4FFZA

Crystal structure of denv1-e111 fab fragment bound to denv-1 diii (western pacific-74 strain).
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
b'YVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
publication title Structural Basis of Differential Neutralization of DENV-1 Genotypes by an Antibody that Recognizes a Cryptic Epitope.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Immune system/viral protein
total genus 12
structure length 97
sequence length 97
chains with identical sequence X
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ffzA00
5AAWC 4AL8C 2I69A 2HG0A 3N43F 4UTCA 3N44F 4UT9A 1OANA 5GZOA 5JHMA 3IRCA 4GSXA 3P54A 1OKEA 3VTTA 3J2PA 4L5FE 2P5PA 5LBSA 2GG1A 5LCVA 4UTAA 5H37A 5KVFE 4FFZA 5LBVA 1S6NA 2R29A 4FFYA 3UAJA 3UZQB 4BZ1A 1ZTXE 3G7TA 2V33A 5JHLA 5IREA 3UYPB 3MUUA 1Z66A 1SVBA 2JV6A 1TG8A 3N40F 4GT0A 3WE1A 2R69A 5AAMC 5KVDE 3C5XA 2JSFA 1UZGA 2JQMA 4FG0A 1OK8A 1Z3RA 5GZNA 1URZA 3N41F 5KVGE 3UZEC 5B1CA 4X42A 4UTBA 3N42F 1RERA 4AM0Q 1PJWA 2ALAA 3UZVA 4BZ2A 4UT6A 4ALAC 5IZ7A 3J27A 3C6EA 5KVEE 2H0PA
chains in the Genus database with same CATH superfamily
4K0OA 3SDCC 3DURA 2V5TA 1N64H 4FD0A 3FC8A 3BN3B 5CP7B 2W60B 2IIJA 3QDAA 4KKBC 4QEGA 4RFNC 4TVSa 4V1DE 1J10A 1KYFA 3FOMB 1KIRA 3EOTH 4WIQA 4WI3A 5D6CA 2ESVB 4QOKB 3KGUA 4UBDD 3AZUA 4OZFA 5EORH 4Z6AT 2FYVA 4L4TB 5IMOB 3G04A 3LKSB 1XSIA 4LDEB 4ZPVA 1IL1A 1DQLH 4NCC1 5F9OH 1WDAA 1MI5A 4IMLA 4N26A 1QLRB 3OHMB 3GSUA 1NUDA 4Y5YA 3WEMA 3KG5A 3VXNB 3F12A 5DRZA 2ADFH 5KN5A 5JW3L 1I3VA 4BQCA 3FSWA 3M7OA 2P5WA 4PJ8A 5GGVH 4N2DA 4HC1L 4U6TA 3W3BA 4K4KA 1R3JB 2YAHA 3WEAA 5G4NA 2D7OA 3W11D 3W1ZA 4PJ5B 5TQ0H 1HH6A 3HLKA 1A1OB 1TKWA 1B2YA 3CFBB 2VDOB 1VZGA 1A22B 2XTSA 5F8QC 3IPFA 2CKNA 2JIXD 2Y7NA 4IGBD 4XP6H 3JWDH 5I1IL 3I6KA 4LGPB 4PWIA 4YZWA 1B0WA 1CR9H 2DLGA 2FD6L 2A9DA 1WT5C 3D52A 3NZHH 5HYIA 2HG5B 3WFDH 1QEXA 3L3IB 3MLXL 5CUSH 1J7VR 1ZT1A 2HFGL 4NQDE 2AJXH 3QQ3A 3WE1A 3LNHA 3M6DA 4D9RE 5H2BB 3D69A 3U9UA 3KPLB 2VNCA 5DMIH 1R9FA 3WGUB 2C9UA 2YO3A 4F7TA 4HUVA 3FRUB 4HETA 2N59A 4V1DD 4A39A 3VXPA 4JLRB 4MVBD 5SX5K 3VFSB 4H0IA 2W0FA 4L3ED 2CRIA 2NR6A 3O2VL 4KTGA 3VXRB 4Y5YC 3N2JA 5H37H 5GS0L 4Y19B 3L3HA 3B9KA 1U91B 2ICCA 4XP1H 4PJ8C 5AEAA 4M6NL 3V4UL 3IDIA 2IG2H 3NJGA 3U7AA 3PGDB 3HPLB 5IW6B 4K3DH 1YN7A 5AFAA 4ODVH 4RGMB 2ZCLL 3ATDA 4P59L 4NI6A 1X5JA 4NNPL 4KJPC 4ADJA 3VH8G 3RPKA 4I0PA 1QUPA 5I0WA 1DSYA 5ELIA 4B50A 1IVTA 4X4XA 3G6JB 8CGTA 2AF2A 3I74A 4MS8D 1YVLA 2NNAB 2H6PB 1A3RL 5E8PB 4NENB 2NZIA 2EE3A 1D2OA 2R23A 2RTTA 3CXDH 1UOWA 2VO5A 1GMEA 3ELQA 1GL4B 3LVTA 1XCTA 4WEBH 4MLIA 3RG1C 4P2RB 3HG3A 3KPMB 4HGKC 3OAUH 5EZLB 3TNNB 3X1GA 1TU2B 4NKIL 2Z93A 1HWHB 2B39A 3M8OL 4NT6A 4D9RD 5DJ0B 4FQHB 4JCMA 2EO1A 5HP5A 1ND0A 9CGTA 2WBJA 3S3BB 3RWGA 5D93C 1U8NB 4LLVA 4ICWA 4UM9A 2WGNB 2WC7A 2E9GA 1MHCB 3B9KC 2W65A 2VDNH 3HS9A 2XWJB 3CIQA 2ZCHH 1DQQB 3F6JA 5GS1B 4QCIB 5C3TA 4LFHD 3WIFA 4DO4A 2WKOF 1I1RA 3QG7L 1XXDC 4UU9A 3L3OB 3VXUE 4TULL 4Z7VF 1T5KA 2PO6B 2KBGA 4Z7QF 4Z7IA 3D39E 5CJ5A 4B0MB 2Y5TB 1U36A 1DFBL 2W9DH 1GC1L 4X7CC 4MDIA 2R1YB 1HXKA 1KUMA 3LQAL 4QKTA 4I0KA 3VWJD 1QO3A 3BD4A 3SPCA 4PLKC 1KB5A 3CSFA 4DKEL 4PH8A 4WUKL 2V9RA 5C0GB 5EU3B 1OTTD 4JFEB 3FL7A 5EC1A 3P2DA 2ZAIA 4JFPA 5C0BA 5EUOA 1NA8A 3B5HA 1XV8A 4ZMZA 1SY6L 5I71B 2E9JA 3C6LD 3DV4A 3BW9A 1RIVL 5J6HB 2C34A 2XV3A 4YDVA 2WBJC 4DZ8B 4M5YH 2BNUA 5DJDB 4ZXBD 4L1HA 5C08A 4NLHA 4DP8X 1UKTA 3LRKA 3S4SA 2PP8A 1L9MA 4YBQD 3U36B 4LSVH 3JT2A 1S7SB 1CN4A 1DUZA 2CDEA 2GUOA 1WZ1H 1UCTA 2Q3ZA 5DUPH 1S78D 2ADJB 5BZXA 1YN6B 1PVHA 2NXYB 2PCFB 5I1HL 2I9TA 3CIAA 5T5FH 4F8PA 1W15A 4E0RA 5FCUL 2VR6A 2HRPH 2Y2TA 4I9XA 5IEKB 2DEWX 4RZKA 3VXUD 1CG9B 1P84J 4R2GB 4V1DA 1MPAH 5I19H 1J9SA 3D39D 4XCCL 1K8IA 2JQZA 1QFWM 1F0LA 5B1AB 4L3EA 4Y4HC 3QYMA 4ZMXA 4IK7A 3GMMB 3L17A 5IFHL 5MP6L 2QR0A 4OLEA 1LDPL 2BWIA 2V5SA 3GBNH 4CKVX 4OZHE 5F8RC 1L9PA 3G6AB 2Z7WA 2P28B 1URLA 3HFML 3K91A 1OM3H 4RVBA 1DBKL 1SDAB 3QJHA 2C5DC 3KVQA 2CR6A 3G6DL 3D2UA 3NA9H 3WJJA 3BXNA 4JPSA 3HLAA 1AGDA 1TQBC 2VLLA 2X12A 3TEZA 1L6ZA 2CBTA 5KOMC 2VO8A 4BDVB 2NY5L 3VE0B 3VGGA 3O0RH 5C0CB 1WD9A 3T0BA 5I18H 5ISZE 5GGSB 3DYOA 5IEHB 2X89D 5DD0H 3MV7E 3W9DB 3UBXG 2WCGA 2WCPA 3EYUH 4KBPA 4TTDD 3V6OE 1UWEH 4M61A 3U46A 4NQXA 3UAEA 4FFZL 3PGFH 2IWKA 3I75B 2BMKA 2UY6B 5FA4B 3STZB 4OZ4A 3KHOA 5A3IC 2J6WA 1WPCA 2DKUA 2DS4A 2NUPB 3DBXB 3QZOA 4HS8H 2XN2A 4WU7B 3RGVC 4R5XA 2NT0A 3RVXD 4RSVA 1DQMH 1IGTA 5E08L 4JDZB 4GI9A 3WHE0 1G9NC 3OXSA 4YAQB 1OQXA 1J12A 2YK1H 1JDDA 1MRDL 2GBUA 4QTIL 1E2ZA 4YL4A 4JQIA 1P4BL 3MCLL 3RUGB 4KFMA 4K5MA 3GSOB 3NZ8B 2CKBL 2GK2A 5FWRA 3FTXA 4AIZB 5F44A 3CN4A 4Z78A 5HHQA 4G1EA 3PWNB 3RY4A 3DOHA 4X6DB 3WJJC 3LPPA 2PABA 4ZO6A 1S8DA 1J0HA 4JRWA 5ITFA 4N3UA 4CBZA 1BLNA 1BXXA 1KXQE 1ASQA 4HOZA 5D7JA 5ETUB 1JI1A 1P5VB 3BQVA 3K0YA 2WN2A 5HYJD 3GUFA 1XIWA 2EDXA 2OMZB 1IC5H 4L8DA 5CSBA 1H15B 2D7QA 1J1OH 5ISZD 1AKJB 1HKLH 3AS0A 4HQQH 4AVJA 4HV8A 1I3GH 5F88A 2CD0A 4ZX5A 1WP6A 3QUZD 4WI9A 4UT6L 5HTSA 3CG8A 2FHBA 2MCG1 4KGJA 4M48H 3O6KL 2V2TB 3FRPA 4K7PH 3OF6D 4A67A 3HW7A 