2H2PD

Crystal structure of clc-ec1 in complex with fab fragment in secn-
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ion transport
molecule keywords CLC Cl transporter
publication title Uncoupling of a CLC Cl(-)/H(+) Exchange Transporter by Polyatomic Anions
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2pD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2pD01
2A74B 2EYSB 1BQUA 2VABA 3UTTB 3UTOA 1XZ0B 2CSPA 3LAFA 5CCKH 3N0PB 3SE4A 1PSKH 4DAGL 5DHYA 3A6CL 5KSAA 1S7TB 3D39D 2NW2B 2OTPA 5B22A 3BPCB 3LB6C 4Z8FL 1P1ZB 4RGNC 2C3WA 1FYTE 3ULUH 3VXSB 1RUPH 3KAAA 1G7PA 3K8KA 5DJ8A 1I3RB 2UYLB 3ARVA 5CEXB 1T20A 4JANA 3P4NB 2EYSA 4HS6B 3LEYH 4Y19B 1Y6NR 2C4FU 3DUHA 2VLME 2FX8H 1RJZB 5EO0B 5FEBA 3Q2CA 1S7TA 3ZYIA 1JHKL 2EDWA 4RSVA 3BPCA 5IOPB 2X89A 1MQKL 1U3HD 4DGYL 3UYPA 1FFPB 5I1EH 1XGTB 5CEXA 2DQJL 2GKIA 1AGDB 1SBSH 2PXYC 2XKUA 3P4NA 5CMAB 1WAAE 5IB4A 2CH8A 4JAMA 4TUKH 5D6DC 4WUUB 4LU5H 3PF2A 2IPTL 1G6VK 2IANE 5D5MF 3Q0HA 3O6KH 5IESL 3MLTA 4GRLD 2AJ3A 3RIAK 5EIQA 5CSZB 4JDVA 3O6LL 3V0WH 4OLWL 2HTKC 1AGDA 3WIHH 4EQ3A 5J3HD 2BHZA 1JNNH 2XQBH 3PHQB 1YY9D 1M7XA 4K3GA 5JW5A 4TVPD 2P5EB 4JFPA 4OFVA 2WBKA 4GW4A 3IFPB 1K4DA 4HUKB 4U33A 3IJSA 5JW3H 1HK6A 5GRXG 5C08D 2WINB 4OLZH 4BQ8A 4C59B 1N6UA 1MHCB 5DGRA 4Z7WA 5CSZA 1NUFA 5DDHA 4JO3H 4AG4L 5IB3B 3S3PA 4BA8A 4QGTA 4OCXL 4HEME 3SJVB 5IG7B 3LN5B 4KRPB 4KHXL 5KW9H 2Q3AA 4XXDB 4WI3A 4NQDD 5EBWB 1AXTL 2WINA 1RIUL 1ACYL 4W6YB 3GSVA 3CSYA 2B20A 3L3IA 4OB5L 1GIGH 5GRVL 1OF2A 5TQ2H 1C5CH 4XZUB 2Y5TB 4FP8H 2FO1A 1E4KC 4KQ4L 1CDCA 3BP5B 1FGVL 3GIVA 3GKWL 4PREB 3KYNB 4P4KB 1J88A 3OR6A 5AZEH 2PTTB 3TNMB 2ZCKH 4I2XB 4NO2B 3ARBD 4D8PB 1MH5A 2EDDA 5FHAH 3KPRA 3DGCR 1FFOA 5F7EH 4JJ5A 4DUXA 2UZIL 5HHXH 4N5EC 4G6AD 2WK2A 3E0GA 4PGBA 4O2EB 2I24N 3GSXA 1YEHH 5EOTA 3MV8E 1NCUA 2DI7A 4P4KA 5EUOB 1T1ZB 1A6AB 4JFDD 1MRDH 2AK4A 4Q9QH 4WI2A 5CBAA 3WKML 2EIZB 5IMOB 4JCLA 2DOCA 5F7WC 2V5MA 1A6WH 4PV9A 2GQHA 3P0VH 4GW1B 4L8BA 4R2GC 3TZVD 1G9NC 1C7SA 5E5MB 3LS4L 3MCLH 4O2EA 1V05A 3RDTC 2VN7A 3EYUH 5EUOA 3D0LB 1IAIL 4GLRI 1PQZB 2FZ3B 4JFOA 3QUYC 4ODBD 3PE9A 4WU7B 1FFRA 1OPGH 4X9FA 5DYOB 2NY2D 3W2DH 2HLAB 3HI6H 1UWEH 3T0EC 2NY3C 3OGCB 3S5LB 4Y5VC 1PQZA 2FZ3A 4ZD3H 4WNQA 4PJXA 1TJHL 3RHWF 5HXMA 1EIBA 1HKLH 1G6RA 4J4PA 2H1PL 3U2SA 3X11A 2VWEC 3B9KB 1Q9KB 5K9QI 3MJ8A 2R29L 3WIFA 4IBLT 2HLAA 1X5KA 1XGPB 1EV2E 3H3BC 1WWCA 3ZKND 1QTYT 4QRRB 1CN4A 4FQHA 4M7LH 4KRLB 1BPVA 3S4SB 4NNXA 1LK2B 1E6JL 1L9NA 2PN5A 5GGSA 3S5LA 4GG8B 3QRFM 3B5TA 1WQVT 1QNZH 4WEUD 3VD3A 1Z0MA 3HS0B 4ONOA 3RNQB 4JRXD 1Q9KA 1T5XB 5EULV 1KIPB 5DSCA 3WHE0 5ABDE 5KSBF 1SJHB 1IGTB 1XGPA 2CIIA 4G43B 4OD1L 3WN5C 3O6FA 4DEPC 1WC7A 1KULA 3C5JA 1G9EA 1LK2A 3I50H 3D2UA 1G0XA 4GG8A 1EPFA 1V3JA 4YXLH 3WDJA 1I7ZB 4IRSB 2FJHA 4AIXA 3HS0A 5BXFB 2X4PB 4JEGB 3X3FH 1KIPA 1JRHI 4YHZH 5TH2B 3QQNA 1IGTA 4G43A 1N0XH 4KROD 1CQKA 1JMZA 4U1MB 4F57H 5ILTH 1F3JB 2RCSH 2VC2H 2J8UA 3RJQB 4ZXBA 3PWVA 3FT3B 4X5LA 1GAFH 1MI5B 2IC2A 1KGCD 3M8OH 2H26B 2YA1A 4KI5F 4RZCA 3WFBL 2ZG1A 4XP5L 3DVNA 3RVWD 2F53D 1BOYA 3CDYA 3VFOA 3FT2B 4PGCB 3BH8B 2H32B 2NY6D 5F1KC 4MJ2A 1AHWC 2DTML 3FT3A 3OWEA 1WBYB 5E99H 1RY7B 3N85L 2RFXB 4K9EL 1T0PB 3JTTA 4W6XB 1T1WB 1CD1B 2IADB 4HDIA 2HWZH 5E5RB 1I7TB 4NRYB 4C4KO 3ARFC 1Z9OA 4HQQL 2E5EA 2HT3D 3K3QA 1MWAA 2B0SH 3C6LB 5ANMA 3X13A 1MRFH 4LP4A 1P7KB 4AL8H 1WBYA 1IGCH 1MFEL 3V6FB 1XGQA 5FA4A 3QNXA 3IB4A 1T1WA 1YEEL 2IQAB 2IADA 4PRIE 3U1SH 2EC9U 2JB5H 5B8CB 3R0NA 1QVOB 4Z6AT 2V5RA 4U0QB 4Z76B 1RZJL 2QSVA 1LHZA 2F54D 3FL7A 5F7FA 4XI5C 3BKYL 1U8IB 1PFCA 3ZLQC 3NA9L 3MOBH 3D85A 5JPNB 2E7LC 3AU1A 5JHDE 1MCCA 1MRCH 1G9ML 1J0KA 2ZPKL 3SGKC 3WE6A 1UH4A 1OHQA 3IKKA 3L3DB 4UT6H 1OB1B 4LCCC 4HPYL 3DV4A 5ISZE 3I6GB 2YSSA 3EFFB 3MRIB 3EYOA 3QFDB 4QXUH 3VFTA 4MD4A 1R6VA 1U8JB 1AD9B 1YY8A 4LSQH 2BMKA 1QBLH 2UWEF 4EN3B 5FUZL 2X09A 3SKUD 2VXTH 3L3DA 5C0RH 2VIRA 1H0DA 3G5VB 2VXQL 3R06A 2YPLD 2VLKB 3FRUB 1ZT7A 4TSBL 3REVB 2R1YB 3IFLL 5DJXA 4I77H 1B3JA 3VXRA 4RA3A 1XCQB 1ZHLA 3LDBC 4DVRH 1IAKB 3EFFA 1DTUA 2EKSA 2XN9D 3O2VL 3QFDA 4ZTPL 4P5TA 2Y23A 1S7RB 4PFEA 1BHGA 3QUXA 2Y1VA 1U8JA 5DFTA 3ZHKA 5EU7C 1HILB 3VGBA 1YPZF 2ADGA 3S34H 1GOGA 1UZ6E 4EN3A 7FABL 5JXAL 1YA5A 3G5VA 2JJSC 2R1YA 2IQ9L 3SHSA 3KPSE 4OGAC 1IAKA 4WW1A 3LS5H 1NAKL 5I0ZA 1S7RA 4LSVL 2FD6L 3WHXB 4KK9C 2Z8SA 1F2QA 4Y4HD 1AR1C 12E8L 4TULL 4MA1C 4I9WD 1XMWA 1OP3K 4K7PX 4XNYL 4OTXH 5ICXA 4NM8L 1ZKAA 1CR9H 4WWKB 2ZUQB 4Y1AB 4U7KA 1FO0H 4WEMB 1U95B 3VXPB 5EZJA 3ZSTA 2BVUA 1IGFH 2FHCA 1Q72H 5T3ZE 4JM2B 4AM0B 2QR0A 1AXIB 4U3HA 4BJLA 4UNTA 3HUJF 1MNUL 1TJGL 3UBXG 1PG7L 3PGDA 1MREH 3P9LA 2G60L 4C83B 3THML 2CR3A 3DRQA 5FF6B 4JHWH 3AGVA 3IRPX 1OGTB 3DURB 2BNQA 3O4LB 4XVUC 2GFBB 3QDJE 4YJZL 1PZUB 4PRHB 4Y4FC 1D3CA 4UQ3B 4WCYH 4HH9A 5HYQA 1SEQL 4G6FB 1XGRA 3R1GH 5C0AE 1IZJA 2Z91A 3I02B 4Z7UB 4C83A 5FF6A 2IBZY 3ZL4L 5E00B 2BX5A 1ZLVK 3S35X 1U93B 2YBRA 4MNHA 2D7PA 3Q5OA 4B5EA 4H1LB 3RVVC 3HFML 4N0YH 3T09A 3BPOC 2DQTL 3VGHA 2AJUL 5C0JB 4Z9KB 3BGAA 3QCTH 4DGVH 3O9WB 1QFWM 4Z7UA 5MI0C 3NAAH 4HLZH 4MA8H 