2H2PD

Crystal structure of clc-ec1 in complex with fab fragment in secn-
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLC Cl transporter
publication title Uncoupling of a CLC Cl(-)/H(+) Exchange Transporter by Polyatomic Anions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ion transport
total genus 43
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2pD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2pD01
4XP9H 2CIIB 1NANH 2X4QA 3RX8A 4ZFZA 3BKML 7CGTA 1FVCB 3LHPL 1I7TB 2Y07L 2WMPA 1RSFA 5IFAL 3ZDZE 3SE4A 4CVZA 3OQ3B 1F3DJ 1LO3L 4X9BA 5TE4H 4Y4KA 3QDGD 2VXSH 3TVMC 4H0HB 2NY0D 4IMKA 3ARFB 3W2DL 4DKFH 1U3HB 1KJVB 1NBYA 4R26L 4D3CH 1Q0YH 1QFOA 1IAKA 1VSCA 3GJFK 1J5OH 5C0AA 5DVNA 1FHGA 1IM3A 1HXYB 1N6VA 2AJ3A 1AKJA 2YKLL 4H88L 4QCIB 3ZHLA 4HCRA 1CBVH 4L4VE 3OAYK 3TH3T 4HIXL 5HYQA 2LFGA 2OYPA 1G1YA 3NGBB 5FUCE 5DF0A 4Y4HA 3VXOB 5IBTH 2NY1C 4LAJH 4ONFL 5IT2L 2WSKA 2B4CL 1CK0H 2DM2A 3QUMB 3J8F7 4OCNC 5KSAD 3EOBB 1TTUA 2VLKB 3SGJA 5HDQH 1FFOB 1E4KA 5TFSH 3MV8D 1VPOH 1MFDL 3GSRB 4MNGE 4F7MB 5ADPL 2NX5D 4Y19E 4HDIB 1ZT1B 3VG9C 3C8KB 3H42H 5IMLA 5CEXA 3W9EA 5HYJB 3HZMA 2QQLH 1BZ9B 2C3XA 4TUJB 4R97B 3CFEB 3IDXL 1P53A 1J1XL 2GITB 3OKEA 3DMMC 5D93C 2EYSB 2DLEA 5I71B 1I8IA 5DT1L 5LGKA 1P1ZB 1J8KA 4NBXB 3QIWB 3LB6C 5DJ6A 4LLWB 4HWBA 2E9JA 4P9MH 1N0XL 5C2UB 1LD9A 3MODL 3MV9E 2HVKA 4W70A 2P45B 4M7KL 4AEIH 1V7MH 3QUXB 1S7XA 2E7CA 4N0CC 2IPKA 1X5XA 4XNUL 3GKZA 2CH8A 5EU6A 4LCWD 5FGSA 1EGJL 2DQHH 3D9AL 3RX5A 1TPXC 2Q1EA 3VI3F 4HXBL 4H25A 1B88A 3FAWA 1XF5A 5C0AE 4MNHA 3VI4E 1T0NA 1FVDA 4I0PD 2H8PB 1EO8L 3QI9A 1QSFB 3O6KH 4M1CC 4AENA 1ITCA 1CIDA 1OAUL 3OKLA 4YHOH 1DBJL 1RHFA 2AVGA 3UZQA 5CIPB 4PGDB 3W11D 2FSEB 2B5IB 4X7CC 3BO8B 3TN0D 3RUGA 3HE6C 4OZGF 4U1NB 1D5ZB 5A2FA 5CEYB 1CR9L 4OBRA 4R7DB 4MNQA 1HQ4B 4JFYA 1RUKL 5I1EL 5KVDL 5EC1A 1TETH 1N4XH 2A74A 2AJXL 3O3DB 4F7EA 2YHGA 5ESQB 1KTLA 2IMMA 5KS9F 4YJZL 3QO1A 1A6TA 4FQ2H 3MRPA 4YR6A 3KPRD 4HKJA 4PJ5B 4Z7UA 4EIZC 3WFHB 5FOJA 5D7LA 5I8CA 2GYSA 5J4MA 1GZQA 2Q6WB 3QAZB 2LVEA 35C8H 4TVPE 2IALA 4RMRA 1WZKA 4HW6A 4W68A 1HI6A 3HUJB 1GL4B 2VKWA 1WGOA 3MUZ1 1R3IH 2IPUK 1M4KA 1KCSL 2GT9B 4E9LA 2IG2H 3IGAA 2PYED 4HSQA 1XMWA 4JB9L 4QEGA 2HG5B 2CD0A 4HH8A 1RI8A 1TQBB 3LN4A 2NXYD 3VRJB 2W0FB 5EU6E 3LH2H 1FNSH 1NGQL 4KVNL 1C16A 3C6LA 2R0WH 3TYFA 3TFKD 3TO4B 3N1FC 2KZWA 1DN2A 1NCCH 4G6JH 3WXWL 3HR5B 1I3UA 4U3CA 3EDEA 4N90E 5K9QG 2RCSH 3CVIL 2DIBA 4OLVH 1G7LA 3MGTA 4Z7OF 2G60H 3CD4A 5I1AB 1FV1A 3LKRA 1U8OB 5AD0B 4K23H 4NO3B 4S1DD 3RVUC 4G7VL 3ESVF 3QDJD 4U6YA 5J7CC 1MFAL 2OZ4L 3RUGE 4QRTB 2BSSA 4MNQE 4KKCC 4NP4H 3BGFC 1VGKB 3VRIA 1FDLL 4Z77B 5DQDL 3GI9H 3AROA 3RGVC 3TBSB 1MCOL 1KULA 2XRAH 3ZKSD 4LVOC 4X80H 4ZXBD 2FD6L 2BOBB 3RFZC 4GKNB 4K3DH 1FSKC 2D7MA 3RTQB 3LKSA 5F7EL 4Z7UE 2WWKT 3MMEB 4R0LC 5D7LE 2AI0H 3P4OA 4OSUL 4D0CA 2Z8VC 4D9LH 1YNTA 1UXWA 5CCKL 2IH3B 5L2KD 2EE3A 2HVJB 3JV4A 5KOMC 1CLOH 5HYFA 1NCUA 5DDHA 2X9YA 3GM8A 3JWOC 4OZIA 2NYYD 4UU9B 4JRYE 4JGJA 1NKOA 4ODTL 1FNGA 4S1RH 3R1GL 4HLJA 4PRNA 5IVOA 1OM3H 3TZVA 4NUGH 1EO5A 4XCFH 2VAAB 5T5FH 2V2WA 3T3PF 3HFMH 4RGOL 1CFSA 1HQRA 3MA9L 4FQXC 3O6FA 1BBDH 1JZ5A 1MRFH 2VXUL 3GDBA 3G6JA 3UTSA 1X4ZA 5I9QC 5IVXF 3BGMB 4KAQH 4HWEH 2APXA 4AM0A 3L3HA 4ODUB 3WIFA 4NQXB 2A9NH 4NDMB 4ZSOE 4KJYA 3KG5A 2QSTA 1M05B 2IBZX 1SYVB 2I24N 4DUVA 2I9TA 2A6IB 1DDHA 5GS0L 2GY5A 4O2CB 3T0AA 5DUBA 1MCKA 2MHAA 2ZOKA 1EEYB 1BWWA 1X6NA 4NOBA 1ZGLB 1P84K 2H26B 1Q0XL 2ADJB 2W38A 4J6RL 4YDLB 4JPIB 4XAKD 2W92A 1F4WH 1UH2A 1MRDL 1ZA3A 3RDTD 4AQOA 5CD3A 1WTGT 3ES6A 3OMZA 4NNXA 5HYSG 2FX8L 1Y6MR 1FL3B 1GH7A 2Z8RA 3HI1B 2NY5H 1ZEAH 4WHYG 3ZDYE 4S1QH 3MOBL 2HJFA 5I19H 5MI0B 4FN0A 1W0WB 3O4LA 3JWNC 3K4ZA 2LU3A 3CDGB 2EDHA 1N5YH 4KWUA 3DXAA 1HHGB 3PV6A 1AGEA 4J3SA 4JFDA 2QKIA 1U8NB 2GQHA 15C8L 4OZIE 3AY4A 4FMKA 1HYSD 1C08A 1OP9A 4M7LL 2ESVA 2ICEA 5LVEA 4XPHH 1SEQL 2G75B 3ARFC 5I1GL 1U3HC 2V9QA 1RU9L 5TJWK 1WAAF 3RZCC 4GFTB 4M61A 2APBA 5T1LD 1HSBB 5CJOH 1B2WH 4YHPA 5BO1H 2OL3L 1EFXD 5D9SB 3ARGB 5CP7A 4KI1A 5I2IA 2A6JB 2MCPH 5AUMB 1LEIB 3IFNH 3G6JE 1T04A 3EKCA 4ZUUA 2O61A 4U6XA 1LQSR 1EAJA 1TZGL 4HUUB 3CPLB 1NAKH 1T5XB 4HS6A 4HK0A 5EZIH 4PJBF 3R8QA 5GRZA 5FECA 4ONHB 1QFWI 2BNUA 4WWKC 3IFOB 4R4ND 3STLA 1JWSB 4PV9B 2CLRB 1IC1A 3DURA 1KPVA 4LNRA 5C92A 5L7XH 3K80A 2XT1B 5INDA 2Y6SC 2LE9A 4NZTH 2HTKC 4GUPA 5CLWA 1HIML 5DVOA 3U0WH 1W0YT 3PWVB 3S6CA 3PGCA 4JGMA 3VFGL 4HUXA 4JM2C 3S35L 1ZE3C 2NW3B 4GRMB 1N64L 4JZJA 1I8LC 2AQ3A 1A3LL 5FYJU 1U91A 5I71C 2VDNH 3A67H 4JQXA 4WNQA 3S37H 4N0FA 4FQHB 4D9RE 3GSVB 3WLWD 4NT6B 1Q9LA 4IIQB 2CGRH 3O4LE 4RMQA 5EU4B 5KANG 5IB2A 3Q3GA 3DXAE 4P5MB 1ZS8A 4PJ9C 3V0VA 5E2UL 4ELMF 4JFDE 1FFRA 3TCXA 1IGYB 2F5BH 3PHQA 4XCEA 4KDVA 4TRPH 5I8KH 1ETZB 5KOVC 1IE5A 3BOVA 2ESVE 1GGCL 3QIUD 3FT4A 1LP9A 1D3CA 2F19H 1C1EH 2YMXL 2WP3O 1MFEH 3FQWB 3QA3B 1IEBA 4JHAH 2ZCKL 1OGAA 3FB6B 3O3BA 1AR2A 3QQ9C 5LWYL 2XG5A 1U95B 2XZAL 3AREC 4OF6A 2EDRA 3GSWA 3OF6D 5DMJB 1YEHL 5C0IB 1BQHA 5KSBA 2XNAA 5CD5C 1EGJA 2CRZA 2CKBL 2WIIB 2B5IC 4D0BA 2ADIA 1A6WL 1KIRA 3TPUB 1M7IA 