2NY2D

Hiv-1 gp120 envelope glycoprotein (t123c, t257s, s334a, s375w, g431c) complexed with cd4 and antibody 17b
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
228
structure length
221
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 50
structure length 221
sequence length 228
ec nomenclature
pdb deposition date 2006-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny2D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny2D01
2CH8A 4RFEB 1KSRA 2H26B 4OLVH 3S34H 4RMUA 5FYJH 5D6CB 4MXWL 4U7MA 3GUTB 4HQQH 3IJSB 5IM7A 5IF0B 1T2QL 5DWUL 1JYNA 1AXSB 5INCB 5L9DH 2Y7QB 5JLZB 4JKPH 1ADQL 4GMTL 4IOFD 1RK0A 1WTLA 4JFHE 5IB1B 1ZGLP 5L8LB 2EIZB 2YPLE 3EYVA 3L1OH 2XN9D 1TTFA 4X9GA 5KANI 3B5HA 4AEHL 3VJ6A 1YNLL 3X11A 4MQ7B 4U0RB 4OLEA 1T6WA 1W8NA 1FLRH 5DURB 4IOFC 3VRIA 4ERSH 5IJVB 5I1EH 3OXSA 4JFOB 1F2QA 4RX4D 1CDBA 2YD9A 4LSVH 3WS3A 5IFJB 4JANB 1YEHL 1YNKH 2VDRL 4JRXB 4APQD 4OIIH 3IF1B 5GGRA 2V2XB 1R5VA 1U8NA 2IH3B 4HWNA 3DV4A 2VH5H 4XNUL 1KEML 3PJSB 3QSKB 4LP5A 3SDDB 4APQC 1JN6B 1G9EA 1PZ5B 3NABH 1NCNA 4NQDE 5BVJA 1WWCA 1ZVSB 5CEYB 1EXUA 1G7LB 1NMAH 3VE0A 3CLFL 1RIUH 2YUWA 4K3EH 2NLJB 1T3FB 3V4UH 1A0QL 1DBJH 2B39A 2ICWI 5E5UB 4EEEA 1BQLH 1MREH 3T3PF 2W9EL 2EECA 5DDHA 1FAKT 1EGJL 1N0XL 3Q1SL 1T1ZA 1IJ9A 2N7BA 4PBWD 5DR5H 4QXUH 5FV2A 4K9EL 4WI8A 3MGAA 3Q6GH 1WIUA 1JNLL 4DUVA 2MQ0A 4HHAA 5F1OB 2Y07L 2VQTA 1B90A 2ICEB 1J1XL 1MH5B 5J12B 5IB5A 2IFFH 2C3VB 2FSEA 4H8WC 2YUVA 4NQEE 4OZGB 5DQJA 2D3VA 4NRXB 5GS0L 3HZMA 5C0EB 1OT2A 1WBZB 4JFZL 4Y8AA 5ELIA 4YX2H 1VKXB 4OTXL 2ZOLA 3EDDA 2D0HA 3BT2H 4OLUH 4G7VH 3K2UL 4AG4H 5DFTA 4RISH 4X6BB 3ARSA 3K0WA 4NN5B 3K80A 5DUPL 1GZPB 4NQCA 4N9GB 1ZOXA 1RZGA 4GUPB 2JB5H 3G6DL 4OF8A 1PLGL 5A2KH 1AY1L 2ZG1A 3TYFB 3V8CA 3GK8L 3UJJL 5I73B 2D4DA 1NC4A 4NOFA 5D5MB 4GSDH 4XNYH 1B0WA 1GGIL 4FOMA 5C86A 5L6YL 1BVZA 4HEME 5CJ5A 3OTTA 1OWWA 1YMHA 4H5SA 2H3NB 3KPSA 5ESVB 2XQBL 1E6OL 3MRNB 5I8CA 5T1DL 3O41B 3NFSL 4HC1H 4M1GL 1INQA 4NYLA 5D2LB 1U41A 3ARFA 5K9OB 3RJDA 2YXMA 4OGXH 4U6XA 3C9NB 2KBGA 1CLOH 3BEVB 1UXSB 3SJVE 3BO8B 4ZUSB 1HHHA 5EORH 2G5BB 3O2VH 5C0CB 3VDBA 5DJ8A 1U8LB 1EJ6A 4U1JB 3TWCH 4HF5L 5DMKA 3EOYG 4PJAB 5IMMB 5GGVL 5CEZD 2WIMA 1RHHB 2XWJA 1BFOB 4Y19A 4JRWA 2HLFD 2IBBA 3S88L 4OD2B 3G6AA 1MCJA 1A9EA 3TJHD 4M9OA 3HUJA 3CDFA 5I16A 1KIQB 3LVEA 3B9AA 1CTNA 4XPFL 1HCVA 1E4XL 3DHMA 3FOMA 2IWGA 4ZFFB 2AJVH 4FTVA 2HLFC 1HQ4A 3TJHC 4ZO7A 5F6IC 1QLRA 4LCCB 5DXWA 4X7SL 1I1YB 3RHWF 1YEKL 4C4KT 3ZTJH 2DL9A 2R2EB 4YXLH 4JFFB 4X9HA 5FYKL 1JPGA 1WEJH 4CVUA 3AU1B 4MCZB 1IKNA 4FQHB 5BZWB 3X13A 2CXKA 2UWEF 4HPOH 4LOUD 4HKXA 4L3CB 5FYKU 4MJ2A 4BH7A 3KPRA 1CD8A 4XPTH 4UIMA 1FRGH 1RZ7L 3O3BA 4YGVA 5B3NA 2F54D 4LOUC 3WIHL 1Q9OB 4PJ7E 4KZDH 4ZSOA 4Y5XB 4OFVA 4NQSB 1P4LB 5J3HD 5E6IA 5EU3B 2NY5L 1PVHA 3O3DB 2FB4L 4M6OH 5LGHH 3LS5H 4PLOB 1FDLL 4TQEH 2R29H 4JM2A 2ZSWA 5J3HC 3RZCB 1A6AA 3BYTA 3LN5B 3IDYC 3CFBB 1U91A 5CZVL 4J7RA 1GH7A 1BZ9A 2NR6D 3W0WE 1QKZH 1DEEB 1MCFA 4HJJH 4AT6B 2R2BB 5I1AA 1ZLVK 4Y0GA 4HS3A 2N56A 3KVQA 2YSSB 4OQ1A 1MAKA 4LAQH 2NR6C 1Z9MA 1OT1A 3FO9A 4XBGA 4JO1H 1B6UA 4MNGE 2Q6WA 4G43B 1YMME 2P5WB 3KYOB 3OGCA 3L3IB 2RFXB 4HUWA 3HNVL 3TPUA 3QNXA 5EC2B 4OT1H 3AREB 5IQ7L 1SJHB 3SKOA 3HNTH 1GPOL 1IKFL 2DQTH 3VWKD 5DA0B 2B1AH 4X6CE 4ETQB 4UINL 5H2BB 1CDJA 4G8GE 4J8RB 4CW1A 4P48A 3MNWB 2Q8AL 5I75B 2XZZA 3NA9H 1OP5K 2H6PB 2V6HA 5CHNA 2Y6SD 3VWKC 4K94H 2X4PA 4KK9D 1PY9A 4QRTA 3FO2B 4IOIA 3D85D 4JFEE 3W82A 1FZKA 4E5XB 3VGBA 3T4AA 2NZIA 5C6WH 2Y6SC 3OJMB 1OSPH 1G1YA 3LB6D 2B20A 1MFCL 3C2AH 1ONQB 4KK9C 4D0DA 1NQBA 4L8SB 12E8H 2GJ6A 4AM0A 3HS0B 3MRIA 4Y5VB 3HPJA 3ZT5A 4IS6A 5SX5H 1EUUA 2J8UE 4BM7A 4KUCD 3ULVD 3LB6C 2HMID 2XNAA 4K71C 5LBSH 2ZKHH 3WO4B 1G7MA 3H9SD 4K23L 3JWOL 1WVZA 1I7ZA 4YDVA 3QULB 1S7UA 3QUXA 1A2YB 5FECB 1JI2A 3SN6N 4V2BA 1G7PA 2EDHA 3VFSB 2DBJA 1CGSH 1HN1A 1P2CA 3ARTA 4NM4L 3QUYD 3ULVC 2HMIC 2BSED 5ADOL 1CZ8H 5JXAH 4PJIF 2ITDB 1S78D 5BV7B 5KSAD 2J88L 4JHAH 4MB4A 3U46B 1HXMB 2HLAA 5FUOL 2AQ3A 2CIKB 1IZJA 3QUYC 3RVXD 1S78C 4UILH 5KSAC 4RGOL 4MNQD 1KACB 3QCUH 3QHTC 1L9MA 4OUUB 4LASH 3VXUE 1ZA6B 4HUUA 1H0DB 1S8DB 2H41A 1JWSB 1J1PL 3HI5L 4GJTB 1AKJD 4J3VA 4D9QE 4ALAL 1LK3L 2BVOA 3FFDB 1VA9A 2F74A 4GKSA 1OSZB 4QRRD 5K9JH 4OQTH 5M7QA 1Y18B 3UTPD 4PPTA 1GC1H 4EUPB 4LLVA 1AGDB 1I75A 3GI8H 3TBYB 3DX6A 3QNYA 4KHXL 4Y4KA 5I71B 3DXAA 1NSNL 1U93A 2CMRH 3VH8A 1J12A 3HRPA 4M6NL 4H25A 4HSQA 3BZDA 3EIFA 3LH2H 2IC2A 3IRZA 2XKNB 3KYAA 5C0AA 5K59F 2VXQL 1TJIH 1A7OL 5J11C 4JGJA 2ORBL 3FRUB 5L88H 3R06A 2O5YL 4Q97A 2VZUA 1G6RA 1N3NB 3KWWB 4YHNA 4RMTA 4AMKL 4WI5A 1N5AA 2KQNA 3KPOA 2C1OA 1Q9WA 4XP1H 2IG2L 3F7YA 1J88A 5FKAA 2C3XA 5BXFA 3QRFM 3RRQA 4TRPL 3GBNL 2NY3D 5ALBL 3STBA 3TLRA 4RSVA 2NYYD 3FQNA 4WV1A 4CN1A 2UUDK 1AO7E 4KFZC 3P0VL 4H1LG 4QYOB 4XZUA 4WHYH 5GSVB 5LXGL 1XF3A 4I9WD 2WBKA 3KJ6L 1MWAH 2CLZA 2NY3C 3CZFA 3TGXA 3T0AA 1F42A 3BP5B 4QNPE 2NYYC 4O58H 2WANA 2VLLB 5T33H 4TNWK 1AD9A 4OAWA 4GG6F 2ESVD 1DBBH 4PJCA 1IAIH 1B0GA 4OIAA 2FX7H 1XMWA 5GRJL 4PS4L 3LS4L 1U8IB 5B38G 4FQLL 2BOCB 3MGOA 5CLTA 4DVBA 1XGYH 