3OKEB

Crystal structure of s25-39 in complex with ko
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
217
Chain Sequence
b'EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPTNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeB01
4J1UA 4WEBH 3EYOA 5C0RH 1GGCH 3B9KA 4PGCB 3ARXA 5E2VL 3U4EB 1RU9H 4N8VB 3MRGA 4YE4L 3T2QA 4WI3A 5HHOE 3MRNB 1ZE3C 2VR4A 4NUJA 2UY7A 3RRQA 4RA0C 1PG7L 4JHWL 1C7TA 2BSTA 5EORH 3GB7A 3UTZB 3BIKB 4S1QL 5FYKH 3L3HA 5IW3A 3TNMB 3UPAA 1O5DT 1G7MA 4YK4C 4UUJB 3BYTA 5HGBB 5L9DL 2D4DA 3HE7A 1UM4L 3MJ8A 3OBAA 4MSWA 3D3VE 5F7UA 5BS0D 1KCUH 1JBJA 1IC5H 3FB8A 3LS4L 4JFQA 1HH6A 3TZVB 1I7TA 3HUJE 3OKKA 1X5XA 4HXAH 4ELMA 3M8OH 5EO1A 2EDHA 3MRLB 1PZUB 1YYLL 2NXZC 5A2IH 4M48H 3GUTA 4OF0A 2EDKA 5C07E 4GRLC 5JW4N 1H3GA 4QWWD 5IV2B 4K3HA 3PL6B 1WAAA 4Z7UB 4Y16A 1HXYB 1CGWA 4HGWA 4OQ1A 2PCPA 2AJSH 1KOAA 4LKCA 3S4SA 3OTTA 1NC4D 4YX2L 4OF3A 1I9RL 1OAYL 5KSUA 2J8UE 5DLMH 5KSAA 5EOCH 2HT4D 4HKZA 5ACLA 1NCWH 5C92A 2QQQA 3IXAB 2ZKHL 3U9UB 1VA9A 4I2XA 4I8DA 3ARGB 5M7QA 3SEPA 2MPAL 1RIUL 4Z7OE 4OUUA 5KTEH 3O41B 1SMOA 4Y2DC 3WFZA 1XGQB 3P0YH 1U9KA 1ORQB 2XQBL 2VDLH 1WQVT 5F6HI 3D0LB 1OSPH 3RTQA 4R90H 4ZSOA 5LGHH 3IS0X 3QUMB 1JGDB 4M03A 2XZAL 2ENYA 2YS4A 1Z9SA 3P77B 5GRJH 5B3JE 3HNVH 4ZUVB 3X3FH 1JN6B 1FYHB 2L4OA 3ARGD 1QLRB 4KY1L 4LEXH 2ZP0T 2W9LA 3HS0A 4X7DC 3D2UB 4XPTL 1H3PL 1SJHB 2BVUA 2NCMA 3QEUB 1XFPA 3SY0B 3U0TA 2H8PB 2XWTA 3GSVB 4N0FB 1A9BB 1IBGH 4FQLL 4U3CA 2QSQA 4MAYB 4DZ8B 2C3VA 3DBXB 4AM0B 2FJGB 4ZFZB 4PJHE 2DDQL 2D7TL 5D5MF 2AGJH 4DGIL 4EEEA 2I9TB 5CGTA 2BOCB 3ULVH 1ULVA 1YEDA 4K9EL 5JA8B 4JKPH 5F1SA 3W11C 4LSPH 4Z7WF 2EDRA 1SEQL 1QA9A 3FB7B 3TA3A 1U8QA 4L3EE 4JFFE 3FOLB 3VXRA 4JDZA 3UPCA 1R5WA 1YNKL 4J6RH 4Y5XB 3C09B 1R3JA 1JHLL 3D2UD 1M71B 4POYA 3DUHA 1RUQL 