3G6AA

Crystal structure of anti-il-13 antibody cnto607
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
210
Chain Sequence
b'SYELTQPPSVSVAPGQTARISCSGDNIGGTFVSWYQQKPGQAPVLVIYDDNDRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCGTWDMVTNNVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO607 Fab Light chain
molecule tags Immune system
source organism Homo sapiens
publication title Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607.
pubmed doi rcsb
total genus 39
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aA01
2AQ2A 1FJ1A 1OP5H 1T0PB 1A9EB 3ZKXC 2JB6B 4NNPL 5SWSD 5DMIL 2P7TA 2BJML 5KOMC 5F9OH 3L6FA 1EEZA 1A7QH 5F7LB 5JR1H 2EE6A 3VW3L 2WSKA 15C8H 1JMXA 4Z95H 5FO7A 5TDPA 2AI0H 3HMWH 2AJXL 1S5IH 5E8NA 1IMHC 5K9OB 2VDQL 5C0BD 5D7SH 4Y5XB 4QHNB 2E9BA 5CP7B 3UTTB 1BF2A 3W0WD 1N4XL 4LPUA 2FYYB 3AMLA 5IBUG 4XX1G 5JW4M 1GGTA 2YSSA 4Z76B 1LE9A 5DEGA 5I0DA 2CKNA 1A9BB 3CUPA 3CZFA 1R24B 1T1YA 4KROB 4DZ8A 2C9AA 5DURD 3RVXD 25C8L 3KLAA 4JGUA 3S34H 2JE8A 3QDHA 4HG4J 1RK0A 3V7AG 1NAMB 2NY7H 1BP3B 1WZKA 4N0YH 4ZPVB 1AC6A 1BVKA 3RKDC 3GMNA 3MRCB 3E8UL 1HQRA 2VSDA 5IW3A 2F54E 2D4DA 5FIEA 1OSPH 1LP9F 2EO9A 3JV4A 4GJTB 4N1HB 3LN4B 3S3JA 3VXRE 4BELD 2JB5H 2LQRA 4HC1A 1EUUA 1MF2L 1CF8L 1CR9L 4CL7A 1LHZA 2AERT 5HD8D 4KRPB 4MS8D 5CINH 4EDXB 3QUKB 4WHTB 3WS3B 1VSCA 5ADPL 5C6PB 1E4WL 3S34L 2FEEL 3C87A 3SKJH 2YBRB 2JIXB 1MHEB 5KSBF 3CSBA 1A0QH 5F6IC 3VG9B 5IEKB 2V7HB 4AIZA 1FAIL 2VXSH 2X4OA 3HR5B 3CDGB 3MLPA 4E42B 1B4JH 1BFVH 5F7HA 3TC9A 5E8OB 3OKYA 1IVLA 4OD2A 3OKNA 5KVEL 2DKSA 1BEYL 2WBJC 3C6LC 2QADB 1Z9SA 2Y1VA 4M6OH 1RVFL 2AJXH 4J3WA 4I0PB 2GQHA 4PJHB 1B0RA 2WBJB 3C6LB 4O2CA 1AO7E 3I2CH 3WFDH 4LQ1A 4D0DB 4F7CA 5GRYA 4EVNA 3QDGD 3WJLC 1BGXH 3FT4B 5JIKA 3FQUB 4OCXH 4BFEA 5ICZB 1NAMA 4L8BA 2NLJA 1DR9A 4HJJH 3QA3B 1SEBA 4ESKA 3N1MC 5DEFB 1IAMA 2Q6WB 1C8PA 1M05B 4X6DB 4N0CD 1DFBL 1KB5A 5E7BA 4MNQD 4J1UB 2MSPA 4WHDA 2D7TH 3VD7A 4YLQT 1N3NA 4M3JA 2CJUL 4F7MA 3BSZL 3V4VL 1DUZB 4Q74A 3DBXA 1D5ZA 5CHNB 4JG0H 4KRPD 1LWRA 3F12A 3QPQD 1MFAL 3IDXH 4XX1E 4IHOA 4GAGH 2KL6A 3GFUA 1VFBA 1GPOL 2N7BA 4HKBA 4TSCH 3LZFH 4HIEB 1JPGA 5F3BB 1NCBL 2BC4A 5FHBH 2QKIA 3DECA 4U1JB 3SDXE 5CCKL 1AJ7L 3ZSTA 2VZUA 5HI4D 4XVSL 4WU5A 3MV8B 4YXLL 1K9TA 5ICZA 5IFAH 3H42H 3O3DA 3KJ6H 1U92A 4YDIH 3CVIH 4M62L 3W2DL 1D5IL 3UYRL 1RZKH 3KPLB 1KN2L 4UU9A 2B39A 3AS2A 5FB8B 4JFZL 5A2KH 1HINH 2H9GB 2AXGA 3GJFK 4MXVE 1XR9A 4PY7B 1IRAY 2AJYH 4GMTH 1HCVA 1NJ9A 2YXMA 1CE6B 4JZOA 1GGYA 1Q9LB 4OQTL 3GMQB 1HOCB 2ERJC 3VXSA 4F2MA 4BYHA 2EC9T 1VKXB 2FR4B 5C0RL 4JFFA 5IGXL 3OX8B 3PNWB 43C9B 4IMLB 3I6LD 1EGJA 1CLYL 4EVNB 5JOEA 3VRJB 4HULB 2MPAH 1NFDB 2A74A 2M2DA 4ZSOE 2X9WA 2I9LA 3BGFC 1CXEA 4UINL 3S4SG 3QUMH 1FLTX 1XF1A 3IDUA 4PJFE 4K8RH 1A9BA 3QWOB 3CSYA 5E5RB 4MXQD 2MCPL 3PL6D 1XH3A 3KLHC 1GL4B 4JDVA 1NANI 4MAUH 5HVHC 2ADFH 1WC7A 2NZIA 2DWEA 1MRFL 4Y16B 1KBGH 5IB1B 5DRNB 4U6TA 1K4DB 4TOYH 2DOCA 1KLGA 2LABA 3RGVC 2P24A 1UZ8B 2X10A 3QUMA 1NFDA 2R4RL 3OJDB 1T7VA 1FE8H 4YHLH 2CKBL 1ADQL 3ZT7A 1KT2A 4K23H 3P73B 3GK8H 4Y1AD 2Y9RT 1QRNE 4FFVD 1P1ZB 4HK0B 4NUJA 5DHVA 4BM7A 1JFQH 1XCTA 1WZ1L 1VERA 5LGJB 4FG6D 1CFSA 8FABB 3T0EB 3D3VB 1MH5A 1Z3GL 4H8WL 4YDLC 1E4KA 1L6ZA 3WBDA 4YAQB 3RL1B 2KQNA 5DZLA 3MC0A 3QCTL 2UY6A 2IPKA 1T3FA 5DHVH 2VLRA 5EU3B 2P5ED 4KK8D 4WU7B 3ZTNH 5F1OB 4WEBH 1U8QB 5C2UB 3BH8B 3Q5OA 4I5BB 1KACB 5C0CE 4NYLB 3PWPB 4P2OC 3QH3B 1LO0H 2X4RA 3C09C 1QSFD 3MRQA 3O8XD 3QB7C 4BFBD 2YXFA 4PIRF 5JW5A 3GJFB 4PJGB 4L4TB 2V17L 3O0RH 5GZND 4Y1AE 3U83A 4IS6A 9CGTA 2AKRA 2YK1H 1QYGH 3QCUL 3VXUD 3QWOA 1UM4H 3D0LA 4LKXA 4P46B 3V7MA 3ARTA 3JTSA 2BY0A 5D2NE 1NBQA 4LVOB 2OK0H 1UM4L 5IROA 1XF2B 2WM0A 4M1DL 4OAWB 5GISL 1SEBB 4GRLC 3QCUH 1Q94B 3OKOB 3QDJB 4Q9QH 3TA3D 3G5ZA 2CIKA 5JOPD 2EE9A 2EXWD 3BZFB 4QRUA 5C0AA 3VWJD 3ALPA 1F02I 1ZWIA 2A2QT 2XQYK 1Q9OA 1A7OH 1Y6NR 2YPLD 1EJOH 5GZNC 5H2BA 4EN3D 3MRBB 2BNRB 4HEME 1GGBL 5MEPB 5F96L 1CDYA 5AUMB 1FGNH 2YS4A 2MOVA 1SJHA 3NCMA 1JHTB 1LO2H 1YUHA 3C5ZB 4X6BA 5JO5A 1G9NC 4Z9KB 5D2LA 3MUGB 3WHXA 4Z7VA 1FZJB 3QCTH 5JXED 2QTEA 4QHKJ 1JUFB 1A6TB 1QSZA 4JFDA 4NGHL 3DMMA 3MJ7A 4IDLA 4UDUA 1PGRB 3EYQD 5IBUB 5BMFH 1AIFA 5KSAC 1A7PH 2FLBT 5DZOA 4KK9D 5ALCH 3GMLB 2W38A 4WTZG 5HPOA 1J5OH 4PGDA 1A4KA 4RISH 3BUYB 4EN3C 4R90H 3QRFM 4L4JA 1BAFH 5DC0A 4CGTA 4WV1B 2JB6A 1EGJH 1LO3L 2YK1L 1HH6B 2ZOKA 4J2XA 2P8PB 1NCCL 5CJQH 4AEIL 5GRVL 5B22A 4LNVA 4OM1L 5DJDB 2XQBL 3MJ9L 2YR3A 5FOBA 4YHIA 1VEPA 2WUBH 4DAGL 5D7KD 4X6FA 1I7RA 2A0LC 5GGSY 2CH8A 4YNYB 4MD5A 2EDDA 2EE3A 3T65A 1R3HB 2MJWA 4XI5C 2ZNWA 5TDNB 2FX9H 1XGTB 5DDHB 5E9DE 4U1LB 3MXVL 4ZOEA 5JHDD 1GYAA 3TP4A 1FG9C 3NVQA 3E6HA 1B4RA 1ZHLA 4YZFF 4MNQE 3B8YA 4UINH 4X4YA 3UPAA 3GMMA 2FIKB 1B90A 1B0GB 5I1DA 5E1AA 1FORH 4M8QB 4FFWD 2NXZD 2VKWA 4PS4L 5J11C 1A6VL 1LK3L 4UV7H 4MNQA 2O5XL 5ACZA 3HPLA 3SE3C 1ZOXA 1W8OA 4PRAB 1WZ1H 1IBGL 2R23A 4GW4A 4QY8B 3GSNB 1QFWM 1H5BC 4AH2A 3D6GA 4L29B 4YGVA 5EU5B 2DL9A 1DE4B 3SQOL 2CKBH 2NY1D 4LGRB 2ORBL 3EIFA 3RWJA 1F4YH 4OZGE 1T4KA 1WF5A 1YEIL 1VACA 2ARJA 2P8MA 4U1GB 1X5IA 4GT7A 3FO2B 