2AVGA 3D2UB 4H88L 4ZUWA 4PJBB 1K3IA 2DD8H 2JELH 4YNYA 7FABH 3KLSA 1F8TH 4LPWA 4Z8FH 4HUNB 3MLYL 1L7TH 1UQSB 2NNAA 1J5OH 2IGFL 4HD9A 4UDUB 4JR9L 2VRAA 4L9LC 2FZ3A 1FN4A 2Z35B 4Z95L 1UM5L 3RWGA 3FRPG 3DSFH 4LF3B 1I8MA 1UWXH 3TP4A 3VW3L 1ZWIB 2X1PA 3QO1A 1HI6B 3KPTA 4NM8L 4OM0L 4XH2B 5FCSH 4HFUH 1JWUA 3RNKA 4U0QB 1SY6A 2HJFA 2I24N 1ZAGA 2FBJH 1S7VB 1CT8A 4NWTL 3VRLF 4W68A 5C2UB 2IJ0C 3IAGC 3SDYH 1TPXC 2BNUA 1PKQE 3ARPA 1QR4A 2FX9L 4YJZL 3RAJH 5E00A 3H9ZA 5DJ6B 3NTCL 4YHZH 2BNRA 1AGCA 2ITCB 3B8SA 3FB8A 4XMLH 3W2DH 1QEWB 3MRLB 4MNQA 4P2QE 5I15H 1FVCA 1N8ZB 1KB9J 1N64H 5GGUB 2DI9A 3HN3A 4UDTA 4QOKB 2I9LB 2Z91B 1H3VA 3A6OA 5F9OH 4YDKL 2PO6A 1MCEA 1A6WH 3NACH 3LIZH 2DLIA 4X99B 1P5VA 3C8KB 4MYWB 5JO5B 3ZDYE 5IEKB 3EYFB 5DS8B 4UV4L 5TQ0L 2YD7A 1TCRB 1QLEL 3SQBA 1RD6A 4F7PA 3DO7A 5F1SA 4MQSB 2KZWA 3D48R 2FL5B 1IM9B 3RI5F 3QDJE 1PG7W 2G75B 2DIJA 3RWCA 2AJUH 4PJGB 3CMOL 4J1UB 1UJ3B 4Q7DA 2WM0A 5DEFA 1CXIA 2YA2A 1BFVL 2Y36H 4YAQA 4K7FB 4LLWA 1IGTA 1EFXB 4IMKA 1J9CT 2R0LL 1MCSA 2JJSC 2YRZA 2CDGB 5I1IL 1M71A 3WE6A 1T20A 2W1NA 4L4VB 1C16B 3HE7B 2DQGH 1J0HA 4TSBL 1O0VA 3TCLB 3LKPA 4P99A 4GAGL 1Z5LA 5B4MD 2PETA 3WEXB 5KJRH 3H3BC 4N1CA 4ZFOA 2GTWB 2BOBB 1JHLH 4R0LC 1IRAY 5HGDA 2MFNA 5B4MC 3VXSA 3FFCE 5DUBA 4GBXD 4WHTB 3WBDA 1OF2A 3I6GB 1S3KL 5CJXA 3MRDA 2EO1A 4I4WA 5B3JE 4TOYH 4QHMB 6FABH 4GBXC 4L4JA 3WIFA 1P7QD 4I48A 5E1HB 2IMMA 1WCQA 1GYAA 4JQVC 5DQ9B 5FGSA 2BHZA 4P4KB 4P3WA 5FO9A 4F7EA 5DD5L 4GG8B 5AYUH 3QDMA 5BW7C 5C7XL 1T2XA 2V5RA 4Y16A 2Y5TA 3DVGA 4PJEF 5IV2B 4NFCA 3QCTH 4YE4H 3PF2A 2NY7H 3G6JA 5KSUA 4XMPL 5DQDL 2VKWA 3OKOB 5JOPE 3TBWB 4DVRL 1EEYA 5TH2A 4S2SB 4KTDL 5AAWA 5MERB 2V2WB 2BXYA 4HBCL 1MRFL 4NWUH 4HS6A 2VXUL 3P9LB 4HH8A 4ELMF 1FBIL 1ZE3C 5DZLA 5T3ZD 2F53A 2VIRB 3OKEB 3DRTB 4G3YH 1Q1JL 3QUMH 2HFGL 1KLUA 2VZTA 5T1KA 4JG0H 5CP3A 3VFMB 3O4LA 4MA8H 4LVHB 4NNXB 5BRZA 1HSAA 5LGJA 1CVRA 5FYLL 4M7LH 5D6DC 5JW4M 4X0KA 1KIPB 1H3TA 2LV4A 2Z92B 1LDPH 3U7WH 4F2MA 2ICCA 3SOBH 4NZTL 3QUZB 4URTB 5KVEH 5J13B 1UYWL 5C07D 5T1MB 1JNNH 2FR4B 2FEDD 2PW2B 1W0YT 1MIEH 4ONHA 3ETBF 15C8H 1JRHI 3IXTA 3B9EA 4YK4C 1UKTA 1GIGL 2DF3A 5KG9A 3WFDL 2FEDC 3RY5A 4OCYL 4ENED 3RL1B 4XCNA 1QLFB 2GUOA 4BH8B 5I1GH 4YBLC 1OAQH 1S7SB 3PXJA 5C8JA 3E6FA 4ENEC 3HE6A 1MCKA 5BO1H 3C08L 2H1PH 2G9HA 4Z7VE 1CE1L 2WUCL 1BF8A 3U4EB 1GAFL 4NQXA 4U49A 2ZCLH 4R3SB 5CIPB 1JFQH 4PB9H 2DQDL 1IC7H 1MRDH 1YC8A 2YRLA 3BDYH 3BVNB 3TT3L 5FM5M 2J6EL 1LE9B 2E8ZA 2ZWLT 4MX7A 2HJKB 1BX2A 3T1FA 3GFUA 3VGAB 5JW3H 4Q2ZB 4F9PA 3VXTA 4YQXH 4TNVK 4GMSH 1BJ1H 2CKBB 2YK1L 4MDJB 1Q9LB 1DQQB 1H5BC 1J1OL 4AJ0A 4H0IA 3BEWA 3U0PA 4NZUH 1GZQA 3DSNA 3WLBA 1K4DA 3ZKXB 2FDBP 3HAEB 3I6KB 5HHVL 5D7JD 3IU3A 2E6PA 4NQCE 1NUDA 4YEFA 3MYZA 4GAYA 1KTDB 2XQYG 3BSZH 5CMAB 1ZEAL 5D7JC 4YHYC 5ITBL 3DYPA 5CGMA 2W9LA 4PRIB 3UX9B 4P5KA 3QIWA 1FPTL 1A1NB 5ILTH 5GHWL 1EMTL 3VXQA 3OG4B 3P77B 2C1PB 1FNEB 3M45A 3A67L 4NN6B 1XH3B 1NDMA 1ES0B 5EBWB 1NCDL 3QI9A 1UWGL 3GJEB 3UDWC 4WGWB 2WSKA 4QRUA 4MLIA 5HYSA 5E6YA 1JI1A 5SWSA 5KBNC 4P9ML 1HEZA 5DTFB 1ZTXL 4FS0A 5GJTL 3VMNA 3GNMH 5IW1A 3QAZB 1I3UA 1U95A 4R97C 1LO5B 1YECH 1WBXB 4F37F 3AY4A 3QEQB 4BUHA 5JPMA 1FYTD 2XN9E 1EO7A 2UVEA 1AP2A 3D25B 3VFGL 4FZEL 1DSFL 3UPRB 4PRNB 3VD5A 4ODXB 4LNRA 4N8VG 4QHNB 1XZ0A 4MNHB 4G9FB 4U33A 2JCCB 1OB1A 2P1YA 1EPFA 1MI5B 1I9RH 4F9LA 1LO4H 3S34L 5FYJL 3OR6A 5CP7B 2GJJA 3MLRH 3ARZA 4M7LT 4PRPA 4HQQL 4C55A 4FP8L 4XPBL 3ARYA 5FYJU 4JO3L 5C0JA 5I8EB 3IDMB 5I2IA 5L9DL 2X44D 4OV5A 1QQDB 3KPRE 1PY4A 3GI9H 3O2DA 4JKPL 2IH1B 2J3SA 5FO8A 2ARJB 1VACB 2JKXA 3LQZB 3HG1A 4XGZB 5HDLA 1INEH 5EZLA 1U8MA 4JZJA 4YPGA 1S7QB 3I9GL 4ZSOE 3MJ9A 2ZNWA 1KCLA 4UZGA 4ERSL 4R7DA 5JNYB 5I9QC 1CK0L 5I1EL 3SO3C 3L6FA 5IHZA 5JHDA 4DGVH 2BHYA 3RWEB 5EO9B 4KY1L 1YNKL 1V3JA 3R0NA 5EU6D 3FCTA 4OIIL 5CJBA 1SEQL 5I66B 4JFPA 3QHZH 4FZ8H 3SE9L 3MROB 1BGXH 4JRYA 4Q9BA 3FQTB 2VH5L 2DYPA 1R3KA 2A83A 3UBXA 4XP6H 2QLVB 2DQCL 4O00A 2XRAH 2HKHH 3QQ4B 4IRZL 4OCXH 3Q5TA 4HUVA 5D7JA 3B9KD 1UZ8B 2W9DH 3HTLX 3V4UL 2LTQB 5I74C 1DBJL 4A2LA 5BOZG 1GJIA 3LPFA 2D7PA 4LSTH 1BIIB 3NAAH 1MREL 2B4CH 5D1QB 3TEUA 4WW2C 3B9KC 1D5XA 4ODTL 3QQNA 1WCBA 4R9HA 5C9JB 4QXUL 5AZEL 3RUGF 1F6AA 4L3EB 2GAZB 3HR5A 3OWEA 3IXAB 2GK0B 1KJ3L 2GSIA 2MNUA 4MJIA 2DTML 1T83A 2IFFL 4NIKB 4O2CA 1FGVH 2IAND 3PWUB 1NCCH 2DKMA 4WU7A 3VXRB 2C3GA 1CDGA 1EV2E 4NC0B 1J87A 4Z18A 4EI6B 1P1ZB 4WO4B 2J4WH 5DJ0B 2RHEA 4QRPB 2DQEL 5TGBB 4X6DB 4HJ0D 1BIHA 1KLFA 4OLUL 4AG4L 3GB7A 1QFUH 5DD6A 5HYQB 3S3SA 2XTJD 2VDNL 4HJ0C 2DIBA 4M4RA 4E41A 1C5CL 4IDLA 1ZMYA 1ODAA 1NAMB 3UZEA 4JAMB 4DWHA 1JRHH 2XI9A 2VL5B 4KKAD 2E9IA 1BD2A 2XTJC 1YPZB 1WC7A 4F3FA 5EUOB 4XNYL 4IRJA 3TNNA 1IFHH 3Q5OA 4TTGA 2EXYD 4ZUVA 3SGJA 1NCAH 4XVUD 4KKAC 3FOLB 4DUXA 5DURD 4BQ9A 4HC1L 1YQVH 5DK0B 5HHXH 3FQUB 5AG8A 4XCEB 2YPVH 2ZJSH 4JFXA 4HT1H 2EXYC 1EEQA 1SEBB 1MHCA 5JW4R 4ISVA 1CLOL 2VLJA 5DD0H 3WN5B 5EORL 4EQ3A 3IS0X 4IM8A 5AG9A 1YNTB 5GGTH 1URLA 4NUGH 5HHMB 5E08H 1XF5A 4BK5A 2E7MA 3TWCL 3P0GB 3H7BB 3WNKA 1HH9B 4MA3B 3SDDD 1Q72H 2BY2A 4FMKA 1HYSC 2Q20A 1CQYA 3P9MA 1AR2A 