3OKEB

Crystal structure of s25-39 in complex with ko
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
217
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPTNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
total genus 41
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeB01
3JXAA 1OAQH 5I18H 3KGRA 1MRCL 1RK1B 1ITCA 3DLQR 4PUBL 2J2ZA 4P2QA 4NP4L 3EYVA 2V2WA 3ZLQC 5CJ5A 2RR3A 4APQC 3SGJA 2O5XL 5E9DE 4K8RH 1GIGH 4PJCF 4Z0BH 1K9TA 3ILQD 3K0WA 5SWZA 5J1AB 3P4NB 3MO1A 1ZVYA 3OAYH 2JTDA 3IXTB 1ND0A 3GK8H 3BKCL 5I74B 4I2XB 3TNNA 5ALBH 5FM5O 4WU5B 1OLZA 1EVTC 4LDEB 2EE9A 4PJAA 1HXYA 4EQ2A 2P7TA 5GGTA 4KVCL 2AJXL 2WBJC 2ADIA 1Q9KB 4M43H 3SO5A 1YN7B 3EYVB 3V6FB 5ISZE 2V2WB 3MLVL 1XR8A 1AD0A 5FKPA 5I9QC 3HZYA 1H5BA 4JG1L 1A7QH 3O9WC 4XC3L 4KGLA 5JDSA 3RVUD 3MA9L 1CD8A 5JOFB 3IDXL 1FC1A 5HGAB 4GSDH 4YHLH 4JHAH 3MO1B 1C5CL 4X5XB 1JP5A 3T3PF 3STLA 1ND0B 1JPGA 5JMOC 1LQSR 1YQ2A 3B5TA 3I6KA 3QXAB 5IM7A 1HOCB 3L3DA 3B3IB 5FO8A 5DYOB 1TIUA 1A7RL 3MRKA 2DS4A 4KI5E 5IROA 2APFA 4OLWL 4AG4H 5F89A 1FYTA 4JZJA 5CEZE 4RMQA 3GSNA 1KELH 5KG9A 1F90H 1AD0B 4OLVL 3VDCA 5DUMH 1H5BB 3T0EB 2QR0A 5F1KC 5KVGH 4F7CB 1O7VA 3QO0A 4XP1L 3E0GA 1U3HA 1JPGB 1JMZA 4C58B 4LKCA 4LDLB 3W9DB 3MV8B 2VLLB 1LDSA 2ARWA 3SY0B 4FTVE 4U1NB 5CWSB 2AABL 1INDL 4HFUL 4P5MB 5C07B 4XZUA 3MRQB 1NC2B 2E6JA 3TBSA 3BISA 5IBLD 3PQYD 1N2RB 5GGRA 4QHNA 1IEAB 3GSNB 2IANE 3IS1X 5DJXA 1FE8H 5GS2H 5TJWK 4X6DF 1IILE 5A3ID 4J3UA 1JE6A 1PBYA 1INQA 2EDRA 4PFEA 4UT6L 1U3HB 4PBWD 2FB4H 4PJ9D 3CLEL 4E9LA 3RWCA 1FSKB 3C60C 3D3VD 4LHUA 3OHXA 4NNYB 3G5XA 2IG2H 2FX9L 3QQ4A 1I8LC 3F7VA 1G7MA 1LO4L 4WFGD 5GGRB 5DRXA 5HI5C 2ZG3A 5IEKA 3RI5K 4F8QA 4LP5A 1P2CA 3PE9A 4HGKC 4JQIL 3BAEL 3QFDB 4XPBL 1G7QA 5TH2A 2FWOB 3QCUL 3QH3B 2EKSA 5C3TA 5FDWA 2ESVB 3MZTA 3RZCA 5C0AE 4XPAL 2NY4C 3VGGA 2CKBB 3ULVD 4WHDA 4LHUB 1DFBL 4NRYB 3D48R 4WUUA 1G6RA 2PYEB 1X5IA 5CBEB 2A83A 3EYQC 1GAFL 5MEQB 1JNLH 1G7MB 1T5XA 3U9UB 1HKLL 3IU4H 4TOYL 5FYJH 3VFPB 2DBJA 1ULVA 3HC4L 3NA9H 2C7UA 4BJLA 3DSNA 5TH2B 2EKSB 3RAJL 4JRYE 3F7YB 5C09D 1WTLA 5C71A 3HN3A 3TT3H 4BUGA 3PL6D 1G6RB 1LK3H 1Q0XL 1A1MA 1GGYA 2FHFA 4WTZA 5GS1C 3UBXB 4ODTH 4WFFE 2R1WA 3IDGA 3SDAB 1E4WL 3P73B 1FPTH 4LCCC 1DL7L 4UT7L 2PKDA 3JV4B 2FH6A 1WGOA 1S78C 1EH9A 3D0LB 4NHCL 4ZD3H 3ZZ1A 4Y16C 4NSKB 1CDBA 4F9PC 1HIML 1EFXD 1G9NL 3FT4B 1OW0C 2A6IB 4KROC 3CU7A 3STZB 3UROR 3U7YH 4XMPL 3U7AA 1LO2L 3QUYB 5GISH 5D96C 3T8XB 4Y5XA 1A0QL 3WUWG 2CD0A 2ZZUT 3MV11 1T1WB 2DD8L 3KPSD 5DJCB 1RURL 5GJTL 3V4UL 1S9KC 3X14A 1I1AA 2G75B 2RQ8A 2HLFC 2R0ZH 4EI5A 3QIWA 4JFHD 4OGAC 3PV6A 1FO0B 4PREB 2YBRA 1OSPH 4PJHF 5INDB 3WO3B 1FL5A 2H1PL 3TCXA 2OR8A 4WI7A 4YFLI 2O61A 3GRWH 1F8TH 4OT1H 3DO3A 3RTQC 3QIUB 3RPKA 5CKGA 3H9SA 4KK6D 3K2UL 2HT4D 2BY2A 1P7QA 2BVQB 1MJJA 5DK2A 2ATPB 1BEYH 3H9HA 3ALXA 3JUZA 4YFDB 4DFIA 3QIWB 4EDXA 5IR1A 2V2TA 3KLHC 4HIJA 3VXOB 3QO1A 4ESKA 3V7AG 3V0WL 4WW2A 4KTEH 1Q72H 4PP1C 4HWZB 3TBVA 3VI4E 2FECL 2Q86A 3D39E 3PUCA 5D7SH 4JE4B 5HVGB 1OTUC 3L3HA 3M45A 4YDKH 3D2UD 1NCWL 4X7SL 4PJAF 1S8DA 1RUPL 4MQXC 4UINH 4IOFC 1FC2D 4L3EE 1U41A 3ZDXF 3GMOB 2FGWL 4KKAD 4GW5A 3OXSB 5DK2B 5IMMB 1HI6A 2IEPA 3JTSA 1KB9J 3OWEA 4Q9QH 4YEEA 3C8KB 4EOWL 2BY0A 5F7EL 4Q97A 1EMTH 1AGDB 1C12B 3VGDA 4OCWL 4Z8FL 1DBBL 3HMXL 4XRCB 5BV7B 4PS4H 4Y1AB 4G8FB 2Q86B 1JF1A 2W59A 3DSFH 4FXGA 3WHXB 4NQCE 4C83B 4OF8A 5DEGA 4MJ6B 2IAMA 1IGTA 1B2WH 4N5EC 4P23C 2BHZA 1OY3B 1TVDA 1T3FA 2FGZA 3L3IB 4X6FA 3U83A 4JHZA 5L88H 5BRZE 4RZCA 5DJ2B 4FFZL 4HCRL 1I7TB 3MFGB 4QY8A 5SV4A 4UIKH 3JUYA 3QDJA 1WUNT 2VDPH 4YE4L 4TTGA 2NTFA 4I3GA 3Q2CA 4L3AA 1UENA 3GHEH 4N1HB 3MFFA 3GO1L 1IGTB 4JPKH 1OCWH 5GZNC 3NVQA 4KPHL 1T3FB 4WW1B 1PAMA 4RZCB 3BGMA 4IRJA 2YD6A 1AY1L 1H3PL 3LEYH 1NAKL 1RUQH 4GAYA 4IBLT 2HJKB 1MCPH 2NTFB 5EZJA 4BYHA 1Q1JL 3O4LE 1NFIB 1QSEA 1NCCH 1DQTA 1Q0YL 5IB3A 2E7CA 1FVEB 2VE6A 3U4EB 1YEKL 2Q1EA 3IRPX 2VLRA 5IB2A 4YR6A 2PO6B 5JR1L 3PGFL 5IG7A 1BZQK 5HHMD 3H7BB 1R3IL 5EBMB 2AQ3A 3BGMB 3O41A 3CH1A 4P5TC 1NSNH 4XCFL 4ODHL 4PJFB 3VXMB 3U2SB 5BQ7B 1EERB 3WLWD 2JELH 4HS8H 4L4VB 3DVNB 4GAYB 1QBML 2ADFH 5LBSH 2LVCA 5HHQB 4L8SC 5J06A 3FQUA 3NPZB 4J3WA 1QSEB 5IB3B 1KN2L 4MA3A 1UVQA 3Q1SL 5JHLH 3KYNB 3OAZK 3EOBA 3QEQE 3DHMA 4FXLA 5IB2B 3HCVB 4YR6B 3UZEA 4NM8H 4DCQB 3SCMB 2AXHA 1YY9C 4Y19E 2HKFL 1TJHH 4NZDA 2QBWA 4L29A 5DVLA 1CGSL 3GRWA 1LVEA 4XNQB 1DQJA 4PJ7A 1LE9B 3LH2L 5FHAL 1MF2L 1P84K 1MEXL 2BFVH 1RUKH 1VKXA 3VFMB 3PABB 2VQ1A 5L6YH 1JPST 1CFNB 2OTWB 4EIGB 4XI5C 1Q9WA 4IIQA 4ZUTB 1A6PA 5FYKD 5FECA 5GSRB 2AJSH 5HHVL 1FV1A 2X10A 1UZ6F 3IFLH 5CD3B 1HHJB 5E03A 4Q9RH 4JO2H 2X4OB 5D7KD 1DQJB 1G7IB 1T20A 2VLJE 4N5UA 2D9QB 1WWWX 4OUOA 1DBAH 1ZV5A 3UTTA 4M5YH 3HNVH 1JI1A 5D7IA 1KTDB 3VJ6A 3BGAA 3D9AL 4MNQE 3U0WH 5IQ7L 1VEOA 4R90H 2KPNA 1EEYA 1VFBB 2YZ1A 1A7OH 1QYGH 1IE5A 4IIQB 2BNQD 5CUSH 4HDIA 3OGCA 1IGMH 3X12A 4YHYC 4JFOA 4APQA 5JNYB 1T89C 4BSWB 1ZMYA 5TE7H 3TA3B 2G5BA 4NQEA 4GAJH 1J8HB 1W72B 5H8DA 3NCEB 1P4BH 5KSUB 3S5LB 5B39G 2OSLB 5D7IB 2E9JA 2AKRB 1GL4B 1JWMA 5AYUH 5MENB 2WBJA 5JQ6H 