4PV9B

Crystal structure of h2kb-q600v complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional correlates of enhanced antiviral immunity generated by heteroclitic CD8 T cell epitopes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 16
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pv9B00
1RZGA 1KLUB 3CXDL 4JG0L 2KZ1B 4JY5H 4PG9A 3SCMD 4K3JL 1CFQA 3BP5B 4OD1H 4U1NB 4GRWE 5IB4A 3NABL 2YPLA 5DMIL 2VZ3A 1QSEE 1NCNA 3PUCA 4KK8C 1FVEB 3AROA 1OARH 1FFRA 4L8SB 5ISZD 3ZHKA 1YMHB 1F3JB 3CU1A 3STLB 5FO7A 2UY7A 4XZUB 3FQRA 1U6AH 1FDLH 3VXPA 5HDBE 3PGFH 3ALXA 1MJ8H 5EPMB 2GITA 2DJSA 4HUXA 1KIPB 1UCBH 4AH2A 1ETZB 5FK9A 2R1YA 1WEJH 3RDTD 4D9RD 4OZIF 4PJHB 2J1KA 4O2FA 2FR4B 5GS1B 2V9QA 2M26A 3QHZH 2R23A 5JUEH 1MAJA 4U6YB 3VMOA 3MRIB 1UT9A 2A1WH 4HBQA 3ZDXE 4LRNL 5C0CA 5BVJA 1PG7H 2AJVH 4DCQB 5IQ7L 5LGJA 5IFHH 4I5BA 4GG8B 3MNWA 2FJFA 4V2BA 1AHWA 3QXDB 1ADQA 4JKPL 3M07A 2HYMA 1HSBA 4ZPVA 4TPRL 4QRTA 1WFOA 3FQXA 3MV7B 5D6DA 3DVNA 4X7DC 3BW9B 3BI9X 1HINH 2BNUA 4G8FB 1OL0A 4XWGL 1XH3A 1JMXA 1VADB 1NGYA 3FN0H 4JRXE 4LPUA 3F7YB 4EI5B 3VXPB 1KPRB 4KVCL 2CKBL 4HGKC 3KYMB 3G6DH 5FKPB 3BKYL 1I9IH 4GAYA 4Y2DB 1INQA 2DN7A 5FA3A 2X4PA 1KCUL 1KELL 2P8MA 4X7SH 4M00A 1ZEAH 2GJZB 3DURB 4WW1A 1MPAH 5IVXB 2R23B 3T2PA 1I7RB 3V5DA 1ADQL 4RGMC 4LGPB 3C6SB 1GIGH 5F7DA 2ZOKB 3CDFA 3RY6A 4Z7UE 3GFUA 5GS0H 1NJ9A 4X9BA 1LEGB 1F6LL 1I3UA 2XT1B 5GISL 5IFAH 2XZCH 1J1OL 3DV6A 4OGAD 3PABA 4QRUA 3IKKA 5EWIH 3MV7A 4PJHF 1F42A 3MV8B 4HPYH 3RL2B 5JHDB 5FECB 1ZT4B 2FZ3B 2KH2B 3H9SA 1JYWA 2CPCA 3V4VH 5BS0E 4ZUTB 4XP6L 3RVTC 4HHAB 1HH9B 1ES0A 4KQ4H 4XVJH 4ODHH 2BNRE 2AV1A 4K3JH 1J18A 3OAUL 4Y4FC 5DK0A 3T77A 4OZIB 2R0WL 1EJOL 4AT6A 1GHFH 1IT9H 3FRUA 5DRNB 5GGVH 1CGUA 4UT9L 5DMIH 4ZYKB 3IRPX 3QUZB 5JR1H 2GJZA 3DURA 1PG7X 2VDMH 4WI2A 1T89C 5C0BB 2OSLB 2G2RA 5ITBH 3LS4L 1UVQB 4N1HB 4PGJA 4LSRL 2WBWB 4PJEE 3FO0H 5T1KA 2IPTL 3IF1A 4XNZB 4X6EA 1FCGA 4JM2D 5JORA 3MRHB 2VISB 5GRVL 1NEUA 3OPZL 2Y23A 1UCBL 4WFHD 1T7XA 3CNKA 3RWJA 3IAPA 4KXZI 3L5WA 2O93L 4QRUB 3SJVB 1J1PL 4WFEE 2NY1D 4P2OB 4I0PB 4ELMB 1CDJA 4NPYB 4GG6F 5HGGS 4HHAA 1IKNC 1RZ7L 2MFNA 2MPAH 4BSWA 2QBWA 1JNNH 3IFPA 1CDBA 1SBSL 4H20L 2P5WA 2HTKD 2J8UA 2GJ6E 4N0UB 4P3DB 5FV1L 5IV2A 3DO7B 1NCCL 3AM8A 5FHBH 1WK0A 2YXMA 3MACH 3BE1L 1FNLA 1X5LA 2VZ1A 5JW3H 4K3EL 3NCYP 2PYFB 2K3TA 1UB5A 3MYJB 5CLTA 4R4FL 4PJBE 5LVEA 5T3XL 3SKOA 3GI9H 3ARGC 3TWCH 3RIFK 4YR6A 3OX8A 5EU7C 3S5LA 5CJQH 3QFDA 3V6ZB 1UH2A 3FQWB 3OB0K 1QR1B 5DA0B 5DHXB 1N3NB 1A7QH 4NQTA 3TC9A 5E6IB 4V1DA 3B6SA 4KWUA 4NRYB 1MPAL 5D1ZA 5D5MA 1J1XH 2YXFA 4TULH 3D18B 3JSSA 3MLWH 4IRSC 3F58L 5ESVB 5EUKB 1M71B 1X5FA 3ZDYE 1UXSA 4HIXL 5HHMD 2Y7QA 1MCRA 4M1GH 3U1SL 5BMFH 3VXMA 4OCNC 3TH2T 4FQQB 3KPLB 4WGWB 4WHYG 4MWFA 2VQ1A 5IMKA 3PHOB 1S9KC 5C0RL 3MRKB 4PJ5B 5D7IB 4ZOAA 1A14L 1SJHA 1YJDH 2V7HB 2FL5A 5L2JA 1R3IH 3QIWC 4JRXA 4U1JB 3D69B 4PB9H 3V4VL 4XP6H 1Z3GL 1C08B 1GGIL 3WIHA 1H0DA 4Z7NF 3FRPG 2R4RH 3H6JA 4TSAL 3SCMA 3GHEH 4HPOH 5IJVA 3F7RA 4YZFF 2W59A 4QEGA 2UZYB 1QR1A 1IEAA 1AD0A 5F9DC 1XEDA 3B8SA 4DOHE 2FD6L 3RWCB 4PR5B 4ZQKB 4C56B 2I5YH 3E2HC 1FFOB 3LPWA 3NAAH 5DR5L 3R1GH 2AQ3A 3V0VB 3KLSA 2A0LC 1V7MH 5D7JA 5C0AB 2AK1H 2RR3A 3DMMD 5ERWB 3T65A 3VXNA 4CU7A 4ZNCD 4X98B 3SKMA 1GC1C 2F74A 4MD0A 4POYA 5C8JA 1Y6KR 5C3TA 3EOTH 4NJ9H 3VFGH 3ARYA 3MRKA 3SE4A 4U33A 4LKCA 4F9PC 2VKXA 3KJ4B 3W0WA 4HXBH 1KCKA 4NKMA 1B9ZA 4ERSH 4LQ1A 2WIIA 1V3LA 5C2BH 5I76B 5DJ8B 3ULSB 1UA6H 1U8QA 4U6VL 4OT1L 4X7FC 1RHHA 1RZ7H 2ITCB 5IJVB 1JNNL 4X0KA 4YAQB 2CDEB 3C5ZB 2E6JA 3DWTA 1Q0XL 4G9FD 1VGEL 2AJUH 2VZSA 1DBMH 4MNQE 4QXGL 2NR6D 3AUVA 2BVQB 2NY5H 1P7QD 1L4IA 5GGTL 1EDQA 1IGJB 1ZGLB 5HGBA 1C5DA 5JW3L 4NBZB 3V0VA 1RIVL 2FLRT 4U1IA 1BPVA 5EBLA 1GVIA 3RI5K 5H35B 5B39G 2VXQL 5FOBA 1H3PH 4L4VB 5EO0B 3RBGA 4WWKB 4MNQD 3IFNH 1FCCA 5C7XL 1QBMH 5FHAL 2P5EA 3O6KH 2AW2A 1AP2B 2VXTL 4XVUD 4Z8FH 4DK3A 1UB6B 3T0DA 2YRPA 1TCRA 4FTVD 3RQ3A 1MCSA 3QFJE 5FDWA 4OCYH 5IESL 3D39D 4XPGL 2FIKB 4NDMB 1MJ7L 3AB0B 3V9FA 2R0KH 4FN0A 1IGFH 3TGXA 4X0KB 3BP5A 5F1NB 1MCEA 3PWVA 1OTTC 4OCRH 4YHZL 2HFEB 4DUWA 2YRZA 2DS4A 3O11A 1CK0H 1ZANH 5C0RH 4HZAA 3GKWH 2ICES 1QTYT 3VU2A 3GNMH 4X9GA 5EZIH 1N64L 4LMQE 4PJBA 3RY6C 1ZSDA 2R2BA 2KPNA 4YIQA 2DB8A 4XZUA 1P4BH 4DN3L 5I9QC 2E6PA 3IJHA 5D7IF 3SO5A 3RGVB 4NWTL 4DAGH 1T7VA 3H9ZA 3DX9B 4NQUA 4F7CA 2Q7YA 4HF5H 3F65A 1FVDB 5EZLB 5D2NE 3CXHK 4KK5D 3FB6A 2X6MA 2X5PA 3MRCA 3UJTL 4BJLA 2F58L 3FOLB 1ZHKA 1IC4H 1OVZA 3O2DH 3VXRD 2P7TA 2YOCA 4G6ML 1G7JA 1DR9A 1V7ML 1WBXA 2K7PA 2ZCLL 1BZQK 3LAFA 3SBWC 4AEHL 5FUCC 1RAMA 5SWSA 4QGYA 1TQBB 3O0RH 5I18L 1WLHA 4N8VA 1LK3H 1GXEA 2XZQL 4Z7OF 2HA1A 4I1NB 5EU5A 3RU8H 2HRLA 3X3GH 4AIZB 4ONFH 4KI5D 4OGXL 2D0HA 2FO4B 3VG0L 2R1WA 1IGMH 5CWSA 3HR5B 3UBXG 4UINL 1I8IB 4IJ3B 5DA4A 2LAAA 2DL2A 3PWPB 4NN5C 4F15B 3SEPA 4GG6B 2QV2A 4WJ5A 4IS6B 4HAGA 1J0KA 1IM3A 5A1AA 5GS0C 4QOKD 2GW5A 1NMBH 5B8CB 5CSBA 3S5LG 1JCKA 3RKDC 3ZYOA 1C12B 4KU1A 4RFOH 1QQDB 1DBML 3MRCB 3I6KB 3BH9B 5E7FA 3NCEB 1LP9B 5BJTA 2IAMA 4JFXB 2FJHA 1F4XL 2BC4A 5D8JL 