4FFZA

Crystal structure of denv1-e111 fab fragment bound to denv-1 diii (western pacific-74 strain).
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
b'YVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
molecule tags Immune system/viral protein
source organism Dengue virus 1
publication title Structural Basis of Differential Neutralization of DENV-1 Genotypes by an Antibody that Recognizes a Cryptic Epitope.
pubmed doi rcsb
total genus 12
structure length 97
sequence length 97
chains with identical sequence X
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ffzA00
3J2PA 1OKEA 3UZEC 1Z3RA 5GZNA 5JHLA 2P5PA 1UZGA 5KVEE 1Z66A 1S6NA 4UTBA 3N43F 1PJWA 3C5XA 3UAJA 3N41F 4GSXA 3C6EA 1ZTXE 3MUUA 1URZA 3N44F 5KVGE 4L5FE 5IZ7A 3WE1A 2GG1A 2ALAA 4FFZA 4X42A 1OANA 3J27A 5LBVA 5JHMA 5H37A 4BZ2A 4UTCA 2R69A 4AL8C 3N40F 3N42F 3G7TA 4UT9A 1SVBA 4BZ1A 2HG0A 4ALAC 5KVDE 4UTAA 3VTTA 1RERA 5GZOA 3P54A 5B1CA 2H0PA 4FG0A 5LBSA 2JV6A 2R29A 2I69A 3UZVA 4AM0Q 5IREA 2JSFA 4UT6A 3UYPB 5KVFE 4GT0A 1TG8A 2V33A 5LCVA 5AAMC 3UZQB 4FFYA 2JQMA 3IRCA 5AAWC 1OK8A
chains in the Genus database with same CATH superfamily
4YL4A 1RMFH 2UZYA 3FN0H 5EIQA 3KPSE 1G5AA 2K6WA 3E8UL 1MW2A 2P43B 2VXSL 3BVDB 3GYRA 4Y1TA 3SGDI 4DGIL 2AI0L 3AITA 2P8MA 2R4RL 1CBVH 3JT0A 3C2SA 1WEJL 2G2NA 1NCOA 4TVSa 3ULVF 1ZD6A 3W37A 3OKDA 3T65B 2XN9B 3BIKA 1SHXA 4UV4H 4DJMA 4ZQKB 2E6JA 3U1QA 1O9WA 5C07B 1IC5H 2EQDA 3QNXB 4FKKA 2Z8RA 1A9BB 1RJCA 3GFUA 1XGUB 3GKZA 1ZLUH 2UXFA 3GUTB 1AR1C 4KUZH 1WS8A 4J3OD 1PFOA 3DX0A 2VERN 4E41E 1LE5A 2PWGA 1U8KB 5IY5B 5LBVA 1H9VA 3SZ6A 2Q20A 3MX0A 5E1GA 3U30C 1XXFC 3RWHA 2QSVA 1U8QB 5EZOH 4P3CL 4ABQA 1H3UA 4GFTB 2ZSVB 4CC4A 4AW7A 3QZOA 2XG5A 2VXUH 4BFEA 1G7PB 4PW4A 1IC5L 3LPOA 3EHBB 4PWGA 5LN8A 1TPXC 5GHWL 1EJFA 2UY6B 4YWGH 2CZNA 3QHFL 4LRIA 4CKVX 1OGTB 1I9RL 1F4HA 2H0JA 4N1HB 4KY1H 1WBZB 3MDJA 5D1ZI 5FWQA 4Z23A 1QNZH 3QBTB 4QXGH 5FOBB 2YMOA 1S7XB 3DIFB 2AI0H 4PJBB 5GGQL 1AIZA 2WBJC 1U3NA 3APMA 3CG8A 1UQSA 3T2NL 2CSPA 3GJEB 3N43B 2KUTA 1ZSDB 4ODSL 3S3BB 2LAAA 2OFQA 1OQOA 3PGDB 4ZODA 5L88L 3QT2A 1GTNA 1TG8A 3F7PC 3HZVA 1NGWA 5JPMA 2G5RA 2D73A 5ACLA 3WXWH 1JGDB 1S7RA 4NN7B 2B16A 1QKZH 4FHBD 4AOFA 4AQ1B 3L3KB 1JTOA 2C4XA 1U91A 4N2OA 2C3GA 1ROWA 4KXDA 4UBDD 2ZXBA 2VUOA 1B0IA 3QRBA 3VSVA 3HLAA 5D5MB 1NANI 2BIIA 4I2XB 1FVDB 2AJSH 3O8XA 4NFDA 4JO1H 4KTEL 1MREH 1NUFA 2YBRB 5TE7L 4NWTH 1CFQB 4KK8C 2O6PA 2VIRA 5AW0B 3RAJL 3TJHD 1URLA 1N3NA 1NMAL 5EWIH 2DWSA 3D85D 3M7FB 4KJQC 1C5CL 5KSUA 2BNRA 3N04A 1MFCL 3FFDA 2NQCA 2QADB 2YN5A 1NBVL 3A6CL 1DYZA 3DO4A 1I8LA 3B43A 4K7PY 4L4TD 1RZIA 2HWZH 4Y7OC 1FF5A 1P0SE 1OSZA 3TBVA 3JV4A 4F9LC 3S3DB 4JPWH 5D5MF 3NACL 3DHUA 1T2JA 5L4IA 3CDCA 1S7TA 4NQSA 4QIRA 3K5RA 2V7HA 3BESR 1CPUA 5IB1A 4BH7A 5KBDA 5F1NB 2EZ0D 2FAUA 3VFOB 2GEEA 4IDJL 4UNTA 1TTCA 5DUJA 2PR9A 3QDJA 1ETA1 5E23A 3U1SH 3L17A 2F5BL 3UERA 3GLDA 4JCLA 1HHJA 3TEYA 4MA7L 4U05A 3VD5A 4YZFE 3ETSA 2J8OA 1KCSL 4OZFB 5I16A 3OXSB 2IEPA 2FLRT 2CLRB 4LSVH 3E2HC 3MHZA 1AG6A 4YSEA 1U3HC 1KTDB 2Z7YA 3BE1L 3MREA 1TDQA 3DUUA 1YYCA 3HS0C 1TZIA 4FNQA 4KK9D 4DW2H 3WSQL 4F7MB 3LEXB 2B0SL 3WFEH 2NX5B 1CFVL 4L4JA 4CC0A 3Q2VA 4UILH 2VLKE 2FBOJ 4XPAL 5D1QE 1ZHLA 2DM7A 1GGIH 3QG6B 1GAFL 4UU9A 1M7XA 3QQ4B 5HYJB 2EYSB 4KKAC 4MQXC 3ATFA 1ZLWH 3LEYH 2LFGA 3OHMB 4CVWA 3OSKA 2VJ8A 2X6VA 3HJ0A 3VI3E 3ARBA 2AKRB 2D7MA 4TVPE 1BPVA 2MH4A 4AKQA 2Y5QA 3J27A 3WJMB 4M02A 1NEZB 3KPPB 1FGVH 4Y19B 3S5ZA 2ZIDA 4J2QA 5GS2D 3TVMD 1X3DA 2DWDA 4PEEA 4Z7NF 4NX0A 4JDVA 3U6XA 2VZSA 3CIAA 4KZCA 5C0BA 1TJIL 3HEIB 3UXFA 1YYLH 4XP1H 4IOSA 2LVEA 4J3OC 3MOBL 2WINA 2GJRA 3OGCA 1YJDC 5FA4B 2HYMA 4BE5A 1IAIM 3L4TA 2CAKA 1BOGB 1AKJD 4QHUA 5CZVH 4UQCA 4FXTA 2QKSA 4L8SB 4AVHA 5HJ3B 2FSDA 1JF5A 4R5TA 3SDCB 1ZHKA 2X1OA 3MV9D 3PWPB 5IJKA 3K1KC 4JFHE 3C6SB 4OD2B 1NM9A 3O0RH 4IGBA 5JW4N 1VF5C 4GXVL 4XZUB 4L4TE 4AQAB 1K4DB 3IVKA 5DVPA 5H94B 2FR4B 2H0PA 4I0PB 1I3GL 4QNPF 1B0GA 1PG7X 3A6BH 5BVJA 3CDZA 2OA9A 1WZ1H 2EYTB 5HYSA 3MPCA 3W9EB 5B4MD 4GKZB 5J6HB 5DRNA 2VDNL 5FX3A 3WD5H 2WBJD 3KE0A 2OMTA 3MOAH 4LARH 1KFAL 1UUNA 5DSCB 4XMKH 2DQ6A 1ZT1A 3BAKA 4HLJA 4S10A 2IAND 3O4LB 1M1XA 4LVOB 1QLEL 3IDIB 5JA8B 1U3ZA 4QDGA 4LLUB 3BP6A 1F56A 1F6AA 1OE1A 4P3CH 4RNRA 4V33A 5H37A 5DVNA 1IBDA 3M6DA 5IV2A 2BZCA 2FBJL 4ZTEA 2A4ZA 4QAWA 5IQ7H 2K3TA 1Q9KA 4G6AC 3V4PA 5J0BA 5F7UA 1CXIA 3RGVA 1IC7L 5D2NB 4O2CA 3STZA 5BS0B 1AGEA 1ZKAA 3RTLA 2XWRA 1FAIL 5J1SC 4PRBB 2UZPA 1AXSA 2AAVA 2DIAA 4JRFA 4NQCB 1BBJB 4JFFE 4UDUA 3P4NB 1WVZA 1QX1A 3DTDA 5SWSD 2VRQA 3F8UB 3GHPA 5FLVA 4JR9H 2PTTA 1QFWI 3QXTA 1RJZA 4W9CC 4L37A 2ADYA 2F8IA 4KJQD 4WFFE 1X4YA 1LYQA 2R59A 5K9OA 4G8GA 5LXVA 2JK5A 4L8DB 4Q52A 4AJ0A 1KCLA 1GSKA 3LAFA 4PWKA 3SCMC 4JNXA 3WNNA 5E8DH 1G7JA 5CGTA 1DVFD 1S9VA 2J1WA 3V6FA 1NEUA 5KYXA 4P4KD 4NHUB 5T3ZL 4AGLA 4XBGB 4OKVA 1A1MB 4PCTA 5FGBA 3HE7A 3S4SG 2EH7H 5E70A 5JIDA 4W4OA 1SXSA 1CL7L 5DHVA 5I75C 4FCAA 1NGWB 3PJSA 5JPMB 1QBMH 4TUJA 2X70A 4LPVA 4LU5H 3VWJC 2AQPA 2J6EA 1E8ZA 1S7RB 3CHXA 3HG2A 4ZMVA 1OZTG 5C92A 2YPVH 4NGHL 4XAKE 3BJ91 2WXMA 4PB9H 3V0DA 1P9MC 