2NY2D

Hiv-1 gp120 envelope glycoprotein (t123c, t257s, s334a, s375w, g431c) complexed with cd4 and antibody 17b
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
228
structure length
221
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 50
structure length 221
sequence length 228
ec nomenclature
pdb deposition date 2006-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny2D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny2D01
3QRGH 4KKCD 2BNQE 1TJIH 4PRAB 2NXYB 2Q7YB 5F9JB 2PR4H 3W11D 4RGNE 1CIDA 2XPGA 2VH5L 2VSDA 3T3PE 3DX7A 1SHMA 3QAZB 4M1DL 3MLWH 4J6RL 3BUYA 3KDMB 3DOSA 3HE7A 4ODWA 2Y72A 3WKMH 2FATL 4IRSD 3CK0H 1MVFA 3D85B 4LEOB 3CIQA 4GAFB 5ISZE 1A7PL 2IMMA 2VR9A 4WY7L 2UYLA 3CU1A 3RZWA 5DJCB 2J8UE 3J7HA 2VN7A 3IFOB 1OTSC 3HCVA 1HHGA 3S88H 5FGSA 4LQFH 3T2OA 3O6FC 3ARDA 3I3EA 3NFNA 3OJ2C 3EYQD 4OD3H 3REWA 3KPQB 3CD4A 5F7NC 4P5TB 4IOFD 2DN7A 3KG5A 2P4AB 3OKDA 2E7CA 1FO0A 2KZ1B 2VLMD 2Q3ZA 4J1UB 6FABH 2UVFA 2DM4A 4XBGA 4PJGA 5IHZA 3QFJD 4I48A 2VITA 5I1GL 3T3MF 3H3BC 1IFHH 3IDJA 1UG9A 1N5AB 1J1OL 1XGRA 3EYFA 4NNYB 2HKFH 3N50A 4Q7DA 4JY4A 4XPTL 1RZKC 1MWAL 1XF1A 5DRWA 1W8NA 2AV7A 4WFFD 1FH5L 4IDJL 5LWYL 5CHNA 1NEZB 2A74A 5T1LB 5BV7C 2RR3A 1RK1A 1DN0B 3S3PA 1OF2A 5KANI 1OSPL 5JW3H 1JZ7A 1RU9L 3ILQD 5D7LE 1INDL 4ZFGL 5C0IA 1CZ8H 1QR1B 1FQ9C 1F4AA 1UEMA 3I75B 2BMKB 4N8VB 3EJJX 5L6YL 1LVEA 3P77A 5C09A 5ICYA 3MRDB 4APQC 3JWOH 3OWEA 3QQ9D 3ZYIA 3TWCH 5ALCL 1JHLH 4KMLB 3F7YA 3VFNB 5CP7A 1DL7L 4Y16C 4LEXH 5GSRA 3MNZA 4NO3A 2X4QA 3FRPA 1KB9J 1KTDB 2PO6D 3IDGB 4PG9A 2GUOB 1HHIA 4H1LH 1QRNB 1YEIL 4PJCF 4P4KA 1CLOH 4OCYH 4R2GB 1ZXQA 2VQUA 2X4PA 1QSED 1EGJA 1Q9LB 5EOCH 1TCRA 2WIIB 4U6HB 4K3HA 4RISH 4ZAKB 5C0NC 2BVEA 4NYLB 3QI9A 3EJZC 4X4ME 4XP6L 4MGXA 4WUUD 1SY6A 1XF5A 3GMMB 3OPZL 5I2IA 4PJCB 3V2AR 4IEFB 1TJGL 3MRFB 2W0LA 1E28A 1TITA 1LHZA 3U4BH 1EFXD 1WC7A 2ZUYA 4LMQE 4GAGH 4F37K 2EXWC 2AXFB 1G7LB 5DS8A 1I8KA 1KC5L 2IBZY 4DOHB 5HGBA 4WENB 2FEDD 4PREA 1CDYA 2FX8H 2I5YH 5CINH 2MNUA 3ZTNH 4GAJL 2JJUA 3O8XA 3L9RB 4ZSOB 3TIEA 3U4EA 3QUXB 4XCYA 2CGRH 3PWJA 5JXEA 2HLFD 3B9KC 2IF7A 3NPSC 2N7BA 4PIRF 5F9OL 5I1IH 3D3VB 5CMAA 3UTSD 1F4XL 1UGNA 5AUMB 2WBWB 1EO8L 5J13C 4OI8A 1CDHA 3FO2B 4HDIB 1SEBB 5I8KH 1FIGL 1RUQL 3C9NA 4TVPL 1R3KB 2NZ9D 2DD8L 2R29H 4EJ1C 4Y5VA 4PRNB 5KTEL 1UM6H 5AZEH 3OKKA 1B9ZA 4M7KL 5HGGS 5GS2H 3OAYK 3VXME 3AROA 5ITFB 1F97A 4ZUSA 2F58H 3GI8H 4LASH 4QOKA 2OZ4L 3V4VH 5J11C 2APWA 3DRQB 3VWJB 4BUHA 1YPZA 3HG1D 3TYFA 4TQEL 1QSFE 4WGWB 5DRXA 2H32H 5BS0A 1MCRA 2VKWA 4FOMA 3BPLB 2YN3A 1R0AH 2ESVA 1EFQA 3P0VL 2DBLL 2E5EA 2CXGA 4U0RB 4BQ9A 3VXUB 3LPFA 5JHDD 4KK9D 4OD2A 5GGRA 3GSNH 3I3DA 5HI3D 4TSBL 4G7YH 1TENA 3AFLA 4FQHB 4M8QA 3TCLA 1F6LL 3WEXB 4YDKL 4V2BA 2HFEA 4JPWH 3VU2A 1W0WA 1H9VA 3MOBL 1QLFB 1ACYL 2BY1A 3MNVA 3QCTH 5TH2A 4I4WA 1MNUH 2XFXA 1F3RB 4U6VL 5HHNA 2QKIA 1VEOA 5JMOC 1YEHL 1LP9A 3SDXE 3DUSB 3TPKA 1QPXA 3BRFA 2QQNH 3PJSB 5KBNC 2AKRA 3B9AA 1PYWB 4FZ8L 3QIWD 1AJ7H 3S4SG 5KSBA 3P9LB 4M6ML 1QLEL 3HMXL 1N8ZA 5HTSA 4UNTA 1QSVA 3FT4A 5BW7A 4UT7L 1FVDB 4MXWH 4ODTL 1CXKA 3SE3C 5ADOL 4NM4L 1A4KB 1AI1H 3JXAA 5KW9H 1N59B 3ZDZE 4OGYH 5IBLD 4HJGA 5EIIB 3JTTB 3OKYA 4EI5C 4GUPB 1U3HA 2XQYK 4QHMB 3GBNH 3A6CL 1MRCH 2V5RA 3MJ7A 5TE7H 4P2OA 2KBGA 1MREL 3B8SA 3MFGB 5DJAA 1I8IA 2FECI 5CCKL 1AY1L 4QNPF 3QWRA 3TBTB 2LTQC 4YR6B 2VWEE 2OR7A 3MC0A 4O58L 1G9NL 2HKHH 1IRAY 3D18B 3U36B 1NQBA 2BSRB 5FUOL 2CPCA 2JB6B 4N0UB 4TN9A 2NY4B 3LEVH 5JNYA 1LO4H 4MAYA 4H20L 4JZNA 1CWVA 3DRTB 4NHCL 4WHTB 5J0BA 4BSVA 1BAFL 3PL6A 2FSEA 4JO2L 3BH8B 5LGKA 4NRZA 1FRGL 1S7SA 3WN5A 1RULH 4PJDE 3MLZL 1K4DB 5C0CD 3UMTA 4WV1B 3KYNB 3RGVD 4ZQKA 1WZLA 1BQHG 5F9WB 4K71B 1S7RA 2YEZA 2ZUVA 3EFFA 3MLRH 2AK4A 3OMZA 2VXSH 3TO2B 2UWEF 4GKNA 1AGEB 3JV6B 3BQUD 4FFZL 3RWFB 5KJRL 1K4CB 3IDNA 5FHBL 1XH3A 3OKNA 4KZEL 4NKOB 5ETUB 4WO4D 2VUOA 3O6MH 3V5DA 1B0GB 1G7IA 2GSIB 3CVIL 2R56H 1FV1B 4PRDA 4XVTL 2UWEB 2VDQL 3GKWH 4DN4L 5HI4C 4OB5H 2D3VA 4QRSA 4X8JB 5DLMH 1X5YA 1M7DA 4B7IA 5IFAH 2AJSL 1F8TL 1S7QB 1UZ6E 2XZQL 5FYKE 1PKOA 3C6LB 3KPSB 2PKDA 3Q6GH 5C6PB 3MMEB 3DXAB 4DGYL 2X70A 1AC0A 5I0ZA 1OWWA 4M6AA 3BP5A 4UIKL 4UB0L 1NDGA 5GGTL 1VADA 1X5KA 1A3LH 5KZCB 1H3PH 4O2CA 1PX3A 2A77H 3I2CH 2GTZA 4PTUA 3ARSA 5SWQB 2ZG3A 3BYYA 1MAMH 4MJ5A 2NY1D 1Q94B 4YHIA 4QKXB 5ADPL 4XCCH 4WFHD 3S5LG 2DQFB 3V6OA 3W39B 1MJ7H 1NBQA 3FTGB 4QF1A 2VLRA 4ZS7H 3KYKH 4EUPA 2CLRB 4FQ1H 4JB9H 4UNVA 5CD3B 1G7PA 4OM1L 1WT5C 5GQBA 3B9VA 4G9FE 5AWNL 3HI5L 5TFSL 3V6ZA 2OLDA 4F3FA 1RVFL 1TZGL 1VFBA 4FP8L 4J3WA 5D2LF 5E94A 1SMOA 1FC1A 1NDMA 1T0NA 3REVA 4BK5A 2DQGH 5FYJH 2O26U 3QUML 3GRWL 3BD3A 1YC8A 4LK4A 2X4NB 4XPHH 1S9YA 1KB5B 4QYOA 2R2CA 2WANA 4OQTL 3S37H 4R4NC 5D2LB 3HC4H 1JYXA 4KJPC 1FDLH 2W9EH 4Y4KD 3MREB 1FFPA 4ERSL 4PJGE 3CX5J 3S4SB 1BWWA 5LCVL 1P2CA 1RJZA 4NNPL 5L7XL 1ZANL 4XMKH 5E08H 2C4FU 1YEEL 4HQQL 4GJTB 4JM2A 1A02N 4MNHA 1HHJA 1G7JA 4PJHE 3FO1B 4GRLD 4NZRL 1JTOA 4P57B 4Y2DB 5DGRA 2XKNA 4KTYA 5FM5M 1E6JL 2NY0D 4F9LA 1HI6B 5FECA 1JWSB 1KCSL 3X17A 1DVFC 3QUZD 3QH3A 2FL5B 4JGUA 2Y25A 3RTQB 1U6AL 