4FFZA

Crystal structure of denv1-e111 fab fragment bound to denv-1 diii (western pacific-74 strain).
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
YVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
publication title Structural Basis of Differential Neutralization of DENV-1 Genotypes by an Antibody that Recognizes a Cryptic Epitope.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Immune system/viral protein
total genus 12
structure length 97
sequence length 97
chains with identical sequence X
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ffzA00
5AAMC 1Z3RA 5GZOA 3N42F 3N40F 4L5FE 5LCVA 5JHLA 3C5XA 4FFYA 3P54A 2H0PA 2JSFA 3N41F 4FG0A 5JHMA 3UZVA 3IRCA 2GG1A 1ZTXE 2JV6A 3J2PA 2I69A 4UTBA 4BZ2A 1SVBA 5KVFE 1OANA 5KVGE 4ALAC 1PJWA 3UYPB 1Z66A 5LBVA 5KVEE 4UTCA 4AM0Q 4UT6A 3N44F 5GZNA 1UZGA 2ALAA 2R29A 3UZEC 4UTAA 4AL8C 1OKEA 4BZ1A 5IZ7A 1OK8A 5LBSA 5KVDE 1URZA 3WE1A 3UAJA 3C6EA 3UZQB 2P5PA 2HG0A 3MUUA 3J27A 4GT0A 1TG8A 4GSXA 2JQMA 5AAWC 5H37A 4UT9A 1S6NA 1RERA 3G7TA 5IREA 4FFZA 5B1CA 2V33A 3VTTA 2R69A 4X42A 3N43F
chains in the Genus database with same CATH superfamily
1IGIL 4P2QE 5DI8A 3PPSA 1V3KA 2PLTA 4HZAA 5FYLH 4YMPA 1U8NB 4JE0A 2IADB 1BMZA 3KPMB 1SJEA 2XWJA 4J3UA 3C5ZC 1FFPB 3EYSL 4I5BA 3RWGB 1KN4H 3O6FC 2BIPA 4OF6A 4WDIA 3W1ZA 1XSIA 2B4CL 4HQQL 1OP4A 1KTLB 3P0GB 4B3VA 4PP1D 2ZYIA 4X8JA 2YD2A 2ADJA 4YSOA 5JW4N 3PGCA 4FTVE 2N4IA 2UUDH 3UMTA 1AZRA 3I74A 5DZOA 4JY4A 2WUCH 2X89D 3L3HB 2DB8A 4XO5A 3CFBB 1REIA 3VD1A 4L9LB 3PWVB 2YD5A 4GI9A 2PYEB 3BQVA 5EBWB 2BSED 4XO9A 4YXKH 1VFBA 3SIKA 4L37A 2ZCKH 5LN8A 4TQHA 4ZFFA 4HFWA 1DDHA 1HINL 4S2SB 3VXMB 2VITB 3UBFA 2D3LA 5C08D 4HUVA 3FCGA 2ORBL 2UZYB 5CZKA 5I1JH 4EI5A 1J1XH 5TDPA 3TA3B 4WW2A 4Z7QB 1QTPA 3IE9A 3B9KD 5FK9B 1Y1DA 2CUMA 3VDBA 1A6WL 2HN7B 4B7IA 3CXDL 4AWJC 1PLAA 3QEHA 3VXOA 4M61A 3ZMEA 5F3BA 1LDPL 4JM2C 2XRAL 1UA6L 4HMDA 1HYSD 3J8F7 1QTYT 1UB5A 5I73C 1QPPA 2I24N 5A2IH 2HG5B 3OLIA 2WLKA 5FHBH 2P7TB 2GSIA 3NIDB 4GW4B 4J4PA 3ZKND 3T6WA 1RUKH 4TRPH 1MQ8A 1VPOH 2PWFA 4QXUL 3OF6D 1S7UA 4EUPH 3BZ4B 3X11B 2J43A 2QKIA 3QZNA 5IF0B 1VFMA 2XQYG 4YC2B 1YYML 3VXME 2EH7H 4TNEA 2F2HA 4MB3A 4CNIB 1DQVA 1HXMA 5D7LD 1LO0L 2EDKA 1NCDH 2G3MA 1UWYA 4KRNA 3U48A 5C6WH 2EC9U 4DO6A 1UQSA 5FC9A 1L3WA 1G7IB 3EADA 1N4XL 2J2ZB 5I1GH 1CMOA 4YL4A 5ACZB 2JELL 2ZYHA 4FNPA 1I1CA 1OW0A 5IP4A 3IMTA 4YN3A 5DJ6A 1Y0LB 4KJPD 1PCSA 2QSTA 4TVPH 3UBXB 3ARGC 1J10A 3LKOB 4A7GF 4L4TA 3SDAD 3L3KB 2VSKB 3M17A 4GAJL 4GSQA 1UUNA 2WJ7A 1QWHA 1P7KB 4OM1H 1LK3L 4KK8C 1LTXA 1Z5HA 3GLZA 5D7SL 5I16A 4ZODA 2HJFA 3TNNB 1X5FA 3L17A 4MCYA 5CHNA 1OTTC 5C71A 5GS3A 5FYKU 3GIVB 1E9QB 4R90H 3TYGL 5JHLL 2DH3A 1RZIA 1BLNB 5DZPA 5I5RA 4TQEH 3UTTB 1PFOA 3U9PH 3ZYZA 3EJZC 1P9MA 3AADB 3EYVB 3ML8A 2NY0C 3D2UA 3HS0B 4N2LA 4NAQA 4WI2A 4P5TA 1SXBA 1MW1A 2ERJC 3QUMH 4YBQC 3RVTC 3FMGL 1CYGA 5CN1A 1FSKC 2I69A 2WLLB 2AV1B 3QA3B 4NI3A 3ZE1F 4K8RH 2QADD 1NOLA 1FNAA 1KPRB 3QWRD 5TF1L 1Q1JL 3E6FB 2ZUQC 3RNQB 4JQIL 5D7JC 4G43A 1VF5C 4RZCB 1LILA 4XMPL 1YAZA 3U79A 2CUHA 2XNAB 3HRZA 1MFNA 2CIIA 4PR5A 2BVOB 3UJIL 1JNHA 3C60D 3QUXD 1IQDA 4FX5A 4LDLB 4ZW5A 4O5LH 2X53A 3BLBA 4MNGB 3ETSA 2EXTA 4S1SH 1ZHLB 2Z9TA 4H5SB 3QXAB 3HEIB 1BGXL 1OTSD 1E28A 4P4RB 2K4AA 5EB9A 4HU8A 3V7MA 2VXUH 2MWCA 3FO2B 1PYWA 2ATAA 1GW6A 5I28A 3UBHA 4Y4FA 2NXZD 4G6JL 1FO0L 3UTTE 4K3EH 1EO8H 2LLGA 3OKEB 3VYNA 1CGYA 3ZTNL 4MD0A 2ZUUA 3FQUA 5MHSD 3MRGA 2Z92A 4NRYA 2C9UA 4LGSB 1AZNA 5EOQL 1YY9D 2P47B 5SX4I 4TUJB 5MEOA 4X7CC 4WKZB 5DSCB 1V7NL 5BUPA 1NGPH 2DQJH 5B38G 1LO4H 4HAFA 3HCVA 5EV7A 4AE1A 1THCA 4G8GE 4TLTA 4PB0H 1RK1A 4WVRA 3GO1L 4OLYH 4B9KC 2AITA 5E1IA 3IPBA 2O30A 1T21A 1TZAA 2XG5B 2XN9B 3D12B 2WIIA 4LIQE 4LSPL 2O5XH 1IM9A 2ZCHH 4MNGE 4N2MA 1DO5A 4O02A 1X7QA 1HH9A 1TPXC 3QDJB 5EZOL 1PZ5A 1MZYA 2PTTA 1MELA 4OGXL 3ZPDA 1IKNC 4GINA 3IJYB 3KWVA 2PXYB 3HG1A 4LQFL 3FB7B 4WFFE 5F7LB 4BV1A 3DUSA 1WCQA 3RX5A 3MGTB 4DVRH 2Z93A 5IVXB 4FCAA 3VH8G 3QIWC 2HX8A 3DRTA 2DAVA 1H3WM 4OZIA 2PTVA 2FWOA 4CMMB 4ZMNA 3BFQG 1Y6NR 2IH3A 5JLZA 1AZUA 3W9DB 1AQDA 3LZPA 3OX8A 4NNPH 4ODWA 2ZSWB 4IKJA 2IF7A 1XGPA 2WZ0A 5DZ9A 3UADA 2NLJB 3IDYB 5HYJE 4EDWH 3UAJC 4FQXB 1FVEA 2J73A 4RFEA 1P1VA 3EHBD 2TSBA 2YQ2A 1FDLL 5ETUB 3STLB 3MAWA 4ZTOH 4MQXC 2X3BA 4BM7A 1NFDF 1CO1A 1AZCA 1NCUA 4XVUD 4JZJC 3AY4C 4FXKC 4X7SL 4KMTH 2XKNB 4QAWA 3NZ8A 4EIBA 2YIHA 4NUGH 1R24A 5IM7A 1E8WA 2ICCA 1QMUA 4NQSA 5EZJB 4BRJA 3OHMB 3LZFH 4N3UA 4PAZA 5TJWK 4P3DA 3MRMA 5TH2B 4Y1AE 3GUTA 3F04A 2XTLA 1NFDE 5HHMB 3T0EC 4HIEA 1FH5H 4GOSA 5KOVC 4YZFE 1AXIB 1BQSA 4LU5H 1O5PA 1SM3H 4DNLA 1KTCA 3FXIC 3LNIA 4KBPA 5IB2B 2X4PB 3IXAA 1A4CA 2L0DA 4TNGA 1MLCA 2C7FA 3RI5F 2I9TB 5DD5H 1K8DA 1Z1WA 3CH1A 4ODXB 3OZ9H 4JRFA 4YSAA 4G7YL 2NTSP 4E9SA 3PJLA 4ZZKA 2NNFA 3HI1B 4YSDA 5F1NA 1OP3K 4KVCL 1E3ZA 4HUUA 5F6IC 2FEJA 4XCFL 5BRZA 3QNYA 1WGVA 3SE4C 5FOJA 1G9MC 4L1TA 3AS3A 3TNMB 4AGOA 1H5BC 4DTGH 2F7QA 1S9YA 2BHZA 3QULA 1Z32X 3PFQA 2YMXH 2AERT 5HHME 3M1CA 2IC2A 3SGEH 2Z91B 3L2MA 5IJCC 2X05A 4A67A 1MHHB 4W9FC 4GKNA 5SWSD 2H5UA 2LU7A 3PQYB 3CK0L 1XFPA 2VMEA 