1N5YL 5DD0H 1P84J 3U7WL 4LQFL 4D9QD 2OM5A 5IT2L 5L2KA 4YXKL 4PJFA 1GRWA 4RDQG 4XNXL 1EEUA 5D2NE 2FCBA 5GGRY 2CKBH 3I9GL 3MV9B 3IVKB 1ZVHA 3CAFA 2YC1A 4IEFB 1A7NL 4N0CD 4PJDF 1J1OL 1T2XA 1RJCA 1LDSA 2B8OT 4DW2L 5DMGC 2WP3T 3FN0H 3VD5A 2HFGL 4APQC 1IGJA 3O41B 3GMNB 3ZDYF 2YPKB 2J8OA 4IHOB 1EVTC 4R0LC 4HIXH 2YEZB 1AY1L 5TE6H 4IDLA 1FNLA 3QIWB 5HVHB 5T3XE 2SEBA 3GJFB 4R3SB 4NQSA 3GRWH 4HUWA 5HYFA 3BN3B 4Y88A 2WNGA 1IGMH 3DX8B 1BWWA 5KVFH 3QI9C 4CUCA 2NY4D 2I9TB 5GS2H 3EO1B 4I4WB 1FRGL 4RGMB 4RQQB 5A16A 3GMNA 1XGYH 2YPKA 5EORL 1A9BA 2YEZA 4NCC2 4PJ5A 1FYTB 5D7LB 4R90H 2DQUH 1W0VB 3RAJL 1Q9OB 3GJFA 4O4YL 4GMSL 2A0LC 4M43L 3UPRA 2DF3A 4QY8A 4PJ7E 2AKRB 2APBA 4FQXD 1SY6A 5CIPH 4ONFL 3V7AE 4TN9A 4CDGC 1KEGL 3U6RB 3KS0H 3V2AR 1Q0YH 4RQQA 4WW2C 3PG2A 4J3UA 2Q76A 1YQVL 1QFUL 4RNRA 5DRZB 1MCQA 3MBEB 3FN3A 5D7LA 1W0VA 4ODVH 4NZDA 4ZPTA 5E8NB 4NP4H 2PTUA 3CIQA 4GAGH 2XKNB 2KKQA 4O2FB 1GSMA 1A14H 2AKRA 1VGKB 4M8QA 4C56D 4WENB 5EFIB 3MFFB 3PWPE 2W0KA 1IE5A 1DBKH 3U6RA 1Z6JT 1VCAA 2VZOA 2IANB 4ODWB 5D1ZC 4XVJH 4HJJL 4MZ3A 4HIEB 4OLYH 5DRZA 4MXVF 1KCUH 1RJLB 4RA0C 5IR1A 4KKAD 3IU3A 2JIXB 4HS3B 4OD3H 1DE4B 5E8EB 5LG1A 1T6WA 4O2FA 4U0RC 5EDXA 4L9LA 3SKOB 1K3ZA 4RMUA 4P2YA 1QRND 3PWNB 4MCYB 4XCCH 1S78D 4YWGL 5I18H 4OV5B 4X9IA 3MFFA 2W91A 3OAYK 4PP2A 5I30L 2PCPA 4M5YL 2CLZB 2VSCA 4ODWA 2QADC 1KV3A 3TCLB 2MHAB 4K3EH 5KN5A 4KPHH 1CBVL 1DEEA 3IXAA 3MJ9H 3CK0L 5GRWA 2Q1EA 1YNKL 2BOCB 3P4OA 1BFOA 2DTSA 1VPOL 4BH7A 1BBDH 3ZE1E 1A6VL 1I3GH 2DYPB 2XWJA 3V9FA 5HGBA 3GBNL 1UACL 1H3XA 5D1QC 3EOTH 4ZTOL 2MHAA 1JNJA 2X89D 4UZGA 5EIIA 3NH7H 2D7QA 3LKRB 3BUTA 2P8MB 1Q9WB 5DK0A 5SX5H 43CAA 5FV2A 5E08L 4FQCH 3SDAB 3H9SE 1RVFL 2AGJL 1AGBB 3HKFA 1WBXB 3QG6B 2Z93B 1XGUB 2ADIA 5DWUL 1AFVL 1AQKL 2NY7L 5E8DL 3DROB 2FH8A 2D7TH 1JPTL 3LKRA 3DJ9A 1BQHB 3LV3B 1JF1B 3P4LA 4JRYB 5DJZA 1FZKA 1UC6A 4J1UB 3TBVA 1CICC 1CVRA 5FA3B 1H15B 3G6JF 1LO0L 3N06B 3MV8B 3QG6A 2NR6D 3DI2B 4L8CB 2A9NL 1F3DH 1KNOB 2JJWA 3MV7E 2V2WA 3I6KB 4KVNL 5IFHL 4ZUVA 1OAUH 1TZGH 4ESKA 4NRXB 4XPTL 4FQLH 1PG7W 3LV3A 4JRYA 1JYVA 3KLAA 2DQFA 1BJ1H 5FA3A 1H15A 1A7RH 3SE3C 1NAMH 1EMTL 1KIQB 4IRJC 3K4ZA 5I71B 1JZ8A 5IWLA 1KNOA 4GLRH 1EJ6A 5I8OL 3D25A 3LRGA 1FZOB 3NZHH 4F15C 4K7PH 5CJBA 2CPCA 3UX9B 3H7BB 1F97A 4KI1A 1UXWB 1W0YT 1IC7L 4EDXB 2OQJB 3UJJL 3KPOB 5CJXA 3DO3A 3RWDA 4KRPD 1FDLH 3NZ8A 2JELH 4XNZB 1BVLB 5BVPL 4G8IB 2D9CA 5IHZB 2ADJB 3GO1H 4Q6IC 1LO4H 4O02H 5FGBA 1QBMH 3KPRD 5I6XC 2HKFL 4H0HB 5FO7A 5MHSE 4JDZB 1O0VA 2JCCA 3PL6C 1A7BA 1CLOH 3H7BA 4PJ8B 2Y25A 4UIKH 5FB8A 1GC1C 3ZO0A 3KPOA 4BFGA 4YHYC 3TLRA 4P4KD 5FKAA 1YYLL 2LAGB 2B1HL 5IHZA 2ADJA 5LQBH 3S96B 1G7JB 2OR7A 4JDZA 1XAUA 4RGOH 3P11H 1OM3H 4FRWA 4UINH 4RISL 1UCTA 4PJ8A 5T3ZL 4Y16C 2FECI 5CEZD 1OT2A 3S35H 3VXQB 3O3AA 4MA7L 1Y6MR 5TJWK 5AD0A 1S3KH 4MHHG 2DWDB 3G08A 2WBJB 1I1AC 1DQQA 4MJ5A 1JRHH 3BQUB 5GRJH 5CCKL 4Q2ZB 4MCZA 3S6CA 4L5FL 4WFGE 4UNVA 4XP1H 2Q8AL 1S9VB 2R9HD 1YJDC 1HDMA 2AK1H 1IKFH 3QUKB 4PGDB 1RUPL 4F9LA 1N64H 4J4PD 3QDGE 4PG9A 2DQCH 4I18C 1GGBH 4JN2B 4TYUA 4Y5XC 3ILQC 4XCNB 4WV1B 4U6HA 4HFUH 4Q2ZA 3UYOD 5DLMH 2GYSA 2XTJC 1XF2A 3BP7A 4JY6B 2YKLH 3CMGA 4HWUA 1N4XH 4PG2C 1LEGA 3V6OC 1S9VA 4NQEE 3TO4C 2CRIA 3E6HA 3VFSB 1KCRH 4YQXL 4L4VE 1X7QA 3FB7A 5D8JL 4AEEA 4F7PB 3WFDH 3IYLW 2D4DA 3B9KD 2D31B 1SBSL 1EEYA 4HT1H 4JN1H 4K8RL 3QPXL 4LFHD 4G9FA 5H37G 4WV1A 3QDHA 5CP3H 4XT1C 3FZUC 4TUKL 3O6FD 4LU5L 3KYMB 1A4KB 2AJSH 5BJTA 5E2VL 3FONB 4JFZL 3O6KL 3DUSB 3ZE0E 3D2UD 1MLCB 4FG6D 5HHOE 4PRIB 5IB2A 5TQ0H 3TA3A 4RMWA 1A3LL 4QRTB 4WFEE 1FCGA 4F7PA 4MAYA 4P49A 2D31A 4GSDH 3BPLC 4IIQA 1I8MB 3L3JB 4QRPA 2EDQA 1NDMB 4ENED 1GHFH 3JXAA 3RKDD 1WFOA 2ICEB 4ZUUA 2GITB 3LVEA 4N9OB 4YAQA 2XZAH 3FONA 4G42B 5JHDB 1DQJB 1F90H 5KAQF 1X6NA 5EU7E 4OLZL 1M6OB 3GSOB 4JO3L 3GSRB 4QRTA 1SMOA 4AYFA 1PW3A 2OR8A 5T3XL 1BFSA 5ISZB 2Y6SD 3REWB 1OAQL 3TN0C 1ED3A 1WSST 4J8RB 4P2OA 2DJ4A 4X4YB 3UROR 2R56H 3QFJA 2GITA 5C2BL 4G42A 5JHDA 4PJCE 5BQ7A 1K2DB 4YDJB 1MI5D 1GIGL 3N1MC 4C55A 3QYCA 5TQ2L 1UQSB 4XTRD 5I74C 4HBCH 1C5CL 5BZWB 4FP8L 4NZRH 3RTQA 5ISZA 5JDSB 3REWA 1WV7T 4D9RE 3IJHA 1NMAH 2IF7A 3LIZH 3QA3A 1D9KB 3OXRB 4FQJH 5AZEL 4X4YA 3CPLB 2ZCKL 4ZPVB 1OTUC 1MCLA 3VW3H 3IU4L 3LKQB 5FHAL 1FORL 1K2DA 4YDJA 2FWOB 5F7EL 1ETZA 1MCEA 3CDGB 5HHXL 1X6LA 4O51B 4JZOB 1L0YA 3AS2A 1QSEE 5I1GH 5JXEA 1FE8H 1YEHL 3VI4E 2WAHA 1FVCB 4NKOB 4XHJD 3IJYB 3BESR 4NDMA 2FR4B 4M1GL 3D85D 3LRSA 4N9GB 3BE1H 2HMIC 1Q0XL 3CDGA 1FH5H 2K1MA 3P0VL 4RFEB 5TF0A 2X4QA 3H3KA 4JZOA 5FYLH 4TUOB 1BBJA 3MCLL 4RAUB 3RWJB 1FVCA 4JFQB 2VOTA 4P3WA 4RWYH 1RMFL 3DX7B 4ONGH 1YNTB 4JLRA 1VSCA 2XICA 3KPQA 3LN9A 5IB1A 2HVKA 1TTFA 1OPGL 2WANA 1QO3B 1TVHB 5HDLA 5F1NB 1CFQA 4LPUA 4FZ8H 5LAXB 3HI6L 1UWEL 3TBSB 4TUOA 4YDIH 4NC2B 4D0CB 3VXRD 3QWQB 4XWGH 4RAUA 3QDJB 5GS0L 3RWJA 3LKSB 3QPQD 4KTDH 4LDLB 5E7FA 5L88L 1A3QA 2P8PB 4P5TD 4QXTB 2Z8VC 3FB8B 3DX7A 5D93C 1YNTA 4UTAH 3LD8C 1U2CA 1HHJA 1LO2L 4L3EE 2VLRE 3SDDB 2EDHA 1HKLL 2HH0L 5C0AB 1KCKA 4EN3D 1TVHA 1HI6B 1I8LC 1KB5H 1ZT1B 5IVZB 3D9AH 1S5IH 3MLWH 1FFQA 4M7LL 