4JFEA 4I18A 2FJHA 1XCQA 1AE6H 4MXQC 2NQCA 3UAJC 1A14L 4GQ9H 2CIKB 2I9LB 3VJ6A 4M7LL 2AJYH 2FR4A 1U0QA 2A83A 4G6JH 1KN4H 5D72H 2FH6A 2DRUA 3K80A 2NYYD 1GHFH 5F96H 4ETYA 3S3SA 1MUJB 3RL2A 4LSVH 3L1OL 4JFPB 4MZ3A 4O9HL 3GM8A 4U6XB 3LV3A 3MNWA 4MJ2A 2WW8A 4U1IB 4FQPA 4K23H 5F8QC 4JR9H 3VMPA 3GSQA 1WCQA 4PGEA 4N5ED 4TVPD 5EB9A 3CDCA 5AG9A 1EHAA 4R90H 3MRKB 1J0JA 2WV3A 3E6FA 4UOW1 1ZLVK 4I0PB 2L0DA 3MRLA 2DQIH 4XB7A 5IV2A 3VGAB 3LPGA 1N6QH 2YA2A 4Y88A 2E7LC 4PJEB 1IC4H 3HN3A 2P24B 1YNKL 1QLRB 5DUPL 3DURB 3QJFB 3FQNA 2DYPA 4KVNL 1BOYA 3K2UH 3IKKA 4UIMB 3BRDA 4HEPG 4YH6A 3BP6A 1E6OH 2FB4H 3FO0L 4IRSA 1S5HB 4RZCA 2B1AL 5INDA 1HCFX 2IEPA 3C60D 4Y5YB 4F57H 1KLGB 3TA3D 1WBZA 1FZOA 3QEQB 4L3CA 1CVRA 4EZMA 2P5EB 1SEQH 1E27B 3WFDH 1MFBH 1XF2B 4ZFOL 2C1PB 4OFYD 4S10A 1S7XB 2OL3A 3FCTA 4HF5L 4NQSB 1MFEH 1IM3A 4N8CL 5E03A 2IFFL 1MJUH 1K85A 3BHBB 3DYPA 5EO9B 4HUUA 1IEBA 3B83A 4JY5H 2J7LA 3EW3B 5FYLE 1HSBA 1TZIB 4XPGL 2ADFL 1WGOA 4MSWB 3RVUD 4KRMB 3QIBA 1RIHL 4JZOA 4M5YH 3T8XB 3P2TA 2WWKT 4XXCC 4KKCC 4LHQB 2UY7A 1HDMA 1F6FB 5ACZA 4JCMA 4P23B 2BDNH 5HHQB 3RQ3A 3I02B 4ZO7A 3S5LB 4W4OC 5IMOB 4LKCB 1RJLA 2OTWB 3S37X 4QHKI 2M26A 1A4JA 1YPZE 5C07E 1C5CH 1HNGA 2JJWA 5J12C 3Q2CA 1QRNE 1YN6A 4E41D 4L3EB 2Z93B 4YGAB 5I1CL 1JNNH 2KUTA 2ESVE 1P4BH 4MDIB 5IEKB 1JNHA 1MI5B 4PP1C 5F1IA 1OAYL 3TT3L 5E1AA 5CIPB 5B38G 3C2AL 4PJ9D 2VMFA 1PKQE 5FYKU 4L4TE 3UTTD 4PJCE 3F12A 2BVUA 2D7QA 1C8PA 4P3DA 3KLAA 4Y1AD 1CQKA 1IGMH 4PRBA 5DZOA 5I15H 4A6YB 5GJSH 43C9A 4G8FA 1WEJL 1BEYL 1IBGL 5C0GB 1IC7L 4IOFC 1G1YA 1S8DB 4HWEL 2OXHA 4OGZA 1EO7A 3C5ZD 3KLHD 4D9RD 2PO6A 3UZVB 2NTFB 3MLSL 5IB5B 4PJ8B 4PJFF 4U05A 1X5IA 1LP9E 1G9EA 4OZFB 4HWNA 5D2NB 1ZGLP 5JO5B 3GMNB 4KH2A 1QSEA 4XPBL 1MHHB 3CZJA 3CXHJ 5I1DB 4RMWA 3RVXD 4XCFL 5H35A 4HW6A 3TBYB 3WMSA 4KV5F 5KSBE 2XN9A 3UC0H 2YS4A 4PJFB 4RAUA 1YEJL 2DTSA 4B50A 1U8PA 4QRRD 2CQVA 4OFIA 2R4SL 1WAAA 3NH7L 3U9UB 5I1EL 2YA0A 3OJMB 5HGHA 3WUWA 5DQDL 3RA7L 4JFQA 5C0AE 1EFXA 3MGTA 4Z95H 5J1AA 3OKMB 3BJ91 3RVVD 4TTDD 3BWAA 2ZJSL 3ILQC 3GJFA 4NZUH 4CN6A 1L6ZA 3OAUL 4IS6B 3G6DH 4OD1H 5HPMB 4C4KO 3FB7B 4HKJA 4ZUVB 2DL9A 1DBJL 5J56B 2E3VA 3W2DH 1A7NL 4Z76B 4Y19D 1NKRA 3ES6A 3NTCH 4LAQL 5ESQA 1D5ZB 5E4IA 4Q97A 3KPLB 4HX1B 3UTSA 1C1EL 1KFAH 5A16B 2X4TA 3D39D 4XNYH 4N0YH 3VXUE 4IHOB 4UDUA 4KXZH 5D7IA 5E7BA 2D31A 4N9OB 2HTKC 4YHOH 3CZFB 3QPXH 2UVEA 2VABB 1CFBA 4WWID 4UV7L 4GO6B 3JTSB 5FYKH 4HKXA 4LSQL 4C57C 1CFTB 3B9EA 3VG0H 1HWGB 4JDTL 5FHAL 3U6RA 1U93B 1A7QH 4I2XE 5HHOD 4G8EA 2P44B 4IMLA 5F7DB 2OTUB 1ITCA 1M6OB 3HG1A 5GGVL 4N0FB 2H2SD 1QEWA 3NIFE 3C5JB 4D8PA 1CN4A 3MGOA 5CEXA 3WIHA 2BHYA 1WSST 3FQWB 4P2RA 1WWWX 4PJ7A 4H26B 3O2DH 5K9OB 3CMOH 1KPVB 1KPUB 2EC8A 4XVJL 3ULUL 3U79A 5JHDA 5JA9A 4FTVB 4GXUM 1JCKA 4Y5XC 1UM4L 1J87A 4NQCE 2Y5TB 5IGXL 3LKQA 3LN4A 1I75A 3O41A 2J1KA 4R0LB 2VISB 3VFRB 4XX1E 3W5MA 5DHVA 1UJ3B 3LKOB 2JIXD 4LOUD 1U8QA 1W72B 4JRYD 4Y4FD 3OXSA 1N0XH 1MPAL 4PFEA 1L4IA 3OKEB 1P7QB 3D25B 1A1NB 5D1QA 5IR1B 1EXUA 4ZNEE 2ATKA 4QRQA 2Z31D 1YZZA 1MHEB 3VDCA 5DEFA 5LVEA 2DQHH 3ZDXF 2NZ9C 4HK0A 4QRPB 1T80A 1ZT4A 2PW1B 5D71L 4GT7A 3QIWA 5SWZE 5FUZL 4BFIA 2DMKA 2GAZB 5CEYB 5E95B 1AQDA 1YECL 1Q9OB 5FO8A 1J9CT 3RZCD 1AR2A 2A38A 3DV4A 4F33B 1JGUH 2F54E 3H0TA 1H15B 3B5TA 5DJXB 3MXWL 1ZLUH 2VLLB 2FZ3A 4HS8H 1G7QA 1KTRL 3QWOB 4U7SA 4N0UE 1XCTB 1HYSD 3S34H 1U8IB 2J4WL 3QDMB 3N9GL 5ERWB 4XGZB 1YYMH 3MA9L 5B38B 1PLGL 1V05A 4LSRL 4NQVA 1MY7A 3BEVB 2E9JA 3C8DA 4UTAL 3OR7B 4LBEA 2R0LL 1KEML 3QT2A 1RQ5A 5GRUH 1O7VA 4L4JA 4N8PA 3ZZ1A 3LQZA 3ULVC 5HI3C 4AM0A 4RRPA 3ZMRA 3ECBA 2AVGA 4NC1E 5H2BB 1H5BB 1UJTA 3KHQA 4MA1C 3UBXB 1ADQA 3GSVA 3B3IA 3FQRA 1JK8B 3GI9H 2IMNA 3V4UL 5IMKA 4YDJA 2ZNXA 3W5NA 3TM6A 3QDJD 4YDVB 3GSUB 4DCQB 3BKML 4OFVA 1ZVSA 3SOBL 2W9LA 4LSTH 1G6RB 2WQRA 4OM0H 1L7IH 3W81A 4NC2B 5I6XC 5T33L 1J8HE 1VA9A 4NN5C 1BGXH 2BVQA 3TBWB 3TNNB 2F8OA 4ONFL 4GAYA 5EC2A 5CFHA 3THMH 2ADJA 4U7KA 4CGTA 5MHSD 5C0CA 3G5ZA 4FQIH 5IJVB 1N64L 3IJHB 2DMBA 5DVNA 5T3XH 1HCVA 2XRAH 4YHNA 1MH5A 3ULSB 4UDTA 2IG2H 4O51B 2APXA 2G75B 1X3DA 4QHLA 1Z0MA 2X1WL 3ARGD 1CFNB 1RK0A 4K8RC 1UYWL 2YK1H 3FRPG 3DWTA 5C9JB 3FMGH 3T1WA 3ZTJH 3CFDB 3P4MA 3O3BB 3QULB 4LGRB 5IQ9A 4JJ5B 3WV0A 4OLZH 3GMPA 2IANB 4QXTA 3VMNA 1CD1B 1MJ8H 3MRGB 2UV3A 1H0DA 5K59F 3TJEL 3MV7E 4JDZB 5LQBL 1NGZB 1I85C 3FL7A 1T5WA 3L3JA 1Z5LB 3U1SH 2G9HB 5FYLH 3W9DA 4HIIB 1S5IL 4UINH 4J4PA 2V2TA 5I66B 1MWAA 3VFOB 5C6TL 2F8XC 3MV8A 2BRQA 1RMFH 5J57B 2QQQA 2WBJC 2GEEA 3LHPH 4BQ6A 4NQDB 5FV2A 5BRZD 1X4XA 3V7MA 1A6UH 1KXTB 3KYOA 3L5XH 3RGVC 4U1SA 1J05B 1WITA 1CE6B 2OR8A 2MHAA 2OSLA 3RHWK 4ODHH 3LS5H 2IH3A 1FE8L 3UYRL 4R7DA 4GMSH 5CP3A 2XPGB 4LCCC 3IFPA 5CEZE 3DX7B 3PP3K 3BQUC 1REIA 2OR9H 3UPCA 4AH2A 2DQCL 2XQYG 4ODWB 4WO4C 3SGJA 3VG9C 3P11L 1A7OL 4U1HA 1Y6KR 2BERA 1JPFA 1DQQA 3H9SE 4LRNH 2VDOL 3MO1A 1Q1JH 3RBSA 2D7OA 3T0XA 4Y4KA 1WWCA 4MA3A 5D7JC 4O5LL 4YHZH 2MKLC 3HCVB 1FFRA 1HHGB 5KVFL 4H8WL 4JFOA 2BK8A 3O11B 5DHYB 3WO3B 4LHUD 1RUPH 4YXLL 1IGYA 3ARDB 4KHXL 4OJFH 5JHLL 4F37F 2Q87A 2XA3A 3JWDH 1OW0C 4WW2C 3SQOH 