3G6AA

Crystal structure of anti-il-13 antibody cnto607
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
210
Chain Sequence
SYELTQPPSVSVAPGQTARISCSGDNIGGTFVSWYQQKPGQAPVLVIYDDNDRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCGTWDMVTNNVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CNTO607 Fab Light chain
total genus 39
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aA01
4P5TD 1NBQA 3QA3B 3HNTH 4NC0B 1I7UB 3OKLB 5FYKD 2Z31A 3QT2A 5H2BB 5DJDA 2DQHH 1RFDL 3PWUA 3ARGA 4KJQD 4F7PB 4MA8H 4JHBA 4AIZB 3ZHLA 1JNNL 1D6EA 4P49A 1JGEB 2EECA 5D96B 2QQKL 5ACLA 4NBZB 3BQUB 4V1DA 1M7IA 4GXUN 2VR5A 1OP3K 3KYNA 4E5XA 3DX6B 1F4WH 1TLKA 4CDGC 1OSZA 2ADFL 3C6SB 3BGFB 3BPLC 1XZ0A 4D3CL 4FN0A 1P53A 4MCYA 3QHZL 1S7VA 4FQIH 3RP1A 2AJUH 4G6FB 2IFGA 4OZFB 2CDFA 2ZUQC 3TBVA 3VWKD 1JPSH 1KPUB 5D8JL 3E1F1 3ULVC 2YD7A 3MJ9H 4GAYB 3JUYA 1UADC 2C1OB 3KJ6H 4NQED 3RU8H 1INEH 3TNMA 3QIWB 5L6YL 3EOAB 2VABB 1FO0H 4Y16A 2RBLA 4OQTA 1V3MA 2J12B 1J0KA 2WW8A 3B9KD 3BP7B 1IQWH 4XCFH 1J12A 1KJMA 3MV8D 4JGJA 2AQ2A 3ZHKA 3MJ7B 2GTZA 4Y4FB 3MLTA 1U8OA 1RZ7H 3O8XA 4P4KB 2DQCH 1SJXA 2D3VA 5D1ZC 5DEGA 1GIGH 3QI9C 1T4KA 5ALCH 3P40A 3W5NA 3TJEL 2DTMH 1VGKA 3O4OB 4LQ1A 4UNUA 4NGHL 5CCKH 4Y4HA 2QKIB 1IGIH 3O4LB 2OR9H 3RWHB 3GIVA 2YD4A 1CFQA 1FBIL 5F7WC 2WLYA 2ICWB 1OAKL 2CK0L 1T1ZB 3GBML 1EZVX 5JQ6H 3TH2T 5M94B 2OMNA 4PGBA 1B6DA 1LO5A 3CX2A 3OAZH 2EEAA 1ZLUH 3SCMC 4DKFL 3H9SB 3NZ8A 3NH7L 1L7IL 5CJOL 1FGNL 1I8KA 4O4YL 4FABL 4G3YH 4Y2OA 2B5IC 4N8CH 4JQVA 1ZS8B 1WZ1L 5D1ZA 5E94A 1IGJB 3MCKA 2DMCA 4PRIB 4FG6D 3U48A 3L3OB 3UTTE 2Q8BL 4WWID 3BIAX 4F58L 3MLPA 3VXSE 1PQZB 2CIKA 5GJSH 1OM3L 4HJ0D 2GAZA 1F5WA 4HF5H 1WICA 2P8MA 4UBDD 2X4QA 1UZ8A 4E42B 1JHKH 4MDJA 1MCFA 1VFAB 2DI8A 4MDIA 3I84A 5EZOL 3WFDL 3G04B 1RPQA 5DJZB 1WK0A 2YRZA 3BZEA 4Q6IA 5F9WC 1QFWI 4OLEA 4APQB 1L0YA 4YGAB 2V5SA 3VWKB 3KLAB 3RTQD 4NQCD 1QNZL 1MHHB 1HNFA 2LVEA 4RZCB 1GL4B 3D18A 4P23C 4AT6A 2IMNA 2QHRH 1A14H 3M45A 2PKDA 1IKFH 1CFNA 2NX5A 4NQEB 4GAYA 4TTDD 4PY8I 4I8DA 4X7EC 1ITBB 3H8NA 4I3SH 4JPWL 4TN9A 1T21B 3L6FA 3MR9A 4NHUA 2X7LB 2EKSB 2OTUA 2ATKB 4O9HH 4U1LA 3PWJB 1JPGB 2KDGA 4L4VD 1NKOA 3ARQA 1Z9SA 1CDUA 4ZNEA 4KRNA 3O9WA 1C16B 1U8LB 3OF6A 3WFZA 1RZ7L 4PLKC 5BS0E 3MBEA 4MS8C 2YPKA 1NGXB 4P3WA 3ZYIA 1WIUA 4P23A 5DFTA 2M1KA 2D03H 1IEAA 3D0VA 4QT5A 1YEJL 4UQ2A 3ABZA 4XRCA 1HWHB 2ESVD 1WFTA 3OWEA 1Y6KR 2VERN 4PLNC 4HSQA 1Y0LB 4U1NA 5E7FA 2E8ZA 4NSKA 3IKCA 2D31B 3ZKND 1QBML 1RZJC 5DZNA 3SO5A 1QOKA 4U49A 3ZYJA 3O11B 4NRYA 5DQ9A 2V2WA 4WHTB 1VFBB 5D2NC 1CFTB 3MV8E 2VXUH 3PABB 4ETYA 3EUUA 3PL6D 2OXGA 2OYPA 2FBJL 5I9QB 3SGJC 4M7JH 1Q94B 5FO7A 1B0WA 1AHWB 3DOSA 4WHDA 4MQ7B 1ETZA 1MJUH 2VSCA 4NQDA 2RFXA 2VAAB 4HUUA 5L6YH 1ERNA 1B2WH 1MJ7L 3UZQA 3WEXA 25C8H 3NCBB 5SWQB 4JFFD 5GISL 1FG9C 1RMFL 4WI4A 3V4PH 3QJFB 5F7UA 3UJJL 1QA9A 4QOKB 3BPNC 3I2CH 1EZVY 1A9BA 5GGRA 1FJ1B 3RTQA 4TTGA 1YMHB 5FOBB 4I0KA 1II4E 1LNUA 3VGBA 2AGJL 4GRMA 3EJZD 4M7ZC 4FMFA 4ZXBA 2C1PB 3N0PB 5FCSH 3VFOB 1YDPA 4UV4H 2YMXL 1AE6L 5F9OH 4YR6A 3TZVD 3W9EB 3KLHD 1ITCA 1QEWA 5LWYL 4AM0B 2ZCKL 3RGVB 4X6CA 4PIRF 4XP1H 2Q76A 4M7LH 4YDKL 3GMNB 3ZZ1A 3UTSB 1A3RH 3G6JE 4Q9CA 2ADJA 4NHCL 4HUXB 3NACL 1J10A 4D0BA 4NJAH 4KRPC 4AK1A 2BOCB 3CH1A 2XYCA 4DFIA 3BT2L 1A02N 3PABA 2VLRD 5DJ2A 3DI3B 4C83A 4RRPA 1ADQH 5IIEB 4WFHD 1PEWA 1P5VA 4F3FB 2BK8A 1WIOA 2PW1A 3CDYA 4DN4L 1TVHB 3VDBA 4EVNB 4I4WB 4XPTL 2R0KL 1T7WA 1YEJH 2YN3A 1QSFE 3KS0H 2VKWA 1E27B 3EZ8A 3HAEA 4JGMA 7FABH 1HEZA 4XNYH 5D72L 1UH2A 5F96H 3PGDA 2AK4A 3F7YB 4OLVH 2A0LC 1C08A 2VE6B 1TXKA 1HZHH 4HGMA 4DVBB 4XPBL 1OAZH 2EDOA 2GT9A 3DI2B 1JK8A 3RWCB 4N8VB 4OD3L 4RMTA 4RNRB 5B8CC 1KUMA 4B41A 1S5IH 4LLDB 5CP7A 1IM3B 1IGFH 5DTFA 5LGHH 3VGEA 2D7PA 4FQQB 3V6ZB 4XPFL 1KLUA 5T5FH 3GMPA 1IKFL 3GZKA 3HI6H 1F11A 3JVGA 3BISA 3OR6A 4HS3A 3ZTNH 4Z95H 2H2PD 2UZYB 4PS4L 5FK9B 4HMDA 4LP4A 3GSNH 2FR4A 2C3VA 3ULUF 4AY0A 1BZ7B 4XI5D 3V8CA 1CQYA 1A1OB 3AS2A 1DEDA 3B2VL 4OCWL 2BSRB 3DVGB 5DEFB 3ULUD 4KUZH 2N4IA 4KROD 1QZ1A 1MCHA 1MWAL 4OV6F 5ITFB 1X5ZA 4ZS6D 4MS8D 4X6EA 1DZBA 5CS7A 3UDWA 15C8L 5HXMA 3FRUA 3UPRB 2VLJA 4BSVB 4MA7H 4UINH 1B4RA 5TQ2L 2ARWA 5FO8A 1D9KC 1R5IB 3UBXB 2F58H 3HE6D 5I66A 4YGVA 3VGGA 2ZSWA 4Y4KD 3LEVL 5KVDL 5ABDE 3MRCA 3RGVA 5JLZA 4JO3H 1UM6L 5EZJB 3MODL 1EEYA 3BN9C 3TFKD 2DQHL 3SQOL 1WIPA 4C59B 3HB3C 2OK0H 4U1GB 4XWGL 3BPOC 4QHNA 1KJVA 2YK1L 2RQ8A 3W0WE 3GSUA 5BV7L 2WUCL 2A9NL 3O45A 5HPMB 1DDHB 3DNKA 1Q38A 3HZMA 4IS6A 1NBVL 1ZE3C 4K2UL 4J3VA 4XBEH 5DJ6B 3U36B 1CDGA 1JPTH 1WC7B 3NN8B 4ZUVB 5DYOA 1R0AL 3OZ9L 1F8TH 2FBJH 5EO0A 3TBYB 3DX9B 4JQXA 3P73B 5EU5A 2Y07L 3KYMB 3FQWA 1G9ML 3RWJA 3HR5A 4I3RH 1PEZA 3TBTB 3JWNC 2BNQD 3C09B 2HLAB 3OMZA 4LSUH 4L4TB 4JB9L 4X0KA 4CN4A 1DVFD 2OSLA 4JPKL 1GPOL 4K3EL 3SPVA 2KQMA 2OTWA 3ULSB 3QPQC 4JFZL 5D5MB 4ZFZB 3QXAA 5ADOL 1KIUA 2X4PB 4YO0B 2V5MA 3KPMA 5HY9B 2FEDD 4Y4FD 1T1WA 3LPWA 4G9DB 1S7RB 1OB1A 2GHWB 2XT1B 4OCYL 5DLMH 4LOUC 1QVOA 1S9WA 2NXYD 2Q86A 3IDGB 4UQ2B 1HEZB 2B2XH 4UMGA 5HD8C 4RGNB 5F9JB 3MTRA 3MV11 2AJVL 1P6AB 1IM9B 3MO1B 4HAFA 