4ZXBA 3BZ5A 5DS8B 1VRSA 4OY9A 3KM1A 4ZFFA 5E8NB 3S3CB 1S7WB 1G6RL 3FXIC 4N0FB 1SOKA 3T0EA 1Q9OB 4M5TA 2A77H 2H2SC 4UMGA 1GYWA 2OX5B 5SWSE 1AGCB 3FSVA 2Q86B 2NY2C 5DJ2A 1LO2H 1CPUA 2H8PB 4ETQA 5DGQA 1NCHA 4YSDA 1IAMA 5G5DA 1SJVA 3OJDA 1ZY9A 3REVA 2FX8L 3T71A 1KTDA 3K8KA 3MA7B 5D6DA 4J8QA 3ZE1B 3EXJA 3OHXA 4ALAH 1QBMH 1YQ2A 4M56A 5JHLH 2VZTA 3FUDA 4XAWL 2AHIA 5A16B 5D7JC 4Y4KB 1IVLA 4CMMA 4MD0B 1UM6H 2EDLA 4XBPA 1XIWC 1HQRA 3FFCB 5EA0L 3WO4C 3AWGA 4F37K 2XQ0A 3ILEA 4NFDA 3CLFH 1QYGH 5AOLA 4KZDH 4Q14A 3WFHA 2RBLA 1KF9B 1KPVA 3WKNA 1PKQB 2K6WA 3ELAT 1USZA 2ITFA 2DLFL 3CHRA 1VB9A 4JPVL 5KJ7E 2F5AL 3FO9B 2YD5A 4FQLL 4V2BA 5ACLA 5LDUA 1EUUA 3UZVB 2F74B 1JV2B 2YAMA 2VM4A 1MFNA 3RILA 1NINA 2OL3H 2EVFA 1E4WH 5ACZB 2X7LA 1HAUA 5IOKA 1YC7A 3TFBA 2VLKB 5DQ9B 1R3KA 3T0EC 1CIDA 1HI6B 1Q4NX 2IALB 4PB0H 4Z7WE 5FYLH 1JV5A 4P23B 4WENB 4DN3H 3DNKA 2YBRB 4X6BB 4EI5C 1FLRH 2AK1L 3FQUA 4N3TA 1WFUA 4UZUA 2AEPH 5I5IA 1Y1DA 1UFUA 5SWSD 1WFOA 4GRWF 5D6DC 3OHXC 3T8XB 4ZMOA 3VFNB 4M8VA 3T04D 3PPEA 3IDYB 3KLLA 2ZNWA 4UQIM 2JI1A 4TMPA 4NQSA 2RFXA 4IIQA 4PJ7A 1XHHA 1H5BB 2ZZUT 2X6AA 4UQ2A 5B3SB 5I2IB 1XGZA 1UZGA 2EKSA 3J8F7 3V52L 2F18A 1MCWM 3DVIA 5DK2A 4PJXE 7PCYA 1JXGA 2APXA 3DPDA 3L8QA 3Q2CA 2QSCL 1U8QB 3PWJB 4XP9H 5L8KB 4JFQB 1RZ7L 1E8WA 4HMEA 3UEQA 2DZEA 4GO9A 5EU6B 4WI4A 2Q7YA 3L1OH 3MLSH 4WNJA 5DHEA 1N3NB 5FW7A 1EBPA 5D1QE 2JCCB 4JKKA 4CMHC 1BZOA 2CLZB 5DURB 1EVTC 1FVDB 3DO4A 3F05A 3TNMA 2UY7A 5MENB 5HYJA 3LKQA 4GINA 4W70A 3LVEA 1KIPA 4W9KC 1K6QL 1J1PH 2QEJA 3TPUA 4JN1L 1TJHL 1PKOA 3FUJA 2OZ4A 5I1EL 4KXCA 2PNDA 2D31A 2VM3A 1MG2C 2YN5A 3ARED 3D4CA 4Y7OC 4GUQA 1WBZA 1QEWA 5JIIA 5FGCB 4N2NA 4H0LC 2H0FA 1E2WA 3ARSA 4TQEL 1AR1D 3VNYA 3ZVVA 5JW3H 3TV3L 2E6JA 2VDPL 1DCLA 3ALPA 3FYEB 2VL5A 4HC1H 2ARWA 3S5LA 1U30A 2NNCA 3Q5OA 1U4FA 2BSDA 5T1MA 2G5UA 2Y5QA 2DD8L 1NPJA 1EJOL 1JCVA 3B6SB 3N44F 3ROOA 1GGBL 1HE8A 1QZ1A 3WFZA 1FRGL 3WMQA 3B1TA 4RCAA 4CVUA 3TYFB 4UM8B 5I1IH 4Y1AD 4BFIA 3DK2A 3QORB 5KG9A 4GOSA 3T3PF 3NDYE 3UPCA 2B59B 4DP2X 3M07A 1FNFA 2J56A 3VXOA 2DQ6A 3IU4H 1T0NA 4LVEA 5C2UB 5I1DB 3ROLA 1XCQB 3IMUA 3O2DA 4LAQH 1A7QL 2HFGH 3ATFA 2KZKA 4N85A 3OV6A 4O58H 5IB4A 1GHFL 2OULB 4UDUB 5D1QD 4WO4B 5E1IA 5GHWL 4LOFA 1SYVA 1UZ8B 2WB1A 3QNFA 5AW6B 1NCNA 2JFCA 3VWKB 2DQTH 2AJZA 1KCUL 1ZAGA 3MACH 1HSBA 1RULH 4EOWL 4F27A 3C5JA 2XZQL 2R29A 4BA0A 1XMEB 4JM2A 4IBVA 3RB5A 5HVWA 2NQ3A 4IEFA 4XBGB 3RNQA 1IMHC 1A4JB 1S9YA 1KULA 1P5UB 4U7MA 3HEIB 1JWSB 1G7PB 3ARDA 2PN5A 3Q01A 3ECQA 3P0VL 4JFZH 5IVZB 3WFCL 5GS0H 3JWOL 4H8VA 5KYYB 2A6KA 2MHAA 3V4UH 4FQXB 3ZRCC 2AV1B 2VDML 1LNUA 1W72B 3ILPA 3U83A 4P04A 1ET8A 2IF7A 1RD6A 1YEDB 1EAPB 1GJWA 2ZCLH 4WCYL 1CB4A 5AZEH 1WUZA 3ALXA 3A21A 4NNPH 4RAHA 3QBTB 1A7OH 1T1XA 5FOBB 4R4BB 4J1UB 3PHQB 5DO2C 4EUPB 2LU4A 2AQTA 3DIFA 4S2SA 4XZ4A 3RTQB 2FJSA 3ABGA 4UTAH 4HU2A 1EXUA 5KVGE 2A83A 1IX2A 4MNGA 2IAMB 4ZFQA 1SVCP 3G9VA 4UINH 3VFGH 3BN9C 5DZJA 1TDQA 4MX7A 1MVUB 5EFIB 3A6OA 4IYKA 2BSSA 4QRBA 3GB7A 2OR9L 3MU3A 3TO2A 2O4EA 2VC2L 5KBMA 2H5UA 3DYPA 1PTZA 5FO2A 3NIDF 3T8VA 4NKIH 5DD1L 3M8OH 4LL4A 4JM2C 3MRKB 3VDCA 3H54A 3B34A 1OGAE 3GWJA 1E65A 1A3LL 4PRPE 4XP4L 5ID1B 4MZIA 4LOEA 5B7MA 4ORGA 1E67A 4YFLI 3Q43A 3ARDC 1EFXD 3BAIA 3HUJF 4GXVL 3TASA 5H35B 5T3XD 1JGUL 1N8ZB 2HJFA 3E0GA 5C0IA 3V6FB 3MHZA 2R83A 2Z1KA 1LD9A 2XYBA 1V3LA 4CSTA 1H9VA 2BO0A 4JANA 5AB1A 2VSKB 2DWYA 3QG7H 4HCRA 4TULH 3MLTA 5E8EB 1DE4B 4CW1A 2X28A 4WWID 3LY6A 3SQRA 1GC1H 3ULVC 3FT2B 4NKDA 4YDIL 3NJLA 1BA9A 2XVLA 5CILL 4LSRL 1I8IA 3IJSB 2M2DA 4Z7WA 2GTZB 5BV7C 4MJ5B 4HJTA 4WUKH 2ATKA 3QPXL 4P2QA 4PGDA 1QSEA 3MQIA 1HXMA 1NAMB 5D1ZI 3L48A 1T1WB 5C0DA 2XYCA 3ZT6A 2CM6A 4BZ1L 3WY4A 3QIUD 4HEME 1SY6H 5DR5L 1XGPB 1Q9KA 3SGJA 3UBHA 4GKLA 4B96A 1X7QB 4BFNA 3PGCB 3T8MA 3POCA 4Y1AA 3WU1A 5ILTL 1X4ZA 5LBGA 3C5SA 1OTSC 4ZK8A 3ASNB 4PJGB 3EOAA 3QT2A 3GEWB 4BK4A 4PRPD 1IILE 2EZ0D 3Q0HA 4PD4K 3DRTB 3OZKA 2FL5B 4JJ5A 1MAJA 4JR9L 5HYQA 4CAGA 5I1HH 4YSTA 1E8YA 5D5MF 5E5MA 1KSRA 1U8LA 2FCBA 1A6WL 1V27A 2P5EA 2X4NA 5TE6L 5H8DA 2XG4B 4AQEA 1KJ3H 1BDYA 4BH7A 2GITB 3KL5A 1NANI 1S7XB 5K39A 5LCVH 2GFBB 3LXBA 1MH5B 5MP6H 3X13B 2EDFA 4K71B 1M2VA 1LDPH 2IBZY 3TVMB 5E9DB 3EO9L 1X7SA 5DUJA 1AY1L 2YXWA 1T3FA 2Z6FA 2HT2C 4NLAA 5KBPA 1S7VB 5DC9B 2ADIA 4JRYB 2Q5BA 1T04B 3EHBC 1LEGB 3LJ3A 4TOYH 3Q8BA 3PFQA 2NY5H 4P57B 4HJSA 5EHFA 4CADB 5JXED 4B7IA 1DQKA 4LP5A 2R39A 4YWGH 3QUKB 2R9HC 4E9SA 2LVEA 1T7XA 5JPMA 3QNZA 3Q3GA 3QJSB 3VQ1C 3V4PB 4OFDA 2YRLA 5K9KB 5DJ8A 3UPRA 1T03L 3SCMB 5FDWA 1KG0B 4OGAC 1D5ZB 3FCSA 1BZ9B 3MR9A 5LO7A 2QZ5A 4ZUVB 1OW0C 4HBCL 4GYBA 1XF2B 1KLGB 1KPUB 2X4UA 4NZFA 4OV5A 2HTLD 4HIIA 4IBWA 3CDGB 1JZJA 5AVUB 1A6UL 1LYQA 1RU9H 1WYJA 4TTGA 1TITA 3EBIA 3BAKA 4JBSA 4PJCA 2QPEB 5AZ2L 2CLVB 3BZEB 1IQDB 3GSNH 4NM4L 1OHZA 1ZHBA 3T2OA 4IRZA 2HX7A 4RGNB 2QKIC 5KEZA 5HD8C 1U3JA 3QZBA 2EIMB 3G3LA 3GI9L 4QHLB 1I1AA 2WZPD 4QLWA 2ARJB 1M1XB 5CEZL 3U9PL 4IOIA 4HLEA 1C7TA 4NX0A 2CE6A 1YPZF 4IJ3B 4RETB 4F7PB 3RFZA 4YLBA 2C7UB 4IBUA 2QADB 3TBBA 1A9BA 3GXUB 4XBMA 3F2LA 1K4CA 2E9WA 3T4AA 5FECB 1E4XL 1NOAA 4M8QB 1F6LL 1NC2A 1AO7D 