3VFPA 1R3JA 4XBGB 2XA8H 2YD7A 1NFDA 1AP2B 4JG0L 4I48B 2VITB 5HYEA 1T83A 2QADD 1QNZL 4KKLC 1XGRB 5IVZA 2ID5A 1G9MC 3EYUH 5FO7A 5LBSH 2AP2A 4JY4B 5CBAB 1TETL 3BDYH 5E2TL 3SDDA 5DRWB 4DW2L 2B1HH 5JOEA 1OM3H 2AV7B 3HNVL 5EDXA 3NCJH 3ARFC 3E2HB 1MCNA 4CAGA 3NCYS 4CBPA 4MNQD 3BUTA 1RK1B 3HNTL 1OF2B 4RFNC 3RWCA 3JWOC 1GAFL 4NGHH 2VZVA 5C0IB 3ZE0E 1HHKA 1OPGL 1II4E 3EO1B 3QRGL 1K2DA 2IQAA 1T66C 5C09B 1TJIL 2Y36L 3B2UD 1X5FA 2OZ4A 2PR4L 1YEDA 4XWOD 2EDDA 1NGQH 3NPSB 4Z7VF 4LLAA 2DI9A 5ESAA 3KPOB 1NCDL 3MLWL 3OBAA 2BNRB 2F5AH 3HKFA 1C5DA 4JHWH 1MCDA 2J12B 5J13B 4ZFZB 4GRLC 1OWRM 3EO0B 5FUCE 1EVTC 2NY0C 1KULA 3O6KH 4NO3B 2X4QB 1WAAE 3QUZC 4Z7VB 4PG9B 4TNVK 3ULUD 1HHIB 2IPTH 1M7XA 3CK0L 4PJBE 3T4YB 4R4BA 2XACC 2X4PB 3RY5A 3KHOA 2P5WD 5GGQH 4M62H 1I4FA 5BJTB 5JW4R 3NPZB 2HYMA 2R4RH 2K1MA 5FAAA 1T1ZB 5I17A 3S88L 5INCA 3VD7A 5SV4A 3D2UD 3PDDA 1T7VA 1OARL 4LQFL 1C7TA 1IC1A 3QI9B 5B4MC 1K3IA 2H2PD 1XF5B 5DJDB 4OD3L 3SDAD 5DA4A 5HGDA 2WINB 5IMMA 4QO1A 5IQ7H 1SJHB 4HHAA 4XAWL 2C9AA 1QFPA 1MI5E 6FABL 4OLWH 4R97B 1DANU 4JFFA 1X5LA 1IKFH 3QEHB 1I8KB 1S78D 1KJVA 2K3TA 4PREB 1T20B 5C08A 1LNUB 4PBXA 1IFHL 4LSDA 4F7MA 2EYSB 4L8BA 3TIEB 5TF0A 3U4EB 5GZNC 4ZPTB 4XCYB 2FGWH 4PY8J 1EZVY 1UCBH 2C1OA 3PWJB 3HMXA 4LLQA 5E8PA 8FABA 2IBGA 1AKJD 5CMAB 3EFDH 4K7FA 3WHE0 3GIZH 5IW1A 4DEPC 2YRLA 1F45A 4LPWA 4OCNC 3OSKA 1A1MB 4NQXA 4X7TA 3DGGA 3FO9A 1WWBX 2BSSA 1EHXA 4E41A 2FH8A 1NFIA 4JRWA 5JW3L 4HXAH 4Y5VB 3L3GA 5D2NE 3C60C 1QOKA 1SM3H 2JKXA 3OKKB 5IROA 3TA3C 6CGTA 1IM9A 1CZ8L 3GUTA 1VGKA 3ARPA 4ZUSB 3NACH 4QOKB 4PJ9A 3CCHA 4PGCA 3I84A 2NXYD 3LN9A 1N26A 2J88H 2PYEA 4NKMB 3ZYJA 2F8VA 1D5XB 3UTTA 1HINL 4EBQH 1U8NA 1E4KA 4Y1AA 4AY0A 3QNXA 3UTQA 3L5WA 5I75C 1JHLL 4YGVA 2X1PA 2NY2B 4KV5E 1KG0A 2FGZA 3AAZA 2HJLA 2PTUA 1M05B 2Z8RA 4XPFH 2C3HA 2RCSH 4OD2B 5GGRB 3D85D 4EUPG 1BMGA 4PRPA 3CDYA 3RJQB 4OCYL 4EIZC 4UT6H 2FRGP 3V5HB 3FOMA 1S7VA 1P1ZA 4YBQD 5EOCL 3TCLB 2QHRH 2V17L 1MIMH 2LTQB 3R0MA 3QXVA 3HZKB 3LVEA 1UA6H 4IRZL 1W0WB 1IZJA 3ALXA 2YD9A 1F4WL 2MCPL 3MNVB 4AK1A 3MJGX 3MRHB 5TH2B 3T2QA 4P5TD 3ZHDA 4MJIB 1INQA 2HFGL 2JE8A 5EZLA 1R3HA 4O02H 3U4BL 1D7FA 4HUWA 3RX7A 4CL7A 1KJ3H 4GAGL 4X9HA 1FAIL 2IBZX 2AKRB 3FT2A 1VGEH 3PWNA 2A6KA 2P48B 4HV8A 4ZODA 4OV5A 1RFDH 2OK0H 2FX8L 2I5YL 5CINL 2YD6A 1A6PA 3U2SA 3X11B 1JWUA 3PGCB 4BZYA 1EJOH 2CGRL 1N8ZB 5EU5A 3BISA 3K1DA 2EH8H 3FT4B 3EDKA 1A6AA 4WI8A 1ITBB 4KFZC 5I1IL 5GS0D 3ARXA 1ORSA 2GT9A 2D03L 5L9DH 3D39A 5EFIA 2UZIH 3LD8B 1U3HB 4FTVE 2XTJD 4IMKA 5GGTA 4PJXF 3HE6D 3MJ7B 1GRWA 1C08A 3C5ZC 3KLHC 4P2OB 1UM6L 5AZEL 4JFHD 4KMQA 1HK6A 1LD9A 4UI2A 1T03H 5DJAB 5TQ2L 4YHML 2F58L 4HPOL 4LASL 1ZLWH 3V4VL 1GIGH 3UXFA 5CGMA 3GSWB 3K46A 4LCYB 1KB5H 1VKXA 3RIAK 5GSVA 1NCUA 2VN4A 1OD9A 1QBMH 2EO9A 2BOBA 3VFVA 3ZDYF 3KJ4B 1ZOXA 1R0AL 5JNYB 4Z6AT 2HWZH 2R0ZH 1G7HB 2DLFL 2QHLA 4HCRH 1QG3A 3PL6B 2JJSA 4ZUUA 2FSEB 1TFHA 2NY3B 4AEEA 2HP4A 3EYSL 4PLKD 3QUMA 4NRZB 4TTDC 3GRWA 1S7SB 5CEZH 4MDJA 2DB8A 2LQRA 3IDIA 1CICA 1FBIH 5KS9A 3B9DA 4ZQKB 2BNUA 4OQTA 1LE5A 5JXAH 3R0NA 3DSFH 4BKLA 4J3XA 2YEZB 3GO1H 2JIXA 1HEZA 4KUCD 3LCYA 2AK4B 2EDKA 1HQ4B 4G43B 4GKNB 1WIOA 1MNUL 3VRLE 4ESKA 3VXNA 5FKPA 5C0RH 1MCPH 4NUJA 1BBJA 2VC2H 2EKSA 4NNXA 1RZ7L 5FDWA 1G7IB 5EA0H 2N1KA 1BHGA 3ARBA 3RRQA 3X13A 3BWUC 1KCUH 4D9QE 4ZO9A 3QUXD 3M45A 1DE4A 4D0DB 1M7DB 1K6QH 5JW4Q 2CMRH 3ROLA 5C3TA 1V8HA 5IHLB 4MXWL 1VEPA 4S11A 3WFZA 5I74B 4YXKL 2PXYD 2H2SC 3RKDC 4AEIL 1AI1L 5KW9L 5D7KE 2X70B 2ADIB 3B5HA 4OGYL 3R1GH 4CW1A 4HGWA 1FYTE 1MLCA 4WFEE 1NDGB 5MP6H 3N1MC 1NUFA 1OB1A 3R4DA 4WNQB 5E8NA 4ZDHA 3GIVB 3ROOB 2ZSVA 3K8LA 5TE7L 2F19H 4LF3A 2GTZB 4KI1A 4PTUB 1Q0YH 4U1KA 3PWVA 4G7VH 4KRPB 5KSAD 4OFKA 4QF1B 2D4FA 2OI9C 2VLRB 4JFXA 4DGIL 1EHLH 4EUPB 1CT8B 1G7PB 3K8MA 4Y4FC 3LB6D 1TJHL 5HDQH 4OGXH 2XKSA 3QIUD 3IKCB 1T7YA 4Q58C 3V6ZB 3KPRB 4M5ZH 3LEVL 2YPLB 4F3FB 1VFBB 5E94B 3HC3H 1T22B 2Z31C 5DO2D 1NDMB 3REVB 3JUYA 3DVIA 4L29A 1U8MA 4HBCH 4GLRI 2W92A 1MCWW 4IRJD 4ZD3H 1S9YB 1TTGA 1RULL 2V9TA 4HGMA 4LLWA 3INUL 5C71A 3RZCC 1XGQB 5EBWA 2GFBA 2A6IA 1UM5L 1NFDE 5E2UH 3GSOA 4DVBA 1XGYH 2PUQT 2VAJA 3BEWA 3O4LB 1X5GA 5GS3A 1P2CB 1RJZB 4QTIH 4ZFOA 1MQKH 1CG9A 3ARGA 1BZ7A 4C83B 3P0GB 1T2XA 3NFPA 4JM2B 1PEZA 4NQDE 4HSQA 4HBQA 1V3KA 4M4PA 5CD5D 4LVOC 4Y0GA 2XKNB 1NMCC 3AB0B 5FECB 3E8UH 2R56L 4ZYKA 1ZMYA 5MEND 2B4CH 3GMLA 4NHUA 3QH3B 1E4XI 3MYJB 1HE7A 3TBSA 5IOPA 4EVNB 1WFNA 1CU4H 1MCQA 4JFEB 3G5XA 4I18B 3I6LE 2FJHB 4OB5L 1RV6X 5EU7C 3AY4A 1Z2KA 4V1DD 2DDQH 4JRXD 3VRJA 3VJ6B 4YHKH 3C8KA 5IFAL 2FR4B 2A83B 3WUWG 3LQMA 2F15A 5DF0A 2C26A 3DX8A 3Q6GL 3CFKA 4NUGH 5CIPH 5KG9A 3MACL 5IBUG 3VGHA 3RL2B 2J8OA 1A7RH 2PN5A 2GJZA 4P5MB 1A3LL 1T1YA 3MNWB 3LV3B 1T7XA 3BDBA 1H3PL 5HHPA 1RHHB 2A77L 4U3CA 3GSQB 4A6YH 1OP9A 2R1XA 5JOPE 5EZIL 1MAML 3WS3A 1N2RA 3E6FB 4MD4B 4NZJA 3NGBB 3FHAA 1WVZA 3MRLB 4ZS7L 5C0JB 5IV2B 1K3ZA 3ARRA 3KYKL 5K33A 4M00A 4FQ1L 1EUUA 5C0BE 4YC2B 5IB4A 4OZFH 2VAAA 4PV8B 3MLVH 4R96A 1I1AC 4JN2A 2CRIA 4OT1L 1KJMA 1FFOA 3AVEA 5GGSY 2DQGL 4ZOCA 5FYJL 5IKCA 5JDSA 1SYVA 3KNBA 1FVCA 3C08H 1LEGA 