5GJTL 4QT5B 4HK3N 1UEMA 4CN4A 1TNMA 2HLAB 5HHOD 3SHSA 1NGXA 4ONOA 1NGZB 4PGCA 5E8OA 2BVPA 3E2HC 1MCFA 3X3FL 1ZV5A 5IGXL 3BD4A 5CILL 3U4BL 4ALAL 1ZLWH 4P23A 2XI9A 4EUPB 3E6HB 2RJMA 3AXLA 1ULVA 4MDJA 3RY4A 5L6YL 1DQML 1HDMB 4IDJH 4FQLH 1YJDH 4GBXB 5F21B 3IFPA 3MLRL 4RFOL 4FFVC 2BNQA 1CFNB 1C5CL 1MCSA 2FRGP 1FVEB 5DMKA 5HVHB 5I1CL 5EFIB 4X4XA 3DVIA 1H8OA 3GBML 3L1OH 3HRPA 2BVTA 1DJSA 3TBYB 2GEEA 1UXSB 5T3ZD 3JVGC 3F65A 2JB6B 2VZSA 2P7TA 1ACYL 3VMOA 4OLZH 2Q8AH 3UJTL 1TQBC 3EYVA 1MREH 1OCWL 2VDPH 5MEOB 1JK8B 2FBJH 3HNTL 5F7DA 1OTUC 1LP9E 3OGCB 3MNWA 1S7UA 1YMHA 4YHNA 3ALXA 5IMOA 2M2DA 1MCCA 6CGTA 1FRGL 1TVDA 5DJCB 3P11H 3B9KB 1IQWL 2OLDA 3IAGC 1BBJA 3B9VA 3O6LH 1T1ZB 4JDTL 3VD9A 1JGEB 1SVZA 1A6VL 3U82B 1KJ3L 5FGCE 4N8VA 5KSBE 1CTOA 5CZXC 3BQUD 4WTWA 4Z95L 4U49A 4KHXL 1BP3B 2IAMB 3IETB 4L8BA 1E27B 4R3SB 5CKAA 4KRPC 3SDDC 4Y5XA 4PJCA 3MRHA 2V7NA 1I7ZA 2DMCA 1JTTA 2MTPA 3UX9B 2VZVA 4XNMB 4X99A 4X8JA 2EDBA 1T4KB 1J1OH 1URLA 4H8WC 4M3KB 4NUJA 3GMQB 1SJVA 4NGHL 1G7IA 2EC9U 1NCAL 1GGBH 2EYRB 2VITB 3QFJB 1G7JA 4QHKI 1JIBA 5D1QB 5DK0B 1SEBA 5MENA 4IS6B 1DBMH 1MVUB 1VESA 4MJ4A 5DEFB 1OP5H 3RTQC 3B2VH 5CWSA 2E9WA 2C4XA 2DQFB 5TQ2L 5J6GA 2VR4A 5GJSL 4HXAL 3THML 4RWHA 3K2UL 3QXUA 5DA4A 3QUZD 4Y2DA 3O8XC 1DUZB 2BVEA 4YDKH 4PLJC 1I9IH 4KRLB 4RMTA 4UDTB 3QEQD 1EV2E 2N1KA 4KK5D 1HH9B 1ORSB 2P8PA 3C08H 3GMRA 5EORL 4OGYH 5FYLD 5K93A 1L0YA 1I7RA 1NC2A 1A4JA 4QNPF 2QHLA 3U46A 1BFOB 4PUBL 4OFYA 3V5HB 2BNRB 3ECBA 5KAQF 5KVFH 3QSKB 2H32A 5I18H 4HUWB 4YBLB 3C60D 1S7SB 3TYGH 3ZE2E 4LIQH 1U0QA 3VWKB 4NN7B 5CZVL 5TPWL 5T3XH 3DTXA 3T1FA 5KSUA 1N59B 4KZDL 2V5SA 3UJIH 4ZPTB 3KPQA 3S5LG 4X8XA 3GMMA 3CLFH 4WO4B 5ACZB 4BKLA 4JKKA 4NBYB 4PJCE 1UM6L 1KN2L 2BRRH 3CSYA 3E6FA 5IV2A 3BP5A 1MRCH 3C5JA 5KSVA 2F53A 3DSFH 4LHJB 1PZ5B 2QADB 5FKPA 4PJDF 5IIEA 1N3NB 4MS8C 4OV5B 1U8PA 2MPAH 2R23A 4I18A 2YUVA 4L4VD 5E6ID 5MENE 4LVHB 2G9HA 4OCYH 1T7ZA 2PCPA 2XXCB 5EU3A 4U7KA 3SJVA 2ZUUA 4HC1L 1TNNA 2Q7YB 5EBLB 2YZ8A 1QLFA 1KELH 1Q9KA 3O41B 3VWJC 4NO2A 1JNNL 1IGML 1MNUL 4KK8D 1JF1A 4HLZG 4P9HH 2DWDA 5JW3H 3PP3H 3Q6FA 3KYNB 3ARBA 2R1WA 2JIXB 2A6DA 3ULUF 3PGDA 5E1AA 1SJHB 5HD8D 4M5ZL 3PWNA 4TUOB 1FZMA 3RL2B 3KYKH 2EDKA 4URTB 4Y19D 3U0TB 1WBZA 3DROB 4NN5C 5F9AC 3WJLC 3QG7L 3VFOA 3GHEH 5J12B 4AH2B 4GW5A 3TA3C 2P5EA 2QJDA 2YN3A 3MRJB 3IT8D 5CAYB 2UVEA 3VW3H 1VEPA 4LKXA 4Y5YC 2IWGA 4YPGA 1ZGLM 4PV8B 4AEFA 1MEXL 3K3QA 5F1NA 3QHFL 5LCVL 4KU1A 5DLMH 1K9TA 4OZHF 1FYTA 5CSZA 4BH8A 3V8OA 2BVOA 2ITCB 3PABA 3T09A 3MV9D 3DX7A 1CS6A 4L29A 3C8HA 4PJEA 2W9DH 4X4YB 4CVWA 4LEXL 3W82A 3FTGA 3KPOA 4XPAL 3KPMA 4WY7L 5B22A 4EKXA 1N7MH 1OF2A 5IUSA 2O5XH 4DN3L 2I07A 3ZKND 1JZ4A 3T8XA 4Y4KD 3MYJB 4OF8A 3QCUH 2F53E 3EYQC 2XWTB 2V9TA 1IAII 3D0VB 3AU1A 2WINA 2H45A 5C0AD 5J6HB 5GIRB 4DW2H 1INQA 5DRXA 3IRPX 4EI5A 5I1KL 1AKJD 2P48B 4Z78B 1OAQL 1S5HB 4XP5H 4F8QA 2KQNA 4IIQC 3SJVE 3ULVH 4Y4HD 4NQCE 4N0UB 1VFAA 3WFBL 3H3KA 1TZIA 3FQRB 1K8DB 2BHYA 4MDIB 4GAJH 3EW3B 2QTEA 1S9XA 4WUUA 4F7TA 5IBLC 1DFBH 2WQRA 2X4SA 3CU1A 5JO5A 3BPOB 3BP7A 1CE6A 4N9GB 4XNYH 3RU8H 1ZSDB 4XH2B 1BWMA 4Q97A 5J1AA 2D7OA 5F9OL 4XWGH 5E2TL 1HKFA 4QWWD 2P5EE 4UUJB 2W59A 2NLJA 4LCYB 4RMVA 1RZ7L 1T5WB 3O2DL 4JY4A 1VFUA 4ESKA 3EJZD 5SWQA 3VD3A 3RAJH 4YH6A 1TJHL 4EIGB 2DS4A 5ALCL 4DEPC 4L8SA 2RFXA 3HPLA 2VQ1B 4TVPD 3BKJH 5IROC 3SCMC 3SKNA 1FYTE 4DVRH 3U6RB 5IHUH 1HHKB 1QG3A 5HGAB 4GAGL 3C9NA 1OQOA 2E27H 4PJEE 3MCKB 2AJUH 2VWEE 3OXSA 5FCUH 3D69A 3FQXA 1TTFA 3MROA 1AY1H 1YEEL 1MJ7H 2AEWA 5LG1A 3IAPA 4OCSH 4RQQB 2HYMA 3KWWB 2PO6C 4OGAC 4PRHD 2N56A 5EU6D 4PRDA 2DIAA 2CKBA 1P7HL 5JHLH 5GRXG 1KFAH 1JPSH 1OP5K 4RA0C 2CMRH 2Y06H 4F8TA 2AXJA 3UC0H 2HJLB 4PB0H 1OPGH 4LRIA 5BS0B 3QI9D 3AM8C 3IDYB 1HEZB 1A4KB 4F7PA 5DD3L 4N90D 3VXSB 5DJAA 3WN5B 1JF5A 4WTZG 4Z5RB 3IXTB 1I9RH 5EZJB 2XYCA 3BH8A 3FO9A 1Z9MA 3HE7B 2KZ1B 3P9MB 3BEWB 2XV6B 1DQJB 3BZEA 3BRFA 1G7QB 3FB5B 1UADC 1XR9B 3HRZB 3N9GH 4KV5E 2A0LD 2C7UA 2ICWA 3EO9L 1RPQA 3R0NA 2FJGB 4MNQD 2ZOLA 3SE3A 3IDIA 1SJEA 3HC4H 4QOKA 5DJ8B 3FO0H 4OIAA 3DWTA 3ARZA 5FM5M 3B9KC 3OG6B 4E5XA 1XIWA 1BMGA 4GQ9H 4GRLB 4U0RC 3SGDI 1PG7L 2EH7H 2FCBA 5DTFA 1IL1B 2D7PA 4NRZA 4P4KA 1LEGB 4KMQA 1NJ9A 1OD9A 3DGGB 4I13B 1AJ7H 2AXHA 5D7LD 1T20A 5I1JL 4PTTA 5F3HA 1A7OL 1KIPB 2E6JA 5BMFH 4TUKL 4EQ3A 2IAMC 3C87A 4JFEA 2VE6A 1KPUB 1MCJA 2XXMB 2ORBL 4JRYD 2EC8A 1LK2A 4KK6D 4UINL 4U3XA 3SDCB 1SY6H 3Q6GL 3SDXB 4P4RB 4GG6F 4KKLD 1F02I 3OKKA 5FHBL 2C4FT 3IJYA 5TDOB 4DGVH 3C6LD 4WW2B 4LVNB 5D1QC 7FABH 3UYPA 1ZT4B 5BOPA 4G8GB 5JQHC 4F58H 5BW7C 5HYSA 4OD2B 4AK1A 1LE9A 3WLBA 5GZOC 1INDL 1T2JA 5GRYA 1G6RL 3FO1A 1HN1A 3IDMB 4Q7DA 1F42A 3PP3K 3HZVB 5FCSH 3NBNA 4S11A 4BSWA 3DVNA 5JW4R 4ZYKA 5DI8B 4W6XB 4XC1L 3LRGA 2FEDD 1W0VA 3V7AE 1D6EA 2G2RB 4ZAKB 3MNZB 5D2NC 1CCZA 3DUSA 3MV7B 4K2UH 4Z7VA 2P5WA 2ID5A 4OAWA 4QHMA 5DZNA 2K3TA 3P9LB 1N6QH 4LEOA 1RZFL 1FG9C 3QCTL 1GHFH 5ITFA 2J88L 4QOKE 2R1YB 2WBWB 3EFFB 1CN4A 5DJ2B 4KMTH 3JWDH 5EC2A 4OFVA 3EBAA 3C2AH 4PRPA 3MOQA 4M6MH 3RWFB 5GGUB 1OB1A 4PR5B 4YBLC 1Z5LB 4CNIB 2MCG1 3IU4L 2XY2A 2XQYK 4NN7C 