2H2PD

Crystal structure of clc-ec1 in complex with fab fragment in secn-
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLC Cl transporter
publication title Uncoupling of a CLC Cl(-)/H(+) Exchange Transporter by Polyatomic Anions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ion transport
total genus 43
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2pD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2pD01
4POYA 1MJJA 5E1AB 1YMHA 4DGVL 5IOPA 5I18L 4OCSL 2WP3T 4X6FB 5CZXC 3HB3D 1VFUA 4UNTA 2Q3AA 1E6JH 1Q1JH 1XH3A 1CL7H 5CEZL 3IKCA 4GQ9H 4EDWH 1WZKA 2J2ZA 5IT2L 1I1AD 1UQSA 2VJXA 5BQ7A 3O41B 5EU6E 1GXEA 3BJLA 4QRRD 3BSZL 3ECBA 3MRBB 3A6OA 1RJZA 4MDJB 4LP5A 3P0YH 2DKMA 3BP4B 1IC5L 4L3CB 5CBAB 2AV7A 1JHLL 4I2XA 2WW8A 3UJTH 2CJUH 1U8NB 3AC0A 1NGYA 5IIEB 2JJTA 2P5WA 2AJVH 1QFOA 3GIZL 4GAFB 4UT9H 2JJTC 3U4AA 2Y06H 4D0CB 3BRFA 2XACC 1HE7A 3MV01 1W0YT 4X80H 3RNKB 1U3ZA 3QNYB 3DX9B 4AH2B 1EZVX 3U1SH 1BQHG 5F71A 1PKQB 3JWOL 4ZPTA 3H42L 1MFBL 5FO7A 5FCUL 4D9LL 1YY9D 1Q38A 1XF4B 3PWVA 5E8PA 4QTHB 4BZYA 4NN6C 3KPMA 5DURB 5I8KH 3CVHB 1FG2A 1K8IA 4GKNA 3RZWA 4OFYA 5DMGC 2DQJL 5D2NB 1CFTB 3O3DB 3U9UA 4AMKH 4AIOA 5ADOH 1RZ8A 25C8H 5KW9L 2DQCH 3QHFL 2PYFB 3K7UA 3D39B 3K1DA 4L8BB 4BUGA 3AS1A 5CINL 3SPVA 1KJVA 4NGHL 1DQDH 3MQIA 3LKNA 1FFOA 4PJCF 4K71B 3V8CA 4X99A 3ISWA 3QCTL 2A6JB 5IF0A 4WGVB 4GG6F 2PR4L 3W0WB 4LCIL 4ZQKB 2DTMH 2Q76A 4PD4J 1JCKA 4U1LA 4XRCB 3DX6A 3QXVA 4MNGA 3PUCA 1I8MA 1HSAB 2LVEA 2AJYL 5CLTA 5DC4B 4LCUA 3B6SA 2QADC 5H8DA 2NY1D 3WS3A 2R2BB 1EUTA 2FZ3B 4OFKA 5TF1L 1TFHA 1X4ZA 4YZFE 2WWKT 3Q5OA 3CLFL 1WFOA 2JB5H 5E5MB 1U8KB 3WNKA 5LGHL 4ZFGL 1G7QB 3MV9E 2Z91A 4QWWD 3BT2H 5D2LA 3LH2L 3BQUA 4P59H 5DEGA 4XBEH 2VDNH 1K5NA 4IBLT 3BQUC 4CN4A 4MCZB 3BAEL 1NL0L 3HE7A 4XMPH 1IC4L 5CSZA 3SJVB 5JXEA 3HE7C 1T66C 1BGXH 4Z7UB 3ROOB 3G5VA 5JXEC 1OSPH 3HNTH 4WV1B 5C3TA 5JOFA 2VL5B 2Z9TA 4FQ1L 4EVNA 4YNYB 3C2SA 3ZTJH 1VPOH 4Z76B 2VXSH 5E9DD 3R8BB 1INEH 3CMGA 3DUUB 4N8PA 2OR9H 3PXHA 1H9VA 5ITBH 3EOTH 1SBBA 1BFOB 1VFAB 4U1HB 4LCYB 4XMKL 3W39A 4N0YL 1DQLH 2C7UA 2GYSA 2XWTA 5ID0B 1MPAH 1JHKL 4L8DB 4I18A 3KYKL 2R4SL 3HZKA 4I18C 4LLYB 5FECA 2EIZB 1UYWL 4J3TA 1G7JB 5JHLH 1G9MC 3FMGL 1TZGH 3VFGL 4TTGA 2JB6A 1HQRB 1JHTB 4GXUN 5F7YC 2F5AH 3L3OB 1SMAA 3NA9H 2A83B 2DQTL 3LZFL 1FGNH 1P4BL 5BZWA 3C60B 5FKPA 4NZRH 1R3IL 2A6IB 2XPGA 4GRLD 3IFPB 4AG4H 5J7CC 2MQ0A 3HMWL 1K6QH 1T1XA 4DZ8B 5T5FL 4LPCA 1OM3H 4YHYC 3UROR 2FGWL 2X05A 3MJ9H 1AI1L 5AZ2L 3LSOB 3MMEB 1TPXC 3IDYB 4B7IA 5EUOA 2P24A 3BKYL 3NFPB 5DD6A 4OQTH 5DJAA 3QQ4A 4PJHB 4C58B 3JVGA 2YZ1A 4OCMC 4OF6A 4GKZA 3JVGC 5GS0C 3EOAB 1BZQK 3E2HC 4HIJA 4Y0GA 1D6EA 5F44A 1W0WB 4F8QA 3T0ED 3TPUA 3WUWA 1MIEL 5EUKB 1QRND 2BSRB 2DQEH 4KROB 2GCYA 4R4ND 5IG7B 5C0AD 1D7FA 3BYYA 5DA0B 3CH1A 3PHQB 1BPVA 2DLGA 5F9WB 3MCLL 3VWJA 3GJFH 2AXFA 3VWJC 3ESVF 4O51B 4PY8I 1JN6A 3NPSB 3EYQD 4P49A 3S3JA 2FATH 1KJ3H 1TZHB 1EX0A 3FT3B 1GRWA 1FFRA 5GRUL 5D5ME 4K3JL 5IHUH 5EU6D 3QDMD 4F7EB 1R3HA 2YD1A 1F11B 2FO4B 3UTSE 1EUUA 5JDJA 5CJOL 4PBWD 1T1ZB 2GEEA 4LCCA 3RWDA 5D71H 1U2HA 4LCCC 4NQCA 5F7DB 2J5LB 2AP2A 2F54A 3FCTB 4LCWB 3BX7C 2E5EA 2XWBA 1A3LH 4WI3A 2VLJB 1MCRA 3LKPB 3QDGE 3WHE1 5DTFB 2DRUA 2NY4C 6CGTA 5FA4A 2DQIL 2EH7H 5DD1L 5DF0A 2QQNL 5EU4A 3R8QA 4NYLB 1A8JH 2RR3A 3N1PC 3MA9L 1QQDB 2AK1H 4RZCA 3QPXH 3HPLB 1RZ7L 2W0FB 1MCBA 3VI4F 2IH3B 4MA3A 1A5FL 3V7AG 1S7WA 4D2NA 3AMLA 2E8ZA 4Y16D 3VXSE 3EZ8A 4WUUA 3JTTB 2CLZB 5FHBH 2VH5H 2LAAA 4D0DB 5BV7L 5L0QB 3S4SA 4NHCL 4N8CH 3UO1L 2OL3A 4F7TA 1ACZA 4ORGB 2D7MA 5EO0A 5LXGH 4YUEH 4XI5D 4XAWL 5IB1A 3VFWA 1XIWA 4JFFD 4LOUD 2Z8VC 3H9ZA 2HKHH 4N90D 1XIWC 1ZEAH 3SBWA 4DKEH 3P0GB 4RAVA 3SBWC 2G75B 1UEMA 2VDPL 1A1MB 3ARBA 3ARBC 2HH0L 3TZVD 5SWZD 3RVUD 3OKNA 3ZKXC 4HBCH 1GHFH 4L3EA 4NT6A 3VFMB 5ADPH 4PV9B 5ESAB 4UILL 1WBZB 5GGSB 1U92B 4OCXL 5ACZA 1RUAH 3TJHD 3V2AR 2DM4A 1X7QB 1FNHA 5C92A 2CKBB 2B20A 4N68A 2IPTH 1JK8B 3MRGA 3OPZL 3FT2A 2WQRA 5EG6C 2HFTA 3BE1L 3VXUA 4NO3B 2YWYA 3TIDA 3MV9D 4L8SA 1RHHA 2EIDA 4GG6B 2KZWA 2P8MA 1GOHA 2FWOB 4HPYH 1EDQA 3TO2A 4QXGH 1SJHB 3U30B 4XPBL 1NCWH 5BCAA 4NQDD 3GMRB 5SWQA 5E08H 2FEEL 2SEBA 1C08B 1XGQB 5C09A 4MXQC 5K9OA 2MHAA 2CR3A 2FX8H 3HI6L 1CXKA 2CIKB 4QF1B 1FIEA 2H9GB 4AIZA 1ZGLM 5EZIH 5C9JB 2EDHA 3PWJB 5E2TL 4YWGH 5DR5H 4RMTA 5DZOA 5C0ND 5MI0B 4P5TC 3IB4A 4JAMB 1RUQL 3M45A 1GOFA 4RGND 3GB7B 1PZ5A 4LSVL 4JDZA 3T4YA 3VFPA 3L3IA 2AEWA 2UVEA 2FX9H 5JIIA 2B1HL 5DDHB 4MAYB 5TDOA 2NZIA 3S3SA 3WNPA 2FJGA 3OJ2C 2X2YA 2F9BT 1JYVA 3F65A 4BYHA 2MKWA 4X9IA 3KNBB 3RIFF 3HLAA 1ORQA 1MJ7L 4I9WD 4NQEB 4HHAA 3T1FA 3WV0A 3ETBF 1U8MA 4EUPG 3GSNL 1AO7A 5IBLD 2PW1A 4IDLA 4K2UH 4ONHA 3RWGA 1A14L 1NKRA 1FYTA 2YZ8A 1K3IA 1BQSA 1ZXQA 3NH7L 3HNVH 4KQ4H 1CLZH 3G6JA 2F5BL 4JB9L 1YUHA 2VQUA 4HUXB 3TT3H 3Q3GB 4G8GA 5B39G 4OJFL 4IOIB 5FM8A 4QT5B 3V5DB 3SDXB 1I8KB 3NIDE 1DLFH 1DTUA 1FZJB 3IETA 3TV3L 2NY7H 3SN6N 1OAXH 1XCQA 3MRPB 4I3SL 5IVXE 4UT6H 2CDGB 5GGTH 2XG5A 3ARWA 3TBYA 1S7VB 2ZOLB 2QKIA 3DSFH 4F9PA 1YN7A 4F9PC 4LEXL 3VXPA 2Q86A 2ZOKA 3VXMA 5I1AA 1CYGA 1S9VB 