4AIZA 4JZNB 3MXVL 3SHSA 3W5NA 3LPGA 3EIFA 3ZDZE 1A6AA 1SJVA 4MAYD 4MJIB 2D0FA 2BVPB 3IDNB 4F7TA 2C7UB 2VLRB 1VHPA 3BT2L 4HZLA 5TPWL 1M05A 4XWOD 4S1SL 5BQ7B 4JANA 1INEH 4M7KL 3EGSB 4PJBF 1CFVL 1BQHB 4F15B 5LVEA 3UYPA 2R0LH 1S7SA 5GRUH 2H2PD 1WBYB 2V2XB 5IIEB 4GRWF 5I8OH 4K7PL 1QKZL 4U6YA 3DWTA 2G5BB 2X9YA 4KQ3H 4MJID 4UMGA 3EJYC 1G7QA 2NY1B 3C5ZA 1T4KA 3H0TB 3H9ZA 3DI3B 3UTOA 2I27N 3V6FA 1RJYB 2NY2B 3SO3B 1CLYH 2NTSP 5DFTA 1IAII 5DGQA 4PTUA 3ZE0E 5GGUB 4F33A 1EO7A 5F9DC 5B4MC 2IBZY 3FMGL 3DMMA 4CL7A 4H0IA 4OLZL 1U8MA 5L2KA 2R23A 4WI4A 1BVLA 3MACH 4Y5YA 1DVFD 4YGVA 5KVEL 1FPTH 1JNNH 1IT9L 1EGJA 4UINH 1XR8B 5J3HC 3GIVB 4NBZB 4X6CF 1XAUA 1FL3B 1A14L 1IEHA 3QXVA 5B8CA 2MOVA 1KPUB 1XT5A 5C1MB 3K74B 2MMXA 2NY2D 3G9AB 2C1PB 5D1QA 4IIQB 4POZD 1R0AH 3TFKC 5IJVA 2GFBB 5CCKH 2MWCA 5KOVC 4XVJL 3WJLA 3V2AR 2QSTA 1G7PA 4OI7A 2DJUA 1T20A 3IDGA 4J12A 5EA0L 1NLBH 3E6FA 3WEXA 3TP4A 1YEFL 1RIHH 2CKBA 1LD9B 1ODAA 4XX1G 1OVZA 1D3CA 1L0QA 4HJJL 3FB6A 1YEJH 5I1HL 2IH1A 3CFBB 4X9IA 2Z92B 3QNYB 1CXKA 5D8JH 4NO0A 4XP6L 3GIZH 2F5AH 1S5HB 4YAQA 4X6FA 2AI0L 3QDJD 4FFYL 4GBXC 4NKDB 4Y1AB 2CDFA 2V2WB 3U1SL 5IR1A 5LGJB 5CILL 3WL9B 3OB0H 3EHBD 1GZPB 1AO7E 3K0WA 4ONFH 5FEBA 2AJ3A 4AQOA 1T2JA 2F8OA 4NRZB 3NMEA 3IXTB 4KPHL 4HEME 3VD9A 4RZCB 4Z6AT 4FQXC 3OZ9L 1F42A 4KJPD 3MUZ1 4MVBD 1ZKAA 1QQDB 5KZCB 4KJWD 5EN2B 4B5EA 5L88H 1Z9MA 5E24E 1K6QL 2UZXB 1OWRM 3I9GH 4O2CA 4PB9H 4P5MA 5D9SB 1H9VA 3AXLA 5IBLC 3AB0B 4G80A 5DJDB 4KVCL 3ZYJA 3UYRL 1LO0L 1GOHA 4KDWA 4QTIL 5I1KL 2HYMA 3WHXA 3OKMA 3GI9L 1S7VA 1DBAL 1TZIA 5H35A 1DQML 3W2DH 4ZS6C 1CFBA 2EIEA 1Q94A 1OAUL 4KGJA 4BZ1H 3IJSA 4NO2B 5KZCD 5C9JB 1PY4A 3JTSB 3C2AH 4R0LA 3WIHL 2FL5B 4K3DL 4WUUD 3VW3L 4G6AC 3QHFH 2XWJA 2QSCL 5J8OA 3AMKA 4QRPB 4PRIA 3QPXH 1LO5B 1B90A 4WHYG 3RVXC 