4NZDA 3TV3H 2Q76A 1A7QL 5AWNH 2AABL 5I1DA 4Z7QF 2YSSA 1UENA 3P0VL 4J4PC 2YEZA 4X4ZA 4ZUTA 4MJ5B 1XGUB 4JFEE 4OI7A 1NUFA 4F7CA 1J0JA 4ZOCA 5TE6L 1WZMA 3T2NL 3D2UB 2OR7A 4LBEB 5EO0A 3TZVD 3RWCB 1FLRH 1KC5L 4ZS6C 1G7HB 2QADC 4HUKB 2BMKA 5HTSA 1P7QA 3B9DA 3EYSH 3WIIL 5ENWA 1YDPA 5ISZB 4UIMA 3O6FD 3KLHD 1C12A 2OJEB 2Y72A 1IM9B 1EXUB 3DIFB 4LVHC 4NFCA 2Z92A 2IGFL 5SX5K 3DNKA 3VXTA 1X5HA 1BAFH 4I3SH 1WF5A 3X11B 3LKQB 4KJWD 5ESVA 4ODVL 2Q86A 2CDFA 3CSBA 4Q6IB 5C0BB 4EDXA 4RAVB 5JPMA 5BXFB 4G80A 3ROOA 4G8EA 2OTWB 2ENSA 4PFEA 4MA8H 3ZE0F 4NKDA 4PG2C 3D85B 3VJ6B 2H41A 3PWJB 4JHWH 1LE5B 3OJMB 4Y88A 3B4NA 3CDCA 2X4NA 2YK1H 1RK0A 1YPZB 4PJ7B 2BXYA 2NY0B 5C07A 1LO4L 2IANA 3DV4A 1H3WM 4HC1A 4PJXF 4Z7VE 2P5WE 3FN3A 4OM1L 1R5WB 5FKAA 3V8CA 1QNZL 5F1SA 4L9LA 3DV6A 3LZFH 1NGPH 5D7JD 5I15L 3ZSTA 2ARJA 1AXSA 2XA8H 1I1RA 5E2WH 3LKOA 4PRPE 1AFVL 1MUJA 1MJ8L 3MRLB 1ZWIB 1H5BB 2BFVH 5J89A 3VH8G 3MJ9L 1OGTB 1BQLH 5J0BA 4FXGB 3O4LD 4KJPC 4ZUVA 2LAGB 4NZRL 3QUKB 3DXAD 5FYJL 3K4DA 4DK6A 4JFDD 5C09A 5ADOL 3QWOB 3NA9L 3ZYIA 3VFRA 3VFVA 5F6HI 3BKCL 3S97C 2ESVD 3EOAA 3WV0A 3PP4L 1NPUA 3CVHA 3WSQH 5JQ6L 3W39A 3WD5L 4CDHA 4Y8AA 4UV7H 2DQTH 4DGIH 3UJJH 3CDFA 4MXVF 2EZ0D 5ALBH 3CAFA 4X5WB 1UYWH 2RBLA 3LDBC 3KGRA 4ISVB 1QFWL 1MFCL 4K71C 5GRJH 1KENL 1PYWA 1IAOB 4MAUL 2ZKHL 1AI1L 3LRHA 3MJ8A 3ZTJG 3MLTB 5KAQG 3DBXA 1J0YA 1J11A 3PWPD 5SWSB 1FNFA 4X6CB 4OZFH 5HXMA 4MA3B 5CGTA 1RZKH 1DQDH 2WUBL 4XPBL 1HYRC 2OK0H 4QXTB 4O9HL 2WNGA 4OBSA 4QRSA 3T65A 4LCWB 5C07E 2XOTA 4XAWL 2IANE 5C3LD 4ZS7L 5B4MC 5F7UA 3AVEA 3QUYB 5HDBE 1YN6A 3O9WB 3L3IB 4MJ2A 2CPCA 2HKHL 4I0PB 5L8JB 1O5DT 4LAQL 3V7MA 1S78C 4LARH 3DHJA 3CU7A 5HHMB 3U4EB 3RA7H 3FFDB 5E8EB 1T2QL 2AJZB 1T1XA 4OF3A 1KB5H 4LSVH 1VKXA 1XFPA 1EBAA 2PW2B 3F7QA 4LQFH 3V5DB 1BOGB 3DRQA 3CZJA 4BA8A 3TN0B 5IHBA 1VFBB 4YHMH 1NBZB 4NO0A 1R3HB 3O2DA 5C09E 4JDVB 1BF8A 4GLRH 4NC2B 3RWGA 1FIGL 3TWCH 4IRSB 5E94B 4TSBH 4XZUA 1G7PA 2HFGL 3ZE1E 1NCDH 3IFLL 4C4KO 2F15A 4LSSL 3WDIA 1F97A 4JRXB 1NL0L 3WS3A 3G5VA 4OCXL 3TNMA 1OT2A 5HGDA 3I6KA 4FTVB 2AEPL 1BEYL 3IDYC 4DN4H 5IMMA 4KZEH 3MGAA 2X6MA 4OIIH 3TESA 3WN5C 2A1WH 3TIDA 2N7BA 1FAIH 4JKLA 3CCHA 3DRTB 5IK3A 3V6OC 5C9JB 3HE7C 2YPVL 4HCRH 1NLDL 1A1OB 1Q9WB 2ITDA 2Y5TB 1I1FA 1FC2D 4WDIB 2QQQA 2VXTL 4WFED 3WE6A 2APTA 2YD7A 1S9VA 3OJVC 3DSNA 1PY4A 1VGEH 3LEXB 4OZGA 3ZKQD 2G5BA 4P23D 2CLVB 4Q9RH 2DYPA 4Y4FC 3W0WA 2JJTA 2R2HB 4LSRL 5BVPH 3GI8L 4OCLC 1AR1D 2BY1A 3LPFA 1T83A 1C7SA 5HGHA 2NNAB 5KS9A 1T1YA 4M48H 3DETC 4CADB 2CLZB 2EDEA 3WFDH 4YHZH 1CGVA 1MCHA 4JFXA 3HAEB 2YRZA 4R8WL 4F9LC 3BP6B 1T1WB 5L9DH 3IJHB 1YECH 3SDCC 2J6EL 1GZPB 5D7IB 5LQBH 3S5LA 2Q8BL 4HWBH 4PJFA 3MLXL 3QISA 2NY5C 3H2WA 3OKNA 5KG9A 2VL4A 3VGBA 4EI6B 3UTTB 4X9HA 2AV7B 1JGLH 1TZHA 1MHHA 4WW2C 3KPLA 5IB4A 4BZYA 4ZG1A 3QZWG 5IMKB 2VN4A 1WV7T 1B0GB 1HH6B 1JYVA 3ALWA 3BZ4B 4EVNA 3HS0A 4JGUA 1UWGL 1I3RA 4N9OB 2PW1A 2DQJH 3T0EB 1WICA 3QFDB 4HWZA 2PXYC 4ZTPL 3G5XA 3S96B 4Z7NF 4J3TA 4LNVA 5ESAA 1YN7A 3D0LB 3RHWK 1KCUH 2FO4B 1D5XA 4YHKL 2O26U 2EDNA 1MLCB 3K7UA 1WC7B 3WDJA 2E6PA 3LQAH 2P8LA 3BDYL 4M7JH 5DWUH 4DCQA 5FO8A 3ZL4L 6FABL 1G6RA 4O58H 2Y7QA 4MCZA 4BK4A 4OZGE 2VDQL 1Y6NR 4B50A 5EPMA 3W0WE 3SQBA 1MHCB 4X7SL 1CLZH 3RWIA 4MHHI 3PDOA 2R8SL 4NC1C 4XGZB 4PLNC 1MF2L 4EBQL 4JKWA 1N6UA 5MEND 2IQ9L 1RFDL 5E8NA 4GKZA 4HIJA 4GXUN 1PKQB 4XXCC 1F45A 4W4OC 1JUFA 4HS3A 2DQUH 2EECA 4HZAA 2CDGB 1FZKB 4Y2DD 2YUZA 4Z6AT 5BRZB 1P5VA 2HT4C 4UILL 3TCLA 3AC0A 5J06A 5F96L 3QIBA 3KXFB 3CZFB 1P7KB 3KS0J 4PJFE 3GEWB 4NQEA 1NFDE 1VENA 4GRWE 3TA3A 4CL7A 1MCPH 3SKMB 1PX4A 1NC2D 3QJHA 1XGYL 1A6AB 3D87B 4TTDC 2FX9L 2OJZL 5B3NA 1EUTA 4L3EB 1DBBL 4OFYD 2CSPA 1Y0LB 2L4OA 4GS7B 1UJ3C 4HFWB 2JB5L 3BUTA 4Q6IC 1GC1H 3RWEA 5FB8B 1KBGL 4F9PA 4WHCA 5IVXA 1BIIA 1CDHA 5GGRY 3BSZH 3MJ7A 2IPTL 2DQGL 3FB8B 4FXKA 3CFBA 4HMDA 4TTGA 2NY0C 4HX1A 5EZLB 3WUWB 4OV6F 4N0YL 1HXMB 3SGEI 3HB3D 3LEYL 5I30L 2F53D 3OR7A 1VACB 2EH8H 3OPZH 4JAMA 3G08B 5DEGB 2EDFA 2BZDA 2AKRA 3PWUB 1L6XA 4RMUA 3QG6B 2VZTA 1JGUL 4K3EH 4NJ9H 4G7YL 3ULUL 3SJVD 4YQXL 3QJFA 4NQCD 3WXVL 4ZODA 1BM3H 4WEMB 1ZVSA 5E2JA 4KQ3L 5I75B 5GS1B 4RDQF 3KJ6L 5ITBL 5D6DC 4WEBL 2IH1A 2OQJB 2IBBA 1FZOA 3HC3H 3MJ9A 2YUWA 1DEDA 4JANA 4NQEE 4AZ8A 4QRPB 2H2SC 4FFZL 2P5ED 1EAPB 1IAMA 1WAAA 1Y6KR 2APVA 3T3PE 3GHBH 5EUOA 5HGBA 4LCIH 1MCBA 2AJYL 4IMLA 3QYCA 1S3KL 3MBXH 3RY5A 5DURD 3WNLA 3SCMA 5JW5B 3R4DA 1DE4A 4WTZA 1XH3B 1FYTD 5C0RL 1FJ1B 1BLNB 2DMBA 1XT5A 5IVXE 1AO7D 3B6SA 2DD8L 1UA6H 2YD3A 1IAIL 1UVQA 4HAFA 4HQQH 4PJBA 4PREA 5LXGH 2OTUA 3QIUB 4I4WA 4WI5A 4F57L 4WU7A 1N8ZB 2D3VA 4NIKB 5SWZB 1HSAA 4JN1L 4CU6A 3WFZA 3GNMH 4AL8H 1UCBH 4BFGA 5TQ0L 4I0PC 4LSTH 3EGSB 4XRCB 1FO0L 5FYKH 4ETQA 3LSOB 5E4IA 12E8H 4FP8H 4Z7WA 1IKNC 1B0RB 4EI5D 4ZOAA 2GSIA 5IFJA 2AXFB 2NY2B 3O11A 3ARWA 3W11C 3QH3A 5EU5B 3BKYL 3TN0C 5MP6H 2R39A 2X4PA 3U0PB 2VXQL 8FABB 5HHOB 2F74A 2J3SA 5TDNA 5FGBC 4IRSC 3MR9A 1J86A 5CKGA 3ZTNL 2XQBH 3KYAA 3OHXA 5HI5D 3JV6B 2VDOH 3G5ZB 4OLXL 5F89B 1UFUA 3QULA 4OF5A 4ELMA 1D5MA 4PGJA 4UAOB 5DC4B 4QXUL 5CMAB 4FOMA 2DQCH 3N06B 