1EEYB 1I7ZB 4NO0D 1ERNA 3MV01 3HRZA 1RJZA 3O3DA 4JFOB 3O9WA 4ZFFA 1K2DB 4OZGE 4ZQKB 1RIUH 1BOGA 1AE6H 5KAQF 2EECA 2VOTA 3MJ9H 1PG7H 4PG9A 1IT9H 4U6VH 3RVVD 5IW6B 5EULV 2VLKB 4XCNA 4E41E 1DZBA 2WBJB 2P5WE 2VQUA 3GIZH 3QZWA 1MELA 1OM3L 5F3BB 5F97E 2VL4A 5D70L 4JFZH 2EIEA 4WW2F 5I9QB 3O3DB 4BSJA 2GJJA 3M8OL 3VXRD 4P9ML 4OFKA 4JZNB 1BOGB 3L1OH 4X99A 1WFNA 2ITDA 2P5EA 3THMH 5ICYB 5SWSD 1ZLUK 3QP3A 4GLRI 3UTSA 2CGRL 2YR3A 1RHHB 2EKJA 3BIBX 3RY6C 5I0DA 3MLUH 1NGYB 1MNUL 4ZS6C 4NYLA 1CLOL 2N56A 4M5ZL 5EA0H 4F7MA 4AIOA 1ZVSA 4ODWA 3PF2A 4DAGH 4I48A 4EI6A 3ARFD 3MRPB 5AWNL 3KNBB 3GIVA 1UM4L 3L3KA 2A77L 4RFEB 3VFSB 3C5ZD 1R3LA 3PJSB 1FP5A 3NABL 4MS8D 5ITBL 1N0XH 1UM5H 3RVXC 3C60A 2BVEA 4JY6B 1VCAA 1C08B 1NMAL 5EIIA 1JUFA 1WCBB 1GZQA 3HE7B 5IFJB 4ZUVB 4QHMB 4J4PC 1I8LA 4K9EC 2WIIB 2ED9A 4NQVA 1UCBH 2BOCA 1WIOA 3GBMH 5LCVH 3GB7A 1M7XA 3PP4H 3OKDA 1FZKB 1YEJH 1C1EL 1C16B 4JRXE 4IRZH 3L3KB 1RIHL 4R2GD 2VYRE 5GS0D 2DL9A 2G60H 4DGVH 2B8OT 3W9EA 1MFNA 2Z91B 1HSBA 2EYTB 4PIRF 2UWEF 1FIGH 1KLUB 2ERJC 4HH8A 4NQVB 4LASL 4S0TD 2GAZA 4JO4H 3GB7B 1KIUA 1MIML 4N68A 4PTTB 3TBYA 2AJYL 1JV5B 2Y36L 5LQBL 1GOFA 2HJLA 4U1JB 5JPMA 3LKNB 5LG1A 3GSQA 4L5FH 3T77B 3GMMA 4PJ5A 3O45B 3REVB 1XH3B 1TZHA 4D8PA 4L4TB 4QRPD 4S1RL 5GS1A 4G6KL 2IF7A 2H26B 3RJQB 4LCCA 5F7FA 4MX7A 1QRND 5IB4B 3B9EA 1X7QA 4FXKB 3CH8A 4NUGL 3TBYB 4TQEH 2NY0C 2YSSA 2GSIA 4LSSH 5JUEH 5D7JD 4EVNB 5CSGA 3GSQB 2BOBA 3BKYL 2R0KH 3QEGL 4Y16A 4F9PA 3GMMB 3LEVH 2OL3B 1GHFH 2IPUG 3FOLB 2FYYB 4X7FC 4CW1A 4ZUSA 2XFXB 1XGUA 1OW0A 4NT6A 2VDRH 1B4JH 2CDEB 2VDMH 5I30L 4K3JL 3MJ9A 3VWKD 4JDTL 1NGZB 4R4BA 3CK0L 5JQHC 3DYMA 1JTTA 5E8NB 5ADPH 3GBNH 4KRMB 4P2QD 5D72H 2DQIH 3M1BA 2DMKA 4HUKB 3KYMB 4KMTH 4LLWA 4XNYH 1U93B 2DTSA 2R69H 3LPWA 3W0WE 3BW9A 4CL7A 1KUMA 2BOBB 3PP3K 1CICB 2BSTA 3FO9B 2VL5A 1NCBL 4LLAA 5SWZD 1IAII 3AY4C 2PCPA 3H9ZA 4TVSa 1VEMA 3S8WA 2D0FA 4TSCH 1MCNA 2UZIL 3RUGB 2NYYC 4PJDA 5FO7A 3PGCA 4BUHA 5IP4A 2YUZA 4NC1C 1DSFL 1J1OH 5DZOA 5I1IH 1BREA 3RTQA 3NBNA 5L2JB 4PV9A 4M1CC 3EFDL 2NX5E 3BW9B 4JFEB 1MCWM 2IADA 2VL5B 3CZFB 5H2BA 1QBBA 4LSVH 1WZ1H 4LHQB 3BN9D 4N8CL 1FZMA 4Z7QE 5D1QC 1PFCA 4LIQH 2AJZB 1HHHA 3MLYH 1QTYT 5FO9A 2V9QA 2HVKA 1U8NA 5F6HI 2C3HA 3FONB 1LEKA 2DQUH 1CGWA 4PLKC 1FYTD 4DGYL 1KC5L 5EOCH 4PV9B 2P1YA 2E7BA 4YHNA 2B5IB 1A64A 3DNKA 5DF0A 2IADB 5H2BB 2NXYC 5JIKA 1VB9A 3CLFH 4G5ZL 4NKIL 2NY5H 1U3HD 1F6LL 3Q5TA 4D94A 4WJ5A 2DQJH 5LKNA 5T1LD 3MGAA 3OKMA 4ALAH 5FO9B 4TRPL 4WU7A 2BRRL 3LKQA 1MHPL 2G5RA 2VABB 3T4AB 3V5DA 4HQQH 2DI9A 3KDMB 1D5MB 2UUDK 3E2HC 1P4LA 5IJVA 1LILA 5BVJA 4P23A 1WJ3A 3QRGH 1DCLA 2HT3C 4LKXA 4YJZL 5DRZA 4I9WE 3UYOD 4DN3L 4TTDC 5I1HH 4TVPH 1E4JA 4YH6A 3DX7B 3LIZL 1O5DT 4LHUD 1YPZA 3MUY1 4M6ML 1NFDA 5KSVA 3ZHDA 2R2CA 3V5DB 1Q9OB 5EU6E 1PSKH 3LHPH 4CNIA 5BCAA 5IJVB 3MGTB 5DJ8A 3IKCB 2QADC 1HQ4A 1IC7L 3PWUB 4M9OA 4JCMA 3E6HA 4JN1L 3V5KA 1WISA 3TV3L 1J8KA 4HT1L 4U31A 5E6IB 1IZJA 4LLQA 2FCBA 1KG0B 1OGTB 3RZCD 3TBWA 5E99H 3ROLB 2FL5B 4HUWA 3EDEA 4XNMA 4HX1B 1CE1L 1YPZB 4WUUD 1RZIB 4G6ML 4LAQH 3SKMA 5DJ0B 3ZO0A 1NFDB 3QUXC 3CDCA 4N9OB 2R29L 3HAEA 5GHWL 4NJ9H 5J12C 3CFJA 1OSZB 2Q8AL 1V3MA 4C4KT 2R0LH 5SX4H 5BS0B 2LU3A 4OAWA 3E6HB 2WINB 3V5KB 4DGIH 1I3RB 4FG6D 1G7LA 1NLBL 2W92A 4O58H 5AZ2L 2DLHA 4MDIA 4P5TA 2VITB 1KCLA 1XGPA 4XNMB 3BPCB 3FOMB 1KCVL 1XEDA 1JPTH 3CFDA 5ALCH 1HSAB 5E5RB 4XXCC 3P9MB 1T21A 4L8SA 5T1KA 1C5DA 2QL1A 4MAUH 2DTML 2JCCB 3CFJB 4KI5C 4H5SB 2R2HB 2R4SL 2WANA 2FBJL 5C8JA 2VAAB 3S37X 4PLJD 1M05B 1SJEB 3VXUA 4FZEL 3T09A 2Y07H 3WNLA 5DHYA 1EO8L 4MDIB 2AV1B 1ZLWH 5FYKL 2IQ9H 2BSSA 4K9EH 3ZKNC 4JGJA 5TQ0L 4ELME 3T0AA 5FYJU 5C08A 3SPVB 4OGYL 3IDIB 1ED3A 4G3YH 4HGWB 2PR4L 4F7PB 2VIRB 3ZTJG 2B2XH 4PJXA 5E70A 1A6AA 2VZOA 2XQYK 3HC0B 1MHEA 5KSAC 5C8JB 1CGTA 1M71A 3UTPD 2EDBA 3O3AA 1WZMA 3MBXL 4KKBD 3EHBD 4Y88A 5BXFA 4U3XA 3MLSH 1PKOA 1I1AD 3MRCB 2BSSB 1N6UA 1GGUA 1OAKL 4EI5D 1TZIA 4X6BA 4N8VB 1RUMH 3QA3A 1B9ZA 3QIWD 4YWGL 2V5MA 1H15A 1II4E 4G43B 2VXTL 5E0QA 1F4YL 4PJXB 4PGCA 3S88H 2DYPB 3WS3A 3IDYB 1U95B 5EU7E 5L2KA 1M71B 1T89A 5JTWA 1G7PA 3RQ3A 4PY8J 5E4IA 3O3AB 3H9SD 1XF4B 4YHML 3MXVL 4LLUA 4Z0XB 1P7QD 2Z8WC 4P3CH 1N59B 3CJJA 2GITB 1TZIB 4KK5C 4JFYB 3QA3B 3PWLB 2GCYB 1HHIA 4QTHB 1KPRB 2QHLA 1OAUH 4PJEF 3I50H 3DUUB 5C0BA 2DJSA 3EOAB 4XHJC 5C0CE 3ZT5A 3BZFB 2V5YA 4HUVA 5LWYL 3KJ6H 2JB6A 3QDAA 3BD3A 3O3EB 4MGXA 4F33A 1I1RA 2IC2A 2AJVH 3KPMB 5HPMB 1FVCA 2BJMH 3VCLA 2CKNA 3RWGA 3BKJH 3RWHB 1IVLA 1NUGA 1FH5L 3OMZA 1S7RA 3PDGA 1F4XL 3GMNA 5EFIB 4LCUB 1CDIA 5CEYA 3F65A 3QXDA 1U3YA 1G7HB 1ZT4A 4OJFL 3HTLX 3FRPG 3VD4A 4BKLB 4LCWB 3WD5H 3PHQA 5J13C 4LEOB 1OPGH 1LHZA 2OTUA 3EOTL 2IFFL 5FFLA 4R26L 5B3NA 1B0RA 1NBYB 3OKYA 3TO2B 3WUZA 2I5YH 1R5VB 1JPFB 4F33B 2PF6A 2IAMD 5MP6H 2QQLL 3VU2A 3VCLB 3DROA 2Y06L 1T83A 4IRSB 1N5AB 2VR9A 3GMNB 5F7MC 5B38G 3MLXH 1CIDA 3W11C 4HFWA 5CEYB 2D31B 4CMHB 2A2QT 1AC0A 4S10A 1JZ3A 3RY6A 5JHDA 4X4XA 3JV6A 2P43B 2P49B 1U8MA 3QDJD 5LVEA 3DMMC 3B2UD 5JIIA 5GXBB 3BRFA 3HMWH 1PVHA 1Q94A 2YC1B 5HD8D 3O8XC 2P48B 4EJ1C 1YMMB 1YDPA 