4IU2B 3VMOA 1R24A 2VR7A 2XYCA 4E41B 4I87A 3NRFA 1EJOH 3BWAA 1YEGH 1JGEB 1J9RA 3ES6B 5T3XE 4NZDA 4OCXL 4QLRA 5EIIG 1QQDB 2XA3A 2IOIA 1X5AA 4S2SA 4DKFH 3TZVB 1Q90A 2A9NH 2GHZA 2N7AA 3BP4A 3QZMA 2JB6A 1Q1PA 4MBRA 4AV4A 1FZMA 2FE0A 2HRLA 3V7MA 5E2UL 4DP6X 4Y16C 1ZGLB 1M42A 5KVFE 1NWOA 4A2GA 4X8XA 1LMKA 3GI9L 3K0YA 4U6TA 4AYGA 5AYTA 2ZZUT 2DI9A 2YD2A 4J8QA 2ITDB 3LNFA 3CZKA 3LB6D 3QI9B 2VDPH 3FO2A 4YXKH 1ZPLA 3SKMB 3EXLA 4DN3L 4UT6H 3TH2T 4AM0A 3I50H 1SFHA 2O30A 4ZMLA 1N19A 4XH2B 1KY6A 5EU4A 1CR9H 1NBZA 2VXVL 1OSPH 3OKKA 3ULUF 5LO7A 1R5WA 4FGMA 1I1AB 2DKUA 5E8EA 4F3FA 3HOGA 2JCCA 2W59A 4JB9H 5FK9A 3UYRH 3DYOA 1X5HA 4N86A 1W8NA 1J5HA 3TLRA 3MACL 3EFDL 3PAYA 2ITCA 5M95B 2CRYA 4QHMA 2ORBH 4H2CA 2BNUB 3K72B 3QHZL 4EUPG 1ACYH 4B50A 1Y0LB 3Q0HA 3ATEA 1UB6A 1KGCD 1JGUH 1BYOA 3UJIH 1M57B 3JTSB 2OZNA 3VFVA 4RMWA 3S5LA 1ZS8A 4NSKA 4PS8A 3MLRH 2JH2A 2X6CA 5D1XA 4IHOA 4BWUA 2E6QA 2IG2L 3ECWA 2PXYB 3QJQB 4XZ4A 4GNKB 4UYPA 4FLSA 3NFNA 1MRCH 1R34A 2COVD 4ZAKB 4HU8A 4BEIA 3FB8A 4QRQB 4GIOA 3EZ8A 4JGUA 3WELA 3MR9A 1Z5HA 1I31A 2F8XC 4Y2DC 3F01A 4FULA 4YHYB 4AGNA 3MROB 4OD3L 3UMNA 2MOGA 4GSDL 5E5UB 1LLAA 2F1BA 1DQTA 3KPRD 3TBTB 3WMPA 1RZKC 3GIVA 5LGJB 2XIIA 5LVEA 4G6AD 3CBKB 1DLHB 1KCVL 2A83B 3ZLQC 4LVHC 1ZS2A 2WINB 4YDKL 2UUDH 4HUWA 4PJDE 5FA4A 4PGBB 3S98A 3ULVD 4IS6B 5IFAL 1WTGT 3OKLB 8PAZA 5J11C 1RZFH 2EKSB 2VN3A 5JW4R 3C6SA 3OM3B 5EB9A 2NZ1A 5HHXH 2R1XB 1PKOA 1D9KA 3GSUB 1INDH 5LQBH 3GM8A 4ZFZA 5IOPB 1OAQL 4MWFA 5DJDA 4NO5A 3G5YA 3PL6D 3C60A 2IJ0C 1CFSA 2VW7A 3B6SA 3IAGC 3L9YA 4Y2LA 3UG3A 4ZDHA 1GS8A 1GOFA 4EPSA 3QQ9D 1IM9A 3PP4L 1KIUB 2ADGA 2EDQA 2ZYSA 3GSVA 3ML8A 4IOFD 3QUYB 4WWKB 1NEZG 5EFIA 3VXSE 4KITB 5BRPA 1BP3B 3OLDA 1NGQH 4L1LA 3MRCB 1NLBL 5D71H 2YD9A 5KZCB 1Z9NA 3QPXH 4YXHH 5ID1B 4TPRH 3ECBB 4WEEA 2NYYD 3HFFA 3PP3H 1A6UL 2FEDC 1TVDA 1TZHB 3K6NA 1F41A 1OARH 1MRDH 1Q9OA 2WB7A 1DSYA 2ZOOA 4Q2ZA 5T1LD 4JFEE 5BO0D 1G9HA 1K6QL 4B3VA 4O2CB 3STZB 3BFWA 2C7UA 5JUEL 2QHLA 1KGCE 5I1EL 3D85A 1CDBA 4HW6A 5E4IA 4PJFB 1TYRA 1SJMA 4HBQA 4XWGL 3WE6A 5TE4L 5ICYB 4RVBA 4ZMNA 4RMVA 4KRMB 3SBRA 5AYUH 4XP5H 2YPLB 4D7BA 1G9NC 1FL3A 4NBYB 1IFGA 3UABA 1TYEB 1PKQE 1D7DA 4N8CL 3O6FC 1H6TA 2WZ6A 4JM4L 4Q9QL 1XGPB 4EZJA 2X1QA 1L9SA 2HLAA 1BD2B 3GMRA 2CWRA 3D0VA 5IQMA 1S9VB 3V6FB 1AQHA 4NKOA 3SE4C 3D39E 3HMWH 3KR3H 4LNRA 1C8PA 4N0YL 4NFCA 1IBBA 3QNYA 4OM0H 2Z92B 3EDJA 5J9PB 1WD8A 2PCFB 1HZHL 3OLEA 2BJMH 1N9PA 3QEGL 2JIXA 3HHSB 2APFA 5EHFA 3O6ML 4JPSA 4MXVE 1QUNB 1YEWA 3QIWD 3MJ8B 4YK4B 5D2LB 5GS2H 1MF2L 1PYWA 4FQCL 4U1HA 1HL4A 4ZD3L 5FO9A 3X1EA 5DJZA 5JNYA 1ID5I 3BPNB 1RZJC 3CFEA 1E4WL 3L4VA 2JCCF 5EO9B 1IC4L 3SKOA 3LQAL 1D5XA 5LGHL 3WAKA 3U0WL 1R24B 2F5BH 1KB3A 1CF8H 3DTXB 4EBQL 2Y72A 3ES6A 1RIVL 3ZE0E 1U3YA 1XF5A 4NQCE 4DNLA 3LS4H 4JFFB 2A6KB 3KYNA 4HIHB 5JHLH 4N87A 4P04A 2V2TB 2VCOA 1TCRB 4FYRA 3FULA 3TEXA 3UDWC 4JPWL 4P59L 4ODBD 2ZPKL 4YSAA 2ED7A 2XG4A 5IW3A 3X12B 4JFSA 3O2WL 1AD0A 4G1EA 3CDFA 3EFFB 3JTBA 3TV3H 3N50A 7TAAA 3T77B 2ITDA 1FNLA 7FABH 1LWRA 1KJMA 5DD0H 4Z3GA 4Y9FA 3ZRFC 1J48A 3LZFH 1WBZA 2FUTA 3FSAA 5L8JB 1PPIA 4M5ZL 1F4YL 4KH9A 3INUH 3SDAB 1OKEA 2FJUB 3HLKA 1NBZB 3CK0L 2YBGA 3DETC 3PXHA 3O6KL 4FYQA 5F7DA 1ASQA 1TQSA 4U3SB 5KSAB 2EDMA 3P40A 1T4KB 5FK9B 1G7HA 4QTHB 1VENA 4ONGH 1UWEH 4JVPA 5BCAA 2HB0A 4XCYB 1QSED 2X6UA 5E99L 3CGTA 1MCRA 3VI4A 3D2UA 1G9ML 4NZJA 4ZNEA 2GJPA 2JTYA 2J73A 2AVGA 1P5UC 1R3JB 1U3HB 3KH3A 5HHVH 1MZYA 1P6AB 1JGDA 3UIZA 2BPBA 3ZT5A 5I1AA 5IM7B 1T03H 4EIBA 2X2HA 2YAOA 2UYLA 4PJAA 1IGIL 1MJJB 1HXKA 3F58L 1A1OA 1QSFD 5FV2A 5AAWC 4PJ5D 1RIUL 4R26H 3JTSA 3VFVB 5JXAH 3OKYA 5C9KA 1CXEA 4FLQA 3V0HA 3MCG1 4JPKH 4Y9CA 3GSXA 1XR9B 4NSKB 2XWXA 4DKAA 4DO4A 1MWAH 2XETA 3VTAA 2ESVB 1E8YA 1BVKB 3V5HB 3QA3A 2IPUG 1TNNA 5KSUB 4YX2H 3E80A 3BUQA 5HTSA 4N0RA 4B3EA 4L1BA 4HAGA 1J12A 4YHMH 3IDGB 4PJ7A 1YMMD 5I6XC 4G6KH 3WIFB 3S8WA 2P8PA 5LN4A 3O3DB 3V10A 1HSAA 1ZDSA 4BSVB 2DLTA 2G30A 2IAMA 1XSJA 3KVDD 2QVMA 3EHBD 2DQJH 3N41F 1LO3H 3H2WA 4YO0B 3VFOA 3UTSE 5F3FA 5C7XL 2VLMD 3FT0A 4U6YA 4Z7WF 2KDYA 1AOZA 1HHJB 4XBEH 4JQIH 1OTTD 2CPCA 4XN5A 2IBZY 2XQBL 1J1XL 1AYOA 4K73A 3ZO0A 1KELL 2OSLB 3F04A 4GOSA 1LEIB 3GPSA 4N6RB 5F6HI 4K0OA 5FKAB 4Y16B 1GOHA 4XMTA 2HXAA 2RFXB 3EH2A 4XAWL 3VD9A 1U93A 4C83A 3QCVH 3NZUA 1OTUC 4Y9BA 5DRXB 2FSEB 2D03H 2E9GA 2M26A 3AREA 5D1QA 1EWHA 2CIIB 1E2WA 4S1QL 4WCYL 2HMID 3EYFA 2H32A 1XL6A 4GSQA 3M8OH 3SPIA 2NR6A 3FSOA 3FTYA 3PDGA 4WWKA 3VFPB 5B39B 3AWEA 1NAMA 1DVXA 1X7TA 1ID2A 3QQ4A 2F8VA 3AGWA 3MRCA 2BP3A 4I18A 4N2FA 1P7KB 5EU6E 2EVHA 3MUHL 5KW9L 5JHAA 4XT1C 1CD0A 1QUPA 3M17A 3B9VA 3ARBC 3RKDD 4MQ7A 1DP0A 4AWJC 2NY6D 5C6TL 5CXPA 2UWEF 3SYOA 2MRYA 4R7NA 1TJHL 4NUGL 5I8CA 1DVQA 4LQFL 1XF4A 2HJKB 3GI8L 3IM1A 4XHJD 1HHHB 4Q7DA 1LNUB 1VHPA 3KR3L 1BFOA 1RZGA 3FT3B 3MGTA 4UTAL 4DK6A 2XWZA 3CSFA 1Q72L 1WCQA 4O02B 4FFYH 5AG8A 3CZNA 1AHMA 1OP5K 2I07B 1QFUL 4NQXA 2AK4D 3NABH 3U4EB 3CHSA 1WA0X 2IV9A 4WGWB 1MUJB 1T2QL 2HJFA 3QFJD 1IEAB 2ZG3A 4OD1L 5E2JA 1ZVSA 5KYNA 2JKXA 4OZIA 3PWPA 5AOLA 3TPUA 2XKUA 5IROC 5B1JC 1GKEA 3QRGH 2A7BA 3MJ9L 2IH9A 3RWDA 1K4DA 