4NO0B 5ITBL 4HD5A 2QV2A 3IKCB 1G84A 5GGSB 3GHEH 4NZUL 2JIXA 4PCTA 1TU2B 2B1AL 3EBHA 3FUMA 4PG2C 4UDUB 1AZVA 4KU1A 5GHWL 3U25A 3K6IA 3DROB 3A24A 3F5WB 3QNZA 4H20H 4MMXB 4XVJL 1KBPA 5E2TL 1K4DA 2Y5EA 2AJYH 3BPNC 1P7BA 3GXIA 4J3OF 4ONHB 5IW6B 4I3GA 3ARRA 1QFUH 1D2PA 4LSTL 4YHLH 1ACZA 2E3VA 1VGEH 1QI5A 2N0MA 2HTKD 4W93A 2VXQA 1NCBH 3QIBD 1A1OA 2AQPA 4AYMC 5ABDE 3VFNA 3QYNA 1DFBH 3PXLA 1T0PB 4O9HL 1K2DB 1RD6A 1W72B 4JHZA 5C0CD 5IJVA 4WO4C 5EBMA 3T8MA 4QCIA 3UYPA 1IBDA 1OTUC 4ZQKB 1IVLA 4Y1SA 4WI7A 5DRZB 5FYJU 1HSBB 4YR6B 5F72S 2IOIA 3C5JB 3UPRA 3OMAB 3RIFF 7FABL 3OBAA 4JO3L 2ZWSA 2NNAB 3BKCH 1E30A 2C3XA 1X5YA 4YSCA 5HPOA 4OJFH 2VJXA 4ECNA 1SOXA 1T04B 3HG0A 4LF3A 1EEYB 3DXAD 3V5HB 3H1ZA 3HS8A 4AIOA 4EAEA 4UOJA 5FYLL 3JUYA 3UL4A 3CX2A 4G5AA 4NHCH 4NO3A 3SBRA 4J5VA 3CU7A 3KEDA 4UM9D 4PP1C 1KN4L 2VABB 1RJYB 2IGFH 3L54A 2WUBH 5D1ZA 1MCOH 5GZOC 5LDSA 4JO2H 2JJTC 3MREA 3V95A 2CGZA 4AVJA 4AEFA 4QJ5B 4IGBB 4UQAA 4F8OA 3KBPA 2OMTA 2Z8RA 1JFQH 1YG9A 4P99A 1CXLA 2WUCL 4J1UB 2C7UB 1GMIA 3JWNG 2A9MH 4NM8H 5JOPE 3DVGB 3K7UA 3ZLQC 1EVUA 4TL4A 1QI4A 5SX5H 4AQAB 1B2YA 3QDAA 4YXKL 5JDJA 3KYNA 4G71B 4GW5A 2ZCKL 4EZMA 3SDXA 4F7KA 5HGGS 1X7TA 4ODUB 1JZ6A 1YPZB 3C5ZA 2AV7A 2H6PA 3O0LA 4GLRI 4X4ME 2BZ7A 3V5DA 4JHUA 4ACPA 1EDYA 3S36X 5FYKD 3O6FA 5E00B 5I1JL 3RZCD 1BOGB 1SXAA 4Q56A 3B9KC 3IDNB 1BJ1H 4ZO8A 4D2NA 3U2SA 3ARSA 1H6FA 1NCWH 4HWNA 2VZ3A 3WUWA 1JZ7A 2DJUA 1YCSA 2IDCA 3ROLA 3MRDA 4RMQA 2OR9H 1HYSC 4JFSA 1RJZB 1UCBH 5T1LD 3FTUA 3ARZA 4M7ZC 3L3OA 4LBEB 2BO0A 5D7IF 4WLCA 3B4NA 5CD3B 2OMNA 2DZEA 2K9FB 4WU5A 3ZKNC 5IR1B 3TBSA 5BZZA 2DH2A 1CICD 1EXHA 3OMNB 1J88A 2CLZB 2PKDA 2WCGA 4XPBH 4ZMTA 1RUKL 4TRPL 3T4AB 2R7EB 4XBPA 1VPOL 1QA9A 1Q9LA 4LEOB 3IGFA 4ATWA 3GZKA 1E4XI 2CGRH 2OMBA 1OK0A 3TJHD 2CK0H 2KLTA 4XWGH 1YPZE 5KYYA 5LGJA 4FNTA 1TTBA 3V0HA 1UOKA 1Q94B 5D7IE 4JGNA 3PL6A 3RUGB 4DSYA 1FYTB 5IOPB 1DTUA 1PZAA 1NCDL 4D9QD 4JM0A 4JL2A 1QLRA 2BXZA 4AYDC 1RJLB 4HLZH 3IMSA 4KUCF 3PP4H 3W39B 2I9LB 2H0FA 4OF3A 3KEHA 3RWIB 2XACC 3T2PA 1BVKB 4KJPC 2I32A 3ATBA 2HFGH 4YSPA 5KS9B 2A73A 4XNYH 3SDAC 3CN2A 1GGCL 4JFXA 1G6RB 4TVPL 4OVVA 3AU1A 4WGVB 2VCOA 3H2PA 1E0OB 2GI0A 5F2FA 4A2MA 5IJKC 5CN3A 3B37A 3ECQA 4JCLA 4HJJH 2AJ3A 4OM1L 3KWUA 1HL8A 1PJWA 3M07A 4F2EA 4Y16A 3U1PA 5KYWB 2VM3A 4PQXA 2R4RH 1RFDH 2ZP8A 1LO5B 4Y19E 1VA9A 1F4AA 3DWTA 1FZMA 4R90L 4Q6IC 1BF5A 1M3IA 2VLLA 2X70A 2Z7UA 1E8XA 3BEVA 3NJJA 3QPXH 4NAMA 5J7CC 4TQEL 4F5CA 3GJFB 2E74C 2J7LA 5D1QA 1BVNP 1WZAA 3ARGA 5D6CB 2RQEA 4Y8DC 1N59A 3QUML 2QADC 3I6KA 1OEZW 2DQGH 3G04A 2CLVA 1ZK9A 4K8RL 2OV0A 1SN2A 4HIQA 3QEQD 1AJ7H 1MH5B 4JN1H 2IAMA 1UA3A 5CBEA 3BVVA 1EGJA 3GXMA 3HUJB 4BDVA 4Z76A 3QUXC 3C60C 1ETJA 3O45A 1F3JB 4ENZA 4ERSH 2IAND 5IMLA 3S48A 1OTSC 1LE9B 2NY3D 1I7ZA 4DKDC 5E1QA 4O5LL 2UY7A 4S1SL 5CLZA 2E9WA 2VXUL 1HKFA 3OD3A 4XOCA 5G5DB 3Q3GB 4OCWL 4K3EL 3D39D 1EO8L 3TV8A 1KYOJ 4MKTA 1A4JB 2KUTA 1YY9C 3IU3A 5EOCJ 1T2XA 4FTDA 1DUZA 4KJYB 1KFAH 4OUUA 1Y18B 4Q2ZA 5AALA 1EMTH 3VRIB 1NLBH 2X4TB 1YUHA 3VO0A 1KEGH 4LLWB 2YGQA 1NGPL 5JXEA 2DQJL 4PRIB 1LO4L 4XOEA 2V17H 4ZPVA 3BWUF 1F18A 2FJFA 3LNFA 2WGNB 4OLYL 4U6TA 4R7DA 3FU8A 3HUJE 1DANT 2QVKA 4YXLH 4DH2A 3U0PB 4IW4C 2O5XL 1JHLH 2V7HA 3AFLA 4U6VH 5HVFB 5JPMA 2ZCHL 4WTXA 4G9FE 4KKCD 4TYUA 1ZE3C 3MN8A 5TE4H 4E9LA 3PDGA 2LTQC 4IKIA 3UEQA 1LP9B 2BNQB 4ORGA 4WK4B 4NO2A 4UCFA 1I1RA 5F1SA 4GNKB 4DVRL 1XF4A 3BH8A 3T4YA 4JJOA 2C9QA 4X9IA 4KV5F 2XQYA 4LLQB 3QAZC 4R4BA 1V3LA 3KW8A 4FNUA 4NPYA 4OJYA 2UXVA 4NN7C 3TCLA 4HYTB 4NNPL 3VXQB 2VGLM 1N6UA 2WVUA 5T3XE 1HQ4B 3EHBC 1QSFA 1SXCA 3DO7A 1LE5A 2YUVA 1UM4H 4EDWL 3TT1H 2ZWKA 4KTDH 4NNXB 3NGBC 2VZVA 1Q72H 1BVZA 1IFRA 4XVUC 4YLQT 3CC5B 5FDWA 4NN6C 4A2HA 3UZQA 4OD3H 1J18A 2BP8B 3M7OA 1AQHA 3HZVA 5DC2A 4HGKC 4GAYA 1U3ZA 2DJMA 3U0TB 4KMTL 5BW7C 1FH2A 5CO1A 3RGBA 3HFFA 3VWKB 4UZSA 2CUAA 4NUGL 3ARED 4TVSa 1RSFA 1VGKA 2YPKA 3HG5A 3ZDXB 2NW3A 4AG4L 1PZUB 2WMPB 1PKOA 3OLGA 2GCYB 2GITA 2JB5H 3QJRB 4Z3HA 1VEPA 1YA5A 3H9SD 3GEWB 1JZ8A 4PVMA 3GMLB 4RGOH 2F1BA 3UAJA 4LLDB 5IB5A 1SM3L 1IGCH 5FYJD 3S5LB 4PJ8D 2P80A 1HAWA 5F7BA 4MDJB 1ED3A 4QJ4B 3BPCA 1L9OA 2OXHB 5I8EB 3AY4A 3DHJA 1F86A 3KLSA 4BFIA 2APFA 3MGAA 5DD5L 5F3HA 2A4EA 4PIBA 3OZ9L 2WD0A 3LKSB 5ITFA 3GIZH 1SLWA 5CEYB 1SUJA 5CFAA 1JERA 4V33A 1AQ8A 1IARB 1R3LB 3L4WA 4FLOA 4YO0B 1QUNB 3HC0B 1MCWW 3U6RB 4RA3A 3T0EA 5D72L 3OHXC 2YN3A 4DTGL 3KYKH 3QFDB 1MRDH 3ARVA 3V5KB 4OI8A 5DHVB 2V5RA 4WSKA 1MIMH 4EN3A 5GSVB 4KDVA 4XCNA 4B3EA 1ZWIA 2YMXL 1S7XA 5IVZB 2OCFD 3GZQA 1DBJH 5GJTL 3ZZQA 3TLRA 3L1EA 4Z95H 4F37K 1A3RH 4BHUI 3HAEB 2XZQH 5A16A 3VD3A 2ZKWA 4MDIA 3BVWA 3WL9B 1WWBX 5HGHB 3GHEL 2F5AL 3QK0A 3SE4A 5EU4A 1N0XH 3IAQA 4G1MB 2F54B 1RZ7H 1ZTMA 2AK4A 1A4KA 3AABA 1AD0A 4PRPD 1FZOB 4DPAX 1K4CB 5B38A 3OR6A 2XA8H 1J8HB 1I9RH 2HTKC 4UM8B 4P4KB 3TL5A 1QFUL 3AS0A 1C5DB 1FLTX 1X9RA 4YHLL 3MLYH 3LRSA 2MRYA 1VGEL 2OTWB 1E7VA 3VXUD 3QYMA 2P8MB 1NCBL 1FJ1A 1NSNL 4XBEL 4OI9A 1DFBL 2VDNL 1EX0A 5E2UH 3GJEB 5FUZL 2VZSA 3A0OA 1KPUA 2FNWA 4P8QA 2AXGA 3RWDB 2DI7A 5I75C 1U58A 2LABA 1NAMA 3INUH 1JPFA 4QYAA 1VRSA 2HAZA 3GTVA 2PW2A 