4NZRH 3NIGE 3MODH 1YNLL 4XWGH 1FFOA 3SEPA 3BHBA 2EDTA 2ADGB 4HBCL 4IRJD 2XTJE 3GUTB 2E3VA 1H8SA 3GI8H 5EO9A 1AHWB 4HXBL 4PYGA 3DYOA 3I2CL 5IESL 4J4PA 5AUMB 5DVMA 3NZ8B 5GS0L 1WBZA 3UJJH 3U48A 4RWHA 1HQRB 3HUJF 3HG1E 4OD2A 3MRRB 3SDCB 1G9MC 2E27L 1YDPB 2VLRD 4XCEA 1PZ5A 1IAOB 3WFDL 3L5XL 1WFUA 3OZ9H 1I9IL 1M7DB 1FFOB 5DRNA 1KJMA 1K6QL 3QISA 4NRZB 5I1JH 1SY6L 1E6OH 4LLDB 4XB8A 1GZPB 1QSZA 3QUMA 2D7TH 1TETL 4GXVL 4V2BA 3T0XA 1ZLVK 2GQHA 3GM8A 1ZHBB 5CILL 4RX4A 4OD2B 3EYUL 3VG0L 4JLRB 5JZ7C 4JO1H 4HF5L 2CO6B 3BUYA 5IHZA 1ZSDA 3UJIL 4DZBB 4QF1A 1KEGH 3QDGE 5GGSY 2YD8A 5DT1L 3RIFF 2A0LD 3BYYA 4JFQA 5IFAL 5T1MA 2AQ2A 4A6YB 1XGRA 5E1AA 4M4PA 4MJIB 2EDLA 2W1NA 4ZXBC 1TQCB 5DDHA 4PRHE 1T7YA 3AAZB 3O6FC 5ELIA 5L8LB 4O5LL 5I75C 1FNHA 3QPXL 4GFTB 4LCIH 1DE4B 4XX1G 1FJ1B 5JA9A 2N1KA 4ODUB 5IHZB 2IPTH 2VNCA 1AO7D 2YA2A 2HTLD 1T03H 5D7LD 1T1XB 3MNZB 5DJYA 4M7KL 3MROA 4LLYB 3UTTD 4GG6A 3MJ7B 1V3JA 2I9TA 4NFCA 1P84J 1IGYA 3BPLC 1F6AA 5DZNA 2FSEB 1MREL 2DOCA 2NY0B 3L9RA 4LSQL 2MJWA 2X41A 3P11L 3QUZB 5GGTL 4APQD 4NGHL 4Q74A 1IKNC 1MCKA 5KTEH 3EJJX 3SJVB 3U4AA 5KVMC 5T5NG 3WEXA 4NQED 3AY4A 5HDLA 1JZ4A 3K4AA 4KJPC 4K23L 2P8MB 1G6VK 4OFDA 1O0VA 3MROB 4E5XB 4ZNCD 3OAYK 4M1GH 2BMKA 4I4WB 2ICEA 1U8QB 4NQDE 1IGYB 1F6AB 1MRDL 4DVBA 2WBJD 1I9JL 3GMRA 4RDQG 1CF8L 2VAJA 2GTZB 1WZLA 1TJGH 3DUHA 5KZCB 3QHFH 4ETQB 1XF3A 3BWAA 3FN9A 4HWBL 5KOVC 4QKXB 4XBEL 4OBSA 5GSVA 3TJEL 3L5IA 3O9WD 2Q8BL 4YDJB 5A2KH 2GEEA 4ZOCA 4OFIA 3NGBB 3T4YB 3GSNL 3ARQA 4FQXC 5D1QA 1D7FA 5C92A 4J12A 4OZIE 4ACPA 2BMKB 1KIPA 5D2NB 2HH0L 4P5KB 2Y5EA 3GMRB 4EN3C 3U30B 5FUZH 3WDIA 5I66A 4U1GC 1S7VB 3LZFH 2F8XC 4JVUA 3QQNA 3IT8D 3OB8A 1GGBH 3VFVA 1F13A 5K9OB 1MWAB 1WV7T 3HNSH 3LKSB 5E6ZA 2P5ED 4HIEA 1JNHB 2XWJB 5ENWB 1U8LA 4L3CB 3UTSD 4ODXA 4X9BA 2L4OA 1KIPB 2KQNA 4R4FH 4AMKH 1FNLA 5I1CH 1QSFB 2FLRT 4GBXC 2LU4A 5KSBA 1T04B 4LOUC 3IJHA 5I66B 1BGXL 3MNWA 5DMJB 3UJTL 3P4MA 3Q0HA 5D6CA 3LS4L 5C0RL 2D4FA 4GJTB 5D2LA 1WWBX 3MLPA 3S37L 2NXYB 3U36A 2ZUSA 3AS1A 3MA7A 4HIEB 2WBWB 1BM3L 2NY3B 2PN5A 3KPOB 2DWEA 2EZ0C 3BIKA 1U8LB 1KJ3L 2YD9A 3QNXA 4JY5H 4WUKH 1JNJA 2J8UA 2ZCHH 3C60D 2R23B 1DN0B 4E42A 3WHE1 3G04B 3QNZB 1DLFL 4OLYL 1I3GH 3LMJH 5HI5D 1UEMA 1G6RL 3P4MB 3C2AH 2FBOJ 1T2XA 3ULSB 5FDYA 3Q5YA 4F3FA 3IFOA 1RMFH 1ZANH 3WFHA 1NGPL 3MA7B 4FFYL 4L9DA 5E9DA 4L8DB 4HWUA 3ILPA 3S3JA 3S3PA 1YYLL 2NNAA 4F57H 2NY4D 1RPQA 4KAQH 5CMAA 3ZTJH 4TUKL 3S34H 4Y4FB 1JGLL 2DRUA 2EO9A 1A4KA 5JOPE 5F7HA 2PTVA 3QUXA 5FM5M 3RA7H 1JK8A 3EYQD 5DMGC 1D5XA 1S7WA 3BZ4B 3Q3GB 2QADB 1F4WH 4MYWB 1EAPA 3M17A 5ISZA 3RFZC 1I7UB 1QSVA 1MFAH 5B3JF 3V4VH 2DLTA 2H32H 4FQHA 1BD2B 4PJ5D 3ILPB 5JMRA 1FNAA 2NNAB 2AAVA 1ONQA 3CXDL 1WITA 2UYLA 4TUOB 2YD2A 1MSPA 3L5WA 3O6LH 3P0VL 2HVJA 3JBG7 4MCZB 3B9KB 2HMIC 1N0LA 2AEPH 4GKSA 1F58L 4NQSA 2VSDA 2JJTC 1NFKA 1CR9L 3QEUB 1KTRL 1EAJA 1S78D 1MHHB 3FN0H 4BFEA 2W9EL 5ESVA 3EO1A 4Y16D 4XP6L 3BZEA 3CX5K 2XPGB 5FM4A 5I19L 1IGCH 2O5ZH 4QOKB 4KROD 5IEHB 3L5WB 2HVJB 5DO2C 3BO8A 2C3GA 2E5EA 4Y89A 4C56D 3MJ8B 2PW2A 1JZ2A 1G9MH 4FTVA 2HFFB 1XZ0A 3EO0A 5E8EA 3IFPA 4Z95L 1VSCA 3RWEA 2V7NA 3O6MH 5HGDB 5KSAA 3QJHA 4LARL 3SOBL 5HHPB 1KYOJ 4YZFF 4QXUH 2WQRA 3BFOA 2IANA 3MBEB 5J9PB 2V7HA 4ZS7L 5T3XH 2HLFD 4ONGH 4FNLL 4TULH 3DX9B 3BJ91 4OGAD 3BO8B 2VH5L 1A8JH 5BJTA 4DK6A 4R6UA 4Z7WB 1OTSC 1XZ0B 5IFHL 4YDVA 3QDHA 1WEJH 2B0SH 2NTSP 3KPRB 2V7NB 4R97C 4WHTA 1UKQA 2ZSWB 3QJHB 2QSCL 4OZHE 1WFTA 3RTQD 1INEL 5BV7L 2IANB 2LE9A 4U6XA 4Z7UB 3V0AC 1NBZA 1KPVA 1EJ6A 2H6PB 2DQHL 3RVWC 3BP6B 2Z8RA 3KLHD 4O2FA 5C0AA 5BJTB 4HMEA 2DKSA 4M7LH 1SBSL 4PP1D 2YOCA 4U1HA 4YDVB 3NN8B 3PG2A 2ICWA 4B50A 3RGVA 5FUCE 4WHTB 4DUVA 1AXTH 3ZKMD 1JMXA 1OTUD 1HDMA 3NH7L 3K4ZA 2YRLA 1EEUA 4WFHD 4MQXD 4LNVA 1FRGH 4IOFD 5E8DL 1KIRA 2NY2C 3O11A 2EH7L 2PETA 5C0EB 4JAMB 5IB1B 4N0CC 2EDNA 4JRYA 4UU9A 1WCQA 4BZ1H 3GJFH 4DTGL 4YAQA 1TQBB 1L7TL 4B7LA 3AM8C 1W0WB 4U1HB 5GJSH 3MR9A 1LO0L 4WY7H 3RGVB 3WFCL 4RGOL 1FL6A 5JOEA 4GRMB 1NGWA 5C0FA 4M62H 5EBWB 2HLAA 4RIRB 5I0ZA 1J1PL 4N5ED 4P23D 4HPYH 3A67L 1NEZG 1KT2A 2H9GB 4NKDA 2VXQH 2DQFB 3RL1B 4MQSB 1JGVH 4P2OB 1BQHB 3GBLA 3WLBA 1BBJB 3BDYL 4LEXL 4YAQB 1BPVA 1MRCH 5HGBB 3ORJA 5J13B 4F37K 2H32A 2UWEB 5T3ZE 3W5NA 3GSUB 3DMMA 4PUBH 4NP4H 4YBLB 4UDUA 4KUZL 2GT9B 4ZNEE 4I2XE 1EJOL 5EOQL 3SE9L 3BP7B 5C6PB 4XWOC 1IAKB 4LK4A 3O8XA 32C2A 3B9AA 5GRZA 2O5XH 1FORL 2HLAB 5GZND 1P53A 4FQCL 4YIQA 2WMPA 1KT2B 1GGCL 3BKCH 5CJOL 2IFGA 5DRWA 2YN3A 1RIVL 4EIZC 3UTQA 3MOQA 4KDTC 2Z92A 4FN0A 4KVCH 2AJXH 3RWJA 4BH7A 3OKOB 4KTYA 3L7FA 2BERA 4R0LB 3MLVH 5EBGA 3LKRA 2J8UF 4JG1H 4XC3H 3MA9H 3L3GB 3CZJA 3GSXB 3IDXH 3OXRA 4XBPA 1C5CH 2B4CC 4N90E 2D03L 2VZTA 5DC0A 2ADJA 5DRWB 2EXWC 3UTQB 5AZEL 4P5TD 4ZFGL 3DRTA 3T0EE 1A7RH 4OLWH 1VADB 3HI6L 4QRSA 4RWYL 25C8L 3DXAB 3L7FB 1ORQB 4ZG1A 5T1KD 4YLQT 3I84A 4OLVH 4ODSL 3CFBB 3MV8E 4JPWL 2BVUA 3D39A 3OXRB 4UIMB 4Q7DA 5C07E 4OI8A 4LVHC 1JWUB 4XP1H 4Q6IB 5MERB 4G9FB 1YY9D 3DV4A 3VXUD 4WEMB 1DR9A 2ADJB 4L3EA 4ELKA 2D7MA 3V6ZB 1KB5A 2AABH 1INDH 3FKUS 3HI5L 3A6OA 4UZGA 2EDWA 43CAB 