3LHAA 3IVKB 1SYVA 3RWIB 2HVKA 4MDIA 5ENWA 3DXAD 3CDZB 3UP1A 4LASH 5T5FH 4N0YH 5FYLL 1F4WH 1A65A 1U8JB 4HOXA 1IGYB 3SDXB 1RSFA 1CU4H 1JI1A 4GMTH 5F21B 3VW3L 4M7KH 1GXEA 4BWWA 3EDFA 5DZVA 2EDRA 5BOPA 4J7RA 4F27A 4RNRB 1DN2A 3PJNA 2CM5A 4UZSA 5AOIA 2QHRL 3GSNL 2VXQL 1XH0A 3RDTC 1VCBC 1GC1L 2CHZA 2K8QA 1YEDB 3G6JA 3ROOA 4BDVB 1GGCL 4PRPE 4GINA 3RJOA 1SN2A 4JG5A 1D2OA 2DMKA 4NRZA 3I3DA 4WV1A 3ZDZB 2BCKB 4Y1AA 3VXPA 3C8KB 4P2RE 1Z6JT 3APDA 1BD2D 3DROA 2H9GA 1OCOB 1EO5A 4KGJA 5DEFB 3EYQC 5KWYC 1J1OH 1CUOA 3KGUA 3WEAA 5DJ6B 1AD0B 4G1EB 3VXMB 2GI0A 4HWNA 2CXGA 4CMMA 5EU6D 5AZEL 1X5MA 4TLUA 1AP2A 3GSNB 3NZ8A 2FT8A 3OKNB 3EOYG 1LP9E 1T5XA 3HZMB 3S36H 5B7MA 4OQTA 3PAZA 4N0FA 3HUJA 1J88A 4ZNCD 1Z5LB 1H3TA 4OFPA 4PYGA 2AZAA 3OWEA 3E0GA 3SDAA 2AV7B 2CDEA 3VXRD 1M6OB 4CC1A 5C9JA 4JHAH 5CN3A 1QLFB 5D7IE 2BP8B 4PJGA 1WAEA 3HE7B 3MV7D 1R5VB 1IEHA 1EQWA 1NFKA 3RLSA 3NCFB 3JWNC 4OFVA 2W60A 1I1RA 5DUMH 3MLUL 4M3KB 1D6EB 3HR5A 1I1FB 4YDIH 1MWAB 3GBLA 5GSVA 4LHUD 4NFBA 4CVXB 4KGLA 3U6XS 3W0WB 4CSZA 1BF5A 2AC0A 3PWLB 1HHKA 1VGKB 4EF3A 1CD1B 4OJFH 1CLZH 5F9JA 1JF1B 4MAYB 4X6EA 3WNLA 3B7YA 3C08H 2GB2A 3FCSA 3MNZB 1JHKH 3ARVA 4JRXD 1HNFA 3LKQB 5CR8A 4HX1B 2GEQA 4NQDE 1AY1L 4PRAA 2OXGA 4XC3L 1OLLA 1BVKA 2DRUA 2ORBL 5J5EA 1AZVA 1YNTA 2BM3A 1OPOA 2FJFA 4OCRL 2XY2A 2A9MH 3EH3B 2VDOH 3QJVB 3GMLA 4A2DA 2QVKA 1FZMB 4MAYC 5JXED 1RUAH 3ZYOA 1JP5A 2NY2D 5GGSA 5IBTL 3QQXA 3RBGA 2VL5A 2WW8A 3ZPDA 4JRYE 3BQUD 1U8IB 4PJ7B 3QNFA 5GSRA 3AY4C 2OZ4H 1CYXA 2F7PA 4PGCB 2V9TA 2OX5B 4ZUTB 4XXCC 3IETB 4E9XA 1HYSD 1ZTXL 4P2RA 3QJXA 1K4CA 1THCA 4BXSV 2JCCE 2YO3A 2FX7H 2J8UF 3LQAC 4NPYA 4MDJB 4MQSB 1IEBA 4KXZH 4HKJA 3KPOB 3L7FA 4Z9KB 4J3SA 4PJCB 1PY0A 3BVXA 1OT1A 4HEPG 2G5BA 4R0LB 4R4FH 1OAUL 4PBDA 1GTFA 1A6ZA 1Y0LA 4C83B 2ADIA 5GZND 2GITA 4RX4A 4ZTOH 1DUZB 2E3VA 2F54D 5JZ7D 2XWCA 5I23A 5EC2A 3LXCA 1R5IB 2HFFB 3II3A 2FLMA 2ESVE 1T1WA 2IPTH 3CLFL 1MCLA 4KQ4H 1ICTA 2C9XA 2DQCH 1Z9SA 4XPBL 4QHNA 4YHPB 3WIHA 2UZIH 4XI5D 3HE6B 3NFNB 1IAOA 3GI9H 2OR9L 2YWZA 5GJSH 5FECB 3PWPE 2PO6C 2IV8A 4I0PC 2P52A 4MAZA 2PO6B 1CLYL 3ZQXA 1XBDA 1W80A 3MNWB 5EBLA 3D52A 2H3NA 4UOQA 1U8LA 3GIVB 5LGJA 3TFKD 3US9A 4XNXL 2DQHH 1OTUD 3N06B 3FHAA 5DJ2B 3V0GA 4OF8A 2G0KA 4M8QA 4N2DA 4PY7A 4WWID 5D6DC 5E56A 5FIEA 3T8VA 3I9PA 1V7MH 2OMYB 2CUMA 4MCNA 3VFRA 4PRDB 5D7SH 3C60C 1QFWL 2DQGH 2ICWA 4WNJA 5BUPA 5B1BB 4B96A 4R4NC 2F5AL 1YC7A 3ILQD 5EORH 1MFDH 2CK0H 3DNKA 5SV4A 4G83A 1NLDH 1WFMA 2PWFA 4JFEA 4E9WA 1NGZB 2P46B 1V3JA 1PD6A 2PR4L 2ZAHA 4W9EC 2H32H 3RIFK 4QOKB 5HDWA 4Z3IA 3T3PB 5B3SB 1CIUA 3K74B 2V33A 3X3GL 2JKLA 3M1BA 3T9WA 2V9RA 4HU2A 4ZFFB 5IJVA 5DHDA 2EC8A 3K6DA 1XCTB 1ZV5A 4ZW7A 5I82A 4C8XA 5C0RH 4MA1B 5FW8A 3LXBA 4HQQH 5DXWA 5DZLA 4APXB 4WENB 1YY8A 3R4RA 1ET8A 3ENEA 3FOLA 3PHSA 4ALAC 2PNDA 5GXBB 2R9HD 2XPGA 1NPJA 4WSJA 3V79C 1EHLH 2XZCL 4YMPA 2V3DA 4C56E 3AB0C 1A6TB 5HGAB 3OXRB 5ALCL 4FL4B 3GEFA 1ZIAA 5T33H 1QYGH 1QR1B 1MWOA 4MA8H 3KHQA 1T21A 2Q7AA 5FV1L 4PPTA 2R0WL 1G7MB 5EULV 5BUAA 4XPHH 1YMMA 4CNIB 2QQNH 2ZT9C 1ZEAH 2YPLA 3LHPH 4Y4HA 5CILL 3QR0A 4OLZH 3E1ZA 5CFHA 1BFTA 2G3ZA 3NZHL 1HKLL 3TIDB 1Z5LA 3B9KD 5SWZA 4LDLB 4A7VA 1FLRL 3Q5OA 5TGBB 4KUCD 3BISA 4R7DA 5CUSL 2X6BA 3MLXH 3SPVB 4KROD 3AACA 4K5PA 2JJUA 3ZBMA 3RZCC 2DBJA 4WUUD 1C1EL 1X7QA 1K9TA 2YEZB 1TQCC 3BUYB 2NY1D 4K7PL 1A8JH 1TQCB 2ICEA 1KLGB 3IKCA 4M1DH 4J4PC 4P46C 1E3ZA 3SE3A 3PWLA 5DD5H 5A2KH 5IW6A 2H26A 3GXTA 1D5XB 1N7ML 1OM9A 2YMXH 1A4KA 3MLSL 3QDMB 3R06B 1I1CA 4KJPC 4XMPL 3RA7L 3PGDA 4MTMA 5DLMH 5EA0L 1WWAX 3WGVB 1BEYL 4O2EB 4XPGH 2YUXA 1SMOA 4X6DE 5E5RB 4ZMTA 1FH5L 2DI7A 4GAGH 4HETA 2B0SH 1AXTL 3WLBA 2ARWA 3BSZH 3DX4A 4AQ1A 3TYGH 3RTQD 5TF1L 4RBPH 3A67H 1YNTB 3GSWA 5T1LB 5BRZD 3MRBA 2G60H 3GMLB 4M6OL 5AW8B 3P4OB 1QMUA 4XXCA 5BVPL 3LSOB 1L0PA 3V6ZB 5GGSY 4MJIE 1UG9A 4XVTL 1S5HA 1RIHH 5CJQL 3M1OA 1DJHA 1RZ7H 3EO9H 4KX7A 3N1MC 1ITCA 1HQRA 3MJWA 3NN8A 4IBQA 4PD4K 5TE6L 4EXPX 1V7NL 3MQIA 1RUPL 2QEJA 4G6JH 2P5EB 3IETA 1U8PB 4QD2E 3VX1A 1PZSA 3FUNA 5AW6B 4FTVE 2E59A 4XPAH 1PU0A 2CHWA 3WTVA 1MJ8L 3ZO9A 3EGDA 5B7FA 1EGJA 3TS8A 1AI1L 1T4KA 3GZQA 1KEML 1UM5H 1P4LB 4PJ8D 2C1PB 1I75A 3L5IA 4JM2D 3PWJB 3CH1B 1EFXD 4JFDB 1T04A 2HCZX 3FXIC 5IM7A 4LRNH 3DV4A 2DQDL 5IF0B 1MQKH 1P6FA 1B90A 5GGTL 5ETUA 2FDBP 4GQRA 4JFPB 5MENA 2FHBA 1FVCB 1U41A 4H8WL 5CLXA 3ZTDC 5HGHB 2J8UB 5SWZB 1Q94B 4YHZH 3RVTC 4DGUA 1ED3B 4D8PB 1ORQA 3I02A 2VSKB 4ABWA 4WKZA 4XCCL 4XNUL 1F86A 4OLVH 1T7WA 1GKOA 4TYUA 1QABA 1AXTH 3BZEB 2XWJB 4X7TB 3QEUB 3QXAB 1A02N 1YSOA 1RQ5A 3C5ZB 4JY5H 2ZP0T 5IB4A 4EDWL 4JRYB 4TSBL 5I26A 3EJCA 3S88L 5LXGL 1Q0XL 3Q13A 1ZHLB 3F6LA 2NX5E 3KJ4C 3QG6A 4JKMA 2VLKB 3SE8L 3P0YL 1O75A 3UCRA 2J4WL 1LO3L 2IAMD 3WIHL 4Y5VC 5FUCC 1XVSA 4GAJH 4GBXD 4N2AA 5TE7H 3CPLA 1NOLA 4LEXL 3FTUA 1LJMA 2X44D 4DP7X 4KI1A 2OMYA 3O6FA 4KTDH 5C86A 3VFRB 4DVBB 1E5YA 4PRDA 1J10A 3KPPA 3WEBA 5C0CA 4N8UA 1XHHA 2OXHB 3CBJB 2L8AA 1J9TA 4AXWA 1T22B 2RJMA 2XNAA 4KX9A 2AQ2A 3PG2A 2VXUL 3OJMB 3WNMA 3HBPA 1JDDA 4XVSL 5CKGA 5EDXA 1TKWA 2H1PL 3O9WD 1SNRA 4M4PA 4JM0A 1KV3A 4AL8C 5CILH 3DX2A 3HS0B 4I18C 4BZ1H 