2IAMC 3DVFA 4NKIH 4JN2B 1JF5A 2R15A 1OSZB 1HKFA 1OGTA 4CMMB 4Y4HB 1H15A 2X4SA 1A1MB 3ARBB 3WFBH 1N59B 1I8MB 1PX3A 5IB1B 4MXWH 2FGWL 3V95A 3B3IB 2JIXD 4QRTB 2WWKO 3JXAA 1R3IH 1YY9C 4PLKD 4S11A 1J8HE 2C1OB 4H1LB 4PJEE 4TTDD 5J12C 4GH7B 2LVCA 4Q2ZA 2I07B 4OFVA 5INDA 2WBJB 4FQHB 5GS1B 1LNUA 4RAHA 2VXVH 4LLYA 2F15A 1L7IL 4R7DB 1SVZA 4PJ8B 4QGYA 5E7FA 2Z4QB 4U1IA 1CL7L 5HHNB 2CLZB 1CXIA 2ERJB 4WWID 4G8IA 3D1MC 3V52H 2ZUSA 2VDPH 4H5SA 2ILLA 2FZ3B 3MLSL 1FJ1A 1TZGH 4PJCF 4UQ2B 3WD5H 3GSXB 4JPVL 4OZIE 4EBQL 1IEAB 3T4YB 2W60B 2EDBA 4PJGA 4R4FL 1MWAL 5C08B 4K3JH 1WIPA 3O8XB 3QJHB 2WBJD 4IRJB 4LLDA 5DHVB 2PW1B 4RBPK 2BHYA 4UBDD 3T3MF 2DRUA 3SKJH 1NMBH 3D85A 4Z8FL 3WS6A 1MHPH 2JB6B 4OZHF 2A6KA 2BDNL 3P4NB 3ZDXF 4NWTL 3IDJB 4RFNB 1WAAF 3KWWB 3DSNA 4WHCA 1P1ZB 3R4DA 3TT1L 4Y19D 4WFFD 2PKDA 1XF4B 3P0VH 2VOTA 4NOFA 4R96B 5EO0A 3GO1L 3V4UH 1L6ZA 2EEBA 1L7TH 1P53A 5C08D 4F7EB 1YPZB 1HSAA 5HYSB 3R8QA 3KXFE 2P43B 3G5XB 5LWYH 4C55A 4IRJD 4YHLH 4V1DA 1ONQB 1HINL 1BVKA 5FYJL 1U3JA 3SKNA 3VGHA 1F3JB 2BNQA 4NUGL 5D70L 2GK0A 1MFBH 3S37L 1C5DA 5DUPH 2G5RA 4OZ4A 4GUPB 2XFXA 1YN7B 3LKNA 2QQLH 2Q87A 2JCCA 5HHQA 4GXVH 1VEOA 3L9RA 3JV5A 4OGYL 4I0PB 2JB5L 4WHTA 2NW3A 5D7IB 3QUZA 3VFPB 5H94A 3NFPB 3OKDA 4FQQA 2QEJA 4CNIB 4XVTL 1I1AC 4LIQE 5IMOB 5DK0A 1F90H 5DUBA 5E7BA 2N7AA 5MEQB 4AT6B 5DS8B 4Y4FD 4F37F 1UXWA 1X5IA 1KJ2H 4HWNA 1WLHA 2F5BL 4ONGH 3PGCA 1CWVA 2ADIB 3WIFB 4M6AA 1FZJA 4WFED 4OF8A 1PKQE 3LEXB 3TGXA 4UAOB 3VJ6A 3MV9A 5D7KD 3BJLA 2V9QA 2GCYA 2YPLA 3O0RH 1T21A 1GSMA 2WMPA 3CU7A 3FT2B 3A6CL 1CGYA 3ZHLA 1XH3B 1K5NA 1ZTXL 2IPTH 4GG6E 1JGUH 2AEPH 3OR7B 3VFOB 3C5JB 1FG2A 3WJJA 1YC7A 4H26A 5DJ6A 4BA8A 3SBWA 5IB4B 3PWPA 1FDLH 4L29B 1II4E 4R4ND 12E8H 4TSBH 1CZ8H 3OMZA 3V0VA 4XAKE 5DZOA 2O61A 2YUZA 5EU5A 4MNGA 3BGFC 