1M7IB 3MOBH 3AREC 4OF7A 3VFRB 1R3KA 3T04D 3L5HA 4MJ4A 2VQ1A 3NGBC 2Q8AL 1NFDE 2R39A 2XY1A 4PG9B 1IMHC 3FB8A 2A1WH 3PWJA 2AEQH 1J11A 3BEWB 4R4ND 5ICXA 3HE7D 3R0NA 4X6DE 1T21A 5GGRY 3IXTB 4P57A 3RIFK 3WN5A 5ESVB 3C8KB 2H2SC 4FZEL 5IVXE 3N1MC 5FGCE 5I1LB 2OZ4L 5KVEH 2VLJD 5HHMB 1MCIA 1ZA6A 1E4WL 2R2BB 3SE9L 3UX9B 2A2QT 4WJ5A 4JJ5A 1U92B 4GW1A 3W2DH 4Y16C 1RU9L 1U8KA 4C55A 1BJ1H 2AKRB 2QHRL 3CVIL 3PXJA 5ELIA 2F53D 1UCTA 2DQJH 1FCGA 1OF2B 3W11C 1P84J 5LAXA 2VWEE 4Z95L 5SX5K 4KQ4H 4UINL 4M4PA 4GAJL 1Q1JL 4RRPG 1SJVA 3KYMA 5E03A 5TDOA 4QHMA 4QKXB 3WXVL 1ZKAA 4P2RB 1TVBB 2CPCA 2IF7A 3DXAE 3JWDL 4HUWA 3CK0L 4LLUA 3DLQR 2HVKB 5IR1A 1GCFA 1C1EL 3HAEG 4XMKL 1TJGH 2D7NA 4EDWL 3ULVF 3I6LE 4N1EA 2DBLH 1Q94A 3STZB 3NZ8B 3KPSE 5J9PB 4WEMB 2D7TH 5EOCL 1S9VA 4U6YA 1H5BA 3ZHDA 3DYMA 2CR3A 5HTSA 2E7HA 5D8JH 4WHYG 5DJ0B 2N7BA 3VE0A 4S10A 1N3NA 2CIIA 3A6BH 1E28A 1JI2A 1XGPA 3LKRB 3WIHH 3WD5L 3MV9D 1XIWC 2P24A 5MEPB 2HT3C 1FAKT 4YUEH 4LSTH 1YYLL 1JTTA 1QPPA 5I1LA 3MPCA 3OL2A 3TGXA 3IETB 1VGKB 3AM8C 1CG9B 5ACZB 2VDML 3P30L 3SCMA 4ZS7L 5GGUA 5AYUL 5KW9H 5CWSB 2H32A 5ICXB 3OKMB 1N5AA 3L3JA 1MUJB 3GJEA 4ISVA 3NCYP 1ZVYA 5FYLD 2GJ6D 2G75A 3GJFA 2G2RB 3WFEL 4Q0XL 1ZVSB 3O2WL 5HHME 3LRHA 2OL3A 4GKSB 1UEYA 2DQUL 1LP9E 3EO1A 3ARBD 3HHRB 1YPZF 1F42A 4H8WC 3DIFB 2OI9B 1S78C 1SY6L 4LNRB 43C9B 2ZOKA 4W4OC 1VFUA 1SBSH 4HC1A 5HHOB 5DUPH 3IDMA 3ULUH 1S8DA 3QUXA 3TIDB 5SX5H 3BKJH 4OSUH 1T1WB 4I0PD 4Z7VA 4F37F 3OGCA 4JDVB 2CKBL 5E9DE 4CU8A 4IDLA 4NNPL 5HI4D 3HB3D 1HSBA 3V52L 4R4BB 3VFUB 3VFSB 2OSLB 5TE7L 1AP2B 4R8WL 5I1HH 4Y8AA 4EUPB 3R8BB 3GSNB 1F6AB 2R4RL 3T0EB 3S35X 4KVCH 1J0JA 1JRHL 1KFAL 2FIKB 3ARBC 4I77L 3TVMB 2LABA 1K6QL 4D0CA 5D2NE 4LU5L 2XPGA 4WO4D 4WW1A 5T1LB 3ZDZF 3HA0A 2DMBA 1N6VA 5AWNL 1UB6A 4XMPL 2I60L 5C0BB 3X12A 5BVPL 4NO2B 1GZQB 1I7UA 2APTA 4NRXB 4UILH 1OGAE 3CLEL 3WNPA 3TESA 1WSST 1BOGB 5K9JL 1DEEB 5T33H 5LQBH 1MAKA 3UJIH 2AK1H 2E9WA 4OGXH 1WWAX 3HE6A 4PJBA 5J3HC 5TE6L 3WSQH 5ID1A 3TBSA 1QYGH 2V5RA 5T5NF 4L8BA 2VDNH 4KTEH 3MRRB 3UBXI 4Q2ZB 4UB0H 1VERA 1T89A 5DJXA 2DM2A 3V79C 4HIJB 2Z93A 1CGVA 5JHDD 5LJYH 1ND0B 1MCSA 4G8GD 5KZCB 4HKZB 1CLOL 4NKMA 2H32B 1H3UA 3QQ4A 4TNVK 3I75A 5D7LB 2WUBH 1JYVA 3QWRA 3O6MH 4XCNA 4O02L 3U6RA 5FYLL 4LSUL 2VO5A 1TMCB 1ZWIB 1AD0A 2YC1B 3HPJA 3IDJB 4MAUL 2CXGA 5I8KL 3TH3T 5I6XC 2X09A 2W9DH 3MRQA 4AQ1B 3ARBB 3NCMA 1SMOA 3HCVA 4ZXBB 3DJ9A 4YNYB 3A67H 2O61B 3EYOA 1MCQA 4X6CF 1QR4A 1T6VN 3F7VA 3TBSB 3IJSB 4JLRA 4JKMA 4GUPA 1I1YA 1MLCB 2D2OA 3VFNB 4FFYH 2NX5D 4MWFB 4BKLA 1RHFA 5EA0L 2BSTA 4QHMB 5DXWA 4R7NB 5MEOA 4NN7C 3K1KC 3MRBB 3PWVB 2AK1L 1AHWC 3T0WA 4UOW0 2WWKT 1IC4H 2ENSA 2FHFA 1RVFL 2GYSA 2YUWA 4NO3A 3ARYA 3G08B 3WJJA 1HILA 1F6AA 2PTTA 4JVUA 3LV3B 4YHOL 4IRZH 3X3FL 1KACB 1HYSC 3VFUA 1CIDA 3OPZL 1KB5L 5HYFA 1A7RH 1YEIH 3T4AB 4PTTB 1GOGA 5B39A 4F33B 1R3HB 3MROB 4YDVA 3VGHA 3IFLH 3ZDYF 1C08B 5DJYA 1QFUL 1CD1A 4WI8A 5JW3L 2KH2B 2J4WL 5DRWB 1BFOB 1CGXA 1CVSC 1WZKA 5EU6B 4X9BA 2FEEI 5DJYB 5HGHA 1P5UA 5JHDA 5EBWB 1FN4B 1FO0B 4OIAA 1I75A 3S3PA 4YXKH 1YZZA 4OT1L 4P9ML 3QEQA 3M8OH 3H3PL 1NGYA 4OLYH 4OCRL 3S34L 1QFUH 4KU1A 1BLNB 4PJ8C 4PBXA 5CBEB 1CL7H 1OOAA 4BH8A 1A1MA 5DHVA 3H7LA 2BY0A 1HHHA 4P5TB 4Y5XA 5IMLA 5JR1H 1NQBA 1IT9H 3SKJH 3MRFB 3MFFB 4WDIA 4XVJH 2EKSA 4EEEA 2XV6B 3IDGA 4LEOB 1NGZA 1Q0YL 1Q9OA 3PWPE 1QKZH 3MRBA 5I1DB 1S3KL 4I0PC 1ADQA 2ITCA 1E4JA 1ZMYA 4LP5A 4YR6B 3VCLA 4J6RH 4UDUB 1RJZB 1LEKB 2J8UF 3KPLA 4PJEB 1JWSB 4FTVB 4PJXE 1RZFL 2BNQB 3LMJH 1K8IA 3JWOC 4HFUH 3O2DA 2AABL 4LEXL 4XCEB 5L2JB 1I1AA 3STZA 5GSVA 2W1NA 5DMGC 1RZJL 2OTPA 4LDLB 2UZIH 2BHUA 4L8CB 4ODTL 4F9PC 1N4XL 3T0DA 4U33A 1J1OH 4GKNB 1WC7A 4NQSB 3PNWA 3C60D 5E8OB 2ERJB 3PDGA 2XG4A 4PJCE 2OX5A 4IS6B 1Q9WA 4LPCA 1U3HC 3BW9B 1FYHB 3K8MA 2XN9D 1LO0L 1IFHH 1XF4B 3NFNB 3K8LA 1JIBA 4JFHD 3UPCA 3E8UH 2R2CA 4NKIL 5L7XH 2G60H 3CJJA 1RJLA 2CRIA 5IW6B 4F7CB 3QSKB 3WIFB 4MSWB 1J9CT 2D31A 5HYJB 3NCFB 4FG6C 5CFHA 3MRCB 2BNRA 3KPQB 4G5ZL 5C08B 4WTZG 1C7TA 1BQSA 5FYKH 3SO3C 4LQFL 3B43A 3KPNB 3EYFA 4WWKB 1IL1A 3IFNL 3S36H 3MZTA 2YPKB 5HHMD 3QQ3B 1URLA 3MBEB 2EE2A 3MLTB 4RFEA 2X89A 2IQAA 3NGBB 4Z7NE 2YS4A 1XIWA 1S7XB 5DVOA 5IW1B 3FZUC 1HOCB 2EXYD 2DWEA 1DBJL 2BVUA 1AP2A 3D2UA 4GMSL 5KSBE 2YEZB 4M7LT 2P5WE 3IJHA 5LVEA 5GS0C 5CBAA 1RZIA 1A1OA 2F5BH 4N8PA 4PRAB 2ZJSH 5GRYA 2R0WL 1NMBH 5C09B 4HPYH 3GO1L 4WFFD 1F45A 3DURB 2BNUA 3RPIA 1JYWA 5TQ0L 4ERSL 2E9IA 5EFIB 5BZDB 3T2NL 1KBGL 1RIHH 2GKIA 3IGAB 5DFWH 4KKAC 3OKDA 4NKQB 4UQ3B 1U93A 1I9IH 4NFDA 4I2XB 3AREA 3MRMA 3QNZA 3VFGH 5CEYA 3SDXF 1CBVH 2WBJC 2HLAA 3PGFH 5FM5O 4NQEE 3VWJB 4MNQD 2CGRH 3QUXC 3R1GL 4XVTH 2X4QB 4NNXB 1DR9A 1G6RA 1MJJA 2GQHA 4JFDD 4JVWA 3EFDH 1GGIH 3BKMH 3MBEC 1S9YA 1MHEB 1MREH 1I9JL 3MLUL 4L1DA 3QIUB 5H2BA 1A6ZB 5DT1H 3C08H 4HULB 2DM7A 2BVYA 5ESAB 1AC0A 1HKFA 3JZ7A 1T0PB 1A7QH 3BXNA 2QQLL 2JKXA 3JUZA 1OAUH 2XQBH 4NCDA 4JRXE 4F7CA 2O5ZL 3ARSA 3M8OL 1IC1A 4JO4L 4RDQF 2YD8A 4L8SC 4O5LH 4HG4K 4Y19A 3VRLE 4HK3N 3WJLC 4LMQI 4WV1C 1JRHI 1EO8H 3AAZA 3VXMA 4CL7A 1QBAA 1E0OB 2ICWA 4DOHE 4EQ3A 3ALXA 