5J9PB 3OWEA 3SE4A 1LO0L 2BNUA 3SE4C 3CFCH 5I75C 1MCDA 4HJ0C 1QFWM 1DFBH 3SDAB 3MRMA 4XWGL 3TO4B 4L4VA 2WANA 2VERN 3EHBC 2P49B 3HI5L 3IDMB 5CJXA 1CGXA 1IAOB 4XNXH 1IQWH 3RIFK 5CJXC 3HE6D 4KWUA 1QR1A 1PQZB 2AXHA 3IAPA 4J1UA 3KR3L 1HEZA 3QEQD 4OCNC 4ODXA 4AYFA 1OD7A 4P2RE 4XP1H 5IK3B 3S36L 3X3GH 3UTSD 4AM0B 4F58L 4JE4B 1OCWH 5F7EL 1AGDA 1GGBH 2Q6WB 1DVFD 1FZKA 3LV3B 1YZZA 4UBDD 3THMH 2XYCA 4IHOA 4H0IA 3IXTB 5FUCC 4G8FB 3E0GA 4EI5A 5C6PB 5E8OB 2GJZB 5D1XA 3QWRA 3C5ZD 4EI5C 4JANB 1CXFA 5D1XC 1F4YL 1U42A 1BEYH 4ELME 4B5EA 3CIQA 3ILPA 1CGSL 3U7WH 5EBLB 1LEIB 1LWRA 3U83A 4FQCL 5GRWA 1NMCB 1P53A 2ICEA 5J12B 4NIKB 1T0NA 1H15B 2BNRE 2IBGA 1KLUB 4ORZC 1DBBL 4WW1B 3VXSD 5ABDE 5D1ZA 2DI8A 5I15L 4ZXBD 4D9RE 5L6YH 5D1ZC 4IDJL 1P84J 3G04A 3O45B 1IAKA 1D9KD 5C07B 5JPMA 5TQ0L 3SKNA 1LQSR 2P4AB 4HJJH 3OG4B 3DBXA 3RL1A 4NPYB 2XNAB 2GW5A 3L6FB 3EYVB 3HCVB 3UTQA 2V9RA 3BZFA 5T1MA 4MCYA 4HXAH 4ZD3H 1KFAL 4S0TD 1DQTA 2IQ9L 4CW1A 1CR9H 1YYLL 3VFTA 2Q8AH 3BPLC 1KLGA 2X89A 3GI8L 2N7BA 4GG8B 4XVUC 3ULUC 1CU4H 4S1DD 4TUOA 4JM2B 3QI9D 1I1YB 3U6RA 3UJIH 1WAAF 5MENB 4W4NA 4L4JA 2CRZA 4Y19E 1JPSL 3UTPD 4H26A 1QSZA 4JDVB 3KWWA 4MX7B 2IQAB 4JO1H 4JFXA 3G08B 3MR9B 3WL9A 1EZVY 4IRSB 2KDGA 2B1AL 2Z31B 1GH7A 3S97C 4HWZB 5CSGA 3PDOA 2KQNA 3ARSA 4F9LA 1MEXL 4P5KA 3WLWC 4HIHB 4PRHA 4RMSA 4F9LC 4MXWH 4K7FA 3CVIL 2XZQL 2RB8A 4LF3B 4PJXB 4NZTH 2B7DT 3RU8H 2CDEA 1IM3A 3F8UB 4YHMH 3H0TA 3MZGB 3D3VA 5DK2A 2Y36L 12E8L 3BDYH 1Q9KA 4Z8FH 4PJAF 5GS1B 4GKSB 1ZHKB 4U1GC 1VKXA 5EWIL 2EYTB 1B90A 3O9WB 3WNMA 2EDKA 2F8OA 2ZUUA 1NBYA 3IVKB 4M48L 5DD5L 1MFAH 4UV7L 3T2NL 1ZHLB 3D39D 5KN5B 3QEHB 2YPLA 4L4TB 3VXRB 1LO3H 3RZCB 2AVGA 5EC1B 2ADIB 3KPQA 2CRIA 3DRQB 4HPOL 1OF2A 4RRPG 4Y4KD 3BD5A 2EEDA 4U3HA 5GGUB 1MIML 4RMQA 1Z0NA 3HKFA 3IJHA 4Y1AE 1NFDF 1MI5A 4LKXB 4YX2H 5KS9F 3IDJB 3V52L 1WZLA 2ZP0T 5DJCA 2EYSB 3DTXB 2E9WA 4PJCE 4WEBL 4Z77A 3T8XB 5F97E 1BQUA 3K74B 5KVDL 3TYGL 1FLRL 2R69L 3L9RA 3VXNA 4LVHC 3WSQH 1AJ7H 3VXOA 1Z3GH 5DRZA 5IV2A 3HR5B 4JQXA 2KPNA 5LWYH 4JQXC 5GHWH 4F15C 2AK4E 4LLQB 1PLGH 4XNMB 4E0RB 2Z92A 3MODH 4BUHA 4QOKA 2XTJC 1IEAA 3LQAH 1AXSA 1OP5H 1CE1L 4JFOA 1BFTA 4BH8B 2CRMA 2Y7QA 4TN9A 4H88L 3NAAH 2W65B 3GSRA 3TPKA 2R9HD 1EAPB 3FKUS 4MLSA 2FSEA 2HLAA 3BWAB 1A4JA 1U8HA 3WFCH 1ZVHA 1KACB 1JTPA 1AGEA 4UINH 3DROA 1C5BH 1CDHA 1OAYH 2VIRB 4R26H 4DWHA 3WIHH 3CCHA 1IKFH 2OTPA 5D7LE 4AL8H 4UIMB 1WFTA 4E42A 5I1LB 5IGXH 2BOBA 2ZNWA 2DM7A 5E4EB 1N0XL 3BKJH 2NXYC 4LVNB 1PY9A 3RPIA 5FYJU 5IEHA 1R5VA 4MVBC 3DYMA 2NZ9D 2ZWLT 4NJ9L 1QSEE 2NY0C 1RFDL 4X9GA 4DW2L 3RVWD 5IMKB 5I1EL 4JFZL 2A9NL 4QRUA 3IDIB 1H3GA 3LS5H 3EUUA 5F7FA 4HWEH 1QKZL 3Q1SH 3VGAB 5GJSH 2LU3A 1BM3H 3D0VA 1UM6H 5I1GL 4O9HL 1B2WH 1G9NC 4PG2A 3MLRL 2D9CA 4UI2A 4PG2C 4S0SD 1T22B 3JUZA 5FM5M 5MP6H 4EIZC 1NBVL 2NX5B 3WJLA 2HN7A 3G6DH 4OCWH 3HPJA 1A9EB 1KN2L 4IMKC 1BD2A 4N0RA 4PGBB 1RJCA 4D9RD 1QA9B 3SKMA 4PS4L 5FYJL 4OLEA 3D85D 3F12A 1HWGB 3SDDB 3ZL4H 1NCUA 1F6AB 1L7IL 2QL1A 4MB5A 4JPIA 4JY4A 3PF2A 5EBMB 3SE8L 1P7QA 4EUPA 5CEYB 2I07A 3DVIA 3L5WB 1IGFL 4KMQA 4FFYH 5HXMA 1SJEB 4Z7VA 3FZUC 4EXKA 2ZUQC 4Y8DC 4N0FA 5MHSE 4S1QH 4G7YL 5JXAH 5B39A 3ARVA 4AT6B 4NKIL 4RWYH 1I4FA 5BO1L 3OJVC 2OSLB 4QCIB 1NLBH 1FC1A 4LNRA 3NIGE 3U2SA 4E41A 1NDMB 1YNLH 1AR1D 1CGWA 3GGWA 3KPOB 2WV3A 3PWUA 4PG9A 5D96B 4WJ5A 5HDLA 3PXJA 2VLJD 3H9SB 1RIHH 5C86A 2GSIB 1JFQH 4X5LA 1R5WB 5GXBB 3DV4A 2IH1B 2VO5A 2X4OB 4KVNL 2HTLC 2DWDA 3P0VL 3QG6A 3BH9A 5EULV 5GGQL 2FJFA 2PTTB 2VDLL 2YA2A 5F3BA 32C2B 3I2CH 2AKRB 3BH8A 4XNQB 5C2UB 1MVUA 5IR1B 3ZDXF 3C8KB 4FFWC 3GI9L 4ODUA 3U46A 1YDPB 3SDCA 4ALAL 1DQML 2G5RA 2APTA 3SDCC 3QXTA 1F13A 3BN9D 5FYKU 5DYOB 3GM8A 1EO8H 2IALB 5LQBL 5I9QB 5IFAL 3F5WA 4PRIA 5GISL 4Y4FB 3F62A 4JHWH 2EH8L 1E6OL 1TJHL 5C7XH 4R0LB 4JJ5B 1CZ8H 4QLRA 1F45A 3RDTB 1DBJL 1IEBB 3U4BH 4XX1G 5FM4A 3VI4E 1KYOJ 1RULL 3A67L 1OB1B 4WTXA 5BS0D 4NRXB 3GIVB 3U4EB 5HI5C 1NFIB 2BERA 1OAQL 4X5WB 4DVRH 4YXHL 3SE3C 3FRUA 3FJTA 1F3DJ 2D03L 2R8SH 4JHAH 3QQNA 1WUNT 1MCHA 5HHOA 1EJOL 2QSVA 5E00B 3O4OC 1NH6A 3JV6B 1U8JB 5IB5B 4CJ0A 2JTDA 3AGVA 3MJGX 4N0CD 1GGTA 2VDRH 3PWNA 1MHEB 1S5IH 5J06A 5FYKL 1VGKA 3ZE1E 5EIIB 2J88L 3U7AA 3FFDB 3I84A 4FXKB 1NMAL 5EU3A 2P48B 3B4NA 3V6ZA 4CVZB 5IB3A 2P44B 2AS5M 3IKKA 4HWUA 1A1NA 1NMBH 2DQUH 2H26A 3KLDA 4FFVC 5KANI 1CFQB 2BC4B 1FSKB 1Y6MR 5CBEA 1NFDB 4CU6A 4LLUA 4P46D 1JZ8A 2HMID 5F8QC 2XZCH 4PJ5E 3GSWA 1HQ4A 4UOJA 3FN9A 2AK4D 2AEPH 5F6HJ 3STLA 3F6IA 1F4XH 2X4SB 5HDQH 3OKOA 4PJGE 4Y5VB 3HZMA 5D7IB 1RUKH 4Z7QE 5F1SA 2XKSA 1HSBA 1CBVL 1ULVA 2BJMH 5KJRL 3F7PC 2ZPKH 2BVTA 2FYYB 2BDNL 3IU3B 3BI9X 3N1QC 4G3YH 5KVEL 5J13C 4PJFA 4V2CB 2HVKB 1I1FB 2HFFA 1KN4H 1OTSD 2PW2A 4GLRI 4XXCA 4OIAA 1M1SA 4WHTB 4XXCC 5D7JA 5GRXG 2WM0A 1I9IL 5D7JC 4LFHG 4MDIA 2IPKB 1G0XA 3H7BA 4DGVH 5JNYA 3D48R 4NQED 3OX8A 1QBBA 1C16B 3RPKA 3I6GB 4QXTB 1KJ2L 4R97B 4PJIA 3ALXA 4WW2A 2CXKA 5D6CA 1FE8H 4IM8A 2HFGL 1YY9C 5DJ2A 4OI7A 5ICXA 1RIUL 1IC1A 2R23B 4XCNB 1HXMA 5EIQA 4KGJA 3F7YA 3BMVA 3QJHB 2D31A 4JKPL 1YA5A 4KJQD 4Y4HA 1RURL 4J7RA 2MNUA 4Q2ZB 2KQMA 5IHZB 