5IB3A 4TQEL 1JHKL 5FYJE 1XF2A 5JHDB 1FE8L 1U8LA 4K3HA 2AK1H 3MLVL 4JKMA 1QHOA 4HHAA 5EUOE 4WTXA 3QEUB 4U1IB 1SYSB 4RGMB 2JF1A 2X4UB 5GGQL 1QRNE 3L5HA 4XHJD 3LHPH 1U93A 2XACC 2GUOB 2D7TL 5GGVH 3SKJL 3GJEA 2A83A 3TO2B 1RIHL 4NKQB 1JZ3A 3RI5K 5IFAH 1OOAA 1TJIH 2BK8A 1D9KA 4MJ6A 2VLRA 4YDIL 4GG8A 2A73B 3B3IB 4FFWD 2WBJA 2NXYC 2R56L 3HG1B 3MCLL 1MI5B 1SBSL 4NCC1 3GB7B 3L5IA 5GSVA 3Q1SH 2YKLH 2DWEA 4K94C 4DUXA 3GMLB 1NBVL 4FZ8L 1QLRB 5FA3A 2OR9L 4UT9L 2XKSA 5GS2H 5CJXA 1FL5B 1NC4B 4LPCA 4G9DB 4GH7B 1I3GL 4Z7WE 1YEIL 3ZDZF 3NIGE 5IBUB 3VXMA 4Y5VB 3V52L 1UKTA 4S1DC 1MSPA 4V1DB 4FXLA 2X40A 4PRIA 1MAMH 4IRJD 3MBEB 4JZOB 3OKDB 1S9YB 3L9RB 2UZIH 4X4MA 5A2JH 4IOIA 2R29L 1IGCL 4NPYB 5E24E 4K9EH 4ELME 5DZLA 1E4XI 2EO1A 3CUPB 4YFLI 1CDBA 2XZQL 5EZOH 2UUDH 1NMCB 3IDXH 4I48B 4QOKD 4ZXBC 2WP3T 4TSAL 4WWID 3M1BB 4CMHB 3DO7A 5DT1H 4O5LL 5D2LB 1XIWD 4BZ1L 4Y16A 2EYTA 2HP4A 5HPOA 3VCLA 4P4KD 4TN9A 1FYHB 4MD5A 1AD9A 3VGAB 4AY0A 3MODH 1I1YA 2JJSC 1ZHBA 3ARTA 3U79A 1Z9LA 4YHIA 2E7MA 4J4PA 5C0CA 2ZSWA 1Z3GL 1RZ8B 1YEFL 4M7KH 1E0OB 2NYYC 2GJJA 3GFUA 4XNZB 4O02H 3ARDA 3QEQB 2CQVA 3QBTB 4JFED 1K6QL 4Y1AA 2VLRE 3L7FA 43CAA 1U8HB 1A1NA 2A38A 4PGZA 3EZ8A 1HINL 1P84J 1A7PL 4LGRB 4HXBH 1RQ5A 4OGZA 1H3XA 2D4DA 2BC4A 4K55A 4NHUA 3T2PA 4N8PA 1EO8H 4P3WA 2PKDA 3MREB 1AXTL 3KPNB 3CFKB 3PWLA 3UPRB 3PGFL 3C60B 3SDAA 1JPFB 5EOTA 3V0AC 3S88L 1NAML 4P59H 1PQZB 5KTEL 4U1MA 2FYYA 3AUVA 4LU5L 3VH8A 2IFFL 5JNYA 4KGJA 5TDPA 5GS3A 2EIZA 1IZKA 5DJYA 5L2JA 1UB6A 4PRIE 5DZOA 3OBAA 3VI4F 3S4SG 2H9GA 1C5BL 3H3PL 1FAKT 5E8DL 3GRWH 2OP4L 3T4AA 1JV5B 1ZOXA 4NC0B 4H0IA 2Q87A 4X4ME 2AK4D 2P5WD 3RDTC 4LFHD 1QR1B 4P2QA 3ILQC 4JO4L 2JCCA 3E0GA 3R06A 4P2RA 3EDDA 1JRHI 1YMMA 4OZFB 4ZO7A 4PRPD 2C9AA 2P8MB 2E3VA 2MFNA 4GS7C 4OFKA 5CLTA 3RP1A 4K3JL 5HHQB 4YFEA 4LLUA 4MVBC 2VABA 1PZUB 5FO9B 4G6ML 5EUKB 2WW8A 4M6NL 1H3GA 3EJJX 5HY9A 5C0CE 4X6FA 1HYSC 2XA3A 1X4YA 4OD3H 5F72S 3ME0A 4I3RL 4HJGB 4LHUD 1PEZA 1T0MB 1UB5A 2NR6D 4KROD 4F33B 1N2RA 1ZT7B 4FABH 4KRMB 4Y1AE 3ZMRA 5D1ZB 4XVSL 5GHWH 3T2OA 1KCLA 3BZFB 1DP0A 4XBGB 1E28A 2JELH 5E4EB 3RNQB 3QUML 1KB5B 3WXWH 5BQ7B 1P7QD 3LEVL 4XI5D 2M8XA 4OJFL 3CVIH 3BD3A 3QDMD 1J8HA 5GRUH 3IDNB 3F12A 2DM7A 4PJAB 1CGWA 3MV9B 4U1SA 5FV1L 5GS1C 2X4QB 4R4NC 3BH9A 2ATPA 1IJ9A 1X3DA 3QNZA 5DSCB 5ERWA 1ZMYA 1MIML 4M6OH 4CVZB 4GAFB 1FDLH 4JKPH 1RZJH 1MIEL 5C07D 5T1DL 2IAND 1G9NC 4HV8B 1NBYB 4ODSH 3JBG7 1P4IL 1IAKB 1TLKA 5ICXA 4TOYH 5GZNC 5I8OH 1HNFA 4P2QE 1NUNB 2A77L 5E2VL 2JCCE 5F7EH 4MHHG 1IM3B 4P2RE 1AKJB 1RJZA 1EJ6A 2W60A 4AG4L 1H3PL 5KJRH 5HYQB 4U6HA 1YMME 3RUGF 1H3TA 5CCKH 3LN9A 1ZLVH 2Z35B 1EHLH 1V3KA 1G9MC 5ICZB 5DYOB 2R0ZL 2AEQL 3CXHK 3OB0K 4YLQT 1CFVH 2OS7A 4M62H 1DLHA 1QEWB 4OZHA 3P77B 4ZO8A 5C09D 3QIUC 3VG0L 2IC2A 3MA9H 3VXUD 1REIA 3NFNA 2VXUH 5CEXB 5K9JH 3QPQD 1K85A 2WLZA 3W9EB 3RJQB 2A6KA 3HZMB 3MA7A 4FQJL 2GIYA 2XTJB 4HF5H 1TVHB 5EOCL 4N1HB 3V6ZB 3OKEB 4TVSa 5IJKA 1I8IB 2NY2C 2UYLA 3U7WH 2D03H 5GS0H 1AD0A 2HAZA 4HZLB 4I8DA 3BJLA 1VEOA 5DJ6B 2YN5A 5FUZH 3BMWA 1LD9B 1YNKL 4HFUL 5DUML 3GK8L 5KVGL 1XGTB 4J8RA 1B0WA 3ARSA 4R7NA 4OLEA 4X83A 4J6RH 1T66D 1Z2KA 3UTOA 3GBNL 1S7XB 1EIBA 5KN5A 3WFCL 1JWUA 1CFTA 2ZG3A 1MRDH 1IC7L 2UUDK 4B7LA 2HLFD 2J8OA 3ULUE 1NDGA 5LGHL 2H3NA 4R4FL 3X3GL 2BJMH 3OAUH 4CDGC 3MOBH 1XF5B 5DMGD 4KHTL 4OM0L 3RVVC 1FVDB 2ERJB 3QZWA 4XCNA 3SGKA 4JFOB 1AHWA 5IB1A 1FFPA 4PBWD 3DHMA 3I75A 3MRIB 4JVWA 1BZ7A 4A2LA 4CU8A 2B2XL 1CDGA 1MCWM 4CMMA 3LS5H 5CGMA 3LKPA 5EOQL 1JGVH 1MJJA 5F70A 4HPOL 1HWGB 2YD4A 2EXYD 3BPLC 4X7EC 4PD4K 1S7QA 5FM8A 4OZHE 4P5KB 3ZDYF 3VFTA 4MNQB 4GSDL 4JFYB 4RGNB 1EHNA 5ICYA 1XCTB 5EC1B 2RQ8A 4NKOA 5GRVK 3TBVA 1NGYA 5BZDB 2R9HC 1A6TB 1CGUA 2QR0A 2MQ3A 4YR6B 1KLUB 2GJZA 4Z7UB 3O4OC 4I5BA 5I8CB 5EBWA 1H15B 4HGWA 1GZQB 2V17H 5F9JB 1QBLL 2F5AL 1M1SA 2KH2B 3HI6H 3KDMB 4XTRD 3FQNA 2VH5H 2K7QA 4KDTA 2GK0A 3EO1B 4C59B 5FIEA 3NZ8A 4NN6C 1OARL 1P9MA 3G6JF 3IU3A 3LN4B 5MHSE 2E9BA 4UT7H 1VADB 4CVXA 3JTTB 3C6LB 3KPPB 1ADQL 1H8SA 1BJMA 2DYPD 1IC5H 3W0WD 3TYFB 4BFIA 4OKVA 2VLME 1II4E 1IGFL 3VGAC 1NUDA 1OSPL 4IEFB 2C1OB 2HA1A 2PR4H 3QUZC 1NFIA 1R24A 5E2UH 2DBLL 4I77L 4YHYB 3NCCB 4BYHA 1KT2A 4UB0H 3SOBL 4OLUL 4NNPL 1QBMH 4KK5C 5D8JH 2BX5A 2BSSB 2B8OT 1TVBA 2WBKA 5T5NG 5IB5A 5D96B 3REVA 4NO5A 3VFWB 1CLYH 1GRWA 5E0QA 1HKLH 4P3CL 1DBKL 3VRIB 1WWBX 3F7YA 4GMTL 5K9KA 4AIZB 2DLGA 3S9DB 4YPJA 2YPLA 3C60C 3I9GL 5ACLA 4ZMAT 2R0LL 5DVLA 1JZ6A 3VU2A 2CKBH 3F7VA 1CF8H 1CE1L 1I3VA 1YNTB 4KK9D 2X5PA 2Q20A 1A1MA 3JV4B 2Z93B 4OZIB 5E8PA 4KTDL 1DTUA 3QDGA 4MMXC 1P2CA 4IJ3B 4PJGE 3IKCA 4NYLB 1FNGB 4RNRB 4PRNB 4UTAL 2R2BA 1NAMA 1J0HA 1UM4L 1RZGB 1RUML 4UQ2A 1WQVT 1EERB 1F4XL 2QLVB 4U6VL 1CFSB 4XB7A 5FHAL 3RVTD 3LMJH 3MLRH 3O6FB 4YDVA 1HZHL 2ZNXA 2VDRH 1EA9C 4K07A 4NNYB 5E6IC 5DFVD 4H1LG 5FUCC 3ETBF 3MLPA 1IKFL 5IR1A 3UO1H 3UTSB 1CD1B 1T21A 3MO1A 2DQEH 2GHWB 1RZKC 5I1CH 1LO2H 4AM0B 3L3HB 3WIFB 1JNHA 5KSAA 4FQPA 1FN4A 1ZVYA 3D3VA 4KJYB 3VFMA 3KHQA 3VXNA 4S2SA 3WJJC 3BWAB 1HHIB 4V2BA 1JYXA 1ACYH 2CIIA 5K9OB 2VIRA 2R69H 5BOZG 4OT1H 1D6VH 2AGJL 