4HFUH 5C08D 4JM2F 5TDPA 4ZXBA 4PD4K 1HILB 2DKMA 1VHPA 5DSCA 3CSBA 2MQCA 3O6FA 4O2CA 1N26A 4XI5D 1DQQB 3VXSB 4AENA 3BJLA 5D1XC 4LSRL 4NQCA 4UT6H 4S2SB 3DV4B 1J12A 4L3EB 1JPSL 3CU1A 1NBVL 2QLVB 3KWWA 4NCC1 3CLEH 2R56L 5ANMB 3LV3A 2LVEA 4P57B 5BRZA 4HK0B 4OIIL 3CFCH 2FX9H 4XXDB 2D2OA 1MCWW 2ESVE 3HE6B 3V8CA 1LO4H 4JFXB 2DLIA 3TVMC 2Y6SC 1MAJA 1EGJL 3O4OC 5JORB 3GJFA 5J6HB 2OK0L 3BAEH 3PWPE 4XPBH 3NPSB 2PYEE 3VXTB 1OAYL 4JFDB 5L2KD 1SHMA 4PJ8C 3ULUE 3T0DA 1X4ZA 3QCUH 4K7PX 5ILTL 1LO3L 1IKNA 3FJTA 4LQFL 2JIXA 2LTQB 4XPAH 5IBUG 1DFBH 5H37H 2ATKB 1A9BA 2J4WL 1GAFH 3MRIB 2MFNA 4NN7C 3QNYB 1D5BB 5C0BD 4TOYH 4NRXB 3HC4H 4OQTA 4X4YB 3OB0K 3ARBB 5DJZB 1I8KA 1KPUB 2D4DA 5SX4I 4TUJB 5HDBF 1IARB 1WIUA 3RAJH 3BD4A 3WNKA 1KJ2A 1SMOA 4X6EA 1DEEA 2NXZB 4P3WA 4FQXA 2XKSA 3AU1A 3PWJA 1Q0XH 4RMTA 4IMLB 1E4WH 1CXIA 1DL7H 4UT7H 4YDLB 1IRAY 2ZUYA 3H6JA 5IK3B 1IFHL 4EN3A 8FABA 5I8CA 4NHCH 1I8KB 1JHKL 1OTTC 5B8CB 4NC0B 3QEQA 1HIMH 1G9NH 3TO4B 4KJQC 4NC2B 1NCAL 4ZAKC 1KJ2B 4Y19A 3W5MA 5DQ9B 2MNUA 3AU1B 3PWJB 3TN0D 4R9HA 4FA8A 3BPNB 3ZDYE 4XMPH 5JHDD 4ZS6D 1LO2H 4GBXA 3RDTC 4EDWL 4MWFA 2P8LB 5D93B 3MV9B 5F3HA 3ESUF 1XFPA 1A0QH 4U1GB 4BM7A 5I8CB 3I3EA 1F42A 2DD8H 4QHLB 4H1LH 4ENEC 1RURH 5GJTH 3V4UH 2QV2A 3R0NA 1KCKA 1EPFA 4OF0A 4HUXA 4Y19B 3C5SB 3QBTB 4PJIB 4KK8C 2V2XA 3VXQA 2KL6A 5DLML 1B88A 1BZ9B 3RVXD 3WFZA 2VLJA 1W0YT 4OI9A 2VXSL 5FGCB 1S5HA 2H1PH 2QSTA 4YK4C 5F71A 1JHLL 4J4PD 5CSZA 5IVOA 3KS0J 5C0GA 1P4IL 4MNQA 4ETYA 4OIBA 1YY8A 3K2UH 2ZJSL 1QO3B 2CUHA 2BY3A 1EUTA 5DC4B 5EU7C 1I3UA 3QIBC 4AM0A 2BNUA 3NIFE 4OZFG 3W2DL 5JIHA 1SM3L 4DOHE 3VXQB 3V0WH 2Q3AA 1PX4A 2X4QB 3D6GA 4XVUC 4G6FB 1T22A 2AV7A 1NCWH 4X7SH 4MNQB 3OR6B 4EBQL 1RUPH 1HYSC 4XP9L 1HH6B 2FGWH 4WEBL 4RX4D 4Y1AE 4EUPA 5I6XC 3LSOB 4G8GE 2BNUB 4OZGA 4EOWH 5F7EH 4P46C 3ZE0F 4M7ZB 4QCIA 4HKJB 1MJUL 1ZK9A 4OCWH 1E27A 4Z8FH 1DBBH 3HMXH 1U3ZA 1HCFX 4G8EA 5K33A 4MB3A 2FJFA 3BYTA 2EDQA 4G80B 3CPLB 4WWID 1NDMA 2EC9T 2AV7B 1BQLL 5IW3A 2A38A 1U2CA 4E41A 1I8MA 1HEZB 2JJTA 1T0NA 2B20A 2P5WA 3V52L 5F1IB 2NY0D 3C9NA 5JW4Q 3MREA 4CU8A 4WV1C 4FFZH 4HCRH 1KTLB 4QCIB 3VFWA 3AROA 1OP5H 1E27B 2FJHB 4PJEB 2YPKA 3BQUB 2EEBA 4YE4H 5C9JA 1E4KC 3CVHA 4YPGA 2DMBA 4PJBF 2O93L 1QLFB 5SWQB 3GO1H 1NDGB 4FRWA 3DPBA 3MOAL 3RIFK 1CXLA 4KPHH 1XCTB 3D85A 3SDDC 4Y4HC 3MREB 3ZKQD 1QFWM 2IJ0C 1AY1H 1LP9F 1XGYL 1H3PH 3NTCL 1NAKH 3IDNA 1A4JA 1EA9C 5E8OB 4JPIB 1IM9B 2NYYD 1Q1JH 1WK0A 3SHSA 4YPGB 2XTJC 1OHQA 1SBBA 4JY4B 4MMZC 1Q0YH 2G9HA 4PJFE 3VXME 2X1XR 1YEKH 3LS5L 2EEAA 4ZPVB 4L4VE 1ORSB 1VACA 4OUUB 3D69B 5JR1H 1RZKC 2IH1A 3PGFH 1RV6X 1FZOB 4PY7A 4M1CD 1R3IH 5F9JA 4RBPK 4XCFH 4ODHH 1M7IA 4H1LA 1UEYA 3WIIL 2XXCB 4JRXA 3VWJC 1QBMH 1A4JB 4OKDA 4PRID 5D1QD 3EYOA 4HS6B 2GFBB 5FYLE 2F5BL 1A47A 2G9HB 3NIDE 1KN2H 2UVFA 1BF2A 3Q1SH 1I4FA 2IH1B 1GXEA 5FEBA 4PLKD 4EKXA 2HKFH 1J05A 4PRAA 4PY7B 4EXKA 1BLNA 1CGSH 3BP4B 1CFBA 4ZFZB 4QRRB 4WO4C 5HXMA 2X4TA 1BFOA 3LH2H 5FHAH 2OMNA 3CFIC 1MF2H 4P2YA 2FX7L 1MEXH 2BXZA 3LRHA 3WUWB 1DUZA 4G8IA 5JXEC 2VDOL 3EYOB 2XWBA 1I9EA 3AM8A 2V9TA 2HN7B 3FQWA 3IB4A 1ES0B 1NGXA 1VERA 2A74A 3RBSA 3U6RB 5HHVH 4AEFA 1J05B 2I60L 1PG7W 1S9VA 2HT3D 2X4TB 4MB4A 5C1MB 1U8IA 5CZVL 4UMGA 1EZVX 3TH2T 4TTDD 3D9AH 5DQJA 1R5WB 4S1SL 1ZTXL 5IQ7H 3FO2B 2XWBB 4IS6A 1UXWA 3CC5A 2ZOLB 1XR9B 2OMBA 3RRQA 3T3MF 1J8HE 3CSPA 2A74B 1M6OA 1PLGL 3HMXA 4U6YB 4S11A 4ZTOL 2OI9B 4L9LC 2A6KB 2CDGA 5MENE 3W81A 2VDRL 5ESQB 3W0WA 4EZMA 5E9DD 3KPPA 4KDTA 1UH3A 4C59B 5HVWA 2JK5A 4IS6B 1UXWB 4J3TA 3H9YA 3HZMA 5HHOB 1FGNL 4K3GA 4XNYL 3TWCL 2YS4A 3MCKB 5TE4L 3QUXD 3ZKSD 1M6OB 3VRLF 5DD5L 5T5NF 2YD1A 2J6EA 2AXFB 2ZOKA 2VLKE 5IHLB 5CINL 5IVXF 5E08L 3I6LE 5D1ZB 4AIZA 2A1WL 1HNFA 4Y5YC 5ISZD 4K7PL 3W0WB 2NCMA 2NX5A 5E00A 5KS9A 3EBAA 4NCC2 1UM6L 4YHPA 3P0YL 1YZZA 3FQRA 5J6GA 1I1YA 2JK5B 4FQJL 3T0BA 5D9SA 2QTEA 5BVPL 1AGFB 4KQ4L 4H0GA 1OM3H 1QG3A 4ZO7A 3BH8A 5D70H 1WWCA 3GSRA 3M8OH 1DEDA 4KI5D 4MA1B 2QKIA 5GGUB 3C2SA 4P9MH 5JW5A 5FB8A 4YXHL 3CDFA 1HXMA 4KY1L 1B0GB 5CEZD 3U46B 2OX5A 5A1AA 3D25B 3GMPA 4MXVE 4WNQA 1A5FL 2NX5B 3TFKC 4L8CA 2CGRH 1F4HA 3VFRA 3FQRB 1KCRL 1MNUH 4U0QB 3FO1A 3ZKND 1P7KB 1ZLWK 1CLOH 4M1DL 3RWIB 1BIIB 4M5ZH 4OZGF 3VFNA 3MYJB 3QEHA 1D9KB 4YHIA 2CIIB 4DEPB 4FTVD 1WIPA 2X4UA 5AWNH 2X44D 5KSAD 1RY7B 4LVHB 5D1XA 1RUAL 3FQNA 4QTIL 2VLME 4LRIC 1UM4H 1R5IA 2A77H 1ZWIA 4NKMB 3MUHL 3FFCB 2BK8A 2JJVA 3NABH 5ITBH 5IQ9B 1NMAH 3IVKB 2ZCKL 4RNRA 5A2IH 3CX5J 2ICWI 3CSYB 4NKOB 3TVMA 3MRMB 1DN2A 2HJFB 3T1FA 5E56A 2FIRT 2VKXA 5D8JL 4XAWL 3UDWC 4PJ8A 1SQ2N 2I07A 1WQVT 4WI5A 1JNNL 3C8HA 5EU6A 1C1EH 3N1GC 2HRPL 3NCMA 3BESR 2YPLB 1ZWIB 1ETZB 5HYQA 1RIHH 1JYVA 3SE8L 2NY6C 1MQKL 3IDJB 5A16B 4DWHA 4KK5D 1JYWA 1U36A 3VXPA 3EFFB 1TVBA 5C0AD 4Z9KB 4LASH 2GK2A 4WWKB 5MI0C 4N0FA 5E95B 1MIMH 1GSMA 4XHJD 1WVZA 4L4TE 1IKFL 3QQ3A 4K71C 5FM8A 2AJYH 2Y36H 5LQBH 4O4YL 1NKOA 1GOHA 5CJQL 2ENSA 2I07B 3G6DL 3H3KA 5FA3A 5CAYB 1RJCA 4CADB 4KKNA 2XN9B 3BEVA 3MNVA 3DVGB 5HYQB 4G7YL 5H94B 4CVZA 4NKQB 2DWDB 5FCUL 4S1RH 4UAOC 1XGQB 5CKAA 2FRGP 1D6EA 2RBLA 