1S7XB 3IDNA 3GEWB 4WEBH 5L2JB 3F62A 3O2WL 4HK0A 2CRYA 5EIVA 3X3FL 4YHLH 3BPOB 5FA3A 3SDDC 5EZIH 3BRFA 5HJ3B 4I18B 5EU6A 5DSCB 5F8QC 2AJVL 4H8WH 4NO5A 4Z7WF 1PGRB 1ED3B 4UTAH 4Q6IB 5CBEB 3N9GH 1KN2L 3ARBA 1VERA 4ZDHA 4P9HL 1WEJL 5F3BA 2ILLA 4KWUA 2W59A 4HPOL 4TUJB 2A6DA 3IDJB 1TVDA 4NO2A 3QIUA 3FB5B 4WWKA 3D0LA 3MRPB 3RX7A 2J7LA 1NC2B 3GSNH 4QRQA 1IAIM 4ODWA 1WF5A 4D0BB 4HJGA 3MNZB 4HUXB 1D5BB 4M62H 1G7IB 5E2VH 1L6ZA 1U8PA 3C6SB 1Q38A 4OCMC 2HFFB 1EEZB 1RY7B 5J12C 3LV3A 3VFNB 1MVUB 2BNQA 1C12B 4M6OL 5LGHL 3MXWL 1AHWB 4QHUB 1I85A 4XWOD 1E4JA 4TQEL 1ZSDA 1HQRB 1ZLVH 4YXHH 3GDBA 3GMRA 3V5HB 5FV1L 3DWTA 3HZKA 1ZVYA 2CUIA 4YHPB 4XWOC 5D7LB 4NN5C 32C2B 2OZ4H 3HNSH 5F7MC 1BQHG 3VRJA 3CPLB 1QKZL 1CFBA 3BPNB 5DGQA 4HJJL 2VWEC 2EIEA 5F88A 1VENA 2X4UB 1JGUH 3KLAB 2H26A 5DRNB 3CFEB 4LAQL 5EWIL 3PV7A 4G80A 1NJ9A 3U7YH 3U30B 3GUTA 3DVNA 5EOCL 5L2KB 1DQMH 2A38A 3IJSA 4O9HL 1W72H 4RQQB 1RJZB 4TVPD 5INCA 3W39B 2Y7QA 2HFEB 2P43B 1DFBH 4OT1L 3H9SE 5JR1H 5CEZH 1CG9A 2FHFA 3HI6H 3HNTL 3QIBB 5C0CD 3TC9A 5IB1A 1VESA 4JJ5B 3FQRB 4Q9QL 2YPKB 4MA1B 5A2IH 5J1TC 2I27N 4JY6A 5L7XH 5D1ZA 2X05A 1EBPA 4DQOH 4UT7L 5IJVA 1WQVT 2DMBA 4KI5D 4JFOA 2ZCKL 2BDNH 5I18H 3V6FB 5IFJA 4UIKH 4JRXA 2VAAB 4V1DB 3ILPA 4L8BB 4MNQE 3S36X 3BQUB 4KUZL 1OSPL 4KI5C 1VEMA 4GRMA 3C2AL 4MSWB 5A2LH 1I8IB 2DLGA 12E8L 5EOTB 1EGJA 4P23B 4ZD3H 3PJSA 1VFAB 1OCWH 2BFVH 5DVOA 3V0WH 1JTOA 1PZ5A 4UV7H 4LCCC 5LBSL 3VXMA 3X12B 1WJ3A 2ICWB 1BAFL 4DCQA 1M7IB 1ZVSA 3BUYB 5CEYA 1G7LA 1RURH 3SDXB 3RP1A 4X8XA 1L0YA 4PJIB 2VISB 5JXAL 1GGBL 4JHAL 1R3IH 1S9XB 3OJVC 5EN2B 3NIFF 2YD4A 3VA2C 2DMKA 1XGPB 4K7PX 3JTTB 1ZA3A 3PWVA 1CL7L 4Y5XC 3UAJD 3JVGC 4UILL 3N85L 3I3EA 1MH5A 4XI5D 3QCUL 2CJUH 2CO7B 4U7KA 1KLGA 3B4NA 4LASL 3HHRB 5GRXG 2V17H 4Z7QE 1U58B 2GT9B 4NRXA 5C0EA 2V5TA 5IBTH 3UAJC 1WBZA 1BBDL 3RZCC 1A3LH 4XI5C 5K9JL 4OQTL 4F8TA 4XBPA 5GZOD 1VKXA 3HKFA 2E6QA 1K5NB 1GC1L 2D4FA 1FFOB 1T5XB 2EH7H 3WFHB 4PV8A 5EOQH 3GI8L 1YEIH 4I9WE 4N9GA 3VXSE 2CMRL 2W0KA 4FXKB 1KENH 1FSKB 4BFIB 5GZOC 2P5WD 1RZ8A 2NXZD 3TYFA 4F15B 1T5WB 3TV3H 4OZ4A 4N5UA 2EDFA 4N9OB 4RNRB 2FD6H 5D5MA 4MMZC 1TJIL 4G9DB 3QDGD 3CK0H 5L88L 2NXZC 2UUDH 4P2CG 1ZLSH 1IM3A 2OMBA 1MWAB 1I1FA 2YWZA 3DTXA 2JJWA 1IEHA 3TYGH 3E8UH 1JTPA 3MRNA 4XP1L 1FVDB 3QDME 5ACMA 1OLLA 5D2LA 2QEJA 3RWDB 1BFSA 5J7CC 4TPRH 3G6JE 3MRQA 3C9NA 3M1BB 3L5XH 1UXSA 4AQ1B 5I75C 1A14H 4OGYH 3O6LH 2G5BA 5HDQH 3BZEB 4CVZA 1QVOB 1EUTA 3ULVH 2BP3A 4U1JA 1MWAL 5E7BA 4BFEA 1DVFB 5IMMA 4O58L 1RHHA 5T33L 2Z9TA 4HX1A 3OAUL 4LLMB 4OD2A 1DBBL 1PX3A 3C6LD 2BZDA 4ZO9A 1IAIL 4EIGB 4LSQH 1S7TB 2FX7L 5MP6H 3O4LE 2QQLH 1CLYL 1KIQA 4OCLC 2WIIB 3CX2A 4ZAKB 4Y5VC 43C9B 3S96B 4JREB 5T3XD 1MFBH 2ADJB 1UGNA 2MJWA 4MDIB 3C6LC 3QISA 3GRWA 1K4CB 1U8JA 1DE4B 1I1YA 5E8EB 3X3GL 5MHSE 2KKQA 1KJMB 5E8PA 2R2EA 3GMNA 4IDJH 4HPYL 4JFFA 3TPKA 1L7TL 2KPNA 3ARDD 5FB8B 4MCZA 1J5OL 2WBJB 3QQ3B 5BZWA 5L8JB 1S5IH 3SHSA 5GSRB 3E1F1 5C2BH 4LLQB 2DQFB 3FHAA 4Y2OA 1EO8H 3KPQB 4L3CA 3VG0H 3KPLB 3DSFL 3DPBA 2OXHA 4LMQI 5I1CH 2Y5EA 3L5IA 4GQPH 1NKOA 4NP4L 4ZXBD 4KKBD 3ARDC 3IKCB 1TQBB 3EO9H 4PJDB 5K9QI 1OWRM 5DJ2A 1Q9OA 4PRBB 1V7NL 2HYMA 1XAUA 4NQSA 1CXEA 1P4LA 1KBGH 3SY0B 3ZSSA 5EU3A 3O3DA 2CIIA 4ZXBC 4KKBC 4J4PD 4Y1AA 5E8NB 4EOWH 2E7BA 2X4QA 1L0XA 4PB0L 2AJXL 4M4PA 4NQTA 1XIWB 2OSLB 5IROC 4DUWA 3NCCB 1JTTA 5IFAL 4OSUH 3VWJD 4XMLL 2D0GA 2GW5A 3W2DL 2RCSH 5A1AA 3RZCA 1SM3L 3NZ8B 2ZSVB 4J4PC 3LN5A 1N64L 3CFBA 4PLNC 4U3HA 1KJ2H 2W65B 4DFIA 3RDTB 5F9DC 5I71C 3G5XB 1X5KA 1DEEA 1M7DA 5AUMA 1A6WL 3NACL 4MAYB 1NMBH 3MBEB 2X89D 4H1LA 4UTBH 1QSFD 3ARUA 4MCYA 4MZ2A 1YC7A 2YSSA 1E28A 4DZ8A 2BY3A 3O6FD 4HFWB 5T1LA 4G43A 1S9YA 4EDXA 2NX5B 4NJ9H 3KYOA 1G0DA 3CFCH 1DLFL 2RFXA 3DETD 3G5ZA 4M93B 5DLMH 5GIRA 5JW5B 4O2FB 1XGUB 4KKLD 5DJZA 3AREA 3KXFA 3NCEB 5CSGA 5BJTB 5B38A 3O6FC 4Z7OE 3MODH 3DECA 5JW4N 4O4YL 2WLZA 3DETC 5H2BA 4JQIL 4J8RA 5EA0H 2XWBB 4M9PA 4KKLC 3V95A 5KZCD 2ZUWA 4LCIH 4KPHH 5FGCE 1GVIA 4P2OD 1HSBB 3PP3H 5SX4I 2OP4H 1U8KB 3FO2A 1OD9A 1NMCB 3FRPA 1VDGA 3BXNB 4OFYD 4WI2A 4N0CD 4WHYG 4B50A 1V8HA 3D2UD 4LSRH 4P2OC 1JHLL 1ONQA 1CICD 3MRMB 3PDOA 3OKLA 4L8SA 4ZG1A 3I84A 1IC1A 4OB5L 5DT1L 4WVRA 5F1NB 5SWSE 3HS0A 4N0CC 4ZUTB 4OCRH 4UT6L 5MENB 3G9AB 4QXGL 5FK9B 4X7FC 4XVTL 1CICC 6FABL 4NUJB 1QFWI 3L3OA 3MLZH 5FECA 1A2YA 1HILB 3CFKB 1SQ2N 5B8CB 4IEFB 3VFSA 3UYPA 2NZ9C 4JKWA 4KI1A 2ITDA 2Q8BH 1X5ZA 3SPVA 4PRAA 2O26U 4UNVA 5AYUL 5C09B 3VD4A 3WUZA 4PJFB 5BZDB 2RQ8A 4JE4B 2LE9A 4YE4L 3QCTL 3ARGD 4N0RA 2G5RA 1S7WA 1IC5L 3DURB 4Y4HB 5LVEA 1IL1B 1ZA6A 3TH2T 1H0DA 1S8DA 4ZO8A 1JWSA 4QOKD 5GZND 1HHJB 3IDIB 3ARGC 4L4TB 5HY9B 3FFDA 1J10A 2D7MA 5DJYB 1UADC 3QG6B 2GEEA 4PD4K 3QUML 3IVKB 2F15A 4X6CF 4JG0L 1MVFA 2M26A 3PHOB 2FX8H 5IMKB 4MA8L 5CBAB 1AGDA 5GZNC 1E4WL 2P24A 3CDGA 3SEPA 3RWFB 2O61B 3VFUA 4MWFB 1IGJA 1D9KB 4M7LL 4QTIH 4KK8D 1BLNB 5F96L 1IM9D 2DKSA 3WJLA 1D5MB 1KPVA 1LDPL 5JHDE 2XKNA 4NT6B 1AGBB 3SOBL 4KZEH 4WFGD 2FIRT 4LLDA 2P5ED 3QFDA 2R0WL 3GMPB 4KK8C 4MHHI 1QYGH 1MIEL 3T2OA 2MKLC 4PJ5B 4U1LB 15C8L 3FRUA 1A1OB 1EFXD 1N3NA 2EDNA 