFA 5D1ZC 4HK3J 5B21A 3QC6X 3KLLA 3TZVA 1M53A 2VDNB 4G7QB 4CGUB 3AT8A 3IYLW 4OGYL 2I60L 4U0RC 4NNPH 1GYCA 5TDOA 3QPXH 5JQ6L 3EH3B 4QRQA 5KYXB 2GUOA 2GSIA 4LQFH 3UERA 4XVSL 4E9XA 5JW4N 1KCBA 4EZLA 3TO4C 2BSDA 1JHTA 1MLBB 4HWEH 3DOSA 1PAZA 3PFQA 3FSZA 1H3XA 5FCSH 5D7IE 4Z95H 5KEZA 4P4KC 3MRPB 1GMIA 1NCCL 1Y18B 2LVCA 2KERA 3EDKA 4TUOA 3QIUC 4MD5B 4PRID 1KZQA 5F2FA 4B0MM 5MEQA 2IOIA 2VN6A 2OLDA 3WEAA 4L4TD 4ZOEA 4X0KA 1E8XA 4HT1L 4DN3H 4G6FD 2ZYIA 2VLKD 2MCMA 3OGCB 3QSKB 2W91A 4ZI8A 1OW0C 4ZG1A 4Z6AT 1CD0A 1OTUC 4K15A 3RAJL 3NCYP 4FFYA 1INQB 1WTGT 2G3MA 1QHPA 4KXDA 3OJMB 4FD0A 1SM3H 4PJHB 2HRPL 3HVNA 4BH7A 2J1ZA 4I89A 4WGWB 4UWQB 2BP3A 4LIQE 3FFCA 1UOVA 3DX2A 4LCCA 3APNA 3RNKA 3RWFB 1U9KA 2ZAIA 4M03A 4KQ3L 2ZXEB 4N1EA 2L4OA 4UDTA 3QG6B 2GUYA 1T66C 3EZJB 3NH7L 3QDGB 1WBXB 4GY4A 1F18A 2OMWA 4XVOA 5FXCH 2FX7H 5L2KA 3DX7B 2JWYA 4ZXBD 4BFGA 2XTJE 4WCYL 2A4EA 1B9ZA 1TQTA 1EMTH 3MNWB 3WL9A 3VI3B 1GAFL 2EIBA 3CMGA 2Z91A 1OALA 3DMMD 4BD4A 5CJ5A 1SJVA 2RB8A 3IE9A 1JGIA 5SWQA 3L7EB 3DVIA 4N8PA 3ULUE 3OLIA 2Q5BA 3BWSA 3SKMA 1NCWL 4ODVL 3CSBA 4D8PB 5A16A 4Z7NF 4I0PB 3H54A 4XRCB 4X5PA 1WAAA 3QUZA 3ZL4L 5H2BB 4XO8A 2CKBA 2YD0A 25C8L 3DNKA 4GSXA 5TDPA 3TYGL 2EUZA 4G8GA 4WFGE 4YPJA 4QXVA 4RRPG 3PHQA 1F45A 3AW5A 3PJNA 1NEUA 2IPTH 4OTXH 4KFMA 4AV0A 3FQTB 5L8KB 3E7JA 3QR1A 1CDHA 2NY5H 4AQEB 4ZUUB 4RRPA 4QIRA 3IDJA 4M8UA 5DRNA 5AVXB 3TIDB 3D4GA 1PSKL 4GRMA 4N8VG 1ETJA 2OJEA 2OMZB 3I3BA 4ODUB 4LP4A 5D7LA 5F71A 1WBZB 4EI5A 5DVOA 4N8VA 2VRAA 3D33A 3QCTH 1ZGLP 3BW9A 3K71A 3FFDA 1BFOA 2GFBB 4TRPH 5AW0B 4Y0GA 4O02B 5K1NA 4IJTA 1YLBB 5J12B 1A9BA 4D0CB 3A6OA 1T5XB 4AYEC 1MCKA 1T1WA 3H0TB 3NIGF 4NFBA 5IVXF 1T7YA 4BBWA 4IBSA 2VDNL 3BZ4A 3TJEH 3FB5B 2OS7A 4NKIH 1TFPA 3UZEC 1HSAB 4LCWB 3HUJF 1MFUA 3GS0A 2AAVA 3EJZD 1F3JA 1Q9KB 3VVVA 4LSQH 2H32B 3H9SA 2MH4A 3VI4B 1DVZA 1ZE3H 5KVGE 1MRFL 4JFEE 4JZOB 3P9MB 3NZHL 1OK8A 4PJEF 1F8TH 1LQSR 3F01A 4WEMB 2ZWKA 2A6KA 3FCTA 4ZXBC 3CQPA 5FW7A 5SWSD 4F3FB 1A3QA 3FN0H 3VD2A 2DOCA 5IJDC 1E4XI 4NZTH 3O6LL 1A7QH 3DMMC 4HC1A 1CD9B 3DDGA 2W65B 3P4LA 1CIDA 1GGBH 2XZZA 2AQQA 4WV1A 1D5RA 1P6AB 3WMSA 1LDPH 1NGWA 3QXDB 4P8QA 4C4BA 2DMGA 2GCYA 2IANE 3P0GB 5JMOC 4HG4K 3E8UH 5AAWC 5F3BA 1F41A 2P5WB 3MFFB 1FNHA 2UZIH 3A4AA 4PHZA 2YAPA 1SOQA 1AO7A 2F1BA 1VACA 1FG2A 1IAIH 1RV6X 4U1GB 2Q3AA 1GGIL 1JZIA 5B1JA 1VIWA 2MIZA 2C9VA 2OCFD 4RX4D 2WZ5A 1UZ8A 3GGWA 1MI5B 1TTFA 3NJFA 1YCSA 4MDIA 3QFDA 5CD3B 1C9SA 1N10A 3HN5A 4B9YA 3PDGA 5JA8B 4QY8A 4GMTL 3ECBA 4JZNB 4MJ6B 2NY3D 3EIFA 5C97A 5IFAL 4IGBB 3VG9C 4P3CL 3IJ9A 5MEPB 2HUEA 3MO1B 4RBPK 3QZOA 5DD0L 1JYNA 4BZYA 2WBJB 3G6DL 4AYDC 4XXCC 4KK5D 4QRTA 1A6ZA 3DJZA 3BKML 1TU2B 3EJZC 4LASH 1YYMH 1FVEB 1ZS8A 4GRWE 4QRUB 2FR4B 1RZQA 2XDHA 2BVTA 2YXWA 3WMQA 4JDTL 3X11B 3PHOB 1GY2A 3MJWA 4TVSa 5ICYB 4G43A 3MRDA 4R9HA 4N3UA 4PTUA 2BSTA 3OG6B 1NC2B 3WELA 3UBXG 2QLYA 2Z8VC 5TE4H 4XVTH 1EZVY 2XLLA 4KY1H 4XPAL 3BUYA 5JXAL 3UBXA 3SDCB 4O02L 3ZE2E 3WI9A 3HLAB 3AB0B 4GG8A 4KRLB 2KYIA 4AYFA 1HQ4B 1U3JA 2JJSC 2WLZA 4HCFA 4C55A 1HC1A 4Z7VF 5A2BA 4Y9FA 2YWZA 4ZBJA 1MHHB 3ETBJ 1NQBA 3G5YA 3QZPA 3A67L 2K8MA 4LEXL 2Q10A 3S88L 3P2DA 2OW7A 1I3GL 4HHAB 4TVUA 5A2JH 1EBPA 3X13B 3FULA 1RFDL 3LHPL 3OZKA 