2NY2D

Hiv-1 gp120 envelope glycoprotein (t123c, t257s, s334a, s375w, g431c) complexed with cd4 and antibody 17b
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
228
structure length
221
Chain Sequence
b'EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
molecule tags Viral protein/immune system
source organism Human immunodeficiency virus 1
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
total genus 50
structure length 221
sequence length 228
ec nomenclature
pdb deposition date 2006-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny2D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny2D01
3RGVD 2AJUH 5ADPL 1G7JA 5IFHH 3MXVL 1PG7H 3N85L 5L88L 4OGXH 4O2EA 2ATKA 2LAAA 4S10A 4WUUA 4W70A 4KJYB 5INDA 5IB2B 4PJ9B 1KTRL 2NQCA 2VQ1A 4X7DC 3QEHA 1EV2E 4JN2B 1FG2A 2IAMD 3FO2B 2VDKL 4K3EH 4OZFB 5IB5B 3VXTB 1ZVSA 5K9KA 2F74A 4PJGA 3C2AL 4NN5B 5IEHB 2BXZA 2KZWA 5L7XL 1L6ZA 1QFUH 3VCLA 3BGMA 1T1WB 3HPJB 5BVJA 43C9B 1CLZL 1UA6L 5GRUL 4GW1A 5ESAB 1W0WB 3BKML 3DMMC 3EBAA 4NCC1 4ZOAA 4NN6B 4Q97A 3O8XB 4E41A 1H0DB 5GZND 3EJYD 4PJ8D 4NRZB 4OM1H 1JZ2A 1U93B 1AIFB 1RZ7L 4G6ML 3LD8C 3BVNA 4YR6A 1KXTB 4L3EB 2HKHL 1NBYB 5F7WC 3RZCC 2NR6D 1T1ZA 3STLA 3MLUH 4G9FD 1E28A 3IJHB 4M03A 4ODVL 1L0QA 4GRWB 3L6FA 3PV6B 5LXGH 4LPUA 3QQ9D 4MXQD 4MDJB 3MV9E 1BEYL 3HLAA 3SCMD 2O5ZL 4XPBL 1T5XB 1XF2A 1G7IB 1ZHBA 4HS3B 4Y7MA 5GSVB 5JIHA 2VZ3A 1EPFA 3KJ4C 3C9NA 3MMEB 3D25B 1B2WH 2QEJA 1NFDF 2DQGH 3W9EB 4FABH 4HGWB 4DUXA 1A6AA 3MBEB 5FO8B 1C8PA 3IFNL 3TVMB 1D5BA 5DFTA 4PJDE 1P53A 4I5BB 5T5FL 5C08E 1U8IA 1MQKL 4Y4FD 4WW2C 3O6LL 1HCVA 1SHMA 2AEPL 3SJVE 3FB5A 4CGTA 4DKEL 5K9JL 5JA9A 3G6JF 4MA3B 2AABH 4OGAD 5I15L 1EJ6A 2V5YA 4FP8H 3PGCB 4FQJH 4ODHL 1U58A 4OJFH 1F4XL 4JY6A 4PRBB 4P5TA 3TBVA 4PB9L 4MJIB 1WIUA 3B9AA 4IRJB 3F8UB 1DQJB 1JF5A 2VAAB 1BHGA 4BQ8A 1CICD 4WV1A 1JV5A 5J56B 1RZFH 3QUZD 1QPXA 4LSUH 1FLTX 4P48A 1DANU 4YHPB 4YJZL 2EEAA 3SDYH 4PTTB 3OKNA 2WINA 4XXDB 5HYSA 1EO8L 1LNUA 5DUPL 5D1XD 2XA8H 5GGTA 3DMMB 4RFOL 4K3EL 4PV9A 2J8OA 3S5LA 4RDQG 1AHWC 1QRNA 1IGTB 2J6EL 4RRPA 4CRPA 3VXPA 3NCJL 4NKDB 4OF5A 3ALXA 1KYOK 1B0RB 1W72L 1J8HB 2EIZB 4RGNB 2HVKA 1EIBA 2OR8A 4YIQA 1UZ8A 2LV4A 3TO2B 3G5ZA 4KAQL 1XGTB 3G5VB 2I60H 4PJ8B 3MV9B 1VKXA 5EULV 5HHXL 4J12A 3AB0C 3P4NA 1CDGA 4X9IA 3R1GL 5DJYB 4HKZB 1W0YT 2PYEB 4KDTA 1QLFB 2OP4H 1FZOB 4IEFB 2PTUA 2B2XH 1MAML 3RZWA 4N8VB 3MLXL 3VXMA 4YXKH 3UDWA 1MWAA 4ISVB 3ECBB 5I1CH 4L3EA 4BUGA 4W6WB 4X6CE 1A6VL 4JJ5A 1C5DB 4GSDL 3VFUB 4Z76A 4HUVB 4U3XA 4PJ5D 4NKMA 4EI6A 6FABL 4BKLA 2Q8BH 1MHCA 5E6IA 1XGRB 4ZUUB 2EXWD 3SCMB 3QDJA 1SJHA 5HGHA 5GGSY 2R0KL 5BVJB 3SBWC 4Q74A 2E27H 4DVBA 2AJYH 1YYLH 3P0VH 4Y16D 4ZUWA 1A7PH 4AG4H 5C8JB 1D6EA 2NY4D 4YAQB 1UKQA 4ZXBB 2GY7B 4H25A 4FQXD 4U4BA 4YHZL 2Z4QB 4OLXL 4MJ6B 4O4YL 1OSZB 5IMLA 3KYKL 2F19H 5D7KD 3KS0H 4POZC 2X1XR 4R0LB 5FYJL 2O5XL 3TH3T 3RIFF 1ORSA 4QF1B 4Y4HD 3AY4A 1A5FL 1ODAA 2P8MA 3TV3H 4JO3L 1ZTXH 1LO4H 4ORZC 5HI3D 5EUOE 1MCWM 2XWBA 4KGJA 1FFNA 2DD8L 1JNHA 1N4XL 4PJXE 4FMFA 3MRQB 4X4ZA 3KPTA 2HA1A 4LPWA 1KG0A 5LQBL 4XC1H 4NQDB 3UAJD 5IM7A 4XVSL 2YD6A 2V17L 3IXAB 1YUHA 1D9KC 2C1OB 3SDXE 4L4VD 4DTGL 2DM2A 3ZKMC 1TMCB 2FLRT 2GSGA 3DRTB 5F9WC 4EDWH 5JR1H 3T3PE 3CFDA 5IBTL 1B9ZA 5L6YL 4NZUH 1MWAH 1T1XB 3WS3A 1N5YH 5F6HI 3NIGE 3HC4H 4P57A 1AD0B 1ED3B 3OTTA 3EYFA 2DI9A 5GGUA 4CDGC 1Z9SA 3SO3C 4X4YB 2YUVA 4Z7QE 1B0WA 4PRPD 1FCGA 3K74B 2YUXA 3D3VB 2F19L 5DRXB 5I73C 4QO1A 1RULH 3MBXH 3SKMB 1KCVL 3QEUB 3PDOA 1MAJA 3LHPH 2CR3A 3MRQA 1OWRM 3TBWA 2FECI 1VACB 4MJ4A 1TETH 3DTXA 3C8DA 2X4PB 5FM5M 4DOHE 3MGOB 3VXRA 4WV1C 3KG5A 1DQLH 1AJ7H 3DVGB 3RWHA 1ORSB 4GMSL 4QF1A 2VR5A 5IR1B 4L9LB 2QQNL 1H8NA 3T0ED 2ARJA 3MOAL 4AEHH 4BQ9A 2MHAB 5DZLA 1KELH 4A6YH 3FOLB 2JCCA 1WWBX 4RSVA 1R5VA 5DLMH 2QQQA 4JHZA 5I0ZA 2O93L 4QRQA 3DVNB 1MJ8H 4L3CB 4JFXB 5E8DL 1HXYA 2XA3A 1TVDA 1X5GA 1DR9A 4Q7DA 1DBAH 5F93C 4LOUC 1JRHL 1V3JA 4P3DA 4TUJB 4JKLA 4NQDE 1VFBA 5ENWB 2H6PB 5CBAB 5CEZE 4NQEE 4BFGA 4XPAH 1ES0A 1LO0H 5E08L 2KQNA 4HUVA 3L3JB 5IBUB 4ZFFA 4IRZL 3DTXB 4LOUD 3D39A 4ZOBA 4TNWF 2G60H 2N1KA 3IB4A 3UTZB 1Q72L 2J7LA 5LQBH 5KOVC 5FOJA 2DQJL 2Y36H 3WD5L 5KVEH 4K3JL 1KCLA 4Q58C 2DIJA 4XBGB 1BVKB 4U6HA 4HK0A 1MIEL 3WSQH 3RWCB 3MX0A 4QT5B 2A0LC 4KKLD 1OP3K 3HS0B 1J5OH 3O2DA 1JWSA 3HMWL 3QCTL 5E1HB 1AGFA 1AD0A 1ED3A 1YJDL 2DLIA 2IMMA 3O0RL 5GHWL 5LCVH 2APVA 1I1AA 3IAPA 4G3YH 3VH8A 2IAND 4FQ2L 4JFZH 2C3GA 2CO7B 3MOAH 4ORGB 2I24N 4TSBL 4NN6C 4OZIB 3MGTB 4P2RB 3C6LD 4CN6A 1ONQA 2V2XB 4WDIA 1RZFL 5D7JC 4BFIA 2D9CA 3SHSA 4P2CG 1WFNA 3MC0A 4OLYL 5D5MA 1RSFA 5B22A 1A1MB 4K7PH 2EKSB 2A73A 4PV9B 5HI5D 1MCPH 3A6CL 1S5HB 4DCQB 4P4RA 4OI7A 1Y0LA 1A1NB 1OAZL 2PXYB 1QBBA 1YEJH 32C2A 4GRLB 1VGKA 2JJUA 1S5IL 3DYPA 2ZOLA 4TQEL 3V6OC 4F8QA 1KOAA 5MEQB 4ZG1A 4UT9H 3W11D 5JIIA 3BEWA 1A64A 2DKSA 1DQJA 2NY4B 2UWEF 3G9AB 3GK8L 3ZKQD 3BMVA 1UB5B 4ZXBD 2EECA 2XT1B 4EJ1C 4MJ6A 1MIEH 4UNVA 5GS0L 5DMKB 4MD0A 4XPTL 1VFUA 5ESQA 3Q3GB 1FPTH 2B39A 4NC0B 4XMPL 5DEZA 2QHRL 3QFDB 2RHEA 1AGDA 3S88L 2EH7H 3MO1A 1YPZA 1WZ1L 4LLAA 2HMID 3BN9D 4U6XA 4PYHA 1X5JA 