4OUUB 4XTRD 5BJTA 1S7SB 3B2VL 1BBDH 5DGRA 1AGCA 4JRYA 4HGWA 3HAEH 2YUWA 1CXHA 4TPRL 1VFBB 2ICWJ 2BSTA 3PJSA 3NZ8B 2C4FT 1B6DA 1IGML 2W91A 3NVQA 4BFEA 4HGMA 2GSGB 3T0XA 4M43L 4ONFL 5E94A 2CIIB 3QDGB 2P7TB 5C0IA 4M1GH 4RRPA 4YK4C 4TSBH 5FUZH 4PTUA 3LN5B 4LQ1A 2NY1C 3P4NB 4BSVA 2Y23A 1WTLA 2CDFA 5JUEL 1X5KA 2G5BB 4JZJB 5TDPB 5I16A 4M6NL 3PGCA 5KW9H 3SDAD 4FQPA 2NY2D 3IDXL 3TO4D 5I1IL 1BOGA 3QFJE 2A73B 4RMUA 4QWWC 2HRPL 4Z7NF 5CINH 4P2OA 1DBML 3ZHDA 1U8LB 4P2OC 1ETZA 4G8EA 4NO2B 1A6AB 3ARFB 3SQBA 1J5OL 3DV6B 2O5ZH 4HV8B 2YUZA 3QCTH 4L8CB 1LVEA 4RGOH 1LD9A 1X6LA 1W72L 3WUZA 3ROLB 4U33A 2OZ4H 1ACYL 1BAFH 2A0LC 2AGJL 4ONGH 5J0BA 1I85A 1D5ZB 1I85C 5EO9A 3QQ9D 1EEUA 3JV0A 3JWDL 5EFIA 4NQVA 3LY6A 1CD9B 4HMEA 1LO4H 1OSZA 3MYZA 3OXSA 3MBED 2WP3O 4NSKA 5LGHH 5EOCJ 4P48A 3B5TA 2VDML 1RMFH 1YY8A 2ESVE 4JQVC 5D2LF 2W9DL 1KIQB 4POZC 2EDBA 3E3QE 4GXVL 5I71C 1HN1A 4PLJD 3I6KB 3DOSA 3NCJH 4CMMB 4D9QE 4FQ1H 3WE6A 3FQNB 3ARQA 1BQLL 3VH8B 3IDNB 5C07D 3ULUL 1VGEH 5HYSA 3QIBA 3FN0H 1J8HA 3QIBC 2XWJA 1NGXA 3U7YL 4XMKH 2IAMA 4XP5L 3GSNB 1XR9A 3MXVH 1P5UA 4HS8L 4GRLC 2UY7A 4N0UA 5DUML 4JRXE 3DVNA 4ZAKD 5EB9A 3F7VB 1J1OH 3OMZA 1HIML 4QRTB 5JPNA 1UJ3B 4L1DA 4XCFL 4W81A 1AQDA 2A6KB 1UYWH 1RIVH 2DDQH 5IESH 1Y18A 2HJLA 5I73C 1CIDA 5T33L 2ZCLL 1O7VA 1PBYA 1QVOB 4PP1D 3V4VL 5MEND 1FYHB 3T0EC 3KJ6L 3REVA 1TJGH 3O2DA 1I8IB 1DLHA 2VLKD 4C83A 5JIPA 5CKGA 4HWBA 3V6FB 3I9GL 3R06B 3I3DA 5KOMC 4ZNCD 4IRSD 2UUDH 1TTGA 3HFML 5HYJB 1N5YL 4ZDHA 3DGGA 3QIWD 4M7LT 1BBJA 3WDHA 3HMWH 1WBYA 2ICWA 5EH1A 4PJ5D 2XG4A 3EYQC 3O0RL 4PJ7A 2XN9A 1ZA6B 4QRQA 1N59B 3CDYA 1RZKC 2J12B 1QG3A 4HLZH 5HVHB 4JPWL 3IJYA 1YNTB 1JPTL 3QQ3B 5EUOF 3UZEA 4OM1H 1OGAA 1BZ7A 4KZDL 4ZUTA 4P2QE 3C09C 1MJ8L 1GIGH 2JIXD 1NC4A 3ARDB 4MSWA 4GBXB 3WO4C 1QP1A 2B2XL 3QUKB 2C3HA 3V6OE 4DUWA 3R1GH 5KG9B 1R3LB 2GJJA 4G6AD 1MCOL 2YD8A 3P4OA 4I77H 4LQFH 1S7QA 3D0LB 1QNZL 2AJSH 1MWAH 3MUGB 4K3EL 3KPTA 4J6RH 2X1WL 1A6WH 3EYSL 4OM0L 3BVNA 1RV6X 2C1PA 3G6AB 4MJ5A 3P11L 4NN5B 1PSKH 2BNQD 1JF5A 5DUPL 1AC0A 4IRJD 1SBSH 4J4PD 5EOTB 3ZTNH 2APWA 2HFEA 5CJOH 1T5WA 5JMRA 4LMQI 4YHOL 4DKFH 4PJBE 2FIRT 4KPHL 1DUZA 1FVDA 4WU5B 2XRAL 4GUPB 1MFNA 2G60L 1NC2A 5T1LD 3MREB 4XP9L 4MAUH 4P2RB 4FQIL 2R0ZH 4IS6A 1EBAA 4I8DA 2DQIH 5DD1H 1Z9LA 2GUOB 3H9HA 1UCBH 3TZVA 5SWZA 5DJ8A 2W38A 3TZVC 5KSUB 2XA8L 4DN3L 3EYUH 1FCCA 5I6XC 4FG6D 2VXVL 3H3PL 5CEZD 4Z78A 4FXGB 5GGVY 3C08L 1F5WA 1D5MA 1GGUA 4PTTA 4ELMB 4TSCL 2FECL 4G6JH 2JE8A 3FTGA 3OKMB 1U93B 2OJZH 2CK0L 1KUMA 1ZLVH 4PBVC 3VMOA 4U1NB 2C3VA 1TENA 2YD2A 5H94A 1J0JA 4XAWH 4BQCA 1WLHA 3D18A 4OGZA 2BNRB 5AEAA 1QLEH 4ODWB 4EN3A 1N2RA 1TCRB 3UTTB 3QWOB 4EN3C 1J8KA 1IQDA 4CU7A 2YEZA 3QJFA 3BKML 1G9NL 5CP7A 4ZUWA 5L8LB 4H1LB 3TYFB 3QEUB 4C55A 3P73A 2P1YA 3TESA 3GMMA 4OD3H 3HG1D 3C6LD 5DRXB 1HINH 5DHYA 4LPVA 4XCYA 2A77L 4KJYB 3MXWL 2GK2A 1HILA 4RGNC 1OQOA 3WIIH 4JY5L 1EMTL 4R2GD 3PABB 1DN0B 1D5BB 1JP5A 2VDQL 4LARH 5I76A 4GRWE 2AJXH 2LU4A 1A3RH 3WXWL 3NCCB 2CLRA 4GAGL 4GO6B 2Z0BA 4X6CB 1MREH 1NEZG 4J23A 1QO3B 1GJIA 3FO2B 2NX5D 1TQBC 3ARED 4XNZB 4Y19B 2ADJA 1T1WB 3KVQA 3FOMB 1I9JL 1JPFA 2C3WA 3H8NA 5LBSH 5DJXB 3TVMA 1JMZA 4A6YA 4F7PB 3O3UN 3TVMC 1KXQE 4NZUL 2VZUA 1YC7A 1HZHH 2WLZA 1C5DA 1A6UL 1Q9OB 2I9LB 1P5VA 4FRWA 5DEGB 2H32H 3ULVL 4PRDA 4OLVH 1RUQH 3K2UH 5CGTA 4NRYB 3QHTC 1QRKA 2ITCB 3FQRB 4O4YL 2GI7A 3AS0A 3MGTB 2D3VA 4ZUUA 4Q0XH 3QPQD 4YFLI 4PY7A 2EE6A 1T0MB 3MBXL 2VLRA 2DD8H 1KF9B 4HZLB 4KFZC 3W39B 1OGTA 4JG0L 1DL7L 3RVTC 1C5CH 2Z93B 1AKJA 4KK8D 5DRWA 5DHVB 4BZ1L 2XKNA 5D9SA 5HHVH 4OLZH 5H2BA 3H9SD 2CGRH 2VLLA 3DECA 4KK9D 3MV7A 1E27B 2OI9B 3G6JF 2R0WH 4B7LA 4IIQC 5ETUA 5HI3D 1ZT1B 4JCLA 1CVSC 1B4JH 3BUYB 3J7HA 1T5XB 1GYAA 1T1YB 2COQA 2R1WB 5GSRA 4Y1AB 3RTQD 1QBLL 4NOFA 1UXSB 1HHKB 1P4IL 3KHOA 3P9MA 1JGEB 2QHRL 5I66B 4KV5F 2H3NB 3S35H 1BVKB 1KEGL 3MV8B 4AEHH 4XZUA 2VWEC 4M6OL 3BZEB 2R2HA 1XGTA 3FFCE 1RZGB 4NZDA 1CK0L 4P2QD 3IDGB 2IANE 5GGVL 1CICB 3ZDZE 4NC1C 2JJVA 3QEGL 3VGGA 1WWWX 4X8JB 3GMNB 1FNSH 3D2UB 4XHJD 1XF5B 5ALBL 4X4YA 4CRPA 2PO6A 4P9HH 5I1DA 1A9BA 4MXVF 2PO6C 5KSVA 3ZDXE 4DCQB 3SCMB 2QQKL 3C5ZC 2MCPL 5IMLB 1YEDB 3DRTA 3HZVB 5CJ5A 2NY3B 2Y1VA 3HRPA 1NAKL 1N0LA 5J56B 3VRLE 2DYPD 4TNWK 3VD9A 4QHNA 3T65B 3KR3H 5EPMB 2AJ3B 3QZWB 5BRZE 3S36H 3ZO0A 3GRWH 3BEVB 4GAYB 2YSSB 4UQ3B 1ES0B 2PN5A 2GCYB 2EKSA 4KTDL 3GSQB 4KK5C 3DX8B 1QFPA 3KXFA 2ICES 1D9KA 5IQ9A 1D9KC 4I4WB 5D7LB 3TC9A 5DJYA 3CUPB 1PFCA 3JZ7A 4F7CB 4U0QB 1WVZA 5E1AA 1RZIB 5C3LD 4X6FA 3BGFB 2DQDH 9CGTA 1CDGA 4HC1A 1R3HB 5GJTL 3ZKNC 5L2KE 4JHZA 1DANT 2XTLA 4YH6A 4FQCH 3O41A 4C54A 4WI6A 3CU1A 1JGDA 3TN0B 4P3CL 4U3CA 2AQ1A 3WFBL 4R4BB 3MRBA 2BY0A 3NA4A 5ISZD 1CFSB 1DBBH 1RZFL 4MDJA 2R2EB 2XWBB 4LMQE 1UWXH 5DXWA 1YMMD 5CZKA 4OBSA 2HP4A 1J1PL 3LEYL 4L3CA 1BFVL 3MLVH 5CBAA 1A7OH 3DXAE 2MCG1 1U8NA 3ZT5A 3U0PB 5IIEA 3NCEB 4OZGE 1NCCL 4D0CA 1CI5A 1HHJB 1A7PH 1G1CA 3RNKA 3QNYA 3VXTB 3DX9A 4AH2A 4MA7H 2X42A 4DN4L 4C59B 1PKQA 1X5FA 3MOAH 3VI3F 1GSMA 3KGRA 1XF4A 1R24B 3MACL 5E5RB 4QTHA 3OZ9L 3ULUF 1IM9D 3CVHA 3QFDB 2XV6B 1FRGL 3OGOE 