1CFQA 2J88H 3MNMA 3P0YH 3RY6A 1IBYA 2WLNA 1MWAH 4LO9A 5SWZD 3RBGA 1CLVA 5I1GH 3BPNB 4W9GC 4Z77A 4RFEA 4WFHD 2EXTA 3FTUA 3HR6A 1FAIH 4NB7A 1M7DA 1S3KL 1F13A 4FJYA 2NZ9D 1P69B 2PPFA 3VXME 4IJ3B 4JFUA 2HTKD 4WJ5A 4RCAA 4E9SA 1EK3A 4UOW0 5JIHA 4QYOA 4FFTA 4Y2OA 3KM1A 4OY9A 3H3BC 4NSKB 1QFWM 2CMRL 3C6SA 1IGTB 1N26A 4XNQA 1DBMH 4XNUH 3TIEB 3QWRA 2NY4D 3UCRA 2X05A 1USQA 4KK5C 1XH2A 1U8JB 4NNYB 2H6OA 3O3DA 3ZHDA 2MKLC 4Z76B 4P59H 1HXYA 2CHWA 3GYRA 1FGNL 3WTYA 2X9XA 1P5UA 3HKZA 2ZCLH 3TBTB 3WOVA 4NQED 1V3LA 1CE6B 1MHPL 3T65B 3G04A 1HHIB 4NQTA 1WA1X 1ZTXH 1ZLEA 1R75A 3CBJB 4YNYA 1GZPA 1O7SA 1UWEH 3H9YA 4Z7OF 2V9TA 1Z3RA 3B43A 4YZFE 1XGQB 5EU5A 2VDQH 2IDUA 3BHBB 3MLVH 1F1GA 3ZIYA 4PJAF 3V0AC 3IJYA 2QQNH 4YWGL 4XBPB 5EF3A 1EJFA 4EN3D 1P0SE 3QEQA 2NW3B 3FO2A 3MUY1 2GKIA 2VZVA 3D85A 1QWHA 3UTTA 2VDMB 2VDLB 1OM3H 3PAVA 3NCXA 3L08A 5FECB 1QFUH 1UCBH 32C2A 3C8KB 4ZO6A 4HQQL 3VFSB 5TE6H 3N42B 5CKGA 5IUCA 4J3OF 4N9GB 4PJ5D 1WZLA 2F61A 3BT2H 4XWOD 4X6DB 5TK2A 4LP8A 3HZ3A 1NKOA 4ODSH 3CZSA 1MFNA 4DF9A 4DKEH 4G6KH 4YXHL 1NBVL 4PV1C 4AKOA 4M7LH 1NCDH 5KS9F 2NZ9C 4LDOB 2OMTB 2WQWA 4DFHA 2HTKC 4CILA 2VQ4A 3O2VH 1U8CA 4A2DA 5IMMA 4I9WE 4QNPF 4GOSA 4MMYB 2ZICA 1LE9B 3UJIL 1TQSA 3UG5A 3VWKD 1SMDA 3N06B 4B5EA 2P8LB 4P5MB 2NY4C 4L8DB 3IFNL 5FYJU 3A47A 1QI4A 2O1AA 1TZGH 1QRNB 3VXSE 3RUGE 5D1ZB 4GXUM 3EO0A 1BQSA 4MBOA 3B2MA 4Q7DA 1LWRA 4XE0A 5I66A 2ZOLA 5CLWA 1IBHA 4UT6H 1EZLA 3ZSSA 4D9LL 4U0RB 3HC2A 1YY8B 1TQUA 4WENB 4OZFH 3BPOC 1XF4A 3EUUA 4S1SL 4FKKA 3VD4A 1MSPA 3BD4A 4HS3B 1GOFA 3TO4B 2E7CA 3HCVB 1BBJB 4NZFA 1OAUH 3D1MC 1SRDA 4LHQB 4WWID 7FABL 1JNLH 3FUNA 2PCPA 2HJLB 4PJBF 2JF1A 3F84A 1E4XH 1UADC 3QIUB 5ID0B 2ITEA 4FZEH 2B9BA 3O2DL 3CFDA 2VR4A 4ODXA 1SHSA 4EN3C 3HPLB 3CZEA 5C08D 2MOVA 5IBTH 1AGFA 4YAQB 5BQDA 4L9LA 3ZYOA 4NBXB 3ZDZF 3CC1A 4U6HB 1NCTA 1AGCB 2COVD 4U6XB 5D2NC 2HRHA 5EUOE 5GRVL 5DJ0B 4FMVA 2E47A 3GK8H 3PXLA 4DQOH 3BUPA 3EBHA 3MRHB 3L9EA 3LEVH 4C56D 1GMEA 4PJ7F 1UWXK 3MV9D 2IH3A 1QATA 3TGXA 1OEZW 3HPJB 4URTB 4OCYL 1ORQA 1SUJA 3KDMB 3JT2A 2VC2B 2NY7L 2QHRH 5JHBA 4MDRA 5H37H 3PYCA 3RTQA 3F05A 1PQZB 5I6MA 5C0AB 3TL5A 3GMNA 3QJRB 4GO8A 1X5GA 3N2JA 1G7HA 1MOEA 2GJJA 5FK9B 1N64L 1U4FA 5IHUH 4L2LA 4NDMA 3AM8C 4GRLD 3VWKC 4HIHB 2KL6A 2JVUA 3P73B 2BCMA 4F9LC 4NRXA 4LLUB 2J2ZA 2H1PL 1JOIA 4M29A 5EA0L 3W2DH 1WLHA 1MAJA 7TAAA 2VDML 1EEUA 2D7QA 2VDLL 2BY2A 4PRPB 4N2OA 3KPMB 3ATFA 4PI2A 2DB8A 4C59B 3I6KB 3KYAA 1WEJH 4J8QA 2DYPA 1FPTH 4YSOA 1ZT1B 2AEIT 5GZNA 3S8WA 3NIDE 2ED6A 3S37L 1PD1A 1MCPH 4FQLL 2VDOB 2KBGA 4NQDA 3NMEA 4DCQB 1HYRC 2OMBA 1MWAA 2GSGB 2ITDB 2Y1ZA 4PCKA 5I18L 3MACH 1RIHL 4IU3B 2O72A 4UILL 2FGWH 3BRDA 3L3OA 3OL2A 2EQDA 3M8OH 1TZIA 3HZYA 4AGPA 3DO7A 5F0MB 2O5YL 3GUTA 3QQ9D 3HZKB 3ZMEA 5C7XL 3CU1A 1ZPUA 5GZOA 3UTQB 4KK8C 2NTFA 4APXA 4L4TB 2EDNA 2VISA 2FSEA 3QPQC 2R69L 5TFSL 1IBGH 2VLKB 1NLBH 5GS2H 1R0AH 4WI7A 4NC0B 1HDMA 2CPUA 3QEGL 4DEPB 4FYTA 4B27A 1VADB 3NK4A 3OR7B 4HXBL 3FQWA 5FR3A 3KPRE 5CLTA 1AC0A 4M48H 4NQCA 4M00A 5K59E 4C4KT 4GKZB 5J9PA 5KVDE 1IGIH 4X9HA 2D7OA 2EC8A 4A2HA 2HKAA 1B4TA 1KG0A 5F21B 3T0EA 2J3SA 3NA4A 5JHDE 5FYJL 1CE1H 4WEBH 1QLRA 2V6HA 4YFLF 4PGEB 3L1EA 1IILE 3BIAX 4GT0A 3ZLQC 3C9NA 4CVZB 4IM8A 