4N5UA 4P5TB 4WFEE 5KS9F 2PW1B 1WFTA 4LHUA 4YPGA 3H3PL 1MRFH 3CGTA 3OJVC 3ARZA 3HAEH 4HJ0D 3UDWA 5C0IA 4F7TB 1FVEB 3V0AC 5FGBC 5LGHH 4HWBH 5SWZD 3QIUB 4F33A 4K8RL 1H15A 3OXSB 3JWDL 5A2FA 1UCTA 3WEXA 4LSVH 3ILPB 1U2CA 2BDNL 3PHSA 1OLLA 2O61B 5I74B 2BY2A 1X5GA 4ZPVA 1LO5B 2CRIA 3B43A 3DXAD 1HHJA 2ED9A 3LQZB 4XNMB 3MBEB 3ILQC 4IJ3B 1QO3A 1BECA 1PQZB 3I6KB 4GMTL 5D5MA 1C5CH 3D2UA 4KUZL 1U36A 2VDLH 3ZKND 4R0LB 4I3SH 5E2VL 2P43B 3KPSA 1OLZA 3OV6A 3E2HC 5HHNA 3FQRA 4ORGA 4KJWD 4QLRA 3REWB 3DYOA 1RUPL 4L9LC 1MCRA 3IU4L 4LCWA 5B4MD 4GG6F 4JKKA 1LEKB 4NC0B 4TQEL 1CFNB 2GY7B 3K8KA 4I48A 4F7PA 4OFYA 4C83A 1BQHB 4PJAE 5I1IH 3T3PE 4AJ0A 1AXIB 2PKDA 4U0RC 3DUUA 1YY9C 1PG7L 2XPGA 2DTML 1S7VA 2XZQL 2Z8SA 3UTTE 3B2UD 1SY6H 4CVZA 3EOAB 1A4KB 1EH9A 4OLZL 4PJFA 4PB9H 4D8PA 2CJUH 1Z9OA 4ZFGH 5E03A 3RKPA 2AK1L 1KLGB 1GXEA 4JFDB 1OARH 1WVZA 3PWVA 4G8EB 5CZVH 2B4CH 1UZ6E 1RIHH 4Z77A 1EK3A 1IKFH 4IIQA 4PV8B 5D1QA 1JGUL 5L88H 4E0RB 4HGMA 2BVPB 4U6VL 4KK5C 3BD5A 3UP1A 5J9PA 3T1WA 3GSRA 3U0TA 1Q0XH 1P6AB 2ZUXA 2OTWB 5FM5M 5IBLC 3EOBB 1KFAH 4HAFA 4K71B 2G5BA 4M93C 3WFDL 3PWPA 1FPTL 3MNVB 3MLVH 4KRPC 4MNHA 4OCRH 3MRGB 4M7KL 1LD9B 5BVPL 5DJ2A 4ZUTA 1HIML 2BERA 4JRXB 2E6QA 1S3KL 4L9LB 4EIGB 3HPLB 2R2HB 2Z31D 4C4KO 3G5XB 4X4ME 4AENB 5AAWA 2HT2C 3BN3B 3GI8H 1OAYL 1OGTA 2I26N 4LNRB 4R0LC 1INQA 1ZA3A 5EPMB 2IWGA 3FMGH 1IAIM 3GMOB 1OP3K 2ZP0T 3MBEC 3UPRB 4ELKA 5MERA 2YA2A 3A6BH 4P23A 3RVXC 1MF2H 4P5TA 4MWFB 2NNAA 1I1RA 1GGIH 5L9DL 4JY4B 4NUGL 1U8LB 5TQ2H 4AG4H 4LF3A 2H1PH 1LQSR 4N68A 3U7WH 3O6KH 1WZLA 3BO8B 3MRRB 4CKVX 2X41A 1RUQL 3W0WA 2CLZB 2ZZUT 5I9QB 2R39A 5E9DD 4KJQD 1T1XA 2NQCA 5EU5A 2BJMH 1K6QH 3VXNB 2J8OA 4MJ6A 1SEQL 3HNTH 3NTCL 3CFEB 4IOFD 4Y2DD 3N9GH 4I9WE 4M00A 3QUXD 1FCGA 1QHPA 4G8EA 4X7FC 1UJ3B 2AABL 1A7RL 3KVQA 1INDH 3PGCB 3ARBC 3RHWF 4OCWL 2OP4L 3WHE1 5CJBA 3MGAA 1CFQB 3WD5H 4P57B 3EDJA 3ZHKA 3P77B 2A6IB 1FZJA 1RFDL 1VENA 4LCWD 1CFTA 2CO7B 4ZUVB 2O61A 1U91A 3MGTA 4HQQL 2EKSA 3UBXA 2W1NA 1PD6A 1YMHB 4YHIB 1AD0B 1F4WL 4PREA 5GRVK 4Z95L 1D5MA 3I3EA 2WBJD 3C6LD 1B2WL 4W4NA 2J88L 4P59H 5EOTA 3SDXF 1GHFH 5C8JB 5DHVB 5JR1L 4PJIB 5F89B 3BKMH 3RWCA 4DW2H 1V7ML 1FNLA 4X9BA 5D71H 2GKIA 4J3UA 4NNPH 1SHMA 4HIJB 3L7EB 1MPAL 3CMGA 5L7XH 2E5EA 3MLZL 4P9HL 5JIHA 4WO4D 4POYA 3HE6D 2PXYC 2X4SA 1C7TA 3SHSA 1OCWL 3IFNH 4NKIL 3CDCA 4LSDA 3DXAE 5EU3A 3RUGB 2H45A 1QKZL 4WU7A 3GKWL 3MACL 2B1HL 1IGML 3HRPA 5C0BA 3RNKA 2ZG1A 3CH8A 3VFPA 1JPTL 4Y5YC 3M1BA 3B2UC 3MMEA 2XTJC 5BQ7A 5MEPA 5F7YC 5HYEA 2Y6SD 3ZTJH 4MDIA 3FT2A 3QIWC 4I2XB 4JG1H 1H3TA 3FB7A 3HTLX 3KPTA 4JRWA 1BVLA 2V5YA 3V6FB 4PJDA 3WXVL 5GSRB 1A1MB 1MCKA 3MRKA 5DTFA 5JXEA 5GS0C 2R1YA 5IM7A 4L3AA 1BOYA 1IGJB 1KT2B 3VD4A 3QUMB 1UZ8A 2DWDB 4NNYB 4PJHF 2YWYA 5F7EH 1XF2A 3U4EA 4XXDA 2GFBB 1IFHH 5EOQL 5E2UL 5C9KA 4KK6D 4P4KD 1IEAB 4WI9A 5DZNA 4WHCA 3UTSB 2N1KA 5KW9H 4HC1L 4IMKA 4M3KB 1CS6A 1RJYA 3BIAX 2IQAA 2Z93A 2NCMA 4QTHB 1I7UB 3SGJA 3WE6A 4BQCA 4UIMB 4PJ5A 3BP4A 4HMEA 4HIHA 1MI5A 3DETC 3GO1H 3EOYG 1IC7H 2Z35A 2EIZB 1EX0A 3VRJA 5JIIA 2IQ9H 2HFFB 1DSFL 1V3KA 2DQUH 3ISWA 3L3HB 3WJJA 1T2JA 1LO5A 1MREL 1BFOB 1I4FA 3JV0A 5J11B 3CSYB 3VDCA 4D9QD 5J7CC 1NFDF 1JPST 4HSQA 3MOBL 3F5WB 2YMXL 3H9HA 2VL5A 4KROD 2IPUK 2XZAH 4JHWH 3MV7A 4PJEF 3VRLE 4FN0A 2KH2B 2BHZA 1WEJL 3T8XB 5JHDA 2UVEA 5CZKA 3HG1E 4ERSH 1F3DJ 5EOQH 4F9PC 5EZOL 2EO1A 4HHAA 3D85D 3G6AB 1FC1A 1DEEB 2HTKD 4NN6B 3RDTA 1M6OB 4MSWA 4OJFH 4QHMB 3TT3L 1JGVH 4DGYH 4DTGL 3WXVH 3SGJC 3IAPA 3O11B 5IEHA 3WLWC 1JWMB 4UQ3A 4OI7A 2E7CA 1QFWL 1BMGA 2ICEA 5C0AE 4U2ZA 1G1YA 4E41D 1G7MA 1IT9L 1ZHKA 4GMSL 4P3CL 2Z8WC 2I9TB 4N8VB 3BPCA 3AC0A 4BH8B 3HE7D 1PG7W 2V9RA 1WIPA 1Q9KB 2ADGB 2D2OA 1KPUB 3HI5H 3LKQB 4KXZH 1X5YA 2ATPA 3PG2A 5CEZD 3SE9L 1WIOA 4JDTL 4NQVA 3V95A 2VLRE 5D96B 5C09E 4DZBB 4YDJA 3D3VD 1IGTB 1MCLA 4H20H 3BVNB 4U31A 1NBVL 1ZLUK 4DZ8B 5KS9E 3QDME 4WY7H 2IPUG 5F7EL 5ITFB 4LKXB 4P46A 2FJHA 2K9UA 4DW2L 4HFWB 4XNYL 4XNUH 5TFSL 3U2SA 3IJHA 1S7SB 2J88H 3FOMA 2DQHL 4GUPB 1E0OB 3O3DB 3LKQA 4NHCL 5DC4B 1QVOA 4PRPA 4JFDD 2EDQA 4BJLA 1EAPA 4Z8FL 1OGAB 4OZHB 3BIBX 4PJHA 4Y4FC 4XCCL 3LEXB 1KJ2H 3DO7B 1T22B 5GGSB 4X6CB 3VXUA 3DV6B 2C7UB 2R0LL 4JHBA 4M6NL 4EOWH 3H6JA 4PJDF 2HMIC 2YD7A 4KRLB 3LKRA 4G6FB 3LN4A 1WFNA 3QP3A 4UQ3B 5C1MB 2HN7B 3Q5YA 1CT8A 1H8SA 3HC0A 1J0JA 4G5ZL 4Y0GA 2FJHB 1OCWH 2W9EL 2OTUA 1U93A 3TBYB 5DVOA 1DN0A 1QSEE 2A74B 1I75A 1KB5B 2C5DC 4P9HH 4UOJA 4B5EA 5DJAB 5H94A 1MCDA 2B1AL 3B5HA 1XF5A 1NMAL 3STZA 1FYTE 1WAAE 1RHHA 5T1KD 4G8IA 4Y8AA 3LAFA 1XR8A 1TLKA 5TF1H 1GHFL 2D0HA 4P4KC 3U7WL 3LN5A 1CQYA 2AJUL 2X09A 1KCRL 4P5TD 4WFFE 4YEEA 1FNSH 3WDJA 3IXTB 1QLFA 1JPGB 2VWEC 4O02H 1HSAA 3RZWA 3OJMB 4N8CL 4A6YH 2X1OA 3SE4C 4QRQA 3EYVA 1MCNA 4NCC2 2G75A 2HKFL 3FOLA 4M48L 4LMQI 5GIRB 3WD5L 4RGNE 1QFUL 4LIQL 3TIDA 2PW2A 3S37H 5EWIH 1FFNA 5FO7B 1DVFA 3BH8A 5HI5C 1M05A 2XICA 3LY6A 5HI3D 1YJDC 4XHJC 1AXTL 1FP5A 1TDQA 2C4XA 2ID5A 4WO4A 1O7VA 5TE7H 4LCUB 1D5ZB 5D8JH 1SEQH 1FBIL 3T8XA 5DI8A 3X14B 2GTZA 1HSAB 4IRSC 2JCCF 3MV9B 4QRSB 1OT2A 4P2RB 4I18B 4KFZC 5IK3B 1JGUH 3O6FC 3D1MC 5E08L 