4QRSB 1TTUA 1N0LA 1YN7A 1KEML 1MREL 2IGFL 5IR1A 2NX5B 4OI9A 4DW2L 1CICA 3NTCL 3WJLA 4I13B 2VXQH 3MRGA 4GW5B 5C0CB 3R4DA 1A3RL 2UZIL 2RAMA 1X5AA 3IDYC 1BJ1J 4LF3B 1W72A 1H8OA 2XWTB 5DGQA 3V5KB 4MXVF 5F97E 3VXSE 3MV8A 4X5LA 4ZPVB 3RL2A 1OQOA 4PRPD 3VDAA 3H9SB 5AYUH 3STLA 2GI7A 1WZ1H 3MQIA 1P7KB 4H0HB 3SJVE 1NC4B 2M1KA 4JHWL 2WP3T 4GRLC 1G7HA 2DKMA 1QSFE 3CFBB 3BPCA 4OSUH 3U4BH 5HHQB 5MENA 2YC1A 4OI7A 1UWGH 3NCMA 5HY9A 5BJTB 2D0FA 4JANB 4KUZL 4FMKA 4WV1C 5ALCL 1AKJD 2VLKD 5FOJA 3DX7A 2JCCB 1EV2E 1HHJA 4OLVH 1N64H 3NIGF 2LTQC 2YSSA 4NN5B 4Z7WA 1PLGL 1HQ4A 2VXSL 1WF5A 3PIQB 3ULVH 5L7XL 3N1MC 1CI5A 1REIA 1ZVHA 4X99B 5T1MB 3OBAA 3PL6B 4AENA 2EDFA 4QCIA 2R0ZL 1MCOL 2C3VA 2E9WA 2FJGB 5DJXB 3LKRA 3UDWA 5I19L 3AS1A 1H15A 3PABB 1WT5A 2ADIB 2P5WD 3SY0B 4GJTB 1RSFA 4G6KL 3VXRA 3HMWL 2NLJB 5ANMB 4S10A 1DQML 1KCLA 5GRYA 3TPUB 4YK4C 1U95B 2RBLA 3CLFH 3O0RL 4ZUTA 4F3FB 1UM5H 2E27L 3OAYH 1HHHA 4NOFA 1WIUA 3QCUH 1HILA 3DO7A 3QWRD 2AV1B 3DSNA 3X3GL 5D7KD 5FYJD 4P5KA 4F57H 3V0WL 5D2LE 4TOYH 35C8H 1Q0YL 3BUTA 3PWUA 5I74C 2V2TA 4PBXA 1RZJC 2YEZA 2QKIA 4Q6IC 5IVOA 3VRIA 3UJIH 1OWWA 4M61A 3ECBB 2XG4A 4IDLA 4PY8I 4XMKH 1YNKL 3HE7C 4YX2H 1RJZB 4ORGA 1SJEB 3VFMB 1OAYH 4HJ0C 3P30H 5GGRA 4RFOL 3KGRA 4HXAL 1FH5H 1GGBH 2VDNH 5IG7B 4DEPC 1KIQA 2O26U 3Q3GA 4QRPB 3QIWB 1IAKA 1TZGH 4P2CG 3EDFA 4U3HA 5EORL 4TTGA 2VITB 1BX2A 1DL7L 3BPOC 4PLKC 1FAIL 2FDBP 1HH9A 5J0BA 1J7VR 3H0TB 3G5ZB 2VABA 1JF1A 3BHBA 4DZ8A 1TJHL 4HEPG 3VXOB 3BOVA 3LQAH 5DRZB 8CGTA 4KHTL 4RGMB 3JUYA 1HHHB 3OZ9L 4WW2F 3OHXA 3CDYA 3FB8B 3SDXA 3TP4A 1UZ6E 2Z8VC 2ZSWB 1DEEB 1YYLH 3W11C 3T4AB 1KJ2H 4LLUB 3LKOA 4C58B 2DTSA 4BUGA 2EC9U 2AP2A 2RHEA 4L3EB 5B38A 4XH2B 2VE6A 4HWNA 3K46A 4FQ2L 1VPOH 5KANG 2PYFA 1WAAE 2E3VA 3MCLL 1JHTB 3K8MA 2VISA 1OCWH 3B5HA 3M17B 3ZDZE 4JHWH 5A2KH 3BDXA 5JIHA 1BQSA 3SCMB 2DIAA 4XP1H 3QUMH 4NQCE 1JPGA 4JFDB 4Z95H 4HUUB 3VFPB 3L9RA 5IHZA 1OT1A 1EEQA 2G60L 2ZUVA 3QZWB 4OD3L 4XP9H 3ZKMD 1KIQB 3D2UA 3I84A 5D1QD 3RUGE 3VFSA 3GO1H 3QXAB 1INQB 1YDPB 1JN6B 1EK3A 2FX8H 4X83A 5FM5M 2Q6WA 1MI5B 5TFSH 2GFBA 2ZWLT 5MEND 5DJAA 1KIUA 1NGPH 2CXKA 4GW1A 1QSED 1X3DA 2EE2A 3MLYL 3AREA 5E08H 1I7RA 5DRZA 3BIBX 4NKQB 1R3LA 3B2UD 1WWWX 4N0UA 4XCYB 5JHDD 4KJWD 2EH8L 3X3FL 4DUVA 1FPTL 4L8DB 2V6HA 5CMAA 3QDAA 4MQTB 3HE7B 5CJOL 2F54D 4MNHB 5DFVC 3QXTA 4MB5A 3ILPB 4MJIA 4PRIE 5B3JE 5B38B 3LS5H 3QA3B 3CVHH 5IEHB 1OQXA 3IFOA 2VAJA 2YD6A 3HMWH 4TTDC 3QEQB 1IL1A 3BFOA 4KZEH 5FGSA 2ED8A 3H7BA 1IAII 4NO2A 5MENE 5ICYB 5DHVA 3OAYK 4PRDA 4LCWE 3MREB 3MRRA 3WJLC 2IH3B 1MHPH 3F5WB 3V6OC 3T0ED 4ENEC 3ES6B 4U1IB 5FM4A 1YEFH 5GRUH 5ID0B 5CIPA 1HZHL 5GSVB 4PJDF 1GZPA 2DL9A 32C2B 4FZEL 3S3JA 1KXVC 4LQFL 2YMXL 1JHKL 2RQ8A 3VXMB 5I8OL 4YXHH 3EGSA 5ERWA 1G7PA 2XQBL 2CQVA 3DPBA 3SO3B 3RWIA 1KCSL 5KTEH 4I77L 1S8DB 3EYSL 5L88H 4D9LH 2HTLC 1CIUA 3H9HB 2JB5L 5AZEH 1SJVA 5I66B 1AD9B 5E5MB 1V3KA 1L0QA 5EORH 4L5FL 3THMH 3RWJB 4TVPD 5EIVA 3UPCA 1I9JL 2EEAA 2AJXH 2DMBA 4IIQC 3BD3A 1YQVL 3SDDD 2YD1A 1CD8A 4JY4A 2ENYA 1A6ZB 3MFFA 3MRDA 5INCA 4KKBD 3GB7A 1N7ML 4MCZA 3NIDE 4K9EC 2QQKL 3OKOA 3F7PC 3QT2A 5EO1B 5D7JB 5C0AA 4TUJB 5F9WB 1PY9A 1PZ5B 4LVNC 1WCBB 4OLYH 3WKNA 4Q9RL 2Q8BL 3T08A 1KT2A 1GGYA 4JRYA 4XPBH 4XTRD 1OCWL 3RGVA 2GT9A 4EN3A 5EC2B 5GS3A 5C0GB 3S3PA 2IANE 5EZLA 5DD3H 4NRXB 1AXTL 1RU9L 3BEVA 2VKWA 3IXTB 1FJ1A 5GGQL 1I4FA 5I6XC 3L3HB 3PQYE 4IJ3C 4OQ1A 1T6VN 2HP4A 1YUHA 5IP4A 1TFHA 2AEIT 4X8JB 1A3QA 5I66A 5E5MA 3L6FA 5E6IC 1Z0NA 5E24E 2LE9A 2E5EA 2RB8A 7FABL 4JDVB 1S7SB 3CFDB 1YEKH 4NQSB 1UYWH 3NZHL 3S36H 1MNUH 4Y4KA 5MEPA 5I15L 4ZPTB 1QLFB 4XWGH 2ZZUT 3FT4A 5F9OL 2ERJB 5C0BE 5LGHH 1PSKH 1I3GL 3LDBB 4FFZL 1JK8A 4U1SB 3LKNA 5IHBA 4HKZA 2BSTA 2FO4A 4IRJC 1SEBB 5BZDA 1X5YA 3WFCL 4OUOA 3EO1A 2MQCA 1CE6A 5CJOH 2XN9A 2A73A 2JE8A 3O45B 1MCFA 2VQ1B 1MFDL 2E8YA 1HDMA 4X6FA 4FP8H 1BZ9A 1T83C 1X5HA 4K3DH 2KKQA 4K23H 4OKVB 4LLMB 2AV7A 2AQ1A 1J5OL 3CZJA 3F8UB 4MA3A 2N7BA 4JPIB 5I1DA 4NRXA 2ZG3A 5DVKA 1BOGA 4P5MA 3O8XC 2ATPB 3OF6D 2H32A 2AK4D 3UTSD 4WI3A 4JM4L 1F5WA 3GBNH 2APTA 1FIGH 3KNBB 1KNOA 2DM2A 4CL7A 1NH6A 1EFXA 5L9DL 4KAQL 5D5ME 3OR6B 1JI2A 2HJFA 4UUJB 1AD0B 3SQOL 1CFNA 1ZT1B 3T2NH 4Q74A 3WBDA 1MQKL 2PUQT 3BESR 4PJBF 3BDYL 2ZCHH 3TYGL 2AJSH 3MV7D 2WWMC 5E8EB 3ZE1F 3OJVC 3OKKA 1I8MB 4FQIH 5E8NA 5KSVB 5I8OH 1TZIA 3SE9H 4KKLC 4XNUL 2VUOA 1BMGA 1KTKE 3LKNB 3SBWA 1BVZA 1J0JA 1SJXA 4UOW0 2QSCL 1XIWC 1EHLH 5CSGA 2CLVA 3TBWB 5C0EA 3OAUH 3WXVH 3EOYG 4JLRA 4K3HA 1DN2A 1GHFL 2X89D 1LE5B 4PUBL 1QP1A 2UVFA 4HK0B 4LFHG 1MHHB 4PREB 3W2DH 1M05B 3O4OC 4X5XB 3HAEA 5CJXC 2WWKO 4Y16A 1LO5B 5HHMB 1P7QB 5JOPD 3BPCB 2MTPA 3PHSA 1A4KA 1IEBA 5DEFA 2X4TA 1YY8B 1NQBA 4OM0L 4M9PA 3JTTB 4JKPH 1OAKL 1XT5A 5C08D 4GO6B 1T6WA 5SWSB 4ODTH 3TZVA 1CFQB 2X10A 1UKQA 4M6NL 3QUXC 2EIZB 1C5DB 1RZKC 3O41A 4NNYB 5HYJB 5I1HH 5D1ZC 5KSBB 1GC1L 3FN0L 4I5BB 4JHZA 3U82B 3S96B 1G7QB 3O4LE 2EYRA 3QXDA 4P4RA 2HRPH 4NKIL 2OK0H 4XMLH 5J12C 3H42H 2NNAA 1CE1L 4Y4HB 4EEEA 4K3GA 2X4NB 4S2SA 4PTTA 1MHHA 4PREA 1BD2B 2Z0BA 4YBLB 3AFLA 5B22A 2X05A 4K3EH 1II4E 