5BVPL 5JPMC 4X6CE 3X2QB 2X0UA 1UJTA 5D7EA 5I0DA 4BM7A 2W9LA 3QI9D 3JWNC 5HGBB 1BBDL 2Q0ZX 4JRXB 1EEUA 4Z7VB 4Z7QB 5FHAL 2C1PA 3QZPA 3QDHA 3QIUA 5CKAA 3V0GA 5T1KD 4UT6H 2GHWB 3O3AA 5BZDB 3VXSB 2ZX8A 2O6EA 2QV4A 1QFHA 4GT0A 1KJ2A 3IYLW 3O6KH 2JSFA 2MFNA 1KB9K 3FUMA 3MLVH 3CFEA 2F7OA 3VU2A 2ZWZA 4OGXL 2B0SL 2PF6A 3CBRA 4X8JA 3ISWA 1G6RH 3OGCB 4DT2A 4R4FL 2EUVA 2JLLA 1GJIA 1WWWX 1J5OL 1I1AC 4R0LA 3MFFB 4PY7A 5DEZA 3KLSA 5FFOA 5C0FA 1OTUC 3ENEA 4PP2A 1XGUA 3FF8A 4AKPA 3D85B 5DT1L 2C3VA 3MROA 3RFZC 3EYOA 2X4PA 2V5RA 2BJML 3QHFL 3IVKA 2BNRD 1ZSDA 2WK2A 3DXAB 3HMXL 3T4AC 4XAWH 2CGRH 4PW9A 3L45A 3ARFD 4LHQB 4NKMB 2Z35A 5AW8B 1FGVH 4ZYKA 5EA0H 4GAJL 5K1JA 5I1JL 4L4JA 3MYJA 2FJHA 1DYZA 4M93B 1ZT7A 3WJMA 1GOFA 5F0LB 3WTYA 3FHAA 3K3QA 3Q8AA 2XRAL 5DWPA 5LAXB 4UOW0 1TIUA 1EJ6A 3SKJL 2G3XA 2DLFH 4IW4C 4JO4L 3H42L 3OKYA 4JPVH 4YE4L 5KVEE 2F5AH 1N59B 4HWEL 3BKYL 3MRJB 4R97B 1PX8A 4OD2A 3OBAA 5CINH 5EEYA 5HYSA 2QVMA 2ZYHA 2QPUA 1GW0A 3QA3A 2YS4A 4KV5E 1MF2H 3NFNB 4F3FB 2AERT 3BP6A 5IT2L 4P5RA 4RMSA 2HT4D 2I7OA 1FBIH 2AK1H 1H8LA 1NKRA 2P5PA 3MO1B 2H3KA 5JLZB 4F2EA 4BZ2H 1NANH 5I6KA 3IMWA 4R96B 2YXVA 3G08B 4YHYC 4RBPH 4XP5H 2Y6SD 2G75A 1F2QA 1QRNE 1PY4A 3P3SA 4JO3L 4NDMA 4GQ9L 4FYQA 4H5SB 4P4RA 4CNIA 1FNGA 2XWZA 1O7DE 4O4YL 1Y7VA 1RQ5A 4Z7UE 1UWXK 1X9LA 3V52H 1QSVA 4RH4A 1EEZA 5HDWA 4F8TA 2H32A 2X1PA 4PV8A 3OMZA 4A2DA 5HI5C 2EH8L 2DOCA 4HMDA 3BE1L 1AAJA 4DEPC 1DVFD 4WKZB 4XT1C 1RZ7H 5IHUH 2UYLB 3I3EA 4OGZA 4QGTA 3HB3D 3MUUA 4GP8B 2P9RA 3IGKA 1E7UA 5E8DL 3HPJB 1F00I 1Z6JT 1ZA6B 3A4FA 3CFKB 4BSWB 4G8GB 4XO4A 1Z5YD 4AMWA 1AO7A 3WGVB 2EKJA 1TNNA 4KPHH 4LBEB 1NM9A 2WVSA 3D30A 1J9CT 2LV4A 4X6EA 3VFUA 4ZFZB 2ZUQC 4JN1H 1B0RA 4B9JA 1TJHH 4L4VA 2VLME 1AKPA 5I1EH 2AABL 4OKDA 4HALA 1D7CA 3JV6B 3Q1SL 4YO0B 1NQBA 1R47A 1LWHA 3VD1A 4TQEH 5HGAA 4DK3A 1KFGA 1T7ZA 3TV3H 1AOZA 1K5NB 2VDPH 4C59B 1MNUH 1ZDSA 2MJWA 4ZW5A 1J88A 1KCKA 4MBOA 5I1KL 3WNKA 3GZOA 1GS8A 5FW8A 1RZKC 5AKSA 3F7QA 5J9PB 1QRND 3D07A 2DD8H 1EJOH 3HNSH 1ZANL 2GY7B 3O3EA 4G6FD 1GGTA 3HN8A 1FRGH 4QXTB 4J3VA 1YG9A 3C9NB 3MRQB 4Y0GA 4HG4K 4J2QA 1BZ8A 4ACTA 3H2QA 3ML8A 2A2QT 2DTML 5DS2A 4LU5H 3RWCA 4CA4A 2OPCA 4QOKE 4K3EH 1NLDL 3TBSB 5CBAB 3L2LA 3RX8A 3HG0A 4P05A 5FGBC 1ZVNA 2HMIC 1L9OA 2BNRA 1PZUB 2IANE 3KYNB 3NN8A 4IRSB 3QEUA 4EQ2A 4Y2DA 1Q9LB 3DBSA 1E8XA 4JHVA 3JVGA 1WC7B 2XVGA 3VMNA 1WBXB 1FJ1B 1FIGH 2KUTA 3M1OA 3R0NA 1KCUH 4I48B 5E00A 4EOWH 1OGPA 3DA0A 3WUWG 1EHXA 2D3VA 1II4E 3W5NA 4KTDL 3PWLB 1OT1A 1FHGA 5LWYH 4K7FB 1RK1B 2ZOTA 4JM0A 2YBGA 4NO0D 5DEFA 3BOVA 2VLMD 4IQHA 4GI6A 1O0VA 3IDXL 4IU3B 2BS8A 4D7BA 3BPCB 3WFCH 1MWAL 2DM4A 1NCIA 3P0VH 3WIHA 1B9ZA 3QQDB 2WZAA 3FPXA 4YGVA 1MREL 3JWOH 5BS0A 3LKPB 3CFCL 4XPAL 1AYRA 4OAWB 3VFOA 2XBZA 3O4LB 3HBGA 4UDTA 3IDJB 5AUMB 3U79A 1SLVA 1FG9C 3FU7A 5TK2A 4A6YA 2Y1YA 1M05B 3TT1H 4U6HB 2WD0A 3X11A 3QDJB 5HGHB 3C5ZC 1PCSA 4ONGL 4XCEB 1JUFA 3ZKSD 4I87A 4WUUA 1ZA3A 2V33A 1IIIA 1ULVA 2WQAA 4OZIA 4ZNEE 2A73B 4X5WA 4DP7X 4FE9A 5C09E 3S3DB 3HZKB 4DAGL 4Q6IB 5F97E 2DQFA 4QOKD 4QR7A 4J3WA 5DU7A 4Y2DC 2MOVA 3FCBA 4K9JA 4LARL 3QCUH 4F2MB 2NXZC 2NW2A 3JVGC 4P49A 4UMSA 4Y19E 2K4WA 2VCOA 1JTOA 2CO2A 3MNMA 3MN8A 1UATA 2VC2H 3LEYH 1D5IH 3JYBA 5TK4A 2OMWB 3GMRA 1ZIBA 4G7RB 4JFWA 3SJVB 1BXVA 4NZJA 3BVNA 4Y1TA 1UM5H 2OQJA 2HJLB 4GRWB 1EJFA 2WWOA 2OMTB 5FCSH 3MBWB 4JL1A 4BH8B 3MKGA 1BP3B 1AD0A 2YD0A 3LB6C 3RZWA 3OKNA 4FX5A 2FEEL 2XNAA 3IJYA 1JGUH 2ATPB 4PRIB 5IIEA 1TQCC 4IOSA 4K7PX 5IWLA 5L2JA 3VXQB 1A1MA 4EJ1C 3IJHA 3IK2A 1IM9B 3WYRA 2D7TL 1F5WA 3CDCA 5BRZB 5EZIL 4I2XB 1WHPA 4YDIH 2GABA 1QMUA 4LSRH 4NWUL 2DW5A 1OO2A 4Z3FA 3K4ZA 4C4BA 1QOKA 1XGYL 3AS1A 1QVOA 3SKOB 2GSIA 4FJZA 1AACA 2W9EL 5HI4D 4ZTPL 5CIPA 4MD4A 1BQHB 3RJQB 2HLAA 4XNMB 4XI5D 2J44A 4PV9A 2ZG1A 3OB8A 3S36L 4UQCA 5HHME 5I5JA 2BHZA 5C09D 5SX5H 4W9LC 5I6MA 5DR5H 1OWWA 1RPUA 3AT0A 4CDGC 4LSDA 5L0QC 4WTWA 2P4AB 4Y19D 1GOGA 4GRLB 4Z7UA 3CVHA 5IB2A 3EYQC 1E6JH 4PBWD 1SLXA 2VLJA 1I9EA 1A6TA 1CFTA 3NTCL 2O5ZH 3X1NA 3Q6FA 3TZVB 1A7NL 4E42A 2YAQA 2BZDA 3GIZH 5HY9A 4M7KH 3O41A 4XNXL 4MDJA 1HL4A 3HKZA 2WP3O 1U92B 3IB4A 1N12A 3N44B 1L0QA 5FO8B 4I1RA 3CX5J 1ODAA 2C9PA 4EI6A 5EBLA 5DRWB 1WIOA 1A6WH 5TE6H 4G8FA 1TUPA 1M71A 3LKNA 2XWDA 1R5WA 4H8QA 1CI3M 3P4NB 3T3PB 5IF0A 3MOBL 4FHKA 1ECYA 5F3HB 3PHOB 1YSOA 4NO0A 2J8UA 4RMRA 5FKPA 1IEBA 4AENB 1A1NA 4YC2C 1F3DH 4MD5A 5GRUL 1PX4A 3EO9H 3AAZA 1AY1H 1UH4A 1FDLL 1HQ4A 4K8RD 3MRCB 3TBVB 2VITA 1TLKA 3D0VA 1J86A 3O45A 3FNKA 1FG2A 2ZXGA 4JHZA 4LASH 1BFOA 3Q2NA 1FV1A 1J5CA 2KS0A 5HHMD 3EGSB 4CJ1A 3ZGIA 4LBAA 4OCYL 3IM1A 2E86A 2F53B 1ADQA 1N7ML 2RIKA 5C7XL 1EZVY 5CP7A 2H3NB 2W60A 4ZFOB 5IY5B 1MW0A 3T5WA 1G9ML 1A3QA 1OP3K 5D7IF 2H26B 2PO6D 2YJLA 1NUFA 3KPNB 4RISL 4FA6A 2DQGH 2XN9E 1T03H 3PFUA 3TN0A 2ESVA 4QOKA 1WBYB 4G6JL 3QEHB 4L4TA 3LKSA 3BZDA 5EOQL 1FNSH 4MHHI 3BAXA 4DGIH 5DQJB 1QLRA 1XBRA 3HC0B 1C5CL 5LJYH 4F33B 5K9OB 1Q1JL 4LVOB 2CGYA 2MTPA 3VXNA 4PGCB 1JPEA 1A6UH 1JK9B 2KHAA 4JFED 3H9SE 1EDHA 2BSED 4DK6A 5AZ2H 3L1FA 3PPSA 1R3JA 1PEZA 3O6MH 3UTSB 5KBDA 1NCUA 4NM4H 4TLKA 3CDYA 4PJ5A 5TJWK 5C0CE 