3OB0H 4DP1X 1E2VA 1KTCA 2GC7C 1PDKA 2Z3FA 3KPLB 4ZPTB 3AGVA 3Q48A 3I75A 3TM6A 1AGDB 5DVOA 2MEJB 1TTUA 1BZ9B 1HINL 2QFPA 5JR1L 3EYFB 5A2JH 5IFJA 2NUPB 1IGIH 1KCRL 1OB1B 2AEOA 4H1LH 3G6DL 1QYGL 3MUY1 2M2DA 4NC2B 4ZUUA 1OM3L 1SUHA 3TNNB 1R0AH 5T1MA 4J3OG 4OI8A 4I18B 3AJ7A 1DANU 3NAAL 3AM8A 2BC4A 1RVFL 1JUFA 3HN3A 4AMKH 2YPLE 4JG1H 2NY1C 5GHWH 2VYRE 1OM3H 3TFKC 4OW6A 2H6UA 4U1LB 4YHOH 5DSCA 1UB5B 2ARJB 5I1HH 3WL9B 1W6WA 4P99A 2VDKL 3JQOB 4KDWA 4PJDA 4HIQA 1HILA 1S78D 2KERA 1F13A 3BP6B 4H0HB 2W95A 2YUZA 2WLHA 1DN0A 3KPRB 1KB5B 2YLHA 3FFCA 1Q9KB 4KNUA 2DYSB 3GRWL 3WFDH 1E4KC 2EXYD 2WIIA 1YMMB 4IK6A 1RSYA 3WYRA 2P8LA 1I7ZA 1OXYA 3KS0H 2APXA 5DMKA 2PCPA 5FO2A 2CHXA 1J8KA 5EEVA 2Z31A 4Y4HB 1HSBB 3EUUA 4G8FA 4Q58C 5IJBC 5CCKL 2XRAL 5E4EB 3TIDA 2YOCA 1IM3D 3P4NA 4YZWA 5IROA 1VGEH 4IOSD 4K7FB 1TEYA 2GHWB 2HP4A 4Y1AE 3GMPB 4OZFH 1RJZB 1SYVB 5HHMB 3RWIA 1CXHA 2R4RH 1CBVL 3FF8A 4OZIF 4KZDL 3SPVA 1ZSDA 3PL6B 4BFFA 3PCYA 1EDYA 1WD9A 3OAYH 2JK5B 4K9EH 3EJRA 4QUOA 3N44F 4UNUA 5JHDE 2E5EA 3KYAA 4YSSA 3OZKA 1LVEA 4XNXH 3IKCB 3SPJA 2HLFD 2PUQT 1CGSH 3SDDB 3U6RB 3FQNA 2W9EH 4NZUL 4ZT1A 5CN2A 1U91B 4OT1L 2B1AH 3ULUE 4G9DB 5C0GA 4G42A 1U92A 3RVWC 1CI3M 1X4XA 1FORL 1MHCB 3JZ7A 2H6OA 4JDEA 4OU3A 3ZOAA 3G6JB 1NBYA 4PJ6A 3ROOB 3PJSB 2BJML 5I6MA 1FE8L 5DUBA 3QZLA 5DVMA 3FCUB 5DLML 5EA0H 1VFUA 1NIFA 2UX6A 1EV2E 3B8SA 1UJ3A 2E9WA 4R3SB 5C09D 2W07A 3WKNA 2DQFA 3ILDA 3TA3A 2CDGB 2MJWA 3Q6GL 3C8KA 3CWGA 4WY7H 2B15A 4FFVC 2JELL 4KJWD 3FO9B 3BDYL 1HL9A 5IQ9A 3RFRA 4FADA 4HZAA 3GXNA 2EDYA 4UQ3A 5EBGA 1KJ2B 4GFXA 3VXMA 3NIDB 1M2VB 4HJGB 3L4WA 4KV5E 4QRTB 4QTFA 4BYHA 1MIMH 2VXQA 3GSNA 5AOMA 3T04D 2HRHA 4FLRA 5F9OL 2G9HA 4TULH 4KJPD 1ROCA 1U8PA 1LDPH 4A2MA 1JAEA 4E2OA 3M07A 4UTBA 2PW2B 1P2CA 4DHLA 3HB3B 1NMBH 3CHQA 3TESA 2E8YA 2PLTA 4RGNC 2BP8A 4PJGB 3CD4A 3JV5A 3QFJE 4YR6A 5HDQL 1YNKL 4F2EA 6FABL 1TMCB 2ATKA 2LOEA 5K9JH 3PAUA 3VQLA 1BGXL 3FHEA 4TPRL 3MLVL 1EEYB 4LGRB 1Z9LA 4XH2A 4EZKA 1WZKA 3PXJA 4M6OH 3DUUB 1XMEB 3NCMA 1ZLVH 3LRGA 2GSIA 4PJIA 5D1ZD 4F3FB 3CVHL 1E50A 2WUCH 3CV5A 2CBMA 4NQDA 1CWVA 2IANA 4AVJA 5CGBA 4NN6B 5ES4B 3CC5A 3VWJB 4ZUWA 3QJHA 5B3JF 3QIUD 3MCLL 4GKSA 3STLA 4WKZB 5HYJA 4XMXA 3BSGA 4XMPH 5EN2A 4V1DD 2BNRD 4UTAA 2GTZA 3RVXD 4ZQTA 3D7PA 5J12C 3M86A 3QRFM 4A66A 1CQYA 1JHKL 1UOVA 2G4EA 1ITBB 3BO8A 4P06A 2AKRA 3O3AA 2B5IB 3RGVD 2CRZA 2CIKB 3FB6A 1NEZA 4Y19A 1RZFL 4PJFE 1L9TA 1U8IA 3AB0B 2N0KA 3BH8B 1QPXA 3T4YB 1UZGA 3IU3B 5J1AA 1TQBB 4PGCA 5HHOB 1XGTA 3NJJA 1NAML 4HGMA 2QSCL 2HFEA 3L1OH 4WTQA 3O11B 5CO1A 4XXWC 4DVBA 1ZK5A 4TQEH 3MRKA 3RGBA 3LPPA 3ESVF 2FD6H 1FNSL 1YDPB 4HOWA 4D2NA 3RL1B 2VC2L 5IBLD 4J3BA 1UA7A 5DQ9B 1BQ5A 1IIIA 1UKSA 2F5AH 5IVXA 3FO0L 1XF2B 4J39A 1I8KA 1NGYA 4FHKA 3VO0A 3FJTA 2XYBA 2G5BB 1G6VK 3EAKA 3N55A 4EDXA 1BAWA 1K8DA 1AHWC 3D39A 5BOJA 1DUZA 2FO4A 4I5BA 1HWHB 4LGSB 2NXYD 4TVPL 3QZWA 1D9KB 4Z7UE 1QPKA 3B56A 2Y7SA 5C7ZA 2C9RA 4NI6A 3B6SB 1Z9SB 2BC4B 4IBZA 4EJ1C 4RWYH 2C1OA 2OSXA 1M71B 4KKLC 2C3WA 1XSKA 3FQXA 4Z7UF 2QADC 3L81A 3V4PB 4HG4J 2ADGB 3WFCL 3GKWH 4CJ0A 2XSKA 2VO8A 1HS6A 2WNGA 5D2NA 1LK2B 4A6YH 4EI5C 3H2QA 2H3NB 2PABA 4U1SA 2WKOA 1WQVT 3G6AA 9CGTA 1JXFA 4KH2A 5LUMA 1AXSB 2CHNA 3I6SA 1I8UA 2DD8L 4GQZA 4NQCA 4YBQC 2MCG1 5C08E 2GK0A 1UKTA 1Q9OB 3GO1H 2PTTB 4HF5H 3N6YA 4Y4FC 1JZDC 2PWHA 4L37B 3I3BA 3OF6A 4KQ3H 4YHLH 5F7NC 5FA3B 5FCUL 2WUBH 3QUMH 3SGKC 5AALA 1AQ8A 2HJLB 4FP8L 3EYVB 3P9LB 4PJXB 2CO1A 4G8FB 5INDA 4IGBD 4BD4A 4B27A 4JFEB 4QRFA 4G80A 2R1WA 3ISYA 3T1FB 4PJHF 4S0SD 1YA5A 2I24N 2XIDA 3VU1A 1R3HA 5DMGD 4K3JL 5ANMA 1FFTB 4BK8A 4ZFFA 3OHXA 4B95C 3QUXD 4NNPH 4OZGA 5F71A 3EFOB 5HYSG 5I17A 2V9UA 1TO4A 2NT0A 1BLNB 4UOW1 4N5EC 5DEJA 5DO2C 2BRRH 1KPUB 3V0EA 4BA0A 2VDRB 1MCDA 1T20A 4X5XB 2Z93A 1UCBL 4I4WA 3U9UA 1IGFL 4JCWA 3OKEB 1Q1JH 2V5SA 4WTWA 3QYMA 1J0JA 3OQ3B 3GQFA 4F80A 4OLWH 4CKQA 1FL5B 2IWKA 2DIEA 2Y07H 3BFQG 2DQCL 2ZWYA 4MNGE 3RPBA 1NWPA 4UYQA 3QDJE 3RNQA 4IRJB 2YA2A 3VH8B 1NCAH 1LP9B 4MXWH 1JGEA 1M4KA 1NUNB 3PE9A 4PP1D 2YEVB 3O3UN 3T09A 3BWZA 1M05A 3QXUA 4EE2A 2FL5A 2ESVD 4TUKL 2HT3C 2VR6A 4R3SA 1AMXA 1TU2B 3N1QC 2CO2A 3I9GH 5DC2A 4DH2A 2K78A 5JDSA 1U8HA 3CVHB 4TV3A 4JK0D 4LLWB 1KWKA 2G75A 4Z7VF 5GRUH 4LSUH 1ZLDA 3F7KA 3IBOA 5I6KA 3PHOA 3T6WA 1OIOA 2NYKA 3D09A 2L7JA 2YA1A 2ZWKA 3GMOB 1A3RL 3VRJB 1XF5B 4QRTA 3PDOB 2E27L 3FONB 3NYKA 4J27A 4LFHD 1FFOB 3OAYK 3C09B 4ODVH 4YBLC 5HD8D 4FTVD 3HG1E 4O9HH 1QLEB 3UBXB 4AG4L 3X12A 4UOZA 4IRSC 4ZMZA 2FJGB 5LLIC 2IANE 1QZNA 2FK9A 1HINH 2EDEA 4Y9EA 1FO0B 6CGTA 3FUJA 4MD4A 5IHZB 1R9FA 4RA3A 5T1DL 1AFVH 4NCC2 2F18A 2WCPA 3F62A 5FGSA 3KYKH 5AZEH 4MJHA 1KJMB 3DX3A 4GMSL 5CSZA 4PVBA 3HG5A 2FQEA 2XZQL 4HAKA 3UC2A 2XKNA 5HDQH 1E40A 3BD4A 3IJHB 4J2XA 3PV6A 3WNJA 2ICEB 2K3HA 3ECQA 4DK5A 3WTYA 2ZCKH 1OD9A 4ODWA 2E7DA 4LSRH 4K3DH 5DTFB 3SE3C 3DMMD 2XX0A 4AUUA 1J9QA 4E5XB 2WY3B 1MCEA 3HNSH 4GUPB 4NPKA 3SY6A 2HVJA 4XHJC 1BVOA 1IKFH 4R8WL 3ARGA 1ZAGA 5HPMA 2XVLA 5JLZB 1YN6A 1IGJB 5IB2B 2R2BA 2FH8A 4KHXL 2X6MA 5CCHE 1ZRUA 2VDQL 1R3LA 3U2SA 1EHXA 2KQNA 5PCYA 3CUPB 1DZ0A 3H42L 2EH8L 4NQTA 2VM3A 3SKNA 