3QYCA 5F9DC 3TIEA 4K7PL 5C0NC 4PJDB 4FQJH 3NCYP 1CLZH 1KXTB 1KPUA 1EFXD 1XF5B 4N0UE 3STZB 3S8WA 1V05A 2F74A 3QEUB 1FJ1B 2ZJSH 4DKEH 5CWSB 1AR1C 1ZANH 2WBJA 3C6LA 5HDLA 1XGRA 2FB4H 3K1DA 5D7IA 1MHPL 4XTRD 3O41B 5F97E 5TPWL 4TVPL 2FGZA 2NY4C 5DJ8B 1OAXL 1OWWA 4Z7NF 2WK2A 2Z92A 1K5NA 4XZUA 2YHGA 1O7SA 3RL2A 4LASH 1DBML 3IVKA 1INEH 3HZVA 5D7IE 3PHOA 5MEOB 1JCKA 4QRRD 3VJ6B 2VISA 3E0GA 4G3YH 4F58H 1UM6H 4HXAL 2YPVL 1IAOA 1QRKA 3S35H 3U4EB 5IFJA 1QVOB 1Q9WA 2IJ0C 5HTSA 3EYUH 4H1LA 1T7WA 4U6VH 2P5WA 4PJ9A 1ZVSA 4R4FH 2OSLB 2BFVH 5FYJH 1IEAA 1RZFH 1UZ6F 5DD3H 4FFYH 1P4IH 4MXWH 3HKFA 3IFPB 4AT6B 1CK0H 4OZGA 4P99A 3K2MC 4R96A 3GBNL 5JOFA 4CADA 4NRZA 5LWYL 3C8DA 2NY5H 1KN4L 3IB4A 1FV1B 5TGBA 5K59F 3HMXA 4LLQB 4K3DL 3OKEA 4E41E 1HILA 4YJZL 1N7MH 2ZCLL 4L9LA 3L7FA 4Y19D 5EIIA 2YKLH 4UNUA 1A64A 1TENA 2BNQB 2DTMH 4Z18A 1T22A 3JWDH 3ZKMD 1ZHNA 3MYJB 1BF8A 1K8IA 2M26A 1MFEL 5LG1A 4GG6B 3H3BC 1I9IH 5INCB 1G9MC 2CK2A 3H2WA 1U95A 4PRIA 3HMXH 3JZ7A 4KI5C 4P23B 4C55A 1Q72H 5F1IA 4N90D 3DLQR 5D7JD 5HHQB 4NQTA 1S7RB 1CFBA 3VXPA 2XTLA 1AGEA 2JJWA 3K8LA 5FYKH 3RPIA 4I3SL 2HJLA 5CD5D 3EO1B 4OLUL 2XRAH 3VG0H 5FDWA 4UTBL 4UILL 4JE4B 4N5EC 4G8GE 3VMNA 4ETQA 4G7VH 2RJMA 4Z7VE 1V7NL 5D2LE 2IANB 1E4JA 2HH0H 4H88L 3DIFB 3N1PC 5IKCB 3H7BA 3AREC 4FQIH 2VTFA 1YEDA 1JGLH 2NW2A 3FT2B 2H9GA 3O2WL 1QSFB 3O8XB 4XPBL 3BPCB 3PWPD 3IJYA 4OGAC 2HJFB 1T2QH 1ND0A 1K8DA 2ICCA 2JK5B 3AM8C 5HPMA 1S78C 3HN3A 4RRPA 1BFOA 2DD8H 1BOGA 2AEPL 3GSQB 3TVMA 3Q5TA 1JYVA 2UZIH 3EDFA 3MR9B 3HPJB 1HHIA 1LP9E 1RK1A 1SBSL 1ZA6A 3NCYS 4NM4H 3MJ9H 1U3HA 3IXAB 4JKPL 4ZXBC 3IS0X 3RVVD 3MZGB 2IFFL 1A6PA 3EJYD 2ITCB 3QFJB 2E7LC 3BP5B 1MIML 5DRZA 4XP1H 3VXQA 4AMKH 1LE9B 1W2KT 3MFFA 1M7IB 1U8HB 5IMMA 3BP6B 2FHFA 1E6OL 5KS9A 3QDGE 5TDNA 2X70A 1VGKB 3UJIL 5IVZA 1P9MA 1FZOA 2AJZA 1JZ4A 4WUUA 1EBAA 1FORL 1BWWA 4O9HL 4HCRH 5DRXB 2XZCL 4OLYH 3QUXC 5AWNH 1FG2A 3V4PL 3MRCA 3IDMB 3RVVC 2XQYG 5DLMH 1CLOL 2MQ3A 1GOGA 1RULH 1MCEA 1LO2L 1NFDE 3T2OA 3RY5A 5BZDA 1S7VB 3D25B 4CMMB 2FHBA 3QR2A 2G9HB 4EN3A 3UMTA 4UT9L 2KZ1B 4PJ5E 4XVJH 1QRNA 2VL5B 4BKLB 4HCRA 1N0XL 5JW4R 1ZHBA 3NZ8A 1ZLSH 1H3WM 3NCJL 5D93C 5FYKE 4YFDB 5DSCA 2YD1A 5B8CC 3RP1A 3ARGB 3WUWG 3C60B 3MRPB 5FA4B 2EXYC 1YN6B 4G8FA 2DYPB 1YQVL 1ZS8B 4Z77B 1KTRL 1CXKA 2F5AH 2BVQB 4D9RD 4WW1B 2VR5A 3TZVD 1S7TA 4WCYH 4YK4B 5IMKB 5ALCL 3GIZH 4PRHA 2PTUA 3HFMH 2GJ6D 5T1LB 3DOSA 1G6RL 2VQTA 3P40A 2G5BB 2CDGB 5HD8C 2FIKA 1QRNB 2NY2B 4HIJA 2ZSWB 5JA9A 3L6FB 4R7DA 5F9AC 1DQDH 3BYYA 3OSKA 3G08B 3MCKA 3PIQA 3VCLA 2XY1A 1S7SA 2HT3D 1U8MA 3VXMA 4UAOC 4QXGL 4L9DA 3VFMA 4NSKB 3T3MF 5JW3L 4GW5B 1Z5LA 4FFZL 2W60A 1ZEAH 1LILA 5I2IA 1FGNL 3QDMD 2SEBB 3T4YB 4A2MA 1I8MB 2RQ8A 5I15H 3KXFE 1Z0NA 2X4UB 4WUUB 3TA3C 1BX2A 1DTUA 1AGDB 5ILTL 3O2VL 3THMH 3ULVD 3S3PA 4NCC1 4O51B 4OUUB 3PJSB 3SKNB 3CFBA 4JREB 2VE6A 4Q9QL 3QQ9C 4ONFL 1U3JA 2ZSWA 4UOW0 1EHXA 2EH8L 4OZFG 4XH2B 5GISH 1G7IB 1AKJD 4ZS7L 3W39A 3OMZA 1OTTC 5A2LH 1FL6B 4RMUA 5DK0B 1FAKT 1CFNA 2QQKL 1XIWD 1PJ9A 2EECA 2HLFC 5IQ7L 1TJIL 3QBTB 2Y23A 3V5HB 4U1LA 1CD1A 1JF5A 1L7TH 1MRCH 4JAMA 5F1NB 3PP3H 1WBZB 3ROOB 2I60H 4MQXD 2HRPH 2VKXA 4NFDA 3RBGA 1VEOA 4QHNA 1NCUA 5FA4A 1L6XA 3DGCR 4KZDL 4JKLA 3H9ZA 3WIHH 2X4UA 1UVQB 3OKMA 2I27N 4KK9C 5DJXA 4PTUB 5J6GB 4AQOA 1YEHH 4UNVA 4D8PB 3I3BA 5CBEA 4JY4A 4PRDB 1XFPA 3DUSB 2CIIB 1FO0A 1T7YA 2VE6B 5GRUH 5BOPA 3ZTNL 1IM9D 3BD3A 3CFJB 3QEHA 4ODSL 1RQ5A 3EO9H 1H3GA 1JRHH 5C3TA 3TV3L 4FQXB 1M7XA 4ODHH 4WW2C 3DSFH 3TYFB 5EU7E 4EKXA 4C83B 1PAMA 5JNYB 3F6LA 2DQCL 2AGJH 4Q97A 1X44A 1FO0H 4PJCF 3EJYC 4QF1B 5A3IC 2ZCHL 4YIQA 3UJIH 4ZTOL 2J8HA 4NQUA 4Q6IA 3BPOC 4RBPK 5IQ9A 3RWDA 3DVGA 2V5RA 4FTVB 1QFPA 1I8KB 2BVEA 4OSUH 2NX5D 1DUYB 3WNMA 4V1DB 4RQQA 3BPNC 3T4AA 4NKDA 3F58H 3CVIL 4QOKA 3VA6A 2X05A 3V7AE 1TXKA 5JIPA 4NQCB 4KUCF 2FSEB 2WQ8A 3DYMA 4YXKL 2ZPKL 3GNMH 4PV8A 4JO1H 5D1QB 4KKBC 5GPRA 3L7FB 4QGTA 1NBZA 4X7DC 4CN6A 3W11C 1D6EB 3RWFB 3QUML 1EEYB 3BWAA 3U9PL 5KSBB 1HEZB 1VPOH 2PF6A 4C56A 2FIRT 3BXNA 2RB8A 4D9LL 3PV7A 5KSUB 4TRPH 2UWEF 3U1SL 5LGJA 4X6CE 4IRJC 1CLYH 4WENB 4RAUB 3MRHA 3KDMB 5J13B 2ZPKH 3O3AB 3Q1SH 2AV1B 4YNYA 4XMLH 3O6FD 4OLUH 3TZVA 2AJYL 3GHBL 1BJ8A 5DK3A 1XCQB 5C3LD 1QA9B 5HHOA 1NAKL 4L8CA 5HBBA 1MLBA 4RAHA 3P0YL 4Z0BL 4JCLA 2XA3A 4JQIL 3NN8B 1NLDH 4HUMB 4ZTOH 3DX9B 3E3QC 4RMSA 5SWSB 1LNUA 5BZWB 2X1XR 4X5WA 1KENL 2NXZC 3O41A 4YXHL 5I8CB 5E5UB 4NT6B 5GSVA 1U8KB 4Y4HB 3ULVH 4E9LA 4P2CG 4YHZH 4GW5A 3LZFL 2DLIA 1FZKA 3EYFB 4KJWC 4OLVL 4NN6C 2NMSA 2BVPA 1OB1B 5CP3A 2DQGL 3TBSA 2ZCLH 3GSQA 1R5WA 5GGVY 5GRUL 1WBYB 3S5LB 1REIA 3DVNA 1KN4H 1MVUA 4U1IA 4DKAA 1KGCE 2R2BA 4F7PB 2IH3B 2LVCA 4HS6B 5DO2D 5BV7B 2DWEB 4Y16A 3TN0A 3SCMB 2HRPL 4OCXL 3GSUA 4CVZB 5D70L 5EOCJ 2HLFD 4CRPA 2WWMD 1I7ZA 3EUUA 1NCWH 2FJGA 1UWEL 1D9KD 4PJ7B 2XTJE 3Q0HA 3RWEA 5MHSE 4OFVA 5FDWB 1G7LA 4NQEB 5E8EB 1N59B 4PGBB 1EEUA 3E8UH 5IB2B 4GKZA 4LAQH 3HAEG 3RWIA 4GAJH 2XKNB 3TVMD 3L3JA 4N0YL 5F71A 5MEQB 3JWOH 4MQTB 5KVDH 2UWEB 4PJ8C 1BD2D 3HZMB 1TQBB 4YHOH 1OOAA 4HKZB 4KKLC 4IIQB 4KK5D 3DRQA 3F12B 2H26A 3PABB 2OI9B 3X11B 3O2VH 