1O75A 1A1OA 3PIQA 3CFBA 4LSTL 4OJDH 2Y1AA 1WHOA 1U4EA 5D8JL 3IFLH 4HUUB 4KKQA 4QI3A 4LFHG 2KZBA 3U9PH 3BZFB 3GBML 4PRDB 3FB6A 4BCZA 2BIHA 1J8SA 2J1XA 2W8CA 3NIDB 1YEGL 1QLEL 3CVDA 4PJAF 4P2OB 4U1IB 2VDNB 4GT7A 1JSYA 1XZWA 4KDTA 2HG5A 1Y07A 3L3IA 4H2AA 2R4SL 3HUJB 1DR9A 1SJMA 2NXYD 4TQIA 2OYPA 1LQBC 5H2BA 3QXVA 2CQVA 1DANU 5ANMB 3KPLA 1C1EL 5DI8B 3DTXB 3TN0C 1BBDH 4MZRA 4UNVA 5KVDL 3PNWB 5I8OH 3FRUA 4PJEB 4XO5A 4R2GD 1QX1A 1XF3B 3QR2A 5FHAH 1ZLWK 4JLRA 1T21B 4YFLF 2XN9D 5LBSA 2KH2B 3WAKA 2ZSVB 1U8OA 3ZGHA 2W5PA 4AGNA 4P5KB 4MKMA 3VXRA 2XG5B 2L8AA 3B2UC 2EXYD 1XF1A 3BT2L 4AM0B 4DUXA 1U91A 3LNIA 2WZ0A 4QYAA 4ZMNA 3FRPG 4XNBA 1IZKA 2O93L 2ALWA 5ICZB 3PGDA 3HPLA 3V4VH 2QTEA 3H9SD 4YHKL 4LPTA 3Q8FA 4R4FH 1C8QA 1OAQH 2X2YA 5IKCB 1J5OH 3VCLB 1VEOA 4R7DB 5C0CD 3QUYB 3BVVA 1NCGA 5IW3A 4X4MA 1VENA 2OKMA 4J4PC 5DT1H 4MHHG 3RVWC 4QXGL 4X80L 3G6JA 5A1AA 1WISA 4KDTC 2NNAA 2H6PA 5AD0B 5E8PA 4OD3H 4NENA 2Q2LA 3HMXH 4O02L 3TJHC 4DGWC 1CLVA 2WLJA 3B56A 5DHMC 4IKIA 3EO1B 4P2RA 3HS0B 3VH8B 2YFNA 1E2VA 1WFJA 3UXFA 5EZLA 3TNNA 1TVDA 1TU2A 43CAB 3U7WL 2ITCA 4FG0A 5D55A 2K0RA 4CUCA 2Q8BL 2WYIA 2PYEE 5D5MB 5DJ0A 3QDGB 2XRAH 1ZDQA 2ZPKL 4U3SB 4NJ9H 1RUKL 2DWDB 2KPNA 2RJMA 3SKJH 1U8NA 1KXVA 4LMQI 4YE4H 4Y4HD 5I15L 1V7ML 4ABVA 4E36A 4Q74A 4Y9GA 1KBVA 1MHCA 4HWEH 5I75B 3BKYH 5EMYA 2GI0A 2XWJA 1Z3GL 2YGOA 5GS1A 4PWFA 4QCIA 2FEEI 3ETBF 3L3OA 1TNMA 2AJ3B 2QLVB 4MQXC 4OZGE 4RZCA 2PO6A 3IJEB 3MXWL 4PJHE 4RGMC 3S8GB 4JZJB 5GJSL 3KPQA 3QUMB 2Y5TA 1KBKA 2FNWA 2R1YA 2DB8A 5IT2H 2NZ9C 3NGBC 5CGYD 2QJDA 5HJGA 4FFWD 5DHXB 2C9AA 4GMSH 3PF2A 5C0GA 1PKQE 4JFEA 1AKJD 3AG3B 4HJEA 3HE6B 1L0XA 3ZN6A 4O4YH 5E03A 5KVGL 1RUAL 4ONFH 4UTCA 5AAMA 3FN0L 4HU8A 1MJ8L 4APQB 4KQ3L 2O72A 4LLYB 5DZVA 5J3HC 3VNZA 2ED9A 4FQIL 1B0GA 2FX7L 5JHMA 5J6HA 4B3EA 3QXUA 3BE1H 3LPOA 4DZ8A 3ULUE 4GXFA 1UA3A 1I82A 1QW9A 2PYED 1LMIA 4N0CC 3BJLA 3WNLA 1E5AA 1QKZH 5E8DH 2WPGA 2X1XR 1S7SA 4XB3A 4UQ3B 3U36A 3FUFA 4B5EA 2E4FA 1F02I 1M9SA 4YDLB 1H3UA 5D1XB 3WNMA 1JPST 2ADJA 3L2MA 3BAYA 3BKML 4BGLA 2PCFA 1CUOA 1O7SA 2UZIL 3X1FA 1ILUA 3DDGA 4WTXA 4YSOA 5JXAH 1MJ7H 3PCYA 5T3ZE 5IEKA 3B2DC 4OI7A 1YPZB 5TE4L 1CG9A 2Q9OA 2BIMA 4RWYH 1UXLA 4U6YB 1V5JA 1WG3A 4ZAKD 2XSKA 4EDWH 1OP9A 2GK0B 3QC6X 3IKCB 3WLWD 2EABA 3S6CA 3G6AA 1N68A 3VW3L 4OM1L 2Z8SA 4Q7DA 2G60H 4FQ2H 5AAMC 1L3NA 2EYRB 4LCIH 3T6ZA 1DQDL 5JQIB 4JQXA 1QPPA 5I71C 1ZANH 4CU8A 1BQUA 1QHPA 1TJIL 4BDVA 3DGCR 5E23A 2WXFA 4HLZH 2R2HB 3LS5L 3VE0A 3TT3L 5FO9B 2JQMA 5C0CA 2K7PA 4UUJB 3CZFB 3HC4L 2OSWA 3QRGL 3WG7B 5A2JH 5GGSA 5IEHA 1J8RA 1Z3RA 4LOUD 2UZYB 3W9DA 2RCSH 1NLDH 3KPOB 5EUKA 5JIDA 2AEOA 1PZBA 4YDKH 2VLKD 3ULUD 2OK0L 1YZZA 1L9NA 3U25A 4P23D 2VN4A 4P5TD 3ZYIA 2NY2D 4AEEA 3I75A 1XB6A 2UY6A 4U05A 5FA4A 4KK6D 2WLIB 3O3DB 1FH5L 3IE4A 3QXDB 4MMYB 2E7CA 2NUPA 3DBXA 3UBXB 1KCSH 1RJCA 4WU7A 3US0A 5K5YA 2YPVA 4JDZA 5T3ZD 4TUUA 4A1RA 3VD9A 2PETA 3BKCL 5E70A 1MWAH 1ZLVK 4F5CA 1LE9B 5AW4B 5E6IB 3RUGA 1MREH 3RBGA 2WXKA 3GSOA 3CFCH 2FHCA 3NZ8A 4KXZH 3V5DB 4PP1D 4AZ8A 3N04A 5AAWC 3VTMA 1CGUA 4FI8A 1WTLA 4AIZA 1P4IL 4KKZA 3IAGC 3PWNA 1CMOA 2EAEA 4N2AA 4TQPA 4X6DA 3ZUNC 1FO0B 4JQXC 2YEZB 4C55A 1IFHL 3GGWB 1KLFB 3NSXA 1PD1A 3L4YA 3LN4B 4PTTB 4YX2H 2B77A 4HUKB 4X9YA 1RURL 3SDDB 4FYRA 3ZR5A 3MRIB 5ETUA 1P5VA 1IGJB 3GMQB 3FU8A 4M1DH 2OMZA 5A2KH 1H15A 3VYPA 3FMGL 2EDQA 1AKJA 3CSGA 3NAAL 4AOFA 3HZMB 2EO9A 4LARH 2VQUA 4H8WL 2KLRA 4D7PA 4IDLA 4E9WA 3NCJL 2P80D 4C56B 4KO9A 5AOZA 5HHVH 1YUKB 3N9GH 1VJSA 1WEJL 4BCYA 1QFUL 5KVFE 2WYHA 3UABA 3UG3A 4Z3IA 2V2TA 1JWMB 4ZZFA 1XH2A 2EDEA 2XV2A 5C92A 1HCZA 5DS8A 4JKWA 5E8NA 1S7WA 3UROR 4EE2A 2R2CA 4N0FA 2MQ0A 1GSKA 1Q9OA 1OB1B 2VR7A 4ZTEA 3NZUA 1VCBC 2FB4L 2H2PD 2OX5A 4WNSA 1AGCA 5CMAB 2X44D 2Q86A 2YOCA 1F1AA 3COOA 1BF8A 5HGGS 1D2PA 1UXWB 4YUEL 5EZIH 3RQ3A 3MA7A 1IQWH 4NYLB 3BO8B 5EOCL 3B4NA 5C9KA 2XVKA 5E6ZA 3GS7A 2IQ9L 3B3IB 4G9DB 4Y1SA 4ZDHA 2NY6B 5A16A 4Y4KA 2PXYB 4MD0A 1XGYH 2WXIA 3FFCA 3ZTJG 1ZV5A 3VVVA 5JDJA 3NSFA 2W9EH 1SXZA 1J11A 3DECA 4Z7OF 3K4DA 1X3DA 5IM7B 2AFNA 3H4FA 1WAAA 2R1WB 3CHQA 3MPCA 1GA2A 4QAWA 4Q4IA 3S3PA 5AB0A 3FULA 3W0WE 3L5WB 4Z76B 1Q72L 3FO9A 4IBYA 1UB6B 5EN2B 3RGHA 2F74A 3UZVA 3H3BC 3AC0A 1C5BL 1JV2A 1P0SE 2P8PB 3NEEA 3GXFA 2DMHA 1IKFL 2L0DA 1P2CB 4FQXD 2JKSA 4BUGA 1MIEL 2OP4H 2X88A 2R2EB 1OE1A 1TZHB 2Y7QB 5ACZA 1S7QA 3KCWA 5I6XB 1A7NH 2E8ZA 5GISH 2VLKA 5DQ9A 5T1DH 2VDLL 2DMBA 1HI6A 2IALA 2ENYA 4P23A 1UZ6E 2IOOA 5DJAB 5FA3A 2YBRA 4X6BA 3RDTB 3ZUCA 1TSHA 2KQMA 3KJ4B 3SQBB 1JF6A 4NPJA 3SYAA 3MTRA 1HL5A 3IEAA 3FFOA 1G9EA 1EZUA 2NY0C 3QULB 3VFTB 3CAFA 2EVJA 2IPKB 3K6FA 1TZGL 3T8XA 1XH0A 3VFNA 5GRXG 1BMWA 1FN4B 2KYIA 1KGWA 4O2CA 2ZOLB 3MOBH 4HJIA 4Y4KC 2EDOA 1H5BA 2CNZA 4ZQKB 1TZIB 5IESL 3L13A 4UQ9A 5GRUH 5I1GL 2Q7AA 1U8QA 3JTSB 3PWJA 4PJGE 5A6LA 1PGRB 4JO8A 4M6AA 4B95C 4YLQT 4H88L 1AZVA 1WJ3A 4J28A 2RAMA 1EANA 1A5FL 5EU6A 1L5GB 1JTTA 2NSXA 4BWWA 1N3NA 4OCYH 1J8HB 4AQAB 3K74B 3FAXA 4QWWD 5LNEA 2JCCA 2R4RL 3QJOA 2CLZA 1AJ7L 2AC0A 1M7XA 2X3BA 1FVDA 2H0EA 3N0AA 5MENA 4F1SA 1BGXH 4HCRH 1NFDE 5M94B 1A0QL 3ULVE 1PIFA 1NDTA 3MZTA 4RISH 