1DJSA 1DJGA 2MNJB 4K3DL 4A55A 3MJ8B 4FQPA 2QPFA 4A68A 1KENH 4GEIA 5F93C 4IKKA 5BS0A 4B0MB 4GRLC 4ZXBB 5ABDE 4V1DD 2OX5B 4M6ML 1TF4A 2OFQA 2WXLA 3WS6C 3M1BA 1CDUA 1E6JH 3DMMB 2DN7A 5A2LH 3RB7A 2VIRB 1A4AA 2BVQB 4YDMA 3VXTB 4FLOA 3OKEB 1HH6A 3LQZA 4ZUWA 4XP5H 2VXTL 3KL3A 3L4XA 3FQNA 2FZ3B 3DIFA 3VRJB 1NM4A 5F7BA 1ACZA 3GZKA 4P9HC 1UA6L 2Z7UA 5CU5A 2DMBA 1LK3H 3GZOA 4CGTA 2X7LA 1CK0H 5AKSA 3IMVA 2DQ6A 1KXVA 3FYEB 1E8WA 5BRZE 2P24B 1OSZA 4TSCL 5F1IB 4OAWA 4WKXA 2WANA 2VC2L 3BE1H 3AY4C 5EBMB 5L0QC 1BX2A 3E9UA 5ADPH 1DQQA 4ELMA 2BFGA 2ZG1A 4V2CB 3OD3A 3QQ9C 4D9RE 5EF1A 3HE7A 4ZW3A 2GJZA 5CF3A 4ELKA 1G6VK 3BO8A 1E5BA 1E8ZA 1FC2D 4CW1B 1P2CB 3ZN6A 3QO0A 2HT3D 3TH3T 4LAQH 4OZHA 1YJDH 3AT0A 1BD2B 3CXDH 3MOQA 5DD5L 2ATPA 4O5LH 1P9MA 4QRPD 5ITBL 2JI3A 3JV4A 3X3GL 3AITA 2J1YA 4QO1B 3ZDZB 3HHRB 2VLRE 3O3BA 4H88L 4Z7VA 3QUHA 3RNQA 4N87A 4R7DA 3SKOB 1E0OB 3A4EA 3TYFA 1YEKH 2VDOL 1MPAL 3FHEA 3V52H 5JTWA 4OZFG 2XWZA 4UT6A 3TH4T 4ZMVA 3OZ9H 5E9DD 5DSCA 3FOMA 4GINA 3BJ91 5J56B 4OZFA 2VLJB 3SE4A 1VFOA 5T1KD 3ZUNC 4EAEA 3TWYA 3QUKB 4APQA 3LN4A 1E6OL 3SKUD 1OB1A 1WS8A 4PJIB 4GW4B 4BUGA 3EXLA 1PG7H 3CSGA 4K23H 4G8IB 4QRSB 2A9DA 2BP0A 2HLEB 4LIQH 3MRQA 2GITA 2FT7A 1KEGH 1R3HB 4F8OA 1AIFA 5DO2D 3V6FB 3BEWB 3FQRA 4N2CA 3MAWA 4WKZA 5AAMC 4AW4A 4YQXH 1JF6A 4XCYA 4KMTH 5I1LA 1ZANH 4YX2L 4ZD3H 1S7XA 1OPOA 1JWMB 5DQ9A 3V0GA 1IFHH 4RWHA 3II1A 1PL3A 1A3LL 2E59A 3SQOH 4Z7IA 2IDCA 1TTBA 2O61B 1G9NH 5GISL 2ZSWA 5CFHA 2W5PA 4N2NA 2EACA 1Q1JH 4PLNC 3AWEA 3QJFB 2YD7A 2BSRA 43CAB 4BH8B 5EIIG 3MRLA 3GKWH 4K3JH 1N8OE 3T4YA 1XIWA 2VAAA 5C0CE 3ZKQD 3ULUH 4GKOA 5EIIA 5H37G 1P1VA 2YUVA 2NY1C 2X1OA 3MRCA 1WC7A 2ZE0A 1F86A 2AEOA 5H37A 2HKFL 4M1DH 1DDHA 5DZLA 3FT2B 5J89A 3QAZC 4DVRH 1EDQA 1TJIH 2D9QB 4FULA 4I4WB 3TO2A 2Q8AH 4CRPA 3SJVB 1BFVL 4PJCA 2XN9D 4F2EA 2OZNA 4XNAA 2HT3C 1TCMA 1W16A 3PGDA 4F7PA 2PCYA 4K5LA 1CICD 3ECWA 1OB0A 2W9DH 5DS1A 2YD3A 1HKFA 1FZMA 3Q06A 4JRYD 3U4EA 3KYNA 5I5MA 2QJDA 2AI0H 4JO3H 1NFIA 1AY1H 3H7BB 4YK4C 1DVXA 4OLWL 3AACA 3T0DA 4L1SA 1KGWA 2VR9A 5KUKA 3X12B 1UYWH 3TS8A 1HT6A 4PM1A 1IFRA 5E6SB 4KUZH 1WF5A 2NXYD 3D69A 1B2YA 4B96A 4WU5A 1UB5A 1F90H 3GTTA 4Y5VC 2GABA 2KLSA 2YARA 2BH0A 1LVEA 2AP2A 3CN2A 1G7JA 5E4OA 2Z4QB 3K4ZA 5KBKA 1EZSA 3K3QA 1U8KB 4UT7H 2CK0L 2WKOA 2X2UA 3ML8A 2FEEI 5FGBC 1LGVA 1S4IA 2AQTA 2V9QA 4G7YH 5T1MA 1TVHA 4M6NL 4KX8A 2PYEA 2ZPKL 4XR8C 3OM3B 4ZMTA 2WXIA 4CADA 3OAUH 5KVGH 1XQ4A 2AJXH 5DO2C 1MFEH 3A6BH 1ORSA 5C0JA 4J1UB 2X1XR 4LSTL 4RMVA 5GGTH 4ZX4A 3BDYH 4BELD 4JFXA 2C1PA 1LO2H 5FYJE 2F58H 4F7EB 3UO1L 4WNJA 2QQLL 3GQFA 3DV6A 3FPYA 4ISVA 5AVYB 1I31A 2HFFB 4QCIA 1WBYB 4JPWH 4P4RB 3BAEH 5D7HA 5IF0B 3DIVA 3QORD 5CZXD 2DKSA 2PW1A 4QXTB 3UJTH 2C5DC 5D71H 2LLLA 2QKIC 1TJHH 1A3RL 2R4SL 3EGDB 1BMGA 4F80A 4ZNEE 3WNPA 4M1CD 3MA7B 3CG8A 1M56B 5DF0A 3EOYG 5SWZB 3B37A 4TNWF 3FMGH 4I3RH 3N40P 2Q3ZA 1CZ8H 2F18A 1A1MA 3FCSB 4G71B 1FNSL 2DLHA 2Q2LA 4HD5A 1IC5L 5I0YA 1C08B 1ZPLA 4DNLA 3HTLX 2DM4A 2OMNA 4JPIA 2Y0SA 3QIWC 3PV6B 4YE0A 5GGVY 5EZPA 4FRWA 4L8BB 2O5XL 2QPUA 4NZUL 2L7EA 1XDTT 1AZBA 2R1WB 3HN8A 3W1ZA 1CR9L 2CDGA 2G3ZA 3PJSB 1T3FB 1J9TA 4AEIH 3EUDA 2NY4B 3KJ6L 3S3BB 1OAZH 2RBLA 3TEXA 5FWRA 2CWRA 5C6TL 1J05A 3MUZ1 