1FVCA 2NX5A 5HVWA 1LO0H 2ZOKB 1BQSA 3HI5H 2QHRL 3QIBD 3RBSA 3MUHL 3EOTH 1IQWH 1GJIA 2R0KH 4NQED 1Z6JT 1RZIA 1GIGL 3FB7A 4MLIA 1T22A 5HI3D 1JPTH 1ZA3B 2E7HA 4MA7H 5CD3B 3NAAH 3BPCA 1A7NH 3ES6B 3NN8B 4B7IA 2BHUA 3OKMA 1HXYA 4JDTH 4QCIA 1GGIL 3ZKXB 5IWLA 2YPLE 2HJFB 4HWUA 4ODXB 3VXOA 3OX8B 1I9EA 2EDOA 3F7PC 2WV3A 3MRRB 3DXAB 3PV6B 3WHXA 3QUMA 4JFDB 3ZT5A 2QKIB 4LLAA 3UTZA 4ZTOL 3A6BL 3EOBA 2VLKA 3A6CL 3EFDH 1J05A 1C08B 1UWEL 3SE4C 2ESVB 2ICEB 3GSRA 4XP6L 4Y4KC 4HIEB 4YIQB 4IMKC 4M7ZB 5FDYA 3M17A 5FUOL 1MHPH 5AAWA 5HYJA 1PKOA 5DQ9B 4KPHH 1JYWA 5CP7B 4TUJA 3HMWL 5GJSH 4JLRA 4HXAH 2P44B 4G6KH 2EYSA 5C6TL 1BPVA 1T04B 1P1ZA 2FECI 4Y4HC 3K1KC 3QIWA 4HS6B 4HK0B 1NMBH 1T80A 3SPVB 5I76A 3D3VE 2JK5A 3SGJC 1MFBL 4GT7A 5CBAB 1E4KC 5JDSB 2F8OA 5HDLA 3STLB 5HI4D 5B3JE 5EORH 3QUXA 3DURB 1KPVB 1AGCA 2D0GA 4R4BA 3NCEB 5INDB 4QWWC 5EN2B 5I17A 3U9PL 32C2B 5MEQB 4GUPB 1PG7W 4PUBH 3KPRA 4QRQA 4HUXB 4UNUA 5FYJD 3EJZC 3SDYL 4JZJB 5TPWH 3X13A 4WNQB 5HGGS 4K8RL 4N0FB 1I85A 3VFSA 4HJJL 3W81A 1LHZA 1Q9LB 1R0AL 5EO1A 1QRND 5IB2B 5CIPA 4PGDA 2PYEA 1ZS8B 2FSEA 3BPNB 1KN2H 2VLKE 5JTWA 2YRPA 1D5ZA 1VHPA 2J4WH 1H8NA 3CLEL 1A3RH 2IF7A 4R7DA 1LP9B 1ED3A 3ZE2F 1MH5B 4YWGH 2D0HA 4I3GA 4GXVL 4O51B 1OGAB 3BW9B 5ESQA 5HYJE 1IT9H 2ZUQB 1RURH 3QI9C 2ERJC 1QLEH 1CDJA 1GPOL 5AEAA 5TF1H 2PUQT 1AGBA 2APFA 3MSPA 4LSPL 2GI7A 1OSZA 4X7DC 5IM7B 1SMAA 3GSWB 4PJCF 1A6ZB 5CJQL 5LBSH 1B3JA 1I1AB 4LF3A 2YA1A 5FGCB 1BQHB 5KSBB 2XNAB 3PDDA 4OKDA 4M1GH 3NACL 4XPFH 2V5MA 1CGYA 2RHEA 5CEZH 3SQOL 2ADIB 1KIRB 4PBVC 1FNEA 2A0LC 2YWZA 1NGXB 2GT9A 4PGCB 5E8OB 3VXQA 4O4YL 2ZNWA 4RGNC 3T3ME 4X6BB 3NABL 4O2EB 3I50H 4POZC 4MZ3A 5AZ2H 3IFPB 3QHFH 3CVHH 3TO4A 1W72H 5BZWA 2BNQB 2JJSA 4MXVE 4JR9L 3MACL 1XCQB 4NM8L 3PDGA 4BH7A 5DMKB 4JQIL 1BVLA 4ZQKA 5I1AA 1K4DA 3EDFA 2O5YH 4DGYL 4QRRB 4G6AD 5AD0A 4KK6C 3VFUA 4NO3A 2PYEE 1D9KD 4XP9L 4QRTA 5CSGA 3S4SA 3VXRA 4KKLC 4PJHB 4PLKD 43C9A 5F7DB 1HILB 3L3KB 3C6LC 3MNWB 1S7UB 1YMHB 1VGKA 4KTEL 4Z9KB 3LPGA 4G6FB 5C8JA 4DZBB 4DKFL 4XCYA 1Q0YL 1BBJB 5SV3A 1J5OL 4UDUB 1P4BL 2ZG2A 2EO9A 1VB9A 4X5XA 3WFBH 1J0ZA 1WIUA 1VFMA 4YHYC 2DJUA 4HUNB 3T4YB 5SV4A 2P4AB 1ADQA 2IH3A 2P24B 3V79C 2DKSA 1E4XL 2FEDC 4P2CG 4KI5E 3HUJE 4L8BB 4PRID 3F58H 3DI3B 1CK0L 3NCYP 4UU9A 1G0XA 3MRHB 4M7LT 3T77B 4ZO9A 5HDQL 1YY9D 5TFSL 1VPOL 4X99B 3RIFF 4X8JB 1SM3H 1MJUH 5C08B 4NUJB 4C4KT 3LQZA 2UY6A 5GGSB 1G7JB 3H42L 1SEBB 2QQLL 4Y16D 5CWSB 2CIKB 1EEZB 5J6GB 4NQXA 3STBA 5AZEH 5I73B 4DVBA 5T1KD 4DFIA 5C0CD 4JVPA 1FPTH 2BDNH 4IJ3C 4HG4J 4P9ML 3PL6A 3ARDD 4ODWA 3TZVC 5DD6A 5LJYH 2ARJQ 3VXRE 1EFXA 2H26A 2P8PB 2GTZB 3GMRB 3ULSA 4MGXA 1I7RB 1NC2B 1F3JA 4JPIA 3O6FC 3KLHC 1JPGB 1DQTA 2DQHL 3I02B 3ECBB 4KJWC 4H8WH 4X0KA 2DJ4A 1DQLH 2BCKB 3NFSH 3HZYA 3SDAD 1W0WA 1DVFD 4HS8L 1U8KA 3DTXB 4MQXD 5KSUB 5B8CA 4NHCH 4YHOL 3EJYD 3CX5K 4PJ8D 3OGOE 3EO9H 1RD6A 5C7XL 4BKLB 1CGTA 3TVMB 3DX8B 3E6FB 2IBGA 3BT2H 5JOEA 3DYMA 2IEPA 3BP5B 4BQ8A 3C5JB 5KSVB 5D7JC 4ODHH 5E6ZA 4AMKH 5IIEB 4YEEA 1HSBA 4P2QD 3L3JA 4M4PA 5D9SA 3ARGA 3BVNA 4M8QA 2VL5A 4P2RD 1TETL 1N4XL 2A6JA 2R23B 4I18B 2ZCHL 4PP1D 2G9HB 1YMMD 5JIHA 4ELKA 4HEPG 1A6UH 2FWOB 4JO1H 4KV5F 2P42B 4FQ2L 3MRCB 4HUUA 1QLFB 1T5XA 4NO2B 4G9FA 3MLZL 4LSUH 4ONHA 1JF1B 5FV2A 2DWDB 1RULH 2VLJB 3NPSB 3Q6FB 5L88H 3ARBB 2R1WB 2FX7L 2GKIA 2A6DB 35C8L 3AY4C 1RVFL 5E1AB 3GSXB 3PWNB 1JWSA 1RK1A 3MRMB 2CLRA 3LN5A 3GM0A 1R3IL 4M7ZC 5FHBH 2EZ0C 4QTHB 1WBZB 2IG2L 3FQUB 3VFOB 4HLZH 2FJFA 3T08A 2ICES 4R2GD 2P5EB 2NY7H 1D5BA 3G6DH 3PWVA 2JJUA 2PYFB 4WEUD 5D93B 3DMMB 3OF6A 4AEHH 3LH2L 1FNSL 4LKXB 1G6RH 3OJ2C 4YPGB 2R0WL 5JR1L 2DKUA 5F1NB 1MQKH 2YRLA 4NT6A 3MZGB 1J88A 2X41A 5EU4A 2WUCH 1BX2B 4PY8J 1EJOL 3P30H 4PJEB 3VGHA 4CRPA 1IGYA 2G60L 3X12A 5CHNA 3KPOB 3O0RH 5DFWH 3QNXB 3KS0H 1DUYB 5ETUB 2B4CC 3T8XB 1TPXB 4GAYB 1TFHA 3ULUD 1DZBA 3GJFH 5DJXB 1S7TB 1YEJH 5HVGB 3WKMH 2WINB 3EDJA 4JZJC 5DRXB 1OAKL 3PIQA 2VOTA 4NQUA 2FHCA 5ID1A 2HJKA 3GI9L 3O3AA 4JQXC 4FZEH 2EE2A 2XRAL 4JO3L 2BRQA 4X80L 1KB9K 3P0VH 3RX7A 4B53A 5FOBB 5C0IA 3HHRB 1E6JH 4K3DL 3V4UH 1QQDA 4TPRH 3QP3A 4TULH 1S7WB 1VFAB 4QHLB 4G9FE 2WIIA 3LB6D 3HE6B 1TZIB 1U3ZA 3GMOA 2LTQC 3T2NH 4D9LL 3TPUA 2JE8A 4QT5A 5TH2B 3EUUA 4P46A 1GAFH 1S9XB 4WUUB 4F7TB 2HLAA 1V3MA 2OI9B 2X4SB 4NQTA 5I1LA 5JO5B 3BP7B 3UDWA 5B39B 5E9DD 3E6HA 5J1AB 1OM3L 4HIIA 4UTBH 4NUGL 5TF0A 4XCFL 5T5FL 3EYFA 4EDWH 1HDMA 2NLJB 4OCWH 2KUTA 5I0ZA 3DX9A 4GBXA 4XP4H 1JFQH 4JY4B 1R3KA 4ODVH 1RJYA 5SWQB 1MRFL 3BQUA 1CFNA 2ADFH 1A9BB 3HNSH 2RFXB 3HPLB 3D1MC 4HWEL 4CUCA 4KAQL 1EEUA 2A9NL 3LIZH 3C9NB 3C5ZA 2Y25A 4U1KB 3OXSB 1CDUA 3D69B 3U7YL 3FQXB 3MROB 4P23C 3O2VH 5GPRA 5MHSD 3RVWC 5MEOA 3NH7L 5TE7H 3SKOB 5JUEH 3OGCA 2CKBB 4XC3H 4JFFA 5DJCA 1AR1C 3GIZL 5D1XD 1WT5A 1F4WL 4XXDA 1DSFH 1BIHA 2VLMD 3Q5TA 1T1ZA 4UV4H 4F7PB 4IOSD 4NZRH 5FYJH 1XF1A 2QQKH 1Y18A 3MXVH 2FIRT 4S1QL 5ADOH 2R4RH 5T3ZE 5I19L 5EIIA 1JN6A 3BH8B 3NA9H 5T1MA 1ZAGA 4B5EA 2CK0L 2C1PB 4R3SA 1GSMA 4ENED 5JPNB 3WD5H 3BZEB 3KAAA 3PQYA 3GSNH 3ZKMD 2YA2A 3SN6N 2ICWB 3BGFB 4U1LB 3P2TA 2ZOLB 1SJEB 1T4KA 1U3YA 4XPHL 