3KPOA 5GRVK 2XPGA 5IMLB 1C12A 1I8LA 2OCFD 1RZIB 3HG1A 1KPRA 2EO9A 5I1IL 4JO1H 3VD7A 4O2CA 1ZHLA 4M7LH 4NIKB 5DD0L 5IW3A 4UAOC 1KJMA 2CKBA 5JW5A 5D1ZD 1QBLH 4X7TA 3GBLA 3RUGA 5HYQA 5GISH 1FNGB 5IFAL 1OP3H 3KWWA 3NZ8B 1OSZA 2RCSH 5FGBA 5JOFA 2EE3A 2F53A 4OZFA 5EWIL 3OJDA 4Z0BL 5LCVH 2EDKA 4KTDL 3GJFA 1MWAA 5EOCH 4LKXA 3MZGB 3IVKA 5C6TH 2R2HB 3PQYA 4OZHA 1U3HD 1FIGL 5DFWH 3SHSA 3P0VH 1JNLL 3KDMB 4CRPA 1AGCA 4MB3A 5JR1L 2NY1C 1JF1B 3BHBB 3AC0A 4P2OC 4MXWL 1X6NA 2EC8A 2YD4A 4G6FB 4FNLL 2AJZB 2P8MB 3ILQC 1OAQH 3EHBC 4HMEA 4K9EH 1KTDA 4K8RL 1OP5H 1JYVA 1Z3GH 5L8KB 2CUHA 2P46B 5CZKA 3QQNA 5FAAA 1OM3L 1Q9KA 4C56E 1FAKT 4RMQA 3RUGB 5HYQB 5I75C 3LKOB 1T0PB 1URLA 1K85A 5HYJD 2Z93A 5HD8D 4HAFA 5ABDE 4JFQB 4F15C 1NJ9B 1BHGA 2NY2B 2AEPH 3RX5A 3BO8B 3O6FA 3WS3A 3V95A 4HW6A 2J6EH 2Q76A 4C83B 3U0WH 1AI1L 4HGMA 1TJGL 2X70B 3RWGA 1I7TA 3WFHA 1VEOA 2KL6A 4L3EE 3PL6A 5FO7B 1MCNA 5I71C 2ARJQ 3ARGB 2FJGA 4Y88A 5DJXA 5JTWA 5TQ0H 3D2UB 4Q58C 4M5ZL 3LEYL 1DTUA 5ECJE 1HWGB 3QIBC 1OD7A 2IQ9L 2ITDA 1A0QL 1HHKA 2FR4A 4UIMA 1HCFX 1UADC 4HXBL 1TZHB 2RFXA 4W6YB 2MCG1 2XRAL 4HG4K 2C3HA 2OP4H 1G9MH 2CDGA 2BVUA 2RJMA 4GBXA 1PKQB 1JV5B 5F7WC 3L7FB 4PRPB 4MNQB 3H9SD 1Q9KB 2CKBH 1WFUA 3G6DL 3OXRB 3FB8A 1QFOA 2QKIB 4U6HB 1HSBB 1S5IL 4XGZB 4R96A 4FG6C 4WEBL 4YHYC 2IPUK 1WTLA 4PJ9A 5ESQA 3UYRL 2Z31B 1RIUL 2FLBT 1QPPA 3RKPA 2DYPD 4PRDB 3VXUE 3S5LB 4M1CD 3M17A 4F7TA 4JO1L 5GGRB 2SEBA 4HH8A 3PG2A 4OCMC 1U8LB 4OLWL 3MLXL 1S7WB 4QRPA 1MEXL 3HZYA 3LQZA 1FFPA 2HKFL 1ACYL 4QTHA 5BMFL 3TIEB 5HHQA 5MENB 4NQDE 2E7HA 1U8MA 1HHKB 5D5MB 4IIQA 5HYEA 5MP6L 2OZ4L 1WFTA 3BZ4B 4GXUM 2PYEE 1R3JB 2NW2B 2YBRB 2WWKT 3JV4A 4P3DA 1GH7A 2F54E 4XRCA 4HFWB 4LGSB 4XX1G 1EHNA 4GG6E 3KPLA 1LEGA 1AY1H 3P0VL 1ZTXH 3F7VA 3FB7B 3DGGA 2FD6H 4UB0H 2W91A 4NO3B 4S1QL 4ZOBA 2DI8A 3GJEA 4URTB 2VZTA 3GMOB 3VFRB 1FYHB 3ZE1E 2AJ3A 3HA0A 1INDL 3UJJL 1H15B 2JJVA 2Z31A 4ZDHB 1A6ZA 3MFFB 4QNPF 5F7LB 2AGJL 2AK1L 5D2NA 5T3ZD 4ZAKA 4KKCC 3SKJH 4S1RL 2GTZA 2FCBA 2XA8H 4NRYA 4NZUH 3RX8A 5C07B 2J88H 2GUOA 3DO3A 2ZSVA 1N5YL 3KS0H 3BQUA 3ORJA 4NCDA 1DQDH 5F89A 4PP2A 2DTML 4X4YA 3OQ3B 1J1PH 4XNZC 2KQNA 3CDGA 3D25B 5F7FA 4GAJH 1X5GA 3MRMA 3TT3L 1A6AA 4YJZL 1M1SA 2IPKA 4W6WB 1FRGL 3N1GC 3NCBB 3GIZH 4M7KH 4ZUUB 4M61B 4XRCB 3VXQB 3MXVL 1I4FB 3HCVB 5I18H 1JNHB 3I50L 2X4RB 5D4QA 1YUHB 1YEJH 25C8L 4RZCA 3FHAA 3AVEA 1UGNA 4ONFL 4DK6A 5GGTH 4Z18A 4KROC 5FHBL 4I0PC 3BE1H 2CJUH 2N7AA 3EJYD 5I76A 2C7UA 2EDHA 3ZT6A 4ELMA 3N1QC 1RIVH 2D7OA 1BD2E 4R7DB 2QQLL 3TH4T 3PV6B 5EA0L 4CN6A 3GI8L 5TQ2L 1FZOB 3TA3D 5KVGH 3I75B 5IMOB 5B39B 4L4TA 4WDIA 3H3PH 2V5TA 4LPWA 2MWCA 4UOJA 1NEZA 1A8JH 2VXTH 2WP3O 4Z8FL 1F3RB 2AS5M 1KACB 5IW1A 4R4BA 1BFOB 5KJRH 5I16A 5FO9A 1NGWB 4M93B 4TVPH 1K4CB 4L3EA 2GTWB 3F58H 4EZMA 4WO4B 4U05A 1MLBA 2YD2A 1XR9B 1FO0B 4L1DA 4LPYA 1KN2H 3UPRB 4M5YH 5C0GA 5E9DD 1XMWA 3H9HA 5DK2A 5T33H 2CIKB 2UZIH 5F70A 5KS9E 3MBXH 3LQMA 3M8OH 4OLUL 5FA4A 1ACYH 3HZVA 1DANT 1M4KA 4G8GA 1BQLL 2NY4D 3IT8D 1D7FA 5DDHB 5KVEH 4DVBB 3GKWL 3H2WA 1I85C 3E0GA 4U2YA 1S7SA 3CFDA 1QSFA 3CH1B 3SDCA 3GB7B 2VN4A 3RWFB 1K5NA 1R3IL 1MRDL 5BS0D 3HC0B 4Y7MA 4P48A 5DF0A 1IGJA 2ZNXA 3UTZB 3I3BA 1XF1A 3GMQA 4H25A 4YXLL 1R3LB 1AY1L 3CFJB 4XNMB 3V79C 1JPTL 4X6BB 1QFWM 4LSPL 5D70L 4HK0A 3ME0A 4QRRD 4MSWB 5KG9A 4OV5A 6FABL 4JQIH 4WWKA 2B4CC 4MNHA 1JZ4A 1OGAD 2P5EB 4G43A 3VXUA 3EJZD 3G5XA 5DD5H 2WBKA 4F7CB 2PW1A 5A2IH 4NFBA 2ARJA 4OKDA 4R9HA 3FFDB 1P9MC 1CGYA 1YY9C 3QYCA 4WI7A 1A6VL 1A1MB 1Q94A 2PTUA 3F6LA 1BQHA 5GJSL 3REVB 2GSIA 3T3PF 4G8IA 4Y4HC 4Y5YA 3MREA 3V4UH 1I7ZA 1S9XA 5TF0A 2WINA 3GSXA 3F5WA 4DVBA 4HX1B 5EU6A 1JMZA 4Y4KD 2OJEB 4HBCH 3ZKXB 4P46C 4NNYA 2PYEA 3EDJA 5E2UH 5D96B 4JB9L 4PG9B 1YMME 1AGFB 2BDNL 4LBEA 4QXUL 3L3OA 5GIRB 5IFJB 4R7NB 5KSVA 2ESVD 3IDMB 3GMQB 3TLRA 3K7UA 3UTTB 2NNAB 5FXCH 4APQD 1BGXH 4WHTA 1JGUH 3O45A 5J6GA 4JY6A 3UAJD 3VGGA 3BEWB 1BF2A 4AIOA 2VLME 35C8L 2XZZA 2Y4SA 4GSDH 4PGDB 3EBAA 3VJ6A 4EVNA 1AD9A 3VXUB 4ODVH 2A9NH 4CW1B 3IKCA 1CQKA 1U8QB 3BKJL 4KDVA 1LMKA 2PW1B 2Z4QA 1RZ8A 3CC5B 5KSBF 5JXAL 3RKDD 3KPRB 3OR6A 4QT5A 2AKRA 2Y6SD 5DMKA 1NCTA 1UXWA 4X4XB 5GS0D 1T1ZB 4TRPL 5IOPB 2VR9A 4CKVX 5D7SH 4K2UH 2CGRH 4MCZB 2B2XH 2I26N 3RVUC 5J4MA 2ZG2A 5GHWH 5T3ZH 1A9EB 1EUUA 5TE7H 3LY6A 4QOKE 4F80A 2GJJA 4LCUB 3RIAF 3VXME 3JV0A 4GMSL 4QRQA 1HCVA 3DLQR 5E6ZA 3VWKB 5KJRL 4FXKB 4F9PA 4BFGA 4M3KB 5K9QI 3O6MH 3IDMA 1T0MA 2VDQL 1D5IL 2GT9B 4EN3B 1UH3A 1G7QA 3M8OL 4OLUH 1UWGL 5TE4L 5DVLA 1YYLL 3ZKMC 4DTGL 2A83B 5KSUA 5F88B 2XZAL 1IAIH 5ALCH 4OF7A 1DDHA 3MBEB 3CVIH 1BD2A 2L0DA 1MCBA 3MLRL 3IKCB 3WIFB 4TVSa 4LP4A 3QCTL 3KPOB 5K59F 2OXHA 4K7PY 2JJTC 1BOYA 1J8HB 3CFBA 2N4IA 3MJ9A 2COQA 1IGIL 5CFHA 1JTOA 1Q9OB 2W9DH 4XVSL 3JWOC 2BY3A 3H8NA 5FYKD 3MMEA 3ZTNL 5JXEC 4OFYA 4J4PD 4CADA 2V7NB 2R0ZH 1LO3H 4JFQA 3UJTH 1YQ2A 1QBBA 3VGHA 1GYAA 5EIIA 3U2SB 1T22A 2LVEA 3MX0A 4LK4A 3QEQD 2IANA 3N0PB 3MUGB 5I74B 3D0VB 3I6LD 4P9ML 4AQ1B 3Q1SH 1H9VA 1DBKH 1QA9B 5KSAA 1M7DA 1TITA 3E3QE 5KS9A 1IFHL 2EO1A 1CL7L 4YDLB 1UEYA 5JHDA 2OQJA 3VDCA 2ITDB 