2HFTA 4IRSB 4XPHL 3WJLC 5C6WH 3VXSE 4PV9A 4XNMA 1OAQH 4PJAE 3S37L 1FZOB 2JELH 5E8OA 4JREC 3VXQA 3HC4L 1LDPH 1FDLL 2W9EL 2A9NL 4TRPH 4Q9RH 1P5UA 4JFFE 4Z8FL 3AMLA 5IJKC 1ZK9A 3CX2A 4XPAH 2BHUA 2VIRB 3KVQA 3T77A 4HIHB 2X44D 1OAZH 3FCTB 4XMKL 5E08L 1BM3H 1EEZB 3MA7B 1G6VK 2LU3A 3A6BH 2Y5EA 5FXCH 1F4HA 3RWDA 5F3BA 3QDAA 3QB7C 4KK6C 4HUUB 1CTNA 1JF1A 1ZHKB 4PJ5E 3G6JE 2HVJA 3U7WH 3BD5A 2APTA 1IGTB 1AC6A 1HSBB 1NGXB 3KPPB 1AE6L 5I8EA 4K94C 4JFZH 4Z0XA 3EGSA 4GW1B 5ACZB 1CTOA 2AJYL 1WICA 1BF8A 4G6JL 2BNRE 1U2HA 1IC5H 4UV4H 4U33A 3STLB 5D72L 5F96L 3SDCD 1RJLB 4QXUH 1D9KD 1A4JB 1NCBH 1GGIH 4OAWA 4ALAL 4LSPL 1RZJH 4Z7VE 4K23L 4JR9L 4MNQA 3PQYA 4EDWH 5JUEH 1J18A 1JUFB 1YN6B 3MRBB 3F5WB 3BO8B 3IF1A 2XWTA 4R90L 1N6VA 12E8L 5F1IB 2LAAA 3EOBA 1EEYA 3L3DA 1VFUA 4X99A 3GHEL 5E1AB 4U1JA 4U3XA 5B8CA 5AYUH 1N6QL 3ZE2F 3BN3B 3ELAT 2QSVA 4FQXD 3MXVH 5I1KH 4DZBA 1JTPA 1IC4L 4P3DB 3KLAB 2R2EA 4I3RH 1KOAA 4PRBB 3VFGL 43C9B 4G8FB 3K2UL 4YEEA 1HHHA 4RRPG 2MPAH 4OCWH 5IB3A 1TNNA 1E6OL 2FB4L 5JW5A 2VRAA 4X7CC 5JMRA 1ND0B 2HLAA 1J1XH 1P9MC 2PO6B 1R5VB 4F57L 2Q86A 3QDGE 2AV1A 2PTVA 5M7QA 1UH3A 2EIZA 3T0ED 2DBJA 2QADC 2EC9T 4WEBL 2P5WA 1QSEB 4L8SC 4R8WH 3GKZA 3WFDL 1MFBL 1AGDA 2ZSWA 3L7EA 4HC1H 4QWWD 3D2UA 1I8MA 3KR3H 1MCBA 3SDAA 1U8PB 4PR5A 1AO7A 4MD0A 4X6EB 5J89A 3WUWB 5HGHB 4JFQB 5L2KD 2GCYA 3FQTA 1EFXB 3MGTB 1NSNL 4JY5L 5J1AB 1KT2A 5IBUB 3RWJB 3VCLA 3BWAB 4F7CB 2Y7QA 3NA9L 4Y5XB 3EDFA 3GZKA 5EIQA 1TQBC 4J12A 4NO2A 3BAEL 4M5YL 4NKDA 5C8JA 5CJXA 5D7IF 5GGSA 1GZPA 2VLKE 3B2UC 3H9ZA 1I9IH 3VFUA 2GHWB 4XWOC 3QXDB 1JZ3A 1WCBA 2MQ0A 1AKJA 2D7MA 1J0KA 5IVNA 3UTSB 3D0LA 5CZVH 3OGOE 4RBPH 4M93B 1QFWM 2X4TB 4QTHA 1C5CL 2ITCA 2NW2B 4P2QD 5D7IB 5CZXD 2AJZA 2D31B 4OZIF 4CADB 1JNNL 1IGCH 1G6RH 4HKXB 1P4BL 2V7HA 1CDIA 1FJ1A 5DJ6A 4A2MA 3HB3D 3U6RB 3SHSA 3BZDA 1SVCP 1I9RL 4NBYB 2VZTA 3FN3A 4LMQI 4PUBH 2DQEH 5TPWH 4IMLB 2J5LC 4OZIB 1GH7A 5B22A 4WI3A 3HG1B 2WSKA 1IGML 4LCIH 1QEWB 5I15L 1T1WA 5GJSL 1MAKA 4EN3D 3MGOB 4I13B 5CEXB 1U8KA 1F13A 5EBMA 4N1HB 4LVNB 4FQLH 4I3SH 4OLYL 3SE8H 4R7NA 4UILH 2BNQD 5JHDB 1I1FA 1ZHLA 4HZLA 2QSQA 4RGND 1OGAE 3QEGH 4Z9KB 3UTZA 3O41B 1KPRA 2P5ED 4P2YA 4MA1B 2ZUTA 1UWXK 4WGVB 5DHVB 2YHGA 1YN7B 1U8QB 3UC0L 5MERA 4X83A 4UAOC 1EEQA 3QEUA 4K55A 2BRRH 1EXUB 2R0KH 1W0VB 2ATKB 4QRQB 2P8MA 4Z95L 5ISZD 5DEFB 3S6CA 3QIWB 4HKZA 4EXKA 4F7TA 3R8QA 1BBDH 3U0WH 4A2LA 1AQDB 1IKNC 3U0TA 3DPBA 3Q6FA 5FO8B 1J7VR 3DV4B 3G6DL 4PJXE 4U1MA 2VZSA 3H0TB 1QFWI 2NXYC 4LDLB 3VXRD 4KQ3H 3NTCL 3QAZC 1FFNA 1TQCC 4HMEA 2VB5A 3I9GH 4G3YL 2JK5B 4XNYL 3ZT7A 4NQVB 2IALA 4OCSL 5CJBA 1BQLH 4N0YL 3PHOA 2IJ0C 1KJ2B 1RZKH 3W0WA 4G8GE 4KWUA 3QPXL 4NT6B 3K3QA 4LBEB 4HUMB 4OCMC 4S2SB 1ACZA 3TF7C 2GYSA 4S0TD 4M1GH 3QYCA 5FYKL 5DK0A 2OTPA 3LQZB 4Z7WA 3ECBB 4X9BA 4GBXD 1B0RA 2XI9A 5K9KB 5T5NG 3RHWF 3SKOA 1O5DT 1U95B 1RUMH 5JIHA 1A7QL 1R6VA 3RDTD 5EO0B 4YBQC 4WTWA 1F11A 3IU3B 2APVA 2EDJA 5F89B 3FQRB 3OB8A 5IMKB 1T1XB 3HLAA 1J11A 4Y8DC 1ZVSB 5MEPA 4GH7B 4P5TC 5ICZA 4XH2A 3PHSA 5F7YC 5DQ9A 4Z7NE 3CMOL 4Q9QH 4CMMB 1IQWH 1Q38A 3KYAA 5KAQG 2BVQB 4L4VE 2F53A 2OP4H 4NQED 4XCNB 5HYJA 4GAYB 5HI5D 3DV6B 2RQ8A 3CUPA 2ADJB 3LSOA 3V7AE 5CJQL 3MBEA 1UXWA 5C0CB 3G5ZB 3RGVB 5TQ0L 4MAUL 4K7PH 1CLYH 4X6CE 4YHNB 1MH5B 3N85H 4UDTB 5GS0C 1PJ9A 4QHLB 4LCCB 4W81A 5A3ID 2P1YA 4PRHD 5DR5H 3BQUB 4LLYA 2JB5H 1B4RA 4MZ2A 4JQXC 3IJSB 5HDBF 5IESH 5IQ9B 2DQHL 4WO4B 1A2YB 3UJIH 3UYPA 3VG9B 3HE6C 1EJ6A 3GMPB 3NAAH 3LRHA 5DC0A 3U0PA 3IAQA 2XWBA 4NZDA 4JKWA 2W60A 3VE0A 2QEJA 4D3CL 1UH2A 1JGUL 2H3NA 2BSTA 3AREA 4WDIA 2ZCHL 5D8JH 4WW2F 2Z9TA 4XAKE 1T5WB 3L3JB 3OHXA 2YPLE 2YSSB 2BVYA 3S34L 2PXYA 1DLFH 5I9QB 1Z0NA 4TUJA 4Z18A 1AR1D 3NIGF 4HWBL 2ZP0T 4Z78A 3OAYH 4C4KT 2R2HB 3QHFH 3ESVF 5GRUL 4WW2B 3EZ8A 4PLKC 4JANA 4WJ5B 4MQ7A 1AGCA 2LU7A 3KYOB 4X6DE 4FRWA 4R2GC 3KXFD 2M2DA 2NY1B 4RMUA 4U1SB 3ZSSA 4X5LA 5KVDH 5C9KA 2XTLA 3WNKA 2OSLB 1MIEL 1CLCA 3GB7A 2NLJB 3GBMH 4I3GA 4ZAKC 2O61A 5F6IC 4MWFA 4R7DB 4KY1L 5F3HB 4NM8L 2R39A 3IFPB 2J8HA 3FT3A 3PV6A 4LSTL 4NKIH 4ZUWB 4WTZA 1L7IL 4AH2B 2Y07L 3VXMD 1ZKAA 1BGXL 3O3DA 4M43H 4TNVF 4QRUB 1KLUA 2ZKHH 2P8PA 4WHYH 4D2NA 4IRJA 1Z9OA 3BKJH 1OVZA 1JPFB 1DQQB 1FNEA 3ARYA 3MO1B 4LSSH 1QSFD 2I60H 3QUXC 4RAVA 3L7FA 4Y4KB 3SBWA 4MA3B 4BSWA 3FKUS 1BVKB 2IG2L 3QQ3B 1KTKE 2H6PA 1RZFH 3B6SA 1A6ZA 5I1LB 1IGYB 4KK8D 5AD0A 2YK1L 1RZGA 3FMGL 4ISVA 1HSAB 4ACPA 5I1AA 5J06A 3IJYA 5FKAA 3LMJH 5E2VH 5SX5K 4OLZL 2NY0B 3VXTA 3VFPB 3SJVE 1R3JB 5T5NF 1WZMA 5MENA 1V3LA 5ABDE 3QUZB 1MJ8L 2AI0H 1AGFA 3WJJA 4IIQA 5HJ3A 1G1CA 3T0DA 5KSAC 4DK6A 3VWJC 4LVHB 5IVZB 1ZTXL 3UTPE 5C2UB 1KXVC 5FO7B 3O9WD 4JQIH 5DMYA 3U1SL 4JKKA 5FYLL 3QIUC 4UINL 2AQ1A 3JVGC 2ADGA 5SWSA 2VERN 1ZSDB 5I8OH 2W0KA 1QPPA 3BPLC 2VXQL 4KHTL 4K7PX 1LK3H 5F70A 5D93B 5F1KC 3LHPL 1DBKL 1JHTA 4LCUB 3RWCB 4WI4A 1U3YA 3L3OA 2CO7B 4H0HB 4OZ4A 3HNSH 3L5XL 2H45A 4KDTC 3FAXA 4Q6YA 5IM7A 1AHWA 4PLJD 4GS7C 5EPMA 1K2DB 2IQAB 4ODHL 3LS5L 2G5RA 1YEDB 3P9MB 1HH9A 4WWKA 1TZHA 4OKVA 4UZGA 4YO0B 5ESAB 2CK2A 5D1XD 2M1KA 2OR9L 3GSXA 3DHJA 5DEGA 2VLME 3V0VB 3LRSA 4WI5A 