2Z8SA 3KR3L 3GMQA 1KENH 2DN7A 2ZKHH 1AI1H 2VITA 5HHVH 2J8UB 3U2SB 4QXGL 1JZ8A 4IS6A 4NRZB 5CJOL 3S35X 5BO1L 5DEFA 1MPAH 4H1LA 1KLGA 4R0LB 2DTML 5ACMA 1A9EA 2DQFA 1YQVH 4PTTB 5F3HB 1B4JH 1I75A 4XPBH 2VQUA 4JY6A 5E08H 2SEBA 1NAKL 4JFEB 2VE6B 1DUZA 4N1EA 5EZIL 1KSRA 4Y5XC 2CJUL 4XVJH 5I1IH 3CFDB 3EYUH 1TTGA 4LAQH 2XWBA 2NXZD 5L7XL 1YEGH 3IJYB 2VDMH 4JFFE 1T2QH 2LAAA 5DVKA 1EDQA 2ED7A 1BFOA 3U0WL 3V5HA 1BJ1H 2ICCA 2BNRA 3RIAF 1OAZH 5M95B 1S7SA 4Q9QH 3FO1B 1AE6H 4LPUA 4M93B 5I73C 1IGJB 3STZA 3A67L 3S37L 3FHQA 3DVNB 4Y2DC 1UGNA 4ZYKB 1WFTA 5D72L 2CGRL 1KACB 1D6EB 1E4WH 3IFLH 5F7NC 3K8LA 4WO4A 2VZ1A 4WHTB 5ACZA 3DUSB 3O81A 5FO7A 4IRZH 4Z7VB 2P5WB 2F5BL 2C5DC 3PQYE 3OWEA 4OAWB 5D5MF 2XIDA 4LEOB 5I8KL 5A2LH 5ITFB 3ZLQC 3QDAA 1PZ5A 4OF0A 2LVCA 1LK3H 1WZ1H 2HFFB 1C1EL 4DZ8B 1N3NA 4FQXD 5ANMB 1LDPL 3NA4A 1MFEL 3QFJE 4PJAF 4J3OC 3G9AB 4JHAL 5IW1B 2Q76B 3ZE1F 2EDDA 5I1DB 3NIFF 3O41A 2YSSB 4XPGH 1R3JA 3P4LA 4KRNA 3TBTB 2VXTH 2JIXA 3P0GB 5EO9A 1PY9A 1YUHA 4TUOA 3HB3C 1WJ3A 4KXZI 5EO0B 3RPIB 3RZCB 4MA1C 1ONQB 1XGRB 2EEAA 2BMKB 3GI8H 3K1DA 4AH2A 5GS0C 1DL7L 1KXQE 5ENWB 2GJ6A 1YDPB 1HOCA 1C12B 4OD1H 4I18C 5F1KC 3GSQB 3HPJA 3O2WH 1V8HA 3RNKB 4IDJL 2BNRE 1A5FH 1YJDL 4FQLL 4YE4H 5C0JA 4NCC2 4R8WH 2Q86B 2CDFB 5HHPA 1XGPA 3D3VD 4RBPH 4YXKL 4WWKB 2ITCA 3NPSC 3ARBC 1C5DA 4PJIF 4G80B 2Q8BH 4NKDB 5J9PB 4X4YA 2H2PC 2VQTA 3L1OL 2X4NB 1RK0B 1I7UB 3G04B 4JREC 4PGBB 3N1GC 5DD0H 5FKAB 3ARFD 2K1MA 4JM2B 1MREL 4JFHE 2XWTA 2VDPL 4WFFE 2FBJL 3D0VA 5H8DA 5LAXB 1UWGH 4MWFB 5GIRA 1CQYA 3P4NA 1CDCA 3LKOB 2BSTA 3LD8C 3P11L 4G43B 1KYOJ 4ZTPH 3TJHD 4JFZH 1EZVX 5DC0A 5BJTA 4Z8FH 4BZ2H 1DQQB 4XPTH 2NY6D 4PJ9B 4QXWA 4ZUVB 5H2BA 1IBGH 2YPKB 3BDYH 3DJ9A 4C57C 4NZJA 3SE8H 3B5TA 5A43C 2VLKD 4PRHA 3VFVB 3LRSB 3EOAB 4LLMB 4LQ1A 2CUMA 3CVHB 1W72B 1E6OH 3D48R 3G6AB 4XH2A 2FECL 5JIIA 2FH8A 3OR6A 5F1IB 5I8EB 4UBDC 4XNQA 5HYJD 3MRGA 3Q5OA 1CYGA 2GJ6E 4J7RA 4LCYA 4EI5C 3AREB 3ARVA 4OF7A 4BELD 1T5WA 5E00B 1PYWB 3V4PL 1GGBL 3MJ8B 5ELIA 1OAYH 5TGBA 3DBXB 4P3DA 3B2VL 25C8L 1NCBH 3QIWD 2IMNA 3U6RA 2V2TB 1WBYB 1HHKA 5HGAA 5J1SC 3K4AA 4QHUB 3C8DA 3E2HB 5AAMA 3MCKA 3N0PB 5HI5C 2DF3A 2FJHB 4UQ3A 2OI9C 3MUY1 4WVRA 3IDGA 4OZ4B 3FONA 4YDKL 3QUXD 3QRGH 4RQQA 3MNVA 3IDUA 5F6IC 2OJZH 5F7LB 4JN2B 2MJWA 4A6YL 1YN6B 5F44A 1CVSC 3ZDXE 5CJBA 4XBPB 2JB5H 2HJLA 2OM5A 3LCYA 4NSKB 5BS0A 4MB3A 3FMGH 1A4KA 1T1XB 1QSFD 4XHJC 3X14A 4L8SC 4PJFF 5KVFL 1NFDF 4GRWF 1EZVY 1VFOA 4JRYA 5EZJA 4JJ5B 3H7BB 4X7FC 3TYGL 4N0UE 3E3QC 3MFFA 4LIQL 1M71A 1ZLUK 4FFWC 2DI7A 1KJ2H 5T3XL 3P9MA 1R5IA 4NO0B 5IOPB 4M43H 3RWGB 3FFCA 1G7QA 5GISH 3FB5A 3V4VH 4PRHE 3UJIL 5F8RC 3UTPD 2FJGA 4Z76B 5DJ8A 3WS3B 4CBPA 1MRCL 3G5VB 4GRLA 3DSFL 5D7KD 1CICA 1CXIA 4CKVX 1JGUH 4LRIC 1IL1A 1JWMB 4ZSOA 5F7KC 5B38G 5IMMB 2GAZA 3ULUH 1LEGA 2MWCA 1ORQB 4PJ5D 2MPAL 1JL8A 3L3DB 1U92A 4OCYL 1NLBH 3DUUB 1KIPA 1QRKA 4HIHB 4KUZL 3CMOL 4KI5D 4KRPB 3SDDB 4C56B 1I1FB 1KELL 4BSJA 4OUUB 2FIKB 4P9HL 1I8MA 5JW3L 5CBEA 1S9VB 4JJHA 4P4RA 3BWUC 5CINL 4PP2A 4P48A 1U6AH 3SE3C 4HKXA 2C3VB 1ZHNA 1XIWC 2ZJSL 5B21A 5TDOA 2I5YH 4WW1B 4KJQD 5IJVA 3GHEL 1ZT4A 4P4KC 4WI9A 3L3OB 1MWAL 5C1MB 1HE7A 3TO4D 4OD2A 5E5RB 5BS0E 5KS9B 5C0RH 4RX4A 4GMSH 3V7AG 2GCYB 3P9WB 4JFXB 1CIUA 3O8XB 1IAIH 3VDAA 3ZZ1A 4NRYB 1RJCA 1OTTD 5DI8A 5DLML 1UZ6F 3V6OE 3VDCA 2CUHA 4JE4B 1EMTH 3N85L 4ZAKA 4U33A 3MNZA 3S5LB 3FFCE 3WFEH 2FR4B 3MV7A 4YC2C 3T0VA 3VXRD 3OKNB 5TQ0H 4BQBA 5KG9B 4JEGB 3P9LA 1N7ML 5D7SL 1TZHB 4EOWH 3NCFB 2O5XL 3KPLB 1IEAB 1X44A 2R1YA 3BIAX 2HKFH 3QCUL 3AB0B 4OQ1A 4YGAB 2FGWH 3NCJH 5GGUA 4EVNB 5JORA 2PW1B 4DW2L 3C2SA 3RTQD 4RBPK 4M93C 2PETA 1A14H 1QUNA 4HWZB 3TT3H 5F9WB 1FCGA 2YD6A 3G5XB 4XP5L 1YN7B 2FHBA 1F5WA 5DJDB 3ULVL 3LVEA 1T89A 4LCCA 2E6QA 3L7EA 4DCQB 1QPXA 3D2UA 1G6RB 4LBEA 5D7JA 2Y7QB 4ZPVB 3H9SB 5I74B 1DFBL 1JTOA 1G7HA 4J1UA 3MLVH 4XNYL 3HR6A 3RU8L 3RWIB 2BERA 3B9EA 4Z0BL 1A7RL 5GGTA 4XWGL 1TENA 1Q94B 3DIFA 1ZHLB 2EXWC 3AS3A 4K7FB 5IESH 2D7TH 4FFYH 3SKJH 3VWJB 3X11A 3IF1A 5E8NB 5KZCB 4HIJB 3W9DB 1KIQB 3E8UL 1N26A 5K33A 3RAJL 5C0BA 1H3VA 1JUFB 2NR6C 4KROC 5BXFA 2NY3D 4LFHG 2I25N 4LPVA 3BKJL 3GJFB 2B0SL 5IHUL 2HRPH 4ACPA 3PL6D 1YPZA 4NN5B 5EUOF 4FZ8H 2AJUL 3MV7E 5FCUL 2HFEA 3TA3B 4YX2L 4UT9H 3A6OA 1KJMB 4PS4L 1AY1L 1MJ7L 1KIUA 4XI5C 4KMLB 5IQ9B 3QJHB 4OCSL 3ROLB 5T33H 3Q48A 4Y5YB 1NGWA 5MEPA 4YGVA 4HKZB 3PWPA 2VNCA 4NM4L 1PG7X 1UH4A 4LL9A 3V52H 1UQSB 2APWA 5JHLL 3SY0B 1KFAL 1JPSL 3MRLA 1ZWIA 4NKIH 2CMRL 2NZIA 4LHUG 5ILTH 3UC0L 4PB0L 1OPGL 3RWEB 4OGXH 2IBZY 3BUYA 4WFGE 3VE0A 4LASH 4LKCB 5IVXB 3SGDH 5DHVH 3DVFA 3CXHJ 1I9RL 3CK0H 3QWOA 4WV1C 5BCAA 1NEZG 4U1HB 3CFBB 2HT3C 4HX1B 2XZQH 4KUCD 4Z7WF 5MERB 5DQJA 3NIGF 4YXLL 3N9GL 4JM4L 4L9LC 5DC9B 4XMPH 4YHLH 4JAMB 1LNUA 1R3LA 3BN9D 4MD4A 1QKZL 4OZFG 3ARGD 4HH9B 3MRQB 3M8OH 5F97E 1IAOA 4GQ9L 5J3HD 5C9KA 5DMIH 3MLTA 5SWSA 3QJFB 1VCAA 1K6QH 1UEYA 3ZO0A 1AJ7L 1K2DA 4G9FD 1ZVSB 5C0BE 2DLTA 1PBYA 4M02A 4RISH 1OHQA 5BMFL 4LDLB 1CDYA 2IH1B 2PTTB 2R2CA 4CJ1A 1IQDA 1LILA 3QPQC 4PJ7E 1YPZE 4JANB 1SY6L 1QA9B 5DXWA 3QUYA 1F6AB 3NMEA 4ERSH 