4ZOCA 3CD4A 5D2NA 1CFTA 3O3DA 1JNLL 3K4DA 4FQXD 5D2NC 2VXUH 2YD7A 4MYWB 4P9MH 5CMAB 3OF6D 3T3PE 1HNGA 5KTEL 2PYFA 1QZ1A 3D39A 4L8BA 3X17A 4MJ2A 4BQ6A 5J3HC 1CXEA 4OFVA 5GZND 5C0FB 1K4DB 2I60L 4G7VL 4H8WL 4APQD 1MF2L 4KUCF 4MS8D 1YEHL 2F53E 1NUDA 4K71C 2F19H 3RGHA 3W0WA 4ZQKA 3AB0B 4PRPD 5I2IA 4XRCA 1ZT7B 3TBTB 1HSAA 3RI5K 4I2XE 1ONQB 3OB0H 4FQ2L 5C08E 2Y36H 2OR8A 1LE5B 1EBPA 1MCEA 3TIDB 1NANI 2P5WE 2R2BA 3WFDH 2FZ3A 3O8XB 1CG9B 4E5XB 4HK0B 1UADC 2EC9T 5E5MA 1U8KA 2CPCA 4HXBL 1SEQH 4KK6C 1G7QA 3ZE2F 4LL9A 1FIGL 4JKKA 1EGJA 4MCZA 1CQYA 1EVUA 3S6CA 2IMNA 15C8H 3SJVA 4Z7UA 5HHQB 3ROOA 1MHCB 1OPGH 4LBEB 3PQYD 4WV1A 4LAJH 4NKQB 2L4OA 4CMHC 4WV1C 4YNYA 3GHBH 3WXVL 5SX5K 4Z76A 1F6LL 3GO1H 3GSVB 5ANMB 4Q9CA 3GMPB 5INDB 3DUUA 1UA6H 1OD9A 3SE9L 2Y9RT 4WWKD 4HH9B 1HH6B 1WK0A 1BFOA 1VFAA 4U1HA 2I5YL 4LCYA 3FHQA 2E3VA 4X5XA 3RGVB 3S3PA 1B6UA 3MLWL 1YNKL 5HHME 5ID0A 4ZOAA 3GSOB 5AUMB 1TJIH 2I24N 1Z5LB 4L8DA 5HVWA 5FKAA 3RKDD 2FDBP 3OAZH 4LLYA 4MQXC 2EIZA 5A2IH 4CGTA 1G7JA 4OZ4B 3GBNL 4MNGE 4LLMB 2MSPA 5FB8A 4OIIL 2X4PB 1HQRA 3FFCD 3L3OA 4GKOA 4NO0B 2A83A 4HT1H 2NZ9C 1Z9OA 1G9MH 3GEWB 4L5FH 1KJ2B 3IFLH 3C60A 2BP3A 4QNPF 3HS0B 1C12B 2A6IA 3KS0J 4OGAC 2JK5B 3IFPA 2GIYA 1R0AL 4R90L 4PJGB 2EYRB 1KTRL 3HTLX 4NM4L 4AENB 3LSOA 3MMEA 1KCVH 3IDYC 4HGKC 3RVVD 1BHGA 1UM5L 2DBLH 4PJHA 5DUBB 3W81A 1JGUL 4JPKL 5BMFL 3EOAA 2ZOKB 1BIHA 4PJ8B 5HHXL 1KULA 1W0WA 3AS3A 3PNWB 4X7FC 3CX5J 2VDOL 3TM6A 1VEOA 1WICA 5KSAB 2NR6D 4ZO9A 5E56A 5EUKA 2CD0A 5C8JB 3EDDA 2BSRA 5E8NA 5GS2D 3PWPE 5IG7A 4U0RB 4JREB 4KROC 5GS0H 1JI1A 3WO3B 1IARB 3PHQA 2J7LA 3QCVL 5F9WC 1LE9B 3K3QA 2V5YA 4O51A 1QKZH 3NFNB 1P2CA 1YEIL 4IOSD 4YHZL 3NPSC 4OTXH 3OG6B 1TZHA 3BKCL 3FT3A 1MOEA 5CJQH 4L3AA 5IFHH 3TJEL 4YHKL 4F7EA 1I3GL 3EYOB 1F11A 4MGXA 4JY6A 4JM4H 2FO4A 4K94L 4FABH 1U3YA 2H2SD 3MO1B 1PD6A 2V5RA 3DIFB 4WO4B 1EJ6A 1T1ZA 4Z0BH 1KN2H 4TSAH 1GAFH 1YQVH 3KPRE 5F7DA 4OD2B 3DXAD 3FCTA 4LCWA 2J5LC 4HCRH 5HBBA 2P5ED 4MA8L 2VLJA 2PCPB 3LKPA 1W72B 5DTFA 2EECA 4UAOB 5IMMA 4NYLA 5EUOE 5BW7A 3SDYH 1OARH 1JWMB 2EICA 2EIEA 3ZT6A 5HPOA 2D4DA 1QQDA 4JFPA 4PJ9B 4YHNB 3HPLA 3PHSA 5JQHC 1SM3L 3KPSB 3QUMH 1T2XA 5JR1L 2W0FA 2VXTL 4XC1H 2IH3A 4I3RH 2A9MH 3W2DH 5F21B 3EO9H 5IKCA 1L7TH 2N1KA 1NPUA 1HKLH 3TA3B 8FABB 3JTTA 3QDJE 1BJ8A 2CLZA 5HDBF 1G0YR 3GBMH 4D0DA 1WZMA 3K8KA 3ULVF 1F4WH 3SGEH 3VGEA 2Y72A 5CZXD 5BVJB 4NP4H 4KVCL 5GSVB 5L0QC 4ORGA 3BZFB 3DMMB 4M5YH 2DLHA 4CW1B 4OZIA 4F57H 5B3JF 2WUCH 1NLDL 1FH5L 1A0QH 4ODTH 1CTNA 5LCVH 1A7NL 4FOMA 1B9ZA 1MCJA 4U31A 2G75A 3RJDA 2E27L 1A1MA 1FO0L 4UTBL 2VDLH 1H3PH 2OL3H 3IU4H 5ILTH 1JGVL 3V95A 4Y5XB 3N06B 1DBAH 4NNPH 4RWHA 3VFMA 1UENA 4PV9A 4IRZL 2F54E 5ESAA 2PXYB 3H9YA 1WBZA 2DLIA 1N6QH 1U92A 2EXYD 2D7TH 4ZTOL 4AEEA 2P5WD 1X7QA 4JJHA 3CGTA 2CKBA 3MSPA 4O2FB 2ZNXA 3MNWB 2YS4A 5LQBH 2IGFH 1JK8A 3AU1B 2ESVB 4RA3A 2EH8H 1E6OH 1UWGL 4HKJB 1A02N 4NO3A 4OZHB 1CN4A 4GG6A 5DJ6B 2VUYA 2XZAL 1AGBB 4LHQB 5C6TH 5JOPE 2DBJA 1SJHA 4ZNEA 1NDGB 1P9MA 3U30C 2DM3A 3D3VB 3GMRA 4M61A 1P9MC 1C08A 4GMSH 3UTTD 2X10A 1XGQA 1TXKA 2VN7A 3LDBB 2CIKA 2E9JA 3EZJB 4MD5B 4KUZL 5ENWB 4QF1A 1VHPA 5ECJE 2H9GA 4OI9A 5C9JA 2UZXB 1X3DA 3PWJA 3QUXB 4LSUL 2CUHA 1RU9L 4MD0B 4BFBD 5FYKH 3CDGB 1CWVA 4JAMA 2DQFB 2J88H 4WHCA 5MI0C 3GB7A 2EDYA 4JZNB 2XXCB 2YK1H 5HHMD 5GRJH 4H20L 4A6YL 4DZBB 5DDHA 4MAYA 1VEMA 1OTSC 3P4LA 5BZDB 3QHZL 4HDIB 1CE6A 1PYWB 4HS3B 2QLVB 5EOQL 3IT8D 1PKOA 3KNBA 2X4QB 4NQEA 5D7KE 1IZJA 4WY7L 4NHUB 5GPRA 2QADD 1ZLVK 5KZCB 2UVFA 5FAAA 3EDJA 3MOBH 2DTSA 4M1DH 3BDBA 1IMHC 3TIEB 3VXUE 3O3EB 5EBWB 4MNQE 3BQUD 3Q48A 5KJRH 3VXNB 3FO0L 3Q3GA 4KJQC 2BDNH 3O6MH 3HE7D 1T66D 4KQ3H 4ZOBA 2WQ8A 4IOIA 5JXED 1NCAH 4QT5A 4MZ3A 3SDXA 3V5DA 4IEFB 4PJFF 2ZUYA 1I8KA 2QSCL 4XTRC 5FDWB 4PRAB 2FH6A 1FZJA 5C09E 3AS2A 4KRMB 3SEPA 4PUBL 1S3KH 3HI1B 2VDKH 1T6VN 3MRPA 4URTB 4XVTH 5DI8B 1MLBB 3SKJL 1AE6H 4R4FH 3MUJA 4PJIF 2CDGA 2R0LH 4I13B 4WW2F 5DVKA 2HFGH 1S7VA 2M2DA 2ZOLA 5FF6A 5EORL 1NFKA 4HEPG 1I3VA 1S9VA 4X7DC 3DURB 1LEKB 5ERWB 1D6VH 1OAKL 3VG9B 3O3BB 1Q0XH 4FQLH 4V1DE 1VEPA 5D8JH 3SDAA 3TO4A 5E8DH 3FB6A 3LAFA 5C71A 5FGCE 3SDAC 3TO4C 3IDMA 1IAOA 1YEFH 4WFHE 4TUKH 2Q3ZA 3L5HA 1AO7E 4YBHA 1PQZA 3OKDB 4PJBB 4P5MB 5IK3A 4AM0A 1FYTE 2E7LA 2OXHA 2E7LC 4LDLB 4G8GE 4EZMA 4JKMA 3LV3A 2ZKHH 5A3ID 3IXTA 4G8FA 2PYEE 5E8OA 2GJZA 3EOBB 3QQ9C 3U9PH 5FO8B 4JANA 3WNOA 5JUEH 2VISB 4Z95H 2NW3B 4KV5E 3NCFB 2RHEA 2NY3D 3IDXH 5DHXB 1MWAB 5EBLA 5K93A 1LEIA 2HRPH 1N4XL 1CDIA 1YEJL 4RISH 4ZUSB 3MLXH 1NMCC 2GK0B 4NFCA 5J12C 2HAZA 1KLUA 4S1RL 3ABZA 4WW1A 4UIKH 2R4RL 1B4RA 5IROA 5E2WH 1EIBA 3EAKA 3IJSB 5EA0H 5IROC 3SQOL 4WFEE 3O45A 1YJDC 3VWJD 5C07A 1XGRA 3AROA 4OFDA 3SGDI 4KHTL 5ALCH 2VLME 4NPYA 3GNMH 1ZLSH 2XNAA 3AUVA 3LHPL 3L6FA 3EYVA 2NY5C 3HCVA 3I50H 3JSSA 4M7JL 2ZJSH 1FL6B 4ONOA 3EO1B 2G9HB 1NKOA 4Q7DA 4HSQA 5EU5B 3UJJL 3MRJB 1X5LA 2APFA 3LOWA 2G2RB 4O02L 4GG8A 4NQCD 2GJ6B 4E41B 3QO1B 3U2SB 1CXLA 2NW2B 3TWCL 5DEFB 2F54D 1M05B 3GGWB 4JM2A 1CF8H 1I1YA 4JM2C 4NQSB 4PB9H 5FUCE 1MQKH 3KYMB 5DS8B 3B9VA 4LDOB 4PGEB 5MENA 