3DBSA 4FABL 4ZYKB 4E42A 2NXYC 4X6FB 1T1XB 4IEFA 4NRYA 5F6HJ 5JQ6H 1LP9F 4QHLA 1VGKA 3LDBC 5GGSY 4YPGB 5C07E 3DSFL 4NQEB 2CO7A 4H0IA 4NZRL 3LNEA 1CQKA 3BPOB 3HOGA 1QSFE 3ZDYB 4B60A 1CGVA 4S0TD 1FV1B 2CALA 2WQRA 4UV4L 3FRPG 5H35A 4ODTH 4GRWH 3VXPB 5FW6A 4Z7UF 1RURH 2B2XH 5LLIC 1LE5B 4FA7B 3FRPA 5D5MB 3G9VA 1JHKL 4UM9A 1U4EA 5BZDA 3O2WH 4KKRA 4QMEA 5D7IA 2XV0A 3SSGA 2IC2A 1QZ1A 2X41A 2F1EA 4L4JA 2Y24A 3HZVB 2JCCE 1JK9B 4OJFL 5I30L 1KIPA 3GO1H 3QORC 4RA3A 5CZXC 3B2PA 3LZQA 4JRWA 5D2NB 5IB2B 5IESH 2ADIA 1PDKB 2NUPA 4B7LA 1FFOA 1UZGA 1E3XA 1ZHBA 4DGVL 5K9KA 4M1CC 2XA3A 2VSDA 2IGFH 3SDAA 1JWUB 1ZWIB 1CXKA 1BVKB 5LXGH 1JXKA 4BSVB 2Q86A 5HVHC 1P53A 2YEZB 4U1IA 2JKIS 5C0BD 2WTOA 4XPGL 3OAZH 1DBAH 3ECUA 3P3YA 4HS6B 3C5SB 4N2LA 2DTMH 2Y06L 2NYZA 1TVBA 4XX5A 1GW0A 1UD8A 5LCVL 1NGYA 4JM0A 3JVGA 4AGQA 1PVHA 3ZZSA 3E0GA 1RAMA 4FFZH 3SGJA 1KNOB 5IUSA 1U95A 5AW9B 5JO5A 3WIAA 1MIMH 4TLKA 4Z1PA 2ETWA 4DP2X 4QF1B 3V4VH 1U58B 4WWKD 4XBGB 4R4BB 3Q6GH 3B2DC 3TYGH 4ZX6A 2V33A 2FQFA 2B3RA 2W0PA 2EICA 4PGCB 2V8MA 5IFHL 2ENJA 1XB3A 4KV5F 3HR5A 3SODB 4MB3A 4FC3E 3Q01A 4JFYA 2ZOKB 4LVEA 4OV5B 4OIBA 2DKUA 1QAWA 2J5WA 2Z0UA 3Q2WA 4LOUD 1KCRL 1DSFL 3S36H 1TMQA 4JEGB 1DVSA 4A7VA 4DZBB 4M61A 1F6AB 1AGDA 4YN3A 1BZ7B 1OWRM 1T6VN 2VM3A 3DLQR 4K71C 2W9EL 1J0KA 2QPSA 1C5DB 4P2CG 1QR1B 1D5BB 4RESB 2JKLA 1NIEA 3QUXB 1HEZA 1NJ9A 3PG2A 3UPCA 3DVGB 4H1LB 3APCA 4POYA 3D4YA 1WK0A 2VLLB 2IDQA 3ZE0F 2FEJA 4CVXA 4LSPH 5BW7C 2EE3A 4MBRA 1M71A 3F5WB 1UXLA 5DT1L 1Y07A 3NK3A 3QS3A 3EYUH 2OSLA 2FATL 4XZ4A 3ALXA 3P9LA 2WK2A 4JG9A 3ZDXF 1DBKL 5DTFB 4FEMA 5CBEA 3R4RA 3UP6A 3WEXA 4UQBA 3T8VA 1MCQA 4R26H 3KXFE 4PGDA 5CLXA 4Z0XA 3ZHNA 3ZQWA 4ZOAA 1SXBA 4R5VA 1LLAA 3ZT5A 3V7AE 5BXFA 4OCSL 2D4FA 3D25A 4GRLB 1TSHA 3LKOB 3CH8A 2DQJH 2HRLA 4K07A 5JOFB 4JFEA 5FOJA 5GGTA 4XN7A 5E24E 4H20H 3KWTA 2G30A 3EOBB 2TAAA 5DJ6B 3B9KA 2FL5B 4JRLA 3HMWH 1EAJA 3CNKA 2ZX8A 1CDYA 4TLUA 1Q4NX 4WWKC 3Q8EA 4GQ9L 4NXKA 4Q9RH 2YR3A 4PCTA 3T3MF 1HILA 3ISRA 3WXVL 2ZNXA 3HI1A 5DYOB 5BOZG 4PGBA 2IWKA 2NY2B 4KZCA 3VD1A 5E0QA 4NT6B 4DQAA 2FT6A 3CDGB 4KXAA 4GMSL 1GIGL 2IOMA 3FU5A 4N2IA 4PBVC 2MCPH 4RAVB 4BZ2L 1MFCH 5C1MB 2BOLA 4XPFL 2IANA 5D7JD 1A65A 1RCYA 1MCFA 5L0QB 3CZGA 3RIFF 4RMUA 4Z7QE 4H25A 3ETSA 4K3GA 4LOUC 2G75B 3JTTA 4RH4A 4DGIL 4DPAX 5C0FA 1RULL 1MXGA 3PWJA 3OSKA 3MNVB 2XACC 2Z7WA 1J1OH 3PU7A 3RHWK 4EKXA 4NZ8A 4HISA 1IVTA 2K6YA 4HS8H 4YE4L 5ESAB 3RYMA 4N6RA 4FNSA 1P7KB 2NNRA 3MN8A 4F2ME 5T8IA 5ERWA 5I0XA 2AW2A 5DURD 4JHWL 3DURB 3ULVD 1ZHLA 2Q6WA 4LLWB 2ENSA 1ETB1 5IW6A 4AEHL 4E9VA 3BZDA 1DQKA 2YBGA 1NGPH 2GHWB 4RNRA 1FFNB 5CEXA 4IU2A 1JN6B 3FOLB 1HINL 1EVUA 3CHPA 5ISZE 1RPUA 4NERA 1MHCB 1MZZA 2YK1H 3V6BR 3VX0A 1NCBH 3U0PB 4N0RA 1MUJA 3G6JB 1PZ3A 3HG3A 2VITB 1DE4B 2UY7A 4ETQA 2BDNH 2WD0A 3ZZQA 3PP3H 4G8AC 1RIUH 3SCMD 4RMBA 3OSVA 3B2UD 5DFTA 4IS6A 1ASPA 3QFJE 3CZLA 2FYYB 3GWJA 5F9OL 5EORH 5KN5B 4V1DB 3WJLA 1KEMH 4OZGF 2QVKA 2DJUA 1E2ZA 3FT3B 1F11A 2WQAA 3KCWA 4NN6C 3TV8A 4JDEB 3V6OE 4ZFGH 4XMVA 1F2QA 1FL6B 3ZSTA 4L0YA 5CJXC 4K55A 4L3CB 4JO2L 1ASOA 3LPPA 3EYOA 4LEXH 5LHDA 3BP6A 2VH5H 2J8UF 4KO7A 1MW2A 2ZSVA 4NPJA 2H32H 4F93B 1RFDH 4DW2L 4BDVA 1A2YB 3GMLB 2Z92B 3V0VA 3QJHA 3VJ6A 2DD8L 