1MCQA 2VAAB 5KN5B 3HMXA 1L7IL 1MLCA 4LASH 4NQXA 4HWZB 3BP7A 2D7MA 2H1PH 5I1GL 5DUPH 1OP5K 1KC5H 3WIHL 5J9PB 4NBYB 1B2WH 1PEWA 2NQCA 1EAPA 1B4JL 4OQTL 1BEYH 4O2CB 5DQDL 4WEMB 4RWHA 3L7FA 1L6ZA 4JANA 2Y1VA 1FYTB 5CSZB 4PP1C 1KULA 4KJPD 4HULB 1WWBX 4R97C 2P48B 5DRNA 5DYOB 3TN0D 2P24B 2XY1A 5DD1H 4YXKH 5F8QC 2DQUH 3VI4E 4P4KA 3HC4H 5GGRY 4LEOA 2FBJH 1NEZG 3PWUB 4MVBD 2UWEE 5HJ3B 1HQ4B 5DMGC 1RZJL 3RTQD 4ZFFB 3ZTJG 2VO5A 5JPMB 3GJFB 3O2WH 3B2VH 1DL7H 3W39A 5JORB 1NBZA 2H26B 1GOGA 4F7EA 3RZCB 1MRCH 2VLRA 4XCEB 2YZ8A 3WS6A 1LO5A 5KS9B 4YXHL 1IILE 5GGUA 1A3RH 1EHXA 2FYYA 1ITBB 4YWGH 4ZD3H 3TO2A 5IG7A 2NY5C 2NLJA 4OQTA 3BP6A 4RNRA 4NQCB 2GCYB 3DX8A 3GM8A 1S7VA 4NWUL 3P4MA 1P6FA 2GK0B 2YBRA 3QAZB 2Z8RA 1HILB 1XCTA 1CICB 2B5IC 5DZLA 3OKEB 3MCLH 2HT3D 4MA1B 4YDJA 1AHWB 1EO5A 1U3HB 4XP1L 2NY7H 1DFBH 3NACL 1QEWA 1CGVA 3NN8A 3HE6B 5EBWA 1F4HA 2G60H 1FGVH 1EEZA 3GJEB 1X5JA 4LLUA 1K8IA 3T4YA 5B4MC 1CD0A 3V5KA 5BW7C 4JRYE 4DTGH 1PDKA 4Z7QF 3EUUA 2HT2D 4CU8A 2EDOA 4NO5A 2FWOB 2QLVB 5DFVD 5CEZH 4GRMA 4XXCA 1XH3B 1HH6A 2XNAA 3QFDB 5C09A 1DE4A 2NY4C 2XICA 1RUPH 3KYAA 4X7CC 4Y8AA 2VLRB 2GTZB 4WIQA 1PLGH 4KJWC 4F37F 5HPMA 2YA0A 1A6PA 2XPGB 1SEQL 2QQNH 4M1CC 4G8GE 4PJDB 3T0AA 3RTQC 3G5ZA 3CMOL 4O4YH 5SWSE 3QIWD 4K7PH 5IVXA 1F13A 4P3WA 5FYJL 3OTTA 3EYUH 1LQSR 2JCCA 1A6AB 1Y18A 3UZQA 4BFIB 1EVTC 5H37H 5E03A 3VXQA 4OLZL 2ESVA 1T7WA 4Q6YA 1P84K 5CP7B 3LB6D 3TT1H 3FAXA 3HE6A 3L7EB 3PL6C 5FEBA 3A6BH 4HJJL 2VB5A 2C3VB 3MUJA 5E5UB 5ESQB 3C60C 4F57L 3QA3A 3TA3B 4LASL 3DECA 1N5AB 2H1PL 5I1GH 1KC5L 3C08L 3X13B 2AJ3B 1DQQB 5FUCE 4O02H 4YNYB 1IVLA 4XMPL 5B39A 4PJCA 2C4FT 5D2NB 12E8H 1BFVH 3UYPA 1CT8A 2BNQE 5I75B 1OGAA 2F53E 1JBJA 1DLFH 4LOUC 2VDNL 1Y6NR 4P0DA 1UM6H 2R0LH 3WNOA 3JXAA 1OW0A 1OSPH 4V2CB 5CZXC 4PJGE 4O2EB 4JFPB 4UBDD 2IFGA 1GPOH 3SQOH 5I16B 2OMNA 4X4YB 2AXFB 2ERJC 4MQ7B 3HUJF 2F5AL 4RAVB 4ZTPH 4PJXB 5IQ9A 4ELKA 5DRWB 2ZCHL 5CMAB 3U48A 4GOSA 4PTUB 3D3VB 3G6AA 3BSZL 4PJFA 43C9A 1WVZA 3VXSA 1A7NL 3MFGB 5JIPA 3HB3C 5JNYA 1YNTA 4MA8L 5ADPH 4G6JL 3QIUA 1A1NB 3EZJB 3HI6L 1T4KA 2FEDD 1NGZB 4RMSA 5C07D 1PW3A 4ELMF 4D9QE 3G04A 4HIJA 1OT2A 3EYVA 1FYTD 3BZEA 3DUHA 3ARBA 5E5RB 1RQ5A 3L1OH 4G8GD 1MELA 2CO7B 3D39B 4RMTA 3JWOL 5JXEA 4JFDD 4LLYA 3DX6A 3U0TA 1BJ8A 3VXOA 1FL3B 1RJCA 3CFKA 3BQUB 3BP4A 4KMTH 1ZT7A 1DFBL 2YA2A 1AR2A 3GMRB 1LDPL 4IRZL 1FGVL 3BJ91 4PJFF 1IGCL 4NSKA 4J3UA 4J1UA 3MYZA 1CXLA 3GO1L 5FGCB 2P8LA 4JRYB 1FL5B 4PGBA 5F72S 2BHUA 5HD8C 1Z9SA 1WBYB 4ODTL 3NZHH 3ZDXF 1JZ6A 4Y1AD 3IDNA 5IJKC 3MOAH 5L2KD 2BSSA 2R56H 2HFFB 4XC3H 3ZMRA 3FO2B 4WI9A 3QPQC 5E7BA 3L9RB 1I7ZB 1S9XB 5FB8A 1QPXA 1ULVA 4DKEH 3L6FB 4HX1A 4K7PL 2XQYK 4GS7B 4JY4B 3UAJC 5HDQL 1JWUA 3GJFH 4RCAA 5FYJH 4PLKD 4HDIA 1FFNA 1ORSA 2DLGA 2Q87A 2DQCH 2V5YA 3GIVB 4PYHA 1AGFA 4HLZH 5DTFB 3Q48A 4FP8L 4WGVB 1FZOA 3KPSD 4GW4B 3S35X 3I9GL 1X4XA 4ODSL 3VE0B 1QHOA 4Y5XB 1EO7A 4A2MA 4X9IA 4PJEA 1KT2B 4OFDA 4KUCD 4BQCA 4GRWB 1QBLL 4HFWA 1OF2A 4HJJH 1CGSH 4PJ5E 4XNMA 4JFYA 3IU4H 4X6FB 3B3IA 3VFUB 3ILPA 4MJIB 4LCCC 5C09E 1XF3A 1ZVSB 3P3YA 1KEGL 3BDYH 4QRPE 5D93C 2HFFA 4UTBL 4FABH 1T1ZA 3RWCA 5CJ5A 3FOLA 1EAJA 3QQ9D 2EDLA 2AEWA 1J8HE 3V6OE 3G9VA 1DLFL 1TIUA 4Z7NE 1G7JB 1GGCL 1UM6L 2Z8SA 3BVNA 2JCCE 1RULH 2J8UE 5JO5A 5C6PB 2W9LA 4U2ZA 5ACZA 5DTFA 4A6YA 2A6KA 3Q5OA 1SBBA 5JOEA 4I9WD 4AEIL 1TZIB 1YQVH 1NCDH 3BMVA 2R1XB 4U7SA 1XZ0A 4PRAB 1J0IA 2DQIH 4YLQT 3V4PH 1T1WA 3QUXB 1CXFA 3SGDH 3M1BB 2UWEA 1CLOL 1J87A 1T20B 1DDHB 2I9LB 3CPLB 3SDAC 2Z91A 4IRSB 4H88L 2PR4L 1S7RB 3L1OL 5ETUB 3EDEA 4OLYL 2ZUXA 4Q9RH 3TNNA 5C92A 3TESA 5E1AB 2BJMH 2R69H 3HS0B 4M6NH 5DXWA 4OFKA 2C7UB 4G7VH 2BNQA 1NUGA 1NANI 1FBIH 1GRWA 4MX7A 5CILL 3OR7B 1HEZB 4PRHE 4A6YL 2HRPL 1HSAA 1B0RA 4M5ZH 4P57B 1V7NL 2P44B 4PJ7E 4F9LC 3DV4A 4YHOL 3L3GB 7FABH 2H6PA 3OKNA 4X80H 1DBAL 2K7QA 1TXKA 2YD9A 2R56L 1JYNA 1SY6A 5TDOA 1U8KB 3VWJB 4OZGA 3U6RA 1NUDA 4LMQI 4LLAA 5E2JA 1MLBB 5E4EC 5I73B 2DLTA 1ZAGA 2HWZH 2P4AB 3UPRA 2UWEB 5EFIB 4JEGB 4NQXB 2X4NA 3BP7B 2BVEA 1G9EA 4JG1L 4RQQB 4EVNB 4H0GA 4I3RH 3ZZ1A 3KXFD 2RCSL 3S88L 4WEBH 1WTGT 1RUKH 1LD9B 4M48H 4YDKL 4Y2DD 5SWZA 4GKOA 2D03L 5GRWA 5CCKH 3WHXA 2MQ3A 5DMKB 4R26L 4DQOL 2DQEH 3GKZA 3MLTA 5LWYL 4G7YH 1RFDL 5GZNC 4KJYB 4XBEL 1HOCB 3KYNA 4LVHC 2APXA 1CGSL 3GMNA 4P5TD 5L9DH 1RVFH 4O00A 3RWHA 2WIMA 2V7NA 3LV3B 5IEKB 3C2AH 1X5XA 4TNWF 2EYRB 1BZ9B 1AHWC 3NIFF 3SOBH 3ZE2E 2V5MA 1IKNA 1X6LA 3QUZC 2ESVE 2AJSL 5DMGD 3DV6B 3BPNC 3U46A 1FFQA 4J4PC 1IC5L 4P2RD 2OX5A 1WITA 1BWMA 1MWAL 1OAQL 3KPPB 1QRNE 3B9KD 5CLWA 3GMMA 4FRWA 3QEUB 4JPKL 1ROWA 2DDQH 4M62L 3WUWB 2EYSA 5DJYB 1KNOB 4N8CL 3WCYA 1EFXB 3NA4A 1J0HA 2CK0L 1AGCB 3P4MB 4UUJA 2D4FA 5I1KH 3CUPB 4DKFH 1WBXB 1ZHLB 4PUBH 4LVOC 5J3HD 5FV2A 3RGHA 5DK0B 1ZMYA 3LSOB 5CZXD 3WHXB 3VWKC 1HNGA 4UNTA 1TJGH 1JTTA 3A67L 5INDA 3HI1B 5JOFB 2ZUQB 4L3CA 1OGAE 2DQIL 4HV8A 3SKJL 3VCLA 4ZFZA 2FH8A 5HGAB 4XP5H 3RTQB 2EDXA 1AJ7H 2QHLA 4L8SA 4X6EB 3GBMH 3C6LD 1C7TA 3PNWA 5E2TL 2WAHA 2PR4H 3MCKB 3PQYB 1QA9A 5KSAB 4YHIA 1M7DB 3V6FA 5A43C 2D7NA 2XRAH 5I1HL 2BZDA 