2HT3D 2VWEC 2VLJB 1FVDA 1NEUA 1MFAL 4PY8J 2AK1H 1N64H 4PBVC 4PJFA 1PYWA 4WO4C 4Y5YB 4M48L 1RHHA 1A6AB 3MBEA 4R2GD 4Z7VE 3UJTL 4S1RL 5FO8A 5IMKA 1MCRA 3R06B 4BZ1H 3VXQB 1YEIH 1DFBL 1GVIA 1KCRH 4Y2OA 4EN3A 4ISVA 4RMRA 5GIRA 2FIRT 2XKNA 3HA0A 1T5XA 3VFRB 1F5WA 3BKMH 5DI8A 5IFJB 2DM4A 3W0WD 5DEGA 2OTWB 1R24B 4WW2A 4Z0BL 4UILH 4PJAF 1B4JL 5GS0D 2IQ9H 5I74B 4RFNB 3BYYA 2EE6A 1BMGA 2X9YA 4PBXA 3ROOA 3KWWA 5A1AA 2IALA 4KQ4L 5FUZL 3S4SA 3L5IA 1PX4A 3BP6B 4MQXD 4KRPD 3P4NB 4YR6B 2IG2L 3OX8B 5EO9B 2H32H 3QG7H 3IDXL 4MYWB 3V52L 3VDBA 2BVPA 3RUGA 1R3LA 1X5XA 4YHLH 1UYWL 1LMKA 5FYKL 3NCMA 3RVVD 1G9MH 5FYJU 3HI6H 1TPXB 3BGMB 2P5EA 4P9HC 2CXGA 4JM2A 3C60D 3MUHL 5F88A 5TE6H 3ARFD 4NKDA 5HGDB 1MNUH 1TJHH 5K9KB 3EYVB 5E2TL 3OF6A 1A7NH 4XB8A 4YBQD 3X11A 1MPAL 1A6UH 5C6TH 4IDLA 4TUOA 1MQKH 1X5IA 3STZB 1IGJB 1S7TA 3MRDB 1MFDH 1UWEL 3CX5K 4WUUB 4MA7H 5T1KA 3MRCB 2H1PL 4I18B 3OKNB 4UOW0 2ADIA 1VA9A 5HI4C 1PX3A 1CXEA 2UY6A 1N0LA 4QHLB 2GITB 3UX9B 3VXSB 4JQVA 5JW4M 3WFHB 5SWSA 1EBAA 2J5LB 2Y72A 4NSKA 3BHBB 1NUGA 2X40A 3D39E 3H9ZA 3QUXD 4U6VH 5CZXD 2X4UB 1R5IB 5I6XB 4XX1E 1Q0YH 2ZSWA 5H35A 2NX5D 1XAUA 5LGHH 3QXDB 4C56B 3UJJL 3QEQE 3P30H 3UJIL 3QQ3B 1CFBA 5FDWA 1I1YA 2IADB 1UZ6F 4ZFOL 3D1MC 3RY4A 4R6UA 2XFXB 3G04B 4XHJC 4WFED 2UUDH 3IFOB 1P84K 3RY6C 5IVNA 3QDJE 1S7UB 4ODVH 5C0BB 4TTDC 3MOBH 4I8DA 1VESA 2CIIA 2EDXA 3MLSL 5DD3L 2FX7H 3MCKB 3QZWB 3NIDE 5KSUA 4PRHB 4R3SB 3WFBL 1N59B 2CSPA 4JN1H 5KS9E 4HX1A 2OQJA 2W92A 5HHME 2YOCA 4UDUB 1T21B 1R0AL 3KYOA 1IJ9A 2GUOA 3NMEA 5F6HJ 2FATL 2YD8A 1RIHL 4I0PC 1I7TA 4Q9RH 5I71B 3EJZD 1NBZA 5JW4N 5ALCL 3MRPB 1OB1B 3N1FC 1WFOA 1KLUA 5HDQL 2BC4B 1T66C 2YA1A 1K6QL 5ID0A 5IMMB 3QXAB 1NCAH 1YEKL 2GSIA 4NUJB 1EFXD 3GSQA 5EA0H 5DEFB 5I8KL 4XMLH 4NRZA 4R8WL 4IIQB 4WWID 4C56E 3CFIC 3IAQA 4S2SA 4OZHF 1KTDA 1S3KH 1CI5A 1K5NB 3QUXB 5I1CL 3U30B 4MNQD 2H2SD 3BDXA 4NZTH 5J13B 4LVHB 3U7AA 5HYQB 2DBJA 4ZO9A 1KJVB 4KK9D 1K8IB 2VN4A 3VXSD 5KSAA 4PGDB 4ERSL 4NQCB 3C5ZA 4ODXA 3V4PL 4Z7OE 1NKRA 3E6FA 3MBED 3QEHB 3ARVA 1BX2A 1KN4H 1HILB 3I02A 5KVGL 1JGDA 3OF6D 1WJ3A 1RJYB 5ABDE 2E27L 3QA3A 1Q9WB 5H8DA 1BVLB 2HFGL 2F9BT 2LU7A 5JXEC 1DSFL 5K59F 1T0MB 3WUWB 1CR9L 5K9OA 3MV8D 1I1FB 4P2OD 4XPGH 1K3IA 4HHAB 5E2WL 5JQHC 4BH8B 3PGFL 1T03H 1CWVA 2IPTL 2BHZA 4LNVA 1NCUA 2FYYB 2BK8A 2P7TA 3NH7L 2QQLL 2O61A 1IZJA 2ZOKA 4M02A 2R4RH 1M7XA 4LBEB 4G6KL 4MB3A 1I9JH 2Y23A 1YA5A 4OZ4A 1CZ8L 5J1AB 3U2SB 3B6SA 5IVXE 4YK4B 4TN9A 1H3WM 2YRZA 4YHML 3N9GL 5C7XH 2NTFA 3ZYIA 4M5ZL 1JWUA 4XC1L 1EEUA 2E7HA 3L95A 3MQIA 2A6JB 3IDNB 2X70A 4WEBH 3BT2L 1NAML 3THML 5KZCD 2X4SB 5DYOA 2R56L 2DS4A 3UTSE 3NIGF 4WU5A 1SYVB 2VLLB 1G7MA 2I27N 3QRGH 5F96L 5DHVB 4JVPA 3HR5A 2VDRH 1CFSB 2OR9H 4LCWA 4WTZG 4YHYB 7FABL 2W65A 5J11B 4JG1H 4M1DL 5F9OH 2N56A 3V9FA 4D9QE 1NEZB 5GGVL 3V95A 1OY3B 4WI8A 4FMKA 3RWJB 4PJ7B 4LSVL 3E3QE 5KSBB 4WGWB 4OZGE 4RIRA 4DVRL 3C6LA 5C9KA 1T2QH 5IJVA 3VGGA 2Z93A 5D70L 3KHQA 5E00B 4PRNA 2I9LB 1VGEL 1FGNL 1NCBH 4X6FA 1YMME 5BZWB 3PQYD 1G7MB 4YPJA 4W68A 1I8KA 5JORB 3LKNA 2M1KA 4QRTB 1MJJA 4P49A 3PQYB 3FCTA 5DYOB 4EUPG 1F97A 2JJVA 4PGCB 5IHUH 4LEOB 5JO5B 3CXHJ 2VLKA 5SWZB 1G0XA 2CR6A 2VXVH 4NQVA 3N06B 3J8F7 4BZ2H 4D9LL 2FGZA 2NTFB 4WHTB 1E6OH 2XZAL 1JYNA 4HG4K 2J4WL 2GYSA 3FT3B 4KDVA 5DJ2A 4RA3A 5IW6A 4N8CL 3ARPA 4YPGA 5CZXC 5IK3A 3MRFB 3QCUH 1QO3B 1ZK9A 2GJZB 2QSVA 1A21A 5B4MC 3NCEB 2JK5B 2DLFH 3CPLB 5EU4B 2H2PC 4I77H 3I50H 5J4MA 2WLZA 1CGXA 4BSWB 3LKPA 1ULVA 1Q9OA 1I3GH 4UB0H 2ITDB 4Y5XC 1ZT7B 1Q9OB 1T5WB 2VIRA 4BSWA 4F7EB 2VLME 1ZGLP 3QH3A 5E0QA 4U7MA 3JUYA 1OLZA 2DJSA 1QFWL 1WAAF 4E9LA 4DOHB 4K9EC 4NKQB 4MD5B 2J3SA 3MJ9A 3TCXA 3L5XL 4HV8A 5SWZD 1CTOA 4QHKI 1FFQA 1AO7D 5DHYA 4Y88A 4FRWA 1P9MC 3VJ6A 2FX9L 4OSUL 3TFKC 3S36X 3T04D 1JZ5A 2GIYA 4HSQA 1JMZA 3PWJA 2YKLH 1FNSH 35C8L 4PJHF 1SY6H 2VITB 2ZUYA 2KBGA 4HJGB 2HRPH 3FRUA 2GJJA 2AGJL 4NQTA 2R2EB 4JRXE 5EZJA 25C8H 5C07B 4Y2DB 5BZWA 2AK4D 3C5ZC 3UBXA 5BOPA 5DEFA 3SGDI 1QLEL 4PP2A 3MV7D 3MACL 1XR9B 1C12A 3DIFA 4Z5RB 4O9HL 3RNQA 3RTQB 3ULSB 4UI2A 4AQOA 2MCPH 1LILA 5FXCH 3FFDA 1NCBL 3UTQB 2MQ0A 2IH1A 4JRYB 2HT4D 1BLNB 4WW2F 4LCWB 3DI2B 1MAKA 3RU8L 2D4FA 2VXUH 2HG5A 1UZ6E 3K2UH 4PLJC 1UB6B 4LASH 5ID1A 3WXVL 4I18C 1SEQL 4ZQKA 4NM4H 4LL9A 3SGKC 3GMPB 2ATPA 5I1AA 5HJ3A 4APQD 1YY8B 4HH9A 5HY9B 4NRYB 2NY2C 4UT9L 4E0RA 1ZKAA 5C0BA 5BO1H 4OCXH 5HVGB 1E6OL 2XZAH 4HZLB 1OARL 1A6TA 3VXNB 5L0QC 5IQ7H 1RUKH 3QIUC 2VLMD 4OLUL 2MNUA 3L3DA 3SN6N 5FHBL 3C6SA 2ADFH 3QWOA 4RMWA 4IRSB 1AE6L 2WW8A 1H5BC 2WAHA 1G7QA 1LWRA 1MFEH 2IADA 2CDGB 2UZIL 1LEKA 1Q9LA 1AXTL 2W60B 3EFDL 5BXFB 4G5ZL 3ZE0F 1MJUH 2ZOKB 3H9SD 3TYGH 1WZ1H 1NBQA 4X7CC 4R4NC 3GHBH 2ZSWB 1L0YA 1BF2A 1BM3H 1D7FA 4KHTH 3WNLA 3DYMA 4OQTH 3S36L 4EOWL 5AD0B 4OLWH 3MRGB 3F62A 3SY0B 2L0DA 4HG4J 3V7MA 5HI5C 3HRZA 3QPXH 1EAPB 2F54B 4JREC 3BKYH 4X8XA 4X0KA 3WFHA 3W82A 4JRWA 1A22B 4Z7WF 3D85D 4G43B 1HNFA 1AFVL 2BHYA 4LVEA 5I1DB 4MD4A 1RJYA 1C08B 4PJIE 6FABH 4NCC2 4XBPB 3BH8B 3RU8H 5L7XH 2G2RA 3AREA 4ENED 5F7EH 4XVJH 3DURB 5FUZH 4HT1H 4K3HA 4JFED 2YD5A 3GMRA 3I9GH 5FM5O 4UAOB 3X14B 5DK0B 1J0YA 