4PP1C 4OLXH 2ARWA 3QULB 4GRWB 1EV2E 1URLA 4JDVA 3S37X 1HH9B 4MX7A 2IQAA 2VE6B 3MUZ1 3G08A 3MR9A 5I30H 4IRSA 3TP4A 2OK0H 4GMTH 2O5YL 5E4IA 3LD8B 5B38B 4IRSC 1LO2L 2Z31A 2J3SA 3QT2A 1F00I 3M1BA 4HWZA 5HGDB 4Q9RH 3C8HA 3QIWC 4HIHA 4R6UA 3INUH 4M6ML 4PB0H 4HUUB 4LF3A 4PJXA 4ERSL 4JFDE 4JO4H 4WUUD 3V7MA 4LLVB 1DQQB 5TE4L 4TQEH 5E6IB 4LVEA 5FYLL 3S88L 1ODAA 4GKSA 2V9QA 5GS1C 4OI8A 2EYTA 1XIWD 3O9WA 2YA0A 1M4KA 3KJ6H 1M71B 3O9WC 3IVKA 4NC2B 3IAGC 1IT9H 1ZHLA 2B4CC 3ARBD 3VI3E 5KN5A 3QEHA 4HFUL 1SVCP 5LKNA 4YDVB 1UWXK 2X1PA 4L4TA 1JRHI 4G6AC 3VXRA 1DP0A 1N5YH 3RZCA 5EC1A 2DLFL 5GRVK 2ADIA 3DRQA 4L3ED 3LEVH 3RZCC 5GGUA 3FL7A 1QFUH 2IC2A 1E4XL 4PJ7F 3CXDL 2I9TB 4LKXA 3PWNB 4LIQH 3ULSB 5JDSB 3IDJA 4OLYL 2HKFH 1DSFH 1KPUB 4J4PC 4KZDH 1MUJB 5FV1L 4Z5RB 4G6KL 5A43C 4EI6B 3F58L 1WF5A 3GMQB 3O8XD 2OP4L 2EYSA 3DTXA 3EFFB 2VZ1A 4RAHA 5JQ6L 2WBJB 5KSBE 1QFWI 2ILLA 2R56H 4X6DB 3GSWB 1EFXB 3V0VB 4QRSB 5FYKD 4MXQD 2YXFA 3HR5A 2YRZA 2E6PA 1I1CA 4FNLH 4LLQA 4XNMA 4E0RA 2X70B 3EYSH 3L3JB 5DJ0B 1QSVA 4PJDE 4NJAL 4TYUA 4G80B 4U6XB 4BH8A 5F89B 1MFDL 3QUZB 2DJSA 3ZE2E 2W65A 1DDHB 4PJEE 4FG6C 4JPVH 1Y0LB 1EAPA 4YBLB 1NSNH 3BWAA 5D1QB 2YPLE 1L0YA 1FVCB 4LIQE 2XFXB 2DQHH 5HHNB 5DD0L 3OB0K 2XRAH 1ORSB 4LAQL 2VIRA 2OX5A 4YGAB 4GW1B 3JV5A 3LIZL 3VH8G 4S1SH 4U6TA 2HWZL 1MNUH 4WW2B 4AJ0A 5BRZB 1MI5E 2B0SL 5EDXA 5ICZB 3RQ3A 1YECL 2BHUA 4UIMA 2CK2A 5I1LA 3N85H 3BJ91 3GSUB 2YMXH 4OD1L 5E4EC 4AY0A 2BRRL 3MLYH 2D31B 4UZGA 3LKQB 3H3BC 1MLCB 5IWLA 2DM2A 3HZYB 3ALPA 2MOVA 1UZ6F 5JTWA 3O4LE 5IWLC 3O2VL 2OR7A 5IMKA 4NCC2 3BPCB 3V7AE 1GOGA 3JWOC 3IDIA 5C0BE 1E28B 4QTIH 1S7XA 1Z6JT 4KGLA 4ZS7H 5L2KB 1D5IH 2XTJE 2UZIL 4QOKE 2IBZX 3QG7L 3D87B 1T22A 3UXFA 2DL2A 2NX5A 2H1PH 4D0BB 4I0PB 1A9EA 4FTVB 3AREC 4JVUA 3VXMD 5C2BL 3P30L 1KELH 1QHOA 4PGBA 1U58B 2NYYC 1G9NH 3CLEH 1QA9A 5DK0B 4HJ0D 4KRPB 1NAMB 1WBXB 1T89C 4R8WH 4LKCB 3SDDA 1IRAY 3ZLQC 1F6AA 1KC5L 4L4VD 3SDDC 2XKUA 4UMGA 5LGJB 4XPHL 1FDLL 4ETYA 1KT2B 4OZFB 3N0PB 2A77H 3EJYD 4LU5L 5EBMA 4YHLL 3MXWH 3MRRA 2WINB 3K2MC 3L5WA 2GT9A 1UB6B 2Y07L 4HX1B 4O58L 4HWNA 4JFEB 2AJZB 1SJEA 4X6EB 1F8TH 4NUJB 4XGZB 1O0VA 1Q0YH 4JGUA 4EUPH 5I8OL 1NCDH 3NIFF 4AT6A 2DWEB 5DQDH 1J1XH 2D0FA 4QCIA 2OSLA 1NDMA 2E8YA 4EI5D 1X5YA 5D1XD 3QWRD 4EEEA 3HN3A 3KPOA 5DFTA 5DC0A 4W6YB 3EDEA 3RY4A 4KK8C 3EIFA 3RX5A 3H9SA 1LHZA 5D96C 2GSIA 2A2QT 5MERB 1R5WA 2F53B 1YPZE 1MFCL 2IH1A 2X4OA 4P3WA 4FN0A 4YXKL 3LVEA 2PTTA 3ZDYE 3MPCA 4O4YH 5E03A 1HWHB 3T1WA 2AKRA 4XNQA 4UUJA 1BD2E 3KPSD 5D1ZD 3BDXA 5IR1A 2EXWC 3C8KA 2ZCKH 1JYXA 1YDPA 4K8RL 2QJDA 3RVXD 7FABL 2GITB 1O5DT 2IFFH 5DYOA 1TNMA 4D8PB 5HYSB 1KCLA 2XWJB 4F37K 43CAA 1JRHH 2IAMB 4J3SA 1YN6B 2IALA 1IEHA 3GM0A 4Y4FA 5IHBA 5I9QC 4R0LA 4JJ5A 4OKVB 4RNRB 4U6YB 5L9DL 5F6HI 4R0LC 3RDTA 3NABL 1IEBA 3D25B 3RDTC 1WWCA 1EEZB 5JPNB 4PD4K 1OB1A 2J6EH 4LSSL 4J3VA 2X89D 3GIVA 3PDGA 3U4EA 4Z7VE 1NFIA 2CKBL 3ULUD 3UYRH 4X5WA 1G7MB 3GHEH 2IG2L 4DFIA 5KBNC 1QBLH 2BFVH 4GJTB 4KKCC 1P4IH 2R0KL 1T4KB 2XQBL 3BW9B 4G6ML 1HI6B 4JFHD 5MEOB 1A7QH 3DI2B 2QHRH 5E00A 1AFVH 3P40A 3JV6A 6FABL 1U8JA 4BZ2H 5IB5A 1MCNA 2Z8RA 1TTFA 5T1DL 3REVB 2WWMD 1NUGA 1QR4A 1BJ1J 5B3JE 1JZ2A 1MHEA 3FB8B 5EIIA 3FFDA 4FXKA 5L2JB 4KUCD 4CVZA 5DFWH 5F96L 3WLWD 4JLRB 1CFQA 2BC4A 2AQ2A 4PRHD 4M8VA 1KPVB 4WWID 2Y25A 1FSKC 1MFEL 1NFDA 3NGBB 3O11B 4H1LG 1R3KB 3T3MF 4JG1H 3D3VD 2YKLH 1UM4H 1MH5B 1UKSA 1NAKH 1OGAB 2ZSVB 1IFHH 5JIHA 2GHWB 4YHIB 2OM5A 3FQWB 2X4SA 4Y5VA 1H3XA 5D7IA 1NC4B 4MSWB 4Y5VC 2HVJB 1EAJA 1MCSA 5ID1B 3X14B 1KTLB 2IJ0C 5SWSB 1A7RL 2YPLD 2FYYA 1GCFA 5HGAB 3IU3A 3O6LL 4XCCH 5DLML 3P3YA 1T2QH 2HVKA 2K9UA 4GAJH 1I7ZB 3AAZB 4HJGB 4WHTA 4DEPB 1F4AA 1B0RB 2MJWA 4RGMB 2H2PC 1F58L 5HHOE 2GAZB 2BK8A 1C16A 5KZCD 2D7NA 5DQJB 3CSYB 3I6GA 3QNZB 4QXTA 5CUSL 2A1WH 4R97C 4M9PA 3PWPB 1NUNB 1QLRB 4P3CH 1GGCL 4S2SB 2MMXA 4XCNA 1QPPA 1KEMH 1EHAA 1OL0A 1MY7A 3QJHA 3PV6B 3DLQR 3V8OA 1ZS8B 4IS6B 3UP1A 1A2YB 4Q2ZA 5IHZA 4OUUA 3B9KA 1A6VH 5ELIA 3MJ8B 5T3XL 1S7SA 1N7ML 3VWKB 1QFWL 1NCCH 3VCLB 1NJ9B 3QCUL 4OLUL 4BSJA 4QOKD 3QYCA 4JR9L 2DJUA 5TQ2H 4QRRE 4KC3B 4CN6A 3RWIB 1VFBA 4MS8C 5CD3A 3KPRB 1OT1A 3LKOB 3NZ8A 4OQTA 5F3HB 1U8OB 1C1EL 4XPGH 2GSGA 1FNAA 2CXGA 2CIIA 3U0WL 4YHYB 4OCYH 3UBXB 5CJBA 5DWUL 1FO0B 2P7TA 3QDGA 4PJFE 4D3CL 4KKBD 1QSFB 5CCKL 5DT1H 2C3VB 3P4NA 2D7OA 3DO7B 4DGIH 3DSNA 2G5BA 1KCRL 4JZJA 5TDPA 3Q6GH 1UH4A 4HEME 5C0RH 4JZJC 4NNXB 2ENYA 3SO5A 2NXYD 2A73A 1VCAA 2CMRH 4PJIE 4Z9KB 4MVBD 4HG4J 2NY0D 1MF2H 1U8LA 4MQ7B 4NO2A 1A6AA 3ARFA 3QDJB 1F4HA 3DV6A 1YEHH 4HV8A 1Q8MA 3IYLW 2AI0L 4L8CA 1F3DH 2X1QA 3ROLA 5J11B 5FHAL 1RHFA 4FQ2H 2LTQB 2PTUA 4G9DB 3KG5A 3V79C 3MLUH 2LE9A 1D5ZA 1JE6A 4WWKC 3MLSL 5I76B 2IMMA 4U6VH 2J8UB 4JRYE 4XC3L 5A2KH 5INCB 3SOBL 4PP2B 3EGSB 3OJDA 2W0LA 5JHDB 4KXZH 1BD2D 4KKAC 4YAQB 5L7XH 3R0NA 1L6ZA 1U3JA 2VXQH 3QUMB 1RVFH 1NGPL 3I6KA 4QXUL 4G9FB 4M62H 3EJJX 4L29B 5I19H 4JFQB 1RZJH 2P8PB 3FQNA 1J7VR 1U2CA 5EN2B 3VH8A 3O3AB 3IDNA 2NQCA 1NBQA 1P7QD 4M1CC 5IQ7L 3RWCB 1E0OB 3DHMA 3QISA 4N5EC 2EO1A 4GW4B 5F72S 4EBQL 3GSNA 1ZVSB 4LPWA 5L8KB 