1L9MA 3MRPA 3LKSA 5ICYA 2A6IA 2P8PA 3NPZB 1G84A 4QXTA 2OMBA 2HG5A 3NIDE 2Y36H 4RDQF 1TFHA 2APTA 2OBGA 3G5XB 3RU8H 1MFDL 1T89A 1WWWX 1XR9B 3FB5A 3IT8D 3BJLA 1UWGH 2H2PD 2E9WA 5DJDB 2E9BA 3F7YB 5HYSG 1J9CT 3FQXA 1R3LA 5FOJA 5CKAA 3WJLA 1T04B 3I50L 5IW6B 5IHUH 1CE6A 3MA7A 1IM3B 3PIQB 2APFA 2A6JB 3G5XA 3FQRA 4U6XB 1K4CB 3EDEA 3VFUA 4DOHE 3LQMA 1UADC 3LZFH 5D2NB 1K8DB 4XPHH 4Y1AD 1TNMA 2FIRT 1N0XL 5ILTL 4F57L 4MVBD 2RCSL 1LO3H 2VC2L 1HQ4A 3HPJB 4JM2D 3HLAB 5IW6A 4P5KA 1U3HC 1Z9MA 5IEKB 3M8OL 3G6DL 3GI8L 4NN5C 1U6AH 1TDQA 2F74A 1JZ2A 2PYEE 4KTYA 2ZG2A 1H5BB 5D2NA 5KS9F 5DUPH 1K8DA 4BH8A 3WIHA 4DK6A 1VEOA 1R5WA 4NC0B 5DMIH 1LEIB 1CDUA 3V5HB 4GRLC 3HPJA 4XNQB 1G7HB 2IBBA 5E99L 5HPMA 1W72L 2R0KH 3DX6A 4PRHD 1VADA 2HWZL 1CL7I 1MFCH 3HZMB 3Q6GH 5KSBE 5J3HC 3VH8B 1RHFA 1H5BA 1YY9C 3GGWB 4F9PA 1MJ8L 2B0SL 1MCPH 1HYRC 1HH6B 4LPTA 1F2XK 1IFHH 1BVZA 1LEIA 4P2RB 4PJ7B 4F7CA 2ESVE 2MPAH 1IGCL 5GRZA 5L2KD 1RUML 4G6MH 1MCWW 5D71L 4NZTL 3B9AA 3S98A 4OZFG 5I66B 4N0UE 3VH8A 3U79A 4J6RH 3GGWA 5JOFA 3HG1E 2BSSA 3SQBA 4QYOB 3L95B 3OKLB 1AGEA 3MGTB 4XNMA 1PYWA 2FBJH 4P2RA 1UEMA 4PJ7A 5EC2A 1QSFE 4PJGE 4KI5E 1GGUA 3PWPB 1V8HA 4DCQB 4UT7L 1DQDH 2D7NA 5I66A 43C9B 2H8PB 1B2WH 4UT6L 4PRAA 2FX9H 4AT6B 2G2RA 3IKCA 3KXFE 3D48R 3OB0H 4QYOA 3W82A 3QO1B 3L95A 4AEHH 1R3JA 2XXCB 2EYTB 1KLGA 3MGTA 2OP4H 3ARBC 4QXUL 1EHXA 4H25B 2EDXA 5AAWA 1EGJA 2BY1A 3FOLA 1QBLL 5EWIL 4Z7NF 4DCQA 1KJVB 4G6AC 1S7QB 1D5BB 1UYWH 1NSNL 4AT6A 2V17H 5T5FL 4DVRL 3STZB 2VDPH 4UDTA 4UIMA 2Y5EA 1BM3L 4V1DB 4X7SL 3L3OB 1RFDH 3CFEB 4P3CH 4D0BB 2XXMB 4MHHI 3MNVA 1YEFH 3QEUA 3S34L 3EOAB 3KYKH 3TZVC 1R5IB 1S7QA 3SBWA 4ZO8A 1P4BH 4N8VA 1E0OB 5IFAH 1QFOA 5I76B 1UKSA 5D7LD 4ZAKB 1GYAA 2R0WH 3H9SB 1H3GA 3WV0A 1UM6L 4V1DA 5HHVH 3L3OA 3CFEA 3PWUA 1ZHKB 4IOFC 3UTSA 1CCZA 1CF8H 3P77A 3VFMA 2EE9A 5EU5B 4FQ1H 3QJHA 4Z0XB 3TJEH 1LD9B 5DF0A 5D72H 1FO0L 4MB5A 2O5ZH 1SVZA 1VFBB 5I76A 3JVGC 1Q72L 4ZAKA 3VRLF 3H9SA 3QQ4A 4P46B 2EDNA 4RWHA 4JG0L 2HVJA 4EI5A 2FH6A 1ZHKA 2Z35B 4NKDB 1YNLL 5A3ID 3VFWB 3T4YA 3L5XH 3MV7B 4GFTB 5INCA 1MREL 3ZKNC 4HWZB 5DEZA 4JHWL 5HGGS 4YDLB 3GDBA 5IIEB 3TVMB 1EUTA 4DUWA 1VENA 1YPZE 4HCRL 4LGRB 1KENH 3QG7H 4YUEH 2IMMA 4WCYL 2Z35A 1I7UB 3NCYS 3U0TA 2E8ZA 3VFWA 4LLWB 3R1GL 3RWGB 4JKPH 2VDMH 3QJFA 5F7HA 5LGHH 3O8XC 1EO8H 4OCYH 1I3VA 5EZOH 4OI7A 1B90A 1L0XA 5IIEA 2GJ6A 4LASL 1QLFA 4U6YB 3IF1B 1JUFA 4LLUB 1FHGA 5FYKD 5KANG 1W72B 4PJ9B 4YFLI 5FKPB 3BOVA 5I1KH 3O0RH 3HR5B 4N0YL 1CZ8H 4P4RA 3N1FC 4WFFD 2DYPD 1U8NA 5CGMA 4KROC 1UGNA 3RP1A 3RX5A 3VGAB 3HUJE 1HZHL 1LDPH 4NN7C 5ENWA 5FKPA 1G7QB 1CFTA 3HR5A 1QBBA 4F3FA 3MRMB 2CDGB 1P5VA 2XPGA 1CDGA 4H26B 2ED9A 5DJ0A 4HGKC 1LO5B 4ZUWB 2XQYG 1A21A 5E95B 1OQOA 3TNNA 1ADQL 2MTPA 5J11C 4OCSL 4JRYD 4QTHB 3IETB 4JVWA 4PTTB 2YXMA 5EO1B 3RNKB 1G7QA 4K94H 1P7QA 1BZ9A 4Z78B 2CDGA 2HT3C 4HIXL 3MUJA 2BVPA 4DFHA 1MUJB 2FYYB 3IAQA 2KQMA 4MAUH 4L9DA 25C8L 3ALPA 3SKJL 4ERSL 2R39A 1IGML 1T3FB 3MRBB 3OJDA 4PTTA 2RHEA 5BW7C 3K4AA 1NGYB 1JI2A 4Z78A 3BRDA 1U8HA 4KZDH 3CJJA 5IGXH 2FYYA 4POZC 2DQUL 4A6YL 2OR9H 4M5ZL 1BIIB 3QDGB 5HTSA 1P2CB 2ZJSL 4NQVA 3L6FB 4Z7WF 1YQ2A 1T3FA 4NKMB 1RJYB 4ZODA 2W60B 1NGYA 1Q0YL 1XIWA 2Z8RA 2B39A 4NQCA 3WJJA 4NQEB 4PJEB 2OJZH 4KZEH 2P46B 3UPAA 2D0FA 4OCNC 4ODVL 4C57C 4L4VB 2KZ1B 3QDGA 4GAGL 5DEFB 1P2CA 3L6FA 3ZDYE 3QEHA 1RJYA 2UVFA 4PJ8D 1DBKL 4KGJA 3SN6N 2W60A 3INUH 1CFNA 1DFBH 3QIBB 4X6DF 2YD8A 4NQEA 4OLYL 4PJEA 3QB7C 1AKJA 5DZOA 5EB9A 4YFLF 1FO0B 3KJ6H 3BZ4B 5FYLE 4L4VA 1JGEB 5IJVA 2YD6A 2V5TA 4NO3B 1W8OA 5I18L 1F6FB 4KUZL 1F00I 4BQ6A 4NSKA 5KG9B 1NCNA 4NBXB 5EG6C 3BWAA 1FO0A 3BUYA 4MA3A 3BZ4A 2KPNA 1DZBA 2R8SH 4QTIL 1TZHB 2BNRE 2Q3ZA 3SE8H 4Y4HC 5JO5A 3ARGA 3TEUA 1IVLA 4NO3A 1P9MC 2DWEB 2IWGA 4UQ2B 5F93C 5IBTL 3ZYOA 4S1SH 3HPLB 1J87A 3QP3A 3RL1B 1QFPA 1I3GL 4PJCB 2AQ3A 3UDWA 5J13B 4W4NA 2HFEA 3PHSA 4HJGB 2AABH 4NFCA 4M7ZB 4FQCL 1BJ8A 3RGVA 4MXQD 4UQ2A 3AMLA 1ZVSB 3L3GB 1R3HB 5K9OB 3TGXA 1WT5C 3BWUC 3AY4A 3ES6A 2X1OA 5C2UB 4KH2A 1ZGLB 1FV1B 4FFZH 4HHAA 4DKEH 1YEGH 4HJGA 4LNVA 3TA3D 4G7VH 2W0LA 4Y5YA 1QSEB 3U7YL 5IJKC 3CXDH 3T0XA 3E2HB 3CNKA 5D5MA 5C09A 4QRPD 1LEKB 3PGFH 5K9OA 4L8SC 1XFPA 1JNHB 1AE6H 1FN4B 1A1OA 3NABH 1ZGLA 3GSWA 1FV1A 1NKRA 5AZ2H 1HYSD 3PP3K 5J12C 1NANI 5EOQH 1NC4B 1QSEA 4MQ7A 5DQJB 3WS6C 4JRWA 3B9VA 3DVFA 4ZSOE 1IGYA 4P2OD 4X4ME 5FO9A 4ELMA 3VG9C 4LQ1A 1FN4A 3GK8H 3U4EB 1BF2A 4N90E 3VXUA 5JHDD 1Y18A 2CKBA 1NGWB 3BPOB 4ODSL 3MPCA 3NZHL 3QSKB 4PR5B 4K7PL 5E2TH 1NC4A 4U7SA 1V7ML 4XP4H 2VQUA 3RTQD 5ISZD 4X8JB 2NY0C 2VE6A 3D39E 3X3GL 3N1QC 3T2NH 2HJFB 2JELL 3EJZC 1IBGH 1ZLUK 1NEZA 4L3EB 2J8UF 2VLRB 3B6SA 3GO1L 3WKNA 4RAVB 2VAJA 4A6YB 2C7UA 4PR5A 3RWHA 1B4JH 3GRWA 4ZS6D 2LAAA 2OSLA 5C0GB 2O5YH 4IOSD 5CIPB 5JXED 5A2FA 1QFWI 4Z18A 1KUMA 1PY4A 2D4FA 5ITBH 5KSVA 4JFXA 2AERT 5BVJB 1A9EB 5JW4R 4RAVA 5LQBL 4B53A 4MNGB 4GQ9H 1V3KA 4RGOL 2EXWD 3HC3L 3VI3F 2NY4C 1X4XA 2DQDH 5C0GA 1H3TA 2JK5A 4UINL 2IG2H 2VRAA 1VEPA 1EA9C 1ZHNA 3T0BA 1MVUB 5FHBL 1BGXH 1UB5A 2B4CC 4MB4A 1A9EA 1NCWL 1NGXA 4MNGA 4DOHB 4G8FA 2XIDA 1S3KL 