4X5XB 4JRXB 3NIFE 2JTDA 5EO1A 1HXMB 1JYWA 4ELMB 3RUGB 5I9QC 3U36B 3ZE1F 1CCZA 4E5XA 4QWWD 4JFFA 3WEXA 1DQQB 5EO9A 2EEBA 4PGEA 2NZ9D 3IU4L 4RMUA 4FFWD 1BAFL 4J7RA 5ID0B 4X4XB 5CGYC 2JJWA 1V7NL 4RGMC 4XTRD 4UAOC 3DMMD 4AY0A 1CD9B 1DBKL 5DXWA 4FXGA 4WW2B 3GJFK 4LNRB 3QFJD 3TN0B 2DQGL 4P23B 4DW2L 3B9KD 4LASL 4ZPVB 5LWYL 3MRGA 1DVFD 1NCDH 5J6HB 4X4MA 4XCYB 4KTEH 3OXRA 3TC9A 3WHXB 2D31B 1BD2D 2HLFC 4FG6C 5CEXB 1CGTA 4GG8A 1QNZL 3VFNA 5I66B 1AXSB 3SBWA 3IU3B 3L3IA 1G7QB 2VH5H 3QWQB 4AENA 3RVXC 3QWOB 4GRWH 4YHIA 2DQUH 5D1QA 4I0PA 2J88L 3T09A 1DFBH 4MNQE 3QDJD 1QFWM 1E4JA 4DTGH 3KXFA 3FAWA 5BZDB 2WV3A 3T1WA 1NC4B 1TVHA 4Y16A 4OD1L 3CLEL 3HNTH 2AV7B 3TYGL 5K93A 5J3HD 4MAYB 5EOCJ 2XN9E 3GMPA 4AEFA 5SV4A 1LP9B 5CJ5A 3D9AH 4NDMA 4RGMB 1RD6A 1U3YA 2NY3D 4OCLC 2PTTB 3F7VA 3HN3A 4WUUD 5T1DL 4K3DL 1UCBL 4KXZI 5CD3A 5MEQA 4KMLB 1IM3A 2FSEA 3CXDH 3MRBA 3O6KL 4KI1A 4NSKB 1HKLL 4XVTH 1CGVA 4U1LB 1RVFL 1N3NA 4LLYB 1NGWA 3AROA 4LCUB 5JUEL 2Z92B 1CLYH 1RI8A 1E4XI 2AI0H 3N0PB 4WWKD 2ICEA 1UACH 4Y1AE 3ILPA 4ZNEA 4XPHL 3W0WE 3EZJB 4TUOB 4PTUB 5IQ9B 2VR9A 1D9KA 3UTOA 1W72H 3NFSL 4EN3C 4MDIB 4ZDHA 4NWTL 5TGBB 3GMOA 2QTEA 1JGUL 4NO3B 1JIBA 5IWLA 1HE7A 4G8EB 1FAIH 1P4IH 5DJ6B 4D94A 3BAEH 4WWKC 4NBYB 2DYPA 4KRPB 4QTHA 3FRUB 4XVUD 2K7PA 3LN5A 3B4NA 1JBJA 1A1OB 3RJQB 3H3BC 4LSSH 2F53D 1HH6A 5F8QC 2DM7A 5JOFA 4P46D 3TGXA 3GJFH 3L3KB 3ARYA 4V1DB 3UJJH 4J6RH 3RPKA 1KB9K 1JF1A 2BDNH 4P59L 5F21B 1KN2H 1G7PA 5SX5K 3FHQA 2AJXH 4YH6A 4J3WA 2LVEA 3VFMA 1Z6JT 3LRGA 2ITDA 2ZCLH 3D39B 1CLCA 1QR4A 3VXQA 3VXUD 2Q7YB 5HDBE 3LKPB 2EH8H 4U3CA 5FO7A 5D5ME 3EYOA 4N5EC 2EICA 5BRZB 5EWIH 5I1IH 3QUMB 1GC1C 3IJSB 2DQUL 4LU5L 5IJKA 3EDFA 2Z0BA 4G6JH 1FZKB 2R23A 4XNXH 4JFEA 2EYRB 2QSCL 5ECJE 1YPZB 2P46B 3TCLB 1KUMA 2P1YA 3E2HC 3QI9C 1PAMA 1R3HB 1FE8H 1SJVA 1WUNT 4PGCA 5HYFA 2MHAA 4BK4A 4F7TA 1UB5A 3I3BA 1TJIH 4OGYH 4PJCA 3HPLA 3CK0H 1MVUA 1ZHLB 1O0VA 3FT4B 4JM2D 2ZOLB 3DV6B 4R90H 5J0BA 5GS1B 3S96A 3QNZB 1HQRB 4MNHA 1R6VA 3L5JA 3BGFC 5KG9B 2IWGA 5I18H 3F5WB 2CJUH 5DWUH 3K46A 3QEUA 4R9HA 3SKMA 1HIML 2A73B 5A3ID 2PW1B 1Z9OA 1QOKA 4IBLT 3NZ8A 1ZLSL 4HEME 2VE6A 4PP1C 5GS1C 4QXTA 3KGRA 4MQXC 1A7QH 43CAB 3U0TA 4YDJB 1AKJA 3VFOA 4OJFL 1BQHA 2ZZUT 4HPOH 1OGTA 1UADC 4X80L 5KN5B 5LJYH 1N0XH 1FV1B 1FZJA 4KUZL 3X13B 1J7VR 3HG1D 3S36H 1WAAA 2F54E 5IB3A 3QIBA 2BJML 3MTRA 4XAKE 2CIKB 5E4IA 5T3ZD 2SEBA 1A9BA 3RWCA 1EVUA 2DJUA 4LHUG 2WP3O 5F7UA 1TJIL 4GRLD 4I0KA 4OT1L 3FOMB 1F6AA 2IBZX 3O3AB 5A2KH 8FABB 1JTOA 4N9GB 3UTSD 1MOEA 3KPMA 1B90A 1OAXL 4R26L 2BVUA 1NCTA 5DQDL 3JWNC 5KVGH 1T6WA 1IC7L 4EUPA 2EXYD 4ZNCD 3BZEA 5ITBH 2O5ZH 5CMAA 4BA8A 5ILTL 3PP4H 3EGSB 4JZJC 4KJWC 1MIML 2DWDB 4HK3N 1S7SA 4XC3H 3NTCH 2QSCH 2YD2A 2R56H 4U6TA 3PWPB 3B5HA 3DX8B 5KSVA 1EO7A 4PRIA 4G6MH 1AGBB 2Z4QA 3H6JA 1XT5A 3PWPD 2ZUQC 5EN2A 1BX2B 5BV7L 3P3YA 3TEUA 2XZQL 1IM9B 3IDGA 5FYKH 1M1SA 4NQCA 4AL8H 5A16A 2YPKA 2XACC 2JCCB 5JPMB 5JW4Q 1HWHB 4JQXC 1CZ8H 5IOPB 5DF0A 4QCIB 2UVEA 4XRCA 2J8UB 3RA7L 2W9DH 3UROR 1NGYB 4KV5F 3U7YH 2B2XL 4IS6B 2GK0B 4OCSH 4HWUA 5FGCE 3TJEL 4J3XA 5EIIA 2MKWA 4IIQA 3BGAA 1RJLB 1INQB 2E9IA 1WCBA 1Z2KA 4QNPE 1Q1JH 1X7QA 3MROA 5E8NB 5D6CA 2GSIB 25C8L 5IMMA 2CJUL 5DWUL 3QPQC 1OM3L 1MWAB 3KHOA 3QSKB 4JZNB 3GUTA 1IEHA 2CLZB 2HN7A 5KANI 3TFKD 4LPCA 1CF8L 4HMDA 3O6FD 4CBPA 1AXIB 1A9BB 3LPWA 2CDEB 2OMBA 1CQYA 1NDMA 4XVUC 2VDPH 5DJCA 4PRPE 4AG4L 2D7PA 2F15A 4F80A 1FZJB 1Q0XL 3OL2A 4PJXF 4ZUVB 1T1XA 4UQ3B 4KY1H 4PREA 3MXVH 1DJSA 3OR7B 2GSGB 5IT2L 5F9JB 1TFHA 1NUNB 2XFXA 1INDL 3G04A 1I3GL 1ZLWK 1OF2B 2AERT 5D72L 1TZHB 5HHXH 1MCKA 4BH7A 3P2TA 2ZJSL 1HHIB 3BO8B 4PLKD 1F8TH 2DOCA 1L4IA 3L3HB 3LV3A 3O6FA 5FCSH 2P8LB 4BQBA 5F9AC 3AUVA 4D9RD 2XKUA 4Y2DD 2FR4A 1WIOA 4LARH 5GRYA 3PQYE 2W9DL 5TDOB 1NGZB 1U8JA 3BEVB 3FQXB 4HUXA 1U41A 3FB8B 4O51B 4MNGE 1S8DB 2ADFL 4GFTB 3L5WB 5EZIH 5ILTH 3HNSH 2NY5H 2CUHA 4TUKL 5C0EB 5JOPD 4MCYB 2I5YH 3AY4C 4KRNA 3U7WH 5ACMA 5FFLA 4AYFA 4HXAL 4YE4L 1ZHLA 4JFYA 3ILQC 4OIBA 4YXHL 4QHLA 1CU4L 3MV01 1A2YA 2ZCHH 2C9AA 3MNWA 2CO6B 1JTPA 4F9PC 3VGHA 3X11B 2E9BA 3BX7C 5ADOL 1UM4H 2XRAL 3IRZA 3P4MB 4S0TD 1NCNA 3V7AG 3N1QC 1X6LA 4YWGL 3DXAE 1J88A 5HGDA 4KC3B 2Q8AL 5J9PB 4DN3H 5F88B 3FZUD 1IAII 1WTGT 3QWRD 3TZVD 4F33A 2BP3A 1G9NC 5EBLB 3D39D 1SJHB 2MCPL 4JFFD 4JPVL 2YPVL 3WDJA 4QHNA 1XGRA 1R3LB 2Z31D 2R2HA 1CICB 3PWPE 5FO7B 3W9EA 4HKJA 3K8MA 4JJ5B 4WU7B 3MNZA 4Z77B 4HWZB 4HEPG 1ZLVK 3EUUA 3BISA 3QQNA 3BWAB 3RAJH 3QDAA 3ROOB 4FFWC 4JFHD 1QR1A 3MUY1 5B21A 2FB4H 2Y9RT 3WL9A 2Z91B 1R24A 4D0BB 4V1DA 2B4CL 4P5MA 2PYEA 2E7LA 3HNSL 3VFRA 4NJ9L 4OQTA 1EEYA 2GAZA 3SKOB 3VXRD 4N9OB 4YHZH 4HXAH 1X5LA 3BVNB 4IMLA 3MRJB 4LKCA 3VXUE 1B0GB 4ONGL 3GHEL 1RHHB 3MLVH 2VN7A 1GIGL 1PYWB 3MXWL 1RZ8A 1RUPH 4G6KH 5IT2H 4YBLB 3R0NA 3AM8A 3U4BL 1WC7B 5DJ6A 4QNPF 2V2WB 1A3QA 5IEHA 1U8PB 1IM9D 1F8TL 2AVGA 1IC4L 4FXKB 1D9KB 2OCFD 4TSAH 3PV7A 5C6PB 2ZG3A 3FFCB 3VXMD 1FG9C 1M05A 5J06A 4LSTL 4QRUB 5JXEA 5ICXB 3F65A 3QFJA 5EZIL 3DOSA 4JQXA 5DR5L 5CZVL 2V5TA 5DT1L 1EXUA 5I1KH 4MA8L 4NNPL 2CGRL 2NY7L 1QFWI 2RGSA 4X4ME 3SDCA 3IRPX 4WV1B 4I3SH 1HI6A 