4H0HB 1D5ZB 2PO6B 4OLWL 5CKGA 2VLME 1KELH 1F3DH 2OJEA 3EYVA 3SO3B 5L2KB 2A9MH 3W39A 1NDMB 1YJDC 4NCC2 3WFCH 2R1WB 4MX7A 3UO1H 4NIKB 4DW2L 4JKWA 4XC1H 4OCSL 3RVXC 3GMLA 4IRJC 5IB3A 5F97E 4NNXA 5B22A 1JGUL 1M05B 4I0PB 2NY0D 2IADA 3QFJD 3SDAD 3NTCH 2BHYA 1R3LB 3FQRB 3ARVA 5J6HA 2BNQA 4PV9A 4DGIL 3RIAK 2DQFB 1TZGL 1KIQB 2GCYB 1CWVA 5F8QC 3TNMB 4HKBA 4TUJA 1I3VA 4ZOEA 1SBSL 2AEPL 3S4SG 4XVSL 3K81A 3O4OC 4NC1E 2P7TB 4XVSH 3FOLB 5GRJL 1MHPL 5D7SL 4U6VL 1FFRA 4LGPB 4PTUB 4DGIH 1SVZA 4R2GB 5I1HL 4BSJA 1N6UA 4M1GL 4P4RB 3NTCL 1DP0A 5C09A 2DOCA 1UWGH 4QOKD 1ZLUK 4P5TA 2HTKC 2BVPA 1ZHBA 1I85C 2AXHA 1EAPA 2B39A 4FQQA 1G0XA 1U42A 5K9OA 1P7HL 4G9FB 4OZHA 4JO1H 1RHHB 5ALCL 3P11L 2NY5C 2BX5A 3HKFA 3BE1H 4OLVL 2A73B 5EPMB 1S7SB 2XRAL 3PWUB 1AO7E 3SJVD 4PRHB 2ICWJ 5JIIA 3EDKA 3U82B 4S2SA 3QDMD 1Q0XL 1Y0LA 4U1NB 5CLWA 2Z31B 3FO1A 2FECL 4I2XE 4HWEH 3MGTB 1KENL 1NAMH 3VU2A 1JNHA 3TYFA 4XPGH 3SGEH 4MD0A 1EEUA 1KTDA 1R3HA 4IOIA 3GSQB 3JV6A 4NNYB 4YDVB 3UJTH 3BJLA 5IQ7H 1NGXA 1XF3B 4UB0L 4ZDHB 3QCVL 2IANE 4M02A 2DBJA 3GKWH 2WQ8A 1NMAL 1OP5K 4EDXA 2NXZD 3A6OA 3KPRA 3TJEH 3AROA 2VQUA 4KGJA 4L3CA 4WI2A 5GHWL 5GIRA 5L2KD 3HI6L 5CINL 1FFOB 4B5EA 4ZXBD 2X4OB 4PGZA 5FYLH 4K3HA 2HKHL 3S35H 1NBZB 4M7LL 4MJ6A 3DGGA 5ENWB 2APVA 1GGBH 5C07E 2WBJB 3OF6D 4YHNB 1Q1JH 3N1PC 3RWGB 4A6YH 4NQXA 3BZFA 5IMOA 3CDGA 3CLFH 4HLZH 2ZCHL 4P59L 1M71A 2E27L 4HJJL 2NY0B 3IB4A 3PNWB 4YHZL 5F1NB 5L9DL 5ITBL 4NZRH 5IB4A 1N64H 3HC0A 4XI5C 1FFPA 4PJIB 4UUJB 4I3RL 1I9IL 5JPNA 5EWIH 1OP3H 2DBLL 2OZ4A 4G6FD 1OTUC 4Q9QL 5IROC 1UXWB 1JZ2A 1KLFA 1JPSL 5AUMB 2C1PA 1U3ZA 4XP1L 5KS9B 2J2ZA 1TTUA 1BQUA 4OCLC 1XGTA 1NSNL 5HGGS 4DN3H 4HV8A 5E4EC 1SY6A 4F8TA 2AEPH 5E99L 5KTEH 2IADB 4AENB 1G7LA 1F13A 3WKML 3HE6C 3TO2B 2MCPH 3I6KA 3QFDA 3WHE1 1T6WA 4Y4KC 3MV01 3X11B 1MFCL 4K9EC 4HZAA 4LCIH 1GC1H 5I1DA 5DD1L 1Q72L 1ZS8A 4LASL 3ARFA 2V2XB 1DBAH 4JANA 1AGDB 1XF2B 1ETZB 2DD8H 5JXEC 1BQHG 3C8DA 3LS5L 3QG6A 3CUPA 2E9BA 5AZEL 4M00A 4U0QB 3ULVH 1FYTB 3QDJE 4BZ2L 3AB0B 5D7LE 2E7LC 1TZIA 1YMME 4Y1AB 4FFVD 1K4DB 1YNTA 4FZEH 3HPLB 5KG9B 4OLWH 4LVHC 3HE6B 3TC9A 3T0EC 3QUMA 1BBDH 2BSRA 2JB5H 3DVGA 3WXWH 3INUL 5FOJA 2VLLB 4PJIE 4PUBH 3UYRH 2IJ0C 3OKNA 1EO8L 2A83A 4M5YH 4JCLA 3QISA 4NSKB 4LCCC 3HI1B 3QIUA 3H9HB 2JCCB 5E24E 5DEGB 3MJ6A 2VOTA 3RNKB 2A6DB 1T7YA 2B4CC 4TUOA 2KBGA 4P2QB 2DWDB 4LF3A 1T04B 5I75C 4CN1A 5B21A 5IHBA 2VZTA 2XA8L 3C9NB 3CC5A 4KRMB 3IGAA 1NUNB 4JDVA 3L3IA 4LSPL 2ATKA 4PP1C 5C7XL 2AXFA 3QCTL 1BVLB 3L6FB 4HH9A 1MRFH 4QRTB 2ED9A 3ESVF 2H3NB 5DJCA 1F90H 4M1DL 3RRQA 4P2OA 2R29L 4OCXL 1I7ZB 3V4UL 1XZ0B 3TPUA 4JHAH 4P5MB 3G5ZB 4PRDA 1UVQB 1NLDL 1MLCA 3W81A 3LH2L 5E2VL 3KLAA 5HD8D 3U2SA 3AMKA 1ZGLA 1YPZE 2HTKD 3WHXB 1A6TB 3MRIA 2BVOA 2G75B 3GJFB 5I1EH 2LAAA 1P4BL 1XIWB 3R8QA 4P3CL 1CN4A 5JPMB 5DD5H 5HSFA 1MUJA 1WVZA 4U1JA 5SWSE 1NCBH 5GGVH 2E6JA 4L4VB 1Z3GH 3WS3A 4FQ1H 1D5IH 2J8HA 3DROA 4APQC 4YHIA 2FZ3B 5IFAL 3BEVB 1TCRB 3TIEA 2AXJA 4JN2B 4JRXD 3IETA 4OIIL 4RGND 4PJHB 4OIBA 5I8OL 1EHNA 5ILTL 5CJOH 4AIXA 5SX4H 1CXIA 1M7DB 4PRHE 5EC2B 4F15C 5F9AC 4NJAL 1IGJA 3MCKB 4ZO6A 3MUJA 3IAQA 3X14B 1FV1B 3KPSB 1XGPB 4KXZI 4N0UB 3QQ4B 2B1HL 1P4LA 2YXFA 1VEOA 2BRRH 1QSEE 1HIML 4EKXA 3BRDA 3ZL4H 2AJXH 3JXAA 5A16B 4YH6A 4DKEH 1FVDA 1F3JA 3HE7B 4JPIB 5EBLB 2J8OA 4QXTB 1NAMB 4QOKA 1S7TA 3PDOB 3RX8A 1BD2B 4S0TD 2RCSH 1J1PH 3M17A 3HUJB 4MXVE 3SGEI 1X5GA 5FGRA 1MIML 3LHPH 2GK0B 2I5YH 2EDQA 5GSRB 3K46A 4LRIC 4JO4H 2VAAA 2YUVA 4N1HB 4A2MA 4R26L 1IQWL 2APWA 4UBDC 3QUZC 4WUKH 1IGMH 3TVMA 4EQ2A 1SJHB 2A6JA 2YD1A 2QLVB 2NY2D 2NXZC 5IEKA 6FABL 4KRPB 2RGSA 4XAWH 5CD3A 3KNBA 2YPVH 3EOAA 4PJEE 1F8TL 5BJTA 2DM4A 5SWSA 3RIAF 3P0VL 1AI1L 2VXSL 3OGCB 1V7MH 3CSPA 5CHNA 4EUPG 3P0YH 4QNPE 5HHNA 4JFDB 4H25B 1YPZA 4U1SB 3FCTB 1D5MA 1OD9A 1M6OB 3C5JB 1EJOH 3NCJL 4P9HH 5BXFB 4MCYB 3CGTA 2F5AH 3TN0B 3ULVL 3QUYA 3UMTA 2J6EL 2PYEA 4GKZA 1A7QL 3J7HA 5H94A 1KN4L 4XHQA 3VXMD 4LPYA 5K93A 1Q8MA 1JNNH 5CBEA 2OQJB 5E2UL 1OTSD 2ZUSA 3QXDB 4JRXB 5ISZB 1MAJA 3ZDXE 3SE3C 1G6VK 3L5WA 4F9LC 4LPVA 5I71B 2WUBL 4NKDA 3S5LB 5GGTH 4M5YL 4K23H 4U2YA 4YPJA 4MNGA 3DMMD 4AZ8A 1NBVH 3MR9B 4NHUB 3KPSD 2KQNA 3HG1B 2PO6D 4P3DA 4X5WA 5I73C 3O8XD 5EU4A 5D7IE 1AKJD 4Z78A 3KPMB 4KK5C 5HY9A 4L4TE 4Z5RB 1IZKA 1DBAL 1U3HD 4HT1H 2FL5B 3T4AA 4Z7UE 5DJ8A 1N3NB 1BD2D 3Q6FA 5F7DB 2J88L 3ARED 1HH6B 1B90A 2CJUH 2FGWH 2C26A 1DUZB 3BZEB 5HI3D 3SDAB 4C4KT 1JVKA 3EZJB 3T3PE 5DJZA 1N6QL 4XP9H 1IILE 5C0AE 3TBTA 3K1DA 2BY1A 2PR4H 4TULL 2BFVL 5C0DB 5IR1B 1LE5B 2QQKH 1UZ8B 4E42A 4HUWB 3E8UL 3T8XB 2P5WB 5MEOB 4KPHH 3ECBB 4HG4J 1AFVH 4TPRH 4BKLB 3O6FA 3QUKA 2J88H 4KRPD 1HHGB 4CKVX 2UVFA 5GS0L 5GHWH 3MRJA 3OG6B 5JNYA 4O2FB 1K2DA 1BQLL 4I5BB 4W6XB 4ODXA 5EO1A 2HT2C 4NWTH 1C5BH 3LSOB 1WT5C 4XPBH 3MV9E 4H5SB 4R4NC 3QZWA 2GJJA 3WUWB 1IEBA 2ARJA 4HIHB 2K3TA 2ZG2A 1EHXA 1EEYB 4XNYL 5D72H 1CS6A 1LK3L 2WIIB 2AABH 4UOJA 3S3JA 4GMTH 5GZNC 2X1PA 4JREC 3KHOA 1E4XH 3MLVL 1IFHL 1J18A 1KCUL 2PNDA 5I66B 3FRPG 3B3IA 3EYQC 1IJ9A 3FFCB 4NC1C 1J8HD 5DWUH 2HWZL 5JIPA 4KKBD 2BSSB 3FRUB 1VADA 5MENE 3NIDF 