1ORQA 4U6HA 1UJ3C 4FABH 1WWWX 1JUFB 3EYUH 2J8UF 5T5NF 4K3JH 1XGQA 5C0IB 5I1GL 1NGWA 4U31A 3ELAT 1OAQL 5C0ND 3U2SB 1MFEL 4G8FA 5ISZB 2E6JA 4JJHA 4BZ1L 4JPIA 2QKIB 4Y5YB 4HKBB 1NEZB 5F1IA 5IJKC 5GSVA 1U8OB 5BO1L 3P40A 5ETUA 2H1PL 5C0NC 2IPUK 5DZNA 2X9XA 4S1RH 3BP5A 5TDNB 3FONB 3AFLA 5HI4D 3MLSH 3WXWH 1DQLL 1W0VB 2ZCLL 1JFQL 3UTSA 3BDYL 1MRDL 3BDBA 1I7UB 1J05B 3U9PL 5HVHC 1N7MH 4MJIE 1U8IA 3QXDA 5HI4C 2BOCA 1PZUB 4LIQE 4AY0A 4L8DB 3D2UA 5MEPB 4YQXL 1AR1D 4PJBA 1CE6B 2ENSA 4P4KD 4PTUB 5B39G 1F4YH 5D93B 2A74A 1UQSA 1NL0H 1YYLH 4PBXA 4UDUA 3MJ8B 4DK6A 2IPTL 3CVHH 1AR1C 1CDHA 1E6JL 4LF3A 1ZHLB 2BRRH 4P4KC 5T3ZH 4ZFGH 4PG2C 1FCCA 4OM1H 1HI6A 3GSOA 4GW5B 4XH2A 1HXYB 1BZ7B 1ZGLB 1T03H 2FGWH 4XC3H 1JGVL 4E41E 5MI0B 2AEPL 4RWYH 5A40E 4P2RB 1BD2E 1U0QA 2VE6B 1FNGB 5BMFH 2OJZH 2PYEB 5E9DB 3RKDC 3SCMA 5DJ6A 1DN2A 2DQIL 2VUOA 1YUHB 1QEWA 3DX8A 3MRLA 3R0MA 4D3CH 1EHLL 4G6AD 4GRWH 3UYOD 1FV1A 4XP4H 1A6ZA 4NRZB 1KNOA 1IVLA 2I9LA 3D3VB 4O51A 2Z91A 1CLZH 4WTXA 2VLJE 4G6AC 2V2TB 1HYRC 1IQWH 4X99A 1HHIB 3C8KA 2X7LB 5JO5A 5IEKA 4QNPF 3PWPA 1FIGH 2ZOKB 5DS8A 5J13C 3MRGB 1RUKH 4R4ND 1NEUA 1TCRA 3UYRL 3WNLA 5DUML 2X4TA 3EDFA 5IVXE 2FL5A 1IM9A 5FHAL 4S1QH 1HIMH 1IEAB 3QFJB 3IFLH 3L7EB 4PJGA 1JGLL 3MGTB 5GRZA 4C58B 1WFTA 3MRKB 1MHPL 2QV2A 1LHZA 3GSQB 3MTRA 4J1UA 4R4NC 1EIBA 1R3LB 5CUSL 5EU6E 3I75B 4K7FA 3S4SG 1I9RL 3P4MB 5J9PB 1LO4L 2CDGA 3DRQA 1VFOA 5CS7A 5BS0D 5LQBH 3LPWA 4L4VA 3MLRL 3HE7A 2VDKL 4PRDB 3D39D 1AI1H 4XNZB 3H42H 4JFDA 3QXAA 3MOBH 4LK4A 3EJZD 3OMZA 1FFNB 5HHQA 5I76B 3WEXA 2IQAB 3EJJX 1JNHA 4DN4H 1UB6B 3UMTA 3G9VA 5IGXH 3ZHLA 2BOBA 4XPGL 2B2XL 5DVMA 2DQJH 3EJZC 3MRCB 4QLRA 1V7ML 4OI9A 1T0NB 2G2RB 5SX4H 1K2DA 3RTQB 5EOCJ 1CF8L 2J5LB 2BXZA 3VGAC 4E42B 3I6GA 4X7EC 1OQXA 4MMXC 4G5ZH 4DGVL 5ICXA 2CDFA 1CFNB 4MS8D 2R56H 2Q3ZA 4QHMA 1U8HB 1U6AL 1BHGA 3P11L 3W9DB 3ZKXC 3F7RA 4PGBB 1F3JB 4X5WA 4MS8C 1KT2B 4PRID 5IWLC 2VDPL 4M1DH 2UY6A 5JXED 2YWYA 3UPCA 4XP6L 4L9DA 1QFWH 4N8CL 1Z0NA 2QQNH 2VXTH 3ZDYF 1A6PA 5IV2A 4HIXH 2XYCA 1WAAE 1FC2D 2VLRD 3QG7H 3RWHB 3OKOA 5JXEC 3TBWA 1C7SA 4JZOB 1F3DH 2GIYA 4KQ4H 4S2SA 4JGMA 3SDAD 2L7JA 2V2WA 3RIFK 3QQ9D 4CU6A 5H37H 1OAZL 1I9IL 3S6CA 4GQ9H 3P9LA 3NAAL 2PW1B 5TF0A 3TA3B 5JQ6H 4N8VA 3OKEA 4NN6C 1OGTB 2WP3O 4LU5L 3K3QA 3F7QA 3SDAC 5C9KA 1F90H 3RNQA 1Q0XH 5JHLH 3QQ9C 3RUGB 2M1KA 4NNXA 1GGCL 3OSKA 3FAXA 2AXFB 4NCC2 4JFQA 5D7KD 1IMHC 5D7SH 4WTWA 2JLLA 4Y8DC 1KIPA 3QAZC 3NBNA 1FGVL 4FQXD 3AS1A 1NCCL 2F58H 5IR1B 2VDOH 3FB6B 5H35B 3QUZA 1AJ7H 4JRXE 4BQBA 5T1MA 3TN0B 3AAZA 2PW2A 1NBVH 1LMKA 4FQXC 3HA0A 2YMXH 5GRVL 4P5MB 1QFUL 1MI5D 3DMMA 2QSQA 1QR1A 3O3AA 1KXQE 1U92B 4X5XB 4APQB 4HIEA 2J8OA 3MSPA 3RL1A 4BH8A 1QLFA 4G6JL 2OTWB 5B3JF 3ALXA 3I50H 5INDA 3VXME 1I8LC 1JRHL 2Z93B 3KYNB 3V6OA 4Z0BH 3S8WA 1S7SA 4XPHH 3BWAB 1IFHL 6CGTA 4D9LH 3QYCA 1WIOA 2HRPL 5CFHA 4GOSA 4HGMA 4ZPTB 4HDIA 3MUGA 1YQVL 3E3QC 5HHXL 5CIPA 8FABA 4L5FH 2YPVL 2ZJSL 3NH7H 3O6MH 3BVNA 5DK2A 4HT1L 1OAUL 1YDPB 4PV9A 3D69B 1LE9A 2HWZH 4G42B 3QXTA 5DD0L 4HXAH 5GGTL 4NUGL 1JIBA 5I17B 3DX7B 1LD9B 4OZGE 2CKBA 4N1EA 1CQKA 4DZBB 3MV9B 1DQQA 3X14A 4MB5A 3LKSB 3O11B 1NKRA 3IDGB 2PTUA 3B2UD 5FAAA 1RU9H 4AL8H 4WEBL 5FUCC 5SWZB 5EO0A 4LDEB 1Z3GH 1OHQA 3LKQB 3RL2B 5E8DL 5EZIL 2VITA 3GSNB 1A6UH 3U6RB 5D2NC 3V4PH 4H8WL 3B2UC 2MWCA 2VWEE 5I6XB 4UTAL 1I9EA 5IOPB 3N9GL 2HN7B 3F5WB 1NBYA 1BM3L 1H9VA 5AD0B 5JXEA 3EJYD 3LMJL 2LTQC 1DEDA 5D5ME 2Q86B 2DQHH 1L6XA 3MOAH 1WT5C 2FO4B 4L3ED 5DMIH 3P77A 2C1PA 1FNEA 2A6KA 1YEEH 3EJYC 1XH3A 1T7ZA 3RY4A 1V3KA 4LQFH 4U3CA 1NBZA 1ES0A 1AXTL 5EBWA 1RVFL 1J8HA 4LPXA 2C7UB 3GJEA 5D2LE 3CC5A 4M62L 5AEAA 5IVNA 1T4KB 5DEGB 4WO4D 3WKML 5HDBE 4KRMB 5C0CE 3QEQA 1XR9A 3PQYD 4Z7VF 5E2UL 4WO4C 4LLUB 3STZB 1T89A 3IETA 3VXOA 1X4XA 3H3PH 4PJAE 2AW2A 4PG9B 1XGTB 4AIZB 3UPRA 3P2TA 4PRNA 1RJYB 4KTYA 1ZT7A 1QSED 2VZSA 3VGDA 1GGUA 3HNSL 4QHNA 3OXRB 4G9FA 1S7RB 2JCCA 1JHKH 4HMDA 5HI3D 3BOVA 5F6IB 2AK4B 3PV6A 3QCVH 5GRUL 1EJOH 1JGUL 2FIKB 1LGVA 1WZKA 4JFFE 4PUBH 1QRNB 5CZXD 5HI3C 3WNOA 1DQML 3F58L 3F7PC 3OGOE 1W72L 2NXYD 2SEBB 5I1HH 2R69H 3JSSA 5DD3H 5JR1L 2APXA 5TE7H 2IH1A 1CD1A 3EO1B 2ARJA 4KRPB 5CZXC 1VACA 3HI6L 1IZKA 1XR8B 3CU1A 3MYJA 3QHFL 4XGZA 5D7IB 2ADFH 2EE2A 5HHMD 3V5DB 1YA5A 3N1GC 3TBSB 5KTEL 1X5IA 3JBG7 2NXYC 4UQ3B 2BCKB 3GMLB 1IGMH 5F7LB 5L7XL 3WN5C 3HC4H 2PXYD 4DQOL 2VLKD 1QFPA 5JNYA 2F54B 3H0TB 2EDXA 1P7KB 5I18L 2PTTB 3RWEA 2XICA 3QXVA 1H15A 1K8IB 4F80A 3DHJA 3FO1B 3V0AC 4PTTA 3MRJB 3V52L 4CJ0A 2PXYC 3IDYB 2IF7A 4JY5L 5I66A 4ZOAA 3MROA 1WBYB 3ZKMD 3FQTA 4XXCC 4ZD3L 3RPIA 5HYJA 1RZJC 1OCWL 5C1MB 3QQ4A 4Q6IC 3OJ2C 1P6FA 1DBAL 2GJZB 3QRGH 5JMRA 4N0UA 3CCHB 4OI7A 3ZKMC 2WK2A 4P57A 3DYMA 4I2XB 3O6KH 1NC2D 2W60B 1NAKH 1P69B 3PL6B 3BKCH 1V05A 5HHOB 2P5WE 1BIIA 3DV6B 5D1QA 3MLVL 1R3HA 2P8PB 1R3IL 1BQHA 1YN6B 4ZQKB 3NGBB 4QF1B 2ATKB 4OD3L 5CD5C 4CADB 1GOFA 1TQCB 2XZQL 3FO0H 4EN3B 2BVQB 5E7FA 2GAZA 1TTUA 3IXAA 2GK0A 3UTZB 5BOPA 1BFTA 1FFRA 1P84J 5B21A 4JO2H 2D7QA 2CJUL 2DQUL 4KHTH 1A47A 2YUZA 4Z7UB 1AHWC 3VXRA 3L95A 5IBTL 4N68A 4MAUL 3GGWB 4EI6A 