2Y5EA 4EVNA 2L4OA 4JB9H 1AQKH 1IGYB 3O2WL 3UXFA 5IVXA 2G5BB 2X4QB 1MHHB 3V4UH 4P5TB 3TBVB 4G9FE 2OP4L 3WS6A 3ZDXE 2XWTB 5E9DA 3ELAT 2PETA 5J89A 5HGBB 2UUDK 1JNLL 4ZUSA 1ZE3C 3EOAB 1RK0B 2BVYA 3D3VE 3GM8A 4FTVD 3LKQB 5D1QB 3NOIA 3ZL4H 4LLQB 3BSZH 3UMTA 4GXVL 4U1GB 5F9JA 1NQBA 1JF6A 3GMNA 3ZKXB 2NR6C 4OT1H 1MY5A 4KKBD 3PHQB 1I8MA 1JRHH 4ZUVA 1B4RA 1F13A 2CXKA 5DJZB 5D7SL 3TO4D 2ZUUA 1WZKA 2MFNA 3AREC 2DWEB 3QJFA 2RJMA 4NUGH 5DK2A 4QT5A 4K23H 1YNTB 1HQ4B 5A2JH 4JZOB 5E2VH 4MNGA 1JZ7A 1ZAGA 5F7YC 3JV4A 5BS0A 5BW7A 4OF7A 2WIMA 1CFQA 3VRJA 3G6AB 4YDIH 3UTZA 1MF2L 5JR1L 3QAZC 4WI3A 3TLRA 1CTNA 3MRNA 5E8NA 1IVLA 2DMBA 3L3JA 3MFGB 1CD0A 2NX5B 4ELMA 1L9MA 3TBYB 2K3TA 5CILL 4X5XA 4Z95H 2AJXL 2H32B 1PEZA 4KZDL 5DFWH 3P9WB 3OGOE 4HIHB 3NPZB 3SJVD 3VCLB 3GMRB 3ZHDA 1BZ9B 4MX7A 4RGND 4RWHA 3VFSA 3I6KA 3U9UB 1LQSR 1TPXC 4KI5E 1IM9A 1OL0A 1A8JH 1KJ3L 4JCMA 4U1KB 4OKVA 4XNYH 1PDKA 3QEQD 2VQ1B 3TZVB 3B2VH 1F3JB 4P0DA 5F8RC 1KCSL 4PJCF 5L8KB 2ZCKL 4PRHE 3E1F1 5I1KL 3H2WA 2ATKB 2DDQL 1FO0A 1TJGH 2XN9B 3REVB 3HB3C 3R0MA 3VFPA 3U1SL 3WNKA 4L8DA 3DV4B 1I4FB 2DMCA 4HXBH 1KV3A 2D7MA 2LTQB 3TJHD 5I75B 2VKWA 1BBJA 4Y1AD 5IROA 2LFGA 1QSFD 1RZ7H 3BMWA 4M62H 1WWWX 2QQKH 3ARSA 2GI7A 1CL7I 3RUGE 5MEPB 4OLVH 3EOBB 3DSNA 2X41A 2DQTL 3SQBA 4PJ5A 1UYWH 3CFCL 1UJ3A 4K94H 1L7IL 1MCDA 4UV7H 3V0WH 4Z7VA 1IEAA 5BMFH 2AXJA 4UOJA 4M3JA 3ZL4L 5FK9A 3GSVB 3L3DB 5IB3B 4N0UA 1SM3H 4RMSA 3NPSB 1RZKL 2I9TA 1I8LC 4YHYC 1DBBH 3E6HB 3CMOL 4HZLA 4R97B 4XPAL 1UACL 5TDNA 4HH9B 4PGBB 1CDCA 2JIXD 1MFDL 1XH3A 3CFDB 2IMNA 5E99H 1MCJA 1CICC 4PR5A 2FIKB 4MZ3A 3WV0A 3HNVH 2GJ6E 4M1DH 4M4RA 2EDKA 5HDLA 1YUHB 5F9DC 3RGVB 3QUYC 3M17B 4JVUA 5J12B 1IGMH 3VWKC 4P23D 3IDYC 2BNRD 3T0DA 4LDEB 2DL9A 1YDPA 3EYSL 3ULSA 3MOQA 3LS4L 3B43A 3RNQB 3S96B 3L3OA 4OZHB 4OV5B 1YQVL 2IFFH 2DF3A 3O2DL 4R7DB 3IETA 4OLWL 5CILH 5KS9B 3TIDA 4QY8A 4O00A 4HIJA 3LKOB 5KSAD 1XF3A 2YZ8A 1E4WH 1A14L 1FNGA 2BXYA 3V6OE 1S9YA 3UPRB 4ZOCA 2A77H 1K2DA 5D7LA 2G9HA 4IIQC 5GRVL 1WVZA 4JY4A 5FF6B 5TQ0L 2HWZL 1RURL 2JELL 4OI9A 5FA4B 2NXZC 5MERB 3QDGB 1FBIH 1WITA 4S1SL 3RRQA 1F4WL 2ZG2A 4JO2L 4F58H 3OKYA 1T0NB 1X5HA 1QSFE 5LVEA 4LQFL 1BEYH 2FWOA 2H2PD 3HAEB 4V2BA 4Y4FB 4G7YL 2HVJB 1VB9A 1BWMA 3UTSA 2P49B 3F12A 4FXLA 4O02L 4TRPH 5HGHB 2UZXB 1XIWC 3SQOH 1GPOH 3N50A 3D0VA 4XAWH 4BKLB 5T33H 1TNMA 4XP5H 1G1YA 1A7RL 1II4E 3HC3H 1OGAD 1T5WA 2EDNA 2Q7YA 3B8SA 5D7KE 5KJRL 4ZXBC 1K85A 3GSNH 1QACA 4IOFC 1F3DJ 1U91A 2YS4A 2XTJB 3DUSB 1AO7E 4XMKL 2XZCH 1NMBL 2GJZA 4FFYL 3VG9C 1ZT4A 2NW3A 1A3RL 1GSMA 1SM3L 1GC1H 1TVBB 4ELME 4EXKA 4KTEL 3O6FC 2Y25A 1MCEA 1AC6A 2F5AL 3MRRA 4UIKH 5JOFB 1DQTA 2DL2A 2FWOB 3IDJB 5EC1B 4XP6H 1XGUA 4KK8D 4NT6B 3ABZA 4DK3A 5SWZA 1SVCP 3QDGA 3T0BA 2VLKE 3U30C 5EU6B 3HUJF 2AKRA 5DT1H 1RU9L 5FIEA 4G8EA 3NFPB 3FN0L 4BYHA 4B0MM 1NFKA 3GMOB 4NPYB 4JQIL 1YYLL 2HJLA 1XF3B 1QRNB 3WYRA 2EIBA 2PR4L 4FQIL 3MRLB 5GRVK 4Y0GA 5BOZG 3C6LB 1CGYA 1HEZB 2OL3B 3ARXA 5C09A 4RMVA 3F58L 1YDPB 3N85H 5F72S 1P4BH 2FBJL 3B2UD 3L1OL 1G9NL 5E94A 5TPWH 3KYNA 5GJSH 1YC8A 3ZLQC 3LQZA 4TTGA 5M94B 5BV7H 4FFVC 2A6DA 1ORQA 5JTWA 2K7QA 3NN8A 1E6JH 3B9EA 4K71C 1MCCA 4KPHH 4AMKL 2DIBA 5TJWK 2H3NB 3IFNH 1F3RB 2X70B 5I1JH 1ZLUK 2BSRA 1MCSA 4BFEA 1CFVH 2LVCA 1N26A 4PJ8C 5CWSA 4Y2DC 4YDLC 4HKXB 1IAMA 3P77B 4I3GA 2PO6A 5EU5B 3L7EB 3T0EE 1NGPL 5DRNB 3V79C 3G6JB 4MAYD 4I0PB 1BIIA 5F1IB 4HAGA 4J3TA 5J1AA 2W59A 1HH9B 3CCHA 3EJZC 3L3IB 1J0KA 3Q0HA 4WNQB 1A3LL 3T4YA 3GBNL 3MREA 4LVHC 3FZUC 4FP8L 3SE4A 4YXLH 3BPLC 2YD1A 3MV11 1DE4A 4AL8L 3OG6B 3H7BA 1XF2B 5B39A 1LO5A 3DGCR 4FQIH 1IT9L 3TBSB 1NCCL 4J1UA 3OHXA 1I4FA 1RUML 1JHKL 5IVXF 5HHOE 4F57L 4JHBA 1RIUL 1U8HB 1YEGL 1E28B 1JPSL 3CJJA 3IJHA 3ALWA 3OPZL 1HINH 5EOQL 4JFDB 1EEQA 3VFTB 1OTTD 5AG9A 1P7KA 1NBYA 4JPWL 4WRLA 5GGTL 3LH2H 4G9DB 1JGDB 3TZVA 1FP5A 4E5XB 2FNBA 4XP4H 1KTLB 4DKEH 3DRQB 3KPRA 3O8XA 2DIAA 3I6KB 4X6BA 1X5YA 5C0AE 3EOTL 4IRSC 1CF8H 2CRMA 4JY5L 2VDNL 3MV7A 2JB6A 2HP4A 5M7QA 3QUXA 4X9FA 2DLEA 1P7QD 1OAUL 4JFHE 3DO3A 4P23C 1GGIL 4KJPD 1YNLH 2NX5A 3PL6A 5C86A 5I19H 1CL7L 2HMIC 3QRGL 5F96H 3P9LA 5IB2A 1OSPH 4X99A 2R1WB 1S7WB 1MUJB 2XY2A 1NBVL 1GH7A 1NAKH 2PCPB 3L9RB 5DJ8A 2XTJC 4X0KB 1B88A 3ZT6A 4EDXB 1CE1H 3JV6B 1JPFB 4X83A 4JZOA 1AR1C 5JMOC 5AAWA 1NMAH 4UTAH 1LO5B 4JRYE 3BZ4A 2H8PB 2J6EA 3CDFA 3F7PC 4UDUA 2P44B 5EDXA 4ALAH 1T4KA 4OSUH 1VGEH 1PZUB 2W60A 4LLUB 3IFLL 5E99L 1MELA 4KRLB 3UZEA 3WFDH 2PXYC 4GAJL 1ZXQA 5FYKU 2PYFA 3MA7B 5EOCL 4C59B 1JGEA 1TQBC 2YSSB 5EUOB 1P9MA 3QDGE 4PJXB 1J5OL 4QRRB 3QIWA 3OB0H 3D9AL 3CFKB 4B41A 3SE3A 4R8WH 4RISL 5F1NB 4ZTPL 1PY9A 2AXGB 1HYRC 1QBML 5MHSD 3W9DA 5FYJE 4JANB 2IH3B 4NNXA 4X6DB 4EVNB 2X9XA 2EE9A 3G08A 1CL7H 3S35X 1ORQB 3QULA 4LCIH 4HFWA 3T65A 4K9EL 3PWNA 4B50A 4DZ8B 3LQZB 3IKCA 2IANA 3UTQA 2AQ2A 2F8OA 4L4TA 2FGWH 3ARED 3PP3H 2Y7QB 2MPAH 3Q6GH 4L8BB 4YGVA 1MI5B 1HHJA 1N4XH 2R1WA 2DQEH 4PJDA 2HYMA 3QFJB 3TN0D 1AGEB 5E6IC 4LVOC 1CLZH 1UA6H 3P9LB 5GRUH 5MENE 4JRYD 4HUWA 3PL6B 3RY5A 3OKLB 5DTFA 1BQLH 3QCUL 4J2XA 3WNNA 4XVSH 4YFDB 2LU4A 4DEPB 1ERNA 1QBAA 3ARBC 4PV8B 1O7VA 4NQCE 4AZ8A 