5BQ7B 1B90A 2QLYA 1JL8A 2ZG2A 3AB0B 4DPAX 3VXMB 3R1GH 1J1XL 4OU3A 4TSBH 4NNYB 1HWWA 2GIYA 4ZZKA 3KEDA 4U6VL 9PCYA 1I8LA 3HA0A 1LJMA 4TNWF 1EZSA 1N0LB 3IDUA 1OE2A 3NCYS 2P49B 5EUOF 3ZTJH 4YSSA 1D5BB 4ZMAT 1DVSA 1UYWH 3IDYC 4KO7A 3UG5A 1H5BC 2OW7A 5E0QA 5J7CC 4J3UA 4NQVB 1RMFL 4OCWL 2J6EA 1S5IL 3B6SA 1NLBL 5FKAB 3MXVL 3SODB 2R0ZL 2WVUA 3NCFB 2ITEA 4KHXH 5D8JH 2IPUK 3TYFA 4NUPA 1DZ0A 4MJIE 2G2RB 3P2BA 4LSSH 1KCVH 1YEGH 3QORA 1QLEH 3E8UH 1XL6A 4G7QB 1MEXH 3WNNA 2B59A 3ILQC 1E9PB 5I1DA 2VN3A 3RX5A 3SE9L 1XCQA 1GVIA 2AMUA 2DDQH 1DQJB 5EIIB 1A4CA 1K3ZA 1RK0B 1HVXA 3MGAA 3ZMEA 4UDUA 5CM1A 4WO4A 3BUBA 3VWKA 1C1EH 4RX4A 2I24N 4AYSA 3G9AB 1DBML 5IB5B 4BSVB 1EGJL 4U4IA 3LIZH 4NC1C 4UT9L 4XBGA 2PTTB 5JW4M 1A4JA 3BIKB 2N3JA 1IGFH 4UIKH 2NY3D 1P5UA 3GS4A 1S4IA 1VFBB 3GPSA 1JWSA 1G7PA 5IVZA 4WSKA 3TVMD 2CHXA 5E9DD 3MX0B 3GK8L 5FV2A 4KU1A 4A7UA 3CWGA 2JJSA 3IWUA 4FQXA 2AV1A 4KOCA 1QZNA 1W72A 4PSRA 3O2WL 3GDBA 3ZT5A 5IHLB 4NZUL 1DJIA 4JG5A 4XH2A 1YEDA 3N3EA 1EAPA 4AEIH 2NNRA 3I84A 4NIYE 3DX3A 4P9ML 5FOBA 4K94C 3HI6H 3E3QC 4J1UA 1CFVH 2ZWNA 3PHQA 1YMHB 3QORC 4JRXE 5GGRY 3RTQA 3LQMA 4QXGH 1KENH 4MJID 2ZAGA 1ZXKA 4N2GA 3SDAD 4J7RA 4F20A 2DYPB 2IAMA 5BW7A 4XZUB 3PWPE 3GXPA 1DSFL 4FZ8L 5AB2A 1U2CA 4W93A 3DTUB 4W6XB 2HLFC 1MVUA 1YEFL 4WO4C 4IBZA 5EFIA 2WLYA 3VWKC 3S2AA 3FUHA 2Y6TE 3QAQA 2YMOA 4O51B 2VWEE 3LSOB 3IN0A 2CBQA 1RUKH 2XXMB 5ID1A 4WLCA 4OLWL 3F7YB 1Z66A 1P5UC 4M8UA 3GMLB 4ZX4A 1V7MH 3MRHB 2PPAA 3ZRSA 5T3XH 5H35A 1EX0A 3LMJH 1N8ZA 3V6FA 3HE7B 3MUZ1 3LHPL 4I1PA 2V0AA 2N0MA 1WFNA 4BQBA 3NFSL 1Z9SB 4A63A 1ZE3C 2IXQB 5E8EA 2FUTA 1Q0EA 4X7TB 2BSRB 2NOYA 2Q10A 3LS4H 4UTBL 5IFAL 2Y7MA 3FT2A 2CJTA 5J1AB 3P2TA 1YQVH 4LSUL 1ACCA 4H13C 1BF5A 3IJSA 2DWEB 2Y36H 4AGOA 5A6MA 2GTZA 3RTQC 3BPNC 4MJ5A 4MRBA 5JTWA 2QQKH 4LEXL 3KNBB 5IUSA 3BIAX 3JUYA 4QXWA 2IAMC 3HHMA 5BW7C 3ZTCC 3GKWL 4JRXD 2XDHA 3PP3K 1MW2A 5DVPA 1NAMA 1T1WA 5KVGH 2VXVH 1RUAH 5AVWB 4EIZC 3UTTE 3PWPD 1MJ8H 3PABB 1XGPA 3BGMB 4KQ3H 1E4KC 4PPTA 4LCYB 1X7QA 1ACZA 2OZNA 1BIIB 4FQIH 2FX7H 3PGCA 5J89A 3X3FL 4M62H 2J3SA 4PBDA 1ZIAA 5CWSB 5DRNB 5AVYB 1DJWA 1WGVA 2HH0L 1ZLDA 3AVEA 1WUNT 2AV7B 5AVSB 3I6SA 1YY8B 4DKFL 3S5YA 2P47B 3DRTA 2RR3A 2CKBB 2FL5A 2Z31C 4BZYA 3LHAA 3NRQA 1TEFA 3BKMH 4M3JA 2JJUA 2AEWA 3D85D 3A6BL 4PRNB 1FPTH 4G9FB 3UGUA 4P99A 2UZIH 2J20A 1MCOL 3QH3B 1FFPB 2XG4A 5AL8A 4F37F 4PJAB 2GITA 1PJ9A 1S7XA 4JG1L 2GFBA 1MH5A 4LVHC 4ONHB 4AMKL 2IV8A 3X13A 3V0EA 3TVMA 2WUCL 4FKKA 5E9DA 1NEZB 4WEUD 3VW3H 4K8RL 3BWAB 2R0KL 4OM1H 3I9PA 3ZQXA 3ZIYA 1S7VA 1BQRA 4JRYA 4AYFB 1T04A 1X5KA 1LEGA 1SF3A 2CDGB 3EW3B 4P57A 35C8H 3Q9QA 2B20A 4NBYB 3UTTD 3TT3H 4CADA 3EG9B 3HC4H 3QUKA 4Q6KA 5K33A 3L7EB 5HDBE 3RHWK 1OAKL 2BXZA 4DGYL 3MBEC 3V4PA 4WW2F 5K9KA 1G6RB 1EK3A 3B9AA 5EBMB 3EFFB 3KR3L 4MKTA 1T1YB 4QMEA 5MEPB 4MNQB 4GSDL 1WH0A 2N7SA 4POZC 3SCMA 3U48A 1KG0A 5IMLB 3GZKA 4PQXA 1BWMA 1D5ZA 1BZ9A 2OW6A 4ZUVA 1XF2A 1KLGA 1KPUA 3S35H 4HJJH 4XVTL 4TQHA 3T0XA 4XHJC 3CDGA 1AHWB 4HH9B 3V0VB 1EBAA 4LCUB 2DM7A 4EZMA 3NPSB 3MA9L 5CD5D 3EDJA 4LQ1A 2VR8A 3ZTEA 2CLVA 3BZEA 2UVEA 3LEVH 1E6OL 3QQXA 1IQDA 4OLZL 4HUNB 4ELDA 3QFJE 4K71C 4Q0XL 5BRQA 4OZHF 3X12B 3ZTNL 1PIGA 2FK9A 1EAOA 1H8NA 3U2IA 1WGOA 3A3YB 2L7EA 4QHLA 2ARJA 1M1XA 3O8XB 4WTZA 4RDBA 2L7QA 3F62A 4TLTA 1P4IH 1I3RB 2F6AA 4JG9A 3AITA 2N1TE 2DYRB 5I9QB 4NO3B 4HEPG 2XWEA 3TU6A 4ZTOL 2C7UA 3NQIA 1IFHH 4ACPA 1DN2A 4EN2A 2EVIA 1GZHC 4JKNA 1RURH 4G8GD 5FECA 1FL3B 3U6RB 1OHQA 4M8QA 1CU4H 3IU3B 4UYQA 1FFNB 1MWOA 2OS7A 5HGBA 3SCMC 2WKOA 4JRXA 5MHSE 3GJEB 4Z7VA 3NAAH 1PPIA 4UCFA 3VGHA 3VI4E 4WWKB 1E4HA 3H9HB 4PLJC 2Z8WC 3V9CA 1INQA 5C0NC 5CP3A 4PS8A 4PJBE 5BZDA 3O4LE 5D2LB 3VXSA 2C4FT 3FKUS 4WI6A 5DGRA 3O9WB 4DQOL 1JDAA 3BAEL 2IADB 5TDNB 2ROXA 3ARBD 1W0VB 4FXKB 3WIIH 1YY9D 2CBMA 4G72B 4RGNC 3T2NH 1EIBA 3PJSB 4PS4L 1QABA 3OGCA 1LE5B 1EEQA 5E4EB 1CICC 5EO1B 1T80A 3MLUL 4QJ5B 2FB4H 1WV7T 3MFFA 1JAEA 3QFJD 1UGKA 4AW4A 4X4KA 1E7VA 2QKSA 4Y2LA 3D85A 4IJ3C 4LDCA 4IK6A 2YR3A 1VAHA 1M9WA 2X05A 2QADC 5F7LB 4LLUB 1S9XB 4F2ME 2HFFB 2MH4A 2A6JA 2IQ9H 3DXAA 4XNZB 3C8HA 4PFEA 2B1AL 4HWBA 5LXVA 3CSPA 5AOMA 5C7ZA 1TTAA 3MLRL 4NKMA 3UPAA 3G7TA 4PJ9D 1SN2A 4G6ML 4LZKA 4W4OA 5SV3A 3OKOB 3CN2A 2J8OA 4JHAL 4R7XA 5LN8A 1R6VA 1CLZL 1TPXC 4NP9A 3ZBMA 4MJJA 4RFEB 3SE4A 5MERB 1B6UA 2K3HA 5LAXA 5CKGA 3RPBA 4XX5A 4GXUM 5MHSD 3VFRB 4GAAA 1Q72H 3UO1H 3ATEA 2XVBA 1N59A 4L9LB 2KLSA 2VDPB 3EUDA 4W6WB 4WZ9A 3MLYL 2F1EA 3MRJA 2PPCA 2WJ7A 4DWHA 1IKFH 4GP5B 4NQEE 3O4LD 4KKAC 4ZO8A 3TF4A 1MIEH 2IJ0C 4C47A 1ZTMA 4KY1L 3QIBD 3M17B 3U82B 3AXLA 2OM5A 2E4TA 1AI1L 3GDCA 3NFNA 1KBGH 1AE6L 2VDLH 4F3FA 5J13B 3QDJD 1QTPA 4W9JC 1KXHA 2YUZA 4JPKH 4LESA 1K2DB 3UG4A 3DMMC 4NJAL 2XQYA 2WCSA 2VJ8A 3MO1A 5JLZA 1CDYA 5GSRB 5HVGB 3NIGB 4Z95H 1YNLL 4R96A 3TYGL 5D7KD 4C4UA 2C9RA 2WAHA 1TZGH 4Y9FA 4RWHA 4TVPD 1UJ3B 4NQCE 1UD5A 4H5SA 3PWUB 1T66D 2IC2A 5E4AA 5HDRA 2AZUA 2B5IB 5EU4B 5I1LB 4JO1L 5IESH 4W4OC 5G55A 1IC1A 4PRHB 5I1GH 4XH2B 3MRBB 4GW4B 4M93C 1PNCA 3X14B 5D7LB 1NBVL 3SJVD 3KCPB 2B4CC 3O3UN 5F1IB 2DAVA 4H88H 3LZFL 4WKZA 5F0JB 4A66A 2UYLA 