1P1ZA 1QFOA 2CQVA 4WO4A 5DJ0A 1A3LL 4QRPA 1KB9K 5TGBA 2GI7A 4X6DA 4YHKH 1NPUA 3VI4E 2PF6A 1UM6L 4RBPH 4D2NA 5EOQL 3D85B 4TVPH 5ACZB 5AYQA 1YJDL 4JPKL 1BEYH 4HC1A 1MLCA 1KENL 4Q74A 3BGMB 2BSTB 5L2KD 1ORSA 3L3GB 3C5JB 3TV3L 4JAMA 2VL5A 4JM2F 1BVKA 4LAJH 1YPZA 4P46B 5EUOA 4LRNH 3U30C 3UTTD 4K94C 3CK0L 1MCPH 5DD1H 3I3DA 1OQOA 1KPRB 3TYGL 1RV6X 3ET9F 5BQ7B 2PNDA 3FOLA 3E8UL 3ZDZE 2RIKA 5DK0A 4RMSA 3I6LD 5C08B 4K9EC 4XCEA 3QUYB 3S7GA 3SGEI 4TPRL 4KH2A 43CAB 3CAFA 2ZUXA 4I3GA 1E0OB 1SEBA 4HWZB 4DGIL 4V1DD 3DIFA 3RFZC 1A14L 1UH3A 4OGYL 3EOBB 3O6LL 4HMEA 5HDQL 1YNTA 4JPVL 1LE5B 4GXVH 4HH9B 5D70H 3EHBD 2Q7NA 5ALCH 1A7NH 4MXVE 1TVBB 1QG3A 3KPPB 3L5WB 1CIUA 5DFWH 5L2JA 1SY6L 2EYSB 3MV7B 2D0FA 2XV6B 3VD7A 3RY6C 3F7VA 4KAQL 4FQIH 3JXAA 4QRRB 5E03A 5HJ3A 4I18A 2Z8SA 1J86A 1EH9A 3S5LB 1ED3A 3GHBH 5ADPH 3W9EB 1OOAA 2VQ1A 3TO4D 2G60H 3CFDB 4QGTA 4XP5H 4TUOA 4QT5A 5A43C 1OLZA 1I7RB 1UACH 5J11B 4DJMA 4P2YA 3UJIL 3PHQA 1FH5L 1IAOA 1S5IL 5C2BL 1C5BL 1R5IB 4TUJA 2B0SL 3TO4C 1YEDB 3IDJA 1AQKH 2APBA 2OX5A 3BPCB 3FB5A 3QZWB 1XGRB 2FO1A 2X40A 3OZ9H 4ZUUA 5FHBL 5DVNA 4OZHB 1KJ2B 4RAVB 4D0BA 3OKNB 3EO9L 2IQ9H 3UTQB 4TULH 1OVZA 5ABDE 1G7IA 3VH8G 2D7TH 3C6SA 3BE1L 2HFFA 4RRPA 3SKMB 3VFNA 4LCWA 4EOWL 5D96B 1IEBA 2UYLB 4PY8J 4QHUA 5F7EH 5I1KH 3H9HA 3JWDC 2NY3B 2X1WL 3PGCB 4YDJB 4OSUL 2FJFB 1HQRA 2RCSL 5FDWB 1C1EL 1A1MA 5TDOB 1F58L 4YC2B 3TFKD 3FMGH 1JWMB 3CNKA 1JGDB 4YHPA 5D7LA 32C2A 1FSKC 2X4NB 4M7ZB 4HCRH 4XAKE 2ESVB 3TFKC 1NMBL 4LL9A 4UTBL 1PDKA 2X4UA 4CMMB 3KLAA 4PJBE 5DRNA 3CFEA 4J3TA 5D71H 3NIDF 1A22B 4U6VH 3IAQA 2JJTC 1I1AB 4P0DA 1MCHA 3T0ED 5DLML 1H3WM 5SX5K 4RQQA 1RJZA 2HFEA 3QXWA 4BQ6A 2LABA 4YR6A 3MODL 3QIBA 2V7NB 1U8QB 5LAXB 3BJ91 2OLDA 4JJ5A 3QWQB 5TDPA 2YPKA 3BD3A 5EA0L 1DVFD 2NY5C 4CVXB 1TDQA 5EH1A 5T3XH 2K7PA 1S9VB 3BPLC 2OP4L 4GKNB 1U36A 4YHMH 4QGYA 1TENA 4DAGL 2DWDB 1DVFC 3HLAB 3TNMB 1MCOL 4ZAKD 2VAAA 3FQWB 2EDYA 1KCUH 4V1DA 1OP9A 3RA7H 1L4IA 3FT4B 3OF6D 5EBLB 3BQUA 3IU4H 4J6RH 3KDMA 2EDEA 1G9NL 1I8IA 3QEHB 4QOKE 3DUUA 5EOTA 3QJFB 4KK5D 4P23A 2MMXA 4M8QA 1IILE 4ZAKC 4A6YH 4HWUA 5DGRA 3EOAB 3VXPB 5KVMC 3TCXA 5KSBB 4ODVH 4KQ3L 3X12A 4XNXH 2ICWA 1IGCL 4ONFH 4RDQG 4KK5C 2AABH 5J1AB 1FZJA 4K2UH 1JZ2A 1VCAA 5HGHA 4EUPH 3WNMA 3W0WB 3GSUA 3BIKB 1CGYA 3BN9D 4JG1H 4PJGE 1SJXA 4HGWB 4OQTA 3NN8A 4WFGE 1EZVY 5EN2A 4ODHH 5FA4B 3JTTA 4PJ7A 5DO2D 2FEEI 3QWOA 2VR4A 3P0YH 1HINH 3BN9C 1KB5B 3WHXA 4YHIB 3NPSB 4D8PA 4RAUB 5GJSH 1TVHA 1YMMB 3S36H 4L4VE 2IAMB 2HKFH 3VFVB 4KUCF 5DO2C 1TETL 3GSRB 5KVFL 1NCBH 4WI6A 4OLXH 3NVQA 3WJJC 4MAYD 3MBED 4OLYH 3R8BB 1K5NA 3J7HA 3QUKA 1FFOA 3RGVB 3BH8A 2DM7A 4YEEA 4N8PA 4F7MB 2FWOB 4QTIL 1QFWM 3T2PA 3KYMB 4MAYC 3MBEC 3IFOA 1SJEB 2R0KL 1T5WA 4YIQB 4ZTPL 4J3WA 4GBXB 4M61B 3JWOC 5DMGD 4KZEL 2EDLA 2XG5A 1QHPA 4MNGA 1QZ1A 2AJSL 4HV8A 1FO0H 4RNRA 1BREA 3LY6A 3PWJA 1A7BA 4G8IB 3PHSA 4K7PH 1QYGL 4G9DA 5EU5B 1JF6A 1MQKH 2EYRB 4LGSB 4XAWH 3C5ZB 1KXTB 1MWAA 4M93C 5DFVD 5DMGC 1XT5A 4FABL 1P7QB 3MNVB 1BP3B 4X6CA 3EYUL 2VERN 4K3JL 3RWDA 1NANI 3GBMH 1PG7L 3G5YA 4FRWA 5DFVC 4HULB 4M5ZH 2YN3A 1VGEH 5FYLE 5KOVC 2E5EA 3FJTA 2YBRB 4X7TB 4Q6YA 1UWXK 2O5ZH 4M00A 3BZEA 5F9JB 1QVOA 3J8F7 4YFLI 3JV0A 2AS5M 4RZCB 4JFEA 1NMCC 2P45B 1DVFA 3SGEH 3MUJA 3MLSL 5FKPB 2EC8A 1T7VA 4NO0D 2R0ZH 3Q3GB 4H0GA 1AD0A 5MEND 4L29A 4KDWA 4UNUA 5F3HB 1WV7T 2JB6B 1Q8MA 3TZVB 1N7ML 1AGFB 2XG4A 2JIXD 1KGCE 3S96A 4WFHD 2ADJA 4PREB 2C3WA 4NO3B 4MDIA 4Z7QF 4JO4H 1K4CA 1JF1B 1DE4A 5E8EA 4YXKL 3ILQD 3STLB 1KJMA 3CSGA 1RIHH 1F4YL 1RJCA 5J4MA 4IHOA 4KVCH 5FB8A 2GTZB 1YYLL 2WBJA 3QQ3A 5GSRA 3WIIL 4ODUB 4LLQA 2DQFA 3CVHL 3ILQC 3O8XD 4NPYB 2BRRL 5T3ZL 4ZFGL 5C07B 1NGXB 4GRWB 4X98B 1T03L 1FL3B 2FGWL 3DGCR 4XC3L 1LVEA 4YBLB 4PJDA 4HLZH 4PRBA 5HHPA 4L4TD 3O8XC 4RWYL 2BSRA 1XCQA 1PQZA 1P9MA 4HWBH 3SY0A 3V6OE 2R2HA 3JV4B 4KJYB 3VXUA 3FT2B 5BMFL 1EO5A 2BMKB 1A6TB 5DMJB 3PGFL 2P4AB 3BP4A 2Y1VA 1XIWA 4PJ9B 3ROOA 4LLYA 1D9KD 2EO9A 4FQ1L 1TZHB 3NZ8A 1U9KA 4D3CL 2ZSVA 1AE6H 3MOQA 3CSYB 4XP4L 5IHUH 4IJ3B 4OF7A 2W65A 1T1YB 4XVSH 1RK1B 4YBQD 3G6JF 3RDTA 1D9KC 1SBSL 3G5XA 2BHUA 4YO0A 2A9ML 4LHUB 5ITFA 2R23B 5KW9L 1IQWL 2OJEB 4MAYA 3WFCH 5I1DB 3BGAA 4PGDB 1BVLA 3UXFA 3HFML 2CDEB 3O9WD 4YBQC 2AK1L 1H5BB 3MRRB 5LCVL 1RIVH 1RUKL 4GH7B 3LZFL 2BVUA 4HFWA 2VDMH 1OGAB 1QA9A 3LRSA 1BBJA 2EDTA 2NX5A 4S1QL 3IFLL 4Z7NE 4PLJD 3O9WC 2VYRE 5C6TL 1XGUA 3ECBB 3MJ9L 5ISZD 3V0VA 3BD4A 1LO3H 3FB7B 5BJTA 1A8JH 1GHFH 1MEXL 1F00I 1M4KA 1HWHB 4GW1B 4PLJC 3U9UB 1JHTA 1AO7A 4MQXD 4PRIE 3QH3A 2DM3A 1KJVB 2DLFH 4Y5YC 4WTZA 4X5LA 1MHHB 3LKNB 2FLRT 4DW2H 4Q58C 1HSBA 3GSWA 4MQXC 3TIDA 2D31B 3BXNA 4DN4L 1MJJB 5ICZB 1LEIB 2GFBB 1QBLH 4PR5A 5H94B 1MJ7H 3MRMA 1K8DB 2CO6B 5ERWB 5FF6A 3DVIA 1U2CA 4BSJA 2ZP0T 4R97B 4CGTA 1KTLB 3NZHL 1CFQA 4ELKA 3HZYA 3QEQE 5F8RC 5D93C 3BX7C 2UZXB 5D7KE 1M05B 3CFKA 1A9BB 4IIQC 4BZ2H 3JZ7A 1DBKL 5B8CA 2MHAA 1VB9A 3MREA 3SE3A 4ODSL 1A3RH 1FYTB 2QSCH 5D72H 2XZCH 4HLJA 3I2CH 4P2RD 1D5IH 2OR9H 4M1DL 3QUMA 4LIQL 2DS4A 5DJXA 4G9FE 2PYED 2OL3H 5C09A 3REWB 1KCKA 1QFWL 2JCCE 5E9DD 2PYFB 4PJFA 1UENA 2QQNL 