2FHCA 4KAQL 5ITFA 3NACH 2ZCHH 1T83A 1NAML 4JPVH 1RZJH 1KT2B 4DZ8A 4LIQE 1HWGB 4H8WL 4QWWD 5GJTL 3OAZK 1IQDB 2MSPA 2W9EL 2XQYG 2X4UB 2BNRE 5C9JA 4YBLC 1U3HB 2ZKHL 1UM4L 5HDQH 5ADPL 2OXHA 5C0FB 3GKWL 2E7LA 1NAKL 2WK2A 5EG6C 2AGJH 2AV1B 2GUOB 1F4HA 6FABH 3QI9B 3WHE0 4HH9B 3WLWD 2XIDA 2P5EE 1VACA 5IW6A 4EDWH 5CD5D 1FZMA 3W9DA 2BC4B 3T0EA 4HIXH 3SPVB 4J3OC 1SYVB 5FF6B 5KVFL 2IWGA 4V1DB 3WXVH 1DQML 3FT4B 4QTHB 5IFJB 4NJ9L 2DWDA 4MZ3A 2Z92B 3K80A 4MLSA 1QFPA 1I3UA 4TSCH 4F7PA 3S3SA 3FQWB 4BSWA 3P73A 5LXGL 3GMRA 3RBSA 2FWOA 3EDFA 5CSGA 2ZG1A 4GKNA 3HI1A 1F00I 4PGCB 1VB9A 3QAZB 5EIVA 5FHBH 4FA8A 1OAQH 5GSVB 4ZUTA 1XR8A 2VJXA 2X4TB 2RHEA 3I9GH 3QPXL 3CFBB 2FLBT 3LDBB 3DBXA 5EIIB 5GJSL 1OM3H 1QBMH 4HS6B 4CN6A 3RUGF 3VI3F 5BS0D 1CGSH 4ZOCA 4ZAKB 4C54A 3CH1B 3MRDA 1MJ8L 3Q6FB 3DRTA 3WO4C 5D2NA 4IMKC 2GTWA 1EFXD 3OAYK 2A9ML 3WFCL 4P46A 4R4FH 4OGZA 1CICB 3BIKB 4ZO7A 4NM4H 4S11A 4ZPVB 1W2KT 2AV7B 4M7JL 2DRUA 3QO0B 5CMAB 4X5WB 2UWEE 3N85H 2CO7B 3V6FA 4HXAH 5B8CB 2V17L 2DYPB 4K3DH 2I07B 4YWGL 5K9KB 3GMQA 3TFKC 2V9TA 2GEEA 1ZA3A 5I1AA 1FZKB 1MI5D 3G6DH 3T65A 4G6MH 4DUXA 4HV8B 4LPTA 4W6WB 4Z7WF 3Q3GB 1MCWW 4U6YB 3ILPA 1H8SA 1YN7A 4YK4C 1JWMA 4QXUL 1MREL 3BYYA 2NTSP 2VYRE 1EPFA 2PYEB 4DGYH 2ZZUT 5BCAA 2NY3B 5K33A 3NPZB 4LHUB 4PJ7E 1N5YH 5E8NA 4X7SH 4H25A 3LKNA 4D0DB 3AXLA 1TDQA 4DWHA 1NC4A 4X4XA 3QIBD 2IPTL 1QSEA 1JPST 2F8OA 3D69A 4XXCC 5LQBL 2NY0C 3QO1A 3PP4H 1MCBA 4FXLA 3GI8L 1OF2A 5FDYA 4K9EL 1RULH 4NQDD 4P48A 1UQSB 4LLDA 1X5FA 4FP8L 4CUCA 2F53E 1HINH 4YDIH 1K4CA 1W72A 2ZNXA 5JMOC 4JY6B 4OFVA 4XT1C 3TA3D 1R5VA 2AJYL 3PL6A 2EDRA 3AB0C 3IU3B 3LKPB 4UT6L 5DMYA 2RR3A 4LRIA 3CVIH 1A7PL 2R0ZL 3R06A 1HDMB 4S1DC 5HGAB 4LPWA 4LGSB 4AYFA 3IS1X 5H35A 3UYPA 5TE7H 3PJSB 2QADD 1G7QB 4WNQA 1F58H 3VG0L 2IH3A 2VL5B 4W70A 4WU5B 3WSQL 4DKEL 1XGYH 4LHUA 3VFNA 2HKFL 5HGDA 4HK0B 4UAOC 2EKJA 2P5ED 3QH3A 5I19L 3VJ6A 3L3GB 2I9TA 3D0LA 1YY9C 4IDJH 1RFDH 4XGZA 4XMPH 4RMVA 5K59E 3MJ8B 5DD1H 5KN5A 3VXQB 1KEGH 1IM9A 4ZMAT 5FYJE 3CVHL 1PY9A 1U95A 3WL9A 3SKOA 5IFAH 4NYLB 3BYTA 4W81A 2AK4E 3VXUA 1GIGL 4CW1B 2QEJA 2O5YH 3V7AG 4EBQL 1XF1A 2X40A 1ZWIA 2EC9U 4OUUA 4HJGA 1NUDA 2C3GA 3GRWL 4FTVE 5JQHC 1CFNB 5DD5L 2X5PA 4YBQC 4ELMF 1JF5A 2AV7A 3OXRA 2R4SH 2YPLD 4WUUA 1HSAB 2X2YA 1OGAA 3IDNA 1GAFH 1T1XA 3GNMH 1YY8B 4K3JL 4OSUL 2EYRA 5DK3A 2EE3A 3WUZA 3QZWG 4MMZC 1JGVL 4JG0L 3LSOA 3PWPB 3BWAB 3PF2A 3SDCB 2HFGH 2VH5H 3IDIA 2AJYH 2D0HA 3U2SB 4XNMA 4FQCL 2HTLD 5C0RH 5D7JC 5ID1B 1FZJB 1EUUA 2NLJA 3V6OA 5A1AA 3VH8B 4JHZA 1B0GB 5IB3B 4ENEC 3TPUB 1NFDA 4LKCB 3MLSL 5CJXC 5DA4A 1TITA 1NCAL 1A21A 3TBYA 3VW3L 3T4YA 1PKQE 4NQDB 1QPXA 5DJ6A 5EORL 4KQ3L 1L4IA 1IGML 3ZE2E 4K07A 2K7PA 3ARTA 4YXKL 2EZ0D 4Y5YB 3MNZA 2DLEA 5HHVH 1AGEB 2I5YL 3VWJD 3MZGB 2P4AB 1BFTA 3SDYH 2HT4D 4QHKJ 5HDLA 4F7EA 2V2WB 2QADB 1CFQB 4QXUH 4PLKD 1U8PB 2BERA 1G7IB 1TJHL 4CVZB 3RZCA 1LDPL 1AXSA 3ZT6A 3TNNA 2FO4A 5BV7H 4EI6B 1R3JA 4YHKH 5HHXL 1JTPA 5F9WB 1GOHA 4KVNL 2APBA 4PJ9B 2DJUA 4WEUD 1LHZA 3DO3A 2OI9C 1CTOA 1AGCA 5T5NG 1FNLA 3OBAA 4P4KA 4Z77A 5C9JB 2Y6SD 3GUTA 1KJ2L 1OCWL 1LDSA 4OT1H 1CDYA 4P9MH 4GG6A 2CK2A 5B3JE 3LIZH 5KANI 5FYJH 4NCC1 3OSKA 5IJVB 1A4KA 2OP4L 4IRJB 4NRZB 4DK3A 3P9MA 4IIQC 5HI4C 4YFEA 4P2YA 1C5DA 3GM8A 2HLFD 5E8PA 1NC2D 5FA3B 5JR1L 2VABA 4DVRL 4OB5H 4G8IA 1MFCH 4PP2B 5INDB 4LCUA 4RGMC 1UB5B 2UY7A 15C8H 1JNLL 4Y19D 3SKMA 4OZHF 4PJ9C 2NY4D 4UV4L 1T0NA 5JW4N 1VEPA 5BXFA 3WJJC 5EBMB 4ZSOE 2J7LA 3MC0A 4NQEA 1ZOXA 3U4BL 1P1ZB 3SBWA 5H37G 3TNNB 4JKPH 2A74A 2YR3A 1BMGA 4IRSD 5F71A 3V6ZA 3ZLQC 2C3HA 3KNBB 5JOFB 2VZVA 1KB5A 4QRQA 2HN7A 4Y2DC 4PRNA 3BQUA 1C5CH 1FFQA 1L6XA 4QY8B 1F4YH 5DD3H 1ZT4B 4M6OH 2QSQA 3WO3B 4ODUA 5GS2H 1Y18A 1KLGB 3PV6A 5ADOH 4PJFE 1EK3A 1QBBA 4HIIA 4PY8J 4MDJB 2FEDC 5D70H 1UH3A 2P8MB 4FP8H 3EYFB 4WWKA 3PP3K 5EDXA 3O3BA 4L4VE 4JPKH 4QF1B 4Z7UF 4P2RA 1VKXA 2KL6A 4OGAC 5JMRA 4Y4HD 1I9EA 3FO2B 3PGDB 3CCHA 1U41A 4AEIL 1NFKA 1LE5A 5I8CA 4LL9A 3NFSL 1G9MH 1BD2A 5D7IB 4N5UA 3ARGC 4KHTH 3PWPA 4JFHE 3GFUA 4Q97A 1AKJA 4XX1E 2ZCLH 4O02H 2XFXB 3GRWA 3BKML 1U8JA 2MWCA 3OKEB 1PZ5B 5CUSL 5E2JA 3KLSA 4I48B 4YQXL 2VWEC 5DK2A 4GQPH 4NWTL 4Z78B 4OZ4A 3B4NA 4U3HA 4LLMB 1QYGL 2ICEA 1H8NA 4XNUL 2NXZB 1WBXB 3PXHA 1JZ5A 1XFPA 5IBLD 5L88H 3Q0HA 3FB6B 1WCQA 4J4PC 4WI9A 5DQDH 2OL3L 2EDFA 5E08L 2YN5A 3V5HB 3UTTD 3VXRA 3GHBH 1ORSA 5HBBA 3QUYD 4OD2B 5GGRB 4M1GH 4NC2B 3ZKQD 5J56B 4ZG1A 1ED3A 1T80A 4BFIB 2ILLA 4OFKA 4OZGF 1T22B 1WZLA 1E4XI 2BVPB 4C58B 4NJ9H 2O5XH 4FQ2L 3T1FB 3SN6N 4OF0A 1ZTXL 4CBPA 4G43B 5SWSD 3VFVA 2IH3B 3PJSA 4ZPTB 1LDPH 4M9OA 1DBJH 4Q7DA 3MREA 1CLYH 1S5HA 3QUZB 4IEFB 1YMMB 5HYJE 1FYTE 3QDJB 5DJCB 1W72H 4L9DA 3X13A 5MP6L 3QXAB 1FH5H 3C60B 5J13C 4OZGA 3DO7A 4LAQL 1FCCA 3SY0B 2BCKA 1EMTH 1UACH 3OHXA 4YE4H 5HJ3A 1S7UA 4OD2A 5BO1L 5GGTL 5DQ9B 3VXRB 5BOPA 4OKVA 4OLZL 3RA7H 5TFSL 1PDKA 1D6EB 2BP3A 3D3VD 1F4XH 1HI6B 4HEME 5IHLB 2HH0H 4LLQB 4M93C 1TNNA 4X4XB 4Z7OE 1KCVH 1RSFA 3L9RB 4PJDB 3WFEH 3GMLB 1EFXB 5CINH 4HIXL 4D8PA 3IAPA 5E8NB 1BBJA 1HCFX 4YXLL 4GW5B 4UNTA 1EO5A 2FYYB 1KJ2H 2BY3A 1E6JL 