5DO2C 1AXTL 3MLWH 1V7NL 4XPAH 3W5NA 1CLYH 1YYML 3PP4H 3F7VA 2PETA 1M7DB 4W4OA 4P2CG 1UJ3A 5I1HL 5HYIA 4JN1L 4WRLA 4W4OC 3ULVD 2A6KA 2V17L 3FOLB 5E9DE 1II4E 4E41D 1OLZA 1VFOA 3RVVC 2XKNB 4ELKB 3NTCH 3O2WL 1QVOA 4FFZL 2EDXA 5F1IB 5JA8B 1RY7B 3KPPB 2HTLD 2JJUA 4IMLB 3V6FA 3R06A 2CUIA 3NFSL 4X7SL 5GSRB 3I02B 5DFVC 4YE4H 1ZV5A 4CVWA 1G9EA 4H25B 4H5SA 4UNUA 4ODHH 5HYJA 4Y2DB 4TNVK 4Y8AA 5TE7H 5DMIL 3WCYA 1R0AH 3FQXB 1ZGLP 4EOWL 3SDCD 4WI9A 1HHGB 3O2DH 1ZA6A 1BFSA 4FQHA 1N59A 3L1OL 3K4AA 1S8DB 4KY1L 4TOYL 4HWBH 4KKNA 5CZVL 3J8F7 1YNTA 4Q6IB 3IXAB 1EHLH 1ED3B 5HVHC 4LSRL 4MHHI 3QQ3A 1AD9B 2AABL 4MNQB 4X7TA 4U1SB 1UM5H 4PRID 2NNAB 1AD0B 4PJHF 4JO3H 1FLTX 4U7SA 5DD3H 2HJKB 5JORB 1J8HE 2H2SC 1RZKH 4OBRA 1ND0B 4PRNB 3MFFB 5I1DB 3ARDA 5L8JB 3HC3H 4GBXA 1T7XA 4RX4A 5H35B 1EEYB 3ARDC 3QUKA 4WU7B 4N0UE 4YR6B 4NC0B 5AZEL 1QYGL 5KG9A 1T20B 4DQOH 1R3LA 4RMWA 4JDTL 2ORBL 3TT1H 3D0LA 5IVXA 1BZ9B 3MRLA 3MUGA 4P5TB 4WENB 4HZAA 1H3VA 5HHOD 2YD9A 1UVQB 4ODVL 3W9EB 4CVUA 2FIKA 2WIMA 3UPAA 2Q8BL 5IHLB 1LK3L 3OR7B 4NN5C 4LVOB 3T0EE 4DK3A 4ODSL 3QRGH 3K81A 4J8RB 4ZG1A 5F9JB 4K55A 3PGFL 2ITDA 4XVSL 5EOTA 2O61B 2BOCB 5IQ9B 3IS1X 1QRNE 5C0AE 1WZ1H 2IPUK 1PG7H 1JF6A 4PLOB 1DEEB 4V1DB 2EDQA 5CJ8A 4AQ1B 5FUOL 3TCXA 4WU5A 4YO0B 2C1OB 1QEWB 2BSED 2D0GA 4GUPA 4AEIL 4K3GA 1Y6KR 4Y2OA 3MREA 2XN9E 1CQKA 5E2UH 4P2RA 3B9DA 3QO0B 2UWEB 4K23H 3QDME 1JGDB 1BQHB 2GUOA 4KTEH 4YIQB 1UKQA 4XP6L 4OGXH 5EOCH 5HTSA 5ACMA 1ZWIB 2OS7A 3S96B 3RNQB 2JKXA 1ZLUH 5KSUA 1WFNA 3VFRB 4Z7WE 2CQVA 3RAJH 1WT5A 1GC1L 4DFHA 3QUZD 1WT5C 2PYEB 4YPGB 1IC7L 1UT9A 4FXGA 5J6GB 1RK0B 2EXYC 4ELMA 1L9NA 3M8OL 5D7JD 5HSFA 2VUOA 1QLFB 3QSKB 3OKMA 1U93A 3S34H 2F58H 4U1NA 1GPOL 4K7PL 1NLDH 4OZIF 2BNRA 4X9BA 3PWLB 1XGYH 3NACL 2HT4D 3VFOB 3V4UL 2E27H 4ODWA 1EA9C 1OAUL 4UTBH 2JELL 1TCRA 1U41A 3QWOA 3UTTA 1U3HB 1I3RB 1TNNA 1VACB 3S37L 1XMWA 3RBGA 4Y4HD 2GFBB 4H1LA 3TYFA 3QEUA 1FVEB 5DRXA 1TIUA 1DBKL 4JFFE 4KJYA 4N90E 4JRYD 5H37G 2IBZY 3PG2A 2DI9A 1RUPH 3EO0B 3PABA 1N8ZB 1DN0A 1D5BA 5SWZE 3D6GA 2LVCA 5I2IB 1G6VK 2MFNA 3CFEB 4X6CA 1P84K 2FGZA 4G6FD 1QO3A 3FO2A 1N5AA 1FNLA 1KB9J 4Y19A 1T1WA 4XNZC 3FOMA 1FN4B 3L7EB 2HA1A 4NRZB 3SKOB 5DJXA 1Q1JL 5C0JB 1CL7L 4QEGA 3RIAK 4F7PA 1Q72H 4KRPD 3VA2C 4ZMAT 4DJMA 4EDWL 2LFGA 3V4PL 1Q9OA 2I9LA 5TGBB 3V5KB 1JMXA 1QBMH 4TTDC 4NRYA 3CZJA 4P2OD 3ARGB 3P0YL 3BUTA 4HD9A 4A6YH 2ITCA 2V5MA 3FQRA 4NQDE 5JW4Q 3SGJA 1G6RB 1V8HA 3SGJC 4JFED 3MGTA 2P42B 3UJTL 1UH3A 2CJUL 3WJJA 3B9AA 2J4WH 3M17B 3N9GH 1K8DB 2VSCA 1T0MA 3WJJC 2A0LD 1JWSB 2AJVL 3FONB 2DLTA 2NCMA 3S5LB 2Y06L 5HD8C 4HZLA 4HF5H 4X80L 4CUCA 2AJUH 1FORH 4DOHB 2AW2A 4OF3A 2NY6B 3U1SL 4X5XB 4RGNE 2Z93A 4DGYH 4Q9QL 4NDMB 4X98B 5DHVA 3EFDH 3LN9A 1S78D 3K8LA 1FZOB 2EO9A 1E27A 4FQJH 5FKAB 5I8KL 2HT2C 1A47A 1ZT1A 2OI9C 4POZD 3OR6B 3BUYA 1T5XA 4I9WE 1T1YA 2R1WA 5JW3H 4Y1AA 5FB8B 3SDXF 2QSCH 1UXSA 1HHKA 4HK3J 2EC9U 1A1OB 4AMKL 5ADOL 5C9KA 4P23B 25C8L 2KBGA 4M6AA 2DQCL 5I0DA 1JGEA 1KCSH 2ZUWA 5I66A 2H3NA 1BMGA 1BVKA 1N26A 1T04B 3MV8A 4XP4H 1XR8B 2CRYA 3IFNH 2L7JA 3QIBD 5CILH 3BZEA 1J8HD 5J1SC 1RZGA 5KSBB 3IDGA 1CICA 3GSXB 2IAMD 2XQYK 1CICC 4X8JA 3GMNA 2DTML 2BVOB 4CNIB 5MEQB 1T03L 3D2UA 3MLTB 1XF5A 2JJWA 3JUYA 1BWWA 3VU2A 4CBPA 5A3IC 4C56B 3UDWA 4DCQA 3SCMA 4B41A 5IUSA 3UDWC 3SCMC 1YEDA 5IMLA 4M5ZH 4PJDB 3HZVA 4MWFB 2NY3C 4LASH 5I1CL 1B0GB 2JB5L 4PBXA 4PJEB 3X13B 3V0WH 4QRPB 3BT2L 3T65A 4P59L 5EPMA 4XBEL 2VDNL 2AJ3A 2ARJB 3QZWA 4GAYA 3BEVA 4XMPL 2WMPA 2YSSA 4UQ3A 1ES0A 4ZTPH 4G5ZL 1VADB 5E8NB 3PIQB 3GSQA 1BGXL 2FB4H 5AAWA 3MV7E 5CSBA 3DX8A 2Q7YB 3WN5B 2DICA 1F97A 4G8IB 3HNTL 3K8MA 3LN4B 4I4WA 3B8SA 3CFBB 4HUNB 5D7LA 1P2CB 5CIPH 1VPOL 4JO2H 5E7BA 2VXSL 3CUPA 1FL5B 4F7CA 3QXDB 2XN9D 5FEBA 5F7MC 1RZIA 3MFGB 2OR9L 5ITBL 3EOTL 3QEQE 4JY6B 2VWEE 1QSEA 5B3NA 1OGAD 3VFNB 3MUY1 3O4LB 1MPAL 4K9EH 5IW6B 4NWUL 3QB7C 4NC1E 1IILE 3TN0A 5IB2B 4TULH 4R4BA 1NC4D 3TN0C 1CFSA 5C0BB 4DTGL 2R2EA 4HC1H 2R4RH 5SWSD 1IGTB 5JHLL 3T2PA 1TZGL 1HHHB 3SQOH 1ZK9A 2BY2A 5IMMB 1AC6A 3U0PA 2F5AL 1PVHA 3NA9L 4NWTH 3JXAA 1OWRM 4JFPB 1UXWB 1FBIH 3VD5A 1FGNL 3P2TA 1HHJA 3FN3A 1MJUH 3E6HB 5DGQA 3VXTA 1UACH 2W1NA 4NZRL 1IE5A 1T0PB 5IKCB 3MV11 1RUMH 4NKMB 4AG4L 3FB5B 2V2TB 1C7SA 1R24A 1K6QL 3ZYIA 3KXFE 1NCNA 2X4UB 1OM3L 4NM8H 3MJ9L 3QFDA 3DYPA 4JM2F 4CVXB 1NC2D 4OQTL 3ESUF 4OZIB 1JPST 1RSFA 3GKWH 2AV1A 1SJXA 2VAAB 5E2VH 3DETD 3RUGE 4R3SB 2JCCB 5CMAA 4EQ3A 2ZUTA 1LP9E 3CVHH 1P7HL 3STZB 4JHBA 5C0FA 1K4DA 2IEPA 4QHUB 2DQEL 1MELA 3AY4A 3AY4C 4PJXF 3AB0C 1UEYA 1ZT7A 3TBTA 1KJ3L 4OGYH 3E8UH 4QY8B 1CGTA 3K0WA 3UTPE 3D5OF 1ONQA 4HIIB 1WCBB 1FP5A 2X4NB 1LE5A 1YPZB 1IGIH 5IHUL 2P45B 3O8XA 3NOIA 5DK3A 1CG9A 4L8SC 4E5XA 3O8XC 1K9TA 2X44D 1MRCH 4HK0A 1CLOH 2R29H 3MTRA 1W0VB 5E8EB 2YBRA 4EN3D 4M61B 4GFTB 1JNNH 1TVBB 5I74B 1CD0A 3NN8B 1ZGLB 5HHQA 1A3LL 1RAMA 1MHCA 1YEEL 4LBEA 1WGOA 2JF1A 4QYOB 2F74B 3GJEB 5LVEA 2OTUB 3WNLA 1PW3A 5AYUH 5FGBA 1EEQA 5D2NE 5FGBC 3GSVA 2AK1L 1EGJH 5ANMA 3GMPA 5INDA 3QPXL 4YXLH 2A74B 4HH9A 1HH6A 3D39E 1SMOA 4WEMB 3RGVA 3WFEH 3RGVC 3VD7A 1CE6B 3HNSH 