4HIJA 1ACYH 4WUUB 5HYSG 1Y6MR 3EOTH 4HIXL 1MI5E 1U3YA 5JOEA 3IT8D 4XWGH 3HMXH 1PKQA 2EE6A 2DLEA 1CGUA 3MLPA 5J1SC 4NRYB 4Y4HA 4BSWB 5F9AC 2MOVA 1IL1A 1NFIA 3I85A 4DFHA 4GQ9L 2FGZA 3ZYIA 2X4OB 1FL5B 1HHJA 5DYOB 3D3VD 3IDIA 4JVPA 5HY9A 4B0MM 4P59H 3SKUD 4TNVF 4Y7MA 2IALB 4Z7OF 5FGBC 3IVKA 1F90L 4Z78A 35C8H 5IMKA 5CBAA 3V6BR 5K9QG 1QNZH 3RWFA 1ZANH 3NA4A 2O61A 4ZFZB 3QEUB 4JFYB 4XP9H 3D0VA 5I9QB 2F58L 5D9SA 3LD8C 3NOIA 2VR9A 4NC1C 4P5TD 1AGBA 4K8RD 1MCWW 5CSZB 3PWNB 5CIPH 5IKCB 4PJ5A 1A1OA 2YMXL 1EZVX 5C0BB 4P5TC 3ALPA 1TXKA 4K8RC 2DKUA 1JUFA 4WI9A 1KIRB 2BVPB 1IGYB 3GIZH 2XWTB 4PJ8A 4KU1A 4KVNH 5EFIB 3I50L 2MQCA 3C5SA 3U2SA 4C54A 4Z0BL 1WICA 5F71A 1N6QH 3MCLH 5I74B 3OKMB 5DRXB 2QKIA 5F7HA 4HKBA 1NEZA 1GRWA 4D9LL 3HAEH 4OCWL 4WW2B 3B9KB 4MJ6A 4M7JH 1TTGA 1NANH 3RTQD 4OCSH 2AQ2A 1TLKA 1LO0L 2DWEB 3BKJH 4P3CH 3V7MA 1W0VA 3NFNB 4FXGB 2OTUB 1KLGB 2FJGA 1IC4H 3O6ML 5IMLA 1I7UA 1J05A 3MFGB 3MZTA 4L3EE 2HWZL 3UBXG 5E94B 3RTQC 2J5LC 4FQJH 4NNPL 5IM7B 5MEPA 1HHGA 1G7HB 3VXRE 4I0PD 2ARJQ 2R1XA 3BRGC 5SV4A 4QRPE 4W4OA 4PFEA 2IANB 3CU7A 4X6DE 4G7YH 1CGTA 1RU9L 4GKZB 4XHJD 3GHEH 2WUBH 4I0PC 3WUWG 1ZHLA 5JW4Q 1VEOA 2A1WL 1VSCA 3INUH 3WNNA 3CLEL 5MEOB 1HXYA 1ZGLA 3V4PL 4UB0H 1X9QA 3OXSB 4XHJC 1X5LA 4R6UA 5JOFB 3E6HA 4QHKI 3TA3D 2XTJB 4ZYKB 1PBYA 1QSZA 1F4WL 4LPTA 2VE6A 2A6JA 1YPZE 1RZIB 5KN5B 1FNGA 5GGRB 5EUOE 5GS1A 1R5VB 1U8NB 1P53A 4E0RA 4FQCH 3DV4B 4NZRH 1YUHA 3TA3C 4GS7B 1JYWA 3OX8A 5LKNA 1OAKL 3V9FA 4UOW0 1YEEL 4LPYA 4XVJH 4F37K 5KAQG 3IFNL 5FGBA 3U4BH 1OW0C 1CU4H 4EI5B 1I3VA 4M7KH 1HHKA 4NRZA 4DGYH 1EXUB 2DTSA 1MCLA 4QXWA 3TN0D 4J3XA 3G5VB 2CK0H 5EIIA 4PJXB 2V2TA 1HHIA 2XT1B 5HHME 1FE8L 1QBBA 1E27A 5DDHB 5JTWA 2ZOKA 4MLSA 3F12A 5K93A 3H3PL 4W70A 4HS8L 3TN0C 1KEGH 3PE9A 4RFOL 1IAKA 3S98A 5A3ID 1IEAA 3QFJA 1FL6B 4FNLH 1AC0A 3MGTA 1G1CA 5C0RL 5F89A 2CUMA 5IB5B 1IQDA 1JNJA 4OJFH 1H3GA 2FSEB 3Q2CA 1M6OB 1JHKL 4ZMAT 3B6SA 2AJZA 3I75A 3QCVL 5DQJB 5A3IC 5GXBB 1EJOL 2I07B 5KOMC 1KC5H 5TE6H 3OPZH 1T22A 2R8SH 3GJFH 3Q48A 4X80H 3SBWC 1N5YH 2I5YH 4PRDA 5KAQF 1F5WA 4QCIA 5L0QC 5FFLA 4Z7VA 4GAFB 1FFNA 5I1HL 2R69L 2IADA 2BX5A 5TE7L 5J06A 1B9ZA 3OB0K 3NIGE 2EDWA 3MRCA 3VCLA 3ZHDA 2HTLD 3MV9D 1T0NA 2X6MA 1DTUA 1IGML 3RTQA 2UV3A 4LDOB 5IESL 4HKZA 2V7HA 4LCWE 5SWZD 2LVCA 3KPSB 2HTLC 3QDAA 2EH8L 5I8CB 5CILH 4JDVB 4PGBA 1F3JA 5CGYD 5D7LE 4WCYH 4QKXB 1F6LL 3NCJH 4PRHD 1HHHB 1X5AA 2ZUSA 2V9RA 4U2ZA 3T0BA 5I6XC 1NBQA 4YH6A 2DICA 5CGYC 2ARWA 3RWHA 3SKNA 4JZOA 2DN7A 4Y19B 5IVXF 1NAKL 4PGCA 5GGSY 1A9EB 3BP6A 3HUJB 4M48H 4UMGA 3H2WA 1C08B 2HT3D 4EKXA 2PW1A 1RUPL 4OZFH 4MJ5A 1KN4H 5IP4A 4FTVB 4OZIB 1QLRB 5D1XD 3FO0L 1NAMH 2MTPA 2HT3C 3F6LA 3VGHA 3CGTA 1MHEA 3U4AA 4JO2L 3T65A 4R96A 1D7FA 5CKGA 5IR1A 5D1XC 2XN9A 5H35A 2UZIH 5DZOA 3R1GH 3KPRB 3GO1H 1N59B 4D94A 4B7LA 1MAMH 5I8OH 3TN0A 4V1DE 1T7YA 4LSUL 2AK4D 4QHLB 5E5RB 3BKYH 4RX4A 3BFOA 4TVPL 3LQAL 1CLCA 1CS6A 4APQA 1QRND 4F57H 1MY7A 1EHAA 2OTWA 4KJWD 2AJYH 1HCFX 3RX8A 2IBGA 4HXBH 3AM8C 2ZSWB 3C09C 4PLKD 3BRDA 2AKRA 5HGAA 1A6AB 4KRPD 3BWAA 4R90H 4LRNL 1HH6B 3SDXE 2FNBA 5GGTA 3RIAF 5JIPA 1R6VA 4JN2A 3DROA 4KJWC 5DD1L 5T5FL 1BZ9B 4PLKC 3IFPB 1R0AH 4KRPC 4WI3A 1RZJH 2W0FB 4X9FA 2W38A 3GRWL 5I1AB 4HS3B 1AGEB 1YDPA 3TM6A 3QP3A 5DRZB 4XBGB 4KDTC 3SO5A 5DHVH 4MXWH 1OAXH 5E24E 4FFZH 1DBMH 3OGCB 4BJLA 5I17A 1T2QH 3DX7A 5DWUH 4HUWB 4GXVL 5E2TL 5AZ2H 2HJLA 3QNXB 5ALCL 1A7NL 5EULV 3FQXA 2AI0H 5JQHC 1ADQH 2ED7A 2P48B 4PBVC 4QY8A 5DJAB 3PDGA 2XY1A 3LKSA 3IDGA 1UKSA 5CJOH 5EIQA 1I4FB 1MUJA 4AEHH 3EYSH 3RL2A 4BKLB 4J12A 4PGEA 5IBUB 3GSNA 3U6RA 3PL6D 5CHNB 2AV7A 5HHOD 1RZFH 2P49B 3GHBL 3DO3A 5IOPA 1FNAA 4QRTB 4S11A 3F5WA 3PIQA 1YEHH 2YD8A 2XFXB 2VDRH 3MLUL 2ATPB 4RA3A 1IT9H 2EC9T 1UACL 2Q86A 3D5OF 3PL6C 3RWJB 3DVFA 4YDIL 2NXZB 1SYSA 3VGEA 4U1IA 4EN3D 3DI3B 1VGKB 1ZV5A 1KEMH 2GJ6B 3LPGA 4IS6B 3NGBC 2NMSA 3OZ9L 3QDGB 5C92A 2GCYB 4EVNA 1TQCC 2XNAB 4EN3C 2C7UA 1K85A 2OZ4A 1G7MB 5JDSA 1T4KA 5DEGA 1X7QB 1I7ZB 4NKMB 3QUXB 1WZ1L 2Y06H 3UROR 4JFHD 1A0QH 1G7PB 4ZPVB 3ZT6A 2JK5A 2VJXA 2YPLD 2B5IC 5F7EL 5I1KL 1AIFA 4HIHA 2YC1B 4LLUA 1N0XH 3STZA 5DI8A 3Q1SH 5C0DA 3DARA 3FMGL 1XGTA 4K9EH 4AIZA 2VC2H 3EGSA 5C0GA 1JNLH 4HWEH 1RJYA 1W72A 2PUQT 3KPMA 2EDOA 2Y07H 4GRLD 4W6XB 3GMMA 4JKMA 4P46D 2V5MA 1S7RA 4HCRL 3C6LB 3D9AH 3IJYA 4OZGF 4NZDA 2IFGA 1E4KC 4CKVX 3EO0A 2BVOB 2F74B 4GRLC 4P9HC 4LVNB 1L7IH 2FIKA 4P46C 5F7KC 4NQDD 4EXKA 5C08D 5D71L 4U6VL 3THMH 1JZ6A 4LLVB 3ZKQD 1BJMA 3DX6B 4NBYB 4H20H 3DXAB 2SEBA 1U93B 3ARDB 2C4FT 3G6DH 3EO1A 4X8JA 1XR8A 5D7IA 3R8QA 5IMOA 3V5DA 4LKCA 3TBSA 3NCYS 4PJDE 5C0FA 3UJJH 2P44B 4OGZA 5KVDL 5C0AB 4A6YB 3GMLA 4ZXBB 5D5MF 1OTTD 1NFKA 1GGIH 1A4KA 3A6BH 3QB7C 2F54A 3R06B 4KRLB 3MV7D 3H0TA 3RVXC 1G6RB 1P7KA 4YHNB 4YHML 4I3RH 1AFVL 3TBTB 5BV7L 1N5AB 3KPOB 2C1OB 2DOCA 3S9DB 4XNQB 4LSSH 1KCUL 1OTTC 3FO1A 4LPCA 3BGFB 3NFSH 4NQED 5T1DH 4M1GH 4I5BB 2P8LA 5D2LF 4J6RL 3LKOA 3VMPA 5FKAB 4BA8A 3T2QA 2VXSL 5SWQB 3VWJB 4WV1B 4KJQD 5HDBF 2AEQH 4R7NA 3TIEB 2ED9A 3ARWA 2B1HL 4J2XA 2FJHA 3KPNB 1AQDB 3BUTA 4ODVL 2FRGP 2MPAH 3RU8L 3MMEB 