4G6KH 4Y2DC 4JRYD 3UPAA 3ALPA 4IOIB 4HIXL 1OGAB 4LNRB 4N0FB 3VW3L 4NUGH 5KN5B 4K94L 5DI8A 3TYGL 2XZAL 3EDJA 4WFFD 5IIEB 2DQDL 3QI9B 5FA3B 3BKYH 3QEGH 5BO1L 1DDHB 2FEEL 2GJZA 3FT2A 4ZAKA 3RNQB 1NC4A 2OXGA 4ORZC 4O51B 1CYGA 5I30H 4L8BA 4RRPA 3FRUA 3JWOC 1D6EB 4WGWB 2FO4B 2VXVL 4K3JH 3MV7B 3LQAL 4JDTH 5DEFA 1MRFL 4HUMB 4ELMA 3CK0H 4NBYB 3RDTA 3FAWA 4LCYB 4X4ZA 4DKEL 3P3YA 3DMMD 1U58B 1G0XA 3LRSA 2YUXA 2YD3A 3RUGE 1E6JL 4QXGL 1L7IL 3PDOB 3O8XD 4K9EL 4HJJL 1HKFA 1KXTB 3OKEB 1NCBH 5DMYA 1J0YA 2I9LB 1ZEAL 4HWNA 2UZIH 4RA0C 3FRUB 3N50A 4Z77A 4CVWA 1YEDB 4HKXB 3OSKA 5DEFB 4JFEE 1G9EA 3QG7L 1KOAA 1DSFH 5ECJE 4I0PB 1VDGA 4D0CB 1S3KL 2AS5M 3CUPB 4A6YL 6FABL 3GFUA 3TZVB 1J88A 2Y7QB 3EFDH 3WO4C 1NJ9B 5DXWA 2XY1A 3QUML 2LFGA 5F1NB 3AB0C 2AK4B 4XP5L 1BOYA 2BNRB 5ADOL 5IMLA 1CXEA 3LQZB 3CFEA 3MMEA 4NCDA 2D7OA 1IMHC 3OKNA 4N8CH 1MH5B 2PTTA 4GQ9L 4GRLC 5E94A 3OKKB 4CBPA 3I3BA 4YK4B 1T7WA 5IGXL 4FFVC 3LKPA 4DGYH 5CP7A 1KC5H 4X7EC 5C0CA 5ACMA 2R1YA 1TTGA 3UX9B 5FUCC 3D39D 3BEWB 4F7TA 4HJGA 5DURB 5HTSA 5JZ7D 1T4KA 1AI1L 4G5ZH 4NKIH 4DK3A 3OKNB 4P46A 2IPKA 5T1DL 4L3ED 4JO3L 1FVDB 4H26B 3RHWF 4TRPH 3X11B 2BRRH 4AZ8A 5ICZA 1MHPH 1OARL 4G42A 4KK9C 3VI3F 4ZXBD 3ZKXC 1TZGL 3G9VA 1UJ3C 4D9QD 5IKCB 3O6FD 2NY7L 4HBQA 1R24B 4RISL 1RHFA 1A9EB 4HJGB 1S9WA 4WV1A 1FNFA 4NQCD 1TVHA 4NPYB 1JGDB 3V79C 4DN3H 3G5VB 2A73B 5MEOB 5H35A 1JYXA 2FLBT 2ZUQB 3LIZH 3I6GA 4M6MH 5DD1L 4M93B 5EWIL 2R1XA 3MRGB 5BRZD 1LO5A 1E4KA 5F9DC 4G42B 4OLXL 1PDKA 1G7JB 1RJYB 1IC7H 1CT8A 2E7MA 1FG2A 4PD4J 4JN1H 3HKFA 5I74C 3TV3H 3SDDA 3MLWL 4Y2OA 4Y4HA 3MQIA 1MCQA 4HT1H 4R4NC 2CQVA 3HZKB 2JIXD 4NZTL 5BS0E 2QSQA 3GSWA 5H35B 1CXHA 4U1MA 4KJPD 1CE1H 4RMVA 4P9HL 3I6GB 1QP1A 4G6MH 3ETBF 4IEFB 1MWAL 4F2MA 2R29H 2Q8AH 5DMIL 4LHUG 4BH8A 3LQMA 1CIUA 5GRYA 1LD9A 5MHSD 3SDDB 3O4LD 1NLBH 5IW1A 1PGRB 2QEJA 5AZ2H 3TCLA 4Y8DC 2IQAA 4LVNB 5LJYH 2JCCE 3HG1A 3QQ9C 1T80A 5SX5K 1KCVH 2K1MA 3VWJA 1MFBL 4PJCE 3DJ9A 4FQXD 2AVGA 1YNTB 3T2PA 3CNKA 4YEFA 3T0EC 2DTMH 3RWDB 4OZ4A 3TYFA 4TNVK 4NJAL 2R4SH 1FN4B 2FBJH 2WWMC 1AQDA 4EN3D 2MSPA 1SYVB 4FP8L 3TNMB 1AGCB 4W6XB 1FLRL 4FZEH 1EO8H 4WO4A 1ZA3A 5FYKH 1I85C 4F15B 3QEQD 5TQ0H 4M3KB 3VG9B 4OGYH 4Y19D 2MCPL 2PR4H 1QPXA 3QDGA 5JXEA 1DQLL 3T3PE 4JEGB 1CDHA 3OR7A 4Z76A 4GBXD 1SJXA 4R7NB 5GGRY 1H8NA 1ACYL 2DDQL 2H3NB 4LOUD 4WTZG 4PGDB 2DB8A 4PRHA 1SJHA 3UAJC 3GSOA 3MBXH 5EU4A 5F72S 1FSKC 4MQTB 1OAKH 5IHUL 2ZWLT 4LU5L 3O81A 4YWGH 4NO3B 1Z9OA 2VXTH 4I13B 1BVKA 2EZ0D 1F4YH 4HIIB 3C6SA 2ZNXA 2VLJD 4GRWH 2RFXB 1SEBA 5GS3A 3LKOB 5EUKB 2LV4A 3CFKA 3BP5A 1AIFA 1J0HA 3CX2A 4L9LA 4ELMF 3KPQB 4PRHB 1SJHB 4YHMH 3WIFA 2JE8A 3MXVH 2APXA 4PRPB 3JV5A 4M61A 4YQXL 5LGKA 4HXAL 3ULUC 4X6DE 1FBIL 2W65B 3V5HB 4QHKJ 4DN4L 4U33A 3G08A 4JM2B 3FB8A 3FFDB 4H0HB 4Z7VF 1ADQH 5GGVL 2CSPA 1J5OL 5LWYH 3OG4B 3QWOB 5DMGD 3BP5B 1BJ8A 1ZOXA 1CGVA 2H2PC 4ISVA 1BX2A 4NQDA 4LSTH 1W8NA 4LCWE 1YYML 1FH5H 5CGTA 4Y5YA 4ZOAA 1F4XH 4K3DL 1EHNA 2R2EA 3SDAC 5F88A 4OJFH 2RB8A 3DI2B 4F7EB 3SDYL 2X6MA 5CEZL 4HS3A 5C7XL 3HRPA 3ABZA 3EOTH 2IFFH 4R26H 4UI2A 4OZIA 4NO2A 1GH7A 3IGAB 4X6CF 2HMID 4NOFA 3V9FA 5JXAL 4E41D 5LGJB 1BX2B 4PRDB 2QQLH 3LN4B 2P5WD 1FNGB 2Y06H 1TCRB 2CR3A 2QQNL 4D9LL 2R2EB 2BHYA 5GRJL 1KBGL 1YMME 3QUYC 1CE6B 2N7AA 4HS3B 5KJRL 3S35X 1IC1A 5DO2D 1OQXA 3HB3C 4LVOB 3QULA 4R96A 4OZIB 4AYFA 12E8L 2DKUA 5FXCH 3VMPA 4M48L 3HNSL 2YPVL 5HYJB 3D85D 2RJMA 4O2EB 1YNLH 4LRIA 1PYWB 1VFAB 3IJSA 1TJIL 5CD5C 4HBCH 5MEPA 4L1DA 2X70A 3G6JB 4HXBH 2NW2B 1Z6JT 2Y23A 2Q76B 4OKVA 3I2CH 5IESH 1UQSB 3QIUC 5GS0H 1QLRA 3EUUA 4FS0A 5DC9B 2ZG1A 1OTSD 3VGEA 1D6VL 3F6LA 3GGWA 2YXFA 4MHHI 3UDWA 2E27H 3C87A 5F7NC 3WFDH 2Z93B 1KV3A 3L5XH 1I9IH 2JB5L 4U7KA 3D0VA 1K6QH 4DW2L 5MEPB 1SY6H 1N64L 1E28A 5KVDL 1QQDB 2X70B 3DV6A 3RVWD 4JRXD 3MRJA 2MKWA 5DHVH 5BZWA 4WDIA 4OLUL 1TETH 4GXVH 4U1KA 4BZ2L 2EIZB 5E5MA 2HFEA 1I9RL 1IM3A 5I8OL 5CILH 1NLDL 1Y0LB 4HWEL 3EYUH 1A7NL 3VG0H 4YNYA 2VQTA 3S4SA 1NAMA 5IOPB 4XGZB 4HF5H 4MJIE 3UJIH 1WAAE 3QDMB 1T0MB 3GHBL 2XWTB 1BFTA 1L9NA 5DT1H 5BV7C 2NY2D 5IFAH 2NY6B 1YJDL 1SJVA 3MCG1 1MI5B 4XPTL 5F7DB 2Z31B 1OWWA 2X9XA 4N0CD 4Q2ZA 2XOTA 4WDIB 4CAGA 4U1KB 4MXQC 2PYFA 5HY9B 5E5MB 5GRXG 5LAXA 1IM3B 2FX8L 1D5ZB 4O5LH 1X4YA 3QPXH 2CLZB 3WS6C 4Q9CA 1ADQA 4IDLA 3FT3B 1NAMB 5KBNC 1LE5A 5J3HC 4NZUL 3SDXB 4ZFOB 1ZGLM 4XCYA 4HH9A 1AD9B 1UXSB 1NMCB 3T2NL 5AG8A 1NCTA 4M7KH 3ZDXE 2MHAA 4UB0L 3UP1A 4OD3L 1TTFA 3B9DA 4B7IA 3R4DA 3SJVE 5ESAB 1JIBA 1LNUB 3IU3A 1MREH 2VZ1A 1J86A 2YUWA 4AH2A 4LSQH 4ZPTA 4X0KA 3P11H 4XWOD 4YFLF 5GGTH 3RKDC 4NGHH 5FA4B 1MFCL 4JRWA 2HG5B 3JV0A 1I8IB 3MGOB 2YUVA 1JZ8A 2X4SB 4K23H 4X7DC 3S9DB 1T7VA 2OP4L 1BWMA 3W0WD 5HYSA 1QBAA 2E9WA 3FN3A 4X83A 4PGZA 2Q3ZA 1MRDH 3V6OE 4PV8B 5EO0A 3S3SA 1I9JH 5ERWA 2PO6C 5JW4M 1CF8H 5GRVK 3WFBL 3ECBA 5IV2B 2XKNA 5E2TL 3TBTA 2IH3B 4HWBH 4XBEH 4QRQB 4YO0A 4ZSOB 3LPFA 3TJEH 4PTUB 5D5MF 2Q8BH 1RZ8A 5D2NE 1MIEL 2E9BA 5KVEL 4OZHA 3GSNH 3RY4A 1MUJB 5CGYC 3K2MC 2EXWD 4GRLA 4AEHL 5ID0A 4AK1A 3EYSL 4U6HB 1CD0A 5CBAB 2HH0H 3U0TA 2ED7A 4PJBB 3ARUA 1KNOA 4GKNA 