1RZ8B 1GXEA 1MAKA 3K2MC 1EAQA 1HINL 2YUVA 5LGKA 3HPJA 3CFKA 4Z5RB 1ZA6A 2GVYA 5AENA 1RI8A 3I3DA 2R4RH 4G8GA 4KRPB 2FLBT 5KVEH 1AJ7H 2G3MA 2VDMB 2VAAB 3HZ3A 4AQ1C 1RZPA 4HKBB 4LBEA 4M3KB 4U0RB 1OP5K 1RFDL 1SN0A 3SPVB 5BRZD 5GZOD 4IRJC 4PJDE 4ZFZA 1URIA 2A9BA 3SKUD 3N1QC 4Z7WF 2NYKA 4GQZA 4L5FE 2FO8A 1J1XH 4OCXL 2P8LB 5L7XL 3JV6A 2CXKA 4U6VH 3BSHA 1FFOB 4XCYB 4YO0A 3KBEA 2YGNA 5TQ2L 2W0LA 3X17A 5CIPH 3FBQA 4OFYD 4Q97A 2AI0L 4TPRL 1K5NA 3K2KA 2DLIA 3HG2A 4TL5A 4K3HA 3KH4A 1NBZB 2FH8A 3UDWC 2O6PA 3BDYL 4MXQD 4NRZB 1RIUL 2CZNA 3HBPA 1RMFH 1WVZA 2AJYL 2VC2B 4PJXF 5J9PA 3CFUA 4NQCD 5E4IA 3MXVH 5HVHB 2EIJB 3C08L 4RIRB 5KSUB 3ESOA 1FORL 3V0DA 3MJ8B 2ENQA 1SHXA 4QXTA 5IREA 2WQVA 3C9NA 3MRQA 3D48R 1EXHA 2FECI 5ABZA 1J9RA 2EECA 4X9HA 1PMYA 3TBSA 4F7CB 5CBAA 3PJLA 1DVXA 4WHCA 1BQSA 1UOVA 4A7TA 3PRZA 1XX9C 2QZQA 3ULUL 4U0QB 4LRNL 3M86A 3KYNA 2X3CA 4IRSA 3WE6B 2LU5A 4Q52A 4OF3A 2XTJB 1Q9LA 2FJGA 5FUOL 1WC7A 4YHMH 1WBXA 2B7DT 1FJ1A 4G6AC 3WNJA 4I48A 3QCVL 2BW5A 1MJJB 2JKJA 2XETA 2ZUVA 1G0DA 4PMFA 1EGJH 2OI9B 3UTSE 3UYRL 5KYUB 1IB5A 3OMIB 3CFDB 3PWLA 1N6VA 4K7FA 5T3ZL 1RK1A 1T2JA 1N5YL 4HK0B 4IU3A 1PG7W 3BPCA 3KPPB 3QQDA 1WZAA 4DVBB 4A68A 3WUWB 3LKPA 3GK8H 2ALAA 3EYVA 1OD9A 3O4LA 3MGTB 1HIML 3IDJA 4Z7OB 5C8JB 4MAYC 3T09A 5KTEL 1BM7A 4NZUH 5L2KE 4IS6B 1M05A 4U6HA 2C1OA 2QL1A 2D2CC 3QDJA 5HGHA 2PW1B 4WEEA 2R8SH 1X5HA 4PG2A 2VR4A 2CALA 2HKAA 4X98B 4XVOA 3S37L 1KJMB 4XCEA 2F2HA 5F7EL 1BIHA 1BD2E 1NCDL 3D9AL 2UV3A 3MUJA 4YN3A 3JV5A 3QPKA 4BFGA 1RZJH 1OP3H 2XBDA 1Q38A 2QGEA 1NFAA 1RUQH 2A73A 3FQRB 4PJEE 4XWGH 4Y9EA 3RDJA 3P02A 1LILA 1ZMYA 4I77H 3HZKA 4OCSL 4Q6IA 4IRSC 4FZ8H 1LWJA 5KWYC 1KFAL 1T4WA 2CXGA 3BQUC 1XMWA 2DWXA 4BSJA 4HUMB 3WKML 1HYSD 3ETSA 3P9LB 4WHYG 2OMWA 3IRCA 3EJZC 3BC9A 4LE8A 3SJVA 1VDGA 3FB7B 2E56A 4YXHH 1LHZA 2HJLA 1ETZB 1DQTA 2ZP0T 3UTOA 3UTSD 3MBWA 4BH8A 4OLWH 2WVVB 3NBNA 2EC9U 3EJRA 4ZT1A 3U7YH 4XMKH 2ATPA 4FNRA 4PRIA 3GSVB 5EZOL 3N1FC 4FNPA 3TTYA 3NFSH 4JKPL 3RB7A 3VXQA 4NN7C 2WOYA 1IM9A 1CLCA 5BRZA 2X42A 4OLVH 4UTBH 2AQRA 1WWBX 1AXSB 1K4DB 1ZLEA 4I2XA 5E6RB 3UAJA 4PG2C 1ZTXE 2ICES 3PE9A 2CO7B 4LSUH 1GGIL 4ODUB 1BZ7B 3RNKB 1M7DB 3NUKA 3DARA 1BOYA 3K1DA 1XTMA 3AQYA 1LO4L 3D05A 4KK9C 3QDGE 3FB5B 2E75C 5DDHB 2X6UA 4Q9BA 1BD2D 1BQHA 2AP2A 3GKWH 4XNMA 2L3BA 1MFDL 4PIBA 5EH1A 5B38A 2ZKMX 1ZLWH 3NT0A 3CZGA 1EDQA 3C09C 4M7LL 5LBSH 2CSPA 3KGTA 3UYOD 3TO4D 4AK1A 5I0YA 1TETL 1VEMA 2E0PA 2E9IA 4N20A 4GRLA 2NY1C 2DV6A 3KWUA 4ECNA 2W81C 3QJFB 5KSBE 1CD8A 1U3HB 2NLJB 2WXJA 3DYMA 5B1BB 4FI6A 2HH0H 3TZVA 3MJWA 5CJQL 2BCKB 4P46B 3SGKC 3OD3A 4DKFH 4TRPL 1G7QB 4MB5A 1J0IA 2LVCA 1U92A 3Q7JA 3ZYOA 5IGXL 3TBTB 5DK0B 3ARGD 5FO8A 3WBDA 1ACYH 4H1LG 4KVPA 3CVCA 5DRWA 1IBHA 5FUZH 1N5AB 3UAJC 2DWTA 1CF8L 3P4NA 1SRDA 2QMKA 4CN6A 5F3HA 3PHOA 4JG1H 4RLDA 1UXMA 4HS6B 1QBAA 4YS4A 4AMKH 3ALWA 4AENA 1BREA 2Y23A 2B8OT 3R7QA 1LO0L 4WHYH 4K8RH 1MJUL 3TBVA 5J11B 3MRCA 3BKJL 1CVRA 3QDGD 2OJZL 1CWVA 3SN6N 3BH9B 4CU6A 3EGSA 2F68X 5LXGL 4GRLC 1P9MA 4TNEA 2F53A 2QDWA 4HOMA 1MFCH 2H3NA 3V4VB 4ZFOA 4OJFL 1HNFA 5IK3B 4XXDA 3TZVC 2WIIB 3FFDB 3N42B 2H26A 5T1LD 2G5BA 3KPNA 3VG9B 4ILDA 4ZD3L 4RA3A 1S9WB 1WBYA 3QEHA 3JWDC 1IUZA 2MPVA 1RKRA 1KC5L 5BNXD 1GPOL 3KHQA 5DQJA 5KS9E 1UQSB 3EH4B 3HC0A 4XVTH 1CE6B 5BZZA 4ELME 1XWVA 2B2XL 2BP5M 4OLXL 2XFGB 4NHCH 2AJVL 4U1JB 3ZR6A 3P1VA 4GG8B 3ZO0A 5IOPB 3GRBA 1QTSA 1TEGA 3HE6D 5BJTB 1E6OH 4OLZH 4ZNCD 5ECGA 2D3NA 4G7YH 1CTMA 1RXLA 4Q0XH 4NQDB 3I50L 4APQD 1CFSA 1JHTA 3EJYD 1L9QA 3KDMB 2DI9A 4HUUA 3TF7C 2WP3T 3QB7C 2HPTA 3NFPB 3QUXA 3BZFA 4PRDA 5HPOA 1UASA 2G0KA 4JE4B 3MJ9L 4P2OA 2NY4D 4Y16A 4U1IA 2P42B 3B3BA 3HC2A 4AYID 3DVNB 3HUJA 4LLWB 3DSNB 5JR1L 4HXBL 1KN2L 5DVOA 1KACB 4DHLA 4U3XA 4LIQE 5ANMA 3Q13A 4H1LH 3W56A 3OG4B 3L5IA 5DD3L 3DTXA 5DI8A 3SZKC 4A2HA 3MOAL 4HJ0C 2FR4B 1P7QD 4DIXA 4KRNA 3PNWA 2Z7YA 1IIKA 3JTTB 4EIUA 3ULVL 1XF3A 1AGBB 3K7UA 1PBYA 1HKFA 1T21A 3EDEA 4HFWB 2ZSVA 3QWRD 4KROC 4N0UE 4KK8C 1PJWA 3I9IA 5BV7L 3I9GH 1JGVL 1SJHB 2XG5A 5T1JA 4AM0A 3ZQ9A 2R1XB 1KTLB 4A7VA 4LHUB 5E6SB 4FG6D 2WWKO 4PD4J 4E9YA 3ETTA 2BHUA 4FJ6A 5B3JE 1UWFA 1EO5A 4A2MA 3C6LB 3CV5A 5IKCA 4LHJB 4W9CC 4NFCA 1HCFX 1YJDC 3VCLA 4R7DA 3QUXC 3QUYA 1X5FA 3T0DA 3FYIB 4YXLL 1AP2B 5DZOA 1UD6A 2BZ7A 3TIDB 2P45B 3D12B 4HAKA 4P2OC 4Y16C 5AD0A 3KWVA 3NG5A 4QKXB 1OALA 2B1AH 1TYRA 4X6CF 4WVRA 4WFGE 4EN3D 1IKOP 1DVTA 1WA0X 2JQAA 3EO1A 3HS0A 5T5FA 3VH8A 1YO4A 5ITBL 2VRKA 3VXUB 1W2KT 43CAA 4JHAH 3LCYA 5H94B 3ZL1A 3D39B 3P73B 4I3SH 3QDGA 5D5MA 5E56A 1O6SB 2JJWA 4DGVL 4M00A 1MCEA 1RUMH 4U3SA 3MV9E 4BYHA 2VE6B 2DWDA 2J1ZA 1K8DB 2GPZA 4L1TA 5TPWL 2XTLA 2Y9RT 2OSLB 2WM0A 5F7BA 1ZLVH 4K55A 5CR8A 5F1OB 1KGXA 2AXJA 3LH8A 5KYXB 1SUHA 2ZOWA 3VRLE 3F5WA 4JZNB 1R33A 4J6RH 2AJ3A 3UZQB 3IJEA 4JVWA 3KVPA 3FSZA 4JZJA 3OMAB 1AE6H 3L3DB 3U4EB 2CHZA 3PREA 3QUYC 2ODIA 3SDDD 1V3JA 2JE8A 2VT0A 4NJAH 2R56L 3EF7A 1HZHH 3L4WA 3IETB 1XB8A 1YNLH 1MCFA 2NSMA 2XZCL 1MFEH 4PMEA 1WS8A 4ANVA 25C8L 3FO0H 3LZLA 3WEXB 4WW2B 3TS8A 4HKXB 3U0WL 3HS0C 1AGFB 1MFBL 2H9GB 1KELH 3B7YA 4JO1H 4APQA 4LLYA 4L8SC 2G3NA 4C56D 