3GSOA 5FHBL 2VH5L 5AUMA 1KB5H 1Z5LA 5DMKB 5HJ3B 4LHUB 2OQJB 4N8CL 4M7KH 2YPVH 4UDTB 4OZ4A 3UC0L 5LXGL 4YUEL 3KLSA 4LLMA 3TVMD 5JZ7C 1DUYA 5GRZA 5D70L 3X3FH 5KVGL 4LFHD 2X4PA 2HKHL 1ZEAL 4DKEL 1FNGB 1UKTA 4NO0A 5DVOA 1KYOK 3SKUD 1KJ2A 4ZFOB 5ADPL 2YD5A 2A6DB 1C12A 3HS0A 1AR2A 1NGZB 2JK5A 1FZMB 4Z7UE 3HUJE 1MRDH 1RUAL 2QQLH 2VLRD 3PL6B 4OFIA 1NCBH 1FGVH 4IJ3B 2EYRA 4PJGA 4AENA 2HWZH 2ERJC 2ZUSA 3RVTD 1JZ3A 5FF6B 1AKJD 4PPTA 5DUBA 4HPYL 1GZPA 4KAQH 2YRPA 4KDTA 4QXGL 4KDTC 4PJ8A 1MHPH 1NCWL 1QHPA 2BRRH 3MV7D 4MA1B 3PNWA 2KL6A 4PJ8C 3N1FC 5FOBA 1PX4A 5KSAA 4KI5F 1D5XB 5EU7C 5C8JA 5KSAC 4RMVA 2OTWB 2FX8L 1IGYB 3FB6B 4U0RC 4JREC 2M26A 2QBWA 4JGJA 5EZIL 5JO5A 1LE9A 1ZLWH 4YWGL 3EJYC 3NFNA 4FZEH 1KTKE 2RCSH 1XZ0B 3FQTB 2UZIH 5HDOA 4BELD 4U2YA 3TBSB 1K4CB 3GDBA 3MNVB 4XBPB 3WKMH 2FX9L 1KENH 3EYOA 1JJUA 4M4RA 3MO1A 1YEGH 4WO4A 3DIFA 3MRKB 4KJWC 4RFEB 4WO4C 3ELAT 1M6OB 3RY6A 2PO6D 3RY6C 3AXLB 1J0YA 4UNVA 4OD2A 3NCBB 1LMKA 1S7UB 3CMOH 1ZHBB 4GOSA 3ZYJA 1I1AB 2E9IA 3P4MB 4PFEA 3KPLB 4QRRB 1BJMA 2PCPA 4K2UL 3CAFA 5C0DB 1W72A 4HBQA 3F7QA 3IRZA 3HNVL 1JWMA 4KQ4L 4UAOC 1CLZL 4JVPA 5F1OB 4FQQB 4M8QA 4PJ9A 2Y5TA 4PV8B 4YHNA 3NPZB 4LSPH 2Y07H 4ISVB 4PJ9C 5CAYB 5J13B 3KPSA 4KK5D 4EXPX 3MGAA 5C0CB 3JWDC 5IVNA 1FPTH 3KXFD 4W70A 1OY3B 1DLFL 4PGDB 1LO5B 1XGRB 3RVXC 4JQIH 2FD6H 3B3IB 3TA3A 8FABA 2NY7L 3TA3C 1I9EA 3OAYK 2P8LA 5BVJA 3PP3K 5GSVA 4KH2A 4FZ8H 3OHXB 5J89A 3UAJD 3DMMA 4UT6L 2E7HA 5GGTL 4KMTH 3ZKND 5L88L 3OKYA 3DSFL 1SY6A 1UG9A 4HKZB 3CK0H 2FBJH 2F8XC 1KCKA 2VB5A 5FOJA 3NMEA 3UX9B 5IB4B 3BZDA 1CDJA 35C8L 4WI4A 3RL2B 3CFCL 1J11A 4Y5XA 1BLNB 1DFBL 3CNKA 2PXYA 4XNXL 2PXYC 3ZKQD 2VLJE 2WWMC 3OKEB 3HC4H 1N64H 4XP1L 4PLNC 4O2FA 3MNWA 5I1JH 1AQKH 3X3GL 3AU1A 2ESVA 1OCWL 1HKFA 4HKJA 3M1BB 4KHXH 4OZHA 1UWEH 5SV4A 3ORJA 5DJ6A 1VA9A 1MCWM 3E3QC 2R15A 4HKXB 1AGBA 4YK4B 5EZJB 4LSSH 1NDGA 3THML 3A6CH 3KS0H 4OAWB 1WC7B 5DURD 4GH7B 4G42B 1FV1B 4YGVB 5BOZG 1T7VA 1BEYL 3LDBC 4G6MH 4HUKB 1JI2A 5MEPB 3U7WL 4MD5A 1I9RL 5ENWA 1LDPH 1X4YA 5HGHB 4TVPH 3QUXA 2EDOA 5C1MB 2OZ4A 3QUXC 4MD0A 4PRBB 3FAWA 5J3HD 1WIUA 3CDGA 5FA3B 2DQFA 2PTVA 4QXWA 5BS0E 4JZNA 1IAMA 1VSCA 4RFNC 1MHHB 4G43B 4DZBA 4LRIA 4D94A 5L6YL 1I3UA 4LRIC 5E9DB 5BZDA 4EQ2A 5E7FA 3W0WD 4HDIA 3DX7B 1VDGA 1PYWA 1ZTXH 1MFEH 3L3KB 4O2CB 5D93C 4HS3A 2C3XA 4MJIB 2X4QA 1HDMB 3HHRB 4HJJL 4NHUA 1F90H 1U6AH 4B50A 4OZFG 1RI8A 3BPOB 4HXAL 1JNHB 5KVFH 1WITA 1CR9L 3C2AH 5D7IF 4KK6D 2Q8AL 2QTEA 3TIEA 3O3EA 5EBWA 5I71B 4GG6E 3QH3B 3TH4T 4UB0H 4XPFH 1AP2B 3VG0H 3SJVD 3L3GB 3UJIL 4TVPE 5IFJB 1BIIA 5FDWA 4PRAA 3PHOB 2VZOA 1CXIA 5BXFB 3DPBA 4Y88A 2V7NB 4JO1L 3QWQB 2B5IB 2YHGA 3HI1A 5BOPA 5F9AC 5DI8A 1G7LB 1MLBA 4GRLB 1KCUL 5CUSH 3WIFB 1UH2A 5TE6L 1IAIH 3GMLA 4MXWL 2BX5A 4NZTL 5JLZB 4PYHA 3BEWB 5F1NB 3ZZ1A 4GQPH 4CMHB 4KKBC 5LJYH 2UV3A 1TETH 3DURA 5SX4I 1LEKA 5ERWA 4YHML 4MQXD 3O3BA 3BDYL 3VG9C 4Z8FL 3WLBB 4NQEE 5HYSG 4GSDH 1TZIB 4NUGH 3QXAB 3T0EB 3KPNB 4JZOA 1ZANH 4ZSOE 2FHFA 1IBGH 1P4LB 1MFAL 1QRNB 5C0AB 4HAGA 3OKDA 4PJBA 4DVBB 4P5MA 2VAJA 4OF0A 4HULB 1WEJH 1LO3L 2EDTA 3VD4A 2B39A 2MPAH 3BXNB 1TLKA 1KXVC 3C60D 4XBGB 4OGAD 1S7XB 5BVPH 1G7IA 1DEDA 2F8VA 4O5LH 5F7KC 4WCYH 5FGSA 1U0QA 4GRMB 4YX2L 4A2MA 5EU6B 3QDMB 1C7TA 5HYQB 3EOBA 2YD4A 5FO8A 1PG7W 2VISA 1X5XA 2NW3A 1U95B 2HT3D 3HRZB 5DQ9B 3MRDB 1MWAA 5AWNH 4Z7WB 1KNOB 5EZLB 3BD4A 3WJLC 1N6UA 4ZUSA 5F8RC 1W8NA 2GK0A 4XH2B 2WZPD 1AJ7L 1Z3GL 4KROD 3MRNB 4NN7B 2APBA 5LWYL 3IJSA 4C4KT 1PLGL 3K1KC 1JZ6A 3MGOB 5DRNB 3MODL 3MRRB 1GGIH 4PIRF 2O5XH 1XF2B 2GT9B 1DCLA 3MLSH 1XCTB 4M93B 4NCC1 3OL2A 3UZQA 3NAAL 2MTPA 1R5IB 2DQGH 4LLDB 4Y16B 4MQTB 4YEFA 1YJDH 3GK8L 5HY9B 3DGCR 3WFCL 3S35X 1FL6A 1Q9LA 1WQVT 3EO1A 5AG9A 2G9HA 4KU1A 3P77B 5F7LB 1EPFA 5EU5A 3MRJA 1C5BL 2CSPA 2NY5H 5F7NC 2G2RA 3ULVC 2GJ6A 1OAYL 3QO1A 3BMWA 2NW2A 4R26L 5DEFA 3L3DB 4XVJH 1M05A 3WIHL 4POUB 4LCWD 4QXUH 5TFSH 4BA8A 3MCKB 4JFFB 4NQSA 3RHWK 4YDJB 3D9AH 5DS8A 3KYMA 4PGEA 3ZE0F 4AL8L 4JEGB 3RA7H 3QULA 5K9JH 2BCKB 3BKJL 4LSTH 1HH9A 2AEIT 2VE6A 3TNNB 2ZSWB 5B38A 4UUJB 3LD8C 2W9EL 1AXTH 2BHYA 4Q74A 5DJDA 1CFBA 5HGDA 1MCLA 3GJFK 5GRYA 4U1JB 3LS5L 1LNUB 5C6WH 4HUUA 2MQ3A 3QDAA 4HWEL 4HIEA 4WIQA 2C5DC 3BRGC 4LLVA 1DQQA 2QR0A 5GJSL 1U8IB 43CAB 4OCRH 3T0DA 3A6BH 3MV9B 1BM3L 5E6IA 4BQBA 5C07E 3HC0A 1UM6L 4YDKH 3VW3H 1B2WL 2UYLB 1KPRB 4UQ2A 4WVRA 5MP6L 4NQUA 4K8RD 3G6DL 4OCWL 3T0WA 1M71A 2E7BA 1SYSB 3BPNB 4FP8H 1EHXA 5DZLA 4YDVA 4OB5H 3OJMB 3UBXG 1P1ZB 4RAUB 4U1MB 3QAZB 4YDIH 2B4CH 4HMCA 3MJ6A 4JVWA 4R7NB 1DE4B 5ESQB 2FLBT 5MENE 2I9TA 3L5XH 5C0EB 2VC2H 1F3JB 5B22A 3ULSA 4U2ZA 5JDSA 2ADFH 3C8DA 2VLKE 1KPUA 4FFYL 4K3DH 1MUJA 4Z5RA 4YLQT 1DJSA 4EI6A 3GMQA 4S1QL 4LRNL 1ITBB 3EFFA 1IGCL 4RWYL 2WBJA 4NFBA 5D7SH 3NIDF 1ZVYA 3EW3B 1NLBL 2WBJC 1QYGH 2WUBL 4TVPD 1MAMH 4X6DA 5HGGS 1EFXA 3V0VA 5IBTL 2VZTA 1XGUB 1YNLL 4PJXE 4CADB 2BSSB 4QRSA 3H6JA 4EKXA 5IVXF 4JGMA 3ALWA 2AXGB 5F1KC 2X70A 3L3JA 5DJ0A 4J3XA 4RFOH 4G80A 5SX4H 1PAMA 4U6XA 3H7LA 4ODSH 4BFGA 4FA8A 2CR6A 5F89A 3I2CL 3QUZA 2Z35B 5GGRY 1DDHA 3WEXA 2BY1A 3QUZC 1Y0LA 2DAVA 