3X14A 3PGFH 1K8IA 3QFJE 4DZ8A 2VNCA 1EIBA 1AO7E 4LFHD 3C60B 3T08A 4JZJA 3TA3B 5CJ5A 4LRNL 1Q1JL 1QFUL 2HG5B 4R4BB 3JV0A 4ODVH 4H1LA 4YHZL 2W0FA 1I4FB 5KSVA 1FG2B 2Q1EA 2AEQH 4LCWE 1RUPL 1QKZH 4P2CG 3G04A 5E56A 1JZ5A 1ONQA 3MV9A 3TEUA 3IU4H 4S1RL 1SQ2N 2WWKO 4OJFL 1LEIA 5IVXA 3HA0A 1NGYA 2ICWA 5LGJB 4L1HA 2VE6A 3JWDL 4AT6B 2QLVB 2IAND 1XIWA 1L7TH 4ZXBD 4G42A 2VDKH 4YE4H 4C56E 2PTTA 3SO3C 2X7LA 1ZLSH 3VXPA 1OHQA 4JVPA 5C08B 4F7MB 4JFDA 4Y8AA 3NCBB 3MR9B 2VDRH 3EYUL 4YHYC 5LBSL 5I73B 2C1OB 1LQSR 3CFIC 1NGWB 3BDYL 2CR3A 5E8PB 1URLA 8FABB 3QG6A 2B1HL 1OM3L 4FQJH 3NCJL 1JZ4A 3M1BB 5C0FB 4M1CD 1F6AA 3IDMB 1XZ0B 4RFEA 5IWLA 4YEFA 4NQXB 3DGGB 4IOIA 3FO9B 5I18H 1KCVH 2ZUWA 4ZS6C 3TYGH 1LK2A 4E41B 1ERNA 1NFIB 1ODAA 3NIDE 3FQUA 3L3GB 4NGHL 1XGPB 1L6XA 3GUTB 5F97E 1DEDA 3QHZH 2ERJB 2VKXA 5DD5H 4XMPH 3RIAF 5F9WC 4WFGD 2AGJH 4CUCA 4PJ9B 3CCHB 4FQXA 4WUUE 1NGQL 3UTTB 4DKFH 3AC0A 1U8NB 4Y1AB 4YJZL 3S97C 5EZJA 2DL2A 2F5AL 4JHWL 2FO1A 2HJKA 3L5WB 1PW3A 5F21B 3HE7D 2HT4C 2NY5C 3DX6A 3NN8B 4PS4L 3SY0B 3O6KL 3P4NA 3BGMB 2K7QA 1GOFA 4O2FA 1FL3B 2IPTL 2CUMA 2MJWA 4LPTA 2XNAA 4G9FD 3PABA 1HKLH 3FOMB 1S7VB 4M62L 4MA8H 5EU3A 5M95B 3KLSA 2R4RL 2VZ1A 1PY4A 5HBBA 3C6SA 1H3VA 3RY6A 2DM2A 3C6LC 3GNMH 5EU6A 3SDCC 1YC7A 1D9KC 4MCZB 4QRRB 1INQB 2ITDA 4GSDH 5E2JA 1P53A 1Q9WB 5EULV 5IQ7L 1R3HB 5L2KA 3WNNA 4HUWB 3DMMD 4WHDA 4OLWL 1I8LC 3I3BA 2BFVH 3AM8C 4HV8B 2A6KB 3CSYA 4ZMAT 5DXWA 3LEXB 5HHME 3U2SB 4OZIE 2ARJQ 4WI2A 1P7HL 5EU5B 3LS4L 4Y19B 1DQDH 2R1YA 4PGJA 1A6AB 2EYRB 3FB5A 3EFDL 4GRWF 1ZVYA 2GT9B 4YX2H 3D39B 4EUPH 3MLXH 5EFIB 4EQ3A 15C8H 4XNXH 4P2QA 4NPYA 2VXTH 1ZLVH 3ULVE 1I1RA 3Q3GA 2N7AA 4U7MA 1C08B 1DUYA 1SM3L 4L9LA 4FG6C 2FIRT 4GRWB 1QBLH 2CUIA 3IDUA 3O3EB 4TUKH 4KROD 2HT3C 4G80A 3MYZA 3T0EC 2B8OT 2F53E 4NJ9H 3NACL 5DVMA 3VWKA 3V6FB 5HHOB 2J88L 4Q6IC 4GG6A 1NANH 2XIDA 2HAZA 4EBQL 1JMXA 1BX2A 4LLVB 5DZLA 5EZOH 1WIPA 4PLNC 4MQXD 3HUJE 5F7EH 4L5FL 5H37G 4ODBD 1X6LA 1KIRA 2AEIT 3BD4A 5KS9F 4Y2DC 3DARA 3HS0A 4PGZA 5D7SH 3OKOA 4MA7H 4ZUUB 3BZ4A 2OJEA 5DYOB 4XPFL 3QUMB 4F2MA 2RCSL 2VZOA 1N5YH 2X9XA 4TYUA 2COQA 4P4KD 3MJ9L 3IDIB 1CICB 4UT6L 5KS9B 5MEQA 2BNUB 4OF0A 2AK1H 3FONA 5D1ZA 4NWTH 5H94A 3GHBH 4L8CA 2FJFB 2JIXB 1HEZB 1UA6L 3QI9D 1IAIM 4Y4FB 3WS6C 4JGMA 4NO5A 1Y6MR 2RFXA 1RUAH 3VXNB 4TSAL 3RUGA 5FKPB 2XG4A 4NUJB 4O02L 2Z31B 1BBJB 1KJ3L 2EKSB 5CSBA 5ISZA 4NWUH 1U91B 5FDWB 1G0DA 2IBBA 4QCIB 2J8UA 1MCHA 1JZ2A 3X13B 3MODH 1ZHNA 3O8XD 3HB3C 3RZCB 1LE9A 4K3JH 5HDOA 3U7YH 1EJOL 4LPCA 4NN6B 5JXED 1SVZA 2EH8L 5SX4H 3SE9H 1CFVH 2ZG1A 3DO3A 3LOWA 2R15A 4EN3C 5T3ZE 4CW1B 4HGWB 4JHAL 4GKZA 1MCJA 1MLCB 1ZAGA 4X4XB 1OB1B 1PQZA 4XNQA 2ZSVB 5IB1B 1T04A 4DAGH 5FM5O 4LF3B 4Y5YC 2VL5A 4YLQT 2IPKA 4U1KB 2XQBL 3PWVB 3VFSA 1JE6A 3BXNB 3GSRA 3M17A 3D9AH 4GBXA 1T03L 2NR6D 4QOKD 3RDTA 1GIGL 3G5VA 4JFXB 1KB5L 3TVMD 2KKQA 3DVFA 5CAYB 3JV4A 3RIFK 5BS0D 3S96A 3QDJB 2NMSA 1GXEA 2YD5A 3CDGA 5IW6A 4K3DH 2VLJE 3WNMA 1BD2E 5D7LA 2ESVD 2YPKA 2HWZL 2YD4A 1LO5B 5DJ0A 2PYFA 1RAMA 4HCRL 1QP1A 1U8HA 3L3HA 4L29B 1U8MB 1JF5A 4M61B 1BFVL 3PDOB 1HZHH 1PGRB 5CEZL 4JQVA 4L4TD 2VYRE 4XZUB 1IAII 5HDBE 1FBIL 2UY6A 1WTLA 2VTFA 2CRYA 2Y23A 2EDQA 4RDQG 3X12A 1SMAA 5JXAL 5KN5A 3EO9H 2GFBB 2A6IB 1R3LA 3CNKA 3D87B 3GO1L 5FA4B 3BEWB 4UU9A 3WFEL 4ZFOB 2ARJB 3ARGB 3OZ9H 2B4CC 2MSPA 4JHBA 1RIVH 5E24E 1MCPL 3E3QC 5F7LB 3SKJH 5EWIH 5KSUB 4BZ1H 3JBG7 5EA0L 1T2QH 3L6FA 3K8KA 5D5MF 3B2VH 4NHUB 5JZ7D 4HIXH 4EI6A 1KCUL 3TBSB 5IOPB 4L9DA 4YFEA 4X4MA 3G5XB 3OJDA 2Y06L 2APBA 2Y4SA 3KJ6H 3MRIA 1K6QL 1XF3A 1SBBA 1ETZA 3VRJB 4XBEH 3RVTD 4K2UH 5FA3B 5ACMA 5IIEA 3C8KB 4HIEA 2LE9A 4L3AA 4LARH 5D5MB 3SPVA 1ULVA 3CFKB 5KG9B 2H8PB 3DI2B 3R1GL 1CYGA 2FEEI 5JW4M 1SBSL 1EA9C 1U3HD 4RNRA 4QEGA 4YBLB 1WLHA 4PY8I 3MLYH 3TZVA 5HHPB 2YD1A 4P2OD 2F19L 4TNWK 5BRZB 3EJYD 2YD2A 1TVBA 2NX5E 4PJ8C 5HI5C 4NSKA 4ODUA 1RHFA 4RA0C 3WS3B 4M7JH 1N2RB 2EZ0C 4ODSH 4WEUD 4NIKB 4F9PC 4FNLH 1A3RH 3EKCA 1NUGA 1EHLL 5DRZA 2Q8BH 4RFOL 5HDQL 1EDQA 4OGXL 4KTEH 5EH1A 2WIMA 4MNGA 5FV1L 4M5ZL 4R96B 3RGHA 2X4SB 5GGUB 1YEFH 4D9LH 4KRNA 2R9HC 4Y2OA 5CS7A 2NY6B 1UB5A 3HC3L 4MAYD 5HGAA 1FFOB 5GRVL 5SX4I 5GS1C 2O5XH 3KNBB 5JDSB 1ZA3A 3MV9E 3HR5A 1FVCB 1OLZA 2NXZD 5J1SC 1MRFH 2QR0A 2MOVA 4ZD3L 3PXHA 3FQXB 1FHGA 4XNMB 5DMJB 2LVCA 5E8OB 3RWGA 3CFEA 5BXFA 5HVWA 4E0RA 5E2UL 3CLEH 1XGYL 4G8IA 3QUYA 3T65A 1JIBA 3IGAA 5JA8B 3ORJA 4GRMA 4P9MH 4R4FL 2P8LB 3FZUC 2R0WH 1AR1C 3F7QA 3RWDB 5F3BB 3WL9B 1E4WL 2N4IA 1JPGA 3KPNB 3P30H 2HVJB 3E8UL 3WDIA 3OXRA 3EDDA 3FOLA 1X7QA 1WBXA 1CU4L 5HD8C 2QADB 3P3YA 4Z0XB 2P49B 3EGSB 2DDQL 2AJUH 4L8SB 4BYHA 4FN0A 4YHKL 3HTLX 2CSPA 1MQ8A 3O9WA 5DTFB 3F7PC 4FZEH 1U41A 4P46A 4BH7A 3LEYL 1DUZA 4W70A 4NUGL 4IJ3B 3SDXA 2DJSA 1BJ1J 5J6HA 1A7RL 5SWZD 4BH8B 4ODXB 4MNQB 5FB8B 1N3NA 2F54D 1BZ9A 3VFTA 1INEL 4RDQF 3WIFB 1AQKH 3LQAH 3FFDB 3IF1B 3MRQA 3NZ8A 4KRPD 3ZHLA 4PB9H 3EOBB 1TQBB 1EEYB 2EDEA 2FX7L 4R0LC 4XP9H 3SE4C 4X99B 4JG1H 1U8OA 1CL7H 1UJ3C 4PG2C 1TNMA 1QHPA 5A2LH 4DZBB 3ZE1F 4AG4H 3HPLA 2XKUA 1WUNT 4HPYH 3ULUF 4KK8C 5FGCB 1U92B 1WFTA 1I9EA 