1S8DB 4ZFOA 3SE8H 3MRBB 3VXNA 3NIDE 2PYFB 4RESB 4MB5A 3I6LE 1N0LB 4YXLH 5I5IA 1PEZA 4LOFA 3T4YA 2R29L 1JFHA 1M3IA 3FSVA 4XMWA 4DKDC 4ZSOA 3T5WA 1RPUA 3PQYB 5HPOA 1N0XL 3F7RA 4JREB 5D1XE 1EEZA 3FYEB 4WDIA 3SPCA 1JXJA 3MRKB 3A6OA 2B1AL 4AZ8A 2VQ4A 4O5LL 4ZS7H 4MB3A 3MVSA 2ZUYA 4LB8A 3HS8A 5ANHA 1CDHA 3LEVL 1ZLSL 1KTLA 1CGXA 3W1ZA 4M5ZH 3KPNB 2AJYH 3P1VA 1SMAA 1UASA 3WN5C 1EFXA 4BGLA 2C1PA 3FF7A 4CILA 4QJ3B 4MWFB 3ESMA 4Y2DA 3KLLA 1DL7H 5DJDB 3Q2NA 1I8MB 4LCYB 4F7EB 4KROB 1J0HA 2MPAH 4GP5B 4JFDA 1IBGL 1K8DB 4XCEB 4KDTA 1J0ZA 5GRZA 1G7QA 2Z34A 4AZUA 2W65B 5A7EA 2WLYA 1TJHH 3HG0A 4NUGH 2B1HH 2J8UA 2EEXA 5CINL 2X7LA 1EX0A 3L3OA 3JZYA 4HP5A 4LCCA 2EADA 2X3CA 3TEUA 2YQGA 3IGAA 4EI5A 4KKCC 5FW7A 5DRXA 4BUHA 1F0LA 3W11D 5F7EL 4PRPB 1WF5A 4R83A 3QXAA 1RZ7L 5C2BL 1I9IH 2CGZA 2P42B 2H32B 2WCSA 3X17A 3ASNB 3D06A 5FB8B 3D33A 2VDLL 4PI2A 1VLXA 4G7SB 3T3PE 4MJ5A 5E9NA 4CDGC 1SVZA 5G4MA 4IU3A 5C0FA 3DC0A 3ZRCC 3WE6B 4PP1C 1YNTF 4L0PB 4C47A 1CJYA 1MPAL 3M17B 3BSZL 1QW8A 2IAAC 2OZ4A 5E6IC 1I82A 3GUFA 3DARA 3RWFB 3C8HA 4WW2B 5LNEA 1Y6NR 4G8GE 2AXHA 4C55A 2I9LA 5E08H 5EO1B 5I73B 4ZUSB 4X4KA 1CXFA 1AJ7H 1S5IH 1KYUA 3MRQB 2FNBA 5I18L 2EO9A 4I2XE 3BH9A 3DHMA 1SN5A 1UXWB 1LO4L 1SZNA 4KKLD 5I1GL 4YSUA 1O7SA 2BNQD 2CBQA 2F6AA 2HAZA 1BG1A 1KBBA 1T5WB 1ZJBA 5EO0A 3UPAA 4KKBC 4ORGA 3D30A 2Q3ZA 4QRRB 4YQXH 1HEZA 2PCFA 4PSRA 3KPLA 4ZPTA 1WZLA 3ASOB 4JFYB 5SX5H 3VXTA 3QHTC 1IKFL 1AGDA 1E42A 1BLNA 1QO3A 3KWXA 2JQAA 4NRYB 4J5VA 4F1ZA 4X5XA 1A7PH 5BXFB 3LV3B 1GMEA 1UZ8B 4BSWA 5KN5B 4M48L 3SCMD 4MD5A 1IFHH 3N85H 1ZLEA 5IJKC 3SE9L 3FUFA 4MAYD 2X4NB 5JXEC 2MOQA 1SDDB 2K4WA 5TTRA 5TDPA 3NIFB 2EDDA 2P5PA 3WIHH 5GIRB 3P3YA 1X5LA 2ZKMX 1FDLH 4V1DA 4NEHB 3W2DH 3HUJE 1ZT4B 4WCYH 1BQHA 1U2HA 1KXTB 3AQXA 4WU7A 4Y4FD 4JE4B 3LH2H 1Q0XH 3BUDA 3VCLA 5JDSB 4O5LH 2X4QB 2AXGB 1WP6A 2R15A 1MJUH 2B59A 3QVAA 5DJXB 4Y2OA 3UTZB 1DFXA 1UD8A 3IWUA 2WIIB 2X2IA 2X2JA 4WI3A 3DPDA 3VRJA 2Z1KA 1N2RB 1ETZA 1UXSB 4HHAA 4C4KO 3KL3A 5DC4B 2H8PB 4YXLL 2XFXB 3G6JF 2KYIA 2VAAB 4OF5A 4NO0A 5HDBF 4OV5A 1OGAE 4CDHA 3SGDH 1E8WA 3QUZA 3TEWA 2DQDH 2WXNA 4QOKD 3EYQD 5H35B 4RZKA 1Q0EA 1ZY9A 4IBYA 1YPZA 4NB7A 4FL4C 3QQ9C 3BAIA 2O61A 1SVBA 4DCQB 4RQQB 5CLZA 2X89D 2UZXB 2BINA 2BVQB 3REVB 3VG9C 2XTJC 4XNZC 4ZO8A 3MTRA 1JNJA 3O9WB 3S34L 5TQ2H 3K80A 1QTYT 1T0NA 4WI4A 4PJ9D 3VXME 5KG9B 2XKNB 1KEMH 1UM5L 2X38A 1GIGH 5MHSD 3ULAB 1UJ3C 2UUDK 3R8QA 3TBBA 2OYKA 2WWMD 2DLFL 2ZCHH 5D7KE 3HC4H 3IJEB 4QXVA 4IBSA 2HVJB 5BZXA 3T3ME 1QD0A 3SJVD 1HJCA 3GSXB 1D6EA 2Q86A 3IXAB 5L2KB 1RIUH 4PG2A 1V7ML 1TTRA 3OL2A 2MSPA 3TONA 3FMGH 4JFTA 2E74C 3HE6D 5AENA 3CFQA 3VFGL 2BS9A 1T1YB 3DBXB 3TA3B 1KN2L 4BQ9A 4L8BA 4KMLB 2XJKA 1SXNA 4OUUA 1GZQA 4NKDB 5DEGA 2X05A 1T1ZB 3FCSB 3MNZA 1SXCA 2AQQA 3MODL 5JDJA 3QORD 3ALXA 5CP7A 1KULA 1DQKA 3V4PL 1QW9A 2OR9H 4MD0B 5C3IA 1H8OA 5KSBF 3BXNB 3WDHA 2DYPD 2A2QT 2AJZB 2BO0A 1AQKH 4FI8A 2HTKC 2VDLH 1WJ3A 1MCWM 3BZDA 4WDIB 3HMXA 4CADB 1AHKA 2BVOA 3IKKA 4ZSOE 3QFJA 4YHYC 2V2WA 2NQ3A 1FBIL 3KXFB 4QLWA 4N8CH 3CFIC 5DD0L 5I8KH 5J6SA 3QIWC 1LILA 3B37A 3T0WA 4YR6B 4MXWL 3S8FB 3QISA 1PQZA 3BEWB 3KPNA 2MTPA 3QPQD 3N43F 5AYUL 3DVGB 3N91A 2JJSC 4UT7H 4LBEA 4HCRA 5I8EB 5J56B 4XRCA 5C0AE 2EE9A 3S3CB 3S2CA 4D94A 1IGFH 5ISZB 3MTXA 1FLRH 1OGAD 1UCBH 4GRLA 5HY9B 2VXTL 3UBXI 5T1KA 1YNLH 5ADPL 4Q56A 2CDFB 2I9TB 2VQUA 5JHDD 4AQ8C 4ZG1A 3QZNA 4XB8A 5IESH 2OTWA 2EDKA 2BCMA 1WFUA 4N9GB 4POZC 1A6ZB 4Y4KB 3GS0A 4Z7WA 3WFZA 3STLB 4XO8A 4H25B 4LOEA 2GITB 5AW9B 1GRWA 2WAHA 3GF8A 5BZWB 1X5JA 3LKRB 4V2BA 5L4JA 2ZNXA 1R5IA 4IQHA 4LAJH 1D5MB 3E6FA 4XMUA 4PB9L 1WIOA 3FB6B 4PJ7F 3L6FB 1NTDA 1T1WB 1XF4B 3ZUNC 3GTNA 4TTDC 5IMOA 1IE5A 3TBCA 1FH5H 4YHNA 4KQ3L 5FCUH 4XPGL 5C0DB 5HHOA 5E8OB 3IFNH 1JN6B 4O02H 4XNQA 2XCMC 1G1YA 4JAMB 5C0ND 2JB5L 4K9EC 1YAIA 3MNWA 1JRHH 5EO1A 4PWFA 1LEGB 3CFMA 4WF7A 4LK4A 3T0AA 3RU8L 5A6LA 3QNZA 1UXWA 3TZVC 5JQ6H 4M8QB 4PY7B 1H0DA 3GXMA 4MCMA 5KYUA 3RVUD 4R5VA 4PJAF 3ZZLA 1T5WA 2RD0A 3RWDB 1BWMA 2ZKXA 4YSQA 5I6NA 3KZ8A 2AQNA 1RJLA 4P2RD 4BKLB 1BD2E 5MEQA 4PS7A 3D39B 5KUKA 4FFYA 2BVUA 1CYGA 2EECA 1ZA3B 2ZCKL 4BQBA 4NRYA 4XP9L 4Z7QF 1SHWA 2C3XA 4JHAL 6PAZA 5HYEA 2VMFA 3U7AA 3C6LA 2YLKA 4BSWB 5KN5A 2XN9A 3MGAA 3M1BB 3Q05A 5D2LE 1T66C 4JGMA 1A1NA 3TU6A 4P2OC 4AYDC 4ZQKA 3N5AA 5C3TA 5DA4A 4BHUA 4DN4H 5TH2B 5TDPB 1XL4A 4UBDC 1A6VH 1N6QH 5JW3H 3U4KA 1QACA 2ATPB 3VFWB 3GXUB 1TJXA 3V8OA 2IC2A 2YAQA 4OFKA 3UJIL 5L0QB 5L2JB 3MRFA 1MJ7L 1CLYH 2BCKA 3JV6B 4U1SB 4Y1AB 4Y5VA 4V1DE 2BNQB 4LHUB 1OT2A 1P69B 1GYWA 3FOMA 5DK3A 5ID0B 3U79A 4PRID 3PU7A 3N42B 3QFDA 4M7ZB 1JNHA 3DSNB 4OCNC 5D96B 4ZFGL 3O2DL 1MIML 3BAWA 2WJ7A 1ZV9A 5F6HJ 1UWYA 1E7VA 2ZG2A 1EANA 4JPVH 1CS6A 2XFXA 4LDEB 1BW8A 1E7UA 4QXWA 4EI6B 4GW1B 3DX9B 3DIDA 3QORC 5FYKE 3ZDYF 1WG3A 3DUSA 1FBIH 3BDXA 4WUKL 3KWUA 4ZTOL 5AL8A 3LKOB 5BPPA 4Y5YB 2ZX7A 2AV7A 2CDEB 1JERA 1M6OA 4M9PA 1K3IA 2CO7B 5K1NA 3P9WB 1JD9A 3ZE2F 4A7QA 4H0GA 1BM3H 1DCLA 3UJTL 2XDHA 1EPFA 2IGTA 3K2UL 2VR9A 1PKQA 1WE5A 2B9BA 3T3PF 2WQXA 1MWAA 1AXIB 3KJ6H 3O2VH 3O3EA 5MI0C 3S37H 1PCSA 3NPSC 2I60H 1ZTXH 4OGYH 1FG9C 