1SQ2N 4F33B 5D1QA 2J8OA 4MAYD 4CDGC 4YBLC 1FVCA 2XFXA 5D1QC 3VXRE 1CD8A 4N9GB 5FUOH 5HHNA 5I18H 4OCSH 1NBZA 4LGSB 1EO8L 1ORSA 2NMSA 1S7RB 3C5JA 3LCYA 1OHQA 4KI1A 1HXYB 5CEZH 4GW1A 4JHWL 3BP5B 5BRZA 5C7XL 5IT2H 1CZ8L 2BNQE 5ICZA 4WW2C 2VABB 3BSZH 2HT4C 3GSUA 3U4BL 2P47B 3AFLA 5HYFA 4YQXL 4DVRL 3LKQA 3VFVB 1IC5H 1V3KA 1MLCA 3HZYA 1WSST 4Y4HC 1JHLH 2R8SL 1HYRC 4JHAL 5F6IB 3HE6B 3B9KB 3BPCA 4L9LB 5D5MB 4F7MB 2V2XB 3QEQB 1E28A 3GIZH 4ELMF 1ZSDB 3UTSB 2WBKA 5L2KA 2YPKB 4P9HC 2VDRL 1S5IL 5CWSB 3TNMB 1D3CA 5CD3B 2ZG2A 2WK2A 1KGCE 4K7PH 3JWOH 3V9FA 3H42H 3SHSA 1MFBH 4FXLA 5FCUH 4D9LH 1DVFB 4U1KB 1NMBL 1OQXA 1J87A 3V4UH 4D0BA 1HHIB 4I0PA 5CEZE 4FTVA 3C5ZB 5LAXA 4I0PC 3GRWA 2XZCL 3EJZC 1U58A 3REWA 2DQJH 5DK0A 2AEPL 4H8WC 1NAMA 1WBXA 4OZGA 4U49A 4KRPC 4OV5B 4LKCA 1EO5A 1F4XL 3L3HB 3GJFB 3QHFH 1JWUB 4WTZA 5HDQL 5LGJA 4QHMB 1KT2A 1RUKL 4OZFA 5CIPB 1DBKH 3B5HA 4NGHH 3KDMB 2WINA 3L5JA 4I48A 3VXSB 2BJML 4ZXBB 1UB6A 4MB3A 5TJWK 2ZPKL 3WBDA 3VFSB 1FQ9C 4HX1A 4G3YL 3RFZC 1KJMB 3OQ3B 4JFEA 2PR4H 4EDXB 4LCIH 2AJZA 3TCLB 2PKDA 1KN4L 4X6EA 4QHKI 4NUJA 5FGRA 4XGZA 4X83A 4X6CF 3W9DB 2AJYH 1MSPA 3HG1E 2DWEA 4PR5B 3X11B 2KZ1B 3RUGB 3MA7B 5J1AB 1LP9B 5DSCA 4RMRA 5TF1H 3G5YB 4YFEA 5B4MD 2ZG1A 2YD6A 3CLFH 3MX0A 3V4PH 3KLAB 1FE8L 4ZFGH 2W0PA 1S78C 3LH2H 5E95B 5MERA 2F53A 3OJDB 1OAZL 3BAEH 3QI9B 1NL0H 1AHWB 1IC4H 1U8QB 2NX5E 3HMXA 5K33A 2DIAA 5E24E 4LSDA 5C08A 5C0CD 1ZT4B 1SY6L 1ZLWK 1BBDL 1EXUB 4JKWA 2GITA 4D8PA 1S9WB 2FEEI 2E9BA 3KYAA 2EIBA 2OLDA 1YN6A 2XIDA 3CSBA 3H3KA 4N0YH 2X4TB 2IAMC 2EDFA 5CEXA 4Q9QH 1ADQA 4JFYB 4OKVA 4RNRA 2YN3A 4U6YA 3ET9F 1JHKH 2ATPB 3D25A 3ARTA 3KYKH 1EEZA 2R4SH 4QHLB 3DUSB 2H8PB 4M1GL 4ETQB 4YBQD 4TSBL 5FUZL 3TGXA 1G7MA 1JTTA 1FJ1B 1I7RB 3FMGH 4JM2D 3VFGH 1T4KA 1OTTD 3BW9A 1HI6A 5MEOA 5E1HB 3BGMB 3M07A 1AIFB 2DQTH 3LZFH 1J0HA 4P3DB 1P7KB 1P4BH 3H9SE 2AXJA 2EE9A 3U36B 3FB8A 1BP3B 2HYMA 4Y4KB 1RQ5A 2O5ZL 4H5SB 1G7HB 5AD0B 3NCYP 5L2JA 1R3IH 1QOKA 2Z31D 3PGDB 3SGKA 5A40E 1NGQL 4RGOL 1T03H 2RFXB 4JLRA 3SGKC 2V7HB 5DMYA 2BVPB 5T5FH 1KPVA 4FQHB 1WAAE 2FGWH 2OZ4L 1BAFL 2VR5A 3O11A 1AI1H 4ONGL 1R3KA 5AZ2H 3NGBC 4YJZL 3BKYH 2H41A 4OCLC 4X7TB 1VERA 2Z8WC 5I8CA 1MH5A 2ZSVA 4EIGB 5I1CH 4QO1A 1LO4L 3MRCB 4OQ1A 4YHIA 3FQWA 3JTSB 1RMFL 3O9WD 2HVJA 1MIEH 3LEXB 4QGTA 4NOBA 5ID1A 3X14A 1KTLA 4G5ZH 4WGWB 2R1XB 5SWSA 3HUJB 1A6TB 5C0GA 4L4TD 5HGAA 4I0CC 3VXRD 1S9KC 3NCJL 2DIBA 5J6HB 3MCLH 3RZCD 2W9LA 5IVXB 3MRLB 3OXRB 3QUYB 4K94C 1CDCA 1I7ZA 3AAZA 4HJGA 3BYTA 1KB5B 2WBWB 4PJAE 1B0RA 2FIKB 4DEPC 1VGEL 2VR9A 3K4ZA 3FN0L 4MJID 5GRUH 4K3JH 4RGMC 5CFHA 2GAZA 5DQJA 3MXVL 2ITDB 1V7ML 3CSYA 3QNZA 1LGVA 2ATKB 3RJQB 1X4XA 4NWUH 2AERT 3PWPA 1QLRA 1J1OL 4S2SA 4I0KA 4PGCB 4M00A 4HUVB 4WDIB 4S10A 4DTGH 1RIVL 2DDQL 3MRQB 1E4JA 3PV6A 2EKJA 2W59A 4Z0XB 5IESL 4HIXL 3T0BA 1NFDE 1ZS8A 2CKNA 3S5LG 1A2YA 2OXGA 2QQNH 5KS9E 3DETC 3T4AB 4R7DB 2CO7B 1F2QA 3MJ8A 5CD5C 3MA9H 5A16B 1FL3B 3VWKA 1KGCD 3VCLA 1TJGL 1NJ9A 4F2MB 3VWKC 2KKQA 3RWEB 1RZ7H 3U0TB 1JV5B 3O81A 3CX5K 3ZKSD 1NQBA 5D7IE 1CDUA 3LRHA 4HW6A 3RWIA 5ISZE 2LQRA 4TUJB 4BQ9A 1NGWB 1A5FH 3KPRA 3IDUA 5GZOC 3LKOA 5F3HA 1U8OA 3G5ZB 5FK9B 2BXYA 1YMME 2DF3A 4OSUL 2NLJB 3F6LA 5BV7H 3UBXA 3MYJB 4NHCH 1FO0A 4L1HA 4NKOB 3UO1H 1IZKA 3FO1B 1QSFA 2IPUG 5TPWL 5HPMB 4OM1L 3DO7A 3RRQA 4NNXA 1GIGL 2VDPH 1X5GA 2HH0H 1T6WA 2ADGB 3D85B 3QNXA 4MQ7A 1AH1A 3R1GL 1NEZB 2CO6B 3QDJA 3ZKMD 4KI5D 1OOAA 4AQOA 5T1KB 4UILH 3NCYS 3NIGF 4I77L 4LQFL 2AJSL 4ACPA 1MWAL 4OCXH 4J6RL 1A6WL 4UV4L 1OP5K 5J11C 4G9DA 3VXQA 5I0ZA 2UY6A 2YWZA 3OPZH 2LTQC 5F7UA 1G7PB 1PSKL 3BE1H 4HCRA 4DAGL 1BJ1H 2HG5B 2J8UA 1SBSL 3ZTNL 3ILQC 5INCA 4DKFL 4XPBH 4PP2A 1L9MA 1N5AB 3LQZB 4BH7B 3EGSA 5T3ZL 5JHDA 4PRPE 4YAQA 2NYYD 1X5IA 3QUMA 3S98A 1C8PA 3HI6H 1YEEH 1H3UA 3Q0HA 4G9FA 3QP3A 4MAUL 4L29A 2R0ZL 3TLRA 4JFQA 3SDDD 5E2TH 2P8PA 4ZO7A 5A2JH 1EERB 3GMOB 5EN2A 1UCBL 3O3AA 5CP3H 1J0IA 4LSVH 5ITFB 1F42A 1J0ZA 1FHGA 2DMKA 3DVFA 3RWCA 3EYUL 3FT4B 4GW4A 2B1HH 3BIKB 2VQ1A 1ZVSA 3VFUA 4MD4B 5D6DA 5D6DC 2RBLA 5IBUB 1MJ7H 3B8YA 4TNWF 3PQYE 4G6JL 1M7DA 5FDYA 2OJZL 5B8CB 5TDNB 2FL5A 1N3NB 3FOLA 3UC0H 3GSNH 5HI4D 5KVGH 5D70H 4J2XA 1A14H 4QKXB 3ZE1F 1Z9SA 4ELKA 5BS0B 3NH7H 2F5BH 1QLEL 4JB9H 5F1IA 3KPPA 3QIUB 2DL9A 4UU9B 2ZG3A 2YR3A 4IMLA 1TDQA 4OJFH 2EDNA 4ZPVB 3I02A 4H25A 4Y2DA 4O00A 4OD3L 2EXWD 2YUXA 1UC6A 4Y2DC 3TV3H 3TEUA 3FQXA 1HINL 5JW5A 1HHGA 5GS2H 3ZE0E 1BREA 1S8DA 2GTWB 4I3SH 4PJGF 4Y89A 4PJCB 3I85A 4Z7QF 3WIIL 4Q6IA 5T5NF 3IXAA 1ED3A 4Q6IC 1AD9A 4MNQA 4LARL 4U1SA 5IM7B 2AJXL 2DKSA 2NNAA 5EO1B 3I75B 4Y4FD 1AD0A 1A3RL 5JORA 2HJKA 2DMBA 4LEXH 2FBOJ 4P46B 3RDTD 1MREL 1ND0A 4M3JA 4PRNA 3MFFA 3VRJB 2AK4B 1LO0H 5H35A 1EEYA 4WU7A 4YR6A 3BRDA 4OF8A 1T20A 4XWGH 5LBSL 4KKCD 3HI5H 1HZHL 3KYOB 1EK3A 4HFWB 1BZ9A 4P5TA 3GFUA 4I5BB 2BY3A 3QXUA 4OLVL 1UVQA 3G9AB 3W9EA 3K2UL 3ZSTA 4F58H 3OR7A 2Q7NA 5F7EH 1BX2B 3IFOB 4J8RA 5F9JA 1XGPB 1U9KA 4LVOC 5EC2B 2O61A 2BOCA 4Q0XL 3CFDB 2ENSA 1FFPB 1DEEA 4V1DA 2DD8L 5HYJE 2XQYG 4YO0A 2C1OA 1QEWA 4Q6YA 1F4YH 4ZSOB 1CIUA 3UAJC 1CGSH 1QSEB 1C5CL 5GS3A