4JE4B 5DHVH 1DQJB 2DICA 5DURD 1HHHB 1T6WA 2MQCA 4XVUC 3KPMB 1A6TA 1MAJA 5EU6E 5IB3B 2SEBA 5JW5B 3C08L 4FMKA 2HLAB 4W4NA 1OAQL 3NCMA 4QRTB 2Q86B 3BRGC 2AV1B 4RQQA 2VUYA 2JELL 4YIQA 1A3QA 1OAXH 1LDPL 1YJDC 3CH8A 4TRPL 1EK3A 4Z7OE 1D6VL 1QO3A 2ARWA 2E9BA 2P5WB 5HPOA 4Q9RL 2ZSWB 4XPAL 4BZ2H 1N7MH 1T21A 3L7EB 1J8HD 2IAMA 1QFOA 3D2UB 3MRCA 4DTGL 4GXVL 1BM3L 3ISWA 5D9SB 3VMOA 2EDWA 3ALWA 4JM2D 3A6BL 5ALBL 3SDAB 1DDHA 1CLZL 3QZWA 5E9DE 4PR5B 4MD0B 3ZKND 4JEGB 4PJDA 4O4YH 3IDXL 3JUZA 4TOYL 2GCYB 3FQTB 2ZOKA 3U7WL 4ZXBA 1KT2B 2FWOB 4F15B 1JPTH 2G2RA 1U58B 2Y7QB 2D0GA 4JFED 1KJ2H 2R8SH 4XBPA 1NJ9A 4PLJC 4NKDB 4JFZL 5IP4A 4JAMA 2JCCF 5C8JB 4WW1A 4XC1H 3O2VH 1A1OB 2DIBA 1GZPB 4OIAA 3VFUB 1IC5L 1T7WA 3G5YA 1WCBB 3ALPA 2Y6SC 1AKJB 3IFNH 5TF1L 1P69B 5DDHA 5D1XC 4QXUL 1Y0LA 1NCBL 1GGIL 4QTHB 3FHQA 1RZJL 1ZA6A 2IGFL 2JCCB 1AXTH 1MF2H 5IHBA 5JUEL 2AJZB 2XICA 3V8CA 3HFMH 3MV7D 4RIRB 1FYHB 3SGKC 2BOCB 1ZGLB 1NLDL 4M1DH 5LGHL 1KBGH 1FJ1B 3O45A 1F2QA 4J6RH 2X2YA 2BCKA 3PP3H 5AYUL 3BIKB 4O2EA 3IVKB 5I1KL 3MXVL 1L9MA 5D96B 2X4UA 2Z35A 2FATH 3BE1H 4Z7UF 1AGBB 4YHPA 4I3RL 2DYPD 1TQCB 5DT1H 1T1WB 2HFFB 3TN0D 4H88H 3VFMA 4XP1H 5ESVB 4OCWL 4CN1A 4PD4K 4DN3L 2EE9A 2ORBH 4LLDA 4MD5B 4R7NB 4RWHA 4Z7UB 5HVFB 3RNQA 1J1XL 5HHVH 3RUGE 4YDLB 2R1WA 4QHUA 3MV11 5FF6A 3MUZ1 5C0DB 2GSGA 3WLBB 4G9FA 5T1KD 3QXTA 5HVGB 4PB0H 3KYMA 3NOIA 1AXIB 2JJTA 2DIJA 5D6DA 3KR3L 1CL7I 3QEUB 4YZFE 2CLVA 3DJ9A 3LKNB 3H9SD 2P8MB 3HZVB 4MX7A 1MJJB 2FIKA 3DMMA 25C8H 3K1KC 4M6NH 4XPTH 3HHRB 4XCEA 3UX9B 2YR3A 5HYSG 4PP2A 4F7TB 4HKZB 4AEFA 3QIBD 1EPFA 5HHOE 3VI4F 1FH5H 3PHQA 3Q6FB 1VHPA 3MRJA 5LWYH 3FJTA 1HXMA 1RIUH 1C5BH 3EDJA 4PJHA 1P4LB 5CBEB 1OSPH 3A0OA 1I3RB 1RU9H 1INDH 3LDBB 5CZVL 1MCWM 3HRZA 4M3KB 1AIFB 1G9MH 2XZZA 3HE7C 3TBVA 3NCFB 2VJXA 1CGSH 3PHOB 5F93C 5CP3H 3MCLH 3UDWA 1E4JA 2Q7YA 2XTJB 4HWBA 2GJ6E 5D70H 1HOCA 1IGCL 3HE6B 4KKBD 1G6RL 8CGTA 1JPSH 1Q0XH 3QXWA 1B0RB 1IEAA 3V5KA 3SKOB 1A0QL 5FYJE 1F11B 2X1XR 1MHCA 4JRYE 4PUBL 5TPWL 4TSCL 5A1AA 4J8RB 3ARDC 3OKLB 3HLAB 4LCIL 3V0WH 3DTXB 2CDEA 4PRIE 2QJDA 2AEWA 4LEOA 3FAWA 5D6CB 5MEPB 5ICZB 4RWYH 2LABA 4Q0XH 5DJCA 3P4OA 2O93L 5DQ9B 4I3SL 3F8UB 3SE8L 1NAMB 3V79C 4KUCF 5HYJB 2ZPKH 3EBAA 3E1F1 1FL6A 1NCAH 1UVQA 2A6DA 3A6OA 5DI8B 4U49A 3OPZH 3QEGL 1CVSC 3HI6L 1UXWB 2P43B 2PW2A 1TJGH 4LU5H 1FL5A 5ACLA 3PWPE 4J1UA 5DFTA 2XN9D 3MX0A 5F6IB 4FFVD 3JZ7A 1H3TA 1KC5H 5K9JL 3E2HC 4X98B 2BRRL 2OX5A 2R0KL 4U1GB 5EORH 2QTEA 1OCWH 4IM8A 4H1LG 1I7ZB 1B0WA 2OMBA 3BSZH 4LNRA 5J3HD 3GMOA 2WZPD 5DD0H 1BBDL 3IAPA 3U0WL 1CDUA 5EU7E 3U0PB 1S9WB 4RMQA 1QVOA 2W60B 1RUQH 3GDBA 1S7TA 4X7DC 2H3NB 3HPJA 4TVPH 4ZNCD 1RJCA 1DN0A 4WDIB 3OHXB 4H5SB 2A0LD 2PXYB 4MQXC 1QR1A 3CLFL 4TUJB 1CGUA 7CGTA 4N8VA 4QXWA 4F80A 1BQLL 1I1YB 4OZHF 4PYGA 1RZKL 5EBGA 2YN5A 3MRDA 4MNGE 5GIRB 4M1GL 1UB6A 1GPOH 1PZ5A 4MQ7B 5J6GB 1AGCB 1CGTA 4YDIL 3WE6B 4AIZA 1X44A 4P4KC 2IFGA 5EUOF 3PWUA 5BV7L 1RUML 3VFNA 2QQKH 5KSAB 4OZHB 4NQTA 3GB7B 3P0VH 4OGAC 5C07A 3TVMA 2DBLH 3CSPA 3HI1A 1KTDA 3QI9C 4XWGH 4MWFB 1I9JL 2GJJA 3WKNA 4WUKL 4TSBH 3QIUB 5L88H 1QRNA 4ZOAA 3PV6B 2GTWB 1M7IA 4JPKH 5EUOB 4P2RD 1Q9LA 3QO1B 4Q9QL 1IQWL 1CXHA 3FFCE 35C8L 4X80H 1KLUB 2OP4L 3G6AB 4R97C 5BQ7A 1FG9C 2P8PB 4PGBA 5DHXB 4P59H 4Y4HD 1PKQA 4IRJB 3GMMA 4L4TA 4CNIB 3VA2C 1ACYH 3MRNB 1L0YA 1FNEB 4PJCA 2LFGA 4WU5B 1Z3GH 3O8XC 4WI9A 3UZEA 3L7FB 4ELME 2X89A 4GS7B 4K7PL 1CLYL 3CPLB 3Q5YA 4OIBA 5HYSB 5D5ME 1Q72H 5JXEC 2MTPA 3N85L 4BSWB 1EBPA 1G7LA 4FZ8H 3V52H 1RZIB 4DKEH 3B6SB 1A6ZB 3IDYB 5AD0B 5D1QD 5DR5L 1JV5A 4ISVB 4M6MH 4ZSOA 4XVSH 1F4YH 5FKAB 4X7FC 5I1JH 5IESL 4J3OC 1PBYA 3UJIL 4UT7H 4Y5VC 3NAAL 5ADOH 5MENB 4NM4H 5AUMA 4I1NB 4IIQB 3B43A 2NR6C 5HJ3B 5ANMB 1J88A 4EKXA 4UBDC 2OS7A 5IFJB 1NC4D 2HJFB 3ESUF 4V1DB 4JRXB 3K4DA 5D8JL 5E5UB 5C0AA 1VCAA 1RD6A 1DLFL 1FN4A 5SWSB 4RSVA 5ITFA 2NY2C 2H41A 2W07A 4OV6F 1JRHH 1UCTA 3QHFL 4URTB 4F7PA 4GMTH 4O58H 5FO9B 1G9NH 4OSUH 4P9HC 5E5MB 3QO0B 4OZ4B 5FUOH 3SO3B 1F3JB 5IM7B 1AHWB 4HUNB 5FGBA 3HAEA 1J0IA 5EPMB 3IXAB 2VDNH 1GC1C 4H20H 4NHCH 4YHYB 2E7MA 2FX9H 3VXUA 2BJMH 2A73B 3OAZK 5FM4A 5FM8A 5E8DH 4ENED 2H9GA 1FRGH 1TZHB 3BKCH 4BA8A 4KUZH 4OKVB 3O0RL 1UADC 4CVZB 4NKIL 5EU4A 1KELH 3GSXB 1NLBH 2EDBA 4FQHA 5DEGB 4WCYH 2B2XH 1UZ8B 2ZKHL 4I2XA 1H3XA 2DQTH 4DZ8B 1WFUA 2V7NA 5JZ7C 2IADA 4JZJB 1BECA 5FYJU 5KJRH 3I6GB 4GG8A 3ABZA 5FHBH 2PETA 2W0FB 5BW7C 1Q9KA 3DUSA 4MB3A 3CVIH 3PJSA 4OZGE 4HWZB 2EICA 1RZFL 3G04B 4HS3A 4N1CA 1CGXA 4DN4H 1LEIB 3LD8C 1U3HC 4NQCA 1T89A 1CGWA 2A6JB 4KC3B 5E2VL 5TE4H 1RUKH 4P2OC 3T0VA 4Z5RA 3EJYC 2X6MA 2XZQH 4G42B 1FP5A 4CJ0A 2AI0L 4MJ6B 1N59A 2PTTB 3AS1A 2X7LB 2VL4A 5EIIA 1FSKB 4J3UA 4BFEA 2Y9RT 2DM7A 4ZNEA 4LP4A 4PLOB 4GRWH 5KVGH 4UT9H 4JQIL 4XTRD 4S1QH 2OM5A 1BWMA 4J4PD 1I7TA 3S36H 3QG6B 5I8OL 3MV8D 3SDCB 3KJ4C 1UWGH 1D9KB 2YPVL 5SWZA 1F6AB 4RFEB 4MAYC 2EEBA 2V2XB 4D9QD 1DBAH 3PL6C 4IOIB 2NY3C 2X9YA 3IRZA 1AFVL 2VDLH 1WFOA 3BOVA 4N9GB 1LK2B 2F54A 3D18A 3WN5C 3FQUB 3N0PB 2BSRA 4CMHC 2JB6A 3HNSL 4N0UA 2WWMC 1J10A 5D7KD 5D4QA 1IARB 4U2ZA 1OLLA 1FCGA 2ZCKH 3DRTA 3QUMH 