2D3VA 4TPRL 1IT9L 4YNYA 4FQXC 4MSWA 3BT2H 3WMSA 4TVPE 5GRJL 2R2CA 1A7OH 2CLRB 4OZ4B 3QDAA 5EU3A 3FO1B 3IFOA 3P73A 1MVUA 1OD7A 5C08E 4XP1L 1GC1L 1DUYB 4Z5RA 3MYZA 1OAZL 3KDMB 3MXWH 1IKFL 1FFNB 3DSNA 4YBLB 2PYEB 2IBZX 5L8LB 5L0QC 3T65B 1GGBL 5L7XL 5D7JA 4OZIA 4KKBD 5C0DA 3QUMH 5DJYB 2A6KB 1T03H 2CLRA 1DLHA 4HFUL 2R15A 1AIFA 2C3XA 3HAEG 3MX0A 4OBRA 4HAFA 1JGDB 3FO1A 5DTFB 3I2CH 1GGCL 1K5NB 4OZHF 3QEGH 3X17A 1TZIB 5ERWB 3IAGC 1DUYA 4KKAC 1FFNA 5KSBB 4NC1E 1CL7H 4HWEH 3MJ9A 1EBAA 3ULUD 1S78C 4XBPA 4JN1L 1A5FH 2PYFB 1JE6A 3O45B 3J7HA 1BD2B 3SE4C 2A6KA 3ILPB 2ESVB 2H9GA 2C4XA 1KJMB 4U0RB 1MCOH 5DTFA 2CUIA 4M62H 1DN0B 5ERWA 5J56B 3CVHH 1JV5A 4YO0B 5TQ0L 4N0UB 2BVQA 5KSBA 3QISA 5DQDH 5TE4H 2X4TB 5MEQA 3HG1B 5HJ3A 1YJDL 2Q86A 4LSRH 3JV0A 4BKLB 4GSDL 4GG6E 2L7JA 3OKOB 5GISH 3O45A 3TH4T 1BD2A 1FAKT 3DX9B 4KY1H 4LKCB 3ILPA 1TJIH 4KV5E 5F3BB 1C12B 2V5SA 1QSFB 5FYJH 4PJGB 3AREB 2NLJA 2XZAL 4LARH 3E1F1 4AENB 3CX5K 4LHUA 5AWNH 2F5AL 1QLEH 3ULVC 2FJFB 2LVCA 4V2CB 4X6BB 4X7TA 4CN1A 3KXFB 4ZNEE 4BKLA 4U1NB 3NFPB 2ICCA 3FO0L 3ET9F 3SO3B 1HHIB 2A83B 4QNPE 4Y8DC 1V3MA 3DX9A 4OQTH 4M93B 2ZSVB 3GSNH 1QSFA 2NW3B 3AREA 4AENA 1T0MA 3TM6A 5F1SA 3MRQA 5HHPA 3QWOB 1SVCP 3GI9H 2F5BH 4U1JB 4FFVD 3TO2A 2FJFA 2VAAA 4X99B 3V5DB 4NZRL 2Y72A 2NR6C 1A47A 1NMAL 2P47B 2YMXH 3BAEL 2A83A 3LIZL 4NNYA 1NAMA 2ED8A 3LQAC 2QKIA 2ZSVA 5HPOA 4YPGA 2NW3A 3VW3L 1MF2L 4U1LB 2QQKH 1ZS8B 2VDKH 5AUMB 2HRLA 5E4EB 3WD5L 2PF6A 1U41A 4KKCD 4Z77A 4X99A 2GAZA 3V5DA 3CZFB 1SYSB 4PLKD 1TLKA 4FQQB 5DRXA 1J5OH 3UC0H 3DETD 1CXLA 3UTZB 4P2RD 1X5ZA 5GXBB 1MHEB 3RL2B 5E6ZA 3QZWG 4LLYA 3BE1L 1ZS8A 2QL1A 4JRXE 2I5YH 2V7NB 5KZCD 3N1GC 1KLFA 1Y0LA 1FH5L 2ZUTA 5FYLL 5T1DH 3CZFA 3LKNA 2GTWB 3ZKQD 4JQXA 4H88H 1PLGH 4W4OA 2R23B 4KRPC 3SY0A 3V8OA 1EHLH 2UWEB 1A0QL 3O2WH 3PWPD 1NBVH 4OD2A 4QXWA 4L3CB 5H37H 2P44B 2V7NA 4M6OH 4I3SH 2FBOJ 4JREB 3DLQR 5IVOA 4S1QL 4QRSA 4Q6IB 4FZ8L 3ARPA 1CU4H 4PJFF 1HCFX 2GTWA 4YDIL 4G6JL 4EUPG 2OJEB 4ZQKA 4P4KC 3WFCL 1FC2D 4N1EA 3JUZA 3CH8A 1YPZB 2UWEA 1U8LB 4UB0H 1CK0L 5F7LB 2NQCA 4P9HC 2F53E 3MUHL 1QZ1A 3QO0B 1KB5L 3OKEB 5EBGA 3D9AL 5ELIA 4E0RB 5IVXF 3PGCA 4DKFH 1S5IL 1SMAA 2OJEA 2IALA 2GTZA 1QG3A 1U3YA 2Z4QB 2EO1A 1U8LA 1YECH 4V1DD 2Y36L 1GVIA 3F5WA 4XXCA 2FEEL 3RU8L 2ITCB 3NTCH 3FTGA 3TCXA 2VUOA 1VFMA 2ID5A 3UTSD 4NFDA 4NT6B 4XP6L 3D1MC 5FECB 1CIDA 5HI5D 3S36X 4E0RA 4U6TA 2DIJA 3WLWD 3MRDA 2BXYA 2WIIB 3EW3B 4XAWH 4ZAKD 2NXZB 5MP6H 3HUJB 2R9HC 3H9HB 3H9SD 5C0CE 4UDUB 4X5XB 3U0PB 1RIVL 4XMKH 5LXGL 1GCFA 4QCIB 4F7MB 1FNSH 4J4PC 4JHBA 4CVZA 4NT6A 1OARL 5FV1L 3DIFB 2GK0B 1HEZB 3F7VB 4KRNA 2F54E 4XX1E 4XPHL 5D70L 5BOZG 2ENYA 3BDYH 5CP3A 1LO3L 5H94B 1D6VL 2EO9A 3S9DB 3HUJA 4WEBL 3H9HA 4Y5XB 4UUJA 4UDUA 5C9JB 3U0PA 1IQWL 1EZVY 3QIUA 4QRUB 2B1AL 3C2AH 1U6AL 3B9KC 4JR9H 4PGZA 5D1XA 3ZYZA 4KK8D 3DIFA 2GK0A 1HEZA 3F7VA 3MV7D 3P0YL 2ITDB 1KT2A 2Q7NA 4NPYA 3MLUH 3V0AC 2AEPH 1A3RL 2CO6B 5FFLA 5H94A 5MEOB 1IC4H 3CCHA 3MRKB 2MQCA 2GJ6D 1ZWIA 4FG6C 3ZHLA 3NCBB 5LGJB 5C9JA 4NBZB 1BJMA 2X1PA 3DPBA 4ZS7H 3X12A 4QRUA 2WM0A 1MFCL 3Q6GL 4YR6B 2YPLE 1KSRA 2NZIA 1A8JH 4GJTB 4X6CA 4ENEC 2XN9E 3RKDC 5ECJE 3T3PF 1MCFA 3IDIA 3GJFK 2N56A 4TQEH 1X4YA 3OR7A 2HFFB 4F80A 2ZOLB 2MPAL 5D9SA 1D5IL 4I5BB 4G6ML 4IRSC 1CVSC 3ARTA 3B83A 4PJ9D 3V4VL 4KAQL 1QSZA 1T83A 4YR6A 4JB9H 2Y6SC 4WO4B 1KYOJ 1U8MB 4RIRB 4B41A 2VERN 4BFBD 4UOJA 2GCYB 5IMMB 2AJZB 2BHYA 4LCWA 3MCKA 2OK0H 5MHSD 2FBJL 1FLRH 1N7MH 3MREB 3OKKB 3MRNB 1U91A 2CXGA 4X98B 2O26U 3O3EB 4XTRC 3NFNB 1WVZA 1DQDL 5KS9E 1P69B 1B2WL 1P7QD 4WO4A 2FX9L 1CE1H 3H8NA 3MLSL 1U8MA 4RIRA 5DXWA 4AEFA 4PJDA 4PJIF 5B4MD 2P8LA 4MS8C 2W92A 1U36A 5I74B 4UTBL 5TE7L 4TVPL 4L29A 3O6MH 3WNLA 2CDEA 3VG0L 4ELKB 3NCJL 2FO4A 5K59F 3VRIA 1JGUH 2CR6A 4XMPH 1IGIL 4MMXC 1UYWL 5DD1H 4YDVB 1NCDH 4TNWF 5BV7L 1UENA 3C6LC 2E3VA 3HC0B 2BNRB 1QYGH 4HGWA 4DUVA 2VDPL 4YIQA 4MJ6A 1RFDL 4P3CL 4XCEB 3W0WE 4HUMB 2AXHA 3KYKL 1AD0A 4ZUTB 1T7XA 1XIWD 5B8CC 1NJ9B 1I4FB 1OVZA 1P4BL 2KBGA 1KB5B 4NQCD 5T5NF 4V2BA 5IFAL 4MX7B 4NN6B 3ARUA 2DQIL 1TVBB 1JZ4A 3HC0A 1CGYA 1T2QH 3VGDA 1FJ1A 1GGIH 3QDGD 3ZSSA 4JFYB 5H35A 2HN7B 1F8TL 4MJ4A 2IH3B 1CF8L 3M17A 2CGRH 3UTPD 1QPXA 3VXNA 4JM4L 5A2IH 5D72L 1CLYH 4EI6B 1KB5A 4NQED 3OKNA 4MX7A 1AKJD 3QPQC 4S0SD 4ZUSB 2PO6B 3RWFA 4D9QE 3OAUH 3MRLA 4L4VD 5B39A 4E5XA 4X5WA 2XZQL 3JV4A 4Z7NE 2HN7A 3FFDB 1X5JA 2JCCF 4XPAH 4LLQB 4EN3C 1EHNA 4MXWL 3EOBB 4KKLD 5EOCH 1S7WB 3V0VB 3LD8B 3Q5TA 4K7FA 1E4WH 3BEVA 3QIBD 5LBSH 4ZUSA 4JZNB 2C1PB 5H2BB 1NANH 1RZFL 4OZFH 3TC9A 2L4OA 3ALWA 1KENL 3QG7L 4YUEL 3ARGD 4ZSOB 2O93L 5D96B 4GAJL 4OCMC 4EOWH 2N7BA 4WI7A 3EOBA 1KTDB 1BVKA 2H2PC 3EDKA 4Y4KB 1MAJA 4JKPL 1GZQA 1XF3B 2FGWH 5LGHL 2AJVH 4NFBA 4OT1H 2HJKB 2YD4A 3VA2C 3FCTB 4OCYL 2KL6A 5CD3A 2BY0A 4S11A 5IF0A 3LSOA 5I1DB 5TPWH 1I7RA 5JNYB 3S4SG 1I75A 4LBEB 3RGVD 3D39B 4XGZB 4HIIA 4ZSOA 4Z95L 5I1KL 3O0RL 5IEHB 3QRGH 4PBXA 5J0BA 3SDCA 3DTXB 1KTDA 1CZ8L 2XRAL 1NDGB 4WWKC 5FO8A 4F7EA 1I8IB 2H3NA 3PWJB 1B6DA 3VRLE 2HJKA 3EIFA 3BO8B 5E24E 4JM2C 4PGEB 1TCRB 2YPVL 4R7NA 5I1DA 