1ZT7A 4NZUH 4E41D 5KW9L 1A6AB 3P4NB 3E6FA 5I16B 1N0XH 3ZT5A 3MA9H 1NCDH 3IFOA 1FL5A 4YC2B 1D5BA 1DSFL 2CLZA 3B5TA 4K23L 4JQIL 1H15A 4IHOA 1S3KH 1JPGA 1FNHA 2YHGA 3SE3A 4FQLL 5ICYB 4JZJC 1XGRA 1DTUA 1CDIA 3QEQD 2X7LA 2XWBB 3N9GL 5DZOA 1XF2A 3L3DA 3ZE1E 1FV1A 2WAHA 5I1IH 5GGVY 2R69L 4U0RB 4U7KA 1KYOK 5DC0A 3T4YB 3FO2A 4ZPVA 1DSFH 2BSTB 3MYZA 4AL8L 1IKNA 1CGSL 3EFFA 4LHUD 4PJHA 5CEZL 4E9LA 4GUPB 1KIRB 3NIGE 3EOBA 1INEL 3UTPE 1EVUA 2V9RA 1ZANH 3MRKA 5I1JL 4B7LA 3BOVA 5A2FA 1NANI 4YFLI 4HBCH 1XGTB 1MCWM 4JFEA 4V2CB 1M4KA 5DF0A 2Y7QA 5KSAA 5ALBH 3FJTA 12E8H 7CGTA 1ES0A 3K2UL 4X7FC 4XP6L 5D2LA 1ZTXH 4ACPA 5B38B 1MCCA 3JBG7 4GS7C 4PJ5D 2KZ1B 1CXKA 3VI3E 43CAB 4NT6B 5IWLA 1JHTA 2JJSA 4UT6H 2BDNL 4PRDB 3F12B 1MCPH 2J8UA 4QRSB 1GVIA 2CKBB 2CDEB 1T3FA 4UAOB 2VB5A 2CD0A 3W0WA 5I18H 5CIPH 1EAJA 4HT1L 3MX0A 5GRVL 4FZ8L 4G9FE 4KK8D 2H3NA 5F7NC 1WBZA 3L3DB 4HF5L 5DI8A 5DQDL 3ZYZA 1AFVL 4TPRL 3Q6GL 4JR9L 4KMLB 3QDGD 4F58H 5INDA 3V95A 3BKYH 1A6WL 3BHBB 4MXVF 2IPUK 3UTSE 3RKPA 3QULA 4RNRA 4XMLH 1R5WB 4IRJA 4NRZA 1KEGL 1CGUA 4X99B 2A6KB 2NY7L 4P2QA 1NGPH 3E6FB 2W9EH 3WV0A 1H3XA 1T0MA 2Y4SA 5GRXG 4TUOB 2JJSC 2XA3A 1UKTA 4LAJH 1VESA 5J11C 1P7QB 4U2ZA 4XWOD 1I1RA 5C0BA 5I1CH 4Y1AE 1ZEAH 4D8PB 3GHBL 3THML 5IKCA 2ZUTA 3WIHA 1CDCA 3L9RA 1QACA 1NL0L 4X6CE 2EDNA 2F54A 3O41A 4LLVB 1OPGH 4X4MA 4Z6AT 1I3GL 3MJ7A 3QDGA 3U30B 2YSSA 1ACYH 3EDDA 3RZCC 5D1XB 4V2BA 4TVPL 1HE7A 3PHQB 3O3DA 4U1GC 5DMKB 1D7FA 4GRWF 3OHXB 1NGWA 1BM3L 2EEBA 4OFYA 5HVGB 1QFWL 3S37H 5L0QC 4LCCA 3F62A 1FIGH 2Q8AH 3CAFA 3S37L 1PW3A 3RTQC 3DVNA 5DS8B 5J11B 5FYJU 3O2DH 2B7DT 4JANB 1AO7D 3SJVE 1Q9KB 5DHVH 1S8DB 3MREB 3IFPB 4M6NL 5HHOA 1I3GH 5JUEL 5HI5C 4L8CA 5A2IH 1ZHNB 2CLVB 4OFPA 2CDGA 3C6SA 4WFEE 3PP3H 3ZTJG 2VLKB 2EO1A 4L4JA 8FABA 2LTQB 4PJ8D 2DQFA 3BUTA 4CAGA 3U9UB 4HXAL 1UT9A 3MRKB 1RUAH 1R3LA 2QTEA 4ODXB 2MKWA 4MD4B 1LEKA 3PE9A 3T65B 3JV0A 4UDUA 1G7HA 3SBWC 3T09A 4XAWL 4ZTOH 4NM4L 2EH7H 4HUNB 2Z8RA 1G9MC 3G6JF 4DGVH 4QCIA 2ITDB 5C8JB 3BDYH 3NOIA 5DJDB 5AZEH 4WEBL 1BWMA 3GB7B 1UGNA 4U1MA 1I1CA 3KYAA 3IVKB 4WTZA 3QDMB 2QJDA 3VRJB 1U8QA 3MODH 4QRPB 1MWAA 3HG1E 4AQOA 4KUZL 1GOFA 4CNIB 2FO1A 3LEXB 5DDHA 2FATH 5E5RB 1R24A 1RUPH 1BLNA 3BDXA 1EEZA 2D9CA 1JZ6A 3CU1A 3WXWL 2AI0H 1NCNA 4WW2F 2NY7H 1CI5A 3VJ6B 2UWEF 1MFEH 2O93L 5D71H 2W59A 1AR2A 1BVKB 2PF6A 4ORGB 5HHPB 2CKNA 2F54E 5DRWA 5I1EL 3V6OE 3OPZH 1JNHB 4PREA 3JWOL 1EV2E 1V7NH 2QQQA 4RAUA 4LSSL 4RWYL 3QJHA 3OKKB 4PTTA 5MEND 2VDPH 3LIZL 4J8RA 5C0CE 3JV4B 3PL6B 2R8SL 4HKXA 2L0DA 3CNKA 3FAXA 2NY5L 4Y89A 4LSRL 5CAYB 4GW1B 4XP6H 2PETA 4WI5A 4KK9D 3X13B 4GKZB 2OTUB 1VACB 3TF7C 2X4RB 3BDBA 3KXFE 3VD5A 8CGTA 5HVHB 1PKOA 5F1KC 3ZE0E 4NN6C 1Z0MA 1WWCA 5IM7B 3D25A 1B4JH 4XB8A 3TO4D 4OTXL 1XEDA 1FBIH 5HVHC 1OTTC 3QCVH 2XKNA 4LSVL 4P57B 3JV5A 4LPXA 3BZ4B 4U4BA 1I1YB 3KJ6L 1RV6X 3MRPA 3MLWH 3FTGB 3SE4A 2XN9E 3N1QC 3MJ9L 3UTTA 2ESVE 1OT1A 4K71C 1CD9B 2E27H 1X5YA 4ODSH 4DCQA 1AGBA 3D2UB 5IT2L 2EIDA 4CGTA 4U6HA 5I1IL 1XF5A 2PYFB 3ILPB 3ZYOA 4KMQA 5DVKA 3NFPA 4L5FH 4UV7L 7FABL 2O5YL 5IKCB 3P11H 3UTSD 1YUHA 1ZLSH 2XKUA 4TOYH 1P7QA 3ELAT 4WU7A 5D1ZB 5E94B 5IB2B 2QQNL 2WMPA 1Z6JT 4FQPA 1BD2E 4TYUA 4EI6A 4GG8A 4K3JH 2OJEB 4P46B 2JJVA 1XCQA 3ARXA 1JTOA 5EOQH 5FYLE 5F96L 1F3JB 3HE7A 4JPIA 3U7YH 4HIJA 5FEBA 4NKOA 4X5XA 1LK3H 4QO1A 5TF1L 2VXQL 1KEML 1DE4A 1A7NL 3EW3B 5HYQA 4HS6A 3P3YA 1T1ZA 1PLGH 4PJGF 1ULVA 4R90L 3SDDA 3WKMH 1F4WL 4OUOA 2FB4L 3OG4B 3BPCB 5F3HB 5EU6E 4W4OA 4ZD3H 4UT7L 3QEUB 2W0FB 3SHSA 3J8F7 4ENED 3NCEB 2JTDA 1CLZH 4NBXB 5B38A 2XPGB 2FGWL 1BQHA 3SKNA 4R9HA 5D7IF 1U8OB 5E1AA 3IXAB 4QY8A 4C4KO 5MHSE 4JRYB 4LCWE 3U1SL 4EN3C 2NNAB 5KVGH 4HC1H 2C7UA 5CEYB 4XZUB 3QNYB 5C3TA 3TCLB 1JWSA 4Z7UB 5DVNA 3VXTA 4ZTOL 3EOBB 3TCXA 3TO4B 1FZMB 4BUHA 5TGBB 2WQRA 3CZJA 2CLVA 4HZLA 1IGYB 1B3JA 4FRWA 3EBAA 4LCYA 3RPIB 3VXOA 2F9BT 4X4YA 2IFFH 3S7GA 4BH7B 3D2UD 2NY1C 4OAWA 1JYXA 1NGZB 4JFYB 1DQLL 1FZOB 4G6KH 1L9NA 3STBA 1IQDA 3SE4C 1JPFB 3DSFH 3VXUB 3NIFF 4WEBH 3DVFA 2EDXA 1UJ3A 4YHZH 3O4LD 3W82A 2JJUA 5DO2D 3ULVE 5C92A 3RPKA 4ZQKA 5BV7B 1SEQL 4PPTA 4PR5B 1NCTA 1LQSR 4EI5C 2VXUL 4HK0A 3ARGB 4K2UH 3B2UD 1W0VA 2WWMC 4WRLA 5EU6A 2IMMA 4HCRL 2DTSA 3KPNA 1J1PL 4WU5A 3D39D 5TE4L 2JF1A 3NZHH 1MI5B 1WCBB 5CHNB 1TTFA 3QUMH 4GRWB 4YEFA 4Z0BL 3KGRA 3WIFA 5EZOH 4O9HL 1PGRB 4N8VG 1RUQH 5I8EB 3LQAH 4WUKL 1J88A 3OAYH 4G6AD 3BHBA 4LASH 2PYED 4Y5YA 2JCCF 1GC1L 3L95A 2NY2B 5C0AD 3BE1L 1FNEA 4X9FA 4ZD3L 1YEGL 2VR9A 4DVBA 3F7RA 4APQD 4UT9H 3CFEB 5I2IA 4HPOH 2PXYD 3VGAB 3RGHA 5FUCC 4PREB 1SVCP 3SDDD 4K94C 3QFDB 5FYKU 4X98B 4MHHG 3TO2A 1EBAA 3LAFA 3MOQA 1FC1A 1BOYA 3IRPX 4D9LH 4P2OD 5TH2A 2HP4A 3HUJA 1D6VH 1SJEB 1WITA 5C6TL 1OP5H 1OAKH 3K74B 3EKCA 3U4AA 1EGJA 3EYOB 3ARZA 3LH2H 5D71L 1WF5A 3BUYA 4NFBA 4MAYC 1KTLB 5I74B 5ILTH 1JNLH 5LXGH 1UXWA 3CZFA 2BSED 4W68A 1AQDA 3DX7B 2FL5A 5GS0D 3FN0L 5JPNB 1MWAB 1UJTA 4N8CL 3G5XA 4XWOC 3HC0B 4X9IA 5FO9A 4LLYB 3WDHA 1CFSB 1UXSA 2BJMH 4S1RL 2FZ3A 1U3JA 3CFKB 4POYA 1QRNA 4QGYA 1CK0L 1DBMH 1S7WA 1Z9LA 1RUQL 2CK0H 2R2EA 3VFOA 2GITB 4NKDB 