3STZB 2DQEL 5DQJA 2CLRB 5D7JC 3UTSE 3IFOB 2CBTA 3NCFB 3R0MA 4AX3A 4N22A 2NY1B 1UUNA 2X4SA 3B9EA 1KJ2H 1WV7T 4GUPA 5BZWA 2LV4A 4HFWA 4YJZL 2WUBH 2XWXA 3CXFA 4ODBD 1S9KC 3B6SA 1T5KA 1SVBA 3DX4A 2MQCA 3QAZB 1Q72H 2BFVH 1WFUA 4KQ4H 4M5YH 4NXSA 1HIMH 4KPHL 1Q9OB 1E50A 3NACH 4R2GD 1E2WA 1XR8B 3AADB 3LQAC 2VDKB 3L1OL 2A9NL 2X9WA 3Q1SL 1Z9OA 5G2NA 4PGJA 4FFZA 3UEZA 5AZEH 3J27A 2EDLA 4CC4A 3E3QE 3ARFD 3ULVC 1YMME 2CO6B 2BVYA 5INCB 3VXMA 3MLWL 4JN1H 1YDPA 2F8VA 4P9HL 3V4VA 3F7YB 3BLKA 4YK4B 4JM2F 3U2SA 3GMPB 3OAYK 5E5MA 3REWA 3VFMA 1IGYB 2XY2A 5GGRB 5E9DB 1E90A 3T3PF 5IHZB 3P40A 1FNGA 1L3WA 2HWZL 3GI8H 4XP4H 4Y5VB 3MJ9L 4YL4A 4BFIB 4P3DA 3X14B 2AEWA 4MCYA 5KVDH 5FYLL 3SCMC 1K2DB 3DX8A 2C7UB 3B2UC 5EN3A 1R3LA 5IW1A 2X1WL 4XB3A 1M9WA 2VQ1B 4M43L 5DD1L 1KN4L 1J8SA 2VRKA 4KKBC 4PBWD 1FNLA 1YEFH 1QSVA 3OJDA 5EOTA 5AD0A 4HG4J 3MDJA 4DN4L 1EZVX 3I6GB 3OLDA 4FXKC 3HS8A 1BVZA 4XMKH 1S9XA 2R9HC 1JNNH 1MN4A 3BN3B 1XL6A 3BYTA 3M7OA 4LPVA 4D0BB 5HYSG 3BWAB 2V17H 1YEJH 2D31B 3WNNA 1A7PL 4AUUA 5I73B 5JQHC 1BCIA 1GPOH 3C87A 4G1MA 1EAOA 3PXHA 4XAWH 5FC9A 5HYSA 3WY1A 2JH2A 5FKPB 2XVBA 3PQYD 1IM9D 4XP6H 1MQKL 1H6TA 4DAGL 2FWUA 4Z7WE 1S9WB 4ZW5A 1OGAE 4MMXA 1RJCA 5IB1B 2WWNA 2ZUQC 1D7BA 1QMUA 1TO5A 1RZFL 2YD6A 1A6VL 2QKIB 2QADD 4GXUN 5D70H 2VO8A 3C2AL 2BJML 4GKSA 4L3FA 2ATKA 4F8PA 4FQJL 1Q0EA 5FGCB 3S96B 4M3KB 2IDTA 3QG7H 2Q1EA 2FLBT 4DP5X 3DARA 4R7NA 4J4PD 4XXDA 2XN9B 4HUNB 2YUXA 3B3IA 3TNNB 2ZUUA 2NZIA 3KPNA 3QIWB 1K6QL 4N85A 5AVQB 3ARFC 1JZ6A 1FVDB 2BVOA 4JRYB 2LU7A 1OPGL 4BINA 2R2HB 4CN1A 1DUYA 1E9QA 5PAZA 1FNEA 4V33A 5BZZA 3WCYA 1ZKAA 3KWVA 2VE6B 4TQ8A 3Q48A 4LCYA 4ZFOA 43C9A 5G5DA 1RUAL 4L2YA 2NXYB 1G7PB 1W6LA 2G5BA 4UQEA 1KGCE 2VWEC 3M46A 1D6EA 1MF2H 4BK5C 3LDBB 4EVNB 2JTDA 3DSNA 2X1PA 3F8UB 3HE6A 2HTLD 2XKNB 3CV5A 5HHVL 3VXSA 4F92B 2KZ1B 3RUGA 2R0WH 1CYWA 4A7GA 3CFQA 4DOHB 3DC0A 1MIEH 4ENZA 4Y9CA 9PCYA 1REIA 3MLPA 1MCJA 1GGTA 1I4FB 1Z9SB 1JNHB 5TF0A 4A7TA 4HAFA 1UVQB 1DCEA 4JKKA 2VDKL 4XO4A 4U1JB 1UFGA 3V9FA 1AOHA 1HSBA 5SV4A 3NAAH 4UANA 2ZUYA 4M7JL 3A24A 1CYGA 4JHBA 1AD0B 1BM7A 2X2JA 3QQ4B 1KN2L 4NOBA 4X4XB 3KLKA 5E5RB 4OCLC 1C12B 1LO0H 4I13B 1OO2A 5A2FA 5I1AA 3IEAA 4NCDA 5DJDB 2A6IB 2SEBA 3DX3A 4HH9B 1LO3H 1PX4A 5D8JH 4AZUA 3MBWB 1AACA 1WQVT 2EIMB 2H3NB 1QYGL 2ZQKA 1FLRL 4UB0H 4IOIA 3QORB 4UU9B 3VXUB 3DGCR 3QNFA 2EXYD 2QTEA 2I9TA 3HRZA 1MZYA 5IIEB 2QADC 2WCPA 3AMKA 5F3FA 3RGVA 5EUOA 5A3ID 1R24A 4DJMA 3BLPX 5EZJB 1IC4L 4JGMA 4XOEA 1P4BH 3PP4H 1X6LA 3QUYA 2BHYA 2HCZX 3FTXA 4KZEH 3D9AH 5I15L 3RGBA 5LKNA 4ZAKA 1I7UA 1AGEA 2X6CA 3RU8H 3CZNA 3GMOA 5DRWA 1VZGA 4W93A 1Y6MR 3FU0A 3WFHB 2EKSB 2OTUB 2K3HA 3U1SH 3VFVA 2VDLH 4Q2ZB 1N18A 4ZFZA 3CHOA 3RWEB 1H15A 2AK1L 4H0HB 1WUNT 1I1FA 1YEHL 2C3VB 4CU8A 2NQDA 5IHLB 4U6VH 1G0DA 1G7MA 1A8ZA 3QJTB 3SE3C 2AABH 2EEDA 3HS0C 3OF6A 1IM3D 3KGUA 4A2EA 5FLUA 3PWUB 1G5AA 3EJQA 1I1YB 4WRLA 4HWBL 5AUMB 1ADQL 5I18H 5HDBB 1EHNA 5GSRB 1V7NL 3MUUA 2D3LA 5DLMH 2WZAA 1J5OL 3ZE1F 1KJ2A 3O3AB 2MNUA 4XCEB 3HRPA 3Q0HA 2DWYA 3B1TA 4X50A 3L3IA 2F08A 3TT3H 3V2AR 2WNWA 4OT1H 3QJUB 5DS8B 4LHJB 3CC5B 4KKQA 4NQQA 5A43C 1S7TB 2YPVL 1OHZA 4XB7A 5DK2A 5KJRH 1FL3A 3OHXC 3ZR5A 3QRFM 4LLAA 3CHQA 2DQIH 1QP1A 3IDGB 