4HWBH 4CNIA 1MIEH 4D9RD 5ACZB 1LDPL 1GPOH 3F12A 4J3XA 1QFWH 4CADB 1NDGA 1C16A 1U3HB 1I8IA 1KPRB 4NM4H 4PRBA 3BO8A 2VNCA 1T1XB 3G6JA 4KC3B 1HIMH 2BJMH 3PDOA 2NXYD 1TCRA 3GSQA 4YHNA 5D2LF 2GY7B 5SX4I 3SCMB 1ZGLP 3PNWB 2MOVA 1QSED 3JTSA 2LTQB 4Y2DB 1YN7A 5ACZA 4K94L 3K74B 4GRLB 2HA1A 5I1IH 1AGFB 3DMMB 2H2SC 1U8OB 3BFOA 4PGJA 4JFEA 4XBGB 4POUB 1L6XA 3HRZB 3S7GA 3EAKA 2MFNA 3BMVA 1S7UB 4GBXB 2CRZA 3VXUD 3AAZB 5HDBE 3G04B 2ZKHH 1RPQA 3PNWA 3S36H 1NC4D 3MNZB 4GXVL 4K9EC 5C0ND 1YUHA 1AC6A 2M8XA 4NO5A 2ZOKA 3ZYJA 1BF8A 4OZGA 4G9DB 4DGIL 3HMWH 3DMMA 3O9WC 5IGXL 1U8OA 5BV7B 1IM9A 1WBZA 4GBXA 4TRPH 1NPUA 4BQBA 3AAZA 3G04A 1DL7H 2VDLH 2XKSA 2FDBP 1UEYA 1NBZB 1NFKA 4KGLA 1PAMA 2NNAB 2UUDK 4JO2H 1KN2L 1CGXA 2PXYA 4G9DA 1IEBB 4KZEL 3P40A 2MWCA 4L3ED 4LPXA 5GPRA 2IEPA 5D6DA 4AH2B 1B0RA 2Y7QB 3KHOA 4R4BB 5IW3A 4NGHL 4H0GA 3HE6B 1S9YB 5ICZB 4LSUH 4AJ0A 3ARBB 5DEGB 5I8EA 2V2XA 3INUL 4YC2C 3VU2A 1KCVL 2K3TA 2J6EL 1YYML 3H0TB 1IEBA 1I1FB 3DUUB 3QIWC 3K0WA 5HVHC 1WJ3A 2EYRB 1MCWM 4AH2A 2Y7QA 1CIUA 4GG6B 1SEBB 4G7YH 3KLDA 4PB9H 4YGVB 1J1XL 4J3WA 1UXSB 4I0KA 4EKXA 1KPUA 4RGMC 1JPGB 4EDWL 1NFIA 3H0TA 5EU6A 3B4NA 2IPKB 3ESVF 2ILLA 4D9LL 3EDJA 2ATPA 1E6OH 1XCTB 4Z7WE 2R8SL 1VACA 2VDOH 2W38A 2AP2A 3SE8L 4YGVA 5BZDB 1J8HA 2ARJQ 4X6EB 1QHPA 2APWA 5CJ8A 5D7JD 3SDYH 3ZTJG 3WEXB 5F89A 3QEQE 1F4WL 4JHAL 3BHBA 2VUYA 5J7CC 1Q8MA 4TSCH 3OKMB 2IPKA 1F4HA 3BDBA 1XCTA 2NY2B 5DD6B 2AABL 3HZYB 4FNLH 5I2IA 4ZNEA 2ICWI 1QFHA 4H5SB 4PJHF 4P5MB 5ETUB 5BZDA 5A3IC 3L9RA 4X6EA 4XC1L 1HXYA 3GNML 3HNSH 4HUXB 1T21B 2X40A 3KPRE 1KC5H 4WHYG 4FFZL 4DKEL 5J1SC 1YEGL 4G7VL 1QD0A 4OGYH 4OFIA 4UV4H 3C2SA 4OLUH 4ALAH 1DQTA 5ETUA 3PGFL 1BD2D 2HLFC 4PUBL 1CYGA 4U31A 2AK4E 3VXTA 2RAMA 1MJ7H 2BHUA 1TENA 3EUUA 3NABL 4X7DC 5ESVB 4JRXB 3RDTA 4W81A 3BDXA 4D0DA 5EOQL 5TDPA 3RX8A 3QUYA 3ULUF 4OLVH 3T0VA 2LE9A 2WWMD 3LN4A 5CEZE 2IPUK 4K71B 4LKXB 4XPGL 3ZT5A 4FQIL 4DKAA 1YEKL 1AH1A 4LF3B 1QSFD 4TTGA 3ARED 3GK8L 1UH3A 4KI5D 5ESVA 3RUGF 5C3LD 3U30B 1S9WA 2IGFH 5E2TL 4Y5VA 1AGCA 3SDAC 2HJLA 1T1YA 4XP4L 2YOCA 2NPLX 4KKNA 1MSPA 4TUJB 2I27N 3AFLA 4LKXA 4YHPB 4RBPK 3T2NL 4JO4H 1IBGL 3BIKA 4P99A 5J1TC 4H1LG 5F96H 5IBLD 2RB8A 1YN6A 4PJXE 3MRFB 4LAQH 4OM1L 2GK2A 2F53B 1H9VA 2VXUH 4HS8H 3FAXA 5HHNA 3UBXB 2NY6B 2O5YL 5IQ9B 1MCDA 1T2JA 4PLOB 1BQSA 1FG9C 2A77H 2FB4L 4PJAA 5I1CH 2N7AA 5DJCB 1OSZB 5DO2D 3EYFB 4R26H 5FDWA 1HHGB 3VDBA 1P4IH 4RMQA 5TF1H 1MELA 1NCAH 1UM4H 2EH8H 4G3YH 2IG2L 5E8OB 5ALBH 4QRQA 3RVTD 4WU5A 1HE7A 2VDNH 4QKXB 2ERJB 5CUSH 5I71C 5C0CB 3ZDZF 1RULH 1UVQB 1ES0A 4HG4K 5FGBC 35C8L 4WTXA 2X5PA 3EYFA 2CJUH 1M4KA 1KJ3L 5CWSA 1E27A 1ONQB 4WHCA 5IW1B 2UY7A 2F54B 5F6HI 2EDOA 2FJGA 4DWHA 4LSSL 4WDIA 3BT2L 3VWJB 5E8OA 2W0FB 2CMRH 4PS4H 3K7UA 5MEPB 3ZDXF 1F4YH 4F33B 3FT4B 4M7JL 1RHHB 2J8UE 2P5WE 4XNZC 1HINL 4UT9H 5C0CA 2BRQA 1B9ZA 5J9PB 4ZDHB 4X6FA 4PD4K 5IB5B 2DRUA 1JZ3A 4MQSB 4GS7B 3OMZA 1XH3B 5AYQA 4ODUA 1EVUA 3VRJB 3HR6A 3K46A 4O2CA 1AXSB 1NMCB 4NRZA 3QCVH 4PJ8C 3QUML 2W0FA 3TV3H 1T03L 3ARFA 1URLA 3OG6B 3EJJX 1V7NH 5JUEH 2J3SA 3I2CL 1WCBB 3QEGL 5HVWA 2OZ4L 5L2JA 5IB5A 4OCWH 1YEIH 1U92A 2YPLB 1XH3A 3VI3E 3CLFH 4P23B 5E94B 4HWEL 3IDYB 3MNWB 1W0WB 2B4CL 3KPLB 1AXSA 2AAVA 2XN9B 1A5FL 1S7VB 5JW4M 2Q7YA 5ANME 4LHUG 1I3UA 1REIA 3CX2A 3CUPB 1WCBA 3KPMA 3VWKB 3CVHL 3AM8C 1KBGH 1D5XB 3KHQA 2YUWA 4F9LC 5CAYB 1W8NA 4LSDA 3QXAB 5DQDL 4PRDB 5TE4L 3VFVA 1W0WA 5ID1B 2XZCL 3CFDA 3ZKXB 2WBJC 4MD0B 5DC0A 2E7LA 3BQUC 4JKKA 5DURB 2E9JA 5HSFA 4MLSA 4XVSL 3T4AB 6CGTA 2ICWJ 3BP6B 4ZO7A 1CGSH 4LCCA 1CFSA 5HGAB 4LARL 5I75B 2NXZD 4ZFZA 3I3DA 5KS9B 3TYFB 1TMCB 5FCUH 3NACH 3QIUD 1KFAL 1LWRA 2ZUUA 4PRDA 5I17B 2Q8BL 4MXQC 5F3HB 2A6DB 3HZVA 3MGOB 4WV1C 1WISA 4OQTL 3QQ3B 2FEDD 4OZHE 3BP6A 3GJEA 3QNZB 2DB8A 2YN3A 5GJTH 5CHNB 2IAMB 5KS9A 1OTSC 3TYFA 3AS0A 2F5BL 4U1IB 2P43B 4EIGB 3QT2A 3QULB 3VXRE 5F3HA 1IMHC 3NFSH 2YMXL 1KJ2H 3HE7B 2WLZA 3MJ7A 1FBIH 3QQ3A 3UZVB 1S7SA 5E6IA 2R1WA 4JJHA 5DJ6B 1P4LB 3SGJA 3W0WB 1HYSC 4JGJA 5CHNA 4L8SB 2IAMA 4JPIB 5J6HA 3RPKA 3WO4B 2VL5A 1BQHG 3U7AA 3VE0B 3BZDA 3S88H 1FL6B 1J5OL 4M9PA 3UC0L 4CW1B 3JWDH 1J7VR 3BXNB 2X70A 1P4LA 3W0WA 4JG1H 1A7QL 4BQCA 5F9WC 4MDIB 3U36B 2XFXA 1DR9A 1R3KB 3FRPG 3HAEH 3MTRA 5T1DL 2CDFA 4WO4D 4H88L 4I0PB 3RA7H 3X14B 3TF7C 2D03H 1QACA 3O2WL 2YRZA 1NBVL 2DM3A 4MDIA 1T66D 4ZS6C 2MQ3A 4M6OL 4OKVB 1N5AA 1CU4L 4LP5A 4Y4FA 1ZANL 4WRLA 1DANT 1U3ZA 2WMPA 5FYLD 3GUTB 3CSBA 1D9KC 2BNQE 3WL9A 2E7BA 4XH2B 2ZCLH 3QCUH 5IMLB 1JPST 4LDOB 2DLFL 5DR5H 4BSWB 2AS5M 1JN6A 2DKSA 3OJVC 2EXWC 1IAII 2BOBB 4WIQA 4PLNC 1A2YA 3W11D 3TESA 5GSVB 2ZSWB 1SJEA 4ZOEA 4XCFH 4HKXA 3WUZA 3QUMB 1Z2KA 4M8VA 1SHMA 3MLVH 1YDPB 5IQ7H 5HGHB 4XNUH 1KTLB 3U0WL 2NY4B 1FIGL 5JMOC 5JDJA 4Q9RH 4K2UH 3MYJA 3RI5K 4BSWA 3NTCL 3VFPB 1N8ZB 2X44D 3QDME 1OOAA 4Z7UE 2CIKB 4HF5L 3EZJB 3QUMA 3B8SA 5DMKB 1F58H 2OX5A 3C8DA 1HN1A 1LP9A 5L2KE 2I60L 5MP6L 3IDXH 2EDKA 1NGZA 2G5BB 1HOCA 4XMKL 4LNRB 3S3SA 3CVHB 1NCTA 4BZ2L 1CT8A 3VFPA 2X4RB 2M2DA 4ODXB 1N3NA 2B5IB 4PJFE 4M4RA 5D7SH 4WHTA 3MLZH 1PJ9A 4FZEH 3SOBL 4H20L 4FXGB 