1RU9L 1HEHC 3BKCL 4L3EA 3VH8A 2VR6A 3QFJB 3BRGC 3GDBA 1MLBA 2EKSB 4M7LH 3DX6B 4OJFL 3RTQD 1VKXB 4S1QH 3BAJA 2YKLL 3WS3A 5LLIC 4Y5VC 4XX1G 3ZHNA 3W37A 4BZ1A 1N5YH 4WQOA 1EO5A 3MMEB 1DQKA 3D07A 1J8HE 1GC1C 4WO4A 1XIWB 3W11D 1GSMA 1CE1H 2IGFL 2WUBL 3BHBA 1MCOL 3C75A 4JO2L 3FRUB 3QJXA 4TOYH 1CB4A 3GJFH 3EKCA 3TP4A 3DIFA 1DJWA 3TZVD 1M6UA 4DHLA 4L05A 2R23A 2BS9A 4YHIA 1JFQL 4PBVC 3K2MC 3VD4A 1V3MA 2ISDA 3WO4B 3B2XA 2C9AA 2ARWA 3QQ4B 4IMLB 2A9ML 4NM8L 1MFEH 5TQ2L 1HDMA 4EXPX 5F9JB 2XBZA 3L3JA 1PQZB 5EOTA 2FL5B 1IGYA 3N5AA 4Z5RB 5M94B 2QVIA 5FOBA 1OARH 1PJ9A 4ZMWA 3HPLA 1HNGA 1BECA 3QFJE 5HY9A 3RZCC 1AHWC 1RJCA 4JN2B 1JWMB 2BWQA 3FT2A 1FVDB 1RI8A 1KYOK 3U4BH 5IUSA 3T2NH 3PWUA 3AXIA 3PCYA 4B53A 1SYVA 5GZOA 5BCAA 2NX5D 4QTFA 1S5IL 4FLSA 1Z0MA 2X89A 3FUEA 1NCWL 2H8PA 3RGVD 2EUXA 5FF6A 4Z0BH 4B6ZA 5I30H 5C0GA 3PWNB 4XOAA 1RZJC 1U6AH 4OZGF 1UCBL 1YECH 3QZMA 2PYFB 4F2MA 3GMMA 3ATAA 4LGPB 1CICC 1R3JB 2UWEF 4WJ5A 1JGEB 3SPVB 2G0KA 2Z3FA 2C9VA 3WLBB 4XPBL 2E46A 5T3XH 4ETQB 3TJHC 4U1JB 2CHDA 2KS0A 2XTJD 2K3HA 3B9KA 5HJ3B 3X12A 3I3BA 2CGRL 4OZGE 4ANXA 4MJ4A 2CK0L 1MZZA 2UZIH 4XWGL 3UTSE 3O2WH 4FXGB 5FWQA 2YGNA 3KL0A 1R3IH 4ONGH 3JZ7A 3QARA 2CO2A 1W15A 3HBQA 4XVOA 2VLRD 2E8YA 4HH9B 2OQJB 1E9OB 2DWEB 5DUPH 4BQCA 3EZ8A 5KSAB 5HHVH 2ZCLH 2VLKB 5DDHB 1UASA 1BWMA 2AS5M 3O9WD 2RH0A 4H8WC 3KWXA 2X12A 5J89A 2HFGL 4YGVA 4XNYL 1SMDA 2VN6A 3WJMA 4AT6A 4F9LC 3UZEC 5LWYH 3B9AA 3VWJA 4LSSH 3CG8A 2YO3A 2O6EA 1X4XA 4R9HA 4AEHH 1Z9NA 4HIXH 4K73A 5T3ZD 3BUYB 1DQQB 3DRQB 3LSOB 3LV3A 4XB3A 4Z3IA 1TJXA 1J0JA 4HJJL 1EO7A 1JGDB 5IQMA 4JAMB 2WQUA 4LGRB 2KI6A 1NGYA 4JRYB 4OLUL 3DIDA 3KS0J 4H88H 3AACA 3DHUA 1G5GA 4M1DH 3RL2B 4Q9RH 4PJAA 4MX7B 4Q52A 4N2HA 5INCB 1HN1A 2R4RL 1DQTA 1RFDL 3OKMA 2DV6A 4KRLB 2BNRA 3OKLA 3EFFA 4IU2A 1II4E 5PCYA 1FGNH 3QPXL 1ZLEA 3BGMB 2E7DA 4F9PA 3L5WB 1BV8A 1NIEA 1U8PA 1XZWA 3SDAA 3ZE0B 4FHJA 1EBPA 1OCZB 3BP5B 3QO0A 4GIAA 4CVXB 4M4RA 5J6GA 4E0RB 1BCIA 3FCSB 1PW3A 1ZV9A 3EBAA 2DQGL 4O51A 4TL5A 2EDQA 1G7JA 3VGAC 4YFLI 3FO9A 5CWSB 3AG3B 5K9OA 2KKQA 3ZYOA 2DLGA 2E56A 3VFSB 5C1MB 5ID0A 1AJ7L 2IG2H 3RU8H 4JN1L 4MAUH 4AL8L 4XO3A 3HN3A 2GVYA 4C58B 3GSXA 2XBDA 1DBBH 1FL5A 4HS6A 4X5QA 1F3DJ 4PJDA 4BFBD 2BZCA 1TYJA 2NY3C 4X5WA 5EU6B 3MV8D 1MG3C 4ERSL 1CDUA 3MBEB 2H9GB 1BM3H 4JRYE 1XF3A 3GSVA 2OKMA 2X42A 1M9WA 2R8SH 1U3HB 2WYZA 2IH8A 3W82A 1JFHA 4N0UA 1USQA 1GS7A 2C4FT 4YSTA 5L8KB 1SBSH 1KV7A 4ZPTA 3IU4L 4E9QA 3ZE0E 5I18L 5CMAB 4G59C 5CIPB 1U30A 2IDSA 3O4LB 5DHVH 3PAUA 3BSZA 1NBZB 1JUFA 1KFAL 1V8HA 1EMTL 1NLBL 3UG3A 3QORB 4JFYB 3GFUA 4MD4B 3DJ9A 2B14A 3VD0A 3HAEH 5JHDD 3FUJA 2V17L 3B3IB 1A0QH 2OS7A 4NQEB 3WO3B 1G87A 3HE6B 3RWFB 4AGNA 3CGTA 2LVEA 3BVTA 4DGWC 2RQ8A 4YVNA 4KKCC 5JIKA 1JHLL 3CVHA 4Z8FH 4U6VL 4IS6B 1BVOA 5EZIL 5L0QC 1I3RA 2MPAH 1LJMA 5FO7B 3K4DA 3WN5A 1WBXB 3II1A 1JBJA 1CURA 4GUOA 3P11H 1AO7B 8FABB 3WTUA 3W0WB 4XNMB 2R2EA 3HC4H 3KPSB 5D1XE 5JOFA 3AT9A 4NRZB 1UWEH 3RAJH 2LU3A 1P7HL 3O4LE 1TFHA 2YJQA 1EA9C 4KO6A 2EC8A 2GTQA 3KPOB 1MN4A 2RFXA 3CFEB 4U4IA 2DIBA 4WU7B 1UM4L 2VDLB 1BF8A 4NQEE 3TT1L 4YHNB 4KTDL 1OIOA 1Q72L 3P02A 1E7UA 5F1OB 1K9TA 4OD3L 5BS0D 4AK2A 3VI3F 5DS8A 1CFQB 2APXA 1PKQE 4NZTH 1NMAH 2WINA 3AREC 3GMPB 2L3BA 3QI9D 4X4XA 1NICA 4Y4HB 4N8VG 1XD0A 4PV1C 1KMGA 2YLKA 2FJGA 4D0BB 1IBGH 3QJFB 2HVJB 5IB1B 1CJYA 3D2TA 3G7TA 2VRQA 1QX1A 4FFZA 4U1GC 4XNZB 4XVSL 4HFUH 3D85D 4F8NA 5EF1A 2F53B 1F5WA 1I7UA 2JB5L 3VI3E 1BDYA 4CBZA 2X2JA 2BSRA 2QT6A 3DUUB 4PJ8C 3VMOA 2DI8A 4RGOL 1XCTB 1G6VK 1IGCL 3C9NA 4U05A 2OJEB 4Y2DD 4WSJA 3LH2H 3GM0A 3BQUD 1R5VB 1I85C 4FG4A 3ARPA 5F96H 1LWHA 2VKXA 1UWGL 1DN2A 5BW7A 4P2RD 1XCWA 4GRLB 2V5YA 3ILPA 2BXYA 6PAZA 4LL1A 4TNVK 5L2JA 1IU1A 1GOHA 4FFYA 3GIZL 4I85A 3BC9A 3O4OC 4HC1H 3WFBL 1H19A 5AB0A 2VXTH 4HKZA 4RAVA 3V79C 3NABH 4JGMA 4N5ED 2GAZA 5F9WC 5KUMA 5DK0A 4PRHD 4V1DE 1E3XA 3KYKL 3L1OH 2ZSVB 5IG7A 1MRDL 1U95A 2IBGA 4DPRA 4BFJA 1MIML 2EIEA 2WVTA 3P4OA 4GKZB 3QEUA 1R5WA 1DBJL 2F53E 1GXEA 3V4UH 4ZO9A 4Z95L 2Y7SA 1A3RL 4POYA 2KL6A 1M05A 1WGOA 3O3BB 2J55A 4RMSA 1IGTA 2E4FA 3R1GH 4BYHA 2NXYD 3AY2A 2W65B 2KT6A 3CFKA 1N0XL 4WUUE 3WG7B 4UTCA 2PP9A 2W88A 1RZ7L 3AWEA 5CJ5A 4LRNH 4ABUA 3ZO9A 4WF7A 1LO2H 3K80A 3MKKA 2IXQA 3H4HA 2KQNA 1BQHG 3REVA 4KDTA 4OH2A 5DQJA 2XA8L 1I9RL 2N59A 5K9KB 3GTTA 4ZFZA 4ZK8A 5L8LB 4K9EH 1RZGB 1FF5A 3K0WA 1I1FB 3MLYL 1I9IH 4ZX4A 3M6DA 1BD2E 2CE6A 4HUXA 3BP7A 4J3TA 4P5RA 3BRFA 4G83A 3U2IA 4KTEH 3BWZA 3U9UB 4JFDA 4JKWA 5E2UL 1H6TA 4MCZA 3S36H 2CRZA 4CN4A 4OCXH 5DQ9A 4AH2A 5E6ID 1PX8A 4J28A 3AZUA 1CBVL 3NSJA 1GGYA 3ZZSA 1NDMA 1DSYA 43C9B 3FTYA 1ZLSH 3MLSH 1ZPUA 1JI2A 1YEIH 4L3CB 1ZSDB 3RTQC 2P8LA 1JZEA 3VG0L 2YSSA 4I0PD 4NAJA 3LQZA 1A6TA 4OZHB 1WFIA 1RULH 4M7LL 4Y7OC 4S1QL 2GJ6D 3K6DA 4PS8A 3OAZK 4N0YH 1K3ZA 2ATPA 1S7SB 1N5YL 1KPVA 5I8CA 1KB5A 3W11C 5IBTH 5ISZB 1YEJH 2G5RA 3FN0H 1ML0A 2DTML 1F6AA 4E5XA 4BINA 2NTFB 3N1FC 4ZX6A 1CE1L 3TZVC 1F0LA 2AAAA 4NERA 5DHXB 2PO6B 3BAIA 3EOBA 3CVIH 4LOVA 4FKKA 1MFVA 1ZXKA 2OMXA 3CDGA 3E80A 3L4CA 4JE4B 4OV6F 3WCYA 3QJHB 3PE9A 3FU0A 2Y5QA 3GEFA 2ZXGA 3NFNB 3WENA 3T8XA 4DKAA 