2D7NA 2VQTA 4WFGD 4V33A 1IAII 2BY3A 2ZONA 4K3JL 4OQTA 4AG4L 2Z34A 1KT2B 1GAFH 4S0SD 2R15A 2JI3A 3M1BB 3UTPE 1MWAB 3ZZQA 3MV9D 4UQ3A 1VIWA 1CVSC 4XOCA 3OX8B 1C16B 3DKHA 4R90L 3D33A 4OZHB 5D1XA 4DKAA 5GGSY 4PGEB 4DOHB 2F54E 4KV5F 1UM4L 4LDLB 3E9UA 4PCKA 2EDJA 1XTLA 2ICEB 3P3YA 1YPZA 1WA2X 4N2BA 3AROA 4OCXH 4IU2B 5AG8A 4HP5A 2GK0A 3IKCA 3EF4A 3LQZB 1KB9J 2ZCKL 3NIFE 1YNTB 4X7SL 2FEJA 3MV7B 2AJUH 4TPRH 1T2QL 3QUZB 4GIPD 2V17H 4DETA 2EYRA 4JS7A 5PAZA 7FABL 3X3GL 4JGMA 3C08H 4K07A 2IPUG 1FORH 2Y69B 2R2HA 4DJMA 5FO9A 3RZCB 2VSCA 4UUJA 1XH1A 3CZFA 1T5XB 2E7BA 2FJUB 1KCRH 2WUBL 5I30L 1CYWA 2UZYA 4LB8A 3KPOA 1M1SA 2LU7A 4XWOC 4LDOB 3VYOA 4QHKI 3ULUH 5DLML 4LRNH 3SQOH 5FS5A 2O6FA 4MA8L 2FO4B 4HK3J 3UTPD 4CGTA 3F7LA 1JFQH 4DO5A 5D1XC 1JBJA 3NABL 3RVVC 2WXRA 5I6PA 3RDTD 5LBVA 3CLEL 3AWEA 1G9HA 3EYSL 3MJ6A 1MCKA 2WLIA 3O3DA 1DDTA 3QXDA 3QCVH 4H44C 3UBXA 4UWQB 5JHLA 2F54D 1FAKT 3P4MB 2VXTL 4G6KL 4PV1C 5DUBB 4E9XA 1JN6B 3MREB 2E59A 5T3ZH 3S35X 1FFTB 2WLNA 1N5YH 3FU6A 3WS6C 1WD8A 4GY4A 3DHUA 4E41E 1WK0A 1LE9A 4NOFA 4DUWA 5E6IA 5FLVA 3GINA 4WK2B 4MCYB 3QWOB 4P3DB 4XN9A 3V5DA 4TSCL 1IGYB 4X5RA 2YZ1A 3EYFA 4NPYB 2NY7H 4X9FA 4X9IA 4XC3L 5CJ8A 3WHE1 1FO0A 5KTEH 4MYPA 4ZS7H 2YEZA 1BJMA 1S7TB 2Q1EA 1RIHL 3WNPA 5GS0D 1KLFA 2TSBA 4PTTA 3LN4A 5JW4Q 3SDDA 2X9WA 4EUPG 1I4FB 3MRIA 3Q6GL 1IGJA 4HZ1A 3GMQA 2AMGA 2ZOUA 1YYML 2VJ0A 3MLPA 3VXMD 3SOBL 1DEEB 1KFAH 2B16A 3HZMA 1QACA 2I5YL 3L5XH 5SWSB 3V10A 4LQFL 3WKMH 4C56A 1EJ8A 4ALAC 1T6VN 4KFZC 2EILB 3KXFE 3VTAA 1H8OA 1DVQA 3FHEA 3ZE0E 3C6SB 2R0LL 3DHMA 3RVUD 3CU7A 1JWMA 3DJZA 5B22A 2BS9A 1TMCB 1CQKA 1KXTB 4M6OL 3RPIB 5I1AA 1W6LA 3IMRA 4UV4H 3ZZ1A 4F9LC 1NIEA 4U33A 5E6IC 1OB1A 4HHAB 5GIRB 5F96L 5CMAA 5L88L 1KY7A 4AYGA 4JKPH 2F19L 4GAYB 4E41D 1F41A 4N8PA 1WS7A 5DWUL 2AITA 4M1CC 2J73A 1PG7L 4EKJA 1UXWA 2Q2EB 3IRZA 3ESPA 5AVRB 3BO8A 3NACL 1T7WA 3H4HA 4HPYL 1OAJA 3GO1L 5F6IB 3JZYA 5IHWA 3B3IA 4G9DA 1GGIH 4ERSL 1JMZA 2PXYA 4BWUA 4HUWB 3HN3A 4XN8A 1LO4H 2HXAA 1A6AB 1YEEH 4NC1E 3UJJL 2G9HA 2PWEA 1D7FA 1MFDH 5IM7A 4N8VB 4KZEL 2R1WA 3AREB 3FQ1A 1JPGB 1JRHI 1O7VA 3ISRA 4S1QL 4D0BB 1E5CA 3L5WA 4Z76A 2F1BA 4WWNA 2WAQA 3FB8B 1AR1B 3LD8C 4L1LA 2HX9A 5EN2A 3B7RL 3SPHA 2E7LA 3IBEA 2P8PA 4HC1A 2MPAH 3E2HB 1F2XK 1KZYA 4A7QA 4ZSOE 1P2CA 1QSFE 2VZ1A 2D03H 2Y7QA 3KXFD 2R2EA 1TZHA 1OV8A 1W72H 3UJTL 3WMSA 5KVFH 4PRAB 1VEPA 3E3QE 3QRLA 1Y6MR 3GBLA 4IOFC 3MRPB 2E7DA 4PJXB 3TCLB 5IGXH 3FT3B 3RDTA 1SF5A 3CC1A 5IBTL 3SQBA 1QLEB 4OI8A 4EUPH 1HHIB 5FGRA 4FA7B 4JFYB 1M2OA 4E9RA 3QULA 3VFTA 1YA5A 4ZO7A 4DP9X 2IPKA 4B9ZA 1QA9B 3ZPDA 1FN4A 4LO9A 2VH5L 2B9AA 1HCYA 3VD2A 2NY6C 3LKOB 5D1QB 2PXYC 5F7DB 3EADA 3QJTB 4M3HA 2DMKA 4ZQKA 3UP6A 1TZIA 2IH1B 3VO0A 1HAWA 1T4KB 4JFUA 2A9NL 3V7AE 4QRSB 1LO0H 4XX1E 1MJUH 2YLKA 3JTSA 4FCHA 3VD0A 4FHBD 1QQDB 2ZIDA 1L5GA 1UD2A 1XDTT 1ESOA 1J8HA 2E7LC 4AQAA 2KERA 3GMPB 4YBLB 1CE1L 5K9QI 1MHHB 1AQKH 2FH6A 1R5VB 1I3UA 3PDDA 3MV8E 3OR6B 4L0PB 4D9QE 3OC8A 5BQ7A 3B5TA 4X7DC 3VXMA 1H3VA 2CUMA 2A3TA 4B60A 3ARVA 4TUOB 4P8QA 4F8OA 4RMWA 4HKJA 4NNYA 3HVNA 4P5MB 3UP1A 1XH3B 3AXIA 4Q58C 2B2XH 1C12A 1VFUA 1BZQK 4IKLA 1N0LA 3F7VB 1WF5A 2AJVH 4NKQB 4Q56A 3ZL2A 1D5BA 4O02B 3ZY7A 4EI0A 3GT6A 1SDDB 4HWUA 3PP3H 4WGWB 4XVSL 1ZV9A 3BPOB 3BMWA 4M9PA 1Z5LB 4NQVA 5DMGC 4LPYA 1L0YA 2WBXA 5FKAA 3RGBA 4GAGH 4XPTL 1X5MA 5BZWB 3ZX1A 5JIKA 2R0WL 2G2RA 1FZJB 1DHKA 2P3YA 4MNQE 5JW5A 2ZWKA 2EE6A 1EFXB 5DD5L 1G7JB 3RRQA 3GM8A 1HWGB 1KNOB 3B9EA 1G0YR 1OSPL 2DRUA 1E9PA 5HBBA 1CXKA 1NCWH 4YHZH 1MW1A 3WSQH 1DQJA 5EIIA 1NCBL 1HILB 1RK0A 3QZMA 4HXBH 4LCWE 4MJ6B 5DZLA 3GNML 4N8CL 4PG9B 1G7LB 4KNUA 4OCRL 2MMXA 2YEVB 2YSSB 3KPSE 1U8MB 5EC2B 5IB5A 4BSVA 2AVFA 4QO1B 4ZMVA 3ULVH 3MV8D 4JY6B 3TA3D 2ICWB 4D9QD 3V9FA 5H4ZA 4U3HA 3MUGB 2PTTA 1SN5A 3AU1B 1KMGA 3ZTDC 3BIKA 1J87A 4J6IA 5JA9A 5JHAA 2ZT9C 1IBYA 3QO0B 3DSFL 2XXFA 5AW3B 1OPGH 1JCKA 4A55A 3MX0A 1GOHA 1MCLA 3U2JA 1MQKL 5F2FA 3DETC 2YAPA 5K9QG 1SY6A 3MLWH 3RL1B 4W9DC 4Y4FB 4RRPG 4XVUC 1OCWH 3A4EA 4J23A 2WN3A 3CD4A 1S7UB 2CRZA 1F4WL 1CL7I 4LSPH 5I16B 3LXUX 4YXLH 4NEHB 1YMHA 1OGAB 3LRHA 4PRPB 1PLGL 5L4FA 2DF3A 1IGCL 1SPDA 4MNQD 2DYPA 1ZGLB 4XZUA 4HBQA 2P24B 5BRPA 5GS3A 1Z5HA 3G5VB 5D2LE 1GCFA 2ZTBA 5SWQB 4WSJA 2I60L 1JRHH 3HRZB 1GC1C 2XY1A 1GTFA 4XO9A 4FKEA 3GI8H 3OVUB 3DPBB 1NOLA 4H2CA 4KI1A 3L1EA 3LSOA 5TTRA 2CIIB 4DGVH 2UZXB 4ODBD 2PCYA 3MUY1 2DWSA 3UTZB 1AZRA 2APBA 5TPWH 3GMLA 3CSBA 1N4XL 3MRHA 2JVUA 1FZKB 2PCPA 1IT9H 3HE7A 5BUGA 5FB8B 3O8XD 1I7UB 4TYUA 1Z9SA 1T22B 3IDNB 2VDKL 4P4KC 1DZBA 2IXQA 4X7TA 2EUZA 3NCWA 3UO8B 1ACXA 3EFOB 5CJOH 1A6VL 3EOBB 5J1AA 2YA1A 1TFPA 3AT8A 1IE5A 4QIRA 3U1SH 2DWEA 1Z1WA 1FNLA 3LRLA 2NPLX 2R56H 5AKRA 2HJKB 4I1NB 1JHLL 1Z9NA 3KNBA 2MQCA 4JFFB 2X9ZA 2WQWA 2XZCH 2JKRM 5F0PB 5INDB 2F61A 2G2PA 4I13B 5D7IA 3BGFC 4FFZA 3U0WH 3N1PC 1ICTA 1Q0YL 5DYFA 5GRVK 2XU9A 1CD9B 3LN5B 1IEAB 3FF7A 3OLGA 3PABA 2IH8A 3BGMA 1E43A 3ESVF 4LCYA 1BIIA 1BYPA 4K3JH 4AG4H 2Z4TA 5HJDA 5TH2A 3DOSB 3DO7B 1MCRA 5DRNA 1LK3H 5CWSA 2CR3A 1VADB 3SIKA 2LHAA 2AV7A 2NX5B 3RI5F 4JMNA 2F5BL 2CKBA 4R90H 2IO5A 2CLRB 3NIGE 3S3SA 