3G9VA 4CDHA 5L0QB 3U82B 4QHKJ 1J0ZA 1DBAL 1OY3B 5SX4H 5CEZL 5I16A 2G5BA 3I75B 3FB6B 4KDVA 2QHRH 3FQNB 3SDDC 5DRWB 3CVHA 1JTOA 2IFFH 2XNAA 2OTUB 4LVHB 2R4RH 2X4RA 4ODXA 5EC1A 5IVXE 3QI9A 5TDNB 1J10A 2W59A 1OP5H 2NTFB 5IV2A 2PW1A 3MLUL 5JORA 1CGVA 1MQ8A 3WJLC 4R8WH 3FB6A 1OAYH 4FHBD 2PR4L 2VZSA 5DHYB 5I15L 5DRWA 3CD4A 4ZS7L 5KSAB 3ULSA 4TTDC 4Q74A 1ZA6B 1X4ZA 4TNVF 4GRWF 3SDCD 4Y4KD 5B21A 5TDNA 3ARSA 4PJ5E 1MAMH 3L1OL 4U7MA 4UILH 3ARDB 4LMQI 4IRZL 4TQEL 4OQTA 1T20B 1NUGA 4JANB 3GSNA 3WNKA 2DDQL 2C9AA 3SQOL 4FTVE 4DTGH 1WTGT 4EUPH 1YMME 1ZA6A 5T1MA 4HD9A 5D2NC 2J1KA 2YA2A 5D7LE 5F7KC 4JQVC 1TQCB 5CJQH 3ARDA 3B8YA 4G5ZL 5M95B 2Y07H 3MOQA 2MCG1 1S7XA 5IB4B 4JAMB 1JGLH 4FFVC 5KVEH 4WY7H 3DO7B 3ZT7A 3FHAA 3MLTB 1H5BC 4UNUA 5GJSL 4F9PC 4M02A 1CE1L 1RK1B 2AJ3B 3H6JA 2VLJE 3HI1B 3ROLA 15C8H 1CQYA 4JDVB 4JFED 3CFBB 3WFEL 3MXVH 1KACB 3SCMD 4PJBF 5JW5B 3O6ML 3LB6D 5GGTH 4JFPB 4Q9CA 3LQZA 4GW4B 4Y2DD 1JGUL 4KKCC 1K4DB 3DO7A 3IJSB 3D5OF 1ZT4B 3MUGA 3SPVA 2XV6B 4PLKC 1RK1A 1AJ7L 1NCDL 3HI1A 1BZ7B 4Z7WB 3DMMD 2VTFA 5DDHB 3ROOB 1KCSL 2HTLD 1QYGL 2ATKA 3CFBA 1IM9D 1WITA 4GBXD 2DQHL 5D1QA 3GMQB 2W9EL 4NNPL 3QHFL 4DN3H 2OMNA 3PABB 2YUVA 2ORBH 4WUKL 3QEQB 3D6GA 3PP4L 4OIAA 1ZT4A 4ODTL 1O7VA 4MQTB 3GSVB 3CSYB 1MJJA 5B39G 2PXYD 1VFUA 1U3JA 3L3IB 1BZ7A 4ELMF 2Q6WA 1OF2B 3ROOA 2BZDA 4UI2A 5D4QA 1T2QL 4OJFH 5DS8A 1UA6H 5FYKE 1HCVA 1MWAL 4YHLL 1GGIL 5LWYH 3UJIH 3GIVB 3GMQA 4X6DB 4KJYB 3OR6B 3PABA 5EPMA 3ULVH 5DA0B 4M6MH 5CJ5A 2X41A 3QEQA 1SM3L 4WFFE 1MH5B 5DK2A 1CICA 3KPRB 3MO1A 4EBQH 1FFOB 3T8XB 3BRGC 4JJ5B 5T1KA 4L3AA 1QP1A 4X4XA 1NGPH 1RZ7L 3U4BH 5K93A 1CLCA 4PB0L 2IBGA 3IFNH 4PGBB 3LMJL 2GJZA 3GSXB 5EOTB 5I8KH 5K59E 4X6DA 3HE6D 4KJYA 3CFIC 3Q6FA 3BIBX 2AK4B 3K8LA 5CBAB 3PV6B 3V5KA 3SBWC 5MENE 4HIHA 2G9HB 4FABH 3SE3A 1MLBA 3T8XA 5EU6D 1AI1H 3LQAH 4MMZC 4IRJA 4PV9B 4L8BB 3DWTA 5GS0C 1ZEAL 4JRYE 4DZBB 3RFZC 4E9LA 3VFGL 2QQNH 5HDQH 4LIQH 1RV6X 3CLEL 3PV6A 5HI5C 2BCKA 4JFOB 2WUBH 1EGJH 4J7RA 2G9HA 4CU7A 2FGWL 2AJVL 4OT1L 1WEJL 4K3DL 3WLWC 1VGEH 2DMBA 4JZJB 3TIEA 4WTZG 4ZAKC 1QR1B 3C8KA 2DLTA 4DZBA 4XP9H 1I9IL 4LVOB 4KTEH 1BP3B 3NIFF 1RZKH 4JDTH 5C7XL 4WNQB 3K4DA 4PJXB 4XAKE 5DVOA 1G6RB 4JZJA 5IROC 3U2SB 3X11B 1QR1A 5GIRA 3MJ8B 1I8KB 3WIFB 4P46C 2WQ8A 2JCCE 4HWBL 3QQ9C 3UCRA 2AW2A 3KLHC 4FQHB 1GPOL 2BC4A 4NNXB 2WWKO 4OZIF 1N2RA 5GGSB 1GL4B 3RKPA 1QFWL 4NJ9L 1QQDA 2CXKA 5FK9A 4DZ8A 4YDLC 4HV8A 4UV7H 4M1CC 3RDTD 3TVMC 1HIML 5CGTA 5DSCB 1I8KA 2EDEA 4JGMA 5A2JH 4K3HA 2CIIB 1OAXH 3O6FB 1WC7B 5FGCE 5F9OH 3RPIA 3C5JB 2AXFA 3TYGL 3D2UB 3L3HB 4XPBH 4AQ1B 5I1IL 1I1AA 3MV11 3CDFA 2FJHB 1MCBA 3OXSA 3T2OA 3LH2H 1BEYH 2J4WH 4MWFB 4GO6B 2ZKHL 3M45A 4J2XA 3S36L 1JNLL 4ZMAT 5ADPH 4PJ9C 3UO1H 2J8UB 3KPNA 4ZXBB 3PWVB 4RCAA 2P5WB 1RUQL 3L3HA 2ADFL 2D7OA 3P30H 5HYSB 3KS0J 1NL0L 5JR1L 3TJHD 1CG9A 2QLVB 4RZCB 1WAAF 4TRPL 3DVNB 4MWFA 5JHLL 3VGAC 1KG0A 4Y2OA 3V6OA 3VFOB 4OF6A 1UM5H 2P5WA 4JO2L 3RHWK 3JTTB 5HYSA 5DUMH 1ZXQA 4HDIB 1JFQL 3A6CH 3BSZL 2DD8L 2R2BB 4Y89A 3B2VL 5GGRA 4DVBA 1VFAA 5FM5O 2P24A 1MWAB 1RZ8B 1ZA3A 4Z8FH 4G9FE 5ANMB 3X13B 4OM0L 4UOW1 1FVDA 1PD6A 3V4UL 1XGQB 5FA4B 3QNXB 4NWTL 1TETH 1JHTB 3WIIL 4XHQA 1OGAA 2R2BA 1JHKH 4YK4B 4G7YL 5SX5K 1RZ8A 2DMKA 4PB9L 1ND0A 1TTUA 1MQKH 4QRPE 3WS3A 5JIHA 3BMWA 5EH1A 3FKUS 4WI8A 2BP3A 3CVIL 1A6TB 2BSRA 3D85B 1VHPA 4ONHA 2F8OA 3AU1B 5C0CD 4NHUA 1JHTA 3WE6B 2CUMA 5F9AC 2VDOL 3B3IA 1C5DA 2BVEA 4HMDA 4M48L 5IESH 3DV4B 2YSSB 4OLXL 4CMMA 3EYOB 1QEWB 4K7PY 2PKDA 3VWJD 4OZHB 3SDYL 3VFTB 4MD4B 4OQ1A 3O6LH 1A6TA 4OLWH 1FAIH 3ARFD 3QFJE 4N8CH 3FN9A 4QT5B 1YY8B 3KR3H 5HYJE 2BMKB 5E03A 4TSCL 3EDFA 2CO7B 5HYIA 4LDEB 1ITCA 3WNMA 1C1EL 5KOMC 2VIRB 1H0DB 3R06B 1OWWA 3GMMB 3K1DA 4FNLL 1ZT7B 3IDNA 4OUUA 5DJXB 1PEZA 2G75A 3VXRB 1G0DA 3WFHA 2YZ1A 1ZHLB 2BVYA 4NIKB 4OZFA 1HHKA 2V2TA 2EKSB 4QOKA 3TH2T 1QEWA 5EN2B 4P5TB 2AEQH 4KKLC 2MNUA 4OZHA 3LPGA 4AG4H 3QUXB 4OCXH 4QT5A 3QIBC 3CSPA 3O4OB 1SY6L 1EJOL 1UKTA 2ADGB 1OSPL 1KC5L 1F3DJ 2YK1L 4YBQC 4KHXH 2VXSL 4MNQE 2HT4D 4OCRH 4XI5D 3GMMA 4P23D 3TFKC 1R5VA 3D0VA 2C1OA 1RIUH 4YEFA 2EDBA 3M1BA 1BJ1J 5EN2A 4OB5H 1YZZA 4WW1B 5LCVL 4ZYKA 4HZLB 1BX2B 3LKOA 4JFFA 2X9WA 4AQOA 1DBBL 3UDWC 4KQ4H 1FGVH 3WBDA 2GJJA 3VWKD 2GI7A 3CZJA 5ICXB 1YEDB 2X05A 1PG7X 3L5IA 3WNPA 1FGNL 5EZJB 4O00A 1DBML 3OHXA 4HWBA 1EDQA 4H8WH 2APVA 5DURD 2QR0B 4HZLA 4PRPE 1BX2A 2Q87A 4GMTH 3F65A 4N0RA 1G1YA 4GRWH 5J13C 3QXUA 4F7TA 4GRMA 3QXDA 1G7MA 2IGFL 2E27L 3ABZA 5GGQL 3PGDB 4PJHE 1YEDA 3CFJB 3P9LB 4M7ZC 5CILL 3WKMH 1IL1B 4KK6D 2B2XL 3DRQB 4OFYD 5CGYC 2BNQB 2VYRE 1IILE 2VZ3A 4QHUA 1I8LA 1E4JA 1J0JA 4XPFL 5E6ID 4L4TB 2V9QA 4HH9B 5HYQB 2X4SA 1M1SA 3RZCA 1F5WA 1XGRB 4LAQL 2KDGA 2Z91B 1FL3B 2IAMD 3CFJA 1IL1A 1GGTA 1HHHB 3E2HC 2D0GA 1JYWA 5C0BA 4KK9D 4B7IA 4LVNB 3A67L 5FYKL 3HE7D 5JQHC 2YBRB 4MNHB 4Z0BL 1CGWA 2A77L 4GKOA 5JW4N 4PP1D 1I1YA 5I1CL 4L4TA 4PTUA 3W0WD 2C3GA 3D3VB 4R26L 3QDMB 3VDAA 1PX3A 3ULUE 1FL3A 4ODHL 5CLWA 1IAOB 3ZTJH 1HHHA 1NCAL 1QA9A 1P84K 1UM4L 2EH8L 4G3YL 1VDGA 4CMHB 1QLRA 2H1PH 2VDNL 4X6CF 1RUKH 4HUNB 5L2KB 