1CD1A 1ZVYA 2CUHA 1PEWA 2Y7NA 1T2QH 4XN2A 1MHHB 4A67A 3U0TB 5LB1A 3QCUL 5HI5C 1YNKH 1B4TA 1D6VL 1CFNA 3IXAA 2Q86B 2YHGA 4OCWH 3O8XD 5EU3A 1CFQA 3A21A 5AZ2L 4DSYA 1J05B 5IBTH 2Y69B 2Y3NA 3SHSA 5AW1B 1GGIL 3ZMRA 3LIZA 3WY1A 3QUKA 4J4PD 3U48A 3MV11 2ZOLB 4N2GA 2X1XR 3U4BL 1GZQB 1NSNH 3A24A 2GBAA 3IF1A 5DEGB 4L5FL 2G75B 4Q97A 5F9OH 3LPGA 4PYHA 2WBXA 2Z7ZA 2NZIA 4K55A 4X0KB 1CL7H 1T6WA 3GSQA 5TQ2L 3E8VA 1FZKA 3SYAA 1BSIA 2OLDA 4BFRA 2XBTA 1CZ8L 1ADQL 1EHKB 3JWNH 5DHVH 1QWHA 4H20L 3UBXA 2QKIA 2ED9A 4WY7L 1CXLA 3EO0A 1BZ7B 2ICWJ 1C16B 1ECZA 2KMWA 2MOVA 1F11A 1OAUH 4ZFGH 3NJNA 3WOVA 2WD0A 3UTSB 3NSDA 5IHZA 2NYYC 4OZFA 5I16B 4U6VL 1KYOK 1MNUL 3SJVB 3ZKMD 4QEGA 5ERWA 2OTPA 4LBEB 3VWKC 2ZXDA 1JK8B 2ZD0A 3W81A 3AZUA 1PLCA 2WN2A 3U7YH 5GGUA 2ADIB 4UF7C 3DMMA 3L16A 5I2IA 5LWYH 3LH9A 5ISZA 3VGHA 4C4BA 5FYKD 3T3MB 3RGHA 5AG9A 5D55A 3D48R 2RAMA 2GJZA 5T3ZD 5EOCH 4OJDH 1G9NL 3U7WH 1VERA 3DBSA 3FO1B 3IXTB 3OAUH 1CGTA 5DC9B 3REWB 4MAUH 1HDMB 4IBUA 1T5KA 3KLDA 4UU9B 2J6EH 2R2BB 2HPOA 2OI9C 3TJEH 4MMZA 2AJUH 5D7HA 1YAZA 3ZUCA 1U4EA 5I5JA 4P23D 3LKRA 4JFPA 2HLEB 4PJEF 2X4TB 4JFDE 4U3XA 3KXFD 1KCBA 2EC9T 2OR7A 3ZX1A 4XC3H 4M93B 3C5JB 4PH8A 1NAMH 1PIFA 2DWDB 3I02B 2P48B 4W9DC 3SGKA 3I6GA 1U8LB 4JDVB 5DMJB 4YHNB 4R90H 3SKJH 4ZSOB 2O6EA 3MRRB 4BWTA 1F90L 5T3ZH 3RDTA 3MSPA 3SIKA 1ZHNB 3C75A 3GSNH 3P02A 4YDJA 2ZP9A 1EXHA 3WLWD 1D7BA 4Y4HD 4KDTC 1T3FB 1IL1A 2AJXH 5HJ3A 5I1GH 2OMVA 3LIZL 4FQXD 4HUUB 3ARQA 2LLGA 1IT9H 4LP4A 5F9WC 3ARFB 2D2OA 1AJ7L 1LO0H 1SVCP 1CICD 4Y4KD 5DCCA 4B9FA 3OMIB 4NQED 4KKBD 2VTFA 1SFDA 3EF7A 4S0HA 2BOCB 2WO3B 4RDBA 2WUCL 1A5FL 3MBEC 1JOIA 3L5WB 4JG0H 2QQKL 4PB0L 3O6KH 3R0MA 2QQQA 4FLOA 3S3SA 1CTMA 5CZRA 1YY8B 3EF4A 4JFQB 3O4LA 1EBAA 5MERA 3VWJD 1RZ8A 2YAMA 4HUKB 3MLTA 2NTSP 5I1DA 5JTWA 1O6SB 3QIUB 4EI5B 2NY5C 2H5UA 5C2BH 5IESL 1BV8A 1WAAE 5IV2B 3HKZA 4PRPA 1BXXA 1D5ZB 2O5XL 4DZBA 4PJXE 1QLEH 5T3XD 2E7CA 3LNDA 4M7LT 4UTAH 4GW4A 3VFWA 3BLBA 2MKLC 1A14H 3CFJA 1A7PL 2V5MA 4TULL 4TS6A 3MRFB 1N64L 1N6UA 2J43A 4JFVA 4B0MB 3W56A 3VYPA 1ETJA 1JSYA 2WMPA 4F7PB 4UQAA 5MEOB 4QKXB 3NCXA 2MCAA 3RRQA 2BFGA 1DFBH 1MCPL 2SEBB 3WKYA 4GG6F 4BXVA 1YO4A 4U1LA 2BIHA 5KW9H 4GAJL 3ALPA 2HUEA 5JIPA 5KJ4A 1JZ2A 3NIGE 2J4WH 3B3IB 3BDYH 3PRZA 1I3VA 3HNTH 2DYPA 2AHIA 5D6CA 1GYCA 2B39A 5K9OB 4JFZL 2ALWA 4TVUA 3VFSB 4BQ6A 1ZHBA 2F54E 5I74B 4P05A 3FFCB 2V17L 3V0JA 3DUSB 3HG4A 3UAJC 5BRZB 4Y5YA 1W0VB 2AK4B 1OGPA 2D03L 3TV8A 5B1KA 4H40A 4NT6A 1A47A 2EXYC 1FORH 3FUMA 4MQXD 5F44A 1U2CA 5FFOA 4QRRA 3VXMD 2WZAA 2RQEA 3VXTB 3IEAA 4KTYA 1CGSL 3IN0A 4XVOA 2NTFA 3JWOC 2EAEA 1DQDH 4U2ZA 1NC4A 1PZ5B 3RA7H 1XGZA 4JQIL 4OD1H 3JYBA 4PUBH 4NJ9H 2NXZB 2OYLA 4Q89A 2F53D 3US0A 4W9GC 5CJOL 1LO5B 3KG5A 4GUCA 4QY8B 4EN3B 2Y4SA 3CIQA 3KYOA 5I5RA 1UHVA 4KTEH 2FNWA 3BEVB 5HGDA 1X5YA 3DO7A 2VMCA 2VERA 4G1MB 4V1DB 1WFIA 5D4HA 3I84A 3QJZA 5FGBC 1I3UA 3BVWA 3LZRA 3RYMA 1FRGH 4LCWB 2W94A 4DEPB 4EN2A 1T2XA 4A6YB 1JYNA 1C5DA 1QKZL 2OQJB 2ZOLA 2R27A 4EUPB 2X4SA 5KAQF 4Y2OB 3UTZA 3TASA 3LSOA 2DZEA 2XY1A 5IBLC 1KNOB 1I7UB 5K9QI 4XN7A 4TUUA 1MRDL 1JZ4A 4OJAA 3ZDXB 2W07B 1T89A 4I9WD 2AQ1A 4PRHB 5IGXH 2IBBA 1L7TH 4DQOH 1P7QB 3JUYA 3ULVE 4U6HA 5SWQB 1GSMA 3H9ZA 1DSWA 4UT9H 1JVOA 1JWMA 5FO8A 5E8PB 3ATDA 3QUZC 5EU6B 4UQ3B 5TF1H 5EU4B 4C4UA 1HESA 1N8ZB 3JBG7 4C59B 4NN7C 1NFDF 1M2VA 4FG6C 4HJGA 4DETA 1LD9A 1B4JH 2JCCB 4FX5A 43CAA 4NI3A 3RWGA 4HYTB 4FXGA 5F7LB 1JNLL 3GK8H 4OJYA 4KX8A 5KSBB 5D7IF 2PW2A 2AABH 2FUQA 1INDL 1KC5L 2DEWX 1J8HB 3SQOL 2B1OA 4L2YA 1CICC 2ZWNA 4NOBA 4UZUA 3UEZA 4CAGA 4YN3A 5IG7B 1AMYA 4Q0XH 2J3SA 5CHNB 5HGHA 4MLIA 1HDMA 3LS5L 1DBMH 5BZDA 4R90L 4S1DC 1N67A 5ACZA 5D1XB 4LSTH 2E6PA 1NKGA 3WNKA 3TBSA 1KXHA 2XXCB 4XAKD 4FJYA 1T1YA 3X3GH 2XWJA 4X7TA 1XZWA 1YMHB 2W9DL 2ED8A 1UATA 1MHEB 1YLBB 5E6IA 4A04A 4JZJB 2JJWA 1F5WA 3RVVD 4LSSL 4G5ZL 2Y22A 1OK8A 4NBXB 3NRQA 1JIBA 2Q3XA 4HIJA 1RZJL 1SOKA 1JNNH 3MLRL 1ERNA 4CADA 1IFRA 3V4VL 3ZJAA 5A43C 3NA9L 3NVQA 2V2WB 1T3FA 5DK2A 4XPFH 4A1RA 2XQYA 4JZJC 4RISL 3EYOA 3W11C 3NQIA 1PLAA 4JEGB 4XCCH 1DQIA 4BFOA 1DVTA 1HX0A 2WUBL 3QUML 5E1IA 3L4ZA 1MNUH 4ZFZB 1JWSA 1RURH 3QC6X 2VLJA 3KL0A 4NUJB 4QOKE 4ZZFA 5HHOE 1CFSB 1FFNB 5F0LB 5LAXB 4UQEA 3K71B 4PJ9B 3CVIH 4V2CB 1FV1B 2JKIS 1IM9B 3T0ED 4ERSH 1QBAA 4NC1C 1Z2KA 4HC1H 2A38A 4WNSA 2HRPH 2OL3L 4OR1A 5EFIB 3LNGA 1DE4A 1JZ8A 2WGXA 3A0OA 3S3PA 1AANA 3IMSA 4MZ2A 4Z3TA 5D1ZA 5ESAA 2VZ1A 3HHRB 1LWHA 4G5AA 1BFSA 2HH0H 1UB5A 1D5MA 2ARJA 5DJ8A 1HNGA 5EF2A 4X50A 1NGXA 4GSRA 1WEJH 3DSFL 1OP4A 1IV8A 4J4PA 4OM1L 3ARFD 2YJQA 1D3CA 2VE6A 4P07A 1BX2A 2NDGA 5LDSA 5IB5A 5C0DA 1ZCRA 2IFGA 4QRRE 4WW1B 5CEZD 4XVTH 3BW9B 3LY6A 5C0CD 1SPDA 3ARUA 3AMLA 4Y5YC 1DQLH 2JCWA 1IMHC 4HWEL 2ZSWA 1LEGA 1SJXA 3LQZA 3AM8C 1U8QA 1I8IB 2A1WH 1ACZA 4YSTA 4NAMA 1H0DB 1WDAA 4FP8H 43C9B 3HRZC 2WAQA 3NSYA 2FWSA 4H4NA 3ZKXB 3GMPA 3QQNA 3GRGA 2E56A 3T4AA 2D3JA 3QEQB 1JZ5A 2P80A 4F8TA 2OMZA 4CBZA 1QLRA 1LGVA 2FQFA 1A4BA 1RP8A 1YEIL 5GJTL 4AMWA 5LQBL 2Z7WA 4RWHA 4XNAA 2BWIA 3ZE2B 1XCWA 2NY2C 3BMWA 4RAUA 4WHYG 4ZOCA 3FQ2A 4H8WC 3WNPA 4LF3A 4HSQA 5CMAA 2E7MA 5E8DL 