1ONQA 3THML 1HYSC 1R3IL 3FFCB 4MAYB 4TVPH 4OGYL 2PNDA 5AUMA 4F7EA 3D2UB 4L4VE 1KGCD 4UV4H 1BM3H 3PHQA 1ZEAL 5D7JC 2GSIA 4F80A 1AE6L 5K33A 2V9TA 2HVKB 1G7PB 5IJKC 4ODUB 3QNYB 3CFCH 4IRZH 5EA0H 3PIQB 4M7ZC 5D7JB 4BSWB 5I76A 3CCHB 3Q48A 3P73A 2VOTA 5I1CL 4O2FB 3Q6FA 1GGCH 1F90H 1YPZF 3BP5A 3VXSE 2MQCA 1NGYB 1XGPB 2DQTL 3QFJA 1B0RB 5C07A 3HA0A 5T1LA 2CRYA 3QIWB 1HH9A 1JYXA 5JQ6H 1ERNA 4W4OC 1MCFA 3TH2T 4F9LC 5HSFA 3TBVA 2OBGA 4G6KL 3MFFB 3UO1L 5IMMB 3G08A 3MCKB 3VCLB 1LK2B 3FT3B 3SGDH 4JDZA 5JQHC 1MFDH 3T2QA 1S7XA 3GGWB 5CIPA 4HWZA 2PYFA 5JTWA 3V6OE 3C5JB 2Y36H 3SDDD 1A4JB 3SBWA 5E6ZA 2E27L 3RRQA 5T5FH 2VDRL 4L29A 4RMWA 3L3IA 3SCMC 4JFYA 2D0FA 4X4ZA 3RWGA 3MRMB 4XCYB 5FGRA 2R0WH 3KYMA 3O9WB 4OUOA 2NYYC 3AAZA 1CLOH 2H2SD 4QYOB 4G8GD 3DXAA 2AJVL 3U9UB 2G5RA 3FHQA 3QWRD 1BQLH 1CDGA 4XAWL 1J8HD 4PRNA 3QIBD 3QUZB 4EBQH 4MVBD 4F7TA 5I74C 1A7QL 3F7PC 4ZSOA 3V6ZB 2B0SL 1OTUC 2Q7NA 4MNGE 4E5XA 3C08H 1T1WA 3KWWA 4QCIB 4BK5A 3DV6A 2HT2D 5DJYB 5JDJA 3S96B 2OJZL 3LIZL 5C2BH 4XP1L 1KF9B 1NMCB 3QZWG 4JGJA 2W9EH 3QCVL 4HH9A 1IE5A 1MAJA 1YNKL 4ZNEA 2IPTH 3R1GH 3PQYB 4U0QB 4W6YB 4HBQA 3GSNL 5T33L 5F1KC 4D3CL 4EDXA 1HH6A 1UYWH 4FS0A 3IDIB 3WUWA 43CAB 5KTEL 1U6AH 5SV4A 2R0KL 2IANE 3IDYB 4ZAKC 2J8UE 1H8NA 3ARFC 1JHTA 1YUHB 3SJVD 1K8DB 4MCYB 4JFQA 3U7AA 3WLBB 4YHMH 3IJYB 2X4OB 5DWUL 3NZ8B 4WFHE 1H5BB 1KYOK 4LEXH 4NYLA 3BVNA 1PX4A 3UTPD 5D1XD 2DLFL 1GH7A 3FB8A 1ZT1B 4A6YA 5DJYA 3L3KA 3SN6N 4TVPE 4QRQB 3ZKNC 2I5YL 2XXCB 1QBLH 4CVXB 4WY7L 3KXFD 2A77H 1WAAA 5ESQA 3V6OC 4M7JL 4O2EB 1II4E 1KCSL 1JTOA 5GS1B 1PKQB 3X17A 2MCG1 3DWTA 3ZDYE 3SKMA 5IJVA 1I9RL 2COQA 2NLJB 4HZAA 4MA3A 4P5KB 1T0MB 1AP2B 2YOCA 2QSTA 1B6UA 1ED3A 4LIQE 4PJ8D 3ARYA 3WFBH 2UWEA 1T4KB 2I07A 3V52H 1K2DA 4JRYB 2IADB 1KB9K 5HVWA 1H3XA 3VFNB 3FFDB 4WV1C 3K1KC 3EBAA 3WDHA 1AR2A 2OTUB 4GFTB 2BP3A 1KXVC 2W07A 4K7PY 1QBAA 3HR6A 1FLRL 3TYGL 1NL0H 3QPXL 4NO2A 1DANT 4IHOB 1MJUH 1D5XB 4JPWL 3CK0L 4JDVB 4GUPA 1S9KC 1KCUH 1C12A 2GT9B 3IJHB 1NSNL 4Y5XA 1TETL 2VDPH 5HGDB 1HHGA 4FNLH 3TLRA 2D4FA 4CVWA 4HT1L 5DVLA 5DHYA 4O2FA 1F42A 1R5VB 3LKOB 4HK0A 4NUJB 2QHRL 4JPIB 5EZOH 2ZCKL 5EBWB 1FC2D 4CMHB 4O5LH 1I85C 1T04A 3EYUL 1Z9MA 4NZUH 3FZUD 1RJCA 3C8KA 3QIWD 4OZ4A 3RL1A 4LP5A 1LEIA 5BRZA 1DN0B 2JTDA 5E7FA 3S37X 4CN4A 1IAOB 4X9IA 4JPKL 1OGAD 2R0ZH 2RBLA 5HHXH 2J2ZA 4Q9RL 4JR9L 5HHOD 4M5YH 3VWJB 5E2TL 5CD3A 1BZ7B 2ZUTA 3M45A 3OKLB 2OZ4H 3U7YL 4R3SB 4XXCA 1DQQA 1YYLL 3U30C 3ZE1F 3CDGA 1MHHB 4X80H 4XNXH 5FO9B 1IZKA 5TPWH 2EIBA 4DQOH 1MHPH 1VB9A 3QT2A 4I5BA 4RNRA 3ULUF 4U1MB 3TJEL 4RDQG 4UT7H 3D69B 4JFOB 3I50H 3I75B 3I6LE 1TJHL 43C9A 5IHBA 4G7YH 3FOLB 4UBDD 3S36L 1N6QL 3B3IA 2Z9TA 1SYSB 4L8SC 1ZGLP 1OP5K 2DQEH 2NXYD 4LCYB 1AXSB 3BH9A 3HCVA 4KJQC 1AO7D 5I71B 3TCLA 4JQVC 1Y0LB 3D39B 3HE7C 5HJ3A 3V5KB 1RU9H 4Q2ZA 1DLFL 1HSBA 5EBLB 2Q6WA 1RAMA 4QT5B 2MHAA 1IEBA 3B2VH 3OQ3B 2BCKA 4UT6L 4J3VA 1SYVB 1U8NA 3EDDA 5BV7L 4TSAH 3BT2L 3WNNA 1A1NA 5FHAL 5ENWB 5TJWK 3EYOA 3LKOA 4QRTB 2D0GA 3VD9A 4F7CB 4FMKA 2RIKA 1K3ZA 1M7DB 2ENYA 2P45B 3F5WA 2VDOL 5MI0C 4HEPG 1CG9B 3IF1B 2RR3A 1MWAL 4JFQB 4XP4L 3WLBA 1G9ML 3LEYL 1WSST 2CLRA 4KKCD 2AV7A 4X6EA 3HC3L 2VL4A 3RGVB 1MAKA 2APVA 1CICA 4GW1A 2OR8A 1FFPB 3SKMB 2WUCL 3RDTD 4QEGA 4MQ7B 4O02L 1QLFB 1QR4A 4RGMB 2HFGH 4QRPD 1TCRB 5CWSA 1KCRH 1ITCA 4KTDH 4MS8C 1D3CA 5FO9A 3WS3A 1AH1A 5ADOH 1VFBB 2Q8BL 4DUVA 4UB0H 4LCWE 4MWFA 1W0VB 5TF1L 2VLRB 4CU7A 1T6VN 2FJGB 3T77A 5FKPB 3VFTA 4D2NA 5HYJB 4GRMA 4OZIA 4X8XA 4OFKA 1RK0B 4I2XA 4FQCH 2V9QA 5CMAB 1F4WH 2EYRA 2NR6C 1UB6A 4ZFFA 2FX7H 3P4MB 3GSXB 4WWKA 4LCYA 5BJTA 3PABA 5GQBA 5FEBA 3ZHLA 2QADD 4FQ1H 4YWGL 2EEDA 1QTYT 1U8JA 3WSQH 2OXHA 4O58L 5DO2C 4G6MH 5BRZD 1DQML 3PHQB 4ZXBB 3VRLF 1CU4L 3DX8B 5CILL 3P4OB 1BQHG 1MLCB 5I1GH 1EFQA 4N9GA 1A7RH 5D7KE 3QQ3A 2NR6D 2O5YL 3KDMA 4G9DB 4JPVL 2CRZA 4RMTA 4H1LH 4LLVA 4F37K 2Y4SA 4NQDE 5EFIA 3B2VL 2VLLB 2VXUH 2VO5A 4XC1H 5FGCE 4Z7WE 3D9AL 1UM5L 4FZEL 4QRPE 2A73B 1RPQA 4WNQA 1RURH 1DLFH 3C5ZC 2MMXA 3INUL 1NGZB 2OR9L 4NHUA 4HJGB 3VD5A 3TBTB 2XNAA 3UBXI 4ONGL 3A6BL 3GBML 4WW2F 1I9EA 4P2QA 5IW1B 2HVJB 1IGFH 4K8RC 2E9JA 1MFCL 1G1CA 1X5HA 5F7KC 1FIEA 2VQ1B 3K4DA 1VGEH 1NGPH 4PRHB 1NC2D 4GQ9L 1N64H 1KNOA 3MGTB 3LRSA 3VXSD 5HY9A 5B3JE 5K9QG 3VFPB 1S3KH 2H3NA 2UYLA 5KANI 4UOW1 1RUKL 1E6JH 4AM0B 5JLZA 3B9AA 1V5JA 2OJEA 3PL6A 1CBVH 4LU5H 4GS7B 2R69L 3K4AA 4M8QA 3AY4A 4QHLB 2VR4A 4H5SA 2Y06H 4HWEL 1U8LA 1BVZA 2NXYC 3IJSB 2J6EH 2AV1A 4J7RA 5C0CA 4QCIA 2P5WE 3BDYH 2QHRH 4MA3B 1NC2B 2B4CL 2JJSA 2WBKA 3NIFF 1MCPH 1F00I 1RUML 1FN4B 1GZPB 1XIWB 5I1AA 4PJ7E 1HN1A 4UQ2A 4HH9B 4FQXD 4UT7L 4FABH 4GKNA 3DX7A 2QJDA 3MLWL 3QEGL 5IOPA 1JYNA 1ORQB 4PB9L 1RZ7H 4NWUH 2EDOA 5INDA 1L9NA 5C0IB 3KYMB 3O9WA 3BYTA 3B4NA 4HFUL 2XY2A 2UZYB 5C08B 1DSFH 2DQUL 3RGVD 2LU7A 5C0CB 5JMOC 3EYFA 4NN5C 5ID0A 3MRDB 3MJ9A 2R4SL 5IHZA 4LK4A 3T2NL 3SY0A 3TPKA 3NFSH 1WISA 1PSKL 5GGVH 4L4TE 5F88B 4NZJA 2UY7A 3OKMB 1Y6MR 3KPQA 4HUUA 3R06A 1DBAL 3VE0B 1ZVYA 4OIBA 4H26A 5ANME 5C0DA 3N50A 3L5HA 3G6JA 1JE6A 4ODVL 3ZKMC 2HJKB 3IKCA 2WNGA 3VGFA 2VUOA 5D2NB 4JB9L 1QRND 