4N0FB 3KYMB 4RNRA 4QRPD 3LB6C 3FTGA 1XGUB 1NSNL 4XMPH 3T77B 5C0CB 1BIHA 3O3UN 1PFCA 4CKVX 4NIKB 5HHMB 3VA2C 2QKIB 1PZ5B 5F97E 5KTEL 1KNOB 4MD5A 2R1YB 4WGVB 3WL9B 4JLRA 1I7ZA 1NAMH 4X9HA 1QBLL 3HZYB 2DQIH 3PDDA 3N1GC 4NYLA 5I75C 5AAMA 2Z31A 1XCTB 5IMKB 3MREB 1AGCB 4HD9A 1CICA 4NFBA 2PN5A 1H3VA 3I2CL 2P5WE 2QQNH 5IW6B 3FT3A 2ZPKH 3IAGC 4GMSH 5TE7L 4HKXA 5I1EL 1IAKB 3ILQD 1AGDB 1KTKE 2VLRA 2YC1A 2E7MA 1JFQL 2QR0A 2VDLL 1DL7L 3U0WH 1E0OB 2GKIA 3C5ZD 3GGWA 4OFIA 3O4LB 3Q5OA 4U1IB 1FFOB 4DUVA 5HPOA 4GW4B 3RNKB 4LLDA 5AUMB 3GSXB 1CDUA 5E2JA 4ZAKC 1M71A 2YUWA 5IP4A 2FL5A 3BSZL 4F7PB 3DROA 2WUCL 4K55A 2I9LA 4R7DA 4OCYH 4P2QA 5E94B 5E00A 3OKMA 5E56A 1WICA 4O58H 1RK1A 4M8QA 2BSSB 3CNKA 3FB8A 3OJVC 3TNMA 4HUXB 1IL1B 5I1JL 3HE7D 5MI0B 1NGQL 1CXHA 1OAYL 3LKSB 1IARB 4FZ8H 1KLGB 4LSQL 2P8LA 3DWTA 3EW3B 4LCYA 2VWEE 1LGVA 4WUUE 3BD3A 4X6DE 1OF2A 5J8OA 3K1DA 4WFEE 1XIWA 2N7BA 5DLML 2X1WL 1HCFX 4PRHD 4P2RA 4G5ZH 4Y5VC 2ZCHL 3QRFM 4BJLA 5T3ZH 4YNYB 5LGHL 4Z0BH 4P9HH 3GRWH 2BJMH 1MAMH 2E8YA 3VH8B 3L95B 4Y19D 1BP3B 1I1AB 5EC1A 2C1PB 3RHWF 2NW2B 4FTVB 3QYCA 3WO4B 2NX5E 2DI7A 1KSRA 5I6XC 1UCBH 3DX7B 3U2SA 4UUJB 3MV8E 2DJ4A 5HVHC 1B3JA 3GI8H 4I9WE 1BFTA 4PJIB 2YPVH 3SEPA 5GISH 4G42A 1G9EA 3TA3B 2P5WB 1T7YA 3QIBD 1SEQH 4R7NB 4F15B 4O5LL 2EDTA 1UM5L 5DMJB 3GFUA 2IFGA 5IESH 1DUZA 15C8H 4ZFFB 3OKEA 4P4KC 4NQXB 5F9WB 3RVTC 5EPMA 4CMHC 2UZYB 3CC5B 1OP3H 3O4LE 4L8DB 3B5GA 5K9OB 1W2KT 2FATH 3G5YB 2VOTA 4X9BA 4OF6A 1QSEA 3K2MC 3WFCH 4PYGA 1NANH 1HDMA 1YNLL 4J8RB 3JWDH 5A16B 5HDBF 5IROC 3VWJA 3WDHA 4XWGH 3IDGB 3E6FB 4U1KA 1JE6A 3UTPD 4NHUB 1UKTA 5MERA 3I84A 1ITCA 3H9HB 1OWWA 1A3RH 2R69L 2O5YL 4PRIB 1L6XA 2DYPD 1Q9KA 3RPIB 2FO1A 3LS4H 3GI9H 4HIHA 1INEL 3UPRA 2UY7A 2VZOA 1S7SB 3VRLE 3BESR 1NLDH 4G8IB 4M7ZC 3TIDB 3ZYOA 5CP3H 2V7HA 1CDJA 5GJTL 4XTRC 1QYGH 4LSDA 5DVNA 4P46A 4WJ5B 3C60C 4M6NH 3UJTH 5L8LB 3HMXA 1MCBA 1SYSA 2A74A 2FJFA 1MREH 3FOMA 2HWZH 5DRXA 5DD3H 5C0DA 4UT6L 4HCRA 2XICA 2GUOB 3AU1A 2J8HA 2RR3A 5GGUB 1D5IH 1T7XA 3BN3B 3GMQB 3SO5A 3U4AA 2BNUB 3X13A 4DEPC 2EKJA 3LQMA 1U36A 1YQVH 1I8MB 3P9MB 1ZA6A 3V8OA 5D72H 3HI6L 2DM3A 2KKQA 1FYTE 3U0TB 4M1CC 3WIHL 2GCYA 4M3KB 4XNMA 1MI5E 3RWGB 4L8CA 4HIEA 1U42A 4Z7VB 2B5IB 2XQBL 3NA9H 4KKNA 3D85A 4YUEH 2VDML 2YA0A 2XWTA 4CVZB 3HR6A 1MHHA 2IQ9L 5A2LH 2BSTB 3ZKNC 5JHLL 2AEQL 1JYVA 3P4OB 1HOCA 2R1XB 4ETQA 1IQDB 1YEEL 4M6NL 4XI5C 4I3RH 1J0JA 3SDCB 3T4AB 5E95B 2ENSA 4P5TD 1EO8H 1UH2A 2IG2H 2BVQA 1C5BL 1LO2L 2B0SL 3H0TA 2OTUB 1MVUB 3KDMA 5SWSB 3C5SA 5DJAB 3CVHH 4RFOH 1BREA 3IF1A 5ALBL 3HKFA 3MRCA 4GG6B 1F00I 4GO6B 5EWIL 2DQFA 1KBGL 3ZKND 4Z7WE 3FKUS 5DVMA 4P5KA 2OL3L 2R2BB 3BIKB 3INUH 1WBYA 2J8UF 4M9PA 5IW1A 5JOPE 2X44D 4KMTH 1YMMD 3U6RA 3EYVA 1KPUA 1VCAA 4ZUWB 2BMKA 1U3HC 1KN2L 3ARRA 3SPVB 2P5EB 1EHLL 1YEHH 3PWLA 2Y6SD 5C0JB 1JPST 3ARFA 4ELKB 3DUHA 3CD4A 5C3LD 1UJTA 3W2DH 3QI9A 3NBNA 12E8L 4P9MH 5I16B 5MEOA 1WBXA 3NABH 2D7QA 1GZPB 1EEYB 3BP6A 3UTTB 4PUBL 4WI6A 4P5MB 1KPVB 2XTJE 5EC2B 4LVOB 3LAFA 1KPVA 1P4IL 3VFGH 4MB5A 4B5EA 1D5IL 1RV6X 4F7CA 5DJYA 3QJFB 5LG1A 2IBBA 4EN3B 4NM8H 3V8CA 1C1EH 3BJ91 1ZLSH 3MV9A 4XHJD 3G5VA 3G5ZB 3UZQA 5ALBH 5BMFL 1F4HA 4J23A 1D5MB 1ACYL 1ZHNB 4U1MA 1FDLL 2DYPB 3UYRH 5EBLA 1FYTB 5C0JA 2HFFB 1MRFL 4U6XB 4Q2ZB 2B20A 3FQWA 1A02N 3I75A 1IGTA 3BFOA 4EQ2A 4B7LA 4Z7VF 4U6YB 5SWSE 3L7FB 4PTUA 3ULVE 3LCYA 2G5RA 1CE6B 1T3FA 5C0AD 3ILPB 5IEKB 35C8H 1N6VA 5I8EB 3AXLA 5IVXB 3ARQA 5C0IB 4UTBH 2W9LA 2X4TB 3C5SB 2AJSL 1NGWB 4FQPA 1HI6B 1NGPH 3OJDB 3QIUA 2EDJA 3MRBB 3NABL 3V0VB 1P1ZB 4H8WH 1A7PL 5D96B 1VGKB 1G0YR 1HOCB 2JLLA 3N1PC 4BFBD 3DBXA 3GJFB 4Y4HB 4KUCD 4C83A 5ICXA 1Q0XH 4PRAB 2R4RL 5DMGC 4JAMB 1LDPL 4R4FH 5B38G 2CUIA 3L7FA 3ES6A 2C3XA 1U58B 2FR4B 3A6BL 3GSRB 3U4EA 5JQ6L 4NBXB 1NCCH 1YPZE 4X9GA 5BZDA 5D71H 3DYOA 4HS8H 3FQWB 2B1AH 3HZKB 4MGXA 1LO4L 4HFUL 3Q6FB 1ONQB 2V2XA 5DURD 1KIUA 2VDKH 2HFFA 3IFPB 5HGAA 4PLOB 3V2AR 3MLWH 4YO0A 1ZHNA 1MY7A 1EDQA 2DD8H 4KV5E 1DLFH 4ZO6A 4UQ3A 1C16B 3DO7B 3O9WC 3GBLA 3OGCA 1T04B 4F58L 3WHXA 5CEXA 2P4AB 4Z7WB 1MIMH 1QKZL 4ALAL 3EHBD 2E6JA 3QHTC 3QUYA 5ETUA 2CDEA 4D0BA 3SQOL 1WT5A 3HZMB 4GAYA 2HT2C 4JPIB 4RFNC 1F2QA 2AJSH 2Y06H 5L6YH 1C1EL 3BIAX 2C4FT 4KDWA 5IBLD 1JZ6A 3HFMH 4AJ0A 4N1EA 5MEOB 2OTPA 4PGEB 5KJRH 3EO9L 1DQQA 5ISZD 1J0HA 4DVRH 3GHBL 5HVHB 5SWSD 1FVEA 2D03L 3FO9B 3ULVD 5J6GA 2FH8A 5CBAA 4RCAA 1VSCA 4ONHB 2GK0A 3MV9D 5DK0A 5BQ7A 1CE1L 43C9A 2J8UA 4LP5A 3H7LA 3VFVA 3OR6A 5CINH 1KB9J 1FYHB 5K59E 2BNRE 3O3DB 4L1DA 5TQ2H 1QYGL 3BWUC 3DVNA 2YPKB 3WKNA 5CGTA 4KDTC 5DRWA 2JCCE 1T1YA 1U8LB 4RGOH 2QHLA 4PJ9A 3MNWB 3MLWL 4F37F 2WANA 5F1OB 3O41B 1S78D 4MJIE 3IF1B 4L9LA 4DZBA 1DUYB 5CEYA 2Y07H 3BJLA 4TVPH 4Q9QH 3S6CA 5I1HH 4N0CD 3DVGA 1SJXA 2GW5A 3EGSA 3W81A 3MGOA 4HGMA 2OS7A 4XP9H 1IQDA 4EUPB 1VEPA 1V7MH 3QJHB 1QQDA 1RUKL 2VKXA 5T1LB 5FO9A 3PE9A 3BH9A 1ADQA 1UM6H 5TE4H 1GJIA 3KPSA 1KPRA 1UWXH 5BXFA 1F6AB 4GRWF 4ZPTB 1F45A 3MOBL 3G9VA 5ICZA 3HE6A 5DMIL 4ESKA 1KJMA 1RZKH 1U8QA 3JTTB 3MRKB 4BH7B 4M1CD 2JE8A 2XNAB 1DBJL 3HE7C 2Z8RA 4DW2H 1FL6A 1JK8B 4OQTL 3KPNB 4JGJA 1OAYH 2P48B 1DDHB 