4G7VL 2JIXD 2ZKHL 5B3JF 5IMMB 1FRGH 1FBIL 4PRBA 1EZVX 4QY8A 4JDTL 2X4TB 1I1AA 3V8CA 3ARBC 1OLLA 4QRSA 3NCJH 1KTDB 1V7NH 5IR1B 4BSWB 4JREC 5FM5O 1BAFL 1K6QL 1T66D 4Y4HD 4DCQA 2AXGA 3HZMA 4P2RA 2BMKB 2CJUL 3S34L 1FZJA 1L0XA 4FQLH 5CUSL 4QHKJ 1JV5A 3NGBC 3QUXD 1DBJL 5CP7A 2NY3B 1HINL 4H5SB 5HSFA 5KSBA 1NFIB 1DEEA 4JQVA 3L3IA 4J3SA 2XWTA 3WNMA 3NA9H 4YE4H 4OLWH 4LHUA 3D3VE 1NCBH 3K4ZA 2DLIA 1JF6A 4KKCD 5HYIA 5E0QA 4LAQH 2ATKA 4G42A 1JGLL 5EUOB 3WN5C 2BP3A 4JO4H 4L9LA 4O9HL 1L9MA 4I3RL 4S2SB 3KR3H 4NGHH 3IAGC 3PWLB 4KI5F 1YMHA 4S0SD 5HHOA 3WUZA 3SKNA 4GAYB 4JFHD 4Y2DA 5SWZD 1X5IA 2GY7B 4N9OB 1ADQH 4V1DB 2JELL 4QY8B 2AI0L 1GIGL 4WCYH 4Z76B 2R2CA 4JRWA 1JRHI 3DX8B 2A6IB 4JFFD 5T33L 3JV6A 4PJHA 2RIKA 1JNLH 4TTDD 3OKLB 4HWBA 4IOSD 3V5DB 4HWBH 4HCRH 2J4WH 4UB0L 2AXGB 3C2AL 3QDGD 2FEEI 3MMEB 3TIDB 5KVEL 4D8PA 4RWYH 4XCCH 1TETL 4PJFB 3JV4B 2CXGA 2JF1A 5JNYB 2Y36L 1YNTB 4XCFH 4FQPA 2AGJH 1MWAB 4LPXA 5JDSA 1K4DA 4AENB 1Z9MA 2PW2A 1MFCL 3LKPA 4YDLC 3VH8A 2CRYA 1TVHA 4U1JA 4G42B 2CK0H 3S98A 1LWRA 3N9GL 1IL1B 1WEJL 1J86A 4FOMA 4D0DA 4U1HA 6FABH 4GXVH 1A6TB 4LSVH 1AI1H 3OF6A 5EC1B 4N0YL 4X4ZA 2X40A 4LLVA 3N85H 3LB6C 5IQ7H 2ZSVB 4OZFG 4Q97A 4LGRB 3V6OA 1MRFH 2HLAA 5EU6E 4E0RB 3FT2B 1T0NA 5F89B 1UVQA 1HYRC 4ZFGH 1HYSC 3HE6C 32C2A 3GBML 5IB2B 2ARWA 2Z93B 1V8HA 3TO4A 4E41A 3B9KB 1HIML 4MCYA 4JFPA 3SPVA 3BO8A 3O6FB 3BIAX 1G7PB 3UDWC 4CBPA 4ZXBD 3ESVF 1RZFL 4NP4H 3QUYB 1PAMA 5DFTA 5CZVL 2L7JA 5J7CC 3SJVA 5B21A 4GKNB 4ETQA 4XBGB 2EKSA 1A1NA 2YK1H 1OHQA 2H32H 3MUZ1 1XGUA 1U58B 1S5IH 3QEGL 1NDGA 3GIVA 4X7SL 4Q0XH 2VABB 4KKLD 3R8QA 3SGDI 5DI8B 1RUAL 1I1AD 3BT2L 5CUSH 3U0TB 1OGAB 4AMKH 1YEHL 5T3XH 2NX5E 3L95B 4QHUB 4RGOH 3BAEH 3IGAB 4ZXBC 1ZLSL 2EICA 1N6QL 1OF2B 5K59E 1J0YA 2IAMC 5EBLB 4JRYD 3VD4A 4K7FA 4LAQL 4MXQD 4F2MA 4PJ7A 3DRTB 1EJ6A 2B2XL 4GQPH 4O9HH 3D1MC 3JWDL 1K8IB 3T4YB 1R5IB 3AAZB 4FG6D 4OZHE 4B5EA 2OZ4H 4BZ2L 2GTWA 3QRGL 1F4WH 2VJXA 2VDLL 4GMSH 4RZCB 4WO4A 1JPGB 2OS7A 2X42A 4R8WH 4MHHG 1KF9B 3FT3B 4S1SL 2YPLD 4FXLA 4NO0A 4J3TA 2ED7A 2DAVA 3O6ML 3O9WB 3IJYB 2OL3A 2ZP0T 2OL3H 3FB5B 1MUJA 4IDJH 2PTVA 4HIXH 4PBVC 4XNQA 4YXLH 3TIEA 4GQ9L 3DSFH 5ESVA 4I0PA 3L5JA 4LLYB 4YHLH 1G0YR 1EJOH 5IMOA 3T0XA 3ARDC 1XGTA 2VDML 2O5YH 3C8HA 3CVIL 1ACZA 4S0TD 3MJ8A 1CU4H 4OJFL 4N5UA 2B1HL 3QCTH 4GW4A 4PV8A 5CGTA 4LSRH 3FO0L 4JFZL 1AXIB 5J56B 4YZFE 1T1WB 5ALBH 3O6FC 1CDGA 3NVQA 2XN9B 2H2SC 1MF2H 2A73B 4NZUL 1SJHB 2DBLH 1T2JA 3CJJA 5AYQA 5FYLL 3RZWA 2BVPB 1CFTB 3EJYC 4UQ3A 1I1AC 1EBPA 3HS0A 3WKML 4G43B 5DK2B 3FO2A 4OBSA 1DANU 2HLFD 5ICYA 5DHVB 2PO6A 4U1LA 5F7EL 4CJ1A 3TT3H 1DBBL 4PR5A 4RRPG 1DBKL 4QXUH 4KV5F 4NKOB 5E99L 2V17L 2WUBH 1ZHKB 5ESAB 2OL3B 5D7LD 3MLVH 2GSIB 5CHNA 1XF2B 5C07A 1JWUB 1MRFL 3AXLB 4OF5A 4P57A 3BD5A 1ORSB 1ZLUK 1UKSA 2CD0A 4XTRC 4JFOB 2HMIC 1CFVL 1HKLH 3WE6B 4H26A 2MCPH 2KUTA 3T65B 3VXNB 1CDCA 3RPKA 3BVNB 4AZ8A 4UZGA 3WIHH 2X41A 2CIIB 4IHOB 3VI3F 3QO0B 5FCUH 3U6RB 4NQED 2A6DB 1KJ2A 2J3SA 4OT1H 1MSPA 1WAAA 1PJ9A 4OV5B 2HFGH 4FQQA 4JFYB 1XIWA 2J7LA 3GRWH 1GZQA 3GMPB 4KROB 4D3CH 2W9EH 3QIUB 5D7SL 2AJUL 2OXGA 4UQ3B 3QEGH 4HC1L 2FNBA 2F5BL 4EQ3A 5HDBF 4RBPK 1CG9B 2VLRE 2JJWA 5FYKH 5A3IC 4HMDA 4J3XA 4DGVH 3IU3B 3ZL4L 3QDJB 4U6XB 2CKNA 2B0SH 2NX5D 3I2CL 4NKOA 2QSVA 5F3HB 2UV3A 1BF8A 2MJWA 3OR7A 3HNTH 3NH7L 3MBXL 2KZWA 4EI5C 4M1GL 4N0UE 3U1SH 3TZVB 2J8HA 4ODBD 4E41E 2F8VA 5AUMB 1QBAA 1KXTB 1JPFA 3OGOE 3ULUL 4OGAC 4G3YH 1T0MB 3SKMB 1R5WB 1IKFH 4ODUB 4U3CA 2AQ2A 4J6RL 4Z6AT 3WN5A 1KSRA 4TNVF 1RK1B 5BOZG 1NC4A 2MOVA 3BPNB 5E2VL 5GGSB 4LCWA 5E70A 4EIGB 2WQRA 1Q9LA 2MQ0A 5C08E 4ODWA 2DQHH 4NCC2 1UWEL 5HVHC 4Y2OA 4FQHA 3TH3T 5T1DL 5CGYD 2IG2L 1AQDB 4X4XA 4J8RA 3AU1B 4HDIB 1KG0A 2GIYA 2ICWJ 3VGBA 3Q1SL 2DQTH 1VFAB 1IGTB 4X4MA 4HCRA 4IRJB 1MFEH 1OSZB 2DQJH 1EGJH 1YC8A 4MS8D 1IFHH 5HI3C 5HGBB 3QXUA 5CP3A 4OAWB 4IRSD 5TDNB 5IKCA 2ZPKL 3EYUL 1EZVY 5TDOB 3BWAB 3O2DL 4JG0H 5DRXA 2XWJB 1BOGB 4G6MH 4JB9H 5DSCA 1T2QL 1IBGL 1A1OB 3SY0A 3WO4C 3WN5B 1CFSB 3WNPA 3UCRA 4KJQD 1AXSB 1YY9D 4MJ6B 3VXTB 2LU7A 1WWAX 3VGFA 4BA8A 3VMPA 4HFUH 4HWZA 4MJ5A 1F90H 2FIKA 2NW3A 5E8EA 4P46B 5ICXB 5IIEB 4PJCE 4Y19B 5C0AE 4MQXD 4NNXB 3B2VL 5JZ7C 2A9NL 4O02L 5I1EH 3LSOA 4WI4A 1NKOA 3DI3B 4JGMA 1DLHB 2BX5A 5KW9H 1E27B 4P4KC 3BN3B 5AD0A 3N1PC 4Y4FA 1NLDL 3LV3A 3ECBA 3MNZB 2A0LD 1VHPA 1FLTX 3VWKD 1AKJA 1Z6JT 5J1SC 4HC1H 3O6LL 1UWXH 4YO0B 5GHWL 5T3ZL 1N59A 1X4YA 2NY6C 1YJDC 2H2SD 4KY1H 2H26A 1IGYA 5FYKL 1F6FB 3ALPA 1KEMH 3KPPA 1YA5A 5DRXB 3ARGA 1GAFL 4X6CB 4OCYL 2OQJB 4YHYB 4BKLA 3NTCH 3I6KA 3HR6A 1H8SA 1N8ZB 1MLCB 3MGOA 1BX2B 3NOIA 5FUOL 4PRBB 1RZKL 4P23D 4RNRB 4RAHA 2GCYA 3QQ4A 3FAWA 1JNJA 3DVGA 1WC7B 2MKLC 3IDGB 1NGXB 1WZKA 3OG4B 1JZ3A 5FKAA 3Q5TA 4KJQC 4WUUD 2IAND 5GRZA 3CGTA 5JDSB 1TVBB 3WIIH 5KS9F 3JWNC 5EU5B 3MZTA 5BRZA 2JB6B 1EEZB 4NWTH 5D1XA 2EXWC 1JHTA 5E2VH 1MHEA 1M7XA 4O4YL 5MEQB 2EE9A 3JVGA 2VZUA 1T04A 5T1DH 5CBAA 1I8LC 2DM3A 1IC4L 3DARA 2DQDH 1S7WA 4XXDB 4P9MH 4AH2B 4AG4L 1ETZA 1FSKC 2K9UA 1MHCA 1MFEL 4O2FB 3PGCA 1A4JB 1MJJA 1LK3L 2WBJD 4NM8L 4ACPA 