2XG5A 4HMCA 3SCMC 3VFTA 3ECBB 4D2NA 1PQZA 1KB5L 1YA5A 2MMXA 4WFEE 4P4KB 2VDNL 5C0JA 4GAGL 1QSFE 3BH9B 5GGSB 4ORGA 1S7UB 2ZKHL 1LP9B 5E8PA 1BFSA 2BC4A 4Y4KB 2OJEA 1LEGB 4GRLB 4XVSL 2C1PB 4GG8B 4NBXB 3F12A 2OZ4A 3U0TB 5F44A 5FF6B 1KNOB 1SY6A 1FFNA 1UCTA 3U0PB 4PP2A 4NNPL 5EZLA 4HULB 1IQDA 3KG5A 5I1LA 1BGXH 1UJ3A 5DHVA 3UJTH 3QXVA 3LS4H 3JTTB 4UQ3A 5C0RH 5GGQL 4XPGL 4R8WL 2EO1A 3S37H 5EDXA 5EUOF 4Q9BA 5DUBA 5D1XD 2OM5A 4JDZA 4M6NL 2NLJA 3QZWG 4AT6B 2BC4B 1AKJB 1BM3H 1RK1A 1KJ3H 2LQRA 3DRQB 4MCYB 3D18B 3DVFA 1JYNA 1Q8MA 2X1QA 4I9WD 3R0MA 4PP2B 3L5JA 4BFIB 2DAVA 3ZKXB 1QKZL 1DLFH 4OLYH 1CD9B 4MJ5A 3TVMD 4TPRL 5HGGS 5I1LB 1G6RH 5J1AA 1F00I 1MCIA 3P4NA 3TA3C 3IXTA 1P1ZB 2WAHA 1EHLL 3MRLB 4ZNEA 4I2XA 5GIRA 4PJ8D 5DUBB 5C0IA 4WU5A 1S7SB 5EU6D 2NLJB 1NGPH 4FFYH 4OQTL 1YYLH 1Q9KA 1UZ6E 3KPTA 2YD5A 4MZ3A 4TUKH 1YN7A 1JGLH 3V6FA 1Z2KA 3LD8B 2NY1B 4ZUWB 4FQIL 5A40E 1QLEL 1KJ2L 3HR5A 5JOFA 1BD2E 4MJ5B 5HGAA 5IBTL 4X5XA 2F8VA 2MPAL 3PXHA 3QXAA 5GIRB 1HOCA 5C0IB 3B3IA 5DYOA 2A6JB 3T2OA 1A6ZB 4IHOA 3CXDH 4W6YB 4JFFB 1DBML 3P0VH 2OYPA 2M26A 2F54D 1FGVL 1U8HB 3H7LA 4RSVA 3T0EA 3HR5B 1F58H 4F7CA 4RA3A 1CR9H 2C4FT 4QOKE 1DUYB 4YX2L 4XVTL 1CK0H 3WDHA 1UWXK 3MV8A 2W0KA 2X4NA 2VLLA 2W9EH 2KH2B 4FOMA 3SY0A 5CWSA 4U1NA 1OTTD 4XP4L 1KLGB 1I85A 4XP6H 4HWBA 4P5MA 5C07A 4BQ6A 3MRQA 1NC2A 5I19H 1IGIL 4KJQD 4IHOB 1MAKA 1HNGA 4FQQB 4GRWF 1NC4D 4ZAKD 1OP9A 3V2AR 3DX6B 1N2RA 3KYOB 1IEAA 4U3HA 4KRPB 4OM1L 2XIDA 4HAFA 4Z95H 5DK3A 3RDTD 2WP3T 4LARH 3SOBH 4AEIL 5IVXB 4CMMA 3C09B 4Z7WE 2X4NB 2ARJB 4MD0A 3TLRA 4ZS7H 4ENED 2C3XA 4NNYA 3KPRE 3HE7C 3ZYOA 4FNLH 2J5LB 3TIEB 3MTRA 5CFHA 4NN5B 2YD4A 1BECA 2VH5H 4KK8D 3I85A 2IMNA 4Z7UE 2EYSA 5IB5A 5IFHH 3QFDA 3S35L 2EE3A 4X7CC 3AUVA 2FWOA 3B5HA 2QSCH 1QFUL 3QH3A 2ESVA 4JANB 5HI4D 1INEH 3QG6B 4CMMB 5BV7H 1DLHA 3IRZA 1DP0A 5GRUL 2CKBA 1ZLSL 4MD0B 4NRYA 1C5BL 1N3NB 5B4MC 3PWPA 2DQHH 4MMXC 2PYEA 3CFCL 3VH8A 5CBEA 1EIBA 3QIBD 1VGKB 5MEQA 2WQ8A 2MCG1 3U9UA 3CXHK 3VFPA 1SBSH 2EYSB 5IB5B 4JN2B 4OB5L 3FQXA 4XVUD 1FFPA 3KXFB 5FYJE 1F45A 3NH7H 3F7YA 1DLHB 2FIKB 4P59L 3VFGL 5ICXB 1HYSD 5E8DH 5C0CD 3QFJB 1ZE3C 3NCCB 3GMLA 2EH7H 3PWPB 3C6LB 1MCOH 3UBXA 3VH8B 4PRNB 3SDAA 4X98A 3P73A 4P46D 3JV4A 4DTGH 1L7TH 3RWFB 2OJZL 4V2CB 1J0ZA 1LO0H 3FQXB 3WFCH 4RGOH 3D0LA 1FFPB 2W9DL 5K59E 3FB7A 1F5WA 4UBDC 4NSKA 2Y5TA 1J1PH 3FT4A 1NGQL 2A6IA 2UWEE 3A67H 3CVHL 2YKLL 3GMLB 3PGDB 3STZA 3RIAF 4NQTA 2AK1H 4X98B 2DI7A 2YD7A 2HFGL 3BDYH 3QUYA 4LEXH 1LDPL 4U1LA 1A1NB 3T8XA 5A2JH 4G9DB 2M1KA 3AFLA 3KVQA 3DURB 1A7PL 2BSRA 4KUZH 3AVEA 3IF1B 1T1WA 1EJOH 3BT2L 3C08L 5EOQH 4D0DA 5DJCA 3FB7B 4TNWF 3SE9H 1W0VB 1CICC 2Y5TB 3DTXB 2G75A 1A1OB 1PZUB 1FORH 4HW6A 3VD7A 1OQOA 5C9KA 4FQCH 2P44B 3EKCA 1GGCH 2OS7A 1FO0A 3SDDD 5CJOH 2Y4SA 3DGGB 3PDDA 4O02L 4PREA 4Y4HD 2CPCA 2GUOB 5BZDB 4QO1A 2WW8A 1RIVH 4FQ1L 5INDA 3DO7B 3V0VB 2IBZY 3I9GL 3NFSL 4U1LB 3SKJL 2GKIA 4RGNB 4P4RB 3QIUA 1K4DB 2BSRB 3GDBA 4NWTL 3DBXB 3ZE1F 4D0DB 2XTJD 1XF5B 4Q6YA 1S7XA 2BVQA 2ATPA 1TPXC 4PRBB 1QNZL 3VXOA 1GRWA 3DXAE 3CSGA 2D03H 5IF0B 3AMKA 4HWZA 5AZEH 4ZFGH 3HG1D 3X17A 3ARWA 1H3VA 2ITCB 3HI6H 4RWYH 25C8H 4OCXL 3VWJD 4G9FE 2J1KA 2V17L 3VFUB 2B5IC 1A6WL 3GMOA 4ODSH 5IMOB 2JLLA 4JPWH 1S7XB 4WGVB 3OXSA 1AO7E 5IMMA 5D7LE 3K3QA 3C8KA 1Z9SA 3UO1L 1AGDA 1C12A 4KHTL 1Y6NR 3HAEG 4WO4D 1JTOA 4XRCA 3FB5B 4X5LA 3J7HA 2YWYA 4Y1AA 4G8FA 3HI5H 3RPIB 4G8GA 3O3BB 2VZUA 1OD7A 4WTWA 1BVLB 3VXSE 3ZT7A 3WHXA 5TDOB 1RQ5A 4C83A 4MJ6A 3QDGD 4DOHB 2MWCA 5JXED 3ZDZF 5ANME 4MAYB 3IJYB 4HLJA 3L3IA 4YBQC 3WS6A 2JJSA 5DJ2A 4LSRH 3ARSA 2WUBL 3EJZC 4K3EL 1I7TA 4PRHD 1JPSH 5KOMC 1NBVH 2GJ6E 2R56H 5I2IB 5HGHA 4G8GB 1Y18B 4KJYB 5IJKC 4HUUA 1HINL 4JFDE 4OIIH 4BZYA 1S7QB 1RFDL 4GMSL 4GW1B 1T2JA 3JWNC 1EGJH 1RZGB 1R3HA 5FYKU 1FFRA 4WW1A 2OK0H 2BCKB 2DBLL 5CP3A 5E6IC 4O9HL 1OAYH 1ZHKB 5FOBA 2ZUVA 3QJFB 1PX3A 5ILTH 1AFVL 1LO3H 4WI9A 4LQFH 5EU5A 2B1AL 3K74B 1ZHLB 5DFVC 4HD9A 5HGHB 2HJKA 3U7WL 4HUUB 2J6EL 2J4WH 5I73B 1NFIA 3UTZB 3EIFA 1FVEA 3U4EA 2B4CL 5ITFA 3OAZH 2XQBL 1BWWA 3ZL4L 2PO6A 4OSUL 5BW7C 1R3HB 5I1KL 3H7BA 5EBMA 3WL9B 5FOBB 3Q6GL 3N9GL 2WIMA 4PJFA 4XNXL 3U2SA 3VXMA 4NQDD 5BQ7A 1VPOL 3JWDL 5EU5B 4JDVB 3BE1L 4L4VA 3DVNA 4NDMB 5HHQA 3MRNB 1JGEB 1NANI 5I76B 3AREA 1QR1B 2YA1A 4G6AC 3FCTA 3NAAL 3KYNA 5ITFB 1NEZB 3HCVA 4YHKL 2VTFA 4DCQA 3SCMA 5J4MA 1IFHH 4JPVL 1A6TA 2AXJA 4K7PY 4XNQA 1JHKH 3S36X 4P2RB 2Y9RT 3TJHC 1LE9A 5F9AC 1NCAH 3MV9E 4K3HA 4GXUM 2YEZB 3VFMA 2E7LC 1OAXL 2IALB 3AREB 3PABA 4S1DC 3FCTB 3DIFB 3TFKD 3GM0A 1CFNA 2FHBA 2OTWA 2Y1VA 3SGDH 4ZUTA 5JW3L 3DECA 4EDWH 2HP4A 5GSRA 1HE7A 2OXHA 1M1SA 1A6TB 2AJUL 2F53B 4PJIE 5CD3A 5I1DB 1HHJA 4MVBC 4F9LC 2X4OA 3GNML 3TESA 1G7IA 5FGCE 1IAIM 1T0PB 3PWNA 3OF6A 3L3OB 1KTDA 2DIBA 3EZJB 4LAJH 5ID1B 4CUCA 5DLMH 15C8L 1VFBA 3IDYC 4QNPE 1F6FB 5EOTA 2VXSH 1MVFA 2AERT 1WBYB 2QQKL 1JHLH 2XQYG 5JNYA 1ZT7B 1WFOA 1P4IH 4BSWA 1TITA 1U8KA 3TA3A 2OQJB 1U2HA 4D0BB 2ZJSH 2Q6WB 1J8HA 2EC8A 1W72A 5KSUA 1ZHNB 3S5LA 4P0DA 4OCSL 3R1GL 3PWNB 1WBXB 2OSLA 4XVJL 3W2DH 2BSED 2AKRA 4ZMAT 1SM3H 