2FQEA 3I9IA 1AHKA 1KLFB 5HHOE 5L4IA 4I87A 4Y5VA 5IQ7H 4DGIH 2C3VB 4IIQB 1OARL 4PRBA 4UNVA 4QAMB 1UB6A 1J9TA 4WI0A 4IK6A 4QRQA 5DZVA 3W57A 4UM9A 5F1IB 3IDXH 1HILB 4FOMA 1I8LC 5LNGA 2W95A 1S7RB 4XMKH 2YD1A 3U4BL 1HH6B 4WEEA 1U8CB 3T2NL 3LRMA 5CF3A 3CPUA 5EUKB 3ZJAA 3RGVC 4C56D 1OWWA 3GXUB 3J7HA 2IWFA 3MUHL 4KKQA 1CU4H 1QBLH 4DQOH 2UZPA 2B39A 1P5VA 5IEKB 1YEWA 5HP5A 4Z0BL 2VMDA 1MVUB 5H35B 2FR4B 3UAAA 4YAQA 1CLCA 5I30L 3PWLB 4JFEB 1U6AL 3MV9B 1YECL 2CO7A 3HC2A 4PEEA 2IQAB 5A6MA 5CIPH 5KTEH 3KLKA 1ORQA 2WXOA 3FFDB 3ZE2B 1QHOA 1QZNA 3MLUH 2QZ5A 3QIUB 4MNQE 1UURA 5D5MB 4QRRD 1WE5A 3UZVB 1AHWA 3FHQA 2XTJC 2FGZA 3JT0A 5FW8A 3HNVH 5T3XL 1PZ3A 4I3SH 3LKPA 4BSWB 4H25A 3T65B 3BGFC 2FX7H 4Y2OB 5J6HB 2UZIL 3O2WL 4QRUA 3R8BB 4PV9A 2HJKB 1R3IL 4JG5A 5DFWH 3K8MA 4ONGL 5GGTA 4PJGF 4GIOA 5FCUH 3UTQB 3UX9B 4X4YA 1G7QB 4YDVA 3LIZH 4ISVB 4MASA 3VMNA 4GEJA 4UV7L 3H9YA 3O9WC 4JHWL 3VFPA 3SD5A 4ZSOA 2ZCLL 2CHXA 1S7TA 2Y23A 3P9MB 5TPWH 3O3DA 5K1JA 3FB6B 2L4OA 2WYHA 2JMRA 3FU7A 3MRPA 5AAWC 4IBYA 4HXBH 3ZMNA 3CJJA 3FQ4A 1E4JA 4ZD3H 2ZKHH 3TA3D 1J0ZA 1HAUA 5LWYL 2WXRA 1OAXH 4YDIH 4X0KA 4AEHL 1B4RA 4HIXL 1UOVA 3K72B 2HUHA 4DP8X 4DKEH 1NFIA 1RSYA 1U92A 2AI0H 4NZRH 1XR9B 1E5UI 1AKJA 1ES0A 1IB5A 2VDLH 1IV8A 2AZAA 4FQQA 5DRNB 2ENQA 1JF6A 4H88L 4M1DL 4Q9RL 2K9UA 1ZT4B 2ZXWB 4N2EA 2LT9A 2QELA 4OLVL 3NEEA 4LXFA 5KBLA 4JLRA 4K9JA 1FGNL 2JF1A 3MRQA 1P69B 3BIKB 4N24A 1OGAB 3BN9D 3ZZ1A 1OSZA 3ZKSD 4F9LA 5BVJB 1P7QB 3UZEA 3F84A 4JM2B 3QO1B 3RHWK 4XBGB 3L5HA 3UG5A 4NPKA 5KBNC 5I73B 4UNUA 4OZ4B 5B21A 4E9WA 1S8DA 5KZCD 1CDGA 1DLFH 3AAZB 3F7RA 4BUQA 5CEXA 3AITA 3UH8A 2XIDA 1MJJB 3HHSA 3X13A 1GCFA 5LGKA 4OQTH 4Z7NF 4QPEA 2IG2L 2R2HA 4MAUL 3RU8L 3OJ2C 1ZT7B 2HFFB 2F7IA 1DBBL 3PHQA 4XH2A 4YS4A 3IJEA 3TBVB 1TVHB 4CC4A 5E8EA 3LN4B 1BM3L 4PY8I 3I2CH 2GABA 2FSEB 3ULSA 1CLOH 3K5SA 1Q0EA 4N0CD 1IAOA 2R8SL 4AVKA 1BFTA 4Z7NE 1B4JH 3D69A 5BOZG 1EBAA 1SBSL 4I88A 1JYNA 4HU2A 1GGUA 3QB7C 1OGAE 2J57A 5H94B 5A2CA 4XNQB 1K85A 2EEBA 4Z0XB 5GS1C 1H8LA 4Z7WA 3NZUA 2PCPB 2VLJE 2XJKA 3OR7A 2GUOB 2BP0A 4X7DC 5E2WH 4Z3FA 1G7HA 1NBQA 4DAGH 3LDBC 2D9QB 4M8QB 4ADIA 3VXRD 4MMYB 5EZLA 1X9UA 1XO8A 4W6YB 5MERA 4Y5XB 4JM4H 1A0QL 3V10A 8PAZA 1TLMA 1EAQA 4TVPD 3C5SA 3DHPA 3EJRA 5DJZB 2EO7A 5E94B 3MV7A 4Z8FL 2L7QA 1P1ZA 3C6EA 2QGCA 4O2CA 4PJHB 1NJ9A 3VJ6B 3H9ZA 5I1EH 4Z3TA 1HOCB 1KTBA 3MRFB 3WI9A 4XAKE 4GP8B 3QDME 2NY0B 2VR9A 3PUUA 3ARBA 3HC4L 4J6IA 3WTVA 2ERJB 3D0VA 3KAAA 1DJYA 4IOIB 1UJ3C 4H8PA 4UT9A 3F8UB 1WAAA 4UU9A 2CZNA 3TC9A 1GJUA 5I6PA 5I8KH 1KXTA 4Y9FA 2W9LA 3EH3B 5KVFH 3MJ9A 2NNXA 5D7JB 4W6WB 4Y9EA 3VXNA 1MI5E 4L4VD 4QY8B 2CCLA 3H42H 5AKSA 4GQQA 5F7YC 5EDXA 3LKRA 3DX4A 2K1MA 4G7VL 3RILA 5F7WC 3QI9C 1SVZA 2ICWI 3PNRB 3SB3A 3MRLA 3TBYB 3ULAB 4APXA 3VDCA 2E7CA 4NZTL 1NMAL 5LAXA 3U82B 4WWPA 5IBLD 3RPIA 1KB3A 2NZ1A 3GNMH 4UYQA 3IGLA 3EBGA 2A83B 4NKDB 1NGXB 1IBGL 1YNTB 3ARDB 3VD7A 3ILEA 5C3IA 2K70A 4LDOB 1HZLA 1WA1X 3PG2A 3WKNA 5C0BD 1MCQA 2O1AA 2D7TH 4E41D 4HFUL 5HDQL 2EC9T 3DTDA 2X6BA 4FHBD 3BX7C 2JJUA 5JIIA 4Y2DC 1TNNA 4XXCC 4A7VA 4MJ5B 3BQUC 3T0XA 2V9QA 4LCIH 3NESA 3VSVA 2P5EE 3LH2L 4F57H 4HHAB 1FBIH 5GSRB 3KDMA 4L2LA 5EEWA 5F96L 1CL7I 1BEYH 3X1BA 5DA0B 3UROR 4IRSB 3VFTB 5ABZA 4WNQA 4TN9A 3VFOA 4G80A 4DEWA 4N5EC 1TPXB 4PTTB 3EGSB 4HC1L 3QWOA 4OIAA 1ZVYA 4KX7A 3U7YH 2VXTL 4LSUH 4C4KT 2D3VA 5AVRB 1DBKH 1XZ0B 3M1OA 5KYNA 1AH1A 5MENE 2VJ8A 3L1OL 2CKBB 4IOSA 5AVWB 2ZPKH 4N90D 1Z9LA 3DURA 4KOCA 4P2QD 1CPUA 1QFHA 3EO0B 3QIWB 1BXVA 4RIRA 2UX7A 4YE0A 5DWUH 3SE3A 4DVBA 1V3JA 1J7VR 1T3FB 2VR3A 5GRWA 2H3KA 4GXVH 3GXDA 2EDBA 3Q6GH 3V4UL 1O9WA 2WVVA 2KBGA 5EN2B 3SJVB 3O11A 3WDJA 1ZS2A 2PCYA 5DQDH 5IVXF 4ZW7A 5I6NA 2NXYC 1RZ8A 3TEYA 2H6UA 2W0LA 2XZCH 3EFOB 4JANA 5J06A 2WWNA 1DJHA 1TMCB 3R1GL 5L2KD 4JZJB 1ZA6B 4FTVD 4RSVA 2DQUH 3FT4B 4FXKB 4K7FB 3FTSA 4MJIB 2V5MA 4CL7A 2R1YB 2LU5A 3GM8A 2ZAIA 5HGBA 4PBDA 1RVFH 2G75B 4AMKL 3KHQA 4LRNL 1LO2L 5DR5L 5GGUA 1YEKH 1A65A 2WXMA 5JW5B 5E8OA 1MFCH 4NLHA 2Z8SA 2F8VA 2WGXA 1RURH 4HJEA 3VFMA 4NQCE 4WHTA 1I9IL 1ECYA 1UVQB 4MJJA 5I17A 2G5BA 3CN1A 4KTEL 4POZD 2KH2B 5E6IC 1IBYA 3S36L 4JG9A 4BFOA 4OCXL 2J71A 1JZ5A 4IOFD 1QBBA 4LCYA 2X6UA 4L9DA 3VYPA 4DK3A 1WP6A 3N44B 1RL1A 1V5JA 1Q1PA 2R29H 4QF1A 5D2NA 3Q9QA 1TZIB 2WWMD 5GRUH 3ZDZF 1ZLSL 4I0PC 3MLSL 1TCMA 1YEIL 3ZGIA 1PU0A 5CFHA 3WNNA 2ARJB 3GDCA 5F6IB 3D4ZA 1DE4A 4YHZH 1KSRA 3PLYA 1RULL 4HD9A 4KXZH 4A2LA 3EJTA 4N0YL 3QH3A 4LRIC 4XN4A 1CXKA 1TTAA 4FLQA 1I8MB 1OXYA 2F6AA 4F8TA 4L3FA 5IBTL 4P49A 1YEJL 3OKOB 3FN0L 1B0RB 4R7LA 1SLXA 3GSOA 1S7VB 3VXMD 2FWSA 1UGNA 2G2RB 2Z8VC 4R5XA 2R1XB 4BFKA 3ZOAA 1UCTA 3VAEA 4TLUA 5IUCA 2BY1A 3QZWG 4OSUH 3CVIL 1A6ZB 4GRMA 4I0KA 5EHFA 5KSUA 1QTSA 2OL3H 4PW9A 4N8VA 4Z7UB 3RTQA 1XGUB 1TCRB 4KI1A 3TWYA 1AD9B 2LOEA 5LG6A 5C0FB 1JTTA 1WCBB 1LHZA 5GXBB 2OSLB 2YFOA 5IFJA 4DGIL 1RXLA 5EC1B 2WTRB 1GH7A 4Z7AA 5AVYB 4GQZA 1BAGA 3O6MH 4QHUB 1KYAA 1J11A 3S8FB 3IDXL 4Y1TA 1H9VA 4XMKL 4PWKA 3LXAA 4P2YA 3FK3A 3IVKB 1YNKH 4NKQB 3L7FA 5DJXA 2WZ5A 3MUJA 2YBRB 1ADQH 2OBGA 2EAEA 2MOGA 2ZOTA 4WHCA 1CU4L 1F56A 1QBLL 4DQOL 1NMCB 