5EO9A 2YRPA 3OB8A 3TCTA 3EFOA 3V8CA 5I17B 4R4FL 5D7LB 5DUML 4D0BA 5CLYA 5TH2A 1Z0NA 2EC9U 3HC2A 3QG7H 4F20A 1PG7W 4X8JB 3ZZ1A 4YDLC 3VDAA 3DGGB 2MNWA 5HYJD 4D0DA 4OGQC 3V6BR 1J0YA 3OMNB 1NANH 4QO1A 2A6KA 1YUHA 3KYNB 4HIHA 2DQFB 1NCIA 3JV6A 2CDGA 3KEHA 3MCKA 5JW3L 5IVNA 3VGBA 2EUVA 1L0QA 5AOKA 2HG5A 4EUPA 1RH8A 3FO9A 4Y19D 1Z9MA 2LU7A 1C5BH 4UUJB 5T1DH 3UO1H 3LNIA 1KJ2A 4OZHE 1V05A 3BSZA 4UANA 5K9JL 3UC0H 1AZRA 2P47B 4AYSA 5IQ7L 2YWYA 3BWUF 2QPFA 4WK4B 2VN7A 4AW4A 3R0NA 3PQYD 3MA7A 4XO9A 3LRLA 1YN7A 1SRDA 5ALCH 4HFWA 5D7IA 5D7JC 2Q2LA 3RTQB 3FFDB 1OP3K 5AZUA 2NCMA 2R2HA 2YAHA 5M94B 3FTZA 2WBKA 5AW7B 1TCMA 4IIQC 4BCXA 1XEDA 3MKKA 4QMEA 4A39A 3V2AR 5CJXC 3WO4C 3NTCL 1OAQH 4I48B 2VDML 4APQD 3MRPB 3JVGA 2D31A 1TEFA 5F1NA 3VI4B 2EIZB 3GGWB 5IEKA 3ZTJH 1X6LA 1PBYA 4EVNB 1ORSA 1MCHA 1RZPA 3D39D 3X2QB 5CWSB 4Y1SA 1QOKA 3IPFA 5KJ7E 1T83C 3O0RL 4AY0A 1FO0A 4GAAA 4LSPH 5EN3A 3QRLA 2NW3A 4Z95L 3MLUH 4FABH 4HZLB 1QI3A 1N4XH 2R4SH 35C8H 4TN9A 5DFAA 3ZL1A 2IANB 3O4LD 4N3TA 1LQBC 1MHHA 1KTDA 1NFDB 2P45B 2WSKA 4P5KA 2J1XA 4KBPA 2AXWA 2OULB 1EHAA 1QP1A 3NJKA 2HTLD 5ELIA 5IHUH 3MOBH 3DKHA 1QWNA 3LEXA 1DJXA 3RKPA 3O0LA 5K39A 5CEYA 4JFDD 1GYAA 3O6FD 3VDBA 2D7PA 3H3PH 1USZA 4NCC1 1W72H 1DBKL 4HWEH 1Y1UA 3IF1B 2F19H 1MHEA 3BGFB 3WE1A 3QULB 2BZDA 3NFPA 1UWFA 3GS7A 1A7QH 3IDGA 1AE6H 4LNVA 3D69A 5C6WH 1S9WA 2W80C 1WHOA 5J1AB 4PHZA 5K33A 1S8DA 2H45A 2R29A 4ZFOB 1DQQB 4MDRA 4YO0A 4ELMB 3KM2A 3L45A 3ZHNA 2WWNA 2QKIC 1OCWH 2UV3A 2H1LM 2IBZX 3MMEB 3SDCD 3QQDB 4M5SA 4ZFOL 4YNYA 2EVFA 5GS1B 4CBPA 1AHWB 4UT7L 1V8HA 3CLFH 1NGYB 4G7YL 2H4EA 4XO3A 3IDYC 5ERWB 5E0QA 2FVNA 2Y1YA 4CRPA 5JPNC 1WISA 1J5OH 2ZUSA 4BKSC 1ACXA 5GGUB 2XTSA 3PQYE 4KRNA 3VUAA 2B8OT 4TTDD 2OPCA 3EYUL 3FT2A 3HHMA 3U36A 4XZUA 2HUHA 4HFUH 1IU1A 3T0BA 3IXTA 4F2ME 3DHJA 2FB4H 5C07E 4LASL 3FZUC 3UPRA 1WYJA 2F7OA 1DUYA 4ADJA 3L9BA 4F8NA 1WFOA 5DRNB 2VR8A 3LNHA 4QHLA 4WO4D 4ZMPA 4MZRA 1MAKA 1E5BA 3MRJA 2XQBH 3PAVA 4WU5A 1DVUA 1W8EA 5GRVL 4OJCA 1JZ7A 5JR1H 2Z8VC 5BQ7B 2GJ6D 3ARGD 4HH9B 3TT1L 1E5AA 4P5TB 1AO7E 2FIKB 1BX2B 3I3EA 5IB5B 4LSSH 3ZHDA 4WWKC 1WT5C 1NCJA 1QSFB 1JMZA 1PY4A 4P4RB 3GZKA 3S35X 3WGUB 1IGCL 1VGEL 2GJJA 5JW5B 2R0LL 2ZSWB 3EYVA 3P9LA 4PJXA 5INDB 1YMME 1MKFA 5E00A 5I66B 3MJ6A 3AMKA 4L9LA 4PRBA 5C6TH 4PJBE 5EU5A 1MEXL 2NY5L 2Y36H 3ZSTA 4CVUA 1R3HB 3SDYL 3RWFA 2DWYA 3KDMB 4OH2A 4K5LA 5JOPD 3SSGA 3CMOL 1ODUA 1SXAA 4K2UL 5DMIH 1CLZL 1ASPA 1PZ2A 2J72A 3QEQA 3HCVB 2V5YA 4LEXH 4N0CC 4R2GD 5C8JA 4HCRH 3FQ4A 5H37G 5HHME 5TFSH 5F7HA 3DXAA 3BH9B 3MBEA 1JHTB 4HXAH 1RU9L 1DJSA 1HWWA 3KGSA 1U8JA 1WIPA 1G7JB 4P8QA 2GFBB 3LZPA 2GABA 1XF3A 2OMXA 3VA2C 3Q06A 3D9AH 3CU7A 5GS3A 4X4ME 3OKEA 5JMRA 2JLLA 1JYWA 4JY5L 4B9ZA 1W91A 1FGNL 2I32A 1HC1A 3HG1D 1RHHB 3L1FA 4N2IA 1TUPA 4X2UA 2QBWA 2KQMA 2YK1L 4M56A 3BPOC 4OLVL 4Y0GA 5L2KE 4NZTH 3V0WH 5E8NA 1N8OE 4CMHC 3L48A 3GXPA 4X9BA 1FAIH 2WQUA 2X70B 4FFWD 1UZ8A 2XX1A 3DVFA 3CU1A 2CR0A 3DYMA 5IHWA 1RZKH 2FHFA 3LN9A 2VT0A 4P9HL 2VLRB 1C9SA 1NCCH 2IIJA 1G0XA 3BKYH 4IJTA 4MSWB 3FU9A 1M7UA 2HG5B 3P4LA 3T0DA 4RMTA 2CQVA 2HTLC 3LEYL 4AENA 2IH1B 4KJYA 3DO3A 4Q6KA 1XZ0A 4KO7A 2AP2A 2F8OA 1YEHL 2DYPB 1KPVB 3MCYA 3OZ9H 3L4XA 1AOHA 3TZVA 1KN4L 1NDMB 2VNCA 2YD8A 3TOPA 1JZ3A 2JB6B 3PUCA 4WHTB 3RTQA 4R96A 1FRGL 3RWCA 3HUJB 3FU3A 2A9CA 2OMNA 1U8NB 4UV4L 5IMKB 3BVNB 4KK8D 4O2FA 4UQBA 1MFEH 4WW2C 2PPDA 2D2CC 1B4JL 3B83A 4J12A 3UAJA 3K6FA 4KTDL 25C8L 3ATBA 2WLLB 1MIEH 4HD9A 2O6FA 2Q8AH 3D0AA 5E4AA 4F1SA 3MRPA 1LMIA 1N12A 2ZUQC 5FHBL 3FBKA 4NO0B 1IILE 3ZK0A 1NC4D 4HK3N 5I1CH 1TF4A 5F1SA 2J6WA 2QV2A 5KS9B 3DIFA 4PJBA 1VFAA 2GTQA 3LQAH 4XPTL 2NY4B 1KTBA 2B7DT 3G08B 1ADWA 1MFUA 1R5WB 2YD1A 4P4KC 3QXDB 4RZCA 4RQQA 5E4OA 4EDWH 5F0MB 2NW3B 2WQRA 5DT1H 2L3BA 4OTXL 1L9PA 1CDJA 1CGUA 1MDTA 2E47A 3FRPG 2X09A 1DCEA 4E5XA 3NIGF 4GUPA 1JYVA 1J5CA 3AS0A 2ZUXA 2B20A 2BNUA 2X1WL 3QR2A 4POZD 3SDDD 4BJLA 4Z7IA 5JLZA 1ZPUA 1IGJA 5IB2A 3K8LA 2PXYD 4ZMXA 4ZFQA 4XXDA 5D1XC 4URKA 3HMWL 5EDSA 1XH2A 4UQIM 4NCDA 4ZW5A 3NRPA 2FX9L 1B4LA 4XI5C 4X6DF 2OMWB 4OGZA 5AVTB 5C0EA 3O9WC 3DVIA 2Z4QB 4M1DL 2VMEA 3BP5A 4J1UB 7FABL 3HN8A 4HSCX 1W16A 4JCMA 1Q72H 3N0AA 3FT1A 4PJHA 1H9DA 2QDWA 3FTXA 4ONHB 1ZJAA 2BSRA 3RZCB 3SPHA 4NJAH 2WQVA 2VLLB 1VZGA 4LHUG 3NOIA 4FXGC 4JMXA 4QRQA 3TPKA 5HHQA 1KZYA 4X42A 1EEZB 3BIBX 3IDNB 4OFIA 4MFHA 1RZIB 4DPRA 4NN6C 3WSQH 3ARTA 1Z3GL 5I6LA 1N8ZA 4HHWA 1F8TH 2ENSA 3K4DA 2I69A 3QO1B 1ET7A 1MFVA 2ZONA 4PBWD 4WI0B 1E9PA 1DLHA 1F1DA 3V0IA 4WKXA 4HKZB 5I0YA 4FXGB 1EH9A 3QDJD 1FZOB 1K5NA 1KCSH 1O7DC 3X13A 3QPXL 4HEMA 1G1CA 4YXHL 1HAUA 3VXRE 2Y7QB 4PR5B 2GK2A 4X7EC 2X53A 5B38G 1D5IL 4JG0L 3WJJA 1BOYA 5AQ0A 5GGQH 1O7DE 1NBQA 2OJEA 4NAJA 4Z7UA 2RHEA 2W65A 2ZP8A 1A7NL 4WQOA 5EC2B 25C8H 3PABB 3L7EA 1KV7A 2AQSA 5CNHA 4K5NA 4WFFD 1PFCA 4N4YB 3V7AG 2B9AA 1KELH 3EOTL 1F18A 1SXZA 3MXVH 3LZQA 2CO4A 2FWOB 1IAOB 3PWUA 5T1KB 5C0AB 4U1JA 1XAKA 4PBVC 2FTAA 3D25B 3MRJB 3QWOB 1L3WA 3LKSA 3GTVA 5AAMA 3VD1A 1RAMA 2OTWB 2J88H 4HS6B 5BQ7A 5J4MA 1GH7A 2XN9D 2EYSA 4FTDA 4NUPA 5KBMA 4F33B 5CEZE 3ULVH 1E6JH 4L9LC 3SYPA 4P9HH 4BFBD 