3KPLB 4R0LB 4PWEA 4K71B 5IVZA 1HEJC 1NEZB 1BREA 6PAZA 4FNRA 4U1SB 1BGXH 2WLLB 2NT0A 3Q9QA 4PRNB 4MVBC 4JFFE 1NCUA 4GH7B 4UV7H 1MFBH 3NJVA 2YS4A 2EXYC 3CK0L 3WXWL 2WIMA 2W81C 4HBCH 5BJTB 3B3BA 4MXWH 4K3EH 1MAMH 3GI9H 5FYJH 5FM4A 3H9HA 5C09E 4MJ5B 4QR7A 3V55A 1KXTA 3BP4B 3RJDA 4YS4A 2V5SA 4FXGA 1T2JA 4MA8L 5E1QA 3KPRA 5A3IC 5F44A 4K5PA 3VNZA 4GG6B 2Q7YA 3NCEB 4PRBA 3SKNB 4L4VE 1R3IH 3CHSA 5C0BB 5GGQL 1JV5A 2VZ1A 4X2UA 3VQMA 1NCAL 1NGXB 5KVMC 1MJ7L 2FHFA 1FL5A 5LDSA 5JHDA 1OXYA 1T89A 5EDSA 1JGEA 3HAEB 5I8EB 5L2JB 5HHXL 4ONOA 5LAXA 5FA3B 3OKMB 1IL1B 4FG0A 5GRUL 3KYOA 3MRGA 5DJXA 3LPGA 5ACLA 4ALAC 5TQ0L 2QMJA 1G1OA 4HSAC 4WU7A 5CEZD 4PV9B 3G5VB 2WCSA 1OM9A 2XT1B 1JXFA 1BZ8A 2CLZA 2ZOOA 4N90D 3TVMA 1E3FA 4ZUVA 1I8KB 3RI5F 4WWKB 3L6FA 4RRPM 1N6QH 3VFWB 4BFEA 1SJEB 4HJSA 5DWPA 2V8LA 5EH1A 3UPRB 4OZIE 5J4MA 1SLWA 1OARL 5EFIB 3UC0H 5IREA 1KV3A 2NR6A 4FXLA 5ADOH 2OJ1A 4QJ5B 3K8MA 1A1OA 2OTWB 4MASA 3E6HA 1SXAA 2ZNWA 3KYKH 5IQ7H 4UQIM 5KG9A 2Z6FA 1E43A 4WTZG 1D7CA 1AQDA 5E1HB 4K9EH 4AL8C 2ALAA 1AZRA 5GSVA 3ELAT 4WTZA 3CSTA 4NQSA 5DK3A 5BRZA 5D7SH 3O8XA 3TZVC 4N0UB 4Z5RB 2BP8B 1KCSH 2OM5A 4X80H 5G4NA 2AXWA 4AJ0A 5E6ID 5KSUB 1RL1A 1JK8B 3IU4H 4YBQD 4O2EA 3W39B 4ZFFB 4Z8FL 1F2XK 1JRHL 4POZD 3SD2A 5ICZA 4G8GD 4PP1D 3N9GH 3KVPA 4ZS7H 3R7RA 3QULB 2Y2TA 2A4CA 2GIXA 4G9DA 2WB7A 3OXRA 1SOSA 3ASOB 4TULH 4G70B 4HKZA 3P02A 1I8UA 2OR7A 2DTSA 3H55A 2HT2D 5D7LD 1OCRB 2BO0A 3FUMA 4MDJA 5CZVH 4F2FA 1TVDA 1EEZB 4POUB 3FB8B 1CT8A 1M6UA 2VLRA 1V27A 3CVHB 3H1ZA 1UZ6E 1E6OH 1VAHA 2F53D 4RZKA 1WRFA 2H8PA 4KGLA 5FYKD 4HK0A 4AYMC 4YXLL 4IBVA 2UZYA 4EZJA 3CFCH 2P8MB 4XBMA 1ZAGA 1XCXA 4UQAA 3SQBA 2ICEA 3T0VA 2OMYA 3IJSA 3WLBB 3DJSA 3F7QA 4J12A 3U30C 1IZKA 3MRKB 5DD3L 4NN6B 4YDZA 5DFVD 1D5ZB 3H9SD 4LCCC 2D3NA 1KYOJ 3KGSA 3LKQA 2QT6A 4HKXA 5G4MA 3BKYL 5D2LF 4GI8A 1A7RL 1NC4D 1QHQA 2BOBA 2D7TH 2EE6A 4GAYA 4XTRD 3D08A 4AMKH 7CGTA 1UXSA 5T5FH 4ZT1A 3VFUB 1XR9A 3OKNB 4PJ8A 1LWHA 3V6ZB 2VXSH 1ZGLA 1F4WH 1T20A 4AYBA 1KLUA 3BAXA 4IOFC 3V79C 2OCJA 5L4JA 3MU3A 4N0FB 3L3JB 2WNGA 4X6CE 4AEEA 3V0WH 3SDXB 4LCIH 5C0CA 5JXEA 2NCEA 4N5EC 1CXFA 4Q52A 2A83A 1KPVA 1PEZA 5EEUA 1OHQA 4YBQC 3AGVA 1WCBA 4CKVX 1O5PA 4POZC 2UY6A 4PV8A 2OP4H 2FD6L 3BWUC 1DBJL 4PP1C 5FOBA 3U36B 3OWRA 4KROD 3D4CA 5CP7A 3ATAA 1XH1A 4WGVB 2MHAA 1RZJL 5LO7A 5I16B 5DURB 3S4SB 1IB5A 4HWZA 1M4KA 3IDNB 3ZRCC 5L88H 2YPKA 2HT2C 4K5MA 4F7CB 1AXSB 1AC6A 4LOVA 5F7EH 4EQ2A 5AWNL 3CTTA 2X4UA 1SEQH 3V9EA 2ZAGA 3UC2A 1EGJL 1S5IH 1EAPA 2JMRA 4AGOA 1D5MA 1TEGA 2ARJQ 3AXHA 3X1BA 2EDEA 3GZPA 4RGMC 1XEUA 4O4YL 1MWOA 2ZWYA 4NKOB 3B83A 4PJGB 5HPMB 5AZ2H 3SCMB 1M1SA 3UYPA 4MJ4A 2FNWA 5LGHH 2GTZB 3SZ6A 4RAHA 4XP1H 1J87A 4WW2A 4W9LC 4HV8A 1S7QB 2JK5A 3IFPB 3NJKA 4TL5A 1RI8A 2AGJL 5DFVC 1FI8C 1NAMB 2CNYA 2G60H 2GYSA 5K9OA 1GC1H 2DQHL 5HDQL 5KYUB 1GZHA 1TPXC 5GS0H 3EG9A 2QR0A 2YRBA 3NYKA 4XTRC 3B5GA 3QEUA 1XCQB 2QL1A 3QO1B 4YHKL 1I85A 4HU8A 1AD9B 3F58L 1UM5L 3F85A 3PAYA 3TFBA 3HG1E 4DIXA 2ERJC 3CVHL 4FQCH 2ZUQB 3V5HB 5FFGA 1CF8L 1JG9A 3BLBA 4LFHG 3NT0A 3VH8A 4F33A 2FIKA 1UWGH 3EDEA 3GRWL 4WV1C 1FNSH 3DGDA 3KPSB 1T0MA 4NM4H 3F6JA 3WHE1 1MJ8L 4QXWA 3I9GL 3IKCB 2AKRB 3HMXL 1UACL 1YY9D 4K7PX 4ZNEA 3PGFH 1IGJA 3AG3B 