5LNDA 3IJHB 2E6QA 5KJRH 2NYYD 5I5JA 2ZOOA 1JWUB 1RPQA 3MNVA 2DQEH 5DYOA 4KQ0A 3G5ZA 5KTEL 4QRTA 1IKOP 2VTFA 3ZN6A 1EXUB 3BCDA 2X1OA 2DLHA 3MLUL 4OLXH 3VGEA 3K71B 1Z5LB 1CFTB 4JZNB 1E4KC 3W81A 3AQXA 2NX5A 1H3XA 1ZKAA 2J6EH 4MWFB 4UUJB 2WXIA 3M1BB 2CHNA 4N2AA 1S5HB 5FKPA 2EE3A 2IALA 4YSUA 2VL5B 5I15H 3KVQA 3U0WL 5KN5A 3ELAT 4OUOA 2YAPA 3L2LA 3BAKA 5EIIG 3BZEB 1YNLH 3V6OC 5FCUL 3MKGA 5E08H 3VFUB 2XKUA 1DN0A 5KJ7E 3LIZL 1FN4A 1A66A 1B0GA 2XA3A 2AC0A 2J5LB 4KO7A 1MCHA 1IEAB 1LWJA 2BFVH 3N3EA 5TPWL 5L4MA 3ULVF 4CADA 1FNLA 4U3HA 5C0AE 4HGWA 5JUEH 4Z78A 1BAWA 7TAAA 4HXBL 1BBJB 4ZD3L 2JSFA 1BQHA 2R59A 2FYYA 2ZKHL 4HZ1A 3UTTD 2XVBA 1OAXL 3O3EA 3Q0HA 4YDIL 5EU5B 4FYSA 1L6ZA 1IO4C 5C08B 4DKEL 3L3IB 3V6FA 1A6VH 1UZ8B 4TNFA 2AI0L 2AJXH 5CXPA 2VDLL 3ULVE 3ECBA 1SXZA 1A7NH 3DDFA 3OC8A 4JPWH 4GUQA 2BDNH 1ONQB 3O9WA 4CRPA 4G8GD 1XCQB 1FORH 4OJAA 3IEAA 3BN9C 5MEPA 4ZFGL 1EK3A 2CR6A 1AGEA 4PJCB 3QAQA 4OZFB 2QQQA 4LK4A 4YIQB 3FUIA 4BKSC 3ECUA 5AAWA 1H15A 2Y3AA 3DV4B 1R75A 1T0NB 1WFOA 4IBTA 1LQSR 1JXKA 1NCAH 3SGEI 4OKVA 4Q9BA 1IAIH 2XX0A 4EBQH 1BQ5A 1DLFL 4WFFD 3FB8A 3EYOA 3KL3A 1MCNA 2H2SD 2IPKA 4OQTL 1QSZA 1SYSA 4AW7A 1W6WA 1FL6A 5D7LB 3VRLF 1MPAH 1JYVA 4R96A 3JVGC 3SBPA 5I1CH 3DX8A 4Q6YA 4ZUWA 1ETZA 3AXHA 4N0CC 3T04D 1E4HA 4MYPA 4U1LB 3B3BA 3DX9B 2BSTB 3RWCB 5HYJD 5I6XB 3I2CL 1TQCB 1DQDH 25C8H 2DWXA 1CLOL 2AQRA 3PWJB 3D48R 2NY5H 5JIPA 1B4JL 1M7DA 4PJCE 3P4MA 4PJ5A 2JKRM 2OMYB 3CHPA 3E9UA 4RRPM 3S7GA 3VRLE 3T6QC 5A7EA 1IGFH 4UMGA 4W9ZA 4IEFA 1ET5A 2X41A 4OFDA 3ZMRA 5FW6A 1QNIA 3MLXH 1T7YA 4IRZH 4KKRA 4EVNA 3QRLA 1XBRA 1M56B 5E2WL 3N1QC 4J8RB 4Y1AD 3AWGA 4J3XA 1ANUA 1WF5A 4O2EA 2BLFA 4WI5A 4HK3N 2B8OT 3WTXA 4JM4L 3HRPA 3FCBA 1NGQH 3OKDB 3UBXI 2DL2A 3X3GL 3WHXA 3RNKB 2YPLE 4F3FA 4UQDA 6FABH 1P6AB 1INQB 3PXHA 1N3NA 5IMOA 5KYUA 3ZT7A 1ZHBB 1PDKB 4Q6IB 5I1EL 4WEBH 2P24B 4FP8H 5D71H 5SV4A 3NRFA 4FNRA 4Z18A 4JKKA 2ZAHA 2PPEA 3KCPB 5L9DH 1OOAA 3BJ91 3CFDB 3KPNB 3QRGH 4HJGB 5CS7A 3V0AC 3P3TA 1J1PH 2ICEA 2XBTA 5I0DA 2X4NA 4R26H 2AJZB 2BVEA 5IQ9A 4QHPA 3L5XH 1A47A 5I8KL 4HA1A 1EQWA 1NDGB 5TDOB 4AJYV 5KVFL 1DEEB 3KPRA 4QHNB 3VVVA 2KYIA 4NI6A 2JCWA 3UP1A 3H6JA 3DX0A 3F7PC 3PNWB 1YEFH 3H42L 4XMTA 3BVUA 3C60B 3QUXB 3WNIA 5HHMD 3CUPA 2X4QA 2Z31D 5KG9A 2VZ1A 4NFBA 2E4TA 3TO4D 1G7PA 3FH5A 2L7JA 3G9VA 1OPGH 2MOQA 4GO9A 4P5KB 5IBLC 4AQEB 2HT3D 2NXZB 2VERN 4QRSB 3IDMA 2CIKA 4ELDA 4HS3A 1UJ3A 1LWRA 1T0MA 2G9KA 4TUUA 3KBFA 2XN1A 5C09B 2ITCA 3MDJA 2APBA 2YFNA 3BZ5A 2KPNA 2EIZA 3A6CH 3BVNB 4NWTH 4UWQB 3U7WH 1U2YA 2D7TL 4X99A 5EO9B 2XHNA 5JIQA 2BOBB 4JQIA 3PWPB 1E42A 4X5XB 4PGBB 1CT8B 2ZD0A 2ZUSA 4LCIL 3ILQD 3EZJB 4F57L 2WANA 2VR4A 4J27A 2KPWA 1FBIL 1WBZA 3RKDD 1AMYA 3P2TA 2XPGA 3MC0A 4KPHH 1BEYL 3MRRA 1DQJB 4LKCB 3SKNB 3R0NA 4K4KA 5IW3A 1M2OA 3HBPA 2I7SA 3QGVA 4UOQA 4DERA 4ES8A 1Q90A 4J3OD 5DJYA 3GK8H 4U7KA 1KIQA 1O0VA 3KW7A 1FWXA 3BAEH 3BZFB 2LTQB 4LSUL 4NO0D 1FO0A 3U7YL 3G08B 1FE8H 2VERA 2O4EA 4ZFQA 5EEXA 4LP4A 4OF7A 2K8MA 3D18A 5C09E 2ZPKL 4QT5A 4TQIA 4XC1H 1EFQA 5E7FA 4XXCA 2C1PB 1RLWA 3QAZB 1F4YH 1PLCA 1KLUB 5DWUL 4AXWA 3KPQB 3VYOA 2A6JA 4ZOCA 4AGMA 3NN8A 32C2A 3MX0B 4Y9GA 4JFTA 1J48A 4GH7B 4GXVL 3Q6GL 3P4NB 1NC4D 4IBSA 4HV8B 1KGXA 5EC2B 1GZPB 2A9NH 3PWPE 3EHBB 4GBXB 5AW1B 3MRKA 3ET9F 3EOAB 1GS6X 1CD9B 5ICYA 1KT2B 3SKOA 3DGDA 4BSVA 1E5BA 3WGUB 2XZCL 2WWKT 2DF3A 2Z7ZA 3FOMB 5J11C 2DQIH 1SXSA 4JRXE 2DQUL 4M5YH 1XH1A 4PJEB 3TBTA 1S9XA 2OMWA 3RIKA 5BQ7A 3EDKA 2BFGA 5FFLA 5JOPD 1RVFL 2UZXB 2B15A 2GEQA 2WXQA 3UBXG 4XCYB 1YEKL 2NW2A 3KBHE 1CDBA 2MIZA 1MFCL 2X4UA 1BPVA 3OB0K 1HL5A 4JCWA 4KXDA 5F8QC 1RURL 2R0WL 4POZC 5E24E 1P4BH 4GB9A 5T5FH 2X1WL 2R0KH 1JHTB 1MHCB 4IOFC 4RRPG 3WNOA 4AQ1C 1FV1A 4LB8A 1P4IH 1RUQH 2OI9C 1E2WA 2LHAA 3OXRB 2QPSA 3P30H 1T20A 3BP6B 4G42A 2XYCA 1M7IA 4R5TA 1MCDA 5I2IB 2NYZA 5GRUL 3BWAB 3MI6A 3HE7A 4X80H 2I26N 5F7DA 1QABA 3A4DA 3MV01 4BE6A 3QDGB 3IFOB 4OAWB 5I1AA 4OGQC 1X4ZA 5EEZA 1XHHA 4YHZL 2MEJB 5K5YA 4NWUH 4AYFB 2DIJA 3WNJA 3OHXB 5F89A 5EUOF 4ONFH 3V0VB 2L04A 1MVYA 3HA0A 2OFQA 3DPDA 2CDFA 4JVUA 4NKIH 4OD2A 2Q10A 3TU6A 4F7TA 4MRCA 1URLA 2EUVA 5TDNA 3ZHFA 1KNOB 1G4RA 5SWSB 2IMMA 1TVBB 4OZFH 5J9PB 3T2QA 4U0QB 5SWQA 2X3CA 2X5PA 1OHZA 4OSUL 4L1DA 2MNJB 5ADPL 3H7BA 2OL3L 3DMMB 3JTBA 2QQNH 5C0IB 5I1HH 4LFHD 2VT0A 2ZTBA 3FUFA 5A43C 4MD5A 5CLYA 1U8KB 4KI5E 4QMEA 2UXFA 3OL2A 4I2XA 3MOQA 2ZG3A 3VXPA 3MCKB 3QDGE 4F24A 1CK0H 4PMFA 1QHPA 3O6ML 4FQ2H 1NCNA 3ME0B 3CXFA 3DSNB 4RFOH 3V0JA 2WTPA 4M62H 5KW9H 3HLAA 3CBKB 3GLEA 1YNKL 3QIBB 1SOSA 5DD3H 1WVZA 2HPTA 1ADQL 2JCCF 4AENA 2F19H 2NYYC 4XWOD 5C0CB 5FO8A 5JHBA 3BIBX 3RPKA 3WY4A 2Y7MA 4RA0C 4U0RC 5KJRL 4PRDB 2DQMA 3NPSC 3GI9H 2DQEL 3CZEA 4Y19D 3IMRA 4LL4A 1HS6A 5IK3B 4RMWA 3VD9A 12E8H 5I75B 5HPMA 3QW9A 4GUCA 5HI5D 4OLXL 3SN6N 2JCCE 2WQ8A 4UNTA 5EFIB 2D7OA 4LEBA 4IRJD 3DXAB 5I0XA 1QSEA 1XR8A 3HMWH 1PBYA 1FNEA 2XJLA 3CVDA 3PDOA 3CX5J 2E7LA 5J1SC 3F58L 1HCFX 3T09A 1E27B 3RJQB 5I15L 2V2TA 1LEGB 4X6FA 2FNBA 5BVPH 1GY1A 3CSYB 3KS0H 1YNLL 1A2YB 1YRKA 3MA7B 4R0LC 1S7WB 4FFVD 5CR1A 4Q0XH 1ACYH 4GXUM 4MA3A 2QMJA 4JGJA 3WFDL 3NA9L 