1S9VA 3GRWH 1FYTD 4FQXB 4WFED 2Q8AL 3BH8A 5JOFB 4NQUA 3MZTA 5ICXA 5KVEH 2YUWA 5EZJB 4WV1A 1BZQK 2HJKB 4HXBH 1YMME 3NZHH 4YFLF 3DX6B 3PGFL 2D0HA 3AXLB 5C86A 3P4NB 5LCVH 4NN7B 1WTGT 2DQUH 3T0EB 4ODVL 1JRHI 4NZRH 2YZ8A 5ETUA 3MJ9A 3D1MC 4KTDH 1G0YR 4PJIF 4YNYB 3C6SB 5I74C 4Q6IB 4EOWH 1J8HA 1KCSH 2AEQL 2UWEA 3VFWB 3S7GA 3MBXH 3IU4L 3X3FL 4MQTB 5IUSA 1PX4A 4X8JA 3MRPA 3RPIA 2ITDB 1FNGB 2YC1B 5L2KB 1DQMH 1OTSD 4PJIB 4WU7A 1KLFA 1L7TL 1S7QA 3H3PH 5A2KH 2VDKL 2CKBL 3WNOA 4AMKH 4F7EB 4YE4L 4G5ZH 4KRPC 1UH4A 4OIIH 2X42A 3V6OC 5ID0A 1IQDB 1NC2A 3L1OH 4X5XA 5J7CC 2DF3A 5IMLA 1T7ZA 3QHTC 3DETC 2ENYA 1RSFA 4LRIA 3SDDD 3TLRA 5FOJA 5SWQA 5DRNB 3QUKA 4K3EH 3EOTH 3FTGA 4Z7UE 4FQ2H 4NC1C 4P2QB 3D69B 3I6LD 4NPYB 4PJEF 2CO6B 1JYNA 4GG6F 3MV7A 3Q3GB 4OF8A 1YNKH 1XT5A 1DUYB 5DUPH 5JTWA 4L9LB 3WHXB 2X4OA 3QHZL 3F7RA 4G80B 4OUUB 5DD5L 2J6EH 4CVXA 2AGJL 3VWKB 3I50H 3RIFF 1TVHA 1HILA 4GG6B 1JPST 3FO0H 4DKFL 1XR8B 3S98A 3WLWD 5MEOB 2B1AH 4JM2C 2HMID 1BQHB 3QPQC 1KNOA 5D2LA 1KIRB 3T3PF 3TN0A 3ZKNC 4EN3B 5JOPD 4X4ZA 1BJ8A 4M7ZC 5T3XE 4DFIA 3UYOD 3HS0B 4E9LA 3AB0C 4F9LC 4BSJA 4APQD 2O5ZH 3S4SA 1WBYA 4QT5B 3BZ4B 3S36X 2BNQB 4HCRA 5IHUH 4F2MB 1X4ZA 2ILLA 5C0BD 4I18C 2WLYA 4HFWA 4RGNB 2GK0B 4DGVH 2Z91A 4OLXH 4P57A 1HKLL 5T1KA 4Y16D 4GW4B 2VR5A 4MXVF 2V2WA 3FONB 1JWSA 5D1ZB 3ARTA 5H94B 3SCMA 2Y1VA 3BX7C 2J8UF 3GNML 3T3ME 4PD4J 1TTFA 2FL5A 5DJZA 3RTQA 4NO5B 2EIEA 2RFXB 3VXSD 5JW4N 3KS0J 3H9SA 4GSDL 2CIKA 5JORB 5ISZB 1RURH 1CK0H 4JFHE 5C0ND 5HHXH 4JFFD 2BFVL 2J8UB 3EJZD 1R3IL 4MYWB 1ZHNB 5C08D 1DBBH 3CFBA 1QD0A 1YQ2A 3NGBC 4U6XA 4HFUH 4U1IA 5H37H 1LE9B 4Q2ZA 4UTBH 3VXRB 3W11C 4XHQA 3V9FA 4YC2C 1DQDL 4LPUA 2EXWD 4YK4C 2Z8SA 3QXAB 3WIIH 4PJ5D 4POUB 3MRKA 2FO4A 4K94H 4YX2L 3TT3H 4I5BB 2VQ1A 4I0PA 4GKZB 15C8L 2I07A 4TNWF 4XNXL 2FLRT 3C2AH 2Z4QA 2VXTL 4JGJA 1DP0A 1PQZB 4XNQB 5IG7A 4IRSC 4O00A 4AEHH 1UKTA 3B9KD 2VL5B 1IM9D 4XP4H 2CIIA 5ID1A 3VFSB 1B88A 4JO3H 2QSCH 3M17B 4GBXB 5F1SA 3GK8L 4NJ9L 4UIMA 3TT1L 3RDTB 4H25A 1MRDH 1UACH 5T1MB 4NP4H 4HWEH 3G5VB 2PYED 4C59B 3KLDA 2VOTA 1ZHBB 1WK0A 5E8EA 1JGLH 5BO1H 5EZOL 4HS6A 4L8DA 5F1NA 3S96B 2L4OA 3EYQC 5F7EL 2DTMH 3QEQA 3CDGB 3S9DB 3Q1SH 5HSFA 2WP3O 4N1EA 1UQSA 5D7LB 3WDHA 1E27A 2PYFB 1XF2A 4DOHE 1U8HB 2HTLD 3L3HB 4B7LA 4NQEB 4ZSOE 1LO3L 1N5YL 4NQSA 3QIBC 4PRPD 5CWSA 5EOTB 2D7PA 5BMFL 3NH7H 1DQTA 2C7UA 4EQ2A 4RX4A 4XNUH 3OGCA 5DQDH 2XY1A 4XP5H 3D3VE 2AK1L 5F9DC 1M1SA 1TMCB 1BPVA 2ZJSH 2DLGA 3NFSH 1OP3K 1D3CA 2IH1B 5LAXA 4YQXH 4PRHB 3DVNB 5HYQB 1KN2H 1RUAL 4LFHG 3QDGD 1TLKA 1BOGA 3TO4A 1NBVH 4PJBA 3LH2H 2FLBT 3L5JA 4P23A 5GS1B 4U6YA 1A7NH 3I02A 3SDYH 4KKBC 1V5JA 4Q9BA 3VRIB 1R5IA 3MODL 4NKQB 4EI6B 4JDVA 5JDJA 4GW5A 3C5SB 3OJDB 1NMBL 3MRIB 4K3JL 3U7YL 1XF3B 1ETZB 3QZWG 3BPNB 5IIEB 4HIEB 4PTTA 1CFVL 5EUOE 1GGBH 3R06A 1MI5A 4FXKA 3RPKA 3QQ9C 4MCYA 5FHAH 4EIGB 4RNRB 2D9CA 5C3LD 3T4AA 2PO6C 2CR6A 2Q20A 4X7SH 5IB2A 1D5IL 2VLKD 1O0VA 4NSKB 1IT9H 4ODUB 5DK2A 3D9AL 4NO0A 4NRXB 2WLZA 3KXFB 5C0GA 4K9EC 4J7RA 4EI5D 1S8DA 5I16A 4NOFA 3ULUH 4NDMB 3HZYA 2CDFA 2W38A 4DUWA 5DRZB 4JM4H 2NTFA 5IB5A 2ZG2A 5IGXH 2AJVH 5GRVK 5IEHB 4OLEA 4K3DL 4OZFA 5D2NA 3GMNA 2HA1A 3C2SA 7FABH 5I1DA 4N90E 1GOHA 3VXMB 1P5VA 3D6GA 2WUCH 5ANME 2CJUL 1UWXH 2QR0B 2CUHA 1HZHL 4Y4HA 1CICD 2FEDC 1H8OA 4V1DE 4JRXE 2M8XA 4Q74A 1QSFB 4FABH 4YPGB 1KF9B 3CVHB 3EO9L 3P73A 2GIYA 2CDGB 2HLFC 4G8IB 3OKMA 1V3MA 3QA3B 4JHZA 1FZJB 1ZWIA 5E6YA 3T65B 3DROB 3OZ9L 4M93C 5LXGH 1RIVL 3WXVH 1WZ1H 3GJFK 5HPMA 3FB7A 3SKJL 1OGAD 5EWIL 1JGVH 3BH9B 1QZ1A 3ARBD 4HX1A 3B2VL 3SDXF 3FOLB 1X7QB 4JLRB 5A16A 1KSRA 4LSRH 4MQSB 2FYYB 3KJ6L 1NC4A 1T0MB 4K2UL 2R0LH 3O9WB 4X6FB 3JTSA 4BH7B 1ZT7A 4PY7A 3SDXB 4QNPE 4AQ1B 2EDNA 3LQAC 5J6HB 2GITB 4LVNC 3TESA 3DI3B 1AD0A 4NZTH 4P99A 1S9KC 3MLYL 3ZDZF 1PFCA 1QYGH 4GKSA 3AS3A 3FRUB 5ILTH 4KK9C 4N0FA 3C5JA 3F7VB 3VFTB 4UQ2B 3MRQB 3IXTA 1MSPA 3I6KB 4M7JL 4TVSa 4ZFFA 4ODSL 5T33H 4FNLL 1U8OB 5K9OA 1A3RL 3LPWA 1KPUA 5E6IA 3H7BA 1F5WA 2PNDA 4ONFH 1X5XA 3O3AB 4G8GD 4FTVA 1KCLA 3RNKA 2Y5TA 1YEKH 4WHCA 3PWLA 1MLBA 32C2A 5D1QC 5D1XB 1YEFL 3UO1H 1MOEA 3ETBF 2UWEE 1A6TB 1KGCE 1T4KA 3QIWC 2KZWA 3OKEA 1BIIB 1P7QA 3UEZA 1ZGLM 1A1NA 4RQQB 1FVEA 4YIQB 1MCEA 5GJTL 4HIJA 3DIFB 4PJDF 2HH0L 1I3GL 3KPSE 4KAQL 3DXAE 1T21B 3AU1B 1WZKA 2PW1A 2FBJH 4YBHA 3MRCB 4J23A 1FLTX 4L4VD 5L8LB 3N1FC 5K9QI 4JKPL 3N1QC 4ZOEA 1Q9OA 5IBLC 4P9ML 4HZAA 3DVGB 3F65A 3GMQB 1BLNA 3QZWB 4OLVH 4R4ND 3TJEH 3WO4B 3WCYA 1DBML 1EAPA 4KJPD 1F90L 4PJDB 5DJXA 2VLLA 5GS0H 3P30L 1MEXH 5DJ8A 3H42H 4ZXBB 3LKSA 5BZWA 2GY5A 2AQ2A 5ERWA 1C16A 3MQIA 1HQRA 5TDOB 4HMDA 4LDEB 3RFZC 5DD3H 1QUNA 3BEVA 4J3TA 5AG8A 4M7LT 4JAMB 1NAKH 3OL2A 3OR7A 2W91A 4AENB 1UKQA 4GFTB 3T2NH 5IT2H 1DVFD 3ZTJG 2P46B 5F9AC 5DDHB 1UZ6F 1H5BA 3UBXA 3ILPA 1K8DA 3VI3F 4QY8B 3UAJD 1ZA6B 5EC1B 2ZWLT 1BFTA 3BP7A 4K7PY 3UYRH 3VGDA 5D2LE 3T0EE 4YDVA 1AQKL 3LKPA 4X9IA 4DCQA 3LKRB 4PB9L 1G6RA 3MV01 3O45B 4XP9L 1NAMH 2X40A 2D2OA 3ZKQD 3OX8A 4O2EB 1FNLA 1FYTA 3IAGC 4AG4L 3ULVL 1A7OH 2X4UB 2BVOA 2Z35B 1IGIL 2RGSA 4HPYL 4YHPB 4MHHG 4WEMB 3T0BA 3VD3A 