1TJGL 2CCWA 2V2TA 4KROC 4P5TA 4X9IA 4JPVH 3E1ZA 1KULA 4LHUA 4TQEL 4X7FC 3V9CA 3ISYA 3EH1A 3FCGA 4MWFA 5I0ZA 3ARFB 3HKFA 2IQAA 1OCCB 3F7VA 3GMMA 3OKKB 1Q94B 5EU3B 2YMTA 3VXOB 1ZK5A 1CFBA 1NBYB 4EXPX 1HYSD 4U3SB 4HIEA 5F96L 5JW4R 2W0LA 3K46A 2D03H 5JW4Q 1N5YL 4W4OA 2HMID 2YGVA 4M5ZH 1S7VA 5F9JA 3RWGB 3V4PH 3MRRB 4F7KA 5JHLH 4EO5A 1FLTX 3LS5L 3BP7B 1NZRA 2BK8A 3TWCL 1RUML 1WISA 4YLBA 4B6ZA 3U2IA 1KGYE 1H3GA 1BYNA 5EOCJ 1DEEB 2F19H 3M1CA 5KSBE 3EBIA 3VACA 5C07A 5EOCH 2CH8A 5MERB 4QRRB 3LQAL 4NC1E 1JHKH 1KMGA 1JFQH 4FFWD 3VAEA 5KSAD 3ABKB 2APTA 4AIZA 4IHOA 5ACMA 4R6UA 1EFXA 3ULVL 4I2XE 2IV9A 1GCFA 2JE8A 2IIJA 5DI8A 4AKQA 1W72H 3MMEB 1SMOA 2GAZA 1DVYA 1QA9A 2Y07L 2BNRB 3T0XA 3LN5A 1U0QA 4PYHA 2HFEB 2AMGA 1XGUB 4BK8A 1FZKA 3DYMA 2YHGA 1L7TL 2WXPA 3BZEB 3BWZA 3ZHKA 1HJBC 4KHXH 1ITBB 3QK0A 4UINL 2ZKHL 1U8LB 3DV4A 4QLWA 3DHUA 4OB5H 1FFPB 1U2HA 2JCCA 2APVA 2E8ZA 2JJUA 4FOMA 1TITA 2DWSA 3S7GA 2UXFA 4OJCA 1YN7A 4R4FL 3MOBH 3QEQD 4JCWA 1XTLA 4L37B 1FF5A 4PJFB 1UB6B 1YY9C 2B16A 1ZA6B 1H3PH 1OVZA 2V7NA 2ESVD 5LCVH 2PWFA 2Q76A 1LL1A 1CJYA 1ZTMA 1NAML 1JZ7A 3PWPE 2EDWA 3GT6A 3H2WA 3TC9A 5DZOA 4G8EB 4HCRL 4Z78A 5F72S 1NMCC 3EFDH 4PREA 5EN2B 1MCDA 3RY6C 5D1QD 1CLYL 1Z2KA 1T21A 1PLAA 4HPYL 5KANI 1JUFB 1P4UA 3N85L 4B9CA 4TN9A 4AIOA 2LABA 3KPOA 1HYSC 3LIZL 4R83A 3VSVA 4NNXB 4YHIB 5T5FA 3EHBD 1OL0A 3FTSA 4HYTB 1AS6A 4L5FL 4NUGL 4WO4A 1ODUA 5FS5A 4HA1A 2RTTA 3CPUA 3HS0B 2HMIC 3IN2A 4QTHB 3WJJA 1RD6A 1G87A 1NKGA 1MHEA 5EMYA 2J4WL 2F74B 3OKOA 4GQPH 1Z5LB 5DMGD 3U1PA 4LOEA 2FJFB 4QTFA 1KCRH 5ESVB 2PYFB 4FERA 1C1EL 4DK3A 4A63A 5C7ZA 4FQXD 4F8QA 2A6JA 1JFHA 4DSYA 3HLKA 4Y19E 5KSAC 2ATAA 3S2AA 3H8NA 2J73A 3OWEA 3QUGA 4HKJA 5DJAA 4HUUB 5BO1H 3OHXB 4JFHD 1BG1A 2JNZA 1P5UC 1FZOB 3ME0B 1YPZB 1DJYA 1HWWA 2HKHH 5ID1A 2R8SH 1FYTE 1TTGA 4XN9A 3L3HB 4HGWB 4K73A 2YPLE 3CFBA 3NZSA 1MREL 2ICCA 3D0VB 3PCYA 3DTXA 3CX5J 4PWKA 2AXFA 1Y7VA 2DQDH 3P3UA 4QHNA 2K70A 2O5ZH 4P5KB 1WGVA 4MA7H 5FO8B 1QLFB 2ADYA 3D2UA 5CJQL 4OGXL 2AZUA 3L8QA 5IV2A 1B0WA 1OQOA 3DX9B 2BMKA 2YAFA 4GT7A 4QT5B 3S97C 3U9PH 2A74A 5HDOA 1T4KB 1J8HD 4Z7NE 2FO4B 2CA4A 4N4YB 4PJDB 4WGKA 2XIDA 4PY8I 3MODH 3DHPA 1ND0B 5LWYL 1K8IA 1XXDC 2UYLA 3L4YA 1A25A 4HU2A 1KYFA 1I7ZB 1ZE3C 5D1QC 1NEPA 1QBLH 4BHUA 2FJHB 3KXFA 5DUPH 1XH3A 4XOBA 5DEZA 3V7AG 4EDXB 2A1WH 1BVOA 4U6YA 2X0WA 2EH8H 4GQ9H 4HDIB 3TNMA 1UJ3A 4P57A 3CPLB 3GJEA 3NTCL 4R3SA 4PEEA 1SF3A 1O5DT 1WH0A 3RTQD 3EHBC 3MX0B 4JG1H 5EZIL 5E2WL 4I18A 4KUCD 4JGUA 1IM3B 4X99B 1IQDA 1SHXA 1HOEA 4H8WL 4WSGA 1F4HA 3O6KL 4WWNA 1YQVH 5IQOA 4M62H 3CD4A 3KYMB 4AG4H 1I3UA 4I1NB 3FT4A 2DYSB 3INUL 3RWCA 3K1KC 1T2QH 3NIGE 1KLFB 1ZDSA 3BGAA 4JPKL 4LSVH 5IVXE 2DYPD 4ODWA 2YBRA 4OLXH 3TZVB 2DPKA 1IKFL 1SXCA 5HXMA 1JBJA 4PRDA 3T08A 3HUJE 3MSPA 2I25N 4WTXA 5TDOB 1YHPA 2VJXA 2E7MA 4LRIA 4QRQB 1BMZA 3AREA 2GUOB 1KJ3H 5C0ND 4FEIA 1V3MA 3UYRL 4P2RE 1ULVA 1NGZA 1E5AA 1JHTB 3DOSB 4CMMA 2PXYA 2QVIA 5CJBA 4O51A 4PJEE 1MW0A 5JR1H 4TUOB 2RQEA 5D4HA 4F2MA 3AG1B 4OD3H 5GZOD 3A4FA 2VUYA 2GT9A 5DMIH 4MNQD 5MEQB 4YHZL 4HHGA 3V4PA 1YAIA 1RMFH 5JHLA 4X0KB 4GO9A 4MKMA 4FKHA 4PJXF 5FHAH 3ZTCC 3FXIC 2Z8RA 4UTBH 4Y9BA 5BVPL 5HHPA 2QFPA 3U6XA 1CC3A 1DVUA 5LNEA 3VTTA 1MCBA 5ISZA 