5CUSL 4NKIH 2X1QA 5DFWH 4XRCA 5D7IA 4HULB 5BRZA 3WDHA 3JWOL 2CJUL 1JI1A 3E8UH 3FMGH 3D3VA 4PJFB 5E8PB 4F2MB 2AJXL 3QDMA 4XVUD 5E9DB 1IAOA 1JPFA 3PWLA 2YC1B 5GHWL 2CMRL 4NO0B 4PS4L 1LE9A 1F4XL 1MFBL 4WHYH 5F88A 5J8OA 4UT9L 5JIPA 4L8DB 1JHLH 4I0PD 4BFIA 4OD1H 5CZVH 2YN5A 3LHPH 1IGJB 2VH5L 4F2MA 5E8PA 4HFWA 3MGAA 5IVXB 5EBLA 5E9DA 1EX0A 3U9UA 3A6OA 1XF4B 2FATH 4LRIA 3KGRA 3QCVL 2SEBB 4I8DA 1BOGB 3QWRA 4NQSB 4HUWB 5K9JL 2Y9RT 1K6QL 4NO0A 5JLZB 2D0HA 3VMOA 5GS3A 3SE9H 5C1MB 5I19L 1HSAA 2I07A 4L8DA 2FX7L 3CSGA 1YEIL 5EZLA 5A16B 3MLXH 5A1AA 3CLFL 3BYYA 5HHQB 4YC2B 1S9XB 5IVXA 1A9BB 1XF4A 4NJAL 1MIMH 4PJ5B 3OKDA 1AO7A 4M7KH 1J18A 1BOGA 3HCVA 3WFBH 3ZDZE 4C54A 8FABB 5JLZA 2DLIA 4ZOBA 1Y6KR 3UPRB 4QY8B 2GSIB 2MKLC 4ORZC 4K3JL 4FTVB 4PYGA 2ZCHH 1KELL 3UZEA 4FXKA 4NZUL 4NQDA 1YMMB 4PIRF 1CI5A 2Q76B 3OB8A 5HHQA 4RNRB 1S9XA 3N85H 3RY5A 1ACZA 5E2WH 2NX5E 5FUCE 3ZDXE 3TWCL 1T5WB 1R3IL 4H1LH 4ZPTB 5J06A 3W9DB 1CLZL 5DMGD 8FABA 3KVQA 4EZMA 2GSIA 4P2RE 1MCIA 4M8QB 4FTVA 1P6FA 1EO5A 1F45A 4KXZI 4KVCH 3B43A 3TT3H 2IMNA 5FCUL 4YBLC 1YMMA 4JY4B 5F7UA 4Q0XH 4ETQA 1EEZB 2VLJB 4ZFFA 1T5WA 1YEEH 5IR1B 3IU3B 3W9DA 3AVEA 2HRPL 4L9LB 5FM4A 4P2QA 5MERA 1RZGB 2WLYA 4LIQE 4YX2H 1RZJH 5GJTL 5FYJD 4PP2B 2LU4A 2PCPB 3BKYH 4D94A 1R24A 5K9KA 3O3DA 4JY4A 3NA9H 4HMCA 3RVXD 4Z7QF 4YE4H 3MLPA 1EEZA 2VLJA 1QPPA 3FQTA 3NCFB 5KN5B 1TNNA 1NFDA 1U0QA 1G9MH 3HNTL 1DEEB 3PHOA 1KJ2L 3IXAB 2P1YA 2EEBA 1TPXB 1RUAH 4PRNA 4MJIB 1RZGA 2AV7A 4CVXB 1A6UL 3P4OB 4HPYH 1U8QB 1BFOB 4P3DA 5F44A 4BH7B 4HXBH 1A7PL 5BS0A 3MRGA 2XWJB 4R97B 5HGBB 5KSAD 3LPWA 1UZ8A 5EIIB 3B2UD 5CJOL 5DK0B 5F8RC 5FUZH 1QUNA 3S88L 43CAB 4XBEL 3O2DH 4KDTC 2VXQH 3ARDD 3JWDL 1Q9LA 3AREC 4KI5C 4TSBH 4V1DE 3IFLH 4MJIA 4CVXA 1U8QA 3O2VH 5IK3A 4ZTPH 3O81A 3UTSE 3B5GA 2ADIB 5J89A 4LAJH 1E4XL 2OXHA 1ZTXH 3SO3C 4ZFGH 5TFSL 1KB9J 7FABH 3IDJA 3EYVA 4M93C 5DJZB 1FZKB 3MACH 3RA7L 1X5XA 3TBVB 2J88L 3DXAA 5IBLC 3L3KA 3GEWB 1F13A 1FZJA 5GSRA 1H3WM 1XF1A 5MENB 4LSVH 2FD6H 4PJIA 4GKSA 2V2WB 1OP9A 3WO3B 4ZUVB 1A6PA 5KOVC 4TULH 1PKQA 4QGYA 4YBHA 3W39B 1X5GA 3KLAB 2DQFB 3PXHA 4LEXL 4E42B 2EXYC 2WUCL 1G7LA 4LHJB 1TVDA 5DO2C 3O8XA 1EERB 4WJ5B 2Y06L 4WI6A 1H8SA 3RBGA 3T77B 5IBUB 3FFCA 5HI4C 3ZT6A 5MENA 4XVTL 3E6FB 5E4EC 3ORJA 1YC8A 1MCJA 3D25B 3RVTC 4PY8I 4JQXC 4XCFL 4IM8A 1UKQA 2Z31B 3W39A 1MOEA 3ZE2F 2GJ6E 5IQ7L 2CK2A 1PG7H 5DUBA 1CDYA 4E42A 2NY5L 1HH9A 1S5HB 4J3VA 4M3KB 4Q9RL 9CGTA 1R0AH 2AJYH 4K2UL 1JPSH 4WJ5A 1BFVL 5KJRL 3LKPA 3RWDB 3T77A 1SBBA 3NZ8B 3LOWA 3H9ZA 3E6FA 4YHMH 3QEQD 1SYVA 3U9PL 8CGTA 1CICD 4OZGF 1QKZL 5FO7B 1GOHA 4LOUD 5H8DA 1L0QA 2Z31A 1X5FA 3H2WA 5T1KD 3DGGA 2JCCB 2DJUA 3IDXL 1GOFA 5F7DA 1S5HA 5FB8B 1WGOA 3ZL4H 1CXKA 2MCPH 3VFRA 5FKAB 5IFJB 4JREC 4J3TA 4JQIL 1RAMA 3D87B 3HFMH 2XY1A 2DQTH 4IRJD 4OKDA 2AI0L 5ACMA 2P4AB 4R96A 3N9GH 4J3OC 4IJ3B 3MOAH 5FGCB 4PYHA 3H42L 1TTGA 2EH7H 4K23H 3MQIA 2R4RL 4LQFH 3O3AB 5IFJA 3CU1A 1RSFA 2AK4D 5HD8D 4YXKH 4QO1A 3JUYA 2HAZA 5IM7B 2GY5A 2CK0H 1X9QA 3G5YB 5AD0B 1WCQA 3UTQA 3QXVA 1I9JL 3G08B 1PY9A 1DQQB 4MJ5B 2OYPA 3BZEA 1OAYL 3BD5A 4MCZB 1A7NH 1N26A 1J1OH 1ZK9A 2R1XA 1HDMB 3IDMA 3BZFB 2DL9A 1K8IB 5IM7A 1MAML 2HFGH 4UILL 3OB0K 1DUZA 3G5YA 1KJ2B 1IJ9A 1PZ5A 2FHBA 3ISWA 4PG9B 3T0WA 2NXZC 3LEVH 3QAZB 4YXHH 3I6LD 4U1HB 4U6HB 1PSKL 3QIUC 4ISVA 2HKHH 1XF2B 3BP7B 3OAZH 3RWCB 2JJTA 1LEGB 4NQCE 5D2LB 4B50A 3BZFA 1I9RH 1K8IA 3E6HB 3ULUL 1FRGH 2BY3A 1DBJH 1KJ2A 1X7QB 3C5ZB 4XC3H 3FB7B 1C5BH 1EEYB 4HK3N 1KIRB 2Y07L 4WVRA 4D3CH 4G9FB 3LEYL 4U1HA 2JB6B 2PW2A 3RAJH 4O4YH 1JGLL 2FX8L 4GMSH 5B3JF 3UTPE 5KVEL 1Z9SA 1WFNA 5BJTB 1CD9B 3RWCA 4J3SA 3NCEB 4PJEE 3HAEB 3ZMRA 4OAWA 5IB2B 1I1AD 5D2LA 3TA3B 4ONFH 15C8L 3K2UH 5EIVA 3CGTA 1KEGH 4WFHD 3FQWA 1HKFA 5HGDA 5I1EL 3C5ZA 1ZLWH 5KTEH 1YQVH 4MAYB 5EUKB 2JE8A 1KIRA 3ZE1F 4IIQB 3MXVL 4QRPB 5DC9B 5C0FB 2OTWA 1I85A 4KWUA 2JB6A 5GGTL 5HI3C 4GRWE 1KF9B 4ZUUB 4YAQB 4GKNA 4M61A 1GH7A 2E7CA 4Y4HA 4IOIA 5JW4Q 3HAEA 5FCSH 1U8PA 3DV6B 1P9MA 3V7MA 3ILQD 3V0WL 1IKNC 3IAPA 4HJJH 5EUKA 4EXKA 4OF0A 3WIHL 2XTJD 1JNNL 2XQBL 5C0FA 1ED3B 5ALCH 4P2OB 4CJ1A 5DMYA 3QFJB 4ZXBD 5C6PB 5HYJB 4TOYH 5JW3L 2P5WD 4WO4C 4S1RH 5BQ7B 5F9WB 1FNFA 4HJ0D 4YWGH 3DV6A 3LY6A 5I30H 1FNEB 2FSEB 3P4MB 1FP5A 1UA6L 3RTQB 5LWYL 3FOMA 3IJHB 5L8KB 1DANU 3VDCA 1T66C 3QA3B 1B0GA 1PGRB 4HIJA 4KJQD 4URTB 4XCYA 5KW9L 3CK0H 2EIEA 2XTLA 5F71A 2VB5A 5HYJA 3TPUA 2I26N 1D5ZA 4EBQL 1VEMA 3DYPA 1ETZB 3EYQD 2XWBA 4MNQB 1G7IB 2HT2D 1OGAD 3U4BL 1FNEA 2FSEA 3P4MA 3GBNH 1UACH 4LLDA 3S8WA 2YHGA 2NZ9D 4ZTOH 5I8KL 5TDOA 2FL5A 2W07A 4CAGA 5D5ME 5C09E 3L5WA 2EDFA 3W11C 5J1AA 4NDMB 3SEPA 2AGJH 3WYRA 1ORQB 3LRSB 4Q6YA 3C6SA 4M1DH 1AI1L 2E7HA 4MNQA 3MMEA 4PJAF 1G7IA 1J0HA 5ESAA 3H9YA 2X4QB 5DWUH 1AQKH 4H0IA 1BBJB 5E8DH 2FGZA 1N0LA 2UV3A 32C2A 4W68A 4PRPB 1MRDL 4LIQL 4Q9QL 1MFNA 2H6PA 3PQYB 4JLRB 1M7DA 1EGJL 4ELME 3KPQB 1ORQA 1J11A 1LO0H 5IB1B 1IC5H 1VGEL 2HVKB 4NN6C 3VXUE 2EDRA 1NGQH 5B38G 4PJHB 3VXME 1A6WL 4I0CC 1CFQB 4RAHA 1LE5A 3D18A 4KVNH 5F9JA 1MY5A 3SKMA 5C0IA 5GZNC 4XP9L 5AG9A 4Z7VA 1ROWA 3EYUL 4F37F 