1SYSB 4OZGF 3QHZH 4PJHF 5JUEL 1YLBB 4BHUA 4PRNA 4G9FA 4L3AA 3L9EA 5DA0B 2XIDA 2NY5C 1BQLH 1I7TA 5CO1A 3QH3A 1U42A 3N1GC 4MZ2A 4ZW6A 4DESA 4PS3A 1XF5A 4PCTA 2EXWC 4FABL 3A4DA 5C6PB 4KJQC 4PJAA 1P7KB 4D0DB 5C86A 4OUUB 2C8NA 1RJLB 1FGNL 1ZTXL 2OMVB 4ONHA 4XNQB 5D7LE 2ZCKH 2D0FA 2AW2A 2DTSA 1HFUA 4MCZB 5CSGA 1PX3A 3MNWB 4LGRB 3BWAA 4ZUWB 1YEJL 2IFGA 1T2QH 2F8IA 5T1KB 2WTRB 3SKNB 4JGUA 1IGML 4UT6A 4AYFA 7FABH 3GMOB 5F7NC 1NSNL 2VXSH 2YFOA 4K23L 1JK8B 2CDGA 4FTDA 4G3YL 2H7WA 5FF6B 1UGNA 3L9RB 3IRPX 3ULUF 3EG9A 4R4NC 3HIZA 4YK4B 3L7EA 3VXTB 2WUBH 5I30H 1YEIL 1ODUA 1G6RA 5EBMA 3EFFA 1B2WL 1T1YA 1QD0A 4JY5L 1S7RB 5FYJE 5MEPA 2MQGA 5IMLA 4MA8H 1CLYL 1TSRA 4FFVD 4AYBA 4QRPE 5IUCA 3AU0A 3NABH 3KM2A 3EYSH 4MMXB 4BE5A 1CDHA 1AHWA 4HH9A 3V0VA 3KWXA 1G1KA 4ZI8A 4LCUA 1JYVA 1TO4A 3ARFB 4UZGA 1PAZA 2G30A 3MLZH 5JORB 5B8CC 5FDYA 3EDKA 1G4RA 2Y06H 3P0GB 2EDTA 5J4MA 3VMOA 2SODB 3X12A 3SE8L 1PS3A 4X6CB 1C7SA 4FZEL 4AJ0A 4AVIA 3WXVL 1UWYA 4E5XB 5J6SA 2A38A 3ZKMC 5D7LD 4YPJA 3O8XA 3Q9PA 1JZDC 4N0YH 1NFIB 3BISA 5IMMB 4XC3H 3HI5H 1CL7H 1I1YB 5BMFL 3KL3A 3NCYP 4NO3A 3ARPA 2XTJE 3K5RA 2P52A 1U6AL 4RGOL 4L37A 4W9HC 4GW5B 5D9SB 3QP3A 8FABB 5CS7A 1FL3A 3U6RA 3AT9A 3PL6D 5C0EB 4K3GA 3ATAA 1OP5H 3IU3A 4ZODA 3TLRA 3S3JA 1FFNA 2VDLB 1YYMH 4YLCA 1S9VB 3GJEA 2X1QA 4MJ2A 3SOBH 1ZV2A 4WWKA 4HDIB 3H9HA 3RVTC 1MW3A 5FYJD 4HJGB 4OF6A 4Z7AA 2AQNA 3H1ZA 4LQFH 3TEUA 1AHWC 3CXHJ 4DGUA 2DLEA 2VABB 2WW8A 3O9WA 2AJSL 3OZ9L 4G8EB 5TDNA 2IADA 1A66A 2YJQA 1W0VA 4FXKA 5DEGB 4DSYA 1U8PB 5D1ZC 4PBXA 1BJ1J 3MODL 4JJOA 3PJSA 2RACA 2MOGA 1LE5A 5EO1A 2X70B 5BCAA 5F96H 4HSCX 5L88H 1DVFB 2CM5A 4H26B 3K2IA 2F19H 4FRWA 5HI3C 1CTOA 4M9OA 1FZOB 5DWUH 5C0AA 5I9QC 1AXIB 2MWCA 2PWHA 2HRGA 1RY7B 4PJFB 5JOPE 3CCHA 4HPYH 4LLUA 5GZNC 3GO1H 4PS7A 2HFFA 4IBQA 4L0YA 4EEEA 3IFOB 2J88L 4M43L 2XTJD 1FH2A 3OSKA 4FLRA 2GJPA 4LIQL 4WWKC 4RFEA 3C60C 5MERA 4G5ZH 1GZPB 4S1QH 2VL4A 1NIFA 5CZXC 4K9EH 5IR1B 5IVNA 5CGMA 3VFRA 4YHPB 1IC4L 5CZRA 1XAKA 4YSEA 2WINB 3RWFB 5F21B 4L9LA 5IB3B 5DVNA 4B0MM 3KWWB 1CDCA 3O9WC 4NUGL 4JO2L 4JHWL 1JYXA 4FXKC 4UOW1 1QRNB 3W39B 3M17A 5GRWA 2HKHH 5E4EC 3P0YH 2EADA 3DGGB 4UF7C 2RHEA 2GBVA 3QQNA 2YXMA 1MY5A 3KE0A 5EBWB 1K2DA 4B9FA 2V2XB 2XICA 3V6ZB 5IBTH 4RFOL 3ZZLA 2DKSA 2A4EA 4M6ML 4LKCB 5DRXA 5GSRA 4BWTA 3H6JA 4FLHA 3THML 4AEFA 3QQ9D 1FYTE 5MEOA 1UJ3A 4XNZC 1WZKA 3PJNA 1N6UA 2JB5L 1EHAA 5JOPD 4XMLL 4JJHA 2QBWA 4D0CB 3HC3L 4QRQB 5EU4A 1A9EB 5I1LA 3L4VA 4PRHA 1OAUL 5E2UL 3RAJL 4MA1B 5DUMH 3MRBA 4GW4A 4HW6A 1JZ3A 3X14A 3BH4A 3KCPA 2DQJH 5EU7E 1ASPA 4G43B 5F1IA 1FC2D 3KPRE 3M45A 3MNVB 3CVIH 1RZ8A 5CEZE 2V5MA 2BHYA 2NYYC 3ZXAC 1ORQB 1DJXA 4B9KC 5CCKL 2VAAA 2MNUA 4QLRA 4WSGA 3FZUD 1X44A 5I26A 3LRGA 4WJ5B 2WWMD 5IW1B 5JO5B 1T5WB 2XFXB 3PP4L 2PW2B 1A3ZA 3SPVA 5KBKA 3BH8B 3DX1A 5GGTL 2QPSA 1F4YH 2H41A 5ICUA 1UZ6F 3DRQB 5L4JA 1KBPA 2JB6A 2P8LA 5D4JA 4PHXA 3U1PA 3V5HB 4YL9A 2FTAA 2J4WL 1FFOA 1T83C 3F64A 4GBXB 1MFUA 4XC1H 3QEGL 5ACMA 2XXCB 3CUPB 4HIXH 2ORBL 1HC1A 1UJ3C 2ZNXA 3STLB 5JHDB 4YR6B 1NOFA 4PUBL 4XVSH 3TV8A 1NBZA 2IANB 1FYTD 3PWVB 4I3GA 4NRZA 2B5IC 4U1LB 1PYWB 3WOVA 5BOJA 5DFWH 1D9KB 4RIRA 5KSUA 2IFFL 5FFLA 4PJGF 3MJ8A 2DQCL 3VJ6B 1C5DB 3MNZB 2R0WH 5DC4B 2B9BA 3QUHA 1BQKA 5KUKA 2YPVL 1U3HD 1MFAL 4B9IA 3HTLX 4F7CA 2EINB 2XQBH 4DFHA 2Q20A 2FSEA 1JGLL 4GSUA 3D6GA 3JWOC 4FNSA 1VGKB 1OSPH 4P46D 4ELKB 5J12B 2H0JA 4KRPC 5CEZD 2V8MA 3SZ6A 3WE6A 1NCBH 3GLDA 5TE7H 1NFDF 3GNMH 4U0RC 3ULVF 1R1CA 3SY0B 4ZW3A 3WKPA 1UVQB 5J56B 1MJJA 1OT2A 4XBEL 3SDCB 2K45A 1B4LA 3FQXB 5KYUA 1BG1A 3CFDA 1BVLB 1Y6KR 4QY8A 4HK0A 4L5FH 3DSFH 3KPPA 4V11A 1T89A 4HXAL 4DVBA 3WUWA 3ZKNC 1DJHA 2NMSA 5C09B 3R06B 3MGTA 5C07A 4BZ1A 5C8JA 3VI3B 2GAZB 1SHWA 3DIDA 4Y2NA 4IS6A 3RHWF 5HVHC 5JW4R 4XRCB 2ZUYA 4Z3EA 5HHOB 3ZDXE 4X98A 2NNFA 1ZJAA 2NCEA 4HWZB 3NH7L 1KJMA 4AQOA 1X5XA 5LAPA 3C12A 4J8RB 5C9JB 4EDXB 5AYUL 1PD0A 2HWZL 4L3CB 1PLGH 3KLDA 2GB2A 2WMPB 3FQRA 3U1QA 4Q9QL 2XA3A 1IGCH 2GTQA 3P30L 1IM3D 1EZLA 2AANA 2C7FA 4FTVE 4ZOEA 4CBPA 3GUTB 1NFKA 3OLEA 2IWFA 2G4EA 4GW1B 4JFHE 4LEEA 5KJ4A 3SDXE 4HT1L 4ICXA 1NIAA 3P9LA 2CPCA 1UKSA 2OI9C 3QPQC 4GAFB 5GJTL 3FB7A 1ASOA 4H25B 4PB9H 5C6TL 1ETZA 2FYYB 4DP1X 6FABL 1CZ8H 2X6BA 2W91A 3BLKA 1N4XH 3PY9A 4NQDD 1J0JA 5E2TH 1F6AB 4LLAA 4X4ZA 3GSVA 4A7GF 1KGUA 4S1DC 1KYOJ 1E28B 2O5NA 3B9DA 3QEQE 5CLWA 1F11B 4HZAA 4U31A 4UOZA 2EE9A 3OR7B 5DJCB 2NR6C 3TFKC 1L9SA 3DX0A 5HHMB 2A74B 4K2UL 4MXVE 2XZZA 4N9GB 1UOKA 1JG9A 3ZL4L 1A6VH 3CHOA 1AXSA 1K4DA 2BSCA 4X4YB 2K9FB 2YMXL 1WO2A 2CO7A 1N6QL 4ODUA 3NCCB 5ALBL 1BZ7A 3RNKA 1M7DA 1KY6A 2A6DB 1BQ5A 1Q90A 1U2HA 3NMEA 3RWIA 4OGQC 5D71H 4LOVA 2VXQL 3ZSTA 3INUL 3FB5A 2ETWA 1KGIA 5DDHA 2W1NA 1Q94B 3H9ZA 4AVKA 3FN9A 4MTMA 3KLKA 1UURA 1Q0YH 4LLMB 4I0PC 1MHEA 2OYKA 3WY3A 4ZOCA 3UBXI 3TA4D 3TWCH 3EIFA 4KMLB 4M7JH 3E6HB 2X2HA 3A23A 5EIVA 5DJXB 4JFHD 1CXIA 4N5EC 5AWNH 1I8KB 3QJFA 4LHUD 2NLJA 4TNWK 3Q2VA 1WIUA 5TDPB 3U9UB 4WK4B 2BCKA 3NYKA 4P46A 3RKDD 1TVHB 2JIXA 3PV6A 1B3IA 1G7QA 4IGBA 4ETYA 1W80A 1O6TA 2DMCA 3KS0J 2ED7A 2W38A 3TBTA 5DK0A 1X7TA 5D93B 1FVEB 2F8VA 5JUEH 1LK2B