3JWDH 3CZFB 4HF5H 3AS0A 4DN3H 4ONFL 1TFHA 4I2XA 1LP9A 4KJQC 2W60A 2X41A 3V7AE 4XT1C 1JBJA 4K2UL 4PJCB 1QSFB 4MD4B 4CN6A 2NX5E 2DB8A 3DV6A 1KG0B 4JG1L 2P8PA 5GGRY 3MUHL 3O6FB 3LRHA 3MGOB 1T0PB 1YN6A 4QF1A 4DVBB 2ATKA 3RQ3A 4CADA 3QWRD 2J2ZA 2F5BH 4QWWD 4EN3A 4NFDA 3FT3B 5CEXB 2NNAB 5GJSL 1W0WB 4R2GB 3VWKA 5D96C 2HKFL 4Z7UA 4O02H 2FZ3B 1FN4B 1BOGB 1VADB 4KV5E 5E8OB 4QWWC 1I9JH 3RWGB 5C70A 1KUMA 1TCMA 1UWEL 3GGWA 3SJVD 5KZCB 3GIVB 1FO0B 4O2EB 5TFSL 1CIDA 4YC2C 4EZMA 5TE4L 1JWUB 3RNKB 4P2OB 3WIHH 4G8EB 3MLWH 3ABZA 2HJFB 2WWMD 2WINB 3D85A 5ACZA 2NY5H 5TQ2H 1CT8B 5ID1B 2FB4H 4H26A 1ZHBA 4M7ZC 3BGMA 3T77B 1I1AD 5MENE 3T8XA 2NY2D 1CICB 2A73A 1CXHA 2BNRB 2Z31D 2YD3A 3MO1A 5BVPL 1FVCB 2KQMA 4LPVA 3T4YB 3MACL 1I1AC 1MQKL 4XAWL 2NY2C 4MD5A 1FNHA 3H9SA 5BQ7A 2Z31C 2PO6B 1VPOH 1ZS8B 5C09E 3QUYA 4PJFE 3GBML 3JTSA 3O0RH 3HRZB 5ESQB 43CAA 1T21B 5KSAA 1UZ6E 4M5ZL 4HWZA 5KS9B 4F7PB 2ADGA 4OD1H 1X6NA 5ESAA 2CGRH 3RWCB 4KK6D 3ARGB 4WJ5A 3HNVH 4CBPA 4L4TE 2BJML 4F7TA 3PDDA 5DEFB 4P4RB 1TVBA 1IKFH 2R0ZL 3KPPA 5GISH 3L5WA 3AGVA 2P7TA 4ZNEA 1IGTB 4KK6C 1AKJA 2EYSA 1HWGB 5EU4A 2BC4A 5I1JH 1MFDH 1M71B 4QRRA 3WE6B 2E7LC 1ZT1A 3GMOA 3MUZ1 3BKMH 3T1WA 3MRFB 4YWGL 3W0WD 2W91A 3CFDA 4Z5RA 1FYHB 1RIHL 2AEWA 4M1CD 3WMSA 3GKWH 1I7RA 4KVCL 4U1SA 3VI4F 4ZFOB 4GW4B 2E27H 5FM8A 4PJ5E 1MFCH 1R5IA 1TJHH 3AXLB 3T0XA 3VXSB 3S37L 2P5EB 5FO7B 4M1CC 1XGRA 1FORH 1XCTA 1YMMD 2IAMD 4Q0XL 4EUPG 4FQQB 3MRDB 1Z9OA 4OZHA 1KJ2A 3OKNA 1B4JH 1V5JA 4DKFH 4I4WB 3UTQA 2AGJH 4ZTOL 4K23H 3JWOH 3WIFB 3NPSC 4UI2A 5ISZE 4X4MA 2IAMC 4NM4H 4G8GD 2UYLA 3RGVD 4YDJA 3P3YA 5FO9B 3ZDZF 4LRIC 1X5YA 3ULSB 2XZAH 4JVWA 5IHUL 4Y16B 4MD0A 1F11A 3ULUD 5HVHB 3DVGB 1JGDA 3RGVC 5KSUB 5IBLD 5JUEH 4RGOH 3PP3K 1EEYB 5TH2B 4C56B 4EDWH 1AH1A 1QP1A 4OUOA 2ESVA 4LEXL 1J1PH 3HI5H 4GLRI 4HS6B 3VGGA 3C5ZD 3ULUC 4LARH 4NJAH 4WUKL 4CMMA 1KCVL 5IBLC 5F7YC 2F53B 1RIVL 1UKQA 1KIUA 2VDML 1GOGA 5T1KB 4L9LA 1IBGL 2H2SD 2X10A 3C5ZC 3T2NH 4LHJB 5FUZL 3WHE0 5BRZB 5ID0B 2A9NL 5LGJB 1O7SA 3SDCD 1NSNH 2C26A 4ESKA 1LO3L 4X0KB 5HGGS 5HI5D 2V7NA 1U8QA 5LAXA 2H2SC 4F2MB 5IHLB 5E2JA 4U1GB 3N50A 3SDCC 1GL4B 2IPUG 4CVXA 3ZL4L 4AH2A 4P2RE 5HI5C 3CFJB 2PYEE 1F4AA 5I1LA 1S9VA 5E9DE 3IXTB 4GKNA 4QHKJ 5ANMB 3TZVD 5I19H 1CGXA 4JVUA 1TIUA 4AMKH 3ZE2F 5KG9B 1QBMH 1LNUB 2D9CA 4JHBA 3TNMA 2IG2H 5EBLA 2WWKT 1EHXA 2J1KA 3K4AA 4D9QD 1MJ7L 3TZVC 3QEHA 5ALBH 1NLBL 3D3VE 3QJFA 2RAMA 1A7QH 2JJUA 5C8JB 2E7LA 2OL3B 3E6FB 4TTDD 1RI8A 3P0VH 3KJ4C 1B4RA 3VXPA 5E99L 2Z4QA 3KJ6H 1TJGH 2CLRB 5J57B 3SE8L 2EXWD 4R26L 2NW2B 4NQXB 4OKVA 4BZ2L 2WQRA 3U0TB 4XCCH 1A3RL 2NY4D 2VSDA 2QSCL 5GRJH 3QFJE 5D72L 5E2WH 2X4SA 3BIKA 2XZCL 2EEAA 2EXWC 2OR9L 3T1FB 4MA7L 2YS4A 1DN0B 2OL3L 5F7UA 1G7QA 4H88H 4Y2DB 4PJBF 1ACYL 2NY4C 4XBEL 4PJ9D 3EOTL 5IUSA 2JJSA 4YHIA 2Q76B 3MLYH 3CXDH 3HMXL 3MR9A 1B88A 2IGFH 3WLBB 3BH9B 4HLZG 2RJMA 4Z95H 1UM5H 3IU3B 1HDMB 4PJ9C 4QTHB 3KAAA 4Q9RL 4RGNE 1WFOA 4P59L 3VW3H 1LO2H 2FEEL 5BS0B 4LHUD 4OM0H 4NM8H 2E7CA 1OY3B 3D39B 1DDHA 4IJ3C 3WS6C 4R0LA 35C8L 4M8VA 4FMFA 2DLHA 1QNZL 1ZANL 4B7IA 4F7MA 4NWTH 2FWOA 1OGAD 1P6AB 4XP9L 4Y4FD 3KYMA 4P5KB 2FX9H 2XA8H 1SJEA 1FNSL 3VXQB 4YIQA 3NTCH 4GBXA 3MZGB 2E8YA 4XXDB 1F4XH 4UU9B 1PX4A 5EU5A 3MX0A 3QI9B 4U6TA 4JQVA 4QRUB 4PY7B 3LN4B 3G08B 5EDXA 3PGDA 5SWSB 1WFNA 4TUKH 1P7QA 3VFRB 4DKEH 3MNVA 4ONGH 1XF1A 3Q6FA 3GM8A 5IW1B 3CH1B 3P4OA 5BW7A 5A2FA 2NW3A 5LWYH 3GIZL 3K74B 4KVNL 4N0FB 1KF9B 1DJSA 3CX5J 2CKBL 3PABA 5JPMB 1MLBA 5TQ0H 1HNGA 1UXWA 1AP2B 3RVWD 1N6QL 3MCLL 2YBRA 4X7TA 4NBXB 4W81A 5F9JA 5E6ZA 2VLRB 4LNRB 1NFDB 3MV01 4PJGF 1ZXQA 3CMOH 4RZCA 4M7JL 5CZKA 1XZ0B 2GY7B 3RVWC 3T3ME 5FKPA 3SDAB 1CR9L 3Q3GA 5LGKA 4HMCA 5IEHA 3CVHA 3QA3B 1A3QA 1IC4L 2JB6A 3NFPA 1WUNT 3MPCA 2EE3A 3U0WL 5K9KA 4P2QD 5I1IH 4AK1A 4HKJB 3OR6B 5D6DA 4M6ML 2X42A 3OKDA 4HIIA 4PREA 2EKSB 4TSBH 4PRPB 3DUSA 3TO2B 1D6EA 4GAGH 1JF1A 3IGAB 3STLA 4JB9H 5C0JB 3D18A 4OV5B 4NKDB 1BJ8A 1F3RB 2VKXA 1A7PH 5FO8B 1DR9A 3HG1B 4FQXB 2GTZA 4G7YL 3GHEL 4WUUD 2VXVH 5F21B 1U8MB 4NPYA 1HKLL 4NQVA 3INUL 4Z9KB 1CYGA 5C07A 2VB5A 5DJCA 1ZK9A 3QDJD 4R7DB 5IVZA 1FL3A 1C5DA 4AIOA 5IHZB 2BK8A 4OLVL 1YEGH 3O4OB 3BIAX 3VMOA 1H8NA 3FT2A 2BMKA 3VFTA 4QEGA 4JRYB 4PJ9A 4NNYB 1MSPA 4NZRL 2DYPB 2MCPH 4ACPA 4G6MH 2QHRH 1QOKA 1I1RA 1R3KB 2A83B 3MRHB 4K8RH 3U4BL 3VU2A 3CSYA 3L1OL 3VXNA 2VO5A 4DGYL 4K7PY 4NHCH 1F97A 1P84K 4DVRH 1FLRL 4RA0C 3DYOA 4JQXC 4HBCH 2CK0L 3VG9B 1G6VK 5I1DA 4U1MA 1MRFH 4PGDA 2VL4A 4DEPC 3FFCD 2H9GA 5C0BD 4LSVL 2CDEA 3DNKA 1D5XB 4L8CB 1H5BA 3GJFB 3MRRA 2DL2A 3MV9E 1Q1JH 2HFGH 4HG4J 1OGAA 3OAZH 3QO0B 2YD2A 5SWZE 2NTFB 4FNLL 4WRLA 4WW1B 4GLRH 4OCNC 2H32H 3ECBA 4XCFH 3FB7A 3BESR 4O2CB 3QPXH 5D2NB 3NABL 1ZLWK 2OS7A 2FYYA 2V9QA 4GW1A 1SBBA 3C8HA 4MGXA 3OPZL 1NMAL 4NZTH 4U7SA 3S35H 2R8SL 3OB0H 1RIUL 4K3EL 4NQUA 1UYWH 1WGOA 1KJVA 4WENB 1N5YL 3BHBA 2I5YL 1BQLL 1MHHA 2IPKB 3LKNA 5IK3A 3WDHA 5JOPD 5DJDA 3WUWA 3WFDH 3H9YA 3W81A 5DR5L 4OCYH 5ICZA 3HAEG 4E41B 2YOCA 1LEIA 3Q6GL 3UDWA 2GY5A 2QQKH 1B0RA 3HR6A 3ROLA 4X6EB 1D5ZA 4PP1D 5ERWA 4M03A 3TH4T 4F3FB 4IRJB 