4P3CH 2CNYA 3K6SA 5E03A 5J1AA 3QQDB 5K59E 2K45A 1ODAA 2YQ3A 1E4KA 3OAZH 4TSCL 5JUEL 3HS0C 1DSWA 1IGMH 3BUDA 5E5LA 3ZRFC 1YYCA 3HKFA 1T5WB 5HGAB 1EZUA 3APNA 3NFSH 4HIIB 3RZCB 5FA3B 1A6VL 4GT7A 4JDZA 2AJXL 3ULUE 4MFHA 2YARA 5DI8B 4X98B 1F3DH 1A7NL 2BOCB 2XQYK 1SY6H 1HHHB 4JPWL 4NKMB 2BDNL 1AXTH 2OXGA 1MWOA 4WJKB 1A9BA 3MR9A 3TH2T 5AOKA 1EZVY 5T1LB 1T80A 4ZMLA 3OC5A 5EORH 2O6PA 2D2CC 2P49B 3C2AH 3PGDA 3GS0A 2HFEA 4RMBA 1KIUB 4G9FD 2FO4A 1NCAL 1KGCE 4EPSA 1CICB 4GG6B 3KLDA 1UA7A 1IAIL 1W2KT 3A21A 4EBQL 3LN9A 2XFXB 2H2SC 2J1XA 1JZHA 1TG8A 5EOCL 4AYGA 4RX4D 4QO1B 2UY6A 1NZRA 4X6DA 2O61B 2ICWA 3IWVA 4PJXA 4NCC2 1E8ZA 3WSQH 2ENYA 4X2UA 3IETA 2UVEA 5AD0B 1H3PH 3SYQA 2YEZA 3NCYS 1MPAL 3CLFH 3STZB 5FAAA 5I1CL 2ZYRA 3NZHH 2ZXBA 3QZWA 1HHIA 3VI4A 4Z1PA 4U1NA 3SGKC 5T3XD 5IT2H 1ASQA 3L3DA 3PAZA 4EI5B 1XH3A 1HL4A 2NMSA 5DGQA 1DQDL 3S5ZA 1EJ6A 3FRPB 2JK5A 1BIIA 1ZE3H 2IIJA 2NY5L 3F7QA 5D96C 2XU9A 3VACA 4UT6H 4NS0A 3STBA 4EKJA 2XWBA 2A6IB 2IMNA 4FQLH 2EDHA 1IGFL 1KULA 3EJYD 1EAPA 1UB5B 3GYRA 4IRZL 3WXWH 2XG4B 2A6DA 2D0HA 1EJFA 3L9RB 5KSBB 2IOOA 3JVGA 2AQQA 3LKQA 1SDDB 1NGQL 5DJ2A 5JIDA 2HCZX 4ZFOB 4RQQB 1XB3A 1YVLA 4LPUA 3IDYC 6FABL 5FX3A 1SEBA 4PU2A 1S9VB 4I8DA 3GMRB 4ZOAA 1T4KA 3OGCA 1JPEA 3BIAX 5EO1B 5DVNA 1W0VB 4TTDD 4FP8L 4IDJH 1MDAA 5D71L 4D8PB 4DP2X 2EIJB 5L9DL 4HX1A 2MTPA 4YSRA 3VXRA 2HLAB 3REWA 2EDDA 3WGVB 4TV3A 3QEQB 1CI3M 1J1PL 3O6LH 4L1HA 3U4AA 1CC3A 4R26L 3L3GB 4W4NA 5DT1L 4BK4A 3ZDYB 1M7XA 2H7WA 3QCTH 3L5XL 4ZUVB 5CKGA 1VENA 5EIIA 4BWUA 4PJ7A 2GTZB 4GP4B 2G9HB 4B9IA 5AG9A 2Z31C 1OAYH 3TO4C 3VM7A 2IANB 3P3YA 1YEFL 5EBLA 4YDNA 1JF1B 5LN4A 3RY6C 2NY3B 1GYCA 4AL8C 2HT3C 3C8HA 4FQHB 1OPGL 3HPJA 4YQXH 1BM7A 5HDBF 4RMRA 2VZTA 1QRNA 3I02A 3VQLA 1NGWB 1JS4A 3D39B 4AGPA 5F21B 5HYSB 2P5WA 4AUYA 2B9BA 1M6OA 3WAJA 3QUMA 5INDA 5DK2A 3WLWD 3WFZA 1EHLH 1TQSA 1I7RA 2GC7C 3E38A 4NWTL 3A6CL 2BIQA 3UO1H 2VAAA 1F45A 4E42B 4IU3B 1MCEA 5HDBE 4JMNA 2W07A 5F6HJ 4BQ8A 3ILQC 2VO5A 3FUDA 5ID1A 3B2PA 4HSQA 3TYFB 1IC4H 1VB9A 2VDPB 4KXCA 3RKDC 2Q7YA 4RFNC 3ZHKA 4WWID 2Y69B 2FJSA 4HJ0D 2DJSA 4U1MA 1D9KD 4N2NA 1JTOA 1F02I 3SE8H 4KPHL 2O93L 4H8QA 4PWJA 3TTSA 2Q76B 2Q3ZA 4PGEA 9CGTA 4PJ9A 4XMZA 2Z35B 2P9RA 5EZPA 5L0QB 1O7DE 4HIHA 3GK8L 4Q9QH 2BVPA 3BAEL 1WITA 4G8IA 3JV0A 1FE8L 3MZTA 1EZVX 2AQ1A 1XEDA 1BXUA 5BJTB 3HG2A 4PG9A 1G94A 3LRGA 1MAML 4MMXC 4XC1L 4AJ0A 4N0FA 1F4YL 1NEZA 1NDTA 5LNEA 2QZQA 2EDJA 5I26A 2VSDA 5KSVA 4BH8B 3PABB 1AG0A 2A6KA 1LO3H 3CX5K 3DO4A 3KWWA 4HP5A 4RNRB 2A9NL 2GIYA 1JV5A 1IEBA 3TJPA 3WFCH 1J8HD 2FT6A 1EJ8A 4B95C 4DUVA 1GR7A 4L8CA 2LU4A 5GGRY 2R1WB 3RRQA 5ANHA 4XOBA 2FCBA 3NJNA 1X5MA 4FERA 4ZMZA 5DURD 5JXAH 3MOBH 5ICUA 2DQIL 1AGDB 3DVNB 4HCGA 2ZQKA 3AREB 1FFTB 4JZOA 1KJ2B 4P2QA 3FO1A 3HZYA 4M5YL 4TM9A 3SY6A 2V7NA 3IFPA 2FZ3A 4AY0A 1LXMA 1ZIAA 4JFOA 3NSFA 5CINH 3TBCA 3SDDA 2X1PA 3ETTA 1G0XA 1I8IA 1MHEA 3DDGA 1Z5YD 4R7VA 4AVIA 3HJ0A 2X2IA 4F20A 2GHWB 2YWZA 4BCXA 3TH4T 3H9SB 3BXNB 4U1GB 2FEEI 3NIFB 1FZJA 3HOGA 3BISA 3QFJD 1HQRA 1GC1H 4PJ8B 5HYQA 2O5ZL 1P4BL 3JV5A 1J0YA 3NK3A 3QJSB 4JDVA 5T5FL 2R0KL 1OGTA 2EICA 1RUQL 3FB5A 3P30L 3HFMH 5CGTA 1I8UA 5DEFA 3HR5B 4Q14A 1NTDA 2E86A 4X80L 2GPZA 3MXVH 3O4OB 4GKSB 4TKWA 3LD8C 2XPZA 2QPEB 4OD1H 4BXSV 4N8CH 2VZUA 1TZ8A 4OZIF 5F9WB 1QAWA 2XVGA 4NWUL 4OBRA 2BC4B 1XGRB 2X6AA 3JWDH 3T1FB 1U8NA 4ONFL 2YAFA 1CFNB 2XYBA 2IADA 2YGVA 4NQSB 4K3DH 4ZW8A 3KPMA 3BT2L 1HT6A 3HG1E 4NKIL 1FFPA 3EBIA 5JA8B 2EVFA 1L6PA 4NIYE 3NIFE 1ZDQA 3RWGA 1OSEA 1RERA 2EXWD 1U8JB 4QR7A 3UTSD 5HVWA 3UBGA 1KTLA 2PWDA 3CFMA 2H1XA 3MBWB 4H0LC 3L4YA 4OZIE 3NP4A 3WIIH 5IMKB 1THAA 4FJ6A 4PJFB 4M3HA 3HZMB 3WN6A 1MF2L 2QQNL 3L3HA 5I1HL 4KZEH 3ORJA 1O7SA 3CFBA 2P8PB 4DCQB 4L9LA 1MLCB 3PWVA 2ZXQA 1JP5A 1BXXA 2AMGA 2PYEA 2BY3A 4G6FB 3NJIA 4CU7A 3G6JB 3I9PA 1TJHH 4NM4L 4S0SD 3E8VA 3CSFA 5F88B 5FPIA 4V11A 4F7CB 1CK0L 1T1YB 4S2SA 1CD1B 2BPBA 1PNDA 5CILH 2N01B 4KUZH 1YZZA 4FQ2L 3C5XA 2IPTH 3VXMA 4RFOL 2VITA 3PV6B 4NFDA 1AR2A 3DC0A 4GYBA 5IB3B 2AP2A 4BIKA 4YEEA 3T4AC 2UZYA 1COBA 3H56A 4M62L 5PAZA 3FU3A 4XWOC 3VXUB 4MS8D 3BKYH 3TA3A 3SCMD 1KBVA 2DYPD 3KPPB 5DD3L 1QRKA 2F19L 2ZF9A 5FK9A 2HN7A 3UTZB 5FR3A 1C8QA 4JPSA 2E27L 1N2RB 1PIFA 4KKNA 5ERWB 2F1EA 5HI5C 3X1NA 3CIQA 4PJFE 12E8L 2HG5A 4L8DB 1UADC 4IRJC 4IMKC 2FHFA 5DXWA 2NCMA 4IHOA 5L4FA 2P7TA 5T1MB 2JB6B 3ETBF 1AC0A 4GW4A 3V6ZB 3Q2WA 2P46B 4ZNEA 3H3PH 2DYSB 3G6JE 2ZG1A 3S3BB 3BZ4A 3X11A 4LSQH 5IF0A 5IGXH 5J56B 4E9TA 2WV3A 1KLGB 2NDFA 2EH8L 4CNIA 4FFVC 1PFCA 4NQTA 5E1AB 2JTDA 5DFTA 2CA4A 1Q0XH 3U4KA 5BVPL 8CGTA 1CDJA 3FQXA 4IDLA 2EXYC 2CPCA 1ETA1 4Q0XL 3TZVB 1ACYL 4ZUSB 1G7IA 2RHEA 3CD4A 3KVDD 4XX5A 4PJIB 2F74B 4JRYD 3KHOA 4XVTH 4P3CL 4P06A 5ACZA 5AZ2H 4QCIB 2QSCH 1X9LA 3O0RH 3S8GB 3NIGF 3NZSA 4Y4KD 5I1DB 2XXCB 3UBXA 1Y0LA 2E5EA 1PLBA 3SOBH 1IGML 1GY2A 3U6XS 1CE6B 5JHDE 2BWIA 4QHKI 3L3KA 4QRAA 4OLZH 1H3UA 3PRZA 4N8PA 4K5OA 2CO1A 4QHMB 3POCA 4HOZA 3NFSL 4W9CC 1P7KA 4Q7DA 1R9FA 4APQB 4RRPA 4BWTA 4R3SB 3TNNA 3D9AH 3LKNB 3DOSB 3N0AA 4PI0A 3V52H 1SY6L 1A64A 1NKOA 3RGVB 1ULVA 3SSGA 3GIVA 1E9QA 3S5LG 3IN0A 1KTRL 5IREA 