1UG9A 1WITA 1JWSB 1KG0A 2P1YA 3WEXB 3MNVA 4MNHB 5TDOA 1A5FH 2B8OT 5DJCA 4LLMB 5I2IB 4ONOA 4X9FA 3TYFA 3HLAB 1MCCA 4L4VD 4XPGL 1ZLVK 4WFHD 1ED3B 5MP6L 4TYUA 1T0MA 1CL7I 3O3EB 3O3UN 2FBOJ 5KJRH 1VFMA 2NY6C 3WL9A 4C58B 5D1XC 3DVFA 4X7CC 1UB5B 2AEQL 2AW2A 2DAVA 1NC4D 5LGHL 4PRID 4S0TD 5T5NG 2V7NA 4HV8A 1QLRB 2FX8L 5MENA 5DUBB 1TZHA 1U8MB 5GGQH 1QKZH 4X4XB 4FQ2L 4X7TB 4HMDA 5EU4B 1YJDH 2HVKA 2DLTA 1OWRM 2ATKA 5T1LD 1EAJA 4CDGC 2AAVA 3FQTA 4NFBA 3VFUA 4DVBA 4BUGA 1MWAB 3TZVB 2ZKHL 3MLZH 3LIZH 1AD9A 4ORZC 3ARDB 3O6FA 1U8QA 1E27A 4M7JH 1I1AB 5J9PB 5C0FA 2D3VA 5IWLC 4L8SA 3ETBF 1BIHA 4PBVC 4U1HA 3VFRA 2O5XH 3S35X 1JWMA 1QSED 1GC1H 3SDYL 4U6HB 3U0WH 3KR3L 3BW9A 5L2JB 5KN5B 1C5DA 4KI5D 2J7LA 1BQLL 3AS1A 3MLTB 2IH1A 4HQQH 2AJ3B 2XN9A 4ZDHA 3O6LH 3QHZH 5EO0B 1RFDH 4MZ3A 3BP6A 1CDUA 2GY5A 2H2PC 3CNKA 3DI2B 5EU6D 5CGYD 4XWGH 2YPKB 1U6AL 3FRUB 4BH7A 1EJ6A 4RX4A 4V2BA 2IGFL 2CDGA 1J1PL 4MA7L 5JHLH 1NUFA 1DL7L 2NTFA 1A6UL 2IBZY 3LQAL 5IVXE 1MFDL 4U6HA 1ZGLM 1Q8MA 3EO0A 1IARB 4HUKB 3QXVA 1EGJL 1LO3H 4JRXA 2F15A 5BVJB 3KLHD 5F7FA 4G9FA 4EI6A 4K94H 3FQNB 1XH3B 5HHOE 5J8OA 3QIBC 1JN6A 5BOZG 5ELIA 5JPMA 1GZQB 4LPTA 4HK3N 5K93A 1ZHBB 2QSCH 1A3RL 2BNUB 4XPFH 2NY6B 1P84J 4NM8L 3VGHA 1OHQA 4NDMA 3LKPB 4OZIE 3ZE1E 3F6IA 4L5FL 2IAMD 3NIDE 4KRNA 4N1CA 1JNHA 3LOWA 3QNZB 4ZODA 1G7HB 3KYNA 3RAJH 1HQ4A 4XPHL 1A3LL 1T2XA 3BO8A 3MRRA 4FQQB 4YE4H 5D2NC 3IU3B 4OLWH 1MH5B 1EJOL 3QISA 2L4OA 3T3PF 3D0LB 1UFUA 4JHAL 2BNQD 3X12B 4AK1A 2VZTA 3BEWB 3MRKB 2APWA 4ENED 3G5YB 4KY1L 4YHOL 3K46A 4MZ2A 2P8MB 4U3CA 3B8SA 5I1KH 4GAJL 3MBXL 3SDAB 5C9JA 4J12A 3ES6B 4G6AD 3VFVA 3ZTJG 2HKHL 4LLDB 5I19L 1CFVH 5CLTA 4OI8A 1P53A 3RWFA 1Q0YH 5A1AA 1XGQB 4ZFZB 2W0FB 1JNHB 4K9EC 5C92A 5C07D 4HZLB 2VXQH 2ADJB 3MUGA 4XP5L 4PB0L 1FVCB 5EG6C 2P8LA 4HV8B 4PGJA 3HZYA 4FQLH 5JO5B 4WWID 5EA0L 4JRYD 4ENEC 1RIUH 4DVRL 4KKCC 5LBSH 3K80A 4TUJA 5SWZE 1JPFB 1W72L 4RGOH 4QRRB 4G80A 4Q0XL 5LKNA 5E00A 2ZUSA 1YNTB 4D0BB 3SCMA 3QDJA 3OKOA 2UYLB 2E9WA 1MJ8L 5GJTL 3AVEA 3OKKA 4ZUUB 3KXFB 1S9VA 2W0PA 1JRHI 1FYTA 4UIKL 4NPYA 2VSCA 4YC2B 1AHWA 1D9KC 5FOBB 2P48B 3MRBA 4TQEH 3QNZA 4GRWE 2GTZB 5DUMH 1CXLA 2HT4C 3LS4L 1JPSL 1S7RA 3G6DL 5DD1H 4DOHE 3VXPB 4DCQB 3NACL 3VXMB 2FNBA 2XWBA 5EUOA 5DFVC 3VXRB 4Y19E 1JPFA 2DKMA 5E2VH 4JFHE 1J8HB 5IHUH 2VWEE 4WJ5A 1D6VL 3F7RA 2H8PB 5A3ID 4N1EA 4UDTB 1VHPA 4PJFF 6CGTA 4QRTA 5J06A 1AGBA 1JZ7A 1CZ8H 2DM7A 4JKMA 3SQBA 4O51A 4B53A 1G7JB 4M1CC 3PQYD 2CK0H 4AL8L 3BAEL 4ELME 4HK3J 3KPNB 2Z92B 2I25N 1A6WH 4WI4A 4D9LH 2HJFA 5IROC 3X13A 1VPOL 1QLEH 3PGFH 4DJMA 4CJ0A 2R56H 3F7VB 1NDMB 1HI6B 3I6GA 1W0WA 3QQNA 2D9QB 4UTAH 3VFOB 3MXWL 3SGKA 3L1OL 4ETYA 3CLEL 4OQTH 2ARJB 2D03H 4KHTL 4LHUD 3DJ9A 4K3JH 1NEUA 1MAMH 3QEQA 1HEZA 4O2CB 4HIIA 3MLSL 2BOBB 3O4LE 4PY7A 4XVTL 2Q1EA 1PG7X 4JFZH 4QWWD 2F53D 2E7HA 1DDHB 3N85L 4NQED 3SQOH 3MLSH 4XVTH 3TPUB 1AXSA 3BH9B 3HCVB 2Z91A 1IC4L 1KELH 5IVZB 2LV4A 1WC7B 1CGVA 3FN0L 5T1MB 3G6DH 5DD1L 4FTVE 4Z7VB 5D2LB 5DUML 1NBYB 5EORL 3UC0L 3WHXB 1PYWA 3H42L 1JHLL 1RZJC 2F19L 3ULUC 2PXYB 5HGBA 4NDMB 5DSCB 3BISA 2G2RA 1AJ7H 4JZNB 1O5DT 2IC2A 4J1UA 1IGCH 1FRGL 2GTWB 1XGRB 3KPRD 3ARXA 5DD6B 2R9HD 3GSRB 4P48A 3KNBA 5IKCA 4W4OA 4GAGL 5L8LB 3SDXB 1MFAH 1VDGA 1U8JB 4XVUD 5KAQG 2W0LA 4Q0XH 4QWWC 5MENB 3IVKB 1TZGH 4YHPA 3JBG7 3MV8E 4NBYB 4P5KA 2ESVB 3P4NB 1KV3A 4I4WB 5I6XC 3DARA 4OTXH 1HZHL 3MOAH 5H37G 1WJ3A 4MJIE 3TO4D 1MY7A 2DDQH 1D9KB 4HUWB 1D6VH 1KTLB 5H35B 5EB9A 3W9DA 4FFVC 3KPLA 4TUKH 1XF4B 3WKMH 4QNPF 3X3GH 4YHYB 2HWZH 3EFFA 3SDXA 3TH4T 4HJGA 2X4QA 5BO1H 1S7WA 2KPNA 2PYED 3FFCD 3OAYK 4LMQE 4MAYD 2ZCHH 4YEFA 4PG9A 2EH8H 3M17A 3RVUD 4M6OL 4Y2DA 1I1CA 1BBJB 4TPRH 3UTOA 5T5NF 4PJ8A 3FQWA 4NIKB 1MQKL 1BEYH 3WFEH 4K7PX 1KIRA 1VFOA 3NABH 1YMMA 4X8JB 3ZDZE 4IOIB 4R2GC 3ARDD 5HHNB 4CUCA 4L8DB 1MNUL 2VZ3A 5BJTB 1G6RB 1LO4H 2RCSL 5I15L 2WP3T 2I9LB 5F9WC 3QRGL 4RGNB 2X4RB 1W72H 3Q2CA 1ZK9A 1DVFB 5INCA 1DQTA 3FAWA 3SKJL 3GMMB 1E28B 1RHFA 1S7WB 2EEBA 4Z7QF 3IXAA 4J3TA 1F97A 4QXGH 2ZUQB 4OUUA 1JNJA 4NBXB 2K7QA 4OZFA 4FQLL 2R1XA 2Z4QB 1NC4B 2A6DA 1T0NB 3HE6C 3VWJA 4ZTPL 4OF8A 1F11A 3TA3A 3OJDA 1YQ2A 5EC1B 4I18A 3IFOA 4DWHA 1TJIH 1T83A 2HJLB 3MRJA 4EEEA 3UJTH 3GIZL 1OSPL 4J4PC 3JV6B 4U6XA 4WCYL 2NX5B 5E94B 4X6DA 1KCKA 3X13B 2FDBP 2VMFA 3M1BB 4FTVD 1XCTB 2ZSVA 2EXWC 3HE6A 4J6RH 3VWJC 2VDNL 4XWOC 4Q9BA 2XTJD 3T09A 1ZVSB 2B2XL 4PRIE 3LMJL 1F8TH 1PBYA 3NIGF 3MUJA 4GAYB 5EC2B 3LQAH 1IC1A 3NCJH 2DTSA 3MREA 5FUOL 3P9MA 4NCDA 4RFEB 2YBRA 3RVTD 3MLUH 3QZWB 3SDDA 2GIYA 3RZCA 1FIGH 3HNSH 1T1WB 4JFED 1I7ZB 3RL2B 2YUXA 3RY6A 5B38G 5JW3H 5CEZE 3LN9A 3LRSB 5I8OH 4OGZA 5KSAD 4MB3A 2IBBA 4U1SB 5EO9A 5E1HB 1PZ5A 1W72B 5F7DB 5ERWA 4XHJD 4OZ4B 3GMPB 3T1FB 2OL3A 1KJ2A 1RIVL 1IGTA 1G6RH 5EC2A 4PJXE 4U3XA 4KVCH 4HS3A 5J57B 2LTQC 4PR5B 1JNLH 5T3XH 3VXSB 5CEZH 3GK8L 1JBJA 1JL8A 3QDJE 3U2SB 1YQVH 1VFUA 4JZOB 2CLVA 4LEOA 1HKFA 3UAJD 2OQJB 4R26H 3QG7H 3WHE0 5HHVL 4NRZB 3BIKB 5CKGA 5HGDA 3GSVA 1DL7H 4TOYL 4KQ3L 2KBGA 5JHLL 3FB5B 3C2AH 1N26A 2WV3A 4P0DA 2W9DL 3EGSB 2Y25A 3KS0J 2QQLL 3U46A 4PUBL 1UKSA 3MLYL 5I75B 