3MRLB 4JVWA 3KS0J 2YWZA 2HJLA 1WZLA 4P2RB 3S37L 1F11A 3BZ4A 1BJ1H 1H3UA 4XCYA 1L7IH 1H3XA 3GMNB 1NGXA 3PIQA 4S1DC 3TIDA 3VFVA 5BO1H 1IQDA 3RWHB 3VH8G 1RIHL 1T2QH 4OZHB 4ODSH 3VFNB 4WVRA 2E7LA 1OPGL 1XF5A 2E8ZA 3F7VB 5CKGA 3VW3H 3OKYA 2FWOA 4MLSA 4HIEA 3KDMA 3QEHA 4UOW1 4TNWK 1HXMB 4BK5A 2PW2B 1NFDF 3LKPB 1A5FL 2ZCKH 1F90L 3UX9B 2FBJL 2ZUWA 3L3JA 3TVMD 1OSPL 5J9PA 1Q0YH 3J7HA 2IGFH 5AZ2L 5I1CH 2HKHH 3DXAE 1MI5D 2BVYA 1U0QA 3KYKL 3HNSL 3QG6A 5BQ7B 1S9VA 4P5KB 3F7QA 1A7NH 4ZTOH 4YHML 4C4KT 3ZKNC 4K7FB 2XTLA 3ZT5A 4F2MB 1F2QA 4LLDB 2QADD 1MOEA 3HNVL 1JGDB 4EJ1C 4P5TC 1K2DB 5D71H 3V0AC 4HKXA 4ELKB 3QJHB 1FL6B 4WW2C 5IQ9B 5JLZA 1FO0H 4N8VG 3OKDB 2VDRH 1CLYH 1JWSA 4H20H 2IBZY 3O9WA 3IJYA 2L4OA 2YN3A 4XC1L 5I1JL 5KOVC 3Q6FB 3GUTA 3HG1E 4OBRA 1KJVA 4XCNA 3DRQA 2X2YA 4XBGA 2Y25A 2UZXB 1TENA 4IRZH 1T80A 4U0RC 3BZEB 4BYHA 2JKXA 4X8XA 3GSWB 4P46D 1R3HB 2FEDC 4KPHH 3OB0H 5EC1A 3LH2L 1O7SA 4OF8A 5LAXA 9CGTA 4PY7B 3VXUD 1QFHA 4PRHA 1OAZH 3SDXB 1RUPL 2DIBA 1JF5A 3O8XA 5C9JB 1C16A 3MOAL 5JW4R 3QSKB 3A6CL 1FIEA 4P49A 2VLRD 3MJ7B 5I17A 4JN1H 4NZRH 4JGJA 4RAVA 5KVFL 3EO0A 1YNLH 3RFZC 4Y5XC 5T1KB 3MV8E 4MXQC 3QJHA 2KQMA 3QNZB 2X4QB 2G5RA 1DBAH 4GKNA 4ETQB 5FA4B 2VIRA 5F96H 4R97B 4PG2C 2EXYD 4FQCL 4BZ1H 5C2UB 5E08L 5IBLD 1MCPL 5GS2D 4RA0C 2YHGA 2PO6D 5EOQL 3QCUL 4HQQH 1CLZL 1U42A 2C1OA 8FABA 4GKZB 2VR5A 3BP4B 3H0TA 4P2QD 5T5NF 1J8HD 3RJQB 2BSTB 4QNPE 4L3ED 2BOCB 2DIJA 4OGYL 4HPOL 3QUYD 3V7AG 2FHBA 4WU5A 2E9BA 3MUHL 2P5WB 1QLRA 1X5KA 4X4ME 3V6BR 4OCLC 4R26H 1A7RH 1UEMA 2O5ZH 5LWYH 2PTTB 2O5XL 3GSNL 3MGTA 3IETA 1OAYL 1UB5B 1MHPL 3QEQA 4HJGA 4WUUE 5IT2L 5C71A 3SKOB 1K9TA 1MVFA 1G6RH 5F71A 1RMFL 2WW8A 4POZC 1DQQA 5TGBA 5IJKA 3DYPA 3K8LA 3P4NB 4JKLA 1BECA 2BVOB 4FZEH 4JFDA 1MUJB 4M8QA 4N1EA 3EOTL 4NJ9L 3VFGL 4ZMAT 1U3HC 3OXSB 1E4JA 1RHFA 2BNRB 1E6OH 3VGAC 4JPKH 2BSRB 2XQBH 3PJSA 2DDQL 4HGWA 4HUVB 4MHHI 4KRMB 1JN6A 1IARB 3WLWC 3CZFB 5EDXA 5JO5B 1C1EH 2GFBB 3CDGB 3D25A 4LSSL 4M7ZB 4H8WH 1FG2B 4FTVB 4LBEB 4EI5D 1FO0L 4L5FH 2Y7QB 2VDPH 3JWOH 4KKAC 4Y5YC 3NFSH 4PTUA 3HAEH 4MCYB 3TFKD 3K0WA 1XZ0B 4PRAA 3CMGA 3KPQA 5I1JH 4BSVB 3QNXA 1KB9K 2IWGA 2YRLA 5CGMA 4Y1AE 1HHGB 5CILH 1M05A 3VWJC 4WRLA 3BQUD 3SKUD 1Q9WA 3LQAC 3MCG1 1Q38A 1RI8A 2CMRH 1U8OB 3DIFA 2J5LB 2PO6B 4JZJC 1AGDA 3IAQA 4U1LB 1H5BB 2ADFH 4N0CC 5E2WH 1U3JA 5GPRA 3IFNL 1CF8L 1FC2D 1KGCD 4MYWB 3P9WB 1KPUB 1WQVT 3O6KL 4XC3L 3R06B 2PXYB 3SJVD 3FQNB 1X7QB 3MLSH 2CSPA 2XG5A 5BVPL 1F4YL 2FO1A 4EBQH 4QHUA 1YNLL 5GGQH 2XTJB 1GJIA 4Z7WF 3ES6A 1YN6A 1EPFA 3BKYH 3E3QC 5K9OA 1UJ3C 2R1XA 3SDYL 1CWVA 4ZOEA 4ZSOA 5FYJU 3MRBA 4RMWA 3ULUE 1UYWL 4KC3B 1A02N 5IW6B 3UZVB 3SE4C 3UTTD 3IDNB 4BQBA 4QHMA 5CCKL 2YPVH 3GMPA 4M3JA 2D7TH 5I8CB 2DMKA 3MLZH 4DQOH 1M6OA 1LP9F 4GMTH 1T3FB 1S7RA 5ETUA 4GS7C 4POZD 3QO1A 4M6AA 3TN0C 4XPFH 1ORQB 3FQTA 1KYOJ 3K81A 1RFDH 4NKMB 3GNML 2BXYA 4PJ7F 4CNIB 1OP3K 5KSAC 5DT1H 4HQQL 4LCWB 5EU6D 3HZKB 1DUYA 2IBGA 3ARDA 5IGXL 5DHYA 1JK8B 4U1SA 5JOPE 1H3VA 5BS0B 3IDUA 4EUPA 1AE6H 4NC1C 5IWLC 3C87A 3EKCA 4K71C 4Y2DC 1VFAA 4NNPH 5GJTH 1KB5B 1PZUB 4M62H 1T22B 2F54B 1IEHA 1YPZE 4M43L 4MSWA 1P6AB 4NCC1 4MA3B 1QR4A 1U8KA 4F37K 2EC9T 2R2HA 3W82A 3K1DA 3A6OA 2GSGA 1F4AA 3UEZA 4P5MB 4QHKI 3EDDA 1I7UA 4ODUA 1CFTA 5IW6A 4P3CH 4D2NA 1H5BC 1NGQH 3NCCB 5ITBL 1Z9OA 1LVEA 3QEUA 1AFVH 1FJ1B 4G6FD 4K8RD 3UO1H 1VESA 1TCRB 4XNUH 1CZ8L 3EIFA 4ZS7L 5DQJA 5ESAA 3IJSA 1S5HB 1AJ7L 5CIPH 3BPLB 1T1YA 4LSSH 4H8WL 3WXVL 1DQLL 4UDTB 5EU3A 1UJ3B 2JTDA 1CGTA 3DXAA 5F1NA 1HOCA 5GIRA 2Q8BH 1ZS8B 2NY2D 3VCLB 3RIFF 4ZFZB 3AY4A 3RTQA 1DLHA 4KZDH 3QI9A 4OAWA 3P9LA 4KFZC 4PBWD 1HXYB 3QUXA 5CEZE 4RISH 4PJBB 5E00A 4LU5H 1GZQB 3C6LC 4OM0H 3D3VD 1AKJB 5DSCB 4M1DH 4XXDA 4LEXL 1CD1B 1N59B 3CX5J 1HIMH 2CDFA 3UBXA 3P0YH 5GGUB 3ARQA 4X80L 4L4TD 1MCWW 4MGXA 3JTTA 4HUXB 5DC4B 5C1MB 3TBSA 3GI9L 3TWCL 1NAMH 5AAWA 5IB1B 2Q7NA 3GSVB 3T1WA 5CJQL 1B0RB 1A6WH 1JGLH 2AEQL 4NN7B 4JO4L 4NO0D 1A7QL 2VMFA 4U6HA 4I8DA 1P5UA 5SWQB 1ZLWH 1J1XL 3MV01 1W2KT 5I1IH 4GMTL 1TDQA 3BAEL 4G7YL 4XPFL 2AI0H 5DEGA 1ND0A 4YO0A 3DMMC 1QFWI 4Q2ZB 2NZIA 4ZO7A 5DT1L 1QNZH 2N1KA 4EDXB 1MHEB 5KZCD 4PJIB 1A3LH 3PWLA 4OLXL 5IGXH 2AABH 2GITB 4ODWB 2OI9B 3JZ7A 3TA3C 3NCYS 5M95B 3W81A 4RWYL 1KCRH 4RAUB 2EDBA 1CLCA 1F4WL 3QRGH 1UG9A 4R8WL 3KWWB 4TUKL 5H94B 3NZ8A 4JKMA 1MCOH 1U41A 4H8WC 5TDPA 4IRJA 4XAKE 1K2DA 4M43H 3PXJA 1U2CA 2MKWA 2VDOH 4Z7OE 3BWUC 2ESVB 4LKXB 3STBA 1GOFA 2EIZA 5EOTA 3DUUA 3LD8B 3L5XH 5DR5H 5TDNA 4XB8A 1IQDB 3DGGB 1NGQL 3R1GL 5SWQA 4OJFH 2R8SL 3VA6A 2R29H 3VH8B 5AEAA 5ALBL 5MEQA 3HN3A 1MY5A 1N5AA 5F93C 3VRJA 3QEQE 4NYLA 5E4IA 1H8NA 1VACB 4MJ6A 5EBMA 1AGEB 4MAUH 1IM9B 1ZT4A 4PJIF 4WW2A 2FB4L 1JHLH 3M45A 5TH2A 4MJ5B 1A6TA 3GRWA 3O9WC 2YUZA 2FX7H 3TVMC 2ZUQC 2P24A 3OKLA 4WFFE 4FQXC 5T3XE 2QHRH 2PNDA 4O58H 1JYXA 1IAIM 4P4KB 5E99H 3T77B 5JPNA 1GC1H 1T83A 2E6QA 3PWNA 1KUMA 1WZMA 1NBYA 4ISVB 4JDTH 2AAVA 1OOAA 4B41A 2AXFA 4BELD 2D31B 1MIEH 5HI5D 1B0GA 4YDIH 1WSST 2I07B 4XXCC 3LEYH 4OZGE 1BLNA 5HI4C 1JNHA 5EU7E 1JZ2A 5EOTB 1A0QH 3OKMB 5EN2B 1ZXQA 3C9NA 