2BK8A 4A63A 1CDHA 1A02N 3GSUB 1XGQB 5E8PB 1X44A 1BLNA 3E6HB 5EIVA 3WFHB 4EQ2A 4HBCL 1J9SA 3UTTA 5EORL 2BCKB 3HS0A 4PJIE 3TVMB 3C2AL 4JKNA 4BCYA 1I1YB 2WKOA 3BWUC 1IFHH 2WLLA 3QA3A 2AV1A 3RKPA 3V8CA 3TXAA 1XL6A 3S3JA 4ATTA 1JHKH 1KPRA 5ENWB 5BXFA 3GBML 2LV4A 5KBMA 3S4SB 5D1XD 3E6FA 3RNQA 3D34A 3KYNB 4GW5B 4RZCA 3WSQL 3O4LD 2XNAA 1H3PL 2DTSA 1LVEA 2BVOA 3CLFL 4EIZC 1TUPA 3NZHL 2VLRB 3QORD 1NKGA 3TT3H 2NNCA 3ZE2F 3OWEA 4M93B 4BWWA 4MNGA 4OTXH 5IT2L 1M1XB 4CDGC 3HAEG 4ENED 1D5ZB 1ZHLA 2X0WA 3N43B 3QXAA 4H5SA 5DVMA 2DW5A 4LE8A 5J12C 4NQED 4P4RA 1K5NB 3RWJB 3RGHA 3UDWC 3VU2A 4HDIA 3FO2A 1ZTXE 3HE6D 3SZ6A 1EVTC 3AU0A 1RK7A 1HESA 3MRDB 4UT6L 2VN5A 3UOAB 3EJYC 3VD5A 3OKEA 3NPZB 5IV2B 5DUBB 4FQLL 2OTUB 3SDXF 1KXVC 4X6BB 4RCAA 1IGJB 2DDQH 3WXWL 4ELMB 1UZ6F 5FGBA 4TUJA 4LDCA 4WKZA 1T6WA 3ZDWA 1RZPA 2EO9A 4Q97A 3SGKA 5DHDA 5HXMA 3NCMA 4HIPA 4KQ4H 1XWVA 4UQEA 4ZXBD 5IFAH 3SDXE 2A7BA 2XN9A 4YGAB 2XG5A 4M6OL 4TUOB 1BX2B 1NPJA 2ZP9A 4NDMB 2BIIA 3FPXA 3ZKXB 4TTDC 1UZ6E 2YD7A 1KJ2H 2WXPA 3QDJA 1NC2D 4LAJH 1T7VA 3O8XD 1UJTA 4IDJL 1JIBA 3IJYA 2FTAA 2PXYA 3FB7A 5DTFB 2OJ1A 3V9CA 4JFPB 5A40E 3MGTA 1ZEAH 5IVXA 1ZLDA 4DUWA 2WYIA 5GIRB 3O6LL 4Y4HD 5FYJH 4V1DD 4CMMA 1F11B 2ROYA 2HP4A 4X7EC 1OP9A 3W9DA 2X44D 3Q1EA 2ZSWA 2Y7QB 3NOIA 1BQKA 3MV8B 2NLJA 1OAYL 3IRPX 3SGDH 1E6OH 4FQXA 1B2WH 1KC5H 5F7UA 2F53D 3NP3A 1GJWA 3STLA 3WIHH 2BVYA 5ETUA 3DSFH 1RIVH 1S9WB 2EE6A 2Y24A 3T8VA 1TSRA 2DIAA 3IDGB 3GXFA 2VDMB 3O2VL 4YQXL 1N67A 2XXFA 2VQTA 2XKNA 2BIOA 1JXFA 2A4ZA 1M7UA 3WLWC 4BE5A 5EZJA 1UH2A 3CZFB 4WUUD 2CBQA 1EHLL 3D0LA 2FLRT 5TH2A 5GS1B 4L5FE 2KZBA 4WFHE 2B3RA 3UO1L 5KVEH 5EF2A 3OKNB 4MJ6B 1UXLA 1W16A 4EDXB 5JHDB 4U6HB 3LDBB 4KXBA 2OYKA 4AGLA 1TYEB 2H32B 4Y0GA 4Z7OB 3SPHA 1T83C 4HJ0C 1D9KC 4JFZH 1IC4L 5IB2A 2X4PA 1NKRA 4NBXB 3VW3H 4NUQA 3RZWA 4L2YA 1BD2D 3D52A 3MGOB 3SE8L 4ODXA 4XAWH 3G5VB 2Z1PA 2HRHA 2QVFB 2M83A 3HI1A 1F1GA 1I7ZB 3HN5A 1G7LB 2UYLB 4Q9QL 2EE9A 4DZBB 4Y89A 2IGLA 4PFEA 4Y2LA 1CGVA 4TNWF 2BVQB 3TNMA 2CBMA 4Z7VB 2HX7A 4M03A 4ZW3A 5B7MA 1RP9A 3VSQA 2CALA 1X5XA 4FNQA 4JGUA 3KD4A 5D1QE 3UYOD 4TXVB 5D4HA 1J5DA 1ZHKB 3DTUB 2Z91A 4HZLB 5IHBA 1MHHA 4PGCB 5I1KH 2FQGA 1HOEA 3R18A 2CQVA 1MFDH 4NXSA 4P4KC 3T77B 3LS4H 1LO3L 1R19A 2H3NB 2LFEA 2NY1D 4HS8H 4JBSA 4Z7OE 2K78A 3WFCL 1QQDB 3PQYA 1JNLH 2GSMB 5ESQB 1FFNB 4PD4J 2CM5A 1YEDB 4NO0A 5BS0B 3IKCA 4NN5C 4XI5D 5CJOH 1DVFD 5GGSA 1G9NC 3QI9B 2FB4H 2HJLB 1TTUA 1TU2A 2DLTA 4UDUA 5JXAL 5FGCE 3EJSA 5IBUB 3B1UA 1I7TB 3DROA 4NLAA 3F5WA 2ESVB 3NJFA 3KLHD 4MMXA 3ES6B 5CINL 3APDA 1WC7B 3ULUL 4JFHE 5HHOD 4IIZA 3D85B 1GS8A 3FQNB 2CCVA 3CZNA 4ONHA 4QIRA 1ZMYA 4Z7VE 5IW6A 3JT2A 3TFKD 3BH4A 3ABZA 2HKAA 4Q74A 4YUEH 4EJ1C 4C55A 3GRWA 4UBDD 1TNMA 5E9DB 4Y2DB 4ZS7H 1ERNA 2CXKA 1A4AA 4GAAA 3BQUB 4OV5B 4PWIA 1K2DA 1W72A 3EDDA 3CDCA 4MA1C 1QLFB 4ZQKA 4P2RB 1N5AB 5DRZA 3HNSH 4YR6A 3C5JA 3BVXA 2JWYA 3THMH 4X7TA 4GKOA 2W8CA 4XP4H 2PO6D 5HHXH 3MXVL 2NNAA 1SOKA 3WO4C 4PRHB 3S35L 1MJ8H 3LTVA 4N8CL 3V5HA 1T04A 2ESVE 1EEYA 4MNQD 3JWDL 4FADA 5JIMA 1PEZA 1RK0B 4K3DL 2B08A 5CCHE 3BFOA 3PAVA 1ILUA 2EXWC 3G3LA 3MNZB 4LCUB 1ZTXH 1RJYA 2VABA 2BINA 1FNGB 3ARUA 4K5MA 1GIGH 1S78D 2HKFH 1UM6H 5E9DE 3R8QA 3TBBA 2FDBP 2KC0A 4GUPB 1GZQB 3T71A 3WIIL 4L4JA 4IGBA 5ESAB 3UGUA 4CJ0A 2NXYB 4WSGA 4KZEL 4J1UA 1QSFE 2C5DC 1J8RA 2C7UA 2CG9X 3PF2A 4PJBB 2Q7NA 5IEHB 3DVGA 3JWOC 1SVBA 2H26B 4AQAA 3L13A 2WNWA 2DM7A 5H8DA 5DS1A 1TJHL 3ZT6A 5IIEB 4GQ9H 1DR9A 3E2HC 5ALCH 3FQTB 5CILL 2YAQA 4KUZL 4ODUA 1YPZA 2IPTL 2W38A 1MSPA 4MS8C 2MSPA 4HMCA 3SCMC 3QIUD 2J5WA 5E00A 2BH0A 1BOGA 1ZV2A 3FTXA 1AXSB 4G8EB 3IDNA 1YUKB 2LFGA 4BJLA 2CRIA 3BKYL 5AB9A 1ZPLA 5BO0D 2Y5TB 3FHAA 2YRLA 4PGJA 4PBWD 1SF3A 4LCCC 3F00A 2L7UA 1RJZA 5LG1A 4YHKH 3TEUA 4F7EB 4PLJD 1N64H 1KDJA 1U3YA 4LBEA 4ZDHB 2VN7A 5CD3A 5IR1A 3U30C 4I0PB 2VDRH 4PJBE 5T3ZH 4X6CB 1M57B 3OB0H 2CLZA 2GJ6B 3T4AA 2Y7NA 2R7EA 1CLZH 3VUAA 4LEOA 3FONB 4K3GA 3D06A 3KLAB 2YAOA 3MYZA 1WWWX 5DRXB 4LSQL 1HYRC 2ZWLT 5IGXL 1INEH 4JG1H 4ZFOL 1Q94A 3RI5K 2AVFA 2FJHA 1VZGA 3RUGA 4HJTA 1FYTA 5IOPA 1Q0XL 1K3IA 2XQBH 2ITDB 1Q9OB 4GSDH 3W39A 2ED8A 2I9LA 3P2DA 2P28B 3AMKA 1ZLWK 4XVTL 3RWIA 2J44A 3FBQA 2J1WA 2VQUA 4G3YL 4D0CB 1N0LA 1BVKA 5AZ2L 4L5FH 2QSCL 1R3KB 2WM0A 5KS9A 1U91B 1XXDC 4OJEH 1G6RA 3SOBL 4ANWA 2WPGA 1UA6H 1OGAD 4ABVA 2J8UB 4FI8A 4G11A 2HVBA 3BVDB 4OLZL 2PW2B 2OAAA 3JTTB 4QKXB 2VLJD 3EW3B 4HT1H 4WWKD 4F2FA 4Z3JA 3IDIB 4C56B 1GPOL 4BK5A 1E67A 3Q5YA 2ENJA 3D9AL 4KVPA 5KYWA 3V52L 4AQ8C 3TN0D 3EUUA 2VDMH 5AOMA 4I48B 1LO5A 2HT4D 4YLCA 3PP3K 1NPUA 2Y0SA 2ZP0T 4NJAH 3P40A 4G6AD 3VGBA 3L81A 3GJFA 3RY5A 1T1ZB 1UXMA 1P4LB 3S35X 5D6CA 1WFMA 3DIFB 2B1OA 1LK2B 4QRRB 1T2JA 4XAKD 2OW6A 2R15A 2BRRH 1Z6JT 3QDMD 3ZIYA 5D1XC 3D3VA 2IO5A 1JHKL 2E59A 2NUPB 2QPDB 1EHAA 2W80C 4UQBA 4NQDB 1MH5A 1JVKA 3I9GH 2H32H 2CPUA 1GL4B 4JJ5B 4BZYA 1S2EA 3OTTA 2AEOA 3CFCH 4K2UH 2V3EA 3SEPA 3HUJA 3QORC 1DZBA 3TCXA 1QR1B 4JVPA 1KYUA 3N85H 2Y6SD 5GGRB 1F3JA 2ODIA 4ENEC 3O41B 1IRAY 1MQKH 2XETA 2DWYA 3QUZB 3QP3A 4UQ9A 3RIFK 3TT3L 43CAB 1LE9A 4M1CD 1LK3H 1MI5D 5CGBA 4OTXL 4UT7H 