4YXKL 4UV4L 4GXUN 4Z7QF 2HRPL 3QFJE 3DRTA 4RQQB 4NP4L 1MLCB 1IGML 4M6ML 2GHWB 3FAXA 4WHCA 2BERA 3VGFA 5C0DB 1KC5H 1Z0NA 4I3SL 4I0CC 1DEEA 3MBEC 3RQ3A 4RGNE 4FQ2H 3WN5C 3KPSB 1NUFA 2IBZY 3NIDF 5C0GA 1JNHB 2WNGA 1FFNB 1BWWA 4X6CB 3FB7A 1G1CA 1XR9A 5GS1A 2XWBB 4DGIH 4P2QB 2FLBT 1INQA 2VDLH 3U0WL 4M61A 3TNNA 1ZOXA 3GM0A 4G8IA 1NC2B 4KK6D 3HE7B 4F7PA 3FB6A 1A6VH 5KW9H 1QZ1A 3KPQB 1ZWIB 2IJ0C 4R4BB 3V0AC 4OLEA 2XI9A 5D6DC 5KBNC 5IMLB 1J87A 3C08L 3MUGA 4GW4A 3RNKA 4AM0A 1V7NH 5B3JE 2R0KH 1U3JA 3ROLA 5AYUH 4DGVL 1G6RB 4JDVA 4LF3B 5JXAL 5GS2H 3EYQD 4GXUM 2VDNH 1IAKA 1A6WH 3TCLA 1HHGA 2GY5A 2XKSA 3KLAA 1NL0H 3T2NH 4JM2C 5I1HL 4PJ9D 4NO0D 5F1KC 1HHHA 1HYSC 3SCMA 5EH1A 1FZMA 3VFGL 4RDQF 4WFHE 1MFEL 4W81A 3G6DH 4NWUH 3BZEB 4M7ZB 2R69H 3VFUA 1TQBB 1KC5L 1NMBH 2BNRB 4FFYH 4NRXA 4G8GE 4N9GA 3SKNA 1GC1L 3K3QA 3O2WH 5EU4A 1A4JB 4JLRB 1SEBB 4P9HL 3PUCA 3CIQA 4U0RB 1NFDA 4ZSOB 3BKYL 2YXFA 4NC1C 3PWUB 4JDZB 2C3HA 4LKXB 5C9JB 4V1DE 4UTAL 3KLHD 1U8NA 3QG6A 1B2WL 1H8OA 3B9KC 3LZFH 4LAQH 4HCRL 5D8JH 4M93C 4OGZA 2WBJA 2YEZA 5A40E 4L3AA 4YIQB 3WFEL 1MHPL 2C4XA 2X1QA 5DO2C 3EIFA 3PQYA 4Y19E 2FD6H 2DDQH 4N5UA 2F53B 5E2TH 2QSTA 5GGQH 1V3KA 2OXHA 4JDTL 4OF0A 5AYUL 1XIWB 3UTTD 5EU7C 5EFIB 3WNMA 2IPKB 5I15H 3QEQA 1UM4L 2XRAH 4PJEF 2ZUXA 1WZLA 1M7IB 3R8QA 1FO0L 3O4LD 3OAUH 4YFEA 4PRNB 5IQ9A 3ES6B 1AQDB 5GJSL 4MNHB 3TNMB 3PL6D 1QBMH 4LHQB 5JMRA 5KSBA 1FAIL 5SX4H 5M95B 4OBSA 5J3HC 3T1FB 4ODWA 2EXWC 4PJGF 2ZWLT 4L4TB 3ZE2E 1DBMH 1JWMB 3FL7A 4S11A 2DI8A 2IANB 1YEFH 3IKCB 4X5WB 5FKPB 2ERJC 1P1ZA 3PWNB 4HFWB 4FQJL 1XFPA 1NDGA 1A9EB 2UV3A 3GSXA 3ZKXC 3FQTA 3V6FB 4X6DA 3ARDC 3T3PF 3VXUB 5HSFA 4MJIA 3MJ7B 2RFXB 2AQ1A 5GS0C 3BD5A 3QUZB 3O4LA 3I3EA 2AV7A 5D5MF 1K4CA 2APWA 3I75B 1ZS8A 3EZ8A 3ZE0E 3O3BA 2P5EE 4Z7UA 4MXWH 4UB0L 1AD9B 4LGPB 3MLSH 4LMQE 4JFEB 3B6SB 4YHIB 4NKIH 3RIAK 3R8BB 3WSQL 3CLEH 4FQLL 1T6VN 1R3IH 1AXSA 3VFNB 3V6OA 3R1GH 5FEBA 4D3CH 1F4AA 5AZ2H 1ZANH 1CG9B 3OXRB 4O2FA 3WFZA 7CGTA 4FQQA 4QHUA 5DD6A 1P5VA 3S98A 5H37G 4F7CB 5J6HA 4QYOA 1JF1B 5AYQA 5HYJB 1D9KD 2HLAA 4Z7UF 1X6NA 4ZFOA 4JR9H 1MUJA 4N68A 1GZPA 2DMKA 3JTSB 3AFLA 1WBXB 1OAXH 4R26H 5ICYB 1KIQA 3C60A 4GT7A 1YJDC 3KPPA 4Z8FL 3UEZA 5FGBC 2BCKA 2VR4A 3JVGA 3QI9B 3CX5J 3OJ2C 1EX0A 4TYUA 4JRXA 3U9PH 4E41B 3ARBA 1IFHH 4YQXL 5CJQH 1B6DA 2CUMA 2FHFA 2ZSVA 5ALCH 3TT1L 4MLSA 4X6CF 1DL7H 1FO0H 1KPUB 3KPRB 4LGRB 4D9RE 4GG6F 5D2LA 4CVWA 4JFQB 2AJZB 4X7TA 1MLBA 5TFSH 2V5RA 5DUBA 2OX5A 5D7IA 3MRMA 1AGEA 5GS0H 5I1DA 2ICEB 5JDSB 3QXAA 3GNML 4G43A 4HWBL 2OYPA 1VADA 3QXUA 1OB1A 2NY6C 2C3VB 1D5ZA 2BOCB 4DZ8A 1N2RB 4OD3H 3RWIA 2HFEA 1FQ9C 3RVUC 1UWEH 3ZT5A 5D2NC 2GTZA 2BSTA 4RWYL 3CAFA 3O9WA 2EC8A 3WUZA 1ND0B 3I6GA 5EOCH 1N59A 1IKFH 4IRJC 3QZWA 2YBRB 4KWUA 5HYIA 4XCFH 2CDGA 2EDDA 1TVHB 3BAEL 3T2QA 4M7JH 4UU9B 3BE1L 1KCRL 3SDAB 1OTTC 1PQZA 3ZZ1A 1SMAA 2YSSA 2EO1A 4JQIH 4PJFF 3B9KA 4E42A 3SDAA 3RDTC 3GRWL 4LPTA 3EO0A 3VGAC 4UNUA 3VWKD 2IGFL 5E6ZA 4JQVC 3OXSA 1ZA6B 3CGTA 3F7YB 5T3ZL 3H9YA 3FO0H 4M6OH 4ONFH 3INUL 1IGFL 1KJ2H 3CFEA 4H5SA 3ZSSA 1FN4B 2WWKT 3CDGB 1L7IH 2X4UA 5ACZB 2LABA 4PJFE 1TITA 1UFUA 2GFBA 2A6DB 2X09A 4LCCB 5KSBE 1OPGH 1TCRB 5HHOB 4LCWE 2NXYB 1MRDH 3QCVL 4OFKA 12E8H 4HT1L 3U79A 4BELD 1MCLA 4UILL 5GGRY 5F3BA 1ZT1A 1SYSB 3SKJH 1TJGL 4WO4B 4BQCA 3STZA 4WJ5A 5D7IB 5DD5H 3MRLA 1U92B 3UBXB 1MLBB 3BQUC 1EAJA 2JIXA 4UIKL 1KB5H 3CSYB 5I76B 2D0HA 4LMQI 1J0ZA 1EUTA 2ESVE 4BZYA 4KJWD 2D3VA 1CQKA 1JP5A 2APFA 4OD2A 3GSWA 4PJ7F 5CD5C 2K1MA 5CUSH 3CDYA 1L0XA 5AWNL 4X6BB 5IBUG 3KPLB 4HC1L 3TPUA 2Y5TB 1X5AA 2VITA 4NHUA 3A0OA 2W91A 4Z0XB 5INCB 2E3VA 1U6AH 2VL4A 1N0XL 3IDJA 2HFTA 4YHOL 1TZIB 1XEDA 2X05A 1RZJH 4OZFH 3HE6C 3EFFA 5CINL 4PB9H 5CD5D 1INEH 2HLAB 5EIQA 4NQUA 1CD1B 4HV8B 5DJXA 5MHSE 1JJUA 4TVSa 3DGGB 4X7EC 2IEPA 4NO2A 1EAPA 1RHFA 3HRZB 4KY1L 3DHJA 2LE9A 3CC5A 1GOHA 2VAJA 4XP6L 1F3DH 2X42A 1F90L 2EDLA 4Z7NE 4QOKE 3KJ4B 3OB8A 4M93B 1FBIL 1IBGL 4QLRA 3VH8G 2X2YA 3ULUH 2HTLC 1GHFH 3F7QA 5DD0H 3R06A 3ARWA 3L5XH 3VW3H 2ZPKL 5IVOA 3T4YB 1OP9A 1LEKB 2XA8L 2X7LA 4HDIB 3QIWD 1FRGH 2IQAA 4NGHL 3LEVH 2NY4C 1Z5LB 4KROD 2VLJA 1HSAA 3MRHA 3UAJC 1AI1L 5DJ2B 1IC5H 4X80H 3QCTH 4OZIF 3VXRE 4HF5L 2NY5L 3DX6A 4E0RB 1E4XL 2VLKB 3MGAA 4R2GC 4U1SB 3RI5F 4J3SA 1FNEA 5TPWL 5FA4A 4MD0B 3A67H 3FCTB 4H1LH 3K81A 5ID1B 4H26A 3RKPA 3FQTB 1U8OA 3V6FA 4OCYL 4GKNA 1T7WA 1NDGB 1G7LB 4L5FL 1H5BA 3NACL 1JI1A 2VL5B 3HHRB 2MOVA 1UJ3C 4GRLA 4IDJH 2ZUWA 2FJGA 1QSZA 4I2XA 2X10A 1RUMH 1J8HE 2R0ZH 4JZJA 3VE0A 4UOW1 4O02H 2AGJH 4TRPL 1BBDH 1XMWA 1YEEH 1BPVA 2NY1D 2FJGB 4JPVH 3WIFB 2CDFB 4JE4B 5JLZB 3RGVA 2P43B 1IBGH 4MQSB 3MNVA 2VDPL 1DQDH 4LRIC 4OTXL 4BFIB 4GKNB 5C07A 1JRHI 5FB8A 5GGVY 2QLVB 5CSZA 1CR9H 3M45A 1DN0A 5AUMA 3PF2A 4WENB 2FIKA 4BUHA 1FNEB 1XH3B 1U6AL 3TO4C 2WBJB 5DRZB 1P4LB 5TDNB 3DX6B 1LD9A 3MYJB 3WIIH 5EUOF 4HWBA 3ARDB 1TVBA 4H1LA 4P3CL 4QTIL 4CMHB 3LHPL 2EH8L 5IHUL 3C6LC 1YEHL 3RWFA 4C56D 4OLZL 1EHNA 1I7UB 1TETL 3MXWH 4HZAA 3DUSA 2R4SL 2JJTA 4YC2C 1GAFL 5CBEA 4A2LA 2OMNA 1IMHC 3S34L 4Z8FH 1YECH 3ZHLA 3TYFA 4APQC 4EQ3A 1B4JH 4L9LC 4M48H 3DGGA 4R2GB 1JHLH 