5MENA 2EIDA 4JVWA 1I7ZA 2NY6D 5EOTB 4MD5B 1FYHB 2X7LA 1K2DA 1IGFH 2WK2A 4ZQKA 4EBQH 1A21A 2BX5A 1U8KB 4OF5A 4XP9H 3H3PL 4WEBH 5JOPD 4Z5RB 1EGJA 4QRUB 1JBJA 4RFNB 1ZLUH 3KPNB 5E1HB 4XPFL 1OD9A 1YUHA 3FHAA 5IW6A 4X80L 4C56E 2VLKA 3RI5F 4DFHA 3KPLB 1MJUH 5FOJA 5KVFL 2V9RA 1OF2A 5F3BA 1JZ5A 2KUTA 3RJDA 2C3VB 2X7LB 1H3TA 4M02A 4Y2DD 1J0KA 3OGOE 2ZSVB 1BQLH 4JKPL 5DJDA 3O2WL 4JZNA 4IRSC 3V52H 4PJEE 5ICYA 1F2XK 4CMHC 4UT9L 1RHHA 2IGFL 1YUHB 3BRDA 1NGYA 1RZJL 1KGCE 5FKAB 4PJ9A 5I16A 4R3SA 4MS8C 4XPHL 1KCSL 2YK1L 2J7LA 4I0KA 4DZ8B 1L0QA 5EO1B 1OF2B 4PB0L 3IETB 4PJGB 3PQYB 5K9KB 4Z7VB 5E7BA 5SV3A 1ZS8B 1CXFA 5DJDB 3MRPA 4KHXL 1IL1A 3MOAH 1J7VR 5IBUB 1T83C 3KNBA 1P5VA 1TDQA 3WE6B 3VFSA 4RFEA 1CLCA 5E4EB 5E2WL 3PJSA 3CMGA 4JY6A 4K94C 1C08A 3QXWA 1AHWC 4PJ9B 4R2GC 1WCBA 3HNTL 4R3SB 5I16B 3HE7A 5IFJA 1XGYH 4ZUVA 4QHMA 3NTCH 2EYRB 2WIIA 3MRDA 2C1OB 1FCCA 1CD1A 2X05A 4NNXA 3EO9L 2VR5A 1U92B 5D71L 2AJ3B 3SDCC 4I18B 1IL1B 4X6CB 3LS5H 1FZKA 3LQAC 1C16A 2DQGL 1T2QL 1AP2A 4YGVB 5I8EB 1U8JB 4J23A 3E8UL 3FQTB 2VRAA 3VRIB 3BD5A 3O6KL 5DA4A 3NFPB 2Z91A 5I1GL 3SE4C 4OFPA 3WIIH 3MRDB 2EYTA 1CD1B 1KLUA 4NNXB 1XMWA 1ZGLB 3OX8B 2X9WA 2F5BH 4QRRE 1H3UA 4E0RB 3Q6FB 4PTTA 2X89A 1JV5A 2EDHA 1C7SA 3L7EB 4U1JA 4Y0GA 3LKNA 3P30L 1CZ8L 3T77A 3EDFA 3MACL 5FK9B 4FFVD 3NZHL 3Q48A 1AP2B 1IC5L 3F7RA 3QWRD 4CU7A 1U8PB 3O45A 3REVA 4QXWA 5F70A 5C09B 1DJSA 1XH3A 4L4TA 5IHBA 5GRWA 2CLRB 3PL6B 3HUJE 2FX7H 2H26A 3UZVB 4P3DB 4NQXB 1X5XA 1S7TB 1TQCC 2NR6C 2FH8A 5HSFA 1UFUA 2VDOH 5IB4A 4UDTA 4FXKA 5TPWL 1P7HL 3KYAA 2JF1A 4U0RB 4EVNA 1J1XL 4RAUB 3RKPA 4J1UB 4KK9D 5DD3L 3PP3H 2OL3A 3BN3B 2I60H 3GI9L 3JZ7A 3FOLA 2FYYA 2BXYA 1UB5B 2XFXA 2F74B 3QUKB 2OR9L 5BOPA 1GYAA 4WTXA 5CZVH 2CDEA 3TPKA 3GJEA 2C4FU 1HH9B 1X5HA 1UA6L 3V7AE 1KYOK 1NGZA 2CIKB 1CFSB 3OJDA 3P77B 1ZTXH 4S1SH 1XGTB 4UDTB 5E8NA 1FNEB 1IGJB 2MKLC 4JFPA 1GC1C 1QZ1A 2ZUWA 3KYMA 5CJXC 1U93A 5DQDL 2XRAL 1PLGH 3QUZC 1AQKL 4JZOB 3L95B 4OZFB 1W2KT 1CICA 3EZ8A 4ZTOH 3FO9A 3ZE2F 3KPSB 3MRFB 2PXYC 5T3ZD 4HKZA 5HHOE 2CRMA 3HAEH 3RUGA 4KVNL 4YXLL 4R4ND 3GJEB 1RI8A 4UQ2B 4PJ7F 1RZKL 4XAKE 3DYPA 3OJDB 5DGQA 1KIQA 4JFPB 1FGNH 5L2JA 1LK2B 1KN4L 3TWCH 3OAUL 5TE4H 2JJUA 1G0YR 5DD5H 1S9XA 3INUL 5EIQA 1VFUA 4JFEA 3CZFA 5CINH 3V6OC 5E08H 3NGBC 4HKZB 2A1WH 4N8PA 2VN4A 3BRGC 4D3CL 1EO5A 4K7PH 4KKLC 1EZVY 4JVPA 4U7MA 2AJZA 4MD4A 1KTKE 2KZ1B 3REWA 5D2NC 1UM6H 5F7YC 3QQ9D 3P0YH 5DK0B 1BFVL 3N06B 1KIQB 3FONA 1X5YA 4IJ3C 5L9DL 4FQJH 3U30C 5D7IF 5BVPH 2UUDH 4N90D 4R7DB 4KQ4H 4KZEL 3P9LA 2GK0B 3D2UB 3OV6A 4P9HC 1S9XB 1FDLL 1VEPA 3T0ED 5K9JL 4MQ7B 2J88L 3ES6B 4K7FA 1TPXB 4YXHH 2WWMD 1JL8A 5TFSL 2A9NL 4KY1H 3DWTA 5AG9A 1F2QA 3MV8D 4RMUA 1A5FH 2VC2L 4MD4B 4KI1A 3REWB 4BK5A 1YEIL 1KCRH 5C07D 1NC2D 2VABA 3NA4A 2P4AB 4M1DH 3T4AA 2W0FB 3KDMA 1D5MA 1JCKA 1WICA 1U91B 3P9LB 3OG6B 3FFCE 3OJ2C 4JQXC 3EAKA 5DD6A 4K7FB 1L6ZA 5D5MB 5KANI 1RUAH 4QTIH 4WCYL 3S36L 2NY3C 3UAJD 3DX7A 4KJWC 2YN5A 3SGKC 1K8DB 5IJKA 2XA8L 2HTKC 2NQCA 3L6FA 2ZCKH 2BVPB 4TVPE 3DX8B 1Q9OA 1RK0B 1F11B 1KXVC 2GIYA 3MGTA 5J89A 3IKCA 5CLTA 2YPLE 3PWUA 2SEBB 5HYEA 1ZA6B 1T1ZB 5D8JH 1UYWL 5DD6B 4MXVF 5E6IA 4XAWH 5C0NC 4QHUB 3S7GA 1MCLA 2ESVD 2ZCLL 1KG0A 1JNNH 1OGTA 3N1FC 2HRPH 3ROLA 1BIHA 2CDFA 2FL5A 3UBXI 1WC7B 5CIPB 4QT5B 5F93C 4M03A 4HX1A 5JIPA 3OQ3B 3AXLB 3MCLL 4Y4FC 3SE8H 1RZIA 3PWPD 1MQKH 2PYED 5DJ0A 1R0AL 4K8RC 3GMQA 3L6FB 1DANT 1OSZA 4X9IA 3EDDA 5BS0A 4ONHB 2X9YA 2XN9E 1YNKL 43C9B 2WINA 4OFVA 5BW7A 5J7CC 1I3RA 1YEHL 3RX8A 1IKFH 5CJBA 4OQ1A 4O4YH 4C57C 4GW4B 5CJQH 5HHMB 3G6DH 2VITA 2KQMA 5EN2B 1X4XA 5EUOB 2CDFB 3IDMA 3TC9A 3BPCA 1OGAE 3FOMA 2DLEA 4G7YH 1HSAA 4I3SL 2P24B 3P9MA 5GGVY 4AL8L 3FTGB 5FCUH 3GMQB 4D9RE 3B9KC 3SDAD 2JCCA 4H5SA 2R2HA 5KW9L 2ZUTA 3CAFA 2VUYA 4HIXH 2CK2A 1A22B 2VAAA 3VW3H 1M05A 3CXHJ 4PJCA 4QXTB 1SJEA 3TP4A 4JCLA 5L7XL 4K94H 3TYGH 4BQ8A 5HBBA 2XZAH 2AV1A 2DQDH 5CEXB 5BO1H 3MV7E 3IDMB 5EC2B 3RZWA 1I3VA 3SPVA 3IDIA 4HGWA 4NOBA 4F7PA 2VIRA 1MLCB 4M8QA 2E7LA 4F58L 2VXVH 4YDIL 2PW1B 3LQAH 3HC0A 1MRFH 3QCVL 5CJ8A 3QUYD 4DKEH 4PJCB 4HKBA 3HB3D 2H8PB 3MBEC 5AD0B 1E6JH 4QXGH 4F9LA 1KJVB 4CU6A 1L7IH 1MVUB 3W82A 2EE2A 3MRCA 4HJJH 1CCZA 4N8VA 2V6HA 4G43A 5LXGL 5JW4N 4M8QB 1ZEAH 4ZUUB 3BXNB 5CD5D 2DYPA 4UTAL 3P40A 4XH2A 2AK4E 1M4KA 1U95A 3DVIA 3QG7H 2BNRE 1MHCA 3B4NA 3QIUD 1I75A 5F7KC 4HKBB 2BNQB 1S3KH 3G5ZB 3RIAK 4A6YH 6FABH 1XF4A 1QFWL 1T1YA 4Z0XA 5TGBB 1N59A 1KF9B 3QUMH 2GITA 5I1AB 1SYSA 4XP5H 1LGVA 4JFYA 4LPVA 5ADOH 3PWLA 3L3JB 2GCYA 4XNUL 2C4XA 4QTHA 1KPRA 4MNGE 5DJAB 2Q20A 2YA0A 3DUUA 4LHJB 3S98A 3J8F7 4TNWK 4YZFE 4GQ9H 3EOAA 1NAML 2LABA 4KKCC 4XH2B 3BZFA 4H25A 1Z9MA 4NO0B 1S9YA 4X6DA 1MHCB 3O3EA 4J3XA 1EX0A 2K7PA 4DKFL 5IGXH 1MAML 3KPMA 5B22A 5HPMA 3NACL 3RWHA 2VN7A 2AEQL 1T1YB 5EFIA 4LCUA 1SYSB 5EG6C 4OM0L 1G7HA 4NBZB 1AI1H 4MA8L 3QWQB 3PHOB 4BKLA 5T1DH 1TQBC 4LCWA 2UZYB 4JO3H 1ADQL 2PNDA 4LEOA 4C55A 5JO5A 4N0UB 4Y1AD 3RGVC 3V6BR 5ETUB 4H25B 1NBYA 1OARH 3TO2A 1S9YB 4PJDF 4X6DB 3VE0A 1R5VA 1JPFA 3HPJA 4LSTL 4PY8I 4MXQD 1TZGH 3VXRB 1KCUL 4IRSA 