3BAEH 4QXWA 3S5LA 1J0ZA 3UZVB 3L5WB 4LMQE 2P5EA 4GS7B 4IHOB 3OB0K 5EN2B 3RZCD 4M43H 3VD9A 3U9UA 5HDQL 1FGNH 4O4YH 2R29H 2KPNA 4HQQH 4OZIE 1J87A 5DJAB 1QFWM 4XNZB 3WNOA 2DQCL 5IG7A 1FNAA 5I15H 1EO7A 5EC1A 3IDXH 4HUUB 1UYWL 4NRXA 4LIQL 4NM8L 1S7RA 3RQ3A 2CQVA 2DB8A 5KSAC 5LCVL 4GBXD 1X5JA 2A73A 5KVGL 1U8NB 1Y18B 3QDHA 4OD3H 3TM6A 1DBKL 3VXPA 5FGSA 2JELH 1A3LL 1VSCA 4X6BA 5GS0H 5DFVC 5HJ3B 1NCWL 3Q5YA 4YHYC 1U58A 4M8VA 5EUOB 3UTOA 2R0WH 5GS3A 1EGJL 1H3WM 3KPPA 5KSUB 1I8IA 3O41B 1CXLA 1P1ZA 5BV7C 2R0KH 5F70A 4TSBH 2ATPB 3INUH 1I8MB 3LB6D 3BJ91 4HS8L 3U30C 3TZVB 1N6QH 5C0FA 4YXHH 3FMGL 5EC1B 2YPLA 4WUUD 3MV7E 3CXHJ 4G8FA 1YC7A 1TQCC 1Z5LB 5TQ0H 4HKBB 4WENB 3DIFA 3BX7C 2V2TA 3SGKA 4DQOL 1J8HB 2R9HD 3RY4A 5J0BA 1ORSB 1XCTB 5I75B 2IAMD 3GKZA 1WFNA 5I1AB 2AEWA 2R23A 3C5SA 5ECJE 3B9DA 5L7XL 5GGUB 2EDYA 4YBHA 2NQCA 4XP9L 4YAQA 4M48L 4O2CB 1FQ9C 3LN4B 1RUAL 1RUPL 3ZE0F 4XCNB 1H9VA 4J23A 4Z7WB 1ORQA 4IRJD 2UYLB 1JHTB 2V9QA 4RZCA 4XP4L 3UPRA 2GJ6A 4Z7UA 3RY6C 1EHLL 2VXTL 4N9GB 5DD6A 2NY4B 3FQTA 4Q2ZA 5HHOD 3MACH 1J1XH 3SCMD 4TOYL 1CLCA 5C0BE 1MF2L 3CU7A 4QWWC 3SKNB 4Q74A 3IJYB 3AS3A 5D4QA 4UUJA 3RAJL 4OM1H 2C3VB 5TDNB 4OD1H 4ZFFA 2E6PA 1NFDB 3T0EE 2BVEA 5E2UH 4JQXC 1TCMA 3ZDZE 1MCOL 1MQKH 4RA0C 5C0CA 1MQKL 5IMOB 4WW2A 2FJFA 3MRNA 3ROLB 2AXFB 4AH2A 3MLWL 3BN3B 3H9YA 1N5YL 2FJGA 4OZIB 3FN9A 2C3XA 4NKOB 3C9NA 4ODTH 2CLZB 4N0FB 1YA5A 3DUSB 2ZOLA 4OTXH 3KPTA 3UDWC 4MA1B 1YY8A 3RX7A 5A2KH 3VXNB 4PJXF 4IOFC 3IDNB 1T04A 4XTRC 5B38G 2NR6D 1AY1H 4BZ1L 1IGCH 4NPYB 1BEYH 3CSYB 5L8KB 3LS4H 5GGSA 3LN5B 1IE5A 2GSGB 3IDMB 1J0HA 4JEGB 4PYGA 4WHCA 5DR5H 1QSFB 4YBLB 1AQKH 1RUML 4AEIH 1A6WH 4HFWB 2ZOKB 3WFDH 3HZKA 2GJZA 4PR5A 4LLQA 3FONA 4PP2A 3FN3A 4HWEL 4L8SA 1XCTA 5KN5B 1EBPA 5T3ZD 2DYPD 4KUCD 4GXUM 4FZ8H 5E2TL 2BJML 3FT2A 4S1RH 4BJLA 5D70L 5HGBA 1CYGA 1AGBB 1J8HA 4M6MH 4DTGL 2EXYC 4MCZB 2VDOH 4XHJC 2VLJE 1MCPL 3GJEB 3RI5F 4AEHH 1F4YL 5GQBA 2AEIT 1LD9A 4I1NB 4L9LA 1PJ9A 2C1OA 4M7KH 3QWOA 1K8DA 3MBXH 5C3LD 4JFYA 4Y5VA 3MV9A 4JFPB 3I50H 1MEXL 4PTUA 3HFMH 3H42L 4MMXC 1CG9A 4LCYB 3TEUA 3VXOB 4U1SA 4NKIH 5D7KD 1FH5L 2EIZA 3OJ2C 5FYJL 5TE6H 5KSAD 1I8MA 3UTQB 2F15A 4ELKB 5GGQH 5JQ6L 2B4CH 2X4PA 4YO0A 1OSZB 4YXHL 2PXYA 4J3TA 4F7EB 1JHKL 5MI0C 3RDTC 3ROOA 3NFNA 2VQTA 5C0EB 1NMCB 4U05A 3F58L 3TP4A 3O6FD 1TENA 4M7KL 4A6YB 1K2DB 4I5BA 4WFED 3WNKA 4O2FA 4AG4H 3C08L 5J9PA 3NIDE 4Z76A 3TT1H 5JXAH 3MRJB 4JM4H 1YJDH 1FRGL 3VFWA 3GDBA 3MCLL 3MLSH 1YMMD 5LBSH 3T0XA 4RAVB 4YLQT 1J8KA 4PJIA 3TA3B 2PW2B 1DFBH 2NZIA 5HHQB 5E08H 5SWZE 1QLRB 4KK5D 2MNUA 5CGYD 4XBPA 1CIUA 4KDVA 3C8HA 5JW4R 2BVQA 1IBGL 4E0RA 1I4FB 4UTAH 4Y5YC 1IZJA 2UY6A 2DLTA 3WNNA 3B9KB 1CGWA 4JG1L 5CJ5A 1U8JB 1GC1C 4JQVC 1YECH 5FGCB 1DL7H 3VXRD 2HVJB 4FTVA 3O3AB 3ROOB 1HXYA 3OAUH 2GITA 2Q7NA 1PY4A 4ODVL 4Y8DC 1U8QB 1WWWX 1Q0YH 1DUYA 2I07A 5F1OB 5C7XH 1OGTA 1SEQH 4ZDHA 2HH0L 5HHVL 3REVB 2W07A 4K7PH 3QR2A 1CL7L 2DDQL 1CICA 3RKDC 4JN2A 1JFQL 1NBYB 1UACL 2R2HB 3B9VA 5I17A 3QIWC 3EO0B 4HWZB 4MZ2A 2Y72A 2VDMH 3U4EB 3SKOB 1RQ5A 1MIEL 4HIIB 1U95B 4HUMB 3WIIH 3I6GA 1MPAH 2N56A 5KSVA 4NBYB 1PBYA 1YYLH 5HGBB 1OQXA 3QNZB 3L5IA 2IFFL 1A6TA 5H94B 3FONB 3FFDA 1G7JB 2HFFB 3MRHB 5BZDA 1I7TA 3JTTB 1BZ7A 4QGTA 1JF6A 1RZGB 4JFEE 1Q9KA 4CJ1A 4FOMA 4X6DF 1S9WB 3NA9H 5IWLC 5B39B 4LCCB 3DSNA 2HAZA 1LO0H 4KJYA 1CT8A 4DUWA 2NCMA 3GEWB 5JW4Q 1OARH 2SEBB 2XXCB 2IG2H 4N5ED 3SE8L 5FAAA 1YEKH 4NO5B 1KCRL 2HFEB 1SYVA 3CC5B 4F7TA 1RZ8B 2MCG1 2DQTL 3GMMB 1I1AD 3AGVA 1UZ6F 4ZYKB 2VZUA 1JZ4A 1JRHH 4LGRB 2A1WL 2NR6C 2P42B 4F2MB 4KVCL 2DMKA 1M05A 4Q58C 5CUSH 4H26B 2WNGA 1IL1B 3BD5A 3F5WA 5I1KL 4G80B 3ARWA 1PQZA 4ZFFB 2I26N 2D0GA 3IYLW 5C08A 5HHPA 4EXKA 3ESUF 3HNSL 1CD0A 1T5WB 4I18A 5K9QI 2AJZB 1RZFH 5CLTA 3R4DA 4GRLC 4UDTB 1JZ3A 5ESQB 3WE6B 1G0DA 4OCYH 3TVMC 1W8OA 4N9GA 1LO5B 1P6FA 1V3LA 1KXQE 2AEQL 3KWWB 4O58L 1ZLSL 1MAML 1HQ4A 2GJ6B 3DTXB 3MV7B 3S9DB 3BVNB 2CUHA 4D0BB 4CMMA 4QRPA 4G8EB 2CRYA 3W0WB 2XWJB 4L3ED 1AGDA 2NTFA 3HI5H 4K71B 2YRPA 4KKCC 4M8QA 1OAXL 4JDTH 5BVJA 1TNMA 4MJIA 5BO1H 5IOPB 5FV2A 1BREA 5EO9B 5IT2H 4LKCA 1OQOA 4I3GA 1IBGH 5K59F 3L7FA 3M07A 1MQ8A 5TGBA 3WLBA 1C1EH 1G6RH 2VUYA 1VENA 3OJDB 4JFEB 1LNUB 4MA3B 3CX5J 4JY4B 1A9BB 4JM2A 4XPGL 3JVGC 2F74B 1LP9A 3MRMB 1NLBL 1FRGH 1WFOA 4JRYE 1DVFA 1P7KA 3A6BL 3S96B 3GBLA 1MJ8H 3GMOA 5LBSL 2XRAH 2P8LA 4LU5H 1BOGA 1S9KC 4NDMB 1OGAB 3FQUA 3U7WH 5IMMB 1KPUA 1Q9LB 1OWWA 4NO2A 3VWKC 3T8XA 4CMHB 1Y6MR 2APXA 5IB4B 4C56D 2UV3A 1RJYA 4YX2L 1BVLA 4QRTA 3OQ3B 4D0CB 5DS8A 4HLZG 2FIKA 5FM8A 3RWGA 5GXBB 4KFZC 2IALB 1C12B 1XMWA 1FFOA 2FD6L 1A1NB 4KQ4L 3HFML 4YFDB 3QIUD 4JCMA 1MNUL 1BFVL 4RGOH 2ZNWA 5A2JH 1XF3A 4K8RD 1NCCH 2B5IB 3O6LL 4GW5A 4OGYL 3C60C 5IVZB 1G9NH 4JFQA 4X4ZA 4R96B 4YHOH 4JHWL 5EUKA 2VLLA 1IAOA 2BNRB 1N59B 5J57B 4AEFA 5HYJA 3EO1B 4PB0L 3LD8B 1XR9A 1KPVB 3E2HC 4HPOL 1UFUA 5DQJA 5L88L 1W0WB 1QQDB 1N7MH 4XC1L 1F90L 2KKQA 1HHIA 4N0CC 3KR3L 1RD6A 2L7JA 4L8DA 5GGSY 2BVTA 2WWKO 3K4AA 3DRQA 4K55A 4H1LH 1WT5A 5FGBC 5JOPD 4FFYL 3BQUD 1G0YR 3SCMB 3TH4T 3C5JA 4EJ1C 2HJLB 4X80H 4WGVB 