3IRPX 4EQ2A 1KTLA 1A4JB 4WNQA 4XTRD 3C08H 2EC9U 2XPGB 4PP1C 3BAEH 5C71A 2WUCH 4YX2L 1GAFH 4N5ED 1C8PA 1KYOJ 3BJLA 3BT2L 5HHNB 4G7VL 1S5HA 2DQDH 3L9RB 4RISL 5FDYA 3TT3H 3PQYB 1FYTA 4XTRC 4I77H 4OZFB 2QL1A 3OJDB 1NUFA 4XRCA 1MHCB 2JB5L 4UAOB 4N5EC 5CEZE 3BIBX 2YRPA 2X5PA 1KPUB 1G0YR 2PYFA 3LSOB 1MIMH 2AK4E 1FZOB 1LEKB 5F44A 1QSEB 5EZJA 5A16B 4CL7A 1RULH 2GITA 4GSDL 5EC1B 2YZ8A 4EI5D 4NRYA 1QRNE 4BSWA 1J0JA 3P9MB 5GS3A 3IDNB 4NDMB 4Z7NF 4WEUD 1FL5A 5HVWA 4HK0B 3BD5A 3G04A 3CVIH 3M07A 4GS7C 3KR3H 2IALA 1KN4L 5ICYB 4ORZC 3V6ZA 4EI5C 1ZEAH 5D7IE 4OGXL 1NAML 4XVUC 2NXYB 4RAHA 3ARBB 2YN5A 4ZFZA 3QEUA 3KLHD 4JFYA 2BY0A 2VN4A 3O2VL 5F3BB 1X4ZA 1ZHNA 4RFNB 2X4RB 2F54E 3OHXB 2A6DB 3M8OH 3UZVB 4NO2B 3R1GL 3A67H 3GSVB 5IVXA 3KLHC 5I8OL 2PXYB 3MCG1 5CSZA 4UOJA 3WD5H 2VLKB 3PWNA 4CAGA 4WU5B 5IKCA 4HJGB 1NCDH 1D3CA 5F9WB 5JDJA 3P4NB 3BKYL 3ZO0A 4PJHA 2C4FU 1EAPA 1CFSB 1ITCA 2Z8RA 4P9MH 4F57L 3OKKA 2D7NA 2BNQB 1KIRA 3WYRA 2BVPA 4POYA 1IGYA 2XWTA 5EFIA 5IFHH 4YXLL 2DLTA 4NQCD 5IW6B 1JGEB 5DHVB 3GMRB 4I2XE 5EBGA 1LP9E 3L7FB 3VFGH 3OKMA 2UWEB 4R90L 3WFEH 1DSFH 2A6IA 2Y9RT 4NCDA 3ZYOA 1UG9A 2EDJA 5HHOE 3EFDH 4WW2A 3B9KA 3QR2A 5KSVA 2XIDA 4XPTL 5CCKH 1FRGL 2DWEA 1RZJL 2HA1A 2JCCF 3K1DA 1JL8A 3NFNA 4FXGA 2OTUA 5F88B 5FOBB 3CXHJ 1NH6A 3UPAA 2E7HA 3KPSD 4KZDL 3AROA 4LCUA 5IG7B 5E94A 2CLVB 2V5SA 4G80B 1NJ9B 1OAXL 4Y89A 1DUYA 5LG1A 3DVNB 4L1HA 4FFZL 1NCWH 3LS5L 3ARFD 1DBML 4FP8H 4Z7UE 4XPBH 1G7HA 4CUCA 2IEPA 5AZ2L 2R29L 4JO3H 1JPTH 2ZUVA 4HUMB 4G6KH 2AI0L 4ZNCD 4JZNA 4J3SA 1CG9B 3U79A 4JEGB 1UCBH 2IANA 3ARFC 4GKZA 1JE6A 2Q1EA 5CJOL 1FQ9C 4RMRA 1EA9C 1YEFH 3ARRA 1MPAH 3EYSL 3I9GH 1A21A 4JY6B 3MRBA 5D1ZB 1QPPA 4Y19D 5CINH 5MEOA 3ZTNH 1CK0H 1RZFL 1WAAA 4LVOB 4RFEA 4BK4A 3CZJA 5JOFA 5DF0A 2VDQH 5CJQH 5D6CA 4ZYKA 4KY1H 1P4BH 4JO1L 4K3DH 1FFQA 1IT9L 3ILPB 1RZIA 5KN5A 4FTVD 1SEQH 4AZ8A 5IF0A 3SE9H 3ULVE 1AXSA 4GRMB 5DVKA 1U2HA 2JE8A 1ZLUH 3SE4C 3L5HA 5JLZA 4RIRB 3TBVB 1NLDH 2DQTL 3UTTB 2B1AL 2DQCH 3ZT7A 4BSVB 4EI5A 5KVGH 5C08E 2EIZA 4IRZH 3VXMB 1UJTA 4OZFG 4DCQB 4QO1A 3KPRD 4LSDA 2HT4D 3CSBA 4MQ7A 3NA9L 1D6VH 2Y06L 1IKNC 3G5VA 1CL7I 4PJXA 4K94L 1LDSA 2APFA 1K9TA 4JANA 5CWSB 5E6ID 2HT4C 4ODTH 1O7VA 3U36B 3IF1A 2VZOA 2K7QA 5K33A 4JDZB 2V2XA 1VFMA 4OF3A 5AZEH 1ZA3B 2VC2L 2IH3A 4C57C 3PWVB 1IARB 4HWEL 4ZNEE 3EYQD 3MV7E 1FL6A 1KJ3H 4JM2D 2BRQA 5E6IC 3SDDA 2DTMH 1RJLB 2ERJB 4QRRE 1JN6A 1KV3A 1M6OA 1Q9KB 3UTPE 3D9AL 3MA7B 2ZKHL 2I07A 3UC0H 3EYQC 2PN5A 4JM2C 3MV8B 2Y72A 2NLJA 1H8SA 1L7IL 1T3FA 3MUY1 2DQEH 4XBPB 1ZKAA 2EDKA 4X6DF 1CGSL 2DMCA 3LHPH 3ZTJG 3THML 1BF2A 3TO4B 4PV8B 1A02N 1CZ8L 1QO3B 4H20L 2VDNH 3GM0A 4BYHA 1C5CH 5HD8D 1RZ8B 4OZHE 4OZ4B 2ICEA 4G6FB 3C60B 1YPZF 4FXLA 2C3VA 5GRVK 5EUOF 2OR7A 4X4ME 3A6BL 4OZGA 3ES6B 4K07A 5HD8C 3BWUC 1IM3B 1I1FB 3DTXB 4I3RL 3T0VA 4F58H 2N1KA 4PYGA 3KNBB 5D4QA 4N1HB 4LSSL 2I60H 2Y4SA 2QHLA 4X6BA 1KULA 4JDVA 3VDAA 2ZUQC 1GZPA 5DC9B 4GUPA 3MRQB 4H0HB 2AEQL 1IAII 2Y25A 1N2RB 5JORB 2WLYA 3L3HB 3FL7A 2VR5A 4CVZB 1FNLA 2ESVE 3LH2L 1LK2B 3DGGB 2MPAL 3JWDL 4RRPG 2GJ6D 4DN3L 1EX0A 2B8OT 4RBPK 1CWVA 4HX1B 4YPJA 1CDIA 2VZVA 4AIXA 2H3NA 1UA6H 3O2WH 5ESVA 1C08A 3TH3T 1X5JA 5HXMA 2OQJB 3SE4A 3X3FH 1T7XA 1U3JA 3QUXD 3O41A 1HZHH 4OZIA 1GGYA 5K9OA 1DUZB 1Z2KA 2F5BL 2CR6A 2NY1D 3T0EB 1U8JB 5E8PB 3GMNB 1KN2H 3BEVA 4P9HH 3BO8A 3QUXC 4ZUSA 1A6VH 3CUPB 5DHXB 1WITA 4QXTB 5C0CA 4FQ2H 1U8LA 4O02L 3BPLB 2NY1C 2VSCA 1I9JL 4HZLB 4OBRA 3B5GA 4PJAA 1UEMA 1N59A 1BFOA 2X1QA 4GG6B 3B83A 3ARQA 3FN3A 3DLQR 3NIGF 4QHLA 3MLWL 4N0YH 5DJ2B 5KANG 2AEIT 2QADD 4HAGA 5TQ2L 2CIIB 4ZFFA 4Y1AB 1XGYL 4CDHA 2X4QB 4LCCA 3MXWH 2DD8L 2JELL 5KSBE 7FABL 4Y4KD 3JV5A 3DXAD 1F8TL 4Z8FL 4LVNC 5FXCH 2QADC 3AU1A 1ROWA 4FQHA 5F7FA 1HH6A 1YY8B 2VDLH 2QJDA 4Y4KC 5C0AD 1WK0A 3IFPA 4KTEH 1M7DB 5AUMB 1VPOL 3IS1X 1JP5A 3A0OA 4HFUL 3LDBC 2W0FA 3EUUA 4KMTH 4H1LB 4GAJH 4MCYB 1AGEA 1E28B 4Y5XA 2AP2A 3JVGA 4DZ8B 1LEGB 3O0RL 1G9MC 2FBJL 5EWIH 3ZDXE 4TVSa 5DRZA 1GOHA 3SDYL 1DL7H 5T1LB 1XF2B 4OD1L 1S9YB 5EOCH 4EDXB 3RAJL 2CGRL 2OI9C 4O9HH 3G5ZB 5GIRB 4YHZL 2XA3A 5DJZB 5GRWA 3KXFB 5I15L 5DJAA 1ZVHA 3BGFC 5TF1H 5B38B 5GISL 4KKCD 5GQBA 4Q9QH 1UCTA 3OV6A 3WCYA 3AB0B 1I4FA 3VWJC 4OFDA 1CGVA 4OFPA 5F9OL 1YJDC 4BKLA 4WV1C 5I1JL 1MFDL 4AT6A 3MCKB 3LIZL 3MXVH 4UT7H 2R2BA 3BKML 4FHBD 2ZCKH 4KKCC 4YFEA 3RZWA 3ULUE 2P47B 4ORGB 1PAMA 5FM4A 2XFXA 3ZE1E 2ATPA 3GKWL 4WGVB 2P5WA 3RWJA 2E27L 4KUZH 3L3IA 2AJUL 1FAIH 5A2JH 1TJHL 3PDOB 3OKLB 3IJHB 5EC2A 3BDXA 1J18A 1VGKA 1B2WH 4XX1E 1ZGLM 1SJHA 1FORL 2A77H 4R2GD 2LFGA 2Y36L 4ETQA 3QDGA 2GCYA 1B4JL 4DKFL 1BAFH 2AGJL 2LU7A 4E9LA 1X7QA 3MNWA 3L3OB 4NKMA 3U1SH 4BZYA 1PD6A 2DQGL 4HCRA 3SDXF 2H6PA 4R2GC 4B5EA 4ZPVA 4FQPA 3ZKSD 4NKOB 3UO1H 3JV6B 1GGBH 2YC1A 5KJRL 3EDKA 3SPVB 4PRAB 4E5XA 1R3JB 1W8OA 2XZAL 2M8XA 4PJ7F 4A2MA 2FLBT 4ZOBA 1CL7H 2BNRD 3N85H 5JUEL 5T3ZE 3HMWH 4Y5VA 1S7WB 4EDWL 5DA4A 4NO0B 1I8KB 3C6LA 4M3KB 4X4YB 4LARL 4TOYL 4NJAL 1PG7X 4F33B 1BBDH 2JIXB 2PO6D 3QULA 3RWIB 3I3BA 4LMQE 3ME0A 3T2NL 4GKOA 3CDGB 2P24B 3BP7B 3VFUB 2EKJA 1IGJB 4BUGA 2PO6C 3U46A 3ARD