1HH9B 2GJJA 3QFDA 5D1XA 5D72H 5L0QB 1BJ1J 5C07B 1QEWA 1BD2A 2NY3C 1JGLL 3HI1A 3SE8L 1SMOA 4OI9A 3MREB 5LCVL 3G6AA 3L7EA 4JN1H 2YD9A 3P3YA 5CJOL 1I8LA 3MRNB 4LCIL 2H41A 4OGXL 3JUYA 3RY6C 1CXFA 2BRQA 4Y4KC 4LRIA 4S1RL 1HXYB 5BS0D 1E6OH 3KHQA 2BSSA 3FB5A 3BRDA 2BSTB 3NA4A 3O45A 3CU1A 4ZFOB 1KEGH 4AENA 2EDHA 4KTEH 4M8VA 2B5IB 2YD3A 3S5LA 1N6VA 4P3DA 3U82B 4XCYA 1I3GH 4N90E 4OFDA 6FABL 4OGXH 4OIIL 1CGTA 1VKXA 1LD9A 3OZ9L 2ADGA 2XOTA 5C6WH 1FHGA 3FN9A 1HNGA 1PSKH 5GGVL 5E9DB 1NGQL 3SE8H 2WINA 4I0CC 3LSOA 2ZOLB 1NCBH 3MLRL 5FHBL 1YMMD 3TIDB 2HFEA 5I9QC 1HE7A 2J8UB 3BZ4A 4HFUH 4ZO9A 3GSWB 3EYSH 3IDXL 3ZE0F 5T1MA 3GI9L 5CZXC 5I8KL 5GRWA 3EAKA 2W9DH 3CFEA 1KYOJ 3GJFA 3HE6B 4PJGA 4XPTL 5E8PB 4WO4B 3MLWH 1X5XA 4NQSB 4TN9A 3H9SB 2W59A 1HWGB 1FYTB 5AEAA 2IEPA 35C8H 3Q3GA 1P4IL 3IGAB 5IMLB 1M7DA 4M03A 3CFKB 4PGCB 1BLNA 3V0WL 1W0YT 4KI5E 1ROWA 1I7UA 4HGWA 4ZAKD 2BFVL 1HDMA 2IG2H 2ZUYA 4HIXH 1UQSB 1CFQA 3EW3B 4KVCL 1F3RB 2A1WL 1BVLB 1MJJA 5E24E 1GAFL 2ZSVB 2GSIB 3VWKB 3ECBA 4FXKB 5DVNA 3TT1H 2X44D 4N0CC 4KKLD 2E7LA 4C54A 2R69H 2VZVA 4PTUA 3HUJE 4ZOBA 3M07A 1I9IL 4CBPA 3D2UD 1U3YA 3NIFE 3NFNA 2WQRA 2RAMA 2OCFD 1G7JA 3L5WB 32C2A 4KKAD 3FT4A 5IB5B 1UEMA 1B4JL 1BFVL 4KPHH 5FA3B 2HLAB 1BLNB 1WZMA 2QR0B 3MLXL 2PO6B 3AU1B 1KLUA 2VZOA 2R8SH 1MFCH 3RDTB 2E6JA 4DKEL 4PJ5B 2NXYB 4FABL 4HHAB 5KANG 1CLZL 1WFOA 2IALB 1R6VA 3ARGD 1F8TL 2VUYA 1G7QB 4E0RA 4IOIA 4K3EH 5E2WH 2YN3A 3TGXA 4LHJB 5FCSH 3O11A 2VB5A 5IEHB 4H25B 5DR5H 3I9GH 4UDTA 3JV5A 1RURL 2FO1A 3O3BB 2BOBA 4GBXA 2R29H 3FB6B 4LSRL 5BXFA 5I1JL 3S35L 1JF1B 2PR4L 1BQSA 5J12B 3VFMB 4ZPTB 1CBVL 4G3YL 3QUYB 4NQXB 1KOAA 1TTUA 4NQCA 1FZKB 1SMAA 3LKPA 3LQAC 4QRRA 4G80B 1DBMH 2NY0C 2D7OA 3BKYL 1J9CT 3OPZL 4NC1C 5DUPH 5KSBA 1MQ8A 4L4VB 3MMEB 3JXAA 4FHBD 4NO0B 4YWGH 1ONQB 2ENSA 3AAZB 4YHPB 4HPOH 2FJFA 2CSPA 1UWGH 3BHBB 3OG6B 5CEYA 4F57H 1WBXB 3C09B 2FX7L 2ZUVA 1I1FB 3MYZA 2V7HA 4PG2C 1OSZA 3CC5B 3GIVA 3QJHB 4RGNC 1MHEA 4FQCL 4NN7C 4UIMA 1LVEA 5IJKA 4MA8H 4FQXC 4PGZA 1UJTA 4E41A 4MCYA 4XP9L 1NBYA 5JHDE 1VESA 3D9AH 2A6KB 1A02N 1NMAH 4QHUA 4TUKL 1AY1H 3NCFB 2RFXB 4KJYA 5DQDL 1BZQK 1AD0A 4FZ8H 5FYKD 4MXVF 5FK9A 2C1OB 3S4SB 5K9KA 4G43A 2DBLH 4UBDC 1UWGL 3IDNB 3VXTB 1Y18A 4WWKD 1YY8A 4G42A 3U6RA 3NAAH 2HT3C 4HW6A 5IT2L 2VRAA 3EFDH 1NC2A 1JVKA 3RI5F 4EDWH 4GG6E 1G9MH 1RD6A 1U3ZA 1G7PA 3OPZH 3VGAB 2HKFH 4ZD3L 2V5MA 1PLGL 4M9PA 3QIUD 2LAAA 5E5MB 4QNPE 4Y16C 3MBEA 4LSPL 5FKAB 4DUWA 5F21B 2A6JB 3CPLA 5T3ZE 1AY1L 1JHLH 3RNKB 5GS0H 5I1JH 2O5ZL 2C7UA 1YEFH 1NCDH 3TN0B 3H0TB 5C09B 1BFTA 5D1ZD 5IVXF 2CLZA 3D85A 4BZ2H 1E4XH 4LF3B 3BMVA 4KTDL 4NQEA 4H20L 3EZ8A 4GQPH 2C1PB 4K3EL 3CMOL 3SJVB 1IC5H 2DKUA 3FO0H 3S36H 3CLEH 3FO9B 2ERJB 3M8OH 3DV4B 4CAGA 2ZWLT 1FL5A 3HI5L 3SO3C 5DUBA 3BPNB 3MXWH 3QO1B 1L0XA 2MQ0A 2VDKL 4KKAC 4GO6B 1MWAH 1T7XA 5ISZB 1UACL 4PJ9C 3CFDA 3QIUA 3FTGA 4NKOA 4WUKL 1R5IB 2B7DT 1FZOB 2WIIB 1CFTB 1IT9H 3H0TA 2DQIL 2F8OA 3P30H 1SQ2N 1U91B 1ZSDB 3AXLB 3O4OB 3DX6B 5I71C 3P77A 1SY6A 2GJZA 1FNEA 3B9EA 4CW1B 4L8SB 1BD2E 3CXHK 3BT2H 5B8CB 5E0QA 4L8CB 4JFEB 8CGTA 4JO3H 5CBEB 5HVFB 5EZLB 1GAFH 4MJIA 4Y5VA 3ES6A 3SDCD 1A1OA 2Y7QA 3AUVA 1PQZA 3EOBA 1JWUA 3SOBL 5HI3C 1CDJA 2GCYA 1ZHNB 2YPLB 3DX9A 3BWUC 4D9RE 5IQ9B 3T2PA 4KTYA 3LHPH 3TBVB 2C4FT 5JLZB 1U3HD 1AI1L 2G60L 1QLRA 3B9KB 4EI5A 12E8L 1N6QH 3DX6A 4HXBL 5HPMB 2X42A 1P7KA 1CDHA 2F5BL 5M95B 3M17B 1MCQA 1LE5B 1M71A 2KZWA 5F88A 4JRYE 4YUEL 1JGDA 4WDIA 5C9JB 1C08B 3W5NA 1UH3A 3MLXH 3ULUD 4H0IA 4QKXB 1ZVHA 1KCUL 4JZJA 2CRMA 1R5WB 5GJTH 3WNPA 3G9VA 5DMGC 2X6MA 1FNFA 1NL0L 1EBPA 4P2RD 2R9HC 3D87B 1YNLL 4M7LH 3P4LA 5EPMA 4PRHE 4OV5B 4PGEB 4LLMA 4Q9RH 1C5DB 3DX7B 4HS6A 4NPYB 2VQUA 4IRJD 3CXDH 4XMKL 2XA8L 4FP8H 3TT3H 1ZT4B 3G6JE 3L95A 5KW9L 3MRLA 5EU6A 5ICYA 1KPVB 4WW2A 3WS6C 3VXNA 3T04D 4HIXL 2FZ3A 3V5HA 1KNOB 3KLSA 2DMCA 5HGAB 2NTFB 3V0WH 5FYLL 1N59A 3WLWD 4CU6A 5B8CA 3MV7D 3PL6C 3WIIL 3VFWB 4M1GL 1LNUB 1U0QA 5TE6L 1FYHB 3UTSA 4MGXA 4X4XA 4X7TA 2HJKA 4PLJD 2GITB 4NO0D 2WIMA 4YO0B 3MUY1 1KIUA 3EYSL 4PLKC 3ARGA 3JTTA 5CJ5A 4WUUE 4YK4C 2EXYD 1MLBB 2Q20A 3PWPE 3VFVB 3FFCE 3N1FC 4NZTL 4FXGB 4ZUVA 4EUPB 1FN4A 2EEAA 3MJ8A 5I76B 3QXUA 2QSQA 3OZ9H 5GGTL 1YEEH 3WXWL 2BVUA 4K94C 5F3HB 3DYPA 3VGDA 3L5JA 4NKIH 2YD8A 3JVGA 1P9MC 2CIIA 4R7DB 2GW5A 5DVMA 1FO0B 3KPSD 3ILQD 4GOSA 4NM8H 4IDJH 4NRYB 5E2UH 3RNQA 4K2UH 5D1ZC 4M5ZH 5DEZA 5DRWA 4LVHB 1JUFA 1J05B 1CWVA 2K1MA 1HXMB 1WQVT 5IR1B 2DLHA 4U7MA 3REWA 3BUTA 4JJ5B 3TVMB 4ZAKB 3IDYC 1WCQA 4IEFB 1V3JA 2JK5A 2QQQA 3R06B 1H9VA 4DN4L 2XKNA 3VA2C 4POZC 4P9MH 4LLDA 3TVMC 4JG1L 3SDAA 2JCCA 1G9NH 3K74B 3BKJH 5GJSL 2F53B 4JFEA 3MOQA 2XACC 2FECL 3ZKXB 1P1ZA 4PUBH 1IGIH 2WWKO 5GXBB 4YPJA 4JN2A 3V0VB 3MLUL 4H1LB 2BZDA 4ZO7A 4DCQA 1IAII 2FJFB 5KSAA 3MCG1 1HOCA 3CD4A 3DMMC 2R2CA 4OAWA 5DT1H 3IGAA 4KQ3H 5DJCB 1DLHB 4LSUL 5KN5A 2C1OA 2IPTL 3R1GL 2VNCA 1WICA 4LARL 2AABH 1P7KB 2VIRB 4HUXB 4MQXC 4OGAD 3ZDYF 1HHGB 2B2XH 5DD0H 2APTA 2AJZB 4JM4L 4G6KH 1S78D 1HXYA 3ZDXF 4RMVA 2FO4A 5CGYC 4LGSB 4C59B 4PTTA 4ZMAT 3O9WC 3UJTL 4E42A 5I75C 4OCSL 3P9WB 1ZLWK 3MRQB 3KAAA 