3ZYZA 1T0MA 1HHHB 5E1AA 3VFPB 5DJXB 3F12B 2DTML 3D69B 2PO6D 1YEDA 1AP2A 5KVDL 3WN5B 2VLJD 4QEGA 1J1XH 4HUMB 3NCYS 3HAEA 2HT4C 5CJOL 2AQ3A 4NQVB 3W11C 4NO0A 4OKVB 4YWGH 4DUWA 4OCRL 5K33A 3VGAB 3U9UA 2OI9B 1MWAL 5DMIH 1GXEA 5LXGL 3TJHC 3O3EB 1E27A 4HJ0C 1X3DA 5BV7C 1HNGA 3IJYB 1FNGB 2CKBH 3HE7A 4X6FB 1NC2A 4LAJH 3D5OF 3HC0B 2J5LC 2VDQL 2ICWJ 5IKCB 3VXRB 1JNLH 1H3PL 1J05B 4GKZB 2Z93B 5GGTH 3UPAA 3ESVF 1RZIB 1FORL 4LSUL 4PJDB 5JZ7C 5E7FA 3REWB 3G6AA 5ESVA 1ZA3A 2W65B 1A3LH 1EFXB 1TCMA 3QO0A 1SJEA 1H3TA 1XF5B 5C6TL 1WFTA 2VABB 3NGBC 4OB5L 2IH3A 4NNXB 4F9PA 2DWEA 4BSVB 2QSQA 3MCG1 9CGTA 4R3SA 2Q3AA 3MJ9L 1LDPH 1T2JA 3MJ8B 1YYML 3MODL 3E6HA 3GMNB 1BGXL 3BD4A 3WXVH 4LFHG 5DA4A 3GSVA 1CDIA 5H2BB 1I1YB 1LK2B 2X4NB 1UJ3B 2Z8WC 5IB1A 2FEDD 5E9DB 2EE2A 3QXDA 4C56A 1IGYA 2YRPA 1I85C 3SDDC 4K07A 2J88H 5TF0A 4BH8A 3WKMH 4QOKA 1QEWB 1N2RA 1K3ZA 3WUWA 5EBWA 4K8RC 1VADB 5FYLE 2GITA 2PCPA 1ZHKA 3VXSA 1C5CL 4RMQA 1QD0A 4X7FC 4H88H 4X99B 4XCEB 4PJAE 2VSDA 3FHAA 4ZXBA 2HH0H 4YAQA 3X3GH 3ME0A 2F58L 4PGDA 5T1DH 5FUOL 3RGVC 1MFAH 4EI5C 3OR6B 2DLGA 5BS0E 1BZ9A 4DVBB 1H8SA 5CGYD 3MLXH 5FKAA 5B4MD 3S3SA 1OM3H 1A7OL 1K5NA 4YHKH 1RUAL 3HZVA 3GO1L 5HI4D 3UCRA 2LU3A 2BCKB 5A43C 4H20L 3GSQB 4FZEH 5DQ9B 1A5FH 5GRWA 3JTSA 2GAZB 2VXTH 3C8KB 3SKOA 3T8XB 4ZYKA 1R5WB 2WUCH 3VFTA 1NGXB 2ZUVA 1RJZA 2IALB 4OCWH 2FD6L 5GGQL 4NGHH 3NVQA 5EU6D 1U2CA 3MRPA 1BZ7B 4N8VA 4MNGB 3HCVB 3O6MH 1AR2A 3EKCA 4QXGL 1JFQH 1OAQH 1XF4A 5I9QB 3IDXH 3C8HA 2BVOB 3PABA 1QA9B 4O2CB 3MNZB 1YNKL 2EDOA 3DXAD 4DN4H 2V17H 1MHEA 4ZO8A 4MAUL 4E41D 1MCHA 3FQUB 4QRRD 3RJDA 3EFDH 2X4OA 2OZ4A 1LE9B 2JJSC 1O5DT 5T3XD 3VRIA 3UO1L 2P8PA 1AKJD 4M43L 4XMKH 1EJOH 2XY1A 1BOGA 2OSLB 2WK2A 3TN0C 1FNAA 5F1SA 4ZS7H 4F33B 5J13C 4KVNL 3LEXA 3NACH 5J9PA 3EOAA 3DLQR 5GQBA 5BVPL 1RIVH 1ZS8B 1BD2B 4JEGB 3BT2H 2BSRB 4S1QL 3D18B 4XX1G 1G6RH 5ESQB 1X5ZA 4CJ1A 1N6QH 4PRAA 2G5BA 1KB5A 4Y4HA 3BKCL 3HMWH 1CDBA 2YHGA 3QUMH 3OMZA 4PJEE 5T1MB 3BHBA 4JG1L 4JO2H 2DAVA 5F9OL 2BRRL 4D8PB 3KYNB 4UBDC 5T1MA 5C0EA 3QO1B 3UJIH 4LSVH 4KGLA 1CT8B 1NFIA 5T1KB 3Q5YA 3MA9L 3UC0L 3BEVA 3FQXA 1Y0LB 3E8UH 4IMKA 4P4KA 2JKXA 3PGCA 3GMMB 2BRQA 4FXKA 4FQXB 1XGQA 3CK0L 5KAQF 1NJ9A 3BP5B 4PY8I 4QGTA 4ODSH 1NLBL 3LS5H 3ULUD 3G5XA 3FB5B 4NN7B 4N0YL 2W0LA 5KSAC 1RMFH 2ZUSA 4Q2ZA 2V9RA 3Q48A 1BJ8A 5HTSA 2F53A 4JGMA 2AKRB 1DBKH 3MPCA 2YPLD 3K7UA 4NZRL 3O2VH 2C5DC 1D5BB 2FB4L 1F2XK 2YEZB 2BVPB 1P6FA 3VGEA 1LE9A 2EDRA 1BF8A 1NH6A 3D2UB 3QHFH 5T5NG 1JUFB 4U1HA 1RIHH 1MPAH 4DKDC 1RIVL 3KR3H 2VJXA 1QSVA 5DJCB 1QA9A 3D2UD 2FECL 3CDCA 4IRZH 3VMOA 5CP7A 3VD3A 1JHLL 1QRND 4IJ3C 4GKOA 5E8OB 2VH5L 2GJ6A 4HMCA 3G6DL 4XBGA 1SEBA 2HN7B 1VFOA 1WGOA 3CSPA 1QFUL 2OTWA 5EIVA 5A3IC 1T1ZB 2OBGA 3STLB 1XIWD 2EH7L 1NGXA 2HJFA 1FVCA 5LBSL 3HAEG 2AXHA 3K4AA 1JPGA 1WWCA 5GXBB 4GJTB 3VD5A 1W8OA 1F6LL 2NY2D 4M43H 1VFBB 1H0DA 2W07A 4ODTH 1FVDB 2PR4H 4IS6A 4TSCL 3E8UL 1J10A 3PWLB 4LVNC 1DTUA 3KLAB 3ARDD 1EH9A 5E4EC 5DC9B 4OZGB 3S9DB 4FQ1L 4RAVB 3FO2A 5E6YA 5IB5A 3LZFL 1IC1A 2R2BA 5HYEA 5DMYA 3P4LA 4C55A 1OAKL 4Q0XL 3U7YL 2XXCB 3BKCH 2D0GA 1VFMA 2DQFB 3MUGB 4AM0B 5D2LF 4KJYA 4JY4B 1MHPH 3TJEH 2AS5M 3U82B 4GG6A 2CK0H 4EI5A 3KYAA 1ROWA 3LN9A 3PWPA 1ZHKB 2P45B 5F7FA 4Z18A 5J7CC 2W38A 3BEWB 4ACPA 3CFJB 4NWTH 1L7TH 1E4XH 2YKLL 2A1WL 1QLRB 4Y5XB 3UBXI 4JO4L 4YDLB 4Q9RL 32C2B 4CW1A 5DS8B 5I74C 4K3DH 3QUKA 3BGFB 1S8DA 1A7RH 1U2HA 1BQUA 4ZFZB 1ACZA 4P4RB 1FNFA 3SDXF 3K8KA 1I9IH 3ZSTA 1FNLA 2GQHA 3D3VA 4XCCH 2O5YH 2X4NA 4PD4K 4YK4C 5C7XL 5D5MB 1VFAA 1TZHA 4JFFE 4MQ7B 4L8CB 4Y5YC 2CIKA 2YXMA 4ZTOH 5C08B 3QIBB 1IGCL 15C8L 4JO1L 1E4KA 4LDLB 2DQCH 3HE6D 5C2BH 4WVRA 1HIMH 3X3FL 1FV1A 2D7TL 4S0SD 1OTUC 1AO7B 5K9JH 1OT2A 4YDVA 2OR9L 3KPNA 4J3VA 2Q20A 3RZCD 3SDDD 2QADD 2P42B 3AU1B 4NHCL 3ARFC 1SJEB 1XF5A 2EEDA 3H9SE 3MRKA 3MUZ1 1TLKA 4R96B 2F8XC 4WWKB 3Q5TA 4J3UA 4OCXL 5ESVB 5FOBB 4L3EE 3FMGL 5IHBA 5F7NC 5IJKC 3LN4B 3RL1A 3QNZA 5T1LA 3DNKA 3GKWL 2VRAA 1BBJB 3QJHA 1J05A 1RZJL 4GKZA 1ES0B 1WCBB 5D71L 2H6PA 1F02I 3WLWC 3DV4A 1OW0A 2VXSL 3HPLB 4JR9L 4XRCB 2CMRH 3ULUF 3NA4A 3B2UC 1UH4A 1QSFA 2FGWL 3O3EA 1G9ML 1R3HA 3ZT7A 2PO6C 3RBSA 4HXBL 3S7GA 5TE6L 1HDMB 2G75A 4J8RA 5FYJD 1WV7T 4OUUB 3JXAA 2ARJB 4I77L 1EUUA 3S4SG 1S9VB 1AP2B 1AFVH 3HTLX 4U3HA 2ITCB 1FZKA 2QV2A 3QUMA 1I1AD 3KPSD 2NPLX 4ONHA 1MHCB 3LOWA 3F58H 4NCDA 3RX5A 4X5LA 4XWOC 5EPMB 4M7LL 4NKMB 4RMTA 1OTSC 4EI6B 1QFHA 4KROB 2E6PA 2PW2A 2VYRE 1PG7X 4RX4A 1JPGB 5E5UB 3JWDC 3TBWB 4HKBA 2OL3H 2W0FA 1L9NA 1MRFH 1B6UA 4OCSL 2RCSH 4PJAA 5D1ZD 4LAQL 2EC9U 1WLHA 1RQ5A 5ETUB 4Y4KA 1IGCH 4JO1H 1J0IA 4H1LB 3HI5H 4YDVB 4PLJD 4D2NA 3ZTNH 3NAAL 1AO7A 3WLWD 1VKXB 1A1OA 3FO1B 3L3GB 1BBDL 4S1DD 3TO2A 1N6QL 1CK0H 3BUTA 4RX4D 1A4KA 4YO0B 1CGUA 1J8HA 2EIZA 3EDEA 4U33A 4D9LH 5HGAB 1EK3A 3ZDZF 4LLQA 3C5JB 1H3XA 1LP9F 5C08A 1M7DB 4U6VL 3FQRB 5C71A 5J57B 2AV1B 3ET9F 3PL6C 4KUZH 2AJ3B 3U83A 5TGBA 4KK9C 5TE7H 3MJ9H 5HGBA 1OAUH 2E7CA 2YZ1A 3GMMA 4UBDD 5FYJH 3RKDD 1I9RH 1TZGL 3H8NA 5D1ZB 5FCUL 5KG9A 1IL1A 2VLRE 4KQ3H 5BS0D 4F9LA 4Z7OF 4NZUL 5GSRB 4ZS6D 3QUKB 4LCUA 4NFDA 1RK1B 3QO1A 4CW1B 2VXUL 