4ORZC 2HVKB 3OKDA 5HHNA 4NOBA 1IAOB 1D5ZA 1OD9A 3BT2H 2FX9H 4M02A 3ZKSD 5DLMH 2FYYB 5H2BA 4ZUSB 4PGEA 1F3DH 4LIQL 1XAUA 3ARBB 3MC0A 3FTGA 2K1MA 1N0XL 1TZHA 3DRQB 2IC2A 3UTSA 5BXFB 2BOCA 3OJ2C 2H2PD 3HZMB 2BMKA 2YPKA 3K1KC 4WNQA 3RY5A 4KK6D 5HHOD 2WSKA 3UYRH 4OD3H 4LFHD 2B0SL 3I2CH 3O3EA 1MJ7H 3VFTB 3MGTB 3VG9B 4EXKA 2JELH 3T3PE 2Y72A 3PWNB 4ISVA 1S7QA 1U8IA 2WV3A 4HJGB 5BW7A 5I17B 4IDJL 43CAA 2VQTA 5FO8B 1G7IB 2VLMD 3VD5A 1QNZL 3PGDA 4J3VA 1BREA 2DKUA 5BRZD 5EH1A 4YHLL 2XFXA 4L8CA 2NXZB 1Z5LB 1MIML 2GEEA 1IC7L 1YYMH 1VFUA 3QJFA 2BY0A 2R4SH 4DFHA 3EDKA 1TETH 4M8QB 1LP9E 5FB8B 1INEH 1SQ2N 3O3UN 4IRJD 4BSJA 4TUKH 1NDGB 5DJDB 1SYVA 3CLEH 4JFZH 1YMMD 5LG1A 3SDCB 4C54A 2X4SB 5D5MF 3LS5L 4GKSB 1A4JA 1MJJB 1MAMH 4TQEH 3RJDA 1TTGA 5CEYA 4BFIA 4Z7WE 2FSEA 4D8PB 4N8PA 3RVVC 3WKMH 5IVZB 1BZ7A 2LU3A 5E8DL 4WTWA 4WU5B 3GSRA 3EO0B 1DBBH 2R39A 2HG5A 3B3IB 4JPWL 1XF3B 2HJKB 4A2LA 2XFXB 4Y4FD 3BX7C 5DVNA 2D0GA 1JHKH 4TYUA 3VG0H 3BXNB 2ZPKH 3L3JB 1CS6A 4U1KB 5DQ9B 4UINH 4NZTL 1U8LA 3L3KB 4NP4L 1YECH 1DZBA 5BZWA 1NFDA 2Q1EA 1EH9A 3VFSB 1CBVH 5HHPA 1IBGH 4P2RE 2VWEE 4Y5VC 2EDDA 4C56A 5LQBH 3I50H 5EUKA 3BUYB 1C7SA 4AM0A 1NAKL 4WO4D 5M7QA 5A2FA 4DUXA 3B9EA 3U9PH 3QXVA 1GL4B 3D3VA 3G6AB 4PG2A 2D2OA 3ZTJH 3K3QA 1FNEA 1Q8MA 3C60A 1FL6A 5IROA 5IVXF 3CAFA 2QQLH 1NC2D 1RIUH 3IETB 5EA0H 2V7HA 1XIWB 5TQ2H 4IRSA 1N0XH 5DS8B 4HIJB 1AO7B 1EEYB 4KKNA 1LE9B 1RZ8B 3CC5A 1I3RB 5DC9B 2CO6B 3IU3A 2PXYD 1XF4A 3EFDL 3T04D 4BZ2H 2VDLH 5F3HA 3S3SA 4FFYH 1MH5B 5HVHB 1F2XK 3QUKB 3S35H 1NEZB 3GMRA 2BRQA 4LCUA 5C9JA 1QFPA 1OTSD 3TJEL 4G6AC 2W38A 4UU9A 4YBQD 3EJJX 1KCVH 5MI0B 4UAOB 1KYOK 3HUJE 1WBYA 3HFML 1UWEH 2A74B 4JFEA 3EGSB 1IC7H 1YEEH 3I6LE 2ADGB 5D2NC 1WGOA 3WMSA 1S8DA 3FL7A 3QHFL 3DTXA 1DVFD 1EMTH 2X4QA 4NUGH 2B1HH 1U8NA 4ZODA 5D2LF 5L0QB 5HI4D 2HTKC 4H1LG 3CLEL 2FH6A 2JLLA 3UTPD 1RURH 2XTJD 3WIFA 1MF2L 4RX4D 4YPGA 1MFDH 5J12B 1ORQA 3FQTB 1EGJL 3PP4H 1D5MA 1SMAA 3EHBD 1K5NB 3UTPE 3Q5YA 4U1GB 5J11C 4BQ9A 1DUYB 2R9HC 3ARDB 1XGTB 3ARDD 5J13B 4XAWL 3JV5A 3KXFE 5FYKU 4KJYA 3DJ9A 4GAJL 5F7EH 3WDHA 1OAXH 4B50A 2JJUA 4M7KL 4PJFE 1S7UB 1XGQA 1A6VH 5GJSH 4HK3J 4NHCH 4L8BA 3HPLA 3PE9A 3TYGH 4MJIE 25C8H 4IOIA 3S37H 3FN3A 4ODXA 1CFVH 4R4BB 1XCQB 2VLKB 5EU4B 4YIQB 5HBBA 3WJJC 1FN4A 4RMRA 4OTXL 2GSGB 1DSFH 5BV7B 3REVA 2AJYL 3SE3A 3EFFA 1FVCA 3QO1B 1EVUA 3MR9B 1YECL 2BDNH 2CIKA 3ARFD 4E5XA 1EFQA 4G8GB 2XXCB 4MA7H 3KHQA 4PJDE 5KVGL 3OXSA 2PYEB 5DQJB 5CSZA 3W2DL 5C09D 3BKCH 5MEPB 3ELAT 3GSOB 1TVDA 4UT6H 4P2YA 4PIRF 1AR1C 3KLAA 1EO8H 3O6LH 1E4XH 3HI1A 4NQDB 4GSDL 1NANH 2ENSA 3ZDZF 4DGVL 4N8VB 4HIIA 1G1CA 4ZO6A 1QOKA 3K2UL 1OTUC 3MLUL 2JK5B 1ZSDB 3MNZA 4ONGL 3BWAA 1ZE3C 1J9CT 1FORL 4J23A 4Y1AB 4KV5E 4CW1A 5KG9B 2DD8L 3PWPA 3V6FB 4Q6IB 1Z9LA 3C5ZC 4M6ML 2Q7YB 1B4RA 2HTLD 3E2HB 5D71L 5E1AA 1A7PL 3QDJE 2E7MA 3LEVL 3CCHA 5J11B 4UI2A 3BP6B 4LHQB 1KLFA 5H94A 4LP5A 1O0VA 4GRLA 4FQ2H 2G75A 3P4OB 3TNMB 3D39E 3ZYJA 1B90A 1MRDH 4CVZA 3ZDYF 1BQHB 3AS2A 4J6RH 1UZ8B 4L4TE 3MJ9H 1XCTB 2ICEB 2BC4B 1D5IH 3R06A 4XWOD 2VLJD 4U6YA 2JJTA 1P4IL 3HB3D 5ELIA 3VFWB 4WI5A 4HEME 4XP9L 4C55A 2ZUUA 4H5SA 2DKSA 1CN4A 3L3OB 3MRBB 4NUGL 1OAZL 3P11H 1NC2B 2CLVB 3TBWA 4W68A 4QHLA 1I8IA 3TN0A 3B9AA 4OB5L 4QRTB 4N9GB 4U31A 5EBMB 3D0LB 3BEWA 4NC0B 5GGSA 4MDJA 1IAMA 1QHPA 1VADA 5HPMB 3ARVA 3KPSE 4P23A 4P2QB 4CNIA 1J8HA 1ZGLP 4EI6A 5C07E 4HUWA 2BRRH 4XNYL 4FA8A 5GS1A 1N2RB 1LP9A 3VMNA 3IYLW 4Z76A 3CVHL 5E2UL 1F00I 3GSNB 4HLZG 5JIIA 3QQ4B 1OAXL 1UXWB 3CFCL 5IF0A 5HY9B 3VW3L 4BZ1L 4P59H 5GRJH 3FHQA 5LGJB 4NHCL 5I1LA 1BGXL 3KLHD 1JGUL 1FLRH 3HUJA 1NCWL 2DM4A 1FV1A 4NUJA 1XR8B 2JB6A 4FXKA 4N90D 4OTXH 1K4DB 3ARZA 1DSFL 3GJFK 4WUUB 3B9KC 1H3GA 2HKHL 1P7HL 1HYSD 4OZHF 3BIKA 4G8FA 4D0BB 2DICA 4N9GA 4LNVA 5DJCB 3TO4D 2YMXH 3BRDA 1T04B 5JXAH 4PJIA 1QZ1A 2O5ZL 2A83A 4TNVK 5D96C 2AEPL 5E6YA 3PWJB 1BVKB 2R15A 3HNVH 4I3SH 3VXRB 2FHFA 5C6WH 4KK8D 3U7AA 2BSED 1ES0B 4AL8H 2JB5H 5AZEL 4P46A 5JMOC 5TE7L 1S78C 2XTJE 2XWBA 1T5XB 1UQSA 4C57C 3O2WL 4X9HA 2CR3A 3O3EB 3X12B 5IF0B 4N68A 1Q9OA 3DUSB 5HGHA 1AQKH 3S7GA 3BMWA 3OAZH 3KLDA 3IDXH 2QR0A 4YWGL 3ARTA 3C6LB 3OAZK 1CVRA 1VEMA 4TSBL 3MTRA 2QQKH 1C1EL 2IANB 3NIFE 5F9AC 1HN1A 4OCWL 3MRFA 5SWSD 4LSQL 2Q86A 2LV4A 4MAYB 2X1XR 2VDPL 2CK2A 5HGDA 4BKLB 5K9QG 1CD1A 2CDFB 4JFHE 2A6JB 4P9HL 5SWZE 2RGSA 3MGOB 1TQBC 1E0OB 1LDSA 4IOFD 4HC1A 1KGCE 1NL0H 3QIWA 3S6CA 4NZRL 2L7UA 5E8OB 5KN5A 4HH9B 1J88A 4D0CB 1HHIB 5FGBC 3JWDC 4F3FA 4FQ1L 3OKEA 3ZTNH 4Y8DC 3UTSB 3CFKB 5IVZA 1UQSB 4XPTH 1LILA 4N90E 4KGLA 1NFIA 2ADFL 2OSLA 1YEKL 3FN9A 4JZJA 5E2WL 5KZCB 1GCFA 3P11L 5DYOA 2P8LB 3VDBA 1B3JA 2Q8AL 5I15H 4H0IA 4RRPA 4XHQA 1YPZB 3NIDF 4JO2L 4R2GB 4FQCH 4X6DB 1O7VA 2XKSA 5BRZB 1OY3B 2FIRT 5LGHL 3B2UC 1AIFB 5DVMA 1XGPB 1QRNA 4L9LB 4ZSOE 3PDOA 4FFZH 5D7JC 5MP6H 4XAKD 3HPJA 2ORBL 3OKMA 5EN2A 1HWHB 4LHUD 1CLZH 2JJSA 4JFEE 1I7TB 4KHXL 5SX5H 3W39B 5GS2H 5IBTH 5L6YL 4LARH 3GUTB 5E56A 3I02A 4EDXA 4XCNB 1Z5LA 5BO1L 3QWRA 1JPSH 2JJSC 1SVCP 4OGYH 2F15A 1LO4L 3ARXA 2UY6A 3T1FB 2A6JA 3C5ZD 2WBJA 1LHZA 