4NHUB 5DYOB 1RZJH 3ULUH 4GBXB 4ZTPH 1F6AA 3DRTA 4H0GA 4JM4H 1GGIL 1KB5L 2OLDA 4Z7NE 3PL6B 5JXEC 4K8RD 1OAQH 1L7IH 2EDEA 5IB5A 3GM0A 4PRAA 2R23B 4QY8A 3ROLB 3OKEB 1CXIA 2AV7B 3P9LA 1G0DA 2FWOB 4QRSA 2PETA 3MX0A 1QSFE 3RU8L 4YHKL 7FABH 2AJSL 3UZVB 1U2HA 4JM2B 3WO3B 4DK3A 4PY8I 1CFSB 4KXZI 2OP4H 1ODAA 1CI5A 5TH2A 4X5XB 2XI9A 4ELKB 3B9KD 3DV4A 1NDGB 4YPGB 5C0BE 4M1GH 4OZFB 4BZ1L 3I75A 1DP0A 3MQIA 3TH3T 4LAQL 2AJ3A 1MFBH 1AQKH 4JGMA 5IMLA 2FATL 3CFKA 4PGCA 1IZJA 1OM3L 4PJXA 1OSZB 3CC5A 3GIVB 3L3OA 4NOFA 1S7UA 3KPMA 2SEBA 2X40A 3PDOB 3TCLB 2X9XA 4K2UL 4U33A 1Z5LB 1OTUD 3VDAA 4XCFL 4YHNB 2A6KA 1MJJB 3MV8D 4S11A 1HHHA 4XBGA 1CDIA 3QDGB 4KWUA 5CP7A 5FFLA 3AY4C 3MOAL 4MX7A 3GB7A 1HZHH 2YWZA 5I1DB 4KMTH 3IXTA 4NJAH 2VDMH 4M61B 4MMZC 5K9QI 3R8QA 1KJVB 1YEDB 2R4SH 3FAXA 4I3RH 4LRNL 3GI8L 2DQGH 3V9FA 3BHBA 4EI6B 1MNUH 3ARFD 1EO8L 1AQDB 3RGVA 1UGNA 1NKRA 2IMMA 1Q94A 4OQTA 3GMQA 4XT1C 2J8UA 3ULVL 3S88H 4ZFOL 3OXRA 4XRCB 1RZ7L 1I7RB 4HUUB 1N5AA 1B9ZA 5CIPH 5IVNA 3ARBA 2JCCE 3K7UA 5J1AA 1X5FA 2XG4A 5FUCC 3OAZH 1U58A 1QSVA 4H25A 5IB3A 3FN0H 1RUPH 1AI1H 1MCPL 4P2RE 5EUOF 2P5WB 4PJ9B 2OSLA 1F4AA 5FKPA 1X4YA 1RZGA 1DN2A 4JCMA 2DN7A 5D70H 2VXTL 5FOJA 3O4LD 5H37H 4WWKC 1TPXC 4P2RA 5HYQA 1OARL 1WAAF 2NY6D 3L1OH 1EHAA 1K4DA 1XIWC 2AK1H 4LSSL 2E6PA 4Y5XC 2VH5L 1CDBA 3BPLC 1YNLH 4M7LL 4YR6B 4ONHB 1I3RB 5FF6B 2VLRD 7CGTA 3DBXB 4O4YH 1J0IA 2HYMA 5HY9B 4LPVA 4F7MB 3BUYA 1SY6L 1DUZA 4S1SH 2XZQH 3CFIC 4R0LA 3OAUL 1D5BB 5FUCE 1DVFD 1VGEL 1YPZB 2BOCB 4I8DA 5D7IB 5JDSA 3DGGA 3DX8A 4YH6A 1WT5C 3AROA 3IFOB 3TNNB 3CH1A 4LEOB 2VDKH 2OQJA 2NTSP 1C1EL 1DZBA 4X7SH 1B6DA 3BI9X 1Z6JT 4MD4A 4Z7WA 4ZYKB 4NQDA 1MCWW 2A83B 1A1MA 3OAZK 1OVZA 1GCFA 5J13C 3FO0L 1QBBA 1RHHB 4BZYA 5I6XB 5IFJB 2DMKA 1F4YL 4LOUC 4RWYH 3P0YH 3EO1A 5J56B 3OJ2C 3V5KA 3LPGA 4Q2ZB 2BSTA 3V6OA 4BZ2L 2CGRL 2OL3H 1YY9D 5FB8A 4WNQB 3VXME 4S0SD 3GHBH 5CAYB 3FFCA 4MAYA 4OQ1A 3LN5B 2O5ZH 4XC1L 1L0YA 3WN5B 4LLWB 2CMRH 3VFTB 2NY2D 1UXWB 4JPVH 3MRNA 4RAVB 4UV7L 1LK3H 4S10A 1KIPB 1C16A 1Z2KA 4D0CA 4Z7UB 5IEKA 4ODHL 1DBKL 1RJZA 4HIEA 5LQBH 1RMFH 2BC4B 2PW2B 2EDKA 4YGVB 3UYPA 4O58H 3PGFL 4KH2A 3UTTD 2VERN 5DFVD 1IILE 4EDWL 5DFWH 3SO5A 3PE9A 5EUOB 5CS7A 4NN7B 1K85A 1R3KB 3OR7B 3RWCB 1X5ZA 4JFFD 4OF0A 3SDCC 5LBSL 3DPBA 3GNML 1IQDA 2Y07L 1IC5L 3CMOH 1VFAB 3X14A 4CVXA 4TNWK 4OSUL 5J89A 4PD4K 5BZDB 1BVKB 2QBWA 4NO3B 3V0VA 1OB1A 3S98A 2BY1A 2YUWA 2GI7A 2HKHH 3X3FL 3MNWB 5IJVB 1ZT1A 2CO6B 5I18L 4BFIA 4U1MA 1FO0L 4PJ5D 4PS4H 3QUYC 2GK2A 1G0XA 1MI5D 3EOTL 1N0LA 2YSSB 2P5EA 3MBED 4NQCE 3NH7L 3NFPA 4HX1A 2EZ0C 1EUTA 4BUHA 3HC3H 4APQD 5GGTA 4NO2B 3CVHA 2ZG3A 1K4CA 4YE4L 4P4KA 2FX9L 4R97C 3IF1A 5DUPL 4AIZB 5KSBE 3LH2H 3VFGH 3P4OA 4BH8A 1F6AB 5F3BA 2IMNA 1NCNA 5E8EA 4BFIB 4KMTL 4DVRH 4KHXH 3S96A 5FGBA 1RK1B 4YFLI 5D5ME 2ESVE 1DBJH 4KZDH 3RDTC 2YD5A 3MV7E 3MZTA 1P7QA 1KULA 5B3NA 1RSFA 5IB3B 5C08D 1L7TL 3F62A 2QSCL 4H0HB 4Z7UF 5HDBF 2DQJL 3VI4F 1XR9B 1CG9A 5MI0B 5FGCB 1FNGB 4APQC 2R2BB 1AQKL 3C8KB 4ZS7H 1A7PL 1ZLUH 4I4WA 4JO2H 3DXAB 2GUOB 4Y5YB 3U9UA 4OZIB 5E2WL 2YA0A 3H8NA 3TFKC 3PXJA 4IMLA 3PWNB 2R1XB 4CDHA 4M6MH 1H0DA 4MD4B 2CDEA 1CCZA 1ZLSL 4A6YB 5H35A 1JHKL 5CZXD 1Q1JH 1IAKB 4NQCD 3LQMA 2LE9A 4XVJL 4XWGL 1KXQE 2C3VA 2Q8AH 1QHOA 3A67L 1A3LH 4ODTL 4Z76A 2PN5A 3VXRA 5DEGB 1GOHA 3C6SB 4HPYL 2AQ1A 3NCCB 4AIXA 1J18A 2FEEI 3OKNB 3HHRB 3LKRB 2WLZA 5JW4Q 1A7OL 1SVCP 4L5FH 1L7IL 3RTQC 2VLKD 5E8NB 3IT8D 2UV3A 4HCRL 4IMKC 5HHXL 1YC8A 4QHMA 3RVTC 1OGAA 2J5LB 1RZJL 3ULUL 4R8WL 5D93B 5E9DA 4Z7UA 2QQNH 2C26A 1ACYL 2A1WH 5EZJB 4BQ6A 3NPSC 4O5LL 3I9GL 5KVFH 2FO4B 5CGMA 3QNYA 3G6JF 4K23L 4NC1E 1SJEB 3ARFB 1QSEA 1PVHA 2Q76A 2WLYA 4EIZC 3RPKA 1OAUL 3H9HB 4U49A 1YJDL 1C5BL 1ZGLA 2EDNA 4X5WB 3G5VB 2IGFH 1WV7T 3H7LA 1G7HA 1LO0L 3KYNB 5D9SA 2UZIL 3JTTB 3LS5L 3GMNB 4QRRE 1X3DA 5HXMA 1HQRB 5I8KH 4I13B 1I9JL 4UT9H 4CMHC 1NC4A 2A6DB 4JO4L 4WVRA 2E7MA 4XCEB 1RULL 3QIBB 3F8UB 4XPBH 3PGDA 3F7VA 2WZPD 3T4AB 4LLUA 1BWMA 3MV9D 2YC1A 1ZAGA 2QLVB 3MA9H 4P9ML 1ZKAA 1NEZG 4QXWA 5HGBB 4OIIH 1CD8A 4JVPA 1V7NH 2VXVL 2Z93B 1PY4A 3WFHA 4PTTB 3FOMB 4YR6A 4Q6IB 1EMTH 1GOFA 2ICEB 3IDIA 5EU7C 4LVNB 1I9RH 5TQ0H 1U8OB 1DANU 3HB3D 4RDQF 3SDDB 3DTXB 4GKSB 1DDHA 5J1SC 4KKNA 1QBML 3LSOB 5F6HJ 3STLB 4LBEA 5DXWA 4BSVB 4S1DD 4PJXB 4WUUD 3S9DB 1P4LA 4LLYA 4JFHD 3QA3A 4ODVH 2ESVA 3P4NA 1KPRA 5ETUB 1I4FB 3NZHL 3WL9B 4NM4L 4HDIA 3T0WA 1O0VA 3O3EA 3L3KB 4LCIH 3QUZD 5GGTH 3V6ZA 2LVEA 1KIQA 5CJOH 1P69B 5IFAL 3CAFA 5C7XH 3FB8B 2BVTA 2F9BT 3MA9L 4L4TD 3DUUB 1HCFX 2DIJA 3DUSA 4EZMA 1AGFB 4LCCA 2XZZA 3O45B 3TBYA 4JVUA 1ZV5A 5D72L 1NANH 4XTRC 3KXFA 4PLKD 3B5GA 4RGND 4N0UA 3KPNA 2MPAL 2AK4A 2R2EA 2X7LA 2XG5A 3OF6D 5C7XL 3LS5H 2BMKB 2A83A 1R3JB 4OCNC 5C07E 5TE6H 2F58L 3TJHC 2EC9U 4N9OB 1F6FB 2ICWB 2NY5L 1BBJA 2X4SB 3GBNH 4XNZB 1S7UB 3KPMB 3PDOA 5JNYA 3BEVB 1KCLA 3OKDA 1XCQA 5HHMB 1MWAA 1S7XB 3GGWA 5CIPB 1SJVA 1MHHA 4F9LA 3BDYL 5HYJE 1JNLL 5T3XL 4WHYG 4V1DE 1CIDA 4U7KA 1JZ3A 2DQDL 3DURA 2G75B 3GJEA 5TQ0L 3F7YB 2X4TB 3GMOA 1JMZA 3U4AA 4ODWA 1KC5H 1OGAE 1U41A 1TQBC 4MHHG 1T21B 2VLMD 4YXLH 2YPVH 1NGXB 