2YR3A 4YHPA 2LQRA 2VL5A 3GKZA 3F7RA 5D1XB 1H5BB 1S7QA 1MEXH 3GSOA 3CFJA 3OJDA 5CD3B 5I0DA 1NSNH 1M71B 1KEMH 4GS7B 1EXUB 4OZFG 4IM8A 4R0LA 3TZVC 4IRJA 3WJJC 5IMOB 2L7JA 1WF5A 4O58L 2QJDA 4XPHH 2WIIA 2NY1B 4PIRF 4PRBA 4UZGA 1JYXA 2RIKA 1CE6A 1T3FB 2X9WA 2Z8SA 3VXSE 2VZSA 3QP3A 4Y8AA 3CXDL 3O6KH 3DX9B 3VI4E 4TNVK 4RBPH 4UNTA 4PJBF 2C3WA 4MA3A 1QSED 4KROC 3GMLB 4HWEL 1R3IL 3T2OA 3QIWC 4MMZC 4ODBD 5ISZB 5JW5A 1AXTH 5DJDA 5AWNH 2E5EA 3HMXL 2BNQD 4AENB 2V7NB 5L2KD 3VGBA 4ZUUA 2ZUTA 1RZ8B 5EBGA 3MFFB 2X7LB 3ALPA 3V4UL 2X4OB 1UWGL 1HZHL 1CGSH 3NCYP 1KELL 3D25A 3B9VA 5KVMC 1CFTA 2YWZA 5GSVA 2D4DA 4UT7L 1FVCB 4M6AA 3NIFF 3PABB 1FL3A 3TN0A 1QVOB 1I8IA 1OQXA 4KKCD 3NH7H 5IGXH 2R1YA 3ZTJG 2YWYA 4HFUH 3KLDA 5F7DA 5FGSA 3BP4A 2ZCLL 1BJMA 4A2MA 1UEYA 1FIGL 4PJHB 5DGQA 4HWZA 5C0CA 2Q1EA 3C8KA 4XBEH 2IAMC 1KT2B 1PG7W 4MHHI 1A6ZB 5IG7B 3H3KA 1JZ3A 5HVFB 1FLRL 5K9QG 2Q86B 4UIMB 4OAWA 4N0FA 3CU7A 3ZE2F 4EN3D 1IEBA 1KJ3H 5HHQB 1MJ8L 2DLHA 1KFAL 4LHUD 4MDIA 4ZDHB 3MLVL 5HHPA 2FO4B 4HUWB 4P4KB 3BH8A 4JFDE 4Z9KB 1ZLUH 4AEIL 1ZGLM 3RVVC 1UG9A 3BPNB 4HIIB 3ZHKA 4G3YL 1GGBH 1NFIB 4NQSA 3EJYC 4L8BA 5CHNA 2YN5A 4JFYB 3VU2A 1GGUA 4G8FB 1ZGLB 1G7JB 3EOYG 4LCCA 2Q8AH 4JCLA 4DN3L 5CJ8A 3BRFA 1JV5B 4XNUL 1LK3L 1LHZA 1MFBL 4Y4KD 2VLJE 6CGTA 1QBLH 3BW9A 4K71B 1FC2D 4M7JL 3D0LA 1KF9B 3R4DA 2IF7A 4EI5D 1T7VA 4JY6B 4LVNB 4HGKC 1ZV5A 2AXGA 1IZKA 2UYLB 5F1NA 1NC4A 4Y1AA 3H9SA 2NXYD 2VDRL 2ICCA 4YXLL 4FZEL 5EUOA 3LEXB 4JFZL 4Y4KC 1J8KA 1UM5H 4PLKC 2J6EH 1U8IB 5E03A 1A6TB 3VXNA 4KI5C 1F4YH 4NQED 1KJ2L 2P8PB 3ZDYF 5CEZD 2V2TA 4TNWK 4XT1C 3UYOD 3MJ8A 2WBJC 4CVUA 1RIUH 1D5XB 3S35H 3BPLB 3KPRD 5FYLD 1JZ4A 3I6GB 4XPFH 5KVFL 5EOQH 3O9WB 4BSVA 3IVKA 4U49A 4K7PL 3QEGH 3IU4H 2A9NH 4L8SC 4MJ5B 2CLRB 2DLTA 3JWDL 3JV6A 3HCVA 1J11A 4EZMA 4YHKL 5C09E 4HPOL 2DKUA 3IS0X 1O7SA 4WY7L 3GUTB 3GO1H 1RJZB 3LKRB 1MCQA 4RGNC 1S7WA 3PWVA 1NCDL 1W72A 4HUUB 3QHZL 1A47A 3GI9L 1E4WL 5DQJB 2H2SC 1QHPA 5A2IH 3WEXB 3S34H 3PXHA 2ERJB 3DARA 2HKFH 3P0YL 5IKCA 1UXSA 4GLRI 4JFQA 3MV8A 4LSQH 2FX9H 1OD7A 3RBGA 1W0WA 4NKOA 4XPTH 3T3MF 1NGYA 3PXJA 5LBSH 2DLFL 5FECA 5JHDE 3MV7B 1J1XL 3HI1A 5SWZE 1Y18A 1Q9KB 2R2EA 5EZJB 3RPIA 2Z35B 1G9MC 5JPMA 3H3PH 5F7KC 5B39G 1CS6A 3LSOA 3VMPA 4DN4L 4JDTH 5CS7A 3VWJB 2BRRH 3EO1A 5ICYA 3P0VL 3EYUL 2Q7NA 4GBXB 3ZTJH 4ZAKA 4ZFGH 5BJTA 1RZJC 2ADGA 4LHUB 2WSKA 5CEZH 4OFYA 3U0PB 5T1KD 2FRGP 2GTWA 3WS6C 1QEWA 4NQEB 4RRPG 5EZOH 2AK4A 4F7MB 5DR5H 4Q9BA 1E4KC 1ZLVH 1TQCC 4P2QD 1FHGA 3GSNB 5MEND 2FZ3B 5C0RL 4MNQA 5D1XC 2WMPA 1ADQH 3H7BB 1ZT7A 2XZCL 4XNQB 3UDWC 4KTDL 2VO5A 4K7FB 4U2ZA 4G8GA 1Q9LB 1EERB 4G42B 5IB1B 4YQXH 4ELMF 1OGAA 4JHAH 5DSCA 5F7LB 2HRLA 4IOSD 1RFDH 4EUPH 2SEBB 5IIEA 3LRSA 1DQMH 2PO6B 2V9TA 4PJEB 4GMTL 4NQDD 1P5UA 3A67L 3MYJA 3O81A 2HTKD 3BKJH 5DRZA 5HY9A 1PGRB 3V0WL 1MF2H 4OGYL 1CIDA 1AKJB 5DZOA 3BZDA 4WHYG 4ZSOE 1N8ZA 1ZEAL 4EDWL 4PG9B 5HYSG 2OM5A 4C58B 2HG5B 2VABA 1A9EA 3MNVB 4GH7B 5BRZE 4D3CL 1X4ZA 4R97C 1BLNA 3O45B 3TT3L 1BM3L 4KHTL 5DHXB 4EOWH 1WBZA 4FQHA 5I8OH 1EO5A 5HHNA 5GJTH 3T1FA 3REWA 3SDYL 5DVLA 5BV7B 2BSSA 5EG6C 5D8JL 4PPTA 4OTXH 3U7WL 2BFVL 3PNWB 1JN6B 1UQSA 3WFCL 3HNTL 3MZGB 4NWUL 3FT4A 2FL5B 2IPKA 1UXWB 5DO2D 2WQRA 1IE5A 5DHVA 2EYTB 4QRSB 4LSRH 5D93C 4JKMA 1E27B 4CU8A 1SYVA 4H26B 5FDYA 3FONB 3FQNA 4HLJA 2IFFL 2CKBA 2HJKA 4PG9A 3SGJA 4F7TB 4CL7A 1NFDE 3EHBC 2FEEL 4H8WC 5C0BD 3V5DB 1KGCD 1U8MA 2L7UA 5H94B 3IDNA 2J1KA 4PRIE 4HPYH 5E5MB 2QR0B 1T20B 4MLIA 2I60L 4YXHH 1MH5B 1A7OH 5DHYB 3WIHH 4JPKL 2R4SH 5TQ0H 4P2QE 3HG1A 4GSDH 5E1AB 1ZT4B 4PB0L 5IHLB 2PYED 3V6ZA 3RDTA 1DANT 5LGKA 4YHLL 3NA9L 3WFEH 5DJ0B 4GAFB 2O61B 3CMOH 4NRXB 2P7TB 4ZTOL 2VNCA 4UT6H 5DJ0A 4MJ2A 2FZ3A 4PJ7E 1LO0L 2F5BH 3OZ9L 3T0EC 4YEEA 5KVDH 4PG2A 4EIGB 1K6QH 1RFDL 4AIOA 5B8CB 2XWJA 3P11H 4FNLH 5FUCE 2BY3A 3AS1A 3HG1B 1QNZH 1YMMA 4NO5B 5D2NA 3WD5H 1WQVT 5JNYA 5C70A 1D6VH 1WAAE 4CMMA 4QXUL 2Q87A 2DTSA 1G6RA 4JDVB 4LF3A 1YEFL 3EO1B 1P4LA 4OZGF 3N1MC 3SCMC 4HULB 1ZANL 2Y5TA 1I9IL 2HAZA 1GGBL 1ITBB 3IXTB 4OD2B 3KYKH 5GGRA 5K9QI 4R4BA 4NO3A 1F42A 4HBQA 1NANI 4NKOB 2WWMD 5CIPA 4S2SB 4Q6YA 1RUQH 5D2LE 3CLFL 2BOBA 3K0WA 2H45A 2ICES 4KKAC 1IILE 1F58H 4N0UE 5CJXC 3BUYB 1NMAL 3THMH 1OOAA 1IC7H 1TCRA 4AIZA 3EDJA 3QDME 2BHUA 3T65B 4GQPH 2IAMB 3S37H 3F7VB 5DD5L 3MLTB 3KYOB 4KQ3L 1U8OB 3CZFA 2B1HH 1J18A 1BFVL 2YD4A 4OFVA 4Y5VB 4NDMB 3IVKB 1LP9A 1PSKH 1BGXH 1N8ZB 2R9HD 4RQQA 2NYYD 1TXKA 1D5XA 1K4DA 5KSUB 4U1SA 2A6JA 1NAKL 4ZMAT 1KCVH 3QNXB 3EO0B 1G84A 3CSGA 2I9TB 2ZJSH 3B9KB 3GSNL 3SKUD 4JB9L 3ARGC 3TO4B 4N0UB 4D0CA 1FGNH 2I25N 5IIEB 1HSAB 3JWOL 1BECA 1FYTD 2XNAA 4G9FB 1IEAB 3RA7H 4J4PD 3GBMH 4OZ4B 3H9SB 2IQAB 3B5TA 4K7PX 5D7IE 4UMGA 1IFHL 5B8CC 5MEPA 1IKNA 3EDKA 2VC2L 4XNZC 3AC0A 3WJLC 4G6AD 1Q94B 3D0LB 3O9WD 3ARGD 1XZ0A 3PIQA 3BW9B 2R8SL 4GXVH 5IB4A 4MNQB 1JGUH 4IRJD 4M6MH 3V7AE 2AEPH 4HHAA 5DDHB 4NQEA 5C1MB 2PXYD 4IOIB 1TIUA 1CK0L 1F58L 1JGVL 1CD1A 3L9RA 4NBZB 5DJ8B 4OCMC 5JDSA 4YLQT 3GIVB 3MRMB 5DVOA 3HG1E 5IV2B 1HILA 3I02B 4N1CA 1JL8A 2VLKD 2EYSA 5HD8C 3U36A 5LAXA 3C5ZB 4ODXB 3WO3B 5EO1B 3LSOB 1T89C 5D2LB 4DJMA