2WSKA 2VDLL 3KYKL 4IM8A 4KAQH 4UNVA 3LQAL 3BKCH 2C4XA 1CZ8H 4KY1L 3AXLB 4OZHE 4JZOA 2IEPA 1GZPA 2GJ6E 4C56E 4UIMA 2VXTH 1S9XB 1AQDB 4HIHA 3IJSA 4F57H 1KCSH 2Z4QB 3FFDB 1ED3B 1JN6B 5C07D 3EGSA 1D9KA 2ZKHH 4R7DB 1FVCA 3DWTA 1JL8A 4JKPL 4O51A 4XNXH 1OGAD 1U91B 3EGSB 4ZXBC 3JV4A 4OM1L 3T0VA 1J7VR 4C56B 1BBDL 2JB5L 4J12A 5TH2B 1CVRA 2H2PC 1FZKA 5HDOA 2UUDK 2A9NH 2MPAL 1ODAA 3MV8B 4IIQA 5E4IA 5F6HI 1U2HA 1OD7A 3RWIB 1SEBB 2ZWLT 4OB5L 3H2WA 2RFXB 2AAVA 2HJLA 4PGEB 1JBJA 1N2RA 4NQXB 1OLZA 5KS9F 4KTYA 2W0KA 3WNMA 1NL0H 3MNWB 5BQ7A 5KSBF 3X3GH 3DRTB 5E5UB 1HYSD 4ZAKA 1K5NB 5C0NC 2ZCKH 2FX8L 3U4BH 3IFOB 1BFSA 1HH6A 5T1KB 5F7DA 5EIIA 3KHQA 4DN4H 4WHTA 3IU4H 4Z8FL 3GM0A 4PJFA 4ZUTB 1IAMA 4RFNC 5I6XB 4KTDL 4Z5RA 3H6JA 3BXNB 2HJFB 3H9SD 2YXMA 3ZE2F 4XWGH 3TA3A 1FL6B 2YD9A 5KSBA 1UB6B 1DQTA 3EYSL 1W0VB 5C0CD 1SMAA 1HI6A 3HAEH 4PJXA 4WWKC 1F97A 3BESR 4HGWB 4POUB 5F6IB 4HAGA 4OJFL 5FUOH 3BP7A 3D39E 5EORH 2J5LB 3ZTNL 1OT2A 1U93B 1EGJH 5F7YC 5J06A 3QIWA 2VZ3A 4KI5F 4BYHA 3RWFB 3U7WL 4L5FL 3G5ZA 1TPXB 3VRIB 1S7QA 4PJDF 4F7MB 4JZJB 3B8SA 1A7BA 4ELME 1WEJH 4Z7VB 4PRPE 3PGCB 2H8PB 2VL4A 2ED7A 4U3XA 3TIDA 1JWUA 4JFFA 1OSPH 5BW7C 2ZG3A 1DBKH 1NMAH 4G43A 4PJAB 4MNQA 3G9AB 3RVXD 3S4SA 3RFZC 3ZSTA 3L3IB 4QNPF 1AR1D 2AXGB 32C2B 1YEFL 1DVFB 1P7KB 3TLRA 4MD5A 1KIQA 2GCYA 3KYOB 3VXTB 4MCZA 4UTAL 4OZGE 4E5XB 5F7FA 4UI2A 1KIPA 1TJGL 1LGVA 3L1OL 4GRWH 1JMXA 3O3DB 3QPQD 4ZS7H 5CILL 2XN9B 4HUVA 1EVTC 1QBLL 1D3CA 1CQKA 3HCVB 3HR5B 2EYSA 2AJ3B 1FPTL 4WVRA 3AS1A 3L7FB 3MRQB 4OLXH 2WWMD 3QQ3A 1PYWA 3RNKA 2ADIA 3KPRD 4JFOB 3DX9A 3WIHL 4AMKH 2ICEB 4MJIB 3LN5A 3PG2A 2A0LD 4OZ4B 2NTFB 2V5TA 2Y5TA 2QSVA 3FL7A 5D9SB 3GSOA 3MXVH 2P46B 2D7TL 2VN4A 1IAIM 4HXBH 2ERJC 3HPLA 5KG9A 1R5WA 2XFXA 5T1KA 1T20B 3BP4B 5HYQB 1KN2L 4MJIE 2QBWA 3UC0H 5DJXB 5C71A 4PGBB 3VFTA 3AMLA 1MHPH 3D3VA 2OZ4H 3L7EB 5ESQA 3GSWA 3UEZA 4RSVA 2ARJQ 3GK8L 4XVJL 4OF5A 5IBTH 5C0CB 5F7LB 5JLZB 1A7PH 2R0ZH 1RZKH 4LLUB 5T3XL 3GSOB 3I2CL 1TVBA 4N0YH 3S6CA 3V8OA 1RIVH 3FKUS 4JY5H 4G80A 3OX8B 1OAYH 4JREB 2ADGB 2X1WL 1RULL 3W2DL 4FS0A 4U1JB 3NFPB 1KNOA 1L7TL 2X1OA 2YA0A 2XN9A 1XF5B 2PYFA 5F89B 3U46A 3OJVC 5J12B 4ZUWB 5DR5L 1QHPA 5IBTL 1K8IB 1IC5L 1YYML 1CXFA 2FX9L 5IBUB 4XP5H 3RVVC 4G8GE 3P9LB 5EZIH 4LBEA 1JI1A 2R2BA 4N90E 4DAGL 1TFHA 1FFPB 2QR0B 4H1LB 4J3SA 4MNQB 5GRUL 5TDPA 5FK9A 2L7UA 3P2TA 4JM2C 2EXWD 1RZGA 4CVWA 4CW1A 5F3BA 3OR6B 4HS3B 2H8PA 3CMOH 1NGQH 4JM2D 2IPKA 4X7TA 1T0NB 4JZJA 2XQBL 3CFDA 4X9GA 3WL9B 2HFFA 1VFOA 4URTB 4LARL 3V4UH 2MQ0A 3RUGE 2G9HA 5JZ7D 2CUMA 1U36A 4POZC 3HLAB 4Z0BH 5ERWB 1JV5B 3FRPA 3HS0A 3QDME 1QQDA 2R69H 3HC3L 5JA9A 3GGWA 1FL5B 3ALWA 3QXDA 4RFEB 3QCTH 3QXUA 1XAUA 4LVEA 4MJID 4OQTL 4X6DA 1FPTH 5DLML 5D7JD 1I1FB 4PFEA 2V6HA 4X8XA 1INQB 1IGCL 4RMQA 5BS0A 2VLRB 4P3CH 1N59A 5IVXF 3D9AH 5IF0A 1CE6A 1RY7B 1N5AB 5JTWA 2D7OA 3MOBL 1CLOH 2AJVH 2D4DA 3PQYA 1BFOA 4RA3A 3KPQA 2G5BB 4OFIA 4I9WE 3REVA 1RIUH 2X4SA 3SDXA 1UM5H 1EH9A 3DYOA 1MHCA 1CF8H 3LEYH 1G7IA 3RZCB 4CVZA 4NQUA 1UZ6E 1P84K 4PJFB 1K4CB 1X4ZA 3OR7A 5DRZA 4MAUH 3MUZ1 1BVZA 1PSKH 1A22B 4NP4L 3H0TA 3ULUC 5E4EB 3V0AC 3QHZH 4DFHA 5IMKB 3GO1H 4EZMA 2R1YA 3VWJC 5L0QB 3PHOA 2IALA 1M1SA 1CLZL 3B9KA 2W0LA 3O6ML 2ZJSL 4HCRA 2DAVA 4KDTC 2YPVL 4FXKB 5L8LB 3LCYA 4QOKE 1CDBA 4E0RB 3T2PA 5IFHL 4U7MA 4YE4L 5IJKC 1SM3H 2H32H 4Y88A 3AY4C 1FO0L 5EO0B 3BKYL 3ALPA 1PLGL 5IK3B 5C0JA 3F58H 4KMTL 4HC1L 4G42A 4ONGH 5BRZB 4IIQB 3V52H 4HEPG 3VFWB 4JPWH 3P4LA 5HPMA 1R0AH 2VTFA 3TPKA 1FJ1A 3RTQB 4NQCB 1KGCE 3RWEA 4IOSD 5GGQL 3V0VA 4FXGB 1FFNB 5BMFH 5JW5A 4MA3A 5T3ZL 1RJZA 2HT4C 3GIZL 1MEXH 4WO4B 3GK8H 1JN6A 4G3YL 3WLBB 3D3VE 1X5AA 1P4LB 3V5KA 3SKUD 4ZFGH 4JN1H 4UIMB 3U1SH 3C5ZD 5EB9A 4K8RH 2DM3A 4UV7H 5IEHB 4PRHD 5D1QD 3SQOH 4GXVL 3Q1SL 2BZDA 2Z31D 2WV3A 1PFCA 4GLRH 5ID0B 3WN5B 1K8DB 2OP4H 2CO6B 4G8EA 4P2OC 5JHLH 1I8LC 3DX7A 3KPRE 1LD9B 4L9LB 3OKEA 2HRLA 2WBWB 2GFBA 1Z9MA 1ACZA 3P30H 4GSDH 4HS8H 1BZQK 2BVOB 1LEIB 5KOVC 5D7LD 2ICCA 4EN3B 4YHKL 4HLJA 2L4OA 3EOTL 1SY6H 1KEMH 5FKPA 5FECB 5I76B 1QSFA 1TJHH 4CDHA 3QAZC 1GGTA 3BP5B 5IV2A 2P8PB 4KHTL 4ONHB 1FL3A 1WTLA 2CSPA 2X41A 2N7AA 3B2VH 3CSYA 3O2WH 1QG3A 1GZQA 3D0VB 4QT5B 1BIIA 3G5VB 2JK5A 2NZ9C 5EWIL 3RU8L 4PRPD 3LD8C 4FFZH 3MXVL 1MH5B 1AJ7L 4F2MA 2Z9TA 3WDJA 2DN7A 5E6IA 2UWEA 1KTRL 4ZUUA 4KQ3H 2EDTA 1NEZA 1L9MA 5CP7B 1RZ8A 5F1IB 3WCYA 2PTTB 4LSVH 4RIRB 1RHHA 5D2LE 5HHOE 2A6IB 2H6PA 3KG5A 4XCCL 4D9RD 5IESH 4YJZL 5GS1B 4PRNB 1B4JL 4J1UB 2Q7YA 4R2GC 2W92A 2IPKB 4X7TB 3BMVA 4ODHH 4PRBA 2NY5H 5T1MA 3FN0H 3LRGA 1YNLL 2CRZA 1VPOL 5K9QG 1U3HA 4F57L 4P2CG 2VRAA 1CCZA 4PJ7F 5B39G 2AJXL 4N1CA 2YKLH 3E0GA 3QEGL 5JOPE 3F7VB 4Q6IB 4XP4H 3KYKH 4Y5XC 5GS1C 4Q9BA 1GH7A 2VZSA 2DI7A 3O45B 1RMFH 3CK0H 1K4DA 1YNTB 3Q3GA 5JIKA 4Y1AA 3EAKA 3P9MB 3V4VH 3VXUD 3LKOB 5IJVA 4N0YL 4GAFB 4MDIB 1BX2A 3B83A 4Y4KA 1ONQA 3OJDA 4R97B 4I0PA 5T1KD 1FZOA 5K9KA 2JCCE 3MSPA 1ORQB 3O6KL 4PY7A 5I1GL 2CIKB 2QSCH 4OAWB 3VXRE 5IOPA 4DKFH 1G7PB 5J13B 4RDQG 1R3JB 2XI9A 4NZTH 3S36X 3C5SB 5I19H 1JGLH 3A0OA 5ICYA 3QRGL 4NWUH 1E28B 1RURH 2ENYA 4OZFH 