3GSWA 1WBZA 1ZTXL 2XQYG 1A7RL 4JFFB 5GRJL 3QDMB 1YEDA 3QXAA 5JQHC 2O5XH 3GSNH 1CICC 2B5IB 1U92A 4Z7VB 3D18A 4O51B 1XIWD 3QQ3A 3VFOA 4EN3D 4M7ZC 5FYLD 2PXYC 3C08H 1QLRB 1BM3H 2D3VA 2Z35A 1B88A 1MJ8L 4L8DA 3HNSH 3VFUA 1YPZA 5EG6C 4ETYA 4ZFOA 1J8KA 3PGDB 3OX8B 1XGPA 1JRHH 4YHNB 3SE9L 4E42B 3BKMH 5L2JB 5CD5C 4L8CB 4ZD3L 3SDCD 3KPSA 1DCLA 4J3OC 4EKXA 1SVZA 5I2IB 4NYLB 1CL7I 5EIQA 2NZ9C 5C09B 2WMPA 1QKZH 3QDJD 4P3CL 3ROLB 4O5LH 4CMMA 3W0WD 3BSZH 3K80A 4XC1H 3FT2A 8FABB 1M71A 5ACZB 1A22B 2ZJSH 3RWDB 3W9DA 3LN5A 2AK4B 4TPRH 4U1GC 4R0LB 1U92B 1JIBA 3IDXL 4PJXA 1E4WH 3BUYA 4CDGC 2IALA 5DD6A 1BJMA 1EXUB 2P42B 3B9VA 3MV8D 2DWDA 4HWEH 4QYOB 3WDJA 4WHCA 3GI8H 4N0RA 4X6CE 4DEPB 3BZDA 4OZGF 5D7JD 2Y5TB 1NMAL 1FSKB 1I9IL 3C60B 5HHOE 5J89A 4DVRL 3GHBL 4LCIL 3FJTA 2HVKA 3IDJB 4YDVB 4ZFOB 1IAOA 5JA9A 1CXEA 4PLNC 1H0DB 1KJVB 4FFWC 2YA1A 2IQAB 1SEQH 4OFYD 3P4NA 4G9FB 4MZ3A 1LDPH 4RISL 4MX7B 4YHKL 3QDJA 3MRRB 1V5JA 4ZAKB 3ROOB 4U1MB 2ITCA 4YEEA 3V52H 1F58H 1HI6B 4BH8B 1FFOA 4XPTL 1ZT7B 5DZOA 3T0WA 3DROB 4M5YL 4YHPA 2VXUL 1P4LB 1CT8B 1FNSL 2NCMA 2DQFA 4MJID 1BQLH 3WFBL 1P9MA 1VCAA 3O3BA 3UZEA 1P1ZA 5ACMA 2FECI 3DRTA 1MCPH 1DN0A 3RNQA 4LHUG 3MRJA 4ODXB 4L29A 4UU9B 4KH2A 2OR7A 1MFAH 1FN4B 4PJAB 4ZUWA 3I6GB 1FNEB 2AEQH 1NCUA 4MNGE 3T2QA 1R5WA 3KYOB 3QH3B 3RWEB 4CVXB 1NCAH 1QSEA 3HI5H 3EW3B 5F7UA 4LSUL 4JM2C 5ILTH 4Y5VA 3S8WA 4Q9QH 1T66C 4EN3C 1M6OB 1T3FA 3WFZA 5LCVL 1JPTH 4KTDH 4LSPH 5I0ZA 4ALAH 12E8L 1BFVL 3P77A 5EZJA 5BV7C 4FQHB 3UMTA 5F44A 2CDEA 3C5ZA 2ED9A 5C6TL 4R7DA 4LPTA 3MLTB 3SQBA 1KB5L 4GKSA 4PPTA 3CVHB 5IROC 2YD5A 3ARFA 4QXTA 1LO0L 3MXWL 4EUPB 2OTUB 2DI9A 2V9RA 2F5AH 4LCWD 4ZTPL 4WV1A 5ISZE 5K9OB 4JJ5A 5IEKA 3HRPA 2IADB 3RVXC 5C0IA 1AFVL 4KK6C 4M93C 1DN0B 4UQ2B 5HHVH 5EO0A 4HBCL 1A21A 5CS7A 4GAGH 4QHMB 2ADGA 2XWJA 3CCHB 4UNUA 1GGCH 3CSGA 1A1OA 1NAMA 3D9AH 5I1DB 1AXSA 1QKZL 3JTSB 4RGNE 4MXVE 3TCXA 4UIKL 2O61B 1RPQA 3B8YA 1SBSH 5ID1A 1UZ8A 3W5MA 3MR9A 4GFTB 4H1LA 5IHLB 1S5HA 3DGCR 2QJDA 3QUMB 2NW3B 3E6HA 4IMLA 3V4PL 4A6YB 4OZFH 3WE6A 1E4WL 4M7LT 2X7LA 4MMZC 3SO3C 3A0OA 1MI5E 3H9YA 4FTVA 4LNRB 4HKZB 2FB4H 3DXAB 4BFBD 1XGRA 1SEBA 2Y5EA 5CGYC 4QXWA 1PX3A 1KJ2B 1I9RH 1QD0A 3PF2A 4Y5XA 5C0FB 2IH1A 3VD9A 4JM2F 2VSDA 1CF8H 3M1BA 3MROB 3PNWB 3T09A 4X9FA 2VL5A 1JP5A 3HR5A 1SY6H 2EDYA 4YHIB 1NAML 1N6VA 3HRZB 2F19L 1XCQA 5EU4A 3MOBH 1Q9WB 3BJLA 1IGYB 3T2OA 3K2MC 1KOAA 2B20A 4LSDA 4UV7H 5E94B 1CG9A 3HKFA 4A6YH 1U8OA 3DIFB 1FNHA 1ZVYA 4TULL 4X5WA 2BNQB 4HKBA 3DVIA 1QFUL 1F58L 1P7QA 1N8ZA 3AMKA 2NYYC 3FFDA 1HEZA 3T3ME 4JCLA 2O61A 3C8KA 3MODL 5C0DB 3O2DA 2OI9C 5D6CB 5D1QB 1FNSH 3AREC 5GSRB 3AM8C 2PXYA 3HLAB 3FQNA 3MRIA 5EU6B 5J06A 5K93A 4PJXE 1R0AL 1NKRA 1FZJB 5D72H 1CYGA 3L3DB 4XVTH 3MRPA 5AUMA 2QSTA 2WLYA 3IFLH 3T0VA 4GW5A 4YK4B 5HYFA 3HC3L 1TVBA 4PB9L 1HQRA 5F1KC 5CWSB 5L2KA 2R4RL 4UNVA 5EUOA 3S96A 3C60D 1W8OA 3MRNA 4Q9QL 4ESKA 1W0WB 1ND0B 5DEZA 3TN0B 2DQEL 1Q72H 4Y4HA 4RBPH 1Z0MA 4Y16B 3HRZA 1NGYB 2A9ML 4XWOC 3ZE0F 1EA9C 4KTEL 3TO4C 4XBPB 4XP4H 4OD1L 4C56D 4KDWA 1Y6MR 4J12A 4J8RB 4P2QA 2MHAA 2A6IA 3I3DA 5D6DC 1LK2A 3TCLA 2ICWI 5D6CA 3T0BA 4KMLB 2ICEA 3TVMB 1INEL 4XHJD 3VGEA 4HMCA 1NCDL 5F7HA 4JKKA 4ZS7H 2VERN 1F3DJ 4QRQB 3VWKA 4GAGL 1FDLL 4Z7WB 1W72B 1S7UA 1XGQB 4JPVL 3MRFB 2F53D 3RBSA 2H6PB 2DWEA 1MJUH 3QIUD 1DQDL 3BGFC 1I7UB 2DTMH 3SE3C 4HIEB 4G9DA 5A16B 1CICD 3K8KA 4Q2ZA 1HXMA 4LCYA 5E8DH 1VGEH 3ZYIA 4LOUD 4LLWA 4YUEH 3VRJB 3TZVC 2YD7A 5DJCA 3RAJL 1RZJH 4XI5D 4OI8A 4ENED 1KFAH 2NXZC 2YKLH 3TPKA 4XP5L 4QHNB 2HN7B 4Y0GA 1BD2D 3PWJA 3WYRA 2CKBB 5JW5B 2FGWH 4Z7UF 4FXGA 3EYFB 5E8PA 1YMMA 4OCSH 2HLAB 3E8UH 4DZBA 1AH1A 4KRPC 2XWBB 1KN4L 1UC6A 4P9HC 1HHJB 1IZJA 3DYMA 1NMCB 4Y4FB 1W0VA 5FGCE 2NTFB 2FX9L 3ABZA 2ZKHH 3KYNB 1CBVL 1C8PA 5EIIB 3MCKA 2QEJA 3VRIB 3JVGC 4ZXBB 4P5TA 4YQXL 2QL1A 2QR0B 2HWZL 3BN9C 5KOMC 5TE6H 2AVGA 4NZJA 1QRND 1KCUH 5C08A 3HMXH 2XKNA 2R2EB 5AWNH 2VRAA 3MODH 1U58A 5DZNA 4PGEB 1IAKB 2EIDA 4OCRL 3T0EE 4KK5C 5DGRA 3TPUA 5F1SA 3GGWA 2CLRA 3GSVA 3WLBA 3WUWG 4Q9CA 3CUPA 5T3ZE 4UIMB 4PY7A 3KPNB 3F12B 4FXGB 1A3LL 1J1OH 3L3IB 1G7MB 2KDGA 1Y0LB 2FATH 3OHXB 2E7LC 5F6IB 2QQNL 1FZMA 4PJ8B 4NM4L 5B8CC 3VFTA 4Z5RB 3QG7H 4L3CB 2ZUTA 4HV8B 3OXRA 3NFNA 1OTTD 1HK6A 1IC5H 4HD9A 4CMHB 2VZVA 3DHJA 4OF6A 4I2XB 3VRLF 5JPMA 5TF1L 5GGTA 2VZOA 2BK8A 2F58H 4HK3N 4R96B 4I4WA 4HS3B 3WFHB 5AAMA 4LVNB 2EEBA 2C26A 2C1PA 3KPTA 5MERB 1KTLA 1U91A 4APQC 3NPSC 5I1KL 4DKFL 2VTFA 3FTGB 2VWEC 3KJ6L 2SEBB 3L5XL 1PGRB 3JV6B 5F1OB 2DBJA 4L3AA 4Y19D 5B38G 4HUWB 3LS4H 1EMTL 5D1ZB 3W9DB 2R8SH 1SYSB 3T1FA 1YDPA 1I1AB 5DD5L 4D0CA 2IF7A 5EZOL 2YZ1A 2YPKB 1VKXB 1F11B 3D85B 3EOBB 2OR8A 4MJ4A 5EB9A 2CRMA 2GK0A 3VGAB 4IIQB 1VDGA 1DVFA 3BRFA 4MNQA 3V5HA 2H8PA 4WWKD 1MJUL 1Y0LA 2Z92B 3QQ3B 2XN9D 1PEZA 4MAYD 2APWA 1FV1B 4NUJB 5EUOE 3CX2A 3PHOA 4XAWH 1S7XA 1XF5B 4PJAE 2P47B 2UWEF 1A2YA 3CSYB 4KMQA 4UBDC 1KLGB 3QEHB 1LO2H 2QHRL 3EJZC 4O58L 4Z7VF 1LNUA 3WFDH 2DQGH 5DJ6A 1PQZB 2BOBB 3FB7A 5F9WC 4U1HB 2PF6A 2NTSP 1EERB 3FZUD 1I1YB 4U1MA 2H2PC 4EDWL 3UC0H 1F8TL 2EKJA