3CMGA 1RY7B 2VZUA 2NY6D 1V7NL 4JN1L 3BUYB 4CJ1A 3IJHA 3HE7B 3W9EA 1PG7H 3ZT5A 4O5LH 1OAKH 4O51A 4H8WH 4LLDB 4FFWD 3RNQB 4QHNA 4WI6A 2VO5A 4YXLH 2R1WB 4QHUB 4KHXH 4YFDB 1GZQA 1OAXL 5I30H 3QULA 2GSGB 4G9FB 2UYLB 2XYCA 3ME0A 5FOBA 3KYMB 1N7ML 4BZ2L 4YWGL 4XTRC 2L7JA 5I9QC 4J4PC 4HK3J 4PJGF 5SX5H 3NFNB 1B3JA 3OG4B 1UWEL 3REWB 1BJ1H 4JDZA 2CLVB 3TJHD 4O4YL 4AL8L 4MX7B 3B5GA 2FIKB 3OKDB 4PJHF 1FO0B 3DMMB 4K8RL 4XCEB 2G9HA 3M07A 4XT1C 1JPTL 4PJGB 5IHZB 3O6FA 3VFOA 5I66A 5I1HH 2NY1C 1JHKH 1KJ2L 2R8SL 4IDLA 3PHQB 4PJEE 2HRPH 4N68A 3IDJB 4QGYA 1MFDH 3QJHA 3EYFB 1HXMB 2R23A 2YBRA 3O2VL 4NQDA 4PJHB 3HNTH 4LKXA 4M3JA 3IFNL 2BP3A 2W1NA 3SJVD 3PNWA 5CHNB 2A74B 1FGNL 1NBYA 3TBVB 1AXTL 1MF2L 3PQYD 3SGJC 3VH8A 1IILE 2Y36H 3HFML 2YKLH 3AGVA 3O4OB 3DNKA 3QEQE 4XMLL 1K5NA 4B5EA 4KPHH 1YNTA 1HOCB 3S35H 3UTPD 3N1GC 1CR9H 2P5EE 1NCDH 1KBGL 1DQLH 1IEAB 5T3ZL 3UPRA 3V5KB 4KROB 4Y4KC 3P77B 1MHCB 5ICYB 4RAHA 1W8OA 3E6HA 3BE1L 3BN9D 4YXHH 2DWDA 2CDEB 5DT1L 4PP1D 4MXVE 5JR1H 3QFDA 4E42A 3F7YB 4H88L 5CP7B 1JFQH 3P4OB 3WKML 4XP1L 5GSRB 4JPIA 4NJAH 3MUGA 1YEGH 3MNZB 1SJEA 2ORBL 3HAEG 3O11A 4APQA 1OARH 5DHYA 2IPUK 5HHVL 1FL6B 1UVQB 2A6DB 3C09C 5C0BA 1FFQA 4W68A 1T83C 4P4KB 3VXRE 4XC3H 2EC9U 4Z7QF 4HWUA 2PW2B 4LVHC 1FL5B 4Y16A 4XAWH 4PB0L 4CDGC 1TCRB 2CRZA 3SN6N 3ZKXC 2EYTA 1CD8A 4NCC2 3SDDC 2NYYC 5EUKA 1AP2A 3E3QE 5I2IB 3OF6D 1AO7D 4ZUTA 3MJ8A 3VXSA 4L3EE 5D93C 1E28B 1HH6A 4PJAA 1WC7B 3MJ6A 25C8L 4M6NL 5CBAA 4N5EC 5GGRY 4I77H 3WD5H 4LNRB 3GMOB 5DS8B 3UJTH 5LJYH 3DYOA 5HGBB 4LCWD 1UENA 3NMEA 5DMGD 1QVOB 3O8XB 1PG7X 4WI7A 1S7TB 2B7DT 1RIUL 2HKFL 3HPJB 1C5BL 5SV3A 2K7PA 2OYPA 2Z8VC 2NY7H 3WLWC 4UOJA 4HH9A 5JLZA 4PJ5A 4UUJA 2HMIC 3G6JA 4G9DA 2YD3A 4XX1G 3EYOA 4C56D 1G9ML 3HRPA 3EO1A 1CGSL 4ZO6A 5TJWK 4NQEE 3C9NB 3BT2H 3MCLL 4DUVA 1YPZF 3TFKD 5D70L 3B9KA 1UB6B 1HINH 4FQCH 1JPSL 2ED7A 1PZ5B 1Q0XL 3KPOA 2W0PA 5IF0A 2BNRA 4AIZB 1EMTH 3UCRA 4ZFZA 3CXHK 3EO0A 3PWUB 1BF2A 4MB4A 3M8OH 3RY4A 4PJFE 2HTKD 1YPZB 5C07B 3JWOL 3TVMB 3HI1B 2DJUA 4PRHE 3TYFB 2E7HA 4Z7VA 4ETQA 3V0WL 5DRXB 5GHWH 3SKNA 5BS0B 5EBLA 3K2MC 1F58H 4FXLA 2DM3A 3TWCL 1KIQA 3T4YA 1M7IB 4RWYL 4Q0XL 2ESVB 5FEBA 4LEXL 5BJTA 2YUXA 2V17H 1T1ZA 2YOCA 5L8KB 4XNZC 5BQ7B 5DVOA 2ZPKL 4IRZH 2CK0H 4PGBB 3RVUC 1NCAL 2XZAH 1PKQB 1F4WH 1PDKA 4L4TB 2MCPH 5DJDA 5TDPA 4D94A 2NY5H 4S1DD 1CLOL 2DKSA 4G6KH 4R3SA 2WINA 5E4EC 4M8QB 2Z0BA 4LU5L 2HFGH 1SJHA 4OQ1A 2E9WA 5I73C 4U1NA 3S8WA 1LP9F 2ZNWA 2VR4A 4RISL 3D5OF 2HFEB 1FAIH 3S35X 1CFSA 3VGGA 5CSZA 3TH3T 3QEHA 4KI5D 1NH6A 4I4WB 1T20A 3BI9X 4HJJH 1LNUA 1JV5B 2XFXB 5KSBF 2EYSA 4I0CC 3QDGA 3BPCA 4LIQE 4ZPTA 5HHNB 5EORL 2QKIB 2FECL 3UROR 1A64A 1LP9B 1OCWL 2AEPH 3P0YH 3KXFE 3BSZL 5IROC 5DD0L 5CZKA 2ERJC 2D03H 3ZTNL 5KSBB 5AAWA 3BKYH 3B8YA 3WXWH 1A1MA 4PJ9C 5HVHB 1KEGH 2YUVA 3H9YA 1YMHA 1E4KC 5C0AB 3T09A 4GLRH 1G9NC 3BW9A 1FN4B 1S7UA 1L9NA 4YHMH 5I8KL 4HJGB 5TQ2H 4HPOH 2C3VA 2NNAA 3ARQA 3W0WD 1CQYA 4AZ8A 1PVHA 3BGFC 1CBVH 1JJUA 4LQ1A 4NKMA 5HHMD 2R29L 4RGOH 1D5XA 2HTLC 2RHEA 4F7PB 1GPOL 2E7BA 2VLKA 4P3CH 5HDLA 3MCG1 3SE3A 3CFJA 1QFHA 4N5UA 4WRLA 5FCSH 1MCKA 3GI8L 1I8IB 3K7UA 2QQKL 5GRJH 3HAEB 4EI5A 4CVWA 3RVXC 2DLFH 1GL4B 5EG6C 4XWGL 1MFAH 1M05A 3EYSH 2ZUXA 2H9GB 3ULVD 3GEWB 5L88L 4X5WA 2ZUUA 1YQVH 1E4XH 4QRPE 4JPKL 5EU4B 3NIFF 3V5HA 4MAYB 2WQ8A 4JZNB 2F53D 4BSVB 3HZKA 4X80L 3RVVC 5HYJD 4I2XB 2NXZB 2DQJH 3GSNL 4P59L 4G7YL 2V7NB 4UNUA 3WN5B 2IADB 3MBED 4LSUH 5GZOD 3MRHA 4CMHB 4MJIA 1Z3GL 3ZDXE 4GG8B 1U3JA 3DSNA 3QDME 1Q72L 2A1WH 1S7RB 1Q9KB 1RZ7H 4JPWL 3EFFB 1PD6A 3QCVH 3UJJH 3HR6A 3V52L 1B2WH 4DKEL 4I8DA 3H6JA 3QCTL 4HS3B 1EX0A 1QHOA 4OFDA 3X11A 4XVSL 3IDNB 3PGCA 4NQCB 1XH3B 3OKNB 1F4YL 5T5FH 1OGAA 4KDWA 5I1JL 4IMKC 3V5DB 1FPTH 1W0YT 2QQNL 1NCTA 4Z5RB 4PRDB 4YXKH 1AJ7L 4AEIH 1M71A 4CDHA 4BK4A 1CGVA 3MFFA 4K8RD 2OBGA 3TPUA 2CKBA 5CGYD 4QRSB 5AAMA 2GKIA 3ARED 4B41A 2EEDA 2ICWI 1I7TB 4N0CD 5BOPA 3BP5B 3K74B 2R2BA 1PAMA 5SWZB 1BIHA 1QTYT 1VADB 3GBNL 1MRCL 3GSWA 4DGIH 4O2CB 1JRHL 4LCYA 2JJSC 4GMTL 4PJXA 1GVIA 2F54B 4OSUL 1TJHH 4IOSD 3IB4A 3RWHA 1CICC 4MJ5B 1B90A 5GPRA 3LZFH 4YHIB 5JIIA 1G7HA 1J5OH 2D7NA 2VDNL 3KPTA 2WBJD 5T3ZD 1S9VB 3WFHA 3JV5A 4P5KA 4LOUC 2FX9L 2BJML 2PCPA 2HKHL 2I25N 4G8GA 5E8DL 3BKCL 3ZL4H 4KUZL 5ICXB 4F58H 2B20A 2UUDK 1J1PH 1KELL 3INUH 1B4JH 1NLBL 1LO4L 2A2QT 2IANE 4WCYL 5DURB 1T0NB 2V9QA 2B2XL 1UM5H 5EN2A 1NCNA 2DQTL 2E6JA 3ARBC 2X05A 4QYOB 1WT5A 1HQ4A 4G43A 1X4YA 1X5ZA 1HWHB 4JM2F 4WTXA 5IBTH 4ORZC 3MLPA 1FFPB 1DSFH 4NN6C 2VLJD 1BD2D 2DQDH 3MLRL 5CILH 3U4AA 5F44A 1HYSC 4CVUA 1J8HB 5K59E 2VXSL 4FS0A 4AIXA 4JY6A 3X3GH 4OCRH 4L4VA 4MNHB 1HHJB 1VENA 1G7JB 4NC0B 4D0DA 3MRPB 1ED3A 3RPIB 4JVUA 4YAQA 4M7ZB 5FCUH 5D7JD 4FMFA 3O6ML 1J0YA 4KQ4H 5TE4L 1RUKL 4NFDA 4WU7B 1JN6A 3EDEA 4YFLI 4X6CA 3VI3E 1F3DJ 2F9BT 3MACH 2ADIA 3GKWL 4WFGE 1OQOA 1XCQB 3RBGA 5ID0B 5DLML 1KENH 1NC2B 4X5XB 3T04D 4I9WE 1XEDA 4WNQA 5F7UA 3GIVA 5IMLB 3ROOA 4H0IA 5KVGL 1OQXA 4UT9L 5GISH 3RWIA 4S1QL 1DVFA 1IMHC 5EZIH 5SWSD 3S36L 1BFSA 3QUKB 1UWGL 4KVCH 4KKLD 1DBAL 4TUOA 4JO1H 3ZYOA 3I2CL 1CT8A 2VDLL