2IH1A 4PRPA 1NBQA 4KTEL 5DVNA 4FQ2H 2ED7A 1N59B 1RZKL 2YRPA 3PQYA 1H8NA 2BVOA 5JOPE 1HHJB 4Y7MA 2VJXA 3VMPA 1EMTH 3STLB 3N50A 2PO6C 3UMTA 3UYRH 3V52H 4PJHA 4EEEA 3QZWA 3W2DL 3EJYD 4LMQE 1EFQA 4BUGA 3MRPB 5ICYB 2A6IB 3RX7A 5CEYB 1N59A 2HG5B 4ZD3L 3QUXD 4JFFD 3A0OA 3MROB 2BFVH 5GRYA 1JWUA 4UV7L 3FB5B 3STLA 1EH9A 5DRNA 4MZ2A 3L5JA 3QUZB 5BVPH 4NQXA 1OAXL 1V3LA 4IS6B 3FQXB 1R3LB 2HKFH 5D96C 4Y4KC 3RUGB 2YS4A 3JZ7A 1CE6B 3MA7B 5CEYA 4EUPA 4FQXA 4XPBL 5C8JA 4O5LH 3FQRB 3MROA 1QNZL 2A9MH 2M26A 4MNGE 3UAJD 4I3GA 2C5DC 4P59H 3VFUB 4A2LA 3LH2L 1BEYL 1YYLH 3MRCA 3QUZA 5ADPL 3UO1L 2ARJA 3NIFE 4IS6A 1HQ4B 4IDJH 3ZKSD 3RUGA 1UWXH 1ZSDA 1GZPB 3P2TA 4P5KB 1FVEA 3VGFA 4C56A 4RISH 1KTKE 5T3ZH 4YXLL 5L6YH 4D2NA 1K3IA 2EZ0D 2F74B 3RZCD 3X3FL 4YHZL 4BH8B 3GBMH 1UG9A 4OZIE 1F6LL 1R5WB 3MZTA 2VZVA 3P0GB 5GGTA 1CFVH 5C0BD 2X4UB 1UM5L 5EU4A 2BNQD 3AXLB 3RIAF 1F11A 5C86A 1GZPA 1GAFL 1QRNA 5HPMB 4CBPA 1EHAA 5DUML 3DX6B 2R0LH 4QF1B 1VADB 3VD9A 2W65A 4L4TD 4U1SA 4L5FH 4LEOA 2EEAA 3C87A 3L5HA 4MYWB 3SCMC 2Q8AH 4ZFOA 3MRRB 3C60B 4HC1H 2ICWB 2LTQC 2H45A 4Y2DC 4MQXD 6FABH 2XA3A 2X4UA 4F7CB 3AXLA 5IUSA 2A74A 4OF3A 3UTTA 3DMMC 1XZ0A 1TETL 4QF1A 2HTLC 2C3VB 4GBXC 5BRZD 3HZKB 1INEH 2NW2A 3D3VD 3QDMD 5JOFB 1U42A 2NX5B 2BSSB 3KYOB 3MRRA 3C60A 2ICWA 1P1ZA 1BD2E 1AGEB 4PJCF 1MRFL 4OF8A 3VXSA 4XNMB 1JP5A 1PYWB 5EC2B 4YQXH 3F6LA 4AL8L 1I3RA 2UYLA 5D8JH 4K8RH 5EZIH 1BMGA 5DI8B 3QPXH 3MLRH 4OSUH 4HS6A 5KZCB 4Y19A 2L7UA 2ZUWA 2C3VA 4KXZH 5BV7C 3U1SL 3AB0B 3HZKA 1RJZA 5EO0A 4FOMA 2JB5L 4PRAB 4U2ZA 5E2VH 2G2RB 4JFZH 3IKCB 3OF6A 3KWWB 2NX5A 5E9DD 5IOPA 2J8HA 3KYOA 1R3JB 3T08A 5SV3A 1A3LH 1KLGB 3QWRD 4NO0D 1FFPA 1FAIL 1XGTA 3MOBL 4N8CL 4NWUH 5DI8A 5JA9A 3KR3L 1D7FA 5CMAA 3FOLB 1MRCL 4NC1C 4WUUA 3VI4F 4OGXH 1NKOA 3KWWA 5CSBA 3HE6C 4DJMA 1AO7D 1V5JA 4AIOA 1WICA 2AEQL 3DYMA 4UDTB 5SWZB 4UIMB 3BYTA 3BVNB 2DLHA 3MNVB 1A6ZB 5T3XH 1OAQH 4LSQL 3PHQA 3QEUB 2P5EA 3F7PC 4EVNB 2VXTL 5J57B 4L4JA 5C0RL 4OCRL 1O7SA 3IFPA 2AXJA 5C2BH 4N8VB 3HNVH 4I77L 2RR3A 4PJ5D 1MHCA 5DHVH 5SWZA 2ENSA 5IB3A 2Y4SA 3BVNA 3SJVA 1A6ZA 3PWUB 1CD8A 5IG7A 4FTVD 3LN5A 2QV2A 3UTSB 5F6IB 3P77B 3VFMB 4X7EC 4EVNA 3QJHB 4XXDA 4YHKH 1YMMD 5EBWA 3IU4H 4N1HB 1FORH 2VR4A 5DT1H 4H8WL 3LS5L 3QQ4B 4QHMB 4LSPH 2JKXA 4XZUA 2Y5TA 2HVJB 4EI5B 4GMTL 1JZ6A 5CSGA 4P2QD 3BP5A 1JWSB 1LP9F 1X5YA 4PREA 3KYNA 4YDKH 1NCCH 2NY2C 3T4YB 2HFTA 2PTTA 4OTXL 3TNMA 5INCB 4I2XA 4NO2A 5F8QC 1CR9L 5C07E 4D8PA 4HLJA 3O3BB 1VFOA 4M1GH 5FUOH 3T0AA 2MMXA 2VLJD 1EK3A 1Q0XH 1IGFL 3NIDF 3WNNA 4QHMA 4K55A 3VXOB 5CD5D 1RU9H 2UWEE 1RK0B 2RJMA 4QLRA 1JWSA 1PBYA 3U0TB 2D9QB 2DKUA 1T1ZA 1A6AA 3QJFB 3UP1A 5BS0D 4XB7A 4X9HA 1RMFH 1KCLA 2EIZA 3O3BA 5IMOA 3VFNB 1T7VA 5FGRA 2GJ6B 3Q3GB 2EECA 1QLFB 4FS0A 4IOFD 3G6AB 1JUFB 4GW1A 3VXOA 4S2SB 1J8KA 1FNGB 1RK0A 1NMBH 4KRMB 1X5HA 5E5MA 3WUWG 4MJID 1PEWA 5GS0H 3MUY1 4P4RB 5L88H 3BGFB 2Z8WC 3D0LA 4BELD 1UH2A 1U8NB 3W9EB 2GUOB 2V7HB 4WU7A 1LO2H 3VFNA 2HH0H 4K71C 2FLRT 3Q3GA 4K94C 3WFZA 1RUKL 3G6AA 5DYOA 4NKIL 3K81A 4S2SA 1FNGA 4WW2F 3TJHC 5ENWB 3DXAD 4HSQA 1CFTB 3U30C 4F3FB 1L6ZA 3E8UL 3KPPB 3FMGL 3ZTNH 2VQ1B 3OGCA 2MKWA 2XPGB 1G9NH 3QCTL 4DGVL 5DJ0B 3W9EA 2GUOA 2V7HA 3NAAL 1VERA 4MA8L 1MFDH 5DD0L 4AZ8A 4LSTH 1UFUA 3TNNB 4JVPA 7CGTA 1ITBB 3B9KA 1VESA 4DFIA 1JHLL 4W70A 5CZVL 3LHPL 3HB3D 4QRRA 3O8XD 1P7QB 1BZ9B 3KPPA 2VQ1A 3S4SA 3RVWC 3FFCD 4R4FH 2BVPB 4JE4B 5MEND 2FATL 3E3QE 3MRJB 1B4RA 3PJSB 1XF5B 2CKBL 1U2HA 2VMFA 2NY6C 5I0DA 2L0DA 3SE9L 3RNQA 5CZKA 1T5XA 5HVFB 2DL2A 3OJDB 1SJHA 1OW0A 3FN0L 2OCFD 4KU1A 5EA0H 4PV8B 3MLXL 4KK5D 1U8HB 2OLDA 2APXA 2X1WL 1Q94B 4X9BA 5TE6L 1MIML 1N6VA 3MRJA 3PJSA 4X6CE 1XF5A 5JA8B 4M7KL 1RQ5A 2LABA 3RQ3A 3G6DH 1I7ZA 3GI8H 4IRSA 4PJGF 3GRWL 2OL3H 4ETYA 4WWID 2ERJC 4NQVB 5HVGB 5BXFA 2Z31D 2X4PA 5F21B 1WTLA 5KVFL 5D7KD 5TH2A 4CL7A 2ZCHL 2VXVH 4U1MA 1XIWB 4PV8A 1F3JA 1XGYL 1BECA 4NQCB 1Q94A 4EXPX 1MI5A 4LLVB 1W72H 3VWJC 4R90L 1VA9A 5E2WL 4XAKD 2H26A 4LCWE 4JKMA 2WWKT 3K80A 1MJ8H 3QEHB 4KVCL 3FT2A 4GS7C 3RZWA 5BO1H 3TT3L 4PGCA 3BH8A 2H32A 4HX1B 1CFNB 4Q0XL 1AKJB 1KPVB 3NPSB 2JJVA 1RUMH 1NMCC 2RFXA 4LLVA 5D71H 5SWSB 3NGBB 1IZKA 1CXIA 4NZTH 4PJDE 1CD1A 2DS4A 1I7TA 4NP4L 4NRYA 3C09B 5IJVB 1A14L 1TQBB 3ZKMD 1WZ1H 4YX2L 1VKXB 5C9KA 4GRWB 3C6LA 4POZD 2HT4C 4HK3J 4NSKB 4HX1A 4P23C 1P7KA 4XVJL 1CXFA 3IDYC 4Z7OF 4YE4L 1KPVA 3BWAB 3BUYB 4MA3B 3V6FA 5SWSA 1RIHH 1KCUL 3S37X 1DSFH 2IQAA 4MGXA 4UT7H 4E41E 5ACLA 4OD3L 3OQ3B 1RUAL 5JO5B 5B8CA 3ARGB 1QVOA 3NVQA 4XCCL 4Z76A 1VKXA 3VWKC 4HXBL 4LLMB 5GGVH 1U8IA 2N1KA 1OL0A 3EBAA 1HQRB 4JO1H 1I9EA 3ZKXC 5JPNA 4RRPG 4K3EL 4KPHL 2HFEB 3OPZH 5EWIH 3MJ9L 4KUCF 3O2DL 1OB1A 3RGVB 2ICES 1CDBA 1NSNH 5KAQG 2FLBT 5I75C 5T5FH 3I6GA 3KJ4B 3MRIA 1BBDL 2PNDA 4LLMA 1BM3H 4KK6C 4X7SH 3ES6B 1HQRA 1AD9A 4N1CA 1T4KB 1DP0A 3EOTL 4HHAB 4G8GB 1ZTXL 4ZFGL 3NH7L 3DARA 5KVGH 4PJBB 4HH8A 4S1DD 4Y5YB 3MACL 3QH3B 5E6IC 3C5ZD 2VLKA 3FRUA 3EKCA 5DK3A 3REVA 1UCBH 3SGJC 5D5MB 5C09B 4CGTA 1XCQA 4G9FD 4QEGA 2QTEA 2IAMC 4Z7QE 4MXVE 3AROA 4C4KT 1UM6H 1A1OB 3KYAA 1T4KA 1INQB 3GSWB 2BXZA