4NQCD 1I7RA 3KVDD 5DHYA 4DERA 2YMXL 4RWYL 4H8QA 2HVJA 4NLAA 1U21A 4BH7B 2GB2A 3N0AA 3T0ED 4K7FA 4W9JC 3BQVA 3P3TA 3FFCB 4P0DA 4TF4A 3OMAB 4LCCB 5E0FA 2VZOA 4B50A 5BMFH 3E2HC 3TEUA 3A5VA 3QFJA 3RNKB 4OV6F 1CDBA 4HFUL 3RTQC 4A7UA 1W72A 4UDTB 3S5YA 2VSMB 3JXAA 3TJHC 1CTNA 1WSST 4MCMA 4S0SD 1JGLL 1QNZH 4EQ3A 1FIGH 4NO5A 1SF5A 2DD8H 3W38A 4ZMOA 5BS0D 2OMWB 1E28A 1OZTG 2I5YL 2VRQA 2WAQA 2YXVA 3QCVL 4P2QE 3V6OA 3ZBMA 2WXJA 2YQBA 4MD4A 4MAZA 4JLRA 4TS6A 5DQDL 3LNHA 3BDBA 3WL9B 3DYPA 5DMYA 2Z91B 5SWQB 4JHZA 4RVBA 1QBMH 2G9KA 2ITCB 1AANA 3SKMB 3LN9A 1VERA 2WSPA 5A16B 1E9OA 4UM8A 5LXVA 3TU6A 3BN9C 3VFTA 5GZNC 5JPNA 1CXEA 4X8JA 3MFGB 3UTSA 4NN5B 1EUTA 2CKBB 3CDCA 1R5WA 5I1JL 3K8LA 3HC0A 5TDPB 5IK3A 3KCPB 1DJIA 4G8GB 5FWQA 3RDTD 2YUWA 4ICWA 4ODHH 3PHQB 5C0NC 6FABL 3LCYA 4GQRA 2YXFA 3L3OC 2VXVL 2I27N 3IDJB 4HXAL 4PHXA 5DRNB 2O4EA 4HETA 4OU3A 1BM3L 4GRMB 1OTTC 3ARSA 5IJBC 2OJEB 3ZQXA 4BQ9A 2XICA 3VYPA 5GZOC 2HT4D 4P46A 5D7LB 4EI5B 6PCYA 4XO5A 1CL7L 2WVUA 4N8VB 3T09A 2MQGA 3NJMA 5T1LD 1YMMA 1F02I 3BW9B 4JFWA 1QD0A 1JPSL 2WQVA 3FFDB 1BFOB 2DIBA 4PD4J 4X42A 3K71B 4Q6IA 4RGMB 4AL8L 5HJ3A 1A9BB 3WG7B 1NDMA 3ATDA 1ECZA 5D9SA 1T1WB 1CXLA 5DD1H 4X4ZA 4UTAH 4Z7VE 2WINA 3RWDA 4HBQA 1T5WA 5HDRA 2RH0A 3BZ4B 5GGVH 1GYWA 1K8DA 4F57H 4XXWA 4HOXA 2ENPA 3REVA 2QLVB 3BJLA 1F3JB 1QVOA 3T0EC 4DKFH 2AXGA 3H9SB 5E4IA 2VUOA 3BUTA 3L9RA 3KLHC 1II4E 5T3XD 4LSRH 4FQIL 3SGDI 2BOCA 2P46B 1TPXB 4YLQT 1KJMA 3IDMA 3MUHL 1OAKH 4DAGH 5D55A 4BGLA 4W4NA 4JFDE 5I1IL 2V9UA 4G83A 1RZFH 1PZUB 2A6KB 3FCTB 5GS3A 4WFED 2JKTM 4YEFA 1IO4C 3IETA 3LEXA 2EP6A 1VGEH 4HCGA 5ICUA 2ERJB 3C2AH 1DJZA 4DETA 3HA0A 2ZOWA 3D39E 3OLEA 4G6AC 1C8PA 4EBQL 1V55B 4JY4A 5BV7H 1AXTL 4MA1C 2P47B 3NCJH 3IXTA 4WV1B 4Z7WA 3ZMNA 1OGAA 1KCKA 3SPHA 1NGWB 4FFYL 5DHEA 3QQDA 4FQ1L 2DMCA 2GCYB 4JQXA 1ZVNA 2G3XA 5I5JA 2CU9A 4HJEA 2YGQA 1COBA 1F97A 3AQYA 3V8OA 2QVTA 3LXBA 1JL8A 1AO7B 1XIWD 2QELA 1VACB 1FG2B 3FJTA 4M02A 5CEZL 3C8DA 3KBPA 4PS3A 1X5HA 2XG4A 4ZSOE 1RPKA 1SFHA 2F7OA 1RY7B 3QXTA 2X6MA 4WY7H 1JDDA 3TA3D 3GGWB 1K72A 1UZ8B 4G3YL 2NQCA 4FNPA 1ZV9A 2ZT9C 2HT4C 3VSUA 3VXQA 4Z7OE 4MDIB 3QFDB 2ARJA 4I7ZC 4JQVA 4QXGL 3ZGHA 4O58L 5HHVH 4J2QA 1BSIA 2N4IA 3BISA 4PRIE 4QY8B 5E00A 3ECBB 5I1EH 1DLFL 1NFDF 3RZCD 4J6IA 5HP5A 2PN5A 4PJ9A 2J7LA 4IOSD 4PJAE 3HI6H 4TVPE 2Y7MA 1A7OL 3H7LA 3BKJH 3MZTA 5DJYA 5HYQA 2CKBL 3MJ7B 4YHYC 4KFZC 4QRTB 1A6ZB 4ETYA 3WN5A 2KLTA 2ZKXA 1WZAA 1FH5H 1ZS8B 5D6DC 3BIKA 2EH7L 1PZDA 2X12A 1T2XA 1R5IA 4Q4EA 4IBQA 2PP8A 5E1GA 1YNKL 1M2VB 4G43B 3RL2A 3MRDB 2H26A 3LH9A 3GSVA 5TQ2L 2AJUH 3SO5A 4PTUB 5LVEA 2BSTB 5IEKA 3CMOL 3WAJA 2CO4A 1WJ3A 4H40A 5KS9E 2P48B 3BUYB 4P9ML 3UBXB 1CIUA 2B4CC 5GGRY 4GG8B 5I2IA 4AYFB 1IC4H 1EIBA 2E4FA 3LIUA 4OM1L 3GBMH 3P0VH 1OSYA 3ILPA 2WN3A 5F1OB 4UTBA 3BXNA 3WFBL 1U6AH 2BWDA 1OSPL 4TNWK 2NT1A 5CSGA 2R15A 3PFUA 4K8RH 3S34L 3G5YB 2DI7A 2OV0A 5E4EC 1XIWC 2YC1A 2IPUG 1CFQB 4XNZC 5KW9H 2J5LC 4Z3EA 1NMCB 1H19A 3TA3C 4YDIL 3VXRD 4HKBA 1SN5A 4Z77B 5KVEL 2IOOA 4XC3L 3H4HA 4RFEB 1M7DB 3LXUX 2DI9A 4W9KC 3PAZA 4A39A 4H0LC 1R3JA 1B9KA 1Q9WB 4WJ5B 3CHXA 4HC1L 2DLEA 4QYOB 4Y2OB 4F7TA 2FH6A 2OZ4H 2MEJB 3ARZA 4PJBE 2JJTC 2NRDA 4DZ8A 5CBAA 1EDYA 4MNHA 3AWFA 1EDHA