4JN1L 1LEKA 3EDKA 3TJHD 4R2GD 1J88A 3T2NH 1QPPA 3TO4B 2R2HA 2KUTA 1CVRA 1NBZB 3ROLA 3VXUE 4PJGF 4LVHC 1MIEL 2XFXB 3L3IB 1A9EA 1W0WB 4KRMB 4JO4H 4F8TA 3FONB 1FAIH 5DS8A 4JEGB 3TNNA 4AZ8A 3IAQA 2VLKA 3RTQD 1JHKH 4LFHG 2ZJSL 1IQDB 3C2AL 5FUOH 5ADPH 4G6FD 3CFBB 5CINL 1RJYB 2ED7A 1KJ3L 3FQNA 3LMJH 4YZFE 2H26B 3EJZC 1KTDB 4G9FB 3HZKB 4JO2L 2VDNH 1YN6A 5GZOD 5D7LA 4L3ED 1T1XB 1QNZH 3LB6D 2RHEA 3EHBC 1ACYH 4PGBA 4L4VA 5F70A 1OD9A 4ZG1A 5HHOB 1UM5H 4OV5A 2Y06L 3ULSB 4HWEH 1F90L 4JZNA 5HHPB 2J8UF 3GB7B 1J0KA 3FONA 4PJBB 2FGWH 3IRPX 3MNZA 4LHUB 2X4NA 1EHLH 2XPGB 2HA1A 4LASL 5AZEL 1CU4H 3MLTA 4QXUH 2DMBA 4KQ4L 5GSVB 4FQQA 4XC3L 5C71A 4LIQH 1BPVA 3D85B 4I18C 4OGYH 5C0CD 4M48H 1A0QL 1HWHB 1IGFL 3VFRB 3TBSB 4M7ZB 1MCJA 3I02B 1MQKH 4WI2A 3WIFB 3GSOB 4Y4HD 3FO9A 4H26B 4U6YA 1QFWI 3SPVB 4IRJB 3HMWL 2OR9H 2F54D 3G9AB 2NY4D 4FTVA 4XH2A 4JM2F 4OBRA 1WLHA 1JWSA 4HLZG 3VGAC 4S1DC 3LKNA 4FZEH 3RWHA 3HZYB 1FBIH 2Q8BH 4CW1A 5F7MC 4MJ6B 5IR1A 3VXRD 1ZSDA 3AXLA 3H9YA 4PJ8B 4JZJC 3MSPA 4OF7A 4LSPH 5MEQA 4X6FB 4CU8A 3ME0A 5DRXA 4GKZB 4S2SA 4KHXL 5ESVA 4Z0XB 4PGEA 5CILH 1HKLH 2BXZA 4G6ML 4IRJA 3RIFK 3LH2L 3W5MA 4FOMA 1TZGL 4QRPA 1U8PA 3KWWB 5SWZB 5F7UA 1QFUH 3OGCB 1T03H 5J3HC 3VGEA 3NAAL 2CXKA 3NCEB 4PJAF 1DBKH 2DBLL 3C9NA 3ILPA 4KI5F 3S4SA 5BS0B 3GEWB 3SDCB 3OGOE 1M71B 5FHAH 1A6TA 1A6ZB 4XBEL 2VJXA 3O4OC 2DYPA 5BO1L 5J4MA 1X9QA 2KDGA 1LEGB 4RZCB 5EH1A 3UZEA 5CP3H 3FL7A 3F65A 1KELL 2Y5TB 4DOHB 1KLFA 1UH4A 3QIUC 1NAKH 3HUJF 2APXA 1T89A 4WIQA 4K3JL 3BE1L 5FAAA 4U6YB 2M1KA 1J8HE 3FT3A 5FXCH 2WUCH 1FNEB 4PJIF 2KQMA 5CEYB 4R4BA 3V2AR 4G8FB 3PWNA 5C0AD 3L95B 1EFXB 1RUAH 3Q6GL 5C0DB 2R0LH 4M6NH 2Q7YB 5L2KE 5CBAB 1S9YA 5IK3A 4Y7MA 5D5MF 4QTIL 4S1SL 4TNWF 3ESUF 1FFRA 3U4BL 3T0EA 4JFPA 2A73A 3U7YH 5DS8B 1MCSA 2ZOKB 4GG8B 2GITA 4RGMC 2ED8A 1FL5B 4YC2C 2VH5H 3A0OA 4JVWA 3WFHB 3FB7B 4TSAL 1UH2A 4UT6H 4PYGA 4ZDHB 1Y18B 2R29L 3QQ4A 4ZO8A 4P2OB 3O2DL 1NFIA 2ILLA 3BJ91 4KMQA 4NP4L 5KSVB 1KJMB 3EHBD 3QULA 4LCWB 5SX4H 4W81A 4OCYH 4R7NB 3MR9A 3QXWA 1HHIB 5MEOA 4Z78A 1BOGB 5D1QC 2D03L 1JPSH 4G7YL 4U2YA 3VE0A 2DQCH 3EDEA 1ZGLB 2Z8RA 1AC0A 4X7SL 2IBZX 1TETH 5EZLA 1C1EH 2GJ6B 1A1OB 2R1WA 3W39B 4YDLB 3ULUE 1NSNH 1P7HL 2NY2C 3DMMD 4ZOAA 5IP4A 3E1F1 5MHSD 3WDIA 3P11H 1MJ8H 2XWBB 3KPPA 5DJZA 3QEHB 3QPXH 1YYLH 3NGBB 4L3EE 5ESAA 4J4PA 4ALAH 1CTNA 4F2MB 2CK0L 4AL8H 4OFIA 5GS0D 1IC7L 4ZNEE 3PWVB 1JF1A 5HGHB 4DN3H 2L0DA 1OGTB 4F37F 3ZKQD 1NUNB 1EA9C 5SWQA 3C60C 4JPKH 2DF3A 1W72A 5F7DA 5HYFA 1OPGL 4X0KA 1GZPA 1XIWA 4JQXC 5I1AB 1FL3B 1Q9OB 4JY5H 3H7BB 1VADB 1PKQE 2C3XA 5HVHB 4XCFH 1T66D 3DURB 4EUPG 3AGVA 4QRPB 4PD4J 5BXFB 1CFVL 2NY0B 2UUDK 1I1YB 3LS4H 5A16B 4JHWL 4BKLA 1X5JA 4RBPH 3STLA 3MBXH 3O4LA 2D7PA 3QUXB 4PJEB 3VI4E 2DYPD 2EDTA 2CDEB 4XB8A 5E6YA 3ZE2E 4BZ1H 1WBXA 3IFLH 3VGBA 1MCHA 4XPTH 1ZA6B 2MWCA 5J12C 3VRIB 1DCLA 5EU6B 1YYMH 4FMFA 3UTQA 4EQ2A 3EO0B 3BZ4B 4LEXL 4OT1L 2AJSH 3C6SA 3ABZA 3UTZA 5EN2B 1QACA 3KPSB 4OLWL 2FRGP 3MLRH 2AXGB 2DICA 1U8IB 4HWNA 1JPTH 5DJDA 5I0ZA 3QDMA 5GRJL 1EVUA 2HFTA 2DJ4A 4C4KT 5IW6A 2GK0B 2X70B 2B1HH 5KBNC 5DQ9B 3DIFA 4XNZC 3ZLQC 1UC6A 4D3CH 3GSNH 5T33H 1OAQL 4OF3A 3QHFH 2W0KA 1DQLL 1I3UA 4WFED 5TE4L 2L7UA 2ATPB 3T65B 2FR4A 4HGWB 4PB0H 2XN9B 2VXQL 3AM8A 3VXTA 2E9IA 1CGUA 1FG2B 1XGYH 4WI3A 4YX2L 3FCTB 4D94A 1P4LB 2W92A 5DJXB 3WYRA 4OCSH 3BWAB 3BEVA 2NY3B 5ERWB 2W65B 2L7JA 3J8F7 2DI7A 1JZ6A 1YPZA 2BOCA 2A77L 2PO6D 1V7MH 5T3ZL 2B0SH 1AGCB 1R3LA 4XAKD 1SJEA 3ARFA 3SGDI 4YBLC 1BFSA 1B2WH 4W68A 3SE3A 1H3PL 4B7IA 4WEUD 1U95B 4PRIB 1A6UH 1J1XH 5DRZB 2H32A 3VWKC 1YDPA 3D3VE 1TVHB 3CIQA 3D5OF 3E3QE 4RFEA 4QHLA 4GXUN 4JHAH 2V2TB 1EAPB 5TDOB 4N8PA 7FABL 4YHKH 4P2YA 4XCEA 3OWEA 3QIBA 4WW1A 3EFFB 1BZ9B 2B20A 3TZVC 3A6CH 1IGMH 3GSWA 3GKWH 3MACH 1OT1A 4NO0A 3T1FA 1U42A 1PZ5B 3A6OA 3CU7A 3SDYH 4DN4H 3GRWH 8FABA 1GC1L 4X6CF 4CMMA 3B3IB 4Y19B 4BK4A 1SYSA 1LDSA 4PR5A 1CLCA 3L3DB 1HDMB 3BKML 4LFHD 5CSBA 5IIEA 1RIVH 4GH7B 5TQ2L 4AG4L 4L3EA 1HSBB 3VG9C 5I1CH 2OTPA 4TNVF 1GIGL 4KJPD 4PRPB 5BRZE 5JDSB 1QR1B 1U3HB 4JKPH 3QJFB 4LSUH 3ZYJA 4IRZL 4N0FB 1J1PH 4MA7H 4FQ2H 1SBSH 5GGQL 5IMOA 5EFIB 3A6CL 3C8HA 1AE6H 2FX8H 4HX1B 2DD8L 2XIDA 4L4TA 4LQFH 1WWAX 3I85A 5F72S 1OAYH 4JLRB 5CEXB 2F53E 3F7QA 5LJYH 4HF5L 1HYRC 3O6LL 3QHZL 4WI7A 1MLCA 2ITDB 3BQUD 4Y4KB 5LVEA 1J1XL 3IS1X 1TMCB 1YYML 1IQWH 4P2QB 4WTXA 5C6TL 4Q7DA 4QRUB 2N4IA 5ICXA 3JWOL 5MP6H 3WIIH 4LKCB 1TTFA 4J6RL 3GJFH 3FHAA 3HNTL 3NTCH 5DHYB 1KJ2B 4UILH 5L0QC 1A21A 1BQUA 4P3WA 1ULVA 3GBLA 1MSPA 3MUZ1 4HBCH 2YD6A 5EBGA 4MLSA 1ACZA 5CEXA 2AQ3A 5DI8B 1XGYL 2ZKHH 3AREB 1TVBA 3SJVE 5L88L 3HB3C 2X4TA 4Y88A 4IS6B 4LAJH 3QUYA 4NQXA 3CXDL 3FQWB 1OY3B 4NOBA 3REVB 5E6IB 5ETUA 3D48R 1YECL 3IKKA 5AAMA 2OL3B 2Z35B 3ULVF 2WINB 5C09D 2PUQT 1F3JB 3TN0D 1FFNB 5HI5D 1K2DB 3SDDC 1DJSA 5DF0A 4BQ9A 1WWCA 4K71C 1AKJB 2BVYA 2WW8A 1G7MB 1ZHKB 3P11L 3QDGA 4B41A 4YHYC 1F6LL 5L6YL 1N7ML 2IAMC 3WFEL 4K3DH 4LVEA 3U48A 2H2SC 3BIKA 5SX5H 4IRSD 2DL2A 3GSVB 4M7KH 1E4KC 2CUMA 2P44B 1IAKA 1F4XL 4Z7QE 4GXUM 1TVDA 1E4XI 4JQIH 4ELMA 2FH6A 3DHMA 3LHPL 3REVA 2HWZL 5C08A