1PF3A 3HE6C 2QGDA 4KQ3H 1MWAB 1PY9A 1SYVB 5CCKH 4FD0A 2XV2A 2L8AA 4W9KC 3W3BA 3V55A 4ADGA 1UOLA 3AC0A 1ADWA 4RX4A 1KOAA 5G5DA 3Q3GA 5JIHA 3U46B 4J23A 5JHLH 4PD4K 1SPDA 1J12A 2DLEA 2OMZA 2XN0A 3GMNB 4CMHB 1A4JA 1P0SE 2VH5H 4X0NA 1TQUA 4F1SA 4EI6B 2DDQL 4KJYA 1Y18A 3VRIA 3FTGB 2X4TA 4U31A 2OMUB 5D93C 4LLWA 6TAAA 2X0VA 5LBGA 4NQDE 4PRIA 4ZXBC 3POHA 1BQRA 3IMUA 5B1AB 4P2OD 3BSHA 5HYIA 3FSVA 4KQ4L 2XZAH 4UTBH 1UOWA 3EUDA 5IFAL 3U0PA 1BFOB 1BREA 2O72A 2P5ED 4JPIB 1DL7H 3O8XC 5HBBA 1KJ2L 4ZS6D 3TURA 2GUYA 4Q9CA 2XPYA 3WMPA 1LP9A 2X4SB 2BNQA 3BD4A 5DVOA 3LQMA 2HT2D 3RX7A 5KZCB 4Y4HC 1ZEAL 4NKOB 5E8NB 4LLQA 3NACH 2WAQA 5AENA 4K94C 4QXVA 4W68A 4GO8A 3ZTNH 5DWPA 2E76C 4DF9A 5FO9B 5MEND 5D2LB 3ARDD 3VQMA 1KIPB 4UTAH 3VXQA 5DFAA 1HQ4A 5CBAB 2XV0A 1QHQA 2DM4A 5LJYH 1E6OL 1NQBA 4NNXA 3RVUD 1B2WL 1KC5L 3BH9B 3CC5A 4EUPB 3DSFL 1RIVL 3JV6B 5CU9A 2BP8A 1XT5A 5JYMA 1BMGA 4ZMPA 1QO3B 4M5ZH 3U0TA 3QUYD 4EXKA 2NYKA 5KEZA 3VWKA 2IWGA 2BNRB 3EFFB 3IXTB 2V0AA 1P4UA 5AUMB 5FM5O 2HSIA 2Q86B 3IJ7A 4L1LA 2GC4C 5F7NC 3MVSA 4IRSD 3WHE0 2EVHA 1MFBH 3R7QA 3QVAA 2OPCA 4OGXH 3CE1A 5C0RH 2WMPA 4KKZA 3JZYA 4WV1C 4G8AC 5KVEL 1A9EB 3RURA 5HHPB 3GMLA 2R0LL 4PJAF 4LLDA 3FO9B 1XMWA 3S5LA 4RVBA 4JFZL 4MDJA 3VNYA 3TIEB 2G4EA 2OXHA 2Z7WA 1GHFH 5I8EA 3W5NA 5EUOA 4NQCD 1FL5B 2H1PH 3FT9A 5L8JB 3FOLA 3K6NA 1B9ZA 1CS6A 2DMCA 4XAWL 3MCG1 1CGUA 4QJ3B 3LKSA 2ENSA 4JW3A 5CEYA 1FDLH 4LDEB 4PJAE 1R3LA 4XN2A 1WT5C 3WS6A 4YO0A 1QUNA 3HC0A 4N6QA 3U6RA 4MAYD 5LHDA 1ZGLM 2BNRE 2X6MA 1HJCA 1SF5A 1URZA 5DLML 3DECA 3QFDA 3V5KA 2PTUA 5DHVA 3F6LA 3GSNB 2JJSA 1U8HB 5GSVA 3ZY7A 1T83A 4PJDF 4N2IA 5IVZA 3ISRA 4RGNE 1CGWA 4AIXA 2NY1C 2W9EL 4L4VB 2Y25A 2VW4A 2YSTA 4NIKB 5DK3A 5I1KL 2IGTA 1MFDL 3HAEA 1EH9A 1HI6B 2XSKA 3LS4L 2QFRA 4HS8L 4XI5C 1YEEH 1DVFC 1JNLL 4YXHH 1IAIM 2CMRH 5CJOL 3WL9A 2WYTA 2W59A 5HGHA 1EUUA 1ICTA 4PJDE 4HJ1A 2FB4L 3W56A 1TEYA 3KLHC 5FIEA 4A55A 1DQMH 3CVHB 3DNKA 1QI3A 4G1MA 2EEFA 2KZWA 1TJGH 2NR6D 4BCZA 2F54A 2VWEE 5KVGH 3TFKC 1OD9A 1NANH 1FZOA 2I60L 1HXYB 1SRDA 3JWNE 1MCSA 5C0BB 4KVCH 1K4CA 3WY3A 4E41B 3KLLA 4XCFH 5HHQB 2AXFB 1QWNA 2CDEB 1UD2A 4QLRA 4P4KA 3CMGA 4UBDC 4UM8A 5D9SB 4YUEL 4B9CA 4YDLC 1C5DA 2ZNXA 4MZ2A 1NMBH 1EFXD 2OTWA 3QCUH 2P8MA 4H4NA 4ZS7L 3U6XA 1CF8H 1P6FA 3LEVH 3GJEA 1E43A 4HWUA 1IAII 4P23D 1UWFA 3WD5H 3HNSL 3RWDA 4GAGH 3KH4A 2PO6C 1BQUA 1DVYA 4XGZB 3THML 1BZ8A 4RMTA 4G7SB 5AW5B 4P3WA 4PWEA 4GSUA 3KXFB 1IM3A 1BYPA 4XP4L 2C3GA 3H0TB 4W4OC 1C7SA 1QYGH 1ESOA 5HHXL 5JPNC 1O75A 2MHAB 3QFJA 4NZUH 3X3FH 4CVWA 2EKSA 1VKXA 1MJ8L 3DX6A 2B1AH 5E2JA 3OJMB 1SQ2N 5GHWH 1G4MA 3WDHA 4O2FB 4UQ2B 4ADJA 5A2AA 3MMEA 2NY4D 4ZO7A 3OB8A 2EIDA 3BKMH 3L1GA 4HKBB 3CIAA 3OJDA 5C0EB 3WNLA 1S78C 1XIWA 4F8QA 3VE0B 2LGNA 4X6EB 1ZTXL 1MIEH 1SLUA 1DBAH 1GIGL 3FRUA 4JO5A 3BO8B 4CJ1A 1A6AB 5L2KB 5E0FA 3VFWA 4FTVB 1UENA 3MROB 4IHBA 4WKXA 5FM5M 3WBDA 2F5BL 3QQ4A 4IMLA 5F9JA 2A3TA 5J11B 5HGDA 2BSSB 1WIOA 2FL5A 2K6YA 4MLIA 3KXFE 4Z5RA 4HC1A 1OAKH 2VO8A 5C0AD 3LZLA 3QIUC 3VA6A 5ALCL 4NOBA 2PF6A 1UD5A 1JWMA 3S3SA 3T3MF 1FVDA 2G0LA 3KNBB 4PHZA 2KHAA 3WU1A 3F05A 2F15A 1WA2X 2HWZH 3QXVA 1IEHA 3CSPA 3L4XA 1MWAH 2CR3A 4LP8A 5F7KC 3ULVD 4BZ2H 4H8VA 2ZUWA 3UEZA 1R46A 4MB1A 4PPTA 4FEIA 4PLJC 1JK9B 4AQ1B 2OI9B 3PWNA 3T3ME 4YHKL 2PYFA 3C6SB 1N64L 5L2KE 1R3JA 4FC3E 2WZ6A 5IKCB 1JGEA 3SPVA 2VDRL 5C0JA 5T3ZL 2VUYA 1AYOA 5CEZE 3WLBA 2OYPA 1BZQK 1B9KA 1YEGH 1U8QB 2A9AA 4U1JA 4KZDH 1CLZL 2CO3A 1AGFB 3MFFB 3EJUA 4LLMB 5HJ3A 5DHEA 4PLNC 3ATFA 1INEL 4JG1L 4OCYH 4DZ8B 4FXGA 2YAHA 3D6GA 3MRHB 1BOYA 4R97B 4NCC1 2UX6A 4P2CG 4AK1A 3P3UA 1T89C 2XQBL 3P77B 5DHYB 4HH9A 1Y6KR 2OQJA 1E9OA 4GSDL 2DWEA 5KSAA 2VLKA 3EGXB 5DDHA 4LCVA 4LPYA 4D0DB 2AQ3A 4L5FL 2EP6A 1JNJA 2WN2A 1KFGA 1NUDA 2R83A 5CJBA 1LNUB 1JWSB 5AL0A 4LPCA 4YPGB 3OSVA 2NT0A 3OPZL 2XWZA 4P9MH 1IIKA 2XTSA 3CPLB 4B5ZA 4ILDA 4P07A 4WWKC 4R4ND 4PY8J 3BUYA 2AEWA 3DRQA 3LSOA 5DUMH 2A99A 4UANA 3CSGA 1OB0A 1FVCB 1JGDA 2I27N 4HT1L 3CN3A 3OKKB 4JAMA 5HJBA 1IE5A 2XIIA 5IQOA 2FECI 3TN0C 2KLRA 4JRYA 2HT4C 3CHQA 1U3NA 3RL2A 1PD0A 4XPGL 7CGTA 3ATDA 4MX7A 5M7QA 3DBXB 3Q06A 5INCA 1C7TA 4G6AC 4MGXA 1A1MB 2VDML 1N68A 4LLUB 1TENA 3II2A 5LXVA 4HPYH 3IMWA 4K5LA 2A77H 3BGMA 4NJAL 4B27A 2YPLD 1WEJH 4U0RB 3L5WA 3NPSB 3FSZA 3BP5A 3AT8A 4E9YA 4CVXA 2BOLA 4G9DB 1BXAA 2X4RB 2VDNB 3CDYA 4JFDE 3OZKA 2PCFB 4XODA 4E0RA 3FCSA 3C08H 3LHPH 4AZ8B 2BRRL 4I4WB 3NDZE 3W38A 5CWSA 4XXWA 1KWKA 3QQXA 4PBXA 3ESVF 1OF2B 2WNKA 4UQCA 4Q4IA 3VFSA 2D3JA 3S9DB 2CKNA 1GGCH 3I9GL 3G9AB 3U36B 4UMSA 4PRBB 2OYMA 2Y6SC 5F3FA 3CFCL 4K2UL 4AQ8A 1GJIA 1ROWA 1SN0A 4G6ML 4M1CC 4B9ZA 2ZUTA 3N85L 2ATKB 5EU6A 1YMHB 3H6AA 1WIPA 2K0RA 2TRYA 1MQKL 3MBEA 2H9GA 4Y5XC 1EXGA 5CR8A 4MKMA 4UT7L 4BUHA 4R0LB 4KQ3L 5CCKL 1U3HA 3MJ6A 3SE9H 4BQBA 3LOWA 5C9JB 2VN3A 3VU1A 2ALWA 2YQGA 2A74C 1UT9A 3OMZA 1FG2B 3W9EB 3IBOA 4ABQA 5I5MA 1KCKA 3EYUL 5CIPA 5CMAA 1BQLH 1I53A 4A39A 3O4LA 5IW1B 1X7SA 3GSNH 1ZHNA 3FT3B 2VH5L 4M29A 3D5OF 3SD2A 1NBZA 1QP1A 4LVEA 3L08A 3ALXA 2X4OB 3QORA 1R5IB 4P2OC 1NH6A 1GKOA 4MD4A 1S9KC 3LPFA 1RHHB 2ICWJ 3BPLB 3NYKA 4NZJA 2FQDA 3TS8A