1N5AA 4WI2A 2NY7H 4KDWA 1OWRM 3JWOL 4ZOEA 4RISH 2XT1B 5E2UL 2D31A 3WN5C 2VDLL 3CDGB 1I7RA 1NL0L 4P2OC 5SWSB 2X42A 3W39B 4M7JL 4DVRL 2VDQL 3IAPA 4WI3A 4EXPX 5JO5B 4RGMB 4YBLC 1RD6A 1FAIL 5DD1H 3H42L 5EWIH 4P2CG 3VE0B 2YC1A 1YJDC 3HPJB 4OLXH 3WSQL 5FV1L 3T04D 1YMMA 1MCHA 5DGRA 3ARFB 4JREC 3WXVL 3MLWH 3VFOB 1L9MA 2ADGA 1I7RB 4TSAL 3RKDD 1D5IL 3GUTA 4PRIE 3B83A 3C5ZB 3V7MA 1AHWA 4NZTH 4UNVA 5DJ6B 3AS2A 1XIWC 3ZMRA 5AUMA 3NZ8A 1HHGA 4P9HH 3HZVB 6CGTA 3E3QE 4R0LC 5HYIA 4LPUA 1MWAH 3MLZL 1HQRA 5L8JB 3SDCA 3MRRA 1KFAL 1MFEL 2DQEL 1EV2E 1IAOA 1JWSB 5DMIH 1CWVA 2PO6D 3BVNB 4TSBL 1M7DA 1T7XA 1G84A 2WWKO 4XHQA 4FZ8L 5DVOA 4NRZA 3LAFA 3VXMD 1MY7A 4LLDA 4LSDA 2W60B 4LMQE 4R2GB 1U6AL 2C3WA 1GZPA 4L4VD 3H2WA 3SE4A 1A6VL 1B90A 1HHGB 1CGUA 1MFBH 2L0DA 3NCYS 2A6DB 5CGYD 1QSED 1ZHBA 1YPZF 2R9HC 35C8L 1CFTA 2XY2A 4NJAH 4JLRA 1NFDF 1X5AA 4Q6IC 3SCMD 4J8RB 5GPRA 5D7JA 4FP8H 4LGRB 4ONFL 2OZ4L 4DZBA 1FLRH 3OKLB 5FYLD 3DETC 4NO5B 5AEAA 5FGSA 4A6YA 3T65B 4KZDL 1YN6B 3FHQA 5FUOL 1EHXA 4QRPB 4MJIA 2MCPH 1UZ8A 1H3WM 2CXKA 3P4OB 4FHBD 1WAAA 3AAZA 1DQLH 1QRNB 1CFTB 1WF5A 4KUCF 4TYUA 1DE4A 3LEXA 4OTXL 5TF1L 2JCCF 1ACYH 1FJ1A 1AJ7L 5D7JB 2DDQH 2GY5A 4ODUA 4U2YA 1UWEL 1T1XA 3MNZA 1E4XL 4MSWB 4OCLC 1MJ7L 4N0YL 5IHUH 4LLYA 4PGEB 4PJHB 4LU5H 3CCHB 2EE6A 3OF6D 4X5WB 4NN6B 4CN6A 3HE6C 1UZ8B 5T3ZL 3MJ7A 2FO1A 3N85L 3FB6A 4PG2C 3Q5OA 3VWKB 2GW5A 2FSEA 5GRVL 3N0PB 5TQ2L 4PRPE 3NPSC 1FNSL 2ZUUA 5CJXA 3LEXB 4P2QB 4BFGA 1WSST 3QUZA 4PGJA 5CSBA 4CKVX 2LTQC 2Z4QA 3SJVA 2PXYA 3TA3D 1CGYA 5AAMA 1J8HD 2P8MA 5SWZB 4YQXH 4E5XA 4HXAH 3LOWA 4JG0L 2IBBA 1FBIH 4I4WA 2F5AL 3TNNB 5E6YA 1U8QA 3FB6B 1Z0MA 3ARGC 4DN4H 1R6VA 5MEND 4PJAB 1HXYB 2P7TB 5GGVH 2GTZA 1J5OH 3ARBC 4PJXF 4ETQA 2ADIB 4ZO6A 4YDJA 3PV7A 5B21A 1XR8B 5FKPB 4I77L 2Z4QB 3HZYB 2PXYB 1K8IA 2VDKL 3V6OA 3T4YA 5JDSB 1V3LA 4OF7A 1YYMH 2BVTA 2NXZC 4K3DH 1RULL 2R2BA 3STLB 3FMGL 2NPLX 1YC8A 3I6KB 3O2VL 5D2NA 5F1OB 2VLKD 3L3DB 4XNZB 4YDLC 5IM7B 4P5KA 5T1LA 3SDYH 5FO8B 3I6LD 4CRPA 5CEZH 3MRKB 5C7XH 7FABL 3OJVC 4W81A 3B2VL 5F89B 1S7VA 4F8TA 4UV7L 1FYTB 4JZJB 2YMXL 2FHCA 5KG9B 5JXAH 5B8CC 5K9OA 1MWAA 1K8IB 3LKSA 4GAFB 3TO4C 2QR0B 5GZOC 1NCNA 2I26N 3N1QC 4RMWA 2GYSA 5I15L 1JNHA 3QO0B 2CRYA 4XMKL 2QQNH 2XWJA 5ENWA 4L3CA 2R2BB 3BPNC 3JVGC 4D9LH 3QHZL 2HKHL 1DQML 2GSGA 2I25N 4P99A 4MLIA 4LKCB 1QSFA 5GRJH 5T1LB 1KBGH 5HDBE 5KJRH 5D93C 4IJ3B 2OR7A 2Q7YA 5HYJE 1T04A 4XZUB 4EUPG 4A2LA 3TBSB 1QFPA 3CMOL 2X5PA 4QHNB 3SGDI 12E8H 3QR2A 4JQXA 5DJXB 4BFBD 3G6JE 4M48H 2YPVH 5F7LB 3KPOA 1INQB 5H37G 1TJIH 1YEEL 1F3DH 3ESVF 2EXYC 2GSGB 2IWGA 2R23A 1P6FA 3SGKA 1DN0A 5C70A 1X5JA 2R8SL 3HE7D 3RWCB 1BAFL 3G04A 3OHXB 2Q7YB 3QNZA 2VLMD 2CKBL 3G5XB 5CZKA 3I3DA 3QQ4B 4OFYA 3F7VB 3ULUL 5DRXB 1D6VH 1N7ML 5IEKB 3CVIL 1FG9C 3ULSA 1P2CB 5HVFB 1G7QB 4L8DA 2JB5H 5FDWB 2XNAA 4XTRC 4H88L 3RZCB 4DW2H 4Y4FA 2X1WL 5B4MD 1N64H 3BMWA 4FQ2L 5KVDH 4WUUB 1UKSA 1GJIA 3BZ4A 3FZUC 2A83B 3Q3GA 4G7VL 4OLUH 3SGEH 4BZ2H 3PIQA 3QDME 1JRHI 1T5XB 1I9RH 5I8OH 2X89D 1NLDH 1TENA 4Q0XL 1I7UA 4HWEH 1A7NH 1MI5E 3WDJA 3QB7C 2BDNL 2C7UB 3ZHKA 2JKXA 2NZ9C 1AH1A 2FD6L 1BD2A 4M7ZC 4HPOL 2XNAB 3GHBH 4TUOA 2VMFA 4MCZA 4L4TD 2CRIA 4GS7C 1YJDH 5INCA 4Z7OF 4XPTH 4CDHA 3B9KA 3SDXE 1A1MB 3PIQB 2R1WB 3IDGB 3QEUA 5TF0A 2FX8H 3B6SA 1MCFA 1MHHA 2DM4A 4H1LG 4UBDD 1X3DA 4P49A 4NZUH 4X4ME 2XPGA 1HYRC 4QOKA 5IEHA 3T2NH 4WEUD 3BQUC 1DTUA 5INCB 1K4CA 3RU8L 4PBVC 2WZPD 3MJ8A 3TT1L 4UB0H 2WSKA 2HFFA 1ITBB 1ZGLP 4OD3H 5HGDA 4MHHG 1FO0L 5L0QB 1UJTA 5HHPA 1A3LL 3ZE0E 3B6SB 1CK0L 3TF7C 1WAAF 3MBEA 3SKUD 5J9PA 4Y5XB 5HPOA 4KQ3L 1CICD 1EEQA 1MFCH 3P2TA 4XCCH 3R8BB 1I1AB 3X14B 3GZKA 4N1CA 3DX9A 4EI5B 1K4CB 3KR3L 5T3XE 4CJ1A 2OP4H 4Z7WA 3K4DA 3PV6B 4MB5A 4ZSOE 2YBRB 3KPRA 2ZSWA 2DQCL 5I71B 5ACLA 1FL5B 3WFBH 2W07A 3ZKMC 4KXZH 2O61B 5E2TH 1JF6A 2CK0H 4Z7UA 5HVHB 2UZXB 2R0WL 4JFED 2H6PA 3H9SB 1MIEH 4JHWL 2DQTL 4PJBE 4RAHA 5KVEH 1P7QB 3BP6A 1MJJB 3H9HB 5IT2L 1QHOA 4EDXB 4HG4K 1ZKAA 5IR1B 2V2TB 4HIJB 3QO1B 3NN8A 4AEHH 3EYSH 4WW2B 3WJLC 5CZXC 4D9QE 3TBVB 2EEDA 4GG6F 1LP9E 3L3HB 1KB5H 4GXUN 3U1SL 2VDNH 2VXUL 1S8DB 1DANU 2FEDC 4GAGH 5TE6L 5C0EA 4JAMA 4GW5B 5IB1A 2ZKHH 1HI6B 3JTSB 4Q58C 2DJUA 1IAMA 1NH6A 1JN6A 3FAXA 1Y6MR 3R8QA 1W0WA 4XVSH 4JM4L 4GRMA 4POUB 1JF1B 2F8OA 4NNPH 5EBWA 4RIRA 4FXGB 3OPZL 5AAWA 4NFBA 5DEGB 2IAMB 3K8LA 5GGQH 2B1HL 4XPGH 4YBQD 1MCOL 2H9GA 3LVEA 4R8WH 3WN5A 2DQFA 2N7BA 3RL1A 3ET9F 3UC0L 4M6NH 4P2OA 3EJZD 4X6FB 1BQHA 1OAZL 5DD0L 1BBJA 1JN6B 3HHRB 4L4JA 4U1IA 5HGBA 2UWEA 5K9QG 3GSUA 2RAMA 1A2YA 3F5WA 2GT9A 5F8RC 4QY8B 3WKML 3QDJB 3BP7A 1IAKA 4YUEL 5BMFL 5MHSE 2FATL 2OI9C 1QKZH 4TPRH 3MFFB 4WRLA 1H9VA 3QRFM 1EHLH 5E6ID 2XZCL 3WN5B 2AK1L 1JF5A 4OQTH 4IRJB 4U1IB 1XIWA 5DFVD 3OKOA 1A2YB 3F5WB 4R0LA 1NBQA 4MJ2A 5EZJB 4FQIH 1QLEH 1PW3A 1KJ2H 3L3GA 5BS0D 3GSXA 4K55A 5KSBF 5D1ZC 5IBTH 2VE6B 2MPAH 4JREB 4JFFE 2ED8A 2VLRB 5IUSA 3HR6A 4XX1E 2OBGA 5IG7B 3T3ME 4YC2B 4MA7L 5D2LF 4BQBA 3O41B 3W9DA 2HFTA 4FQLL 1VADA 3CH1B 1XIWB 1P9MC 3LDBB 5FYLL 3X3GL 3DXAA 1WZKA 1ORQA 1DBMH 5KS9F 3QAZB 4KUCD 4G6AD