5JOEA 3O6LH 4OGYH 1H15B 4JAMB 1FNSL 3AAZB 1DBBL 1RIUL 1PAMA 4BQCA 4KTDH 2O5XL 1AXTH 2X4NA 3MLXL 4FQ2H 1KCLA 4OIIH 4OM0H 5AD0B 4XX1G 3IU4L 4RMSA 4Z8FH 1RUKL 1Z5LA 4TNWF 5BMFL 1ZT7B 1BP3B 4FQ1L 5CZXD 2EDJA 4NQSA 5E8OA 3KVQA 4QHLA 2CLRB 5C0AB 3IKKA 3TZVA 5INCA 1T4KB 2BMKB 2XZCH 3GMRB 5F1NA 4WW1B 5T1LA 3NABL 3ETBF 1O5DT 3HC3H 3VH8A 4X4ME 4Z0XA 4NUGL 1A3LH 3VMNA 4JKLA 3BH8A 4Z7VE 5GRVK 5DA0B 2VKXA 2GSIB 1AR1C 1KLUB 1CF8L 1QP1A 3WDIA 4QTHA 4WGWB 3GSNA 1I9JH 1NBZA 4MJ6B 1LILA 1FLTX 4DKAA 3T2NH 5DHYA 4ESKA 1DQLH 4R4BA 3G9VA 4RCAA 4WI7A 3SY0A 4N68A 1QRKA 4L3CB 4A6YL 4FQCH 5F44A 5C0RL 1BM3H 4UTBL 4N8VA 1VGEL 1AI1H 2E5EA 2VXSH 4ELKA 5E2WL 1A14L 2WP3O 4FQXC 3BRGC 1IARB 3GSQA 3JV6B 1N7ML 2YBRB 1BECA 1MCDA 2QHLA 2XY2A 3MGTA 3BP5A 5IF0B 2VN7A 3VI4E 1DQDH 5BS0B 5CBAB 4BA8A 3ZMRA 4PJGE 2YEZA 3MUHL 3GJFK 2DWEB 4G6AC 1HN1A 5EN2A 2IANB 2Z8SA 4CRPA 5K9OB 5GRUH 4I77H 2ICWI 2GJZB 5IB5A 5HGDB 3O6KH 1TJIL 1MFDH 2MCPL 5HYSG 4WY7H 1YEEL 2FD6H 1FAIH 2FBOJ 4P0DA 2VUOA 5F93C 4R8WH 3NAAH 4M6AA 5TDPB 3VG9B 1OARL 1PG7W 3DUUB 2Q87A 4OGAD 3MROA 3SEPA 1CFVH 2ED8A 3D18B 5T33L 2YPLE 1R5VB 4R0LB 1NFDF 4JFDE 4WO4A 1KOAA 2I60H 4GRMB 3CFIC 4FQJH 4DAGH 2GY7B 4GBXB 5TJWK 1N0LA 1FNGB 3EJYC 2F5BL 4NO3B 1RIVL 1JF1A 1MNUH 3MNWA 5BQ7B 4KV5F 1QA9B 5C09D 3W5MA 4JFXA 1IC5H 1NCUA 1VPOH 5E1HB 4OFDA 3PWVA 1XT5A 2J6EA 4KI5C 4K9EH 2YUXA 3A6CH 3WEXB 3WBDA 3VDCA 4PRIA 5INCB 2NW2A 1SQ2N 1JUFB 3WJLA 3NN8A 1E4KC 2X9WA 1S7TB 2YD6A 5C0BD 2VLMD 3ES6B 3TN0C 4L29B 3F8UB 3KXFB 3WYRA 3HZMB 4LIQH 1I1AB 1HYRC 4J4PD 2DLIA 2LU3A 5CJQH 3SDAA 1XGQA 3VXMB 5DUML 5T1DL 4HIEB 4PRPA 2E7MA 5C0ND 3RL2A 1J0YA 2HMIC 3H0TB 3BSZH 5F7EH 3HMWL 2MOVA 3T0BA 3BKCL 4GG6F 4ZO8A 1FLRL 4OBSA 3MUGA 2A74B 2E8YA 4JQIH 1HKLH 3VCLB 4XTRD 4MJ5A 2B0SL 5EU3B 2HFGL 5AYQA 2Y5TB 5D9SA 1LP9F 3GB7A 3S37X 3UTQA 5EU4B 3O8XC 2EIZB 5EUOE 1G6RL 4KXZH 3S8WA 1OY3B 2RAMA 3HZVB 1UCBL 2EDEA 4EUPH 5MI0B 4PJAF 1PYWB 1R5IA 4LHQB 1NMCC 4HH8A 3O8XB 3HNSH 2W9LA 4L8DB 4OQ1A 4AL8H 1NEUA 1A9EA 1G7HB 1N0XL 3NVQA 5A43C 1PD6A 2HWZH 2IANA 3VW3H 5IQ7L 4Z7VF 5E8PB 1C16A 3GRWH 1W0WA 1GGIL 1JMZA 1TPXC 1XR9B 3MUY1 1CLYL 1XR8B 3ARPA 3S5LG 2FH6A 1WEJL 2CDGB 4BK5A 4NZJA 5EUKB 1PKQB 4R96A 5HGHB 3LMJL 3G5YB 1NFIA 1JGVH 4JG0H 4MJ2A 3MGOB 4P5TC 3LPFA 5C0GB 4LAQH 4JFDA 4PG2C 4M5ZL 1S7VB 5E00A 3EDJA 1V3JA 4WFFE 2FO4B 4MNHB 1K3ZA 3RVUC 5JW4M 1VCAA 3RWFA 3QQ9D 4GAGH 3X3GL 4KWUA 5IVXA 1LWRA 1UH4A 2PN5A 1QR1B 4GT7A 4CVXB 3V6OC 2YZ1A 4XNUH 1YJDL 2EC9T 3UXFA 4OZIA 1A6UH 4MHHI 3W9DB 3UYOD 2NY4C 5L9DH 5EA0H 2IH1A 5DZLA 4YQXH 5E6IC 3H3PH 3QDGE 3CXDL 2JK5B 1RK1B 5E6ID 3ISWA 2CLRA 5C0AA 2VE6A 1GXEA 1KF9B 3LRSB 2AK4B 3F7YA 5CGYC 1FC2D 3LOWA 5DK0A 3RKDD 3HAEB 3RNQA 3DPBA 4G9FD 3FFCD 3FAWA 1TZIB 1QSFD 1NJ9A 1KPRB 4X6FA 1F2QA 2APFA 2JJTC 4YNYA 4WY7L 5A16A 3MMEA 2UVEA 2CUIA 4GO6B 5C2BH 4DK6A 4H0GA 1X5LA 5F88B 4H1LG 4WFGD 2CMRH 1T1XB 2MJWA 3PQYD 4C57C 5EO9A 5IROA 3X14A 4UZGA 3R1GH 3CFKA 4Z9KB 2PXYC 1P2CB 3WFBL 1QFWH 1UWXK 3IRZA 2BNRD 2CKBA 3DARA 4WU7B 3BD4A 5EU3A 1MCRA 1IAIH 3EJJX 4X6CB 5C2BL 4KKBC 1IC7H 4HDIB 3DYPA 3N06B 3AU1A 1IEBB 3CZFB 3GBNL 1BEYL 3NFSH 4ZSOB 2GTZB 4Y4FA 2P47B 3MMEB 3S97C 3UJIL 3MJ8A 4ERSH 4YPGB 5KS9A 4XGZB 3RVVD 2R1XA 3TWCH 4DCQB 4X8JA 5F72S 4UDTA 4K7FB 4FTVD 3CXDH 2I27N 5ANMB 3V5DA 4HFUL 4RGOL 3LRSA 1I7ZA 3QFJA 5KAQG 4X7CC 5IK3A 5FYJD 4F37K 4PJFF 2HG5B 1TZGH 3BI9X 3ILQD 4K3DL 2X9YA 4YIQA 1FNEB 1QSZA 2R56H 5CSBA 1IM3A 1BZ9B 4YK4B 2DQDL 4HBQA 3DX6A 2YUZA 2PUQT 4JRWA 1U58B 4MB5A 5FYKL 5GZOC 3GI9L 5E6IB 1NGYB 1L0QA 4IMLA 2W0PA 4RFOH 3OR7B 5DRZB 1ZXQA 3KR3H 1FO0A 4GQ9L 1QSEB 3T08A 4NQVB 1MY5A 3PWLB 2A6DA 2A38A 2FX9H 3IKCB 5FA4A 1PG7H 1KB9J 2HA1A 3H9HA 4JFQB 4NWUL 5E70A 3HRZB 1CICD 3IXTA 1H3TA 1BVKA 3UC0L 4LCWB 1UM6H 5JIHA 3CLEH 4F33A 3UAJD 1FYTD 5KVDH 1JHLL 4I13B 4JRXA 1BJMA 4Z7QE 4WWKD 1R3KB 3LKQB 2QSCL 1ZVSA 3QP3A 5KSVB 5KAQF 2BCKB 4BZ1H 4GQ9H 2Q8BH 3EJZC 1UA6H 3CUPB 5KJRH 4H8WH 1JPFA 1NCAH 3EO0A 2RIKA 3UBXG 4OV5A 3KDMB 3CIQA 5I30H 5EZLB 1NCBL 3ZSSA 5FB8B 1D5MB 3EYUH 1VHPA 4UOW1 4O58H 5FCUH 1OCWH 3RVUD 5E9DA 1IGYA 3V5KB 4QCIB 3RBGA 1JCKA 5D6CA 1P4IL 2P8LB 4D9QD 4XXCA 3MUGB 3VH8G 3P9LA 2OTWB 1YMHA 5FOBA 3ULSA 4GW4B 3MRDB 3P4OA 5ADPH 3VXSB 3LS4L 3GNML 4OCNC 1XGQB 9CGTA 4GRLB 4XVUC 3MXWL 5FCUL 4FFVC 3NPSB 3FOMB 2D7QA 2P49B 3JWDH 1DFBL 2COQA 4QYOA 3WD5H 1KNOB 4L29A 4X9HA 1BAFL 4HQQL 3TT3L 4LSRH 2ADGA 3L3KB 4K7PY 4EI5D 5EOCH 4BUGA 4WO4C 3UTPD 1MFBL 1OW0A 3KPOA 5DYOB 5LGKA 3U9PH 4DKDC 3PGFL 3QIWD 4PJBE 4U0RC 5FUOL 4M62H 3DVNB 4NM8H 4FQJL 2DLGA 4CMMB 1HZHL 3JWDC 2JB6A 3DGGB 5ENWA 3IDXL 3HUJE 5ETUB 1OWRM 3JWOH 1JGDB 3TBWB 4GBXA 4QHNB 1MVUB 4PJIF 4U1KA 3EIFA 3H42H 2QV2A 5I8EA 3H3KA 2IAMC 1KJ3H 2XTLA 1FVEA 3VGAC 4B53A 2EH8L 2VC2L 1G7PA 1E4KA 4OLZH 3RA7L 3T2OA 5GS2D 5HYSA 5J4MA 4DOHB 5IW3A 2VDNL 2NPLX 4Y5VB 4BZ2H 3O3BB 3QWOB 5D96C 3ZE1F 4QLRA 4KZEL 3V4PL 2VLJB 2ZUQB 4MQXD 1X7QA 1I1FA 3Q1SH 4L4VA 4X6DB 4DZ8B 1UWXH 4LRNL 4L3AA 4PB9L 4LLAA 1C12A 1MFDL 1YNKH 4MB3A 3BGFC 3BPLB 1AC6A 2FEEL 4QRQB 4TQEL 4U1LB 1TETH 4UT7H 1WISA 5DVMA 4K7PL 4PRID 3KS0J 4ODWA 5H8DA<