3O9WA 3L3IA 1NAMH 1T3FB 1NCWH 3OV6A 4XP1H 3R8BB 1G84A 3U4EA 4DGVL 3TLRA 3PWPE 4DEPB 5JMRA 4IMLB 3FFDA 7FABL 3F5WB 1WEJH 2EC9T 3SCMB 4F58L 4GKOA 3U48A 3GSNB 5AYUH 3HCVA 4LOUC 1DE4B 1PAMA 1S9WB 5E8DH 1K5NA 1VFBA 1T66C 3G5YB 1NBZA 5C6WH 2HT2D 1UVQB 4PD4J 4PJBB 4PREB 2HLFC 1P6FA 4G8FA 5J13B 4A2MA 2PO6B 4ZFGH 3BZDA 3IVKA 4EN3A 2GK2A 2BHZA 5DMGC 4K2UL 1UM5H 4CVUA 4JRXA 4XCCH 1ZLSL 4ETQB 4K3JH 2E7BA 4FTVA 1T03H 4LSDA 2CDEA 4KMTL 1IFHH 3C5SA 3JWDL 5IFJB 1FNAA 1K8IB 3C2AL 3L5XH 3O11B 4M6ML 3I6GB 1KGCD 2F54A 4B0MM 3T0XA 1FORH 4A6YA 5C9JA 2X4PB 5SWSE 2EXYC 1A1OA 3TV3L 1Q9WA 5AWNL 4XVSH 2F74B 4KH2A 3U30B 1ES0A 3UXFA 2GSGB 3OAZK 4LDOB 5F7FA 4J3VA 4P46D 2ZUYA 5E1HB 4HBCH 4G3YL 4ELMB 3OB8A 4QF1A 4K8RD 4NRXA 3PJSA 2F58H 1BD2A 4KC3B 4U0RB 5IB3B 2Z91A 4OGAD 4PRAA 1NMAH 1FLRL 1XF2B 3EYSL 4GBXD 1F6LL 2MOVA 5D6CA 5HHME 2NNAA 4E41B 4DK3A 5DS8A 4XTRC 4CADA 2CLZA 1U93B 5EBGA 1S7RA 3GJEB 4I3SL 2RGSA 4RAHA 1MIMH 1T6WA 4WFEE 4ZUSA 3EAKA 2EKSA 2VLRB 5GXBB 3C5ZD 1Q1JL 3VGEA 2ADGA 2CXKA 5EU7E 5T1DH 1WCQA 4LSQH 2WBJB 1NCTA 2A77H 4EI6A 3MJ6A 5GSVB 2YK1L 3HTLX 2JJTC 4AG4H 1H3PH 3UPCA 2OZ4A 5DUPH 1Q9OB 4JFFD 4JRXE 3FRUB 5I16A 1JP5A 1B0GA 2CK2A 1T83C 1NGPL 4FTVE 1M6OA 1V3JA 2VMFA 2CKNA 4NQDB 3VXMB 4Q74A 2XA8L 1JMXA 3QFDA 4LLQB 5E2WL 3GIVB 4PTUA 1AQKL 2F54E 1L9MA 3GMPA 3MLWH 3VG0H 1U36A 2XWJA 3LY6A 2FO4A 3FN0L 2JCCF 5D2NB 1MLCA 1WC7A 4MJIB 2VDKL 1MWAA 3UAJD 5DGRA 4IOIB 2MQ0A 3PQYD 3CC5B 1N5AA 4RMSA 4X9IA 2B20A 3KNBA 2EDLA 5DRZA 1GCFA 2DRUA 1PGRB 1BD2E 3ILPA 1P4LA 4IDLA 3WSQL 3DO7B 4UV7L 2DQTL 2Y9RT 4DGIL 4LIQE 3AB0C 3UJJL 3QFJD 5A3ID 2EYTB 5T3XE 5ALBL 4K94H 1UYWL 1AD9B 4KK9C 3CFJB 1ZHBB 4KVCH 5F9WC 3GK8H 5KVGH 1PKQA 2KBGA 5C0CB 2ZSWB 2DI9A 2VDLH 1RUQH 3LPWA 4N8CH 1W8OA 2CDGA 3PNWB 4Y8DC 2RB8A 1G9EA 3HAEH 3VXPB 4Y1AB 1LEKA 4F15C 5D70H 3L7FB 5BRZA 2W65B 5BV7L 4R4FH 2W91A 3CMGA 3KXFA 5CP3H 1DQDL 1P7KA 2YA0A 3CZFA 5I74C 3RVTC 1P6AB 4KHTH 4NHUB 4OM0H 4LRNH 3SKMA 5GGVY 3UTTE 2VUYA 4JDZB 1A6AA 4QKXB 1YEDB 4NQCA 5EOTB 2QSCL 1CFQA 1NKRA 4NJAH 2BNRD 4ZD3H 2XZZA 4DQOH 4LARL 4XBEH 3T0EE 1IC4H 1F6FB 4U1JA 4KY1H 3VWKD 1Z9SA 5JNYB 4LSVL 5TDPB 2EIZB 4LQFL 5L2JB 1UB6B 2ATKA 3FB8A 4Q2ZB 3RGHA 3T4AB 3QIBC 4JO2H 5EZLA 4YHML 3OSKA 4WO4D 4Q58C 3KPSA 5HI3C 3NTCH 1TCRB 2AP2A 3TWCL 2VISB 4TSBL 4JFHD 4S0SD 1VACA 4WFFD 1RUPL 2QADD 3G08A 2OMNA 2RR3A 1YMMB 2WQ8A 3PWUA 4LLUB 2KDGA 2VABB 3K8KA 1AO7A 2OL3A 4DN4L 4F9PC 4KZEL 4OIIL 1WCBA 1PKQE 5HY9B 1R6VA 2A1WL 1KG0A 1OARH 4G42A 1FAIL 3TM6A 2JIXD 1N2RB 2OQJA 3FL7A 3P0YH 5BRZE 2NTFB 5INCB 5FDWB 3KXFE 3SE9L 2FH6A 3CXDL 2X4RB 3LDBB 1VGEL 4K71B 2BVUA 2GJ6D 3KLAA 2Y36H 4Q9RL 2QQNL 3ULVE 3WDHA 4PJDB 5SX5H 2DBLH 2E8ZA 1KJ2B 3IS1X 1J8HB 5BVPL 3V95A 3PXHA 3DVGA 3REWA 5EA0L 3TJEL 5H37H 1KF9B 1XH3A 1FJ1A 1BLNA 1GOHA 3MYZA 4KJPD 4ZOBA 4YHZL 3EYOB 5DK2A 4L4TB 1LVEA 3UBXI 4QY8B 3BEVA 5L9DL 3GSUA 1QFUH 3PXJA 3CIQA 4S1SH 4JG1H 1GGUA 1YC7A 3UTQB 3O3EA 3KPSE 1JF6A 4U31A 5LQBL 4HWBL 4N5ED 5E5MB 5ICXB 3L95A 1KTRL 2IJ0C 3EGSA 4XRCA 2W60B 4XNXH 1FFNA 2GFBA 1JHTB 4YNYA 3HLAB 1B0RA 4MSWA 3VFPA 3AGVA 5B38A 2AXFA 2X10A 3QO0A 3VRLF 3NVQA 4OI8A 1W8NA 3N50A 1KXTB 3BP4A 3IXAB 1SY6A 1AO7E 5EU5A 1I9JH 4X7TB 4U4BA 8FABA 2DM4A 4TNWK 2V5YA 4ORGA 4P49A 4CJ0A 1DLHB 4OZHB 3D5OF 2NY4B 5J13C 1F4XH 1KCUL 4JZNB 3F62A 3NFNB 5F89A 3LQAL 1HZHH 4YBQC 1V7NH 1CD9B 5CMAA 4M7JL 5DWUL 1ACZA 1ND0A 1GGYA 4O58L 2YWYA 1G9NH 5JHDA 4PJGF 4GKSA 4NWUH 1CLZL 2UYLB 5JW4N 5IFHL 4BQCA 4MCYB 4IRJA 3MV01 4W6YB 2OBGA 1FH5H 1OLZA 4I2XA 3U30C 4OCRH 4J8RB 1CQKA 3QR2A 1KCRH 1G9MH 3MFGB 2FATH 1F58H 3QXAA 2DQUL 2PF6A 1CFTB 5DO2D 3HG1A 1EPFA 5EWIH 4Y4FB 2R1XA 5IP4A 4I0CC 3GB7A 1NSNH 4NKMA 2H3NB 3WNKA 1CTNA 5GGSY 1VEMA 5SWZE 3GMNA 3GMLA 2ICWJ 3QPXH 2FZ3A 3WNNA 1MCPL 1QFWM 1JZ7A 2FDBP 1FL5A 1NC4A 4XCNB 4R90H 4G9DA 4N5UA 1FFPB 5BS0D 3I75B 4Y5VA 1BZ7B 4P57B 4G6AC 2FLRT 2W9EL 3UZEA 4F3FB 3D25A 3LKPB 3BX7C 1D9KC 1MJJB 1GC1L 3HE7D 5CS7A 3MBEA 4ZFOL 1S7QB 1RUAH 2WBJC 3BSZL 3FFCD 3VFTB 1RV6X 4NPYA 2X1XR 1A21A 3HMXL 3I3EA 5ICYB 2X7LB 4BUGA 5C70A 5CJXC 1HHHB 1NGYB 1RHHB 2QR0B 4GRLD 1CICD 2OCFD 5JHDE 2EH8L 3OPZL 4NZUH 1EO7A 4I5BB 3GSOA 3KLDA 2PXYB 1U8MA 2BOCB 1OTSD 1CXLA 5IQ7L 1H3UA 4L5FH 1RZ8A 1XGQB 5DHXB 4K3EL 4NJ9L 1JYNA 2GK0B 4I2XE 4BSVB 2AK4A 1YY9C 1BM3L 3BAEH 3QQ3A 5T3ZH 1SMOA 1U8HA 4RZCA 4QRUB 3HKFA 3SDCD 5JOPE 3HG1E 3QEHA 1RIVH 1MI5E 4RIRB 2VB5A 4NFBA 5HSFA 1FCCA 4ONGH 3RVXD 3MREA 1H0DA 3KPNA 4MXWH 4Y16C 3FQTA 3CFKA 1EFQA 4OKVB 1DANU 2XZCH 5IW6A 5DHVB 1JPFA 5B3JF 3O6MH 2P1YA 3GHBL 5I6XC 4RX4D 4LHUA 1RIUH 5C86A 3Q2CA 3QNYB 1KT2B 3W5NA 3E1F1 3ARDC 3QXDA 1RAMA 4V1DE 3S3PA 5HBBA 3CX5J 4LLVB 1ZHKB 2NTSP 1NEZA 2RIKA 4ZAKD 4E0RB 3BXNA 1UA6L 3MV7D 5DJ0A 4GXVH 4HQQL 4NO5B 3REVB 5LXGL 1AGDB 1QR1A 4HUVA 5DFTA 3F7YB 1GPOH 5A2IH 5F1OB 3L6FB 1HWHB 1TXKA 3QDMA 5FEBA 4GG6B 4K7PH 2YPLB 3GNML 4AL8L 1UJ3B 1UCBL 5D2LE 3SDAC 4OZFA 4P2OA 2P8MA 2VLLA 4LSTL 2VSCA 5FYKL 3WIHL 4FQCH 5DMYA 12E8L 4FP8L 5KVEL 1AP2A 4MQXC 3V5KA 5FO9A 4TSCH 1A1MB 2Y23A 3MTRA 3SEPA 4WFGD 5J56B 1U8JA 2BVQA 4WV1A 4CW1B 5E8PB 1Q72L 1KUMA 3OJDA 3QDGB 4R9HA 