3MLXL 3FN9A 4N68A 4Q2ZB 1QFPA 3H6JA 2MFNA 1UM4L 3WJMA 2IPUK 2HLFC 3ZKXC 3L6FA 2DMHA 4XE5B 3MRQA 3ZTJG 3KLHC 2B2XH 1TETH 3E6HA 1MFDL 2CK0L 5E8OA 2MWCA 2JFCA 5F7MC 4YDNA 3EGSB 3P0YH 3SE4A 3QUMA 4R26L 1GW0A 5F72S 2VLJB 5GGVH 5A2FA 2YFOA 1HEZB 3B9DA 2AVFA 5LBGA 1RMFL 2XVBA 2CE6A 1SLUA 2CHDA 4QRPA 4PJ9A 3QNZB 1B3JA 2F7QA 5FO7A 4F2MB 5DMIL 5IMLB 1U3HD 3P30L 3DYPA 2QMJA 3GMRB 1P7HL 1NC2B 3D3VB 3CHRA 1KFGA 3EJYD 4N2KA 4ZOAA 3V4VA 4NKIL 5IP4A 1RJLB 3QE5A 2WLKA 4IMLB 1B0GB 1Q0YH 2QJDA 3WHE1 2Z92A 5J9PA 4P46D 3QHZH 4HEME 3OR6B 2JIXB 4FZEH 2JWYA 3QUXB 4WNQB 1NL0H 1IGCH 1FCGA 2SODB 1BPLB 5DJ8B 1HH6A 4JB9L 4X83A 1JF6A 3CFEB 2P9RA 4NKMB 3K6IA 3FDWA 4FTVA 3OAUL 4YFEA 1DR9A 1EA9C 1T21B 4LCIH 3RX7A 5AVXB 3WKML 4KKRA 3UDWA 4G6MH 1P4BL 2Y07L 1PNCA 5KOVC 3T4AC 3L8QA 4AYMC 5D8JL 4BIKA 1AGEB 2YARA 3AS2A 1J1PL 4ONOA 3WMSA 4Q6IC 1HCVA 1AS8A 3RWCB 3TA3D 1IZKA 4DFIA 3QFDB 1JNHB 3DSNA 4LPTA 2VXSH 1RULH 2APBA 4R7DB 4Z3HA 4OGXL 1TIUA 3Q8AA 4TNGA 2W5PA 2YQ3A 4C4KT 3ESNA 1J5IA 2BVQA 3E38A 3JWDL 4MCZB 4GW1A 1DZBA 4OIBA 1UZ6F 5HVHC 3S37L 2GT9B 4N25A 4MBOA 1FFRA 5KBPA 1A25A 1CE1H 1GVIA 5GQBA 1NOAA 4WJ5B 2R69A 4G7RB 4BZ1A 5F7DB 3ABLB 4JMNA 1Z0MA 5IW6B 3TWCL 4I3RH 1FN4A 5F96H 3MO1B 3V4UH 1MW0A 4KQ4L 4X8JA 3BUPA 4B97A 4KNSA 4OLUL 2P44B 4AKOA 4RIRB 4PHXA 3OHXC 1OEZW 2XPZA 1ASOA 4OIIH 4B6ZA 5HHNB 1YUHB 2ODIA 1EBPA 4IKKA 2ZX6A 4FA7B 3EJUA 5FYKL 3IMWA 1T0MA 4LLDB 4EIUA 3BWAB 1S5HB 2AGJH 1DBKH 1LEKB 4NO0D 5E95B 3BHBB 1QQDA 2YN3A 4XNYH 5LGYA 3MA7B 4JKPL 2H6PB 4JR9L 2UWEA 3UTTB 3RJQB 4O00A 3ZKSD 1DSFL 1WBXA 1IBHA 3N44B 3IDNA 1OALA 5J3HC 2BVOB 4JDTH 1Z66A 2VR5A 4KV5F 4TQPA 2O1AA 2KPWA 5HDRA 4FN0A 3Q9PA 4G6ML 1A6UH 4H13C 4CW1A 4H7VA 4BBWA 3GSQB 3TJPA 4POUB 4IDLA 1CLOH 1IC7H 3FW6A 5KS9E 1EJOL 3A3YB 3QI9A 3BMVA 5IIEA 4HJTA 5CLWA 1NIEA 1QFOA 3X13B 2K6ZA 1KWGA 2LU5A 4OCMC 3ULUC 5T33L 4PJDF 2BY2A 1DANT 3EO0B 4IKNA 5FGRA 5HP5A 3KDPB 1OOWA 4HA1A 4XP9H 5T3XL 3O2DH 4OSUL 3CZJA 3UTSA 5ABZA 5ETUB 2AQ3A 3E9TA 4IEFA 5HVGB 5HY9A 1HN1A 1X5KA 4AX3A 1OF2A 5IQLA 4WFHE 4KTGA 4FNLH 3R18A 4GB9A 3SJVA 1FVCA 2LHAA 3NH7H 2ITCB 3PHQA 3TCLB 2I9TA 1NFDA 4NN5B 4P5KB 1B6DA 2IALA 5MEND 3RY5A 4N9GA 2Z1PA 3AT8A 3B9KB 5IKCB 1SHMA 2FGZA 1Z32X 1AZNA 4I0PD 3NP4A 1PVHA 4U0RC 1NH6A 4CSTA 2ICCA 1WWBX 1AGFB 2DJSA 3DI2B 2DQEL 5C0RL 3LKSB 5FAAA 1SLVA 2GJ6E 2R0ZH 4EMZA 3B5TA 5SV3A 2JJSA 4K71B 1RJYA 2YQ2A 1DQJB 1F4WL 4KRPB 3WY2A 1P7KA 4XCNA 5D9SB 1SEBA 1PJWA 4Y5XA 5DRWB 1EMTL 4MA3A 2X87A 4JJOA 2WV3A 1U6AL 1NIAA 5KVFH 4PRPD 5C97A 4UTCA 4J3XA 4R7NB 5I8CB 3C5JA 2HKFL 1NJ9A 4PLKC 2BP5M 4RSVA 5FHAH 4QPEA 2Q6WB 1LNUA 1W9XA 1OV8A 2C34A 3F65A 4Z7NB 4YSRA 1UYWL 3TVMB 5IEHA 4AK1A 1I8AA 1INQA 4PQXA 4YPGB 3UTOA 2YAEA 4YLCA 2KT6A 1TKWB 1EGJH 4NQCD 4P2QA 4KC3B 1KXQA 2NDFA 6PCYA 5KEZA 3EJZD 4QRPB 5ANME 2OMVB 2JB5H 2WXFA 3FT2B 5FO7B 4F2MA 5A2LH 3LKNB 3OPUA 4X6CE 1GGTA 4XVJL 4ABVA 2N0MA 2NUPA 3VI4F 15C8H 3QUHA 3US1A 1J86A 4P48A 1NCHA 3ETTA 3TNNA 1DO6A 4ZDHB 1MOEA 3BP7A 4G3YH 4GS7C 3VNZA 3VQ2C 1HEJC 2A99A 2VLME 3QUXA 4WNQA 3H0TB 1U8MA 4A7GF 2VXVH 1KIUA 3I6KA 3FPXA 2ZWSA 3Q6GH 4Q74A 5DHYB 3K0WA 4LCWD 3BZ4B 4K5MA 3QIUA 5L2JA 4KHTL 1RULL 4P5RA 4GG6A 2FZ3A 4WV1C 3VXUE 5TD4A 3F2LA 4HWUA 3K2KA 4FQQB 4ZMOA 3L3GB 2EDBA 1SN0A 4R84A 4P23A 2CCVA 3P11L 3TN0C 2HH0L 3ROLA 2FX8L 5JIKA 3PNWA 4OY9A 1INEH 2IGFH 4KMTH 4NWUL 4XB3A 3THMH 4L18A 3VXPB 4F7PA 1P4BH 4OCXH 2AXFA 4OLXH 3RG1C 4PCKA 4HJJH 3FMGL 3AUWB 1PF3A 2EE2A 2B4CH 3QWRD 1C5CH 3CDGB 4OIFA 4B41A 3B2UD 3KDMA 1UWGH 1BJ1H 5C8JB 3K81A 3NZ8B 3S96A 1V54B 4FS0A 3UGEA 3WS3A 4GO9A 3RUGE 1HKFA 5I6PA 1I85A 4J8RA 5IBUG 4HPYL 2H0EA 1JE6A 3N1FC 4BUGA 4DP5X 4TRPH 2IDFA 4QRSB 4WJ5A 4NT6B 1ADQA 1FAKT 3FFCE 3P4MB 5DURB 4NKIH 1HNYA 3NCCB 1RHHA 3BE1H 3C08L 2AK4E 2Z9TA 4JDEB 1J5DA 3QORA 1JZGA 5I74C 1UD2A 1KN2H 2JI1A 2H41A 2ZXQA 5KBKA 2NQDA 4L2LA 3K6SB 3CFNA 2CKBA 2VLRA 2VDKH 1CD8A 2OCJA 4E41D 2Q9OA 1XIWD 5EUOB 5I1HL 5ILTH 4EN3A 1T0MB 1S9XB 5INCA 2YJLA 1RPKA 2ROXA 3LQMA 3VWKB 4HK3J 4YWGL 3T6XA 2W9DH 4A2LA 1TPXB 4AQ8A 2D0FA 2EVJA 3OAWA 2P1YA 2WIMA 3UYPA 5KYYA 1JPFB 3EOBA 4H8UA 5FGCE 1WSST 5K9KA 1DBBL 5KSAC 1TCRA 3P77A 2A9AA 1C5DB 1VAHA 2OQJA 3GRBA 5F3BA 2KLTA 2ZOTA 3VXSA 4M6NL 3ZDWA 2XG4B 2VZVA 2FLBT 5EZOL 3ZSSA 4LCWE 1SBBA 3RY4A 4GT7A 3PP3K 2VH5H 1JVLA 2X4OB 3QJOA 2WP3T 1ESOA 2AJ3A 3SZKC 3UBFA 1X9LA 5HI4D 3NK4A 2EXWC 1P7QA 3V5DA 1H3XA 3FN3A 4AV5A 2E76C 4HAFA 5KS9A 4TVPD 4AL8L 3GZOA 4NOFA 1KUMA 1IUZA 3KHOA 2VDNH 3G08A 4RZCB 5I73C 2ETWA 4P59H 4AEIH 4YX2L 3F5WB 4GXUM 3RFZB 2HKHH 4HJ0C 1FA4A 4XBPA 4JDZB 2CLZA 1B0RA 4A38A 1E5ZA 4PRNA 4YQXL 1FJ1B 1GPOH 1IGTA 3WTUA 3FO1A 3REWA 2CCLA 3IBEA 4R0LA 4DGIH 3V4LA 2MKWA 3BH4A 3ARRA 3MI6A 3WDJA 3PFQA 4ELME 1NMCB 2QLVB 2FO1A 5CBAA 1FDLL 2DYRB 4EKXA 1KIPB 1JZHA 3ERXA 1TVHB 3HZKB 4J3WA 3UCQA 3ZYIA 1EVUA 5I1LA 4RFOL 3CMOH 3X1BA 1I9RH 2ENJA 1BVLB 4PLOB 3QHFH 2BVTA 5TPWH 5BZDB 2LLNA 2K9UA 1XR9A 2PN5A 1G9MH 3G04B 4Z7VB 2Q1EA 1YYLL 4L05A 4AGMA 1BIHA 5GGRB 5C09E 2ESVA 1FYTE 4HUMB 4MA3B 3MJ9H 5AWNL 4X4ZA 3TGXA 2VLLA 1TQWA 1TJMA 1S7UA 4WW2F 3UFIA 1UH3A 4AC4A 1E6JL 1PAMA 1M6UA 4HLZH 4HUCA 1NJ9B 2IQ9H