5MP6L 2AK4E 1NEUA 1L0XA 2X1QA 1NAMB 5J11C 3MRFA 5D1ZA 5GSRB 3D2UD 4UQ2B 4DKEH 1Z0NA 4XBGA 2XQBL 2MSPA 4HPYL 2ZCLH 3RNQA 4TNWF 3MXWH 4YDVB 5FYLH 4PP1C 4JR9H 2JJVA 3CH1A 3MACH 5D5MA 5ISZD 2DQCL 3S7GA 4TTDD 4MYWB 3H9YA 1IM9D 4JQIH 1EUUA 3MO1B 2V2XA 5H94B 4DGYH 1JNHB 5KSAB 2HTLD 4GW4B 3T3MF 3VFMB 2AK1L 3D3VB 5E99L 4PJAA 3HZKA 3MV8B 1JZ2A 4S2SB 4CU7A 1L7IH 3MOAH 2COQA 4OQTH 1N0LA 2VIRB 5C0BD 1U9KA 4H1LH 1JHLH 3VXUA 5DRWA 5GGVL 2NX5B 4B41A 5I1HH 5DSCA 3VA6A 2B1AL 3D85D 1TJIL 4PG9A 4U2ZA 5HHXH 1VDGA 4KTEH 4IOFD 5CSBA 3NFPA 4OB5L 4R2GC 4HV8A 4RCAA 2UV3A 1RZIB 1K4CB 3FB7B 5HHNB 1T22B 1P4BH 2D9CA 3BPCB 1KTDA 3OKMB 3Q1SL 3QDME 4KGLA 1KEMH 3GBLA 5E5UB 3ESUF 1FG2A 2Z35A 3UYRH 1DBAL 1E4XH 2E7LA 3U7AA 1KB9J 2NY6B 4PGEA 1H9VA 1HK6A 5I66B 1MCNA 5ICZA 2WLYA 5DYOA 1SQ2N 3WHXB 4MAYA 3UTZB 4JY5H 5A40E 1J05B 1QEWA 1JTPA 3P77A 1KPRA 1X5FA 1MAML 3BDBA 4PJIA 2ZP0T 3ULUC 3D18A 3MRKA 3SO3C 1F13A 3J7HA 3M17B 5HVFB 5DK3A 4G8IA 2UZIL 1X5GA 1KXVC 5LGJB 1X5KA 4Z18A 4K9EL 4PJXB 4KI5F 3WEXB 3HUJF 5EZOL 1TVHA 2H2SD 4JLRB 3V6ZA 5D5ME 3WCYA 2DLFH 3L5WA 4OLWH 2YC1B 2Z9TA 3V0WH 4H26B 4ZFFB 2DLHA 2FEEI 3FAXA 3MPCA 3WNMA 4HZLA 4YAQA 2DOCA 3BE1H 5I76B 4XVTH 5SWSD 4PJAE 2JK5B 4OI9A 3QQNA 4LLYA 1KEGH 1XGTA 3KYOB 3KYMB 1KNOA 2NY4C 1CL7H 3VXUE 3EHBC 2J8HA 5GGRB 5J57B 3NIFE 4O02L 1AGCB 4R4BB 4R96A 3RKDD 5I17B 1F4YL 4KKAC 3MLSH 3KPRB 4U7SA 4U1GC 2DDQH 1F4AA 4D0DA 4QRQB 1U58B 3BHBA 3QUYD 4ZDHA 3O9WD 4OLYH 4Q6YA 3V6BR 5IJKC 5DD5H 4HS8H 5FA4B 3X13B 2EIDA 4JFOA 2VTFA 5HHMD 2I60H 5GRVL 3VFSB 5EBMB 3MRIA 3OXRA 2A9MH 5FM4A 5EO1B 1OQXA 1S5IH 3K2MC 4P59L 2PYEB 5K59F 5C7XH 1OAXH 1JRHH 4XMKH 2X05A 4OIBA 2XFXB 4YXHH 2NXYB 1ZK9A 3JTSA 2ZPKH 3GKWH 3RZWA 5M94B 2O5ZH 3WL9A 4APQA 4P5KA 2P43B 4IRSD 1ED3B 3LKNA 4PJIE 3RJDA 3QXVA 1XCTA 4NWTL 2NZ9D 3GRWL 1I4FA 1D5IH 3R0MA 5D1XC 4EN3D 2ZCHH 3BISA 3DI2B 5BZDA 5AG8A 4JRXD 2XTJE 1QTYT 1QVOA 2VUOA 1KLUA 3SGKC 1K3IA 1AHWC 3LV3A 1AGBB 2Z8WC 4FTVD 4HUMB 3S34H 1OSZB 3MLZH 1J7VR 3FCTB 1H15A 5C2BH 4LF3B 5F9JA 2FX7H 5D71L 5DRNB 4PRBB 3QDJB 1RVFH 1TDQA 2F54D 4YUEH 3TT1H 4WGVB 3KDMA 4ENEC 4TVPH 1A2YA 4QGTA 1IAIM 3EO1A 2GW5A 3ZKMC 1FNEB 1NFDA 3UBXG 3VXQB 1TJGL 4X6DB 3U1SH 4OD3L 5B39G 2V7HA 4C58B 2UZYB 4FABL 3HNVL 5IHZA 1VADA 4ZXBB 2JTDA 1SVCP 3JTTA 5GHWL 2EEBA 3KPPA 4RFEA 5C0FA 1BD2D 5JR1H 4JG0H 1BQUA 2XPGA 4KQ4L 2JELL 4ZFOA 1IGTA 4UOW0 4UNVA 4CGTA 5T3XD 2HN7A 1GGTA 1CGSL 1YEKH 5BZWB 5L2KB 2C1OA 1EJOH 2VC2H 3HMXA 4BH7B 4H0GA 1BVLB 1WK0A 1XR8B 4ZQKB 1K4DB 3GUTB 5GRUL 1FFQA 4KDTC 3VFUB 4MZ2A 1P9MC 2UWEB 5CJ8A 4W4NA 3S4SB 3VXRB 43C9B 2NXZC 2D0FA 3VFWA 4M6OL 4RGNE 3PUCA 1OAKH 1PD6A 3UTTD 4JKPL 1RZJL 4AIZA 5C8JB 4XCYB 4ODSL 4JO3H 3MRDA 4TOYL 5I8OL 3BMVA 3B83A 1XZ0A 1DLFL 1X9QA 4X5XB 2HH0L 4KUCF 2B1HH 3BRGC 1FGNH 3T0ED 3ZHKA 5KJRL 3WS6A 2HWZL 2CRIA 2ENYA 2Y4SA 3S36X 2Z93A 1EHLL 5GRWA 3VMNA 5FF6B 3S3SA 5JXAH 4NYLA 4RNRA 3DECA 1CFVL 4M62L 3RDTB 3VFNB 5F7HA 3VMPA 1RZGA 1KCVH 1FGVH 3BRDA 4L8CA 3HN3A 1YNLH 3JV5A 3LQZB 1RMFH 4NNYA 4OTXH 5JZ7C 3MRNA 5K9JL 4RWYH 1CD1A 4HF5L 3OZ9H 1LO5B 4DOHB 1QO3A 4ZUWA 5E7FA 3WUZA 4DVBB 3BWAA 1HHIA 2VN7A 3OKOB 3U7WL 2NY3B 3U7YH 2D03L 5K9OA 4IM8A 4JPVL 2FB4H 5FUZL 3PL6B 4ODWB 1PLGH 1MOEA 3NH7H 4X9GA 5DD6B 5T1LB 3WIHA 5BRZD 1EFXB 4HGMA 1X6LA 2ILLA 5KW9H 3ULSB 2R4SH 3GIZH 3KXFD 2DQIL 1F3JB 5HPMA 1OW0A 4ZNCD 3QEGH 3ILQD 1B4RA 4M03A 1C7TA 3NN8A 3ZYOA 5CUSL 2PTVA 4X6EB 2BJML 3B2UD 3ULVD 2YR3A 3OAUL 4X0KB 4WUKH 4G5ZH 5IHLB 4L3ED 3HZYB 1B6UA 5F3BA 2X4TB 5KSAC 4MX7B 5F88B 3F6IA 4RAUA 4ODXA 4EJ1C 5H35A 3OX8A 1TQCC 2CK0H 1U8KB 3MRRA 5M7QA 4MVBD 4AT6B 1ZA6A 4HT1L 5B8CB 1F11A 4XVUD 3RQ3A 3RY6A 5JIKA 2NW2A 3LS5L 1JGVL 1ZANH 3CSGA 4RA3A 3KR3H 4HIEA 1I8KB 4YIQA 1UWXH 2LABA 1UZ6E 1CD0A 3KPSD 1CG9B 4IBLT 4QXGH 1NCNA 4QTIH 3T0DA 1IRAY 3TBWB 3L3JB 1KN4L 1F90H 3BVNB 5DQ9A 4EEEA 3KLSA 4M8QB 2VL5B 2DTMH 2YD9A 2AJVL 5IWLC 2AV1A 3TJHC 4D2NA 3NGBC 1QRNA 1SBBA 2EDQA 4ELKB 3LQMA 3UTSE 1INEH 2NY6C 3AFLA 1BGXH 2Z31A 4HD9A 4G9FB 2YBRB 3SPVA 2F8XC 2CJUH 1G6VK 1OL0A 2V17L 1GOGA 4GW1A 5CBAA 5JDSA 4WU5B 5C0DA 4PB9H 5DJZA 1FL6A 3HI6L 1RK1B 1MLBA 2VH5L 3LN5B 5FYKE 2C3WA 5EN2A 32C2A 2FJFB 5MEQA 1IMHC 2DL2A 2Y5EA 1D5BB 2HMID 4QRPD 1IGIH 5GZND 3V6FB 4R97C 4UT7L 4V2CB 5DGQA 5CGYD 1IC5L 3MV11 3RWJA 1BFTA 3CSPA 3QIWC 4OUOA 2DTSA 5D72H 3C6SB 3IJSA 1J1PH 2X89A 1WBXB 5GGTH 1OLLA 5T5NF 2XY1A 3V9FA 2ZSVB 2PR4L 1CD8A 3D39A 4L8DB 1U8IA 2DQDL 3X12B 1WLHA 5CHNB 2H1PH 3QUXC 2YZ1A 3MLUH 4UB0L 2EIEA 3H9HA 4FQIH 1QBML 4IHOA 4NFDA 5D8JL 3VGDA 1MH5A 4WCYL 4FQQA 5SWZD 1LDPH 1MHEA 2M1KA 1CXHA 3U9UA 4YDJB 4O51A 1CLYL 3BW9A 1BJ1J 2IADA 1YY8B 1HKLL 4O2FA 3PIQB 4JQVA 4L4JA 1ZGLP 5ID1B 2HJKB 3O3AB 4EXKA 2WANA 3BKMH 1I85C 5IM7A 1A6ZA 1I1AA 2ZUTA 2Y07H 3BIKB 2NY2D 3MZTA 2D31B 1QQDB 1LO3H 3BPLB 3GMOB 1CF8L 1QD0A 3OB0H 3W2DH 1S7VA 4R26H 4QGYA 4P46B 5HJ3A 1PW3A 1WISA 1NFKA 3FOLB 1A0QL 5I1LB 4H88H 1DL7H 5DD1L 3SO5A 3UP1A 4HIXH 3TFKC 3BYYA 1K3ZA 4KKBD 4X6BA 1NANI 4HIIB 4O2EA 5DHYB 2DAVA 5IF0A 4FQ1L 3EYFB 3RWDB 4LP4A 4ONFH 5IT2H 2B4CH 3DX9B 3O4OB 1R3KB 3LMJL 4HMEA 4KFZC 5JHDD 1RJYB 4HWNA 2VDRL