1LP9A 1RIVL 3GMOA 4PJFE 4UT6L 2H9GB 5DR5L 3T0AA 1V3KA 4FZEL 1JWMB 4L8SB 1M4KA 3BUYA 4PYGA 2HT3C 5FYKU 4LHUB 5SWZB 1G1CA 5D1ZC 2AABL 1T89A 5E9DE 2W9EL 1EH9A 5IB3B 5ESVB 1S78C 2PXYD 1ZSDB 2RBLA 4UTBH 3EFFB 4F8QA 3KLHC 3H3KA 1U8NB 3TVMB 4HUVB 1A7OL 3VU2A 5DDHA 1SY6L 2F9BT 4JPIB 2AW2A 4C4KO 3FQUB 4OFKA 4HXBH 2VERN 5D2LB 3V6OC 2AV7A 3MA9H 1ZWIB 4PJDE 4YR6A 3QEQD 3RWGA 5FUZH 1BOGA 3VG9C 5HDLA 3BKYL 2PETA 4PUBL 3J8F7 3ULUH 4XCNA 3O11A 4LHUD 1HWHB 2FX7H 5KBNC 4UNTA 4XWGL 1K2DB 3OF6A 1AR2A 4K71C 3DTXA 1GYAA 4G8EA 3Q1SH 2VLLA 4HIEB 2EYTB 1MVUA 3TVMD 1A4JB 3Q3GA 3VXPA 1TETH 3O3AB 1T2QL 3PHOA 2HTKD 4JB9H 5CMAB 3C6SB 5C09A 3VFMB 1B6DA 3RA7L 4ZAKB 3T2OA 4WNQA 1UEMA 2CJUL 3T65B 4X7TB 4ZFFA 5E8DL 5C0AD 3W5MA 4ODVL 2V9RA 2OXGA 5DC4B 1NBYB 3MYJB 3MOBL 4Z18A 1NCTA 2YA2A 1AD0B 1BAFL 2B1AH 3QUXA 1UFUA 1BEYL 2A74B 1HNGA 4NQUA 3STBA 3IETB 3ARDC 3CLFL 5HGDA 4Z0BH 5IFJA 4KTEL 2OQJB 2QKIB 1MRFH 1VFUA 1QFWH 1CXHA 2WWKT 4J4PD 4OFPA 1NMAL 1WFNA 3SJVA 2EZ0C 3JV6A 5IFHL 2FATL 3CXDH 5A2LH 1AJ7H 4OKVB 4ELME 3MV8E 3QCTH 1A7RH 4ZAKD 4PJ7A 1WSST 1TTGA 3QJFA 4IMKA 1EMTH 5BVPL 5EU4A 3KPRA 3VWJA 3NFSL 1EAJA 2P49B 1IVLA 3SCMA 3D0VB 3TO4C 5EC2B 2CD0A 1KT2A 4PG2C 1WAAE 4YQXL 1DCLA 2DB8A 4NQSA 2BVOA 5DQJA 4K3EL 3O3BA 2P8PB 1X5LA 4HPOH 2HFTA 1WT5A 3T1WA 4UV7H 2AVGA 2VXUH 2XZZA 5EOCJ 4NSKB 1EXUA 1YYMH 4B7LA 1HK6A 5DJCB 4XPAL 4X4ZA 1K3ZA 3GMPA 1KCVL 1E28B 2J4WH 5FKAA 4M5ZL 4Q9BA 4PJXA 4NO3A 4FQCL 4TPRL 4QRRE 3RL1A 3V0WL 4MJ4A 5CIPH 3B6SB 5C6PB 3PWNB 1YNTB 2LAAA 2M26A 1IGYA 2J5LB 4D0DA 3SE9L 4HG4K 3L3JB 3OX8A 4YHIA 4WWKD 5JUEH 2YBRB 2FO4B 3WXWH 1YN6A 1MCEA 3MCLL 1NGXB 3VD5A 1H8OA 1I1YB 1N3NB 2HJLB 2PW2B 4JFYA 1S7QA 1J5OL 2AJVL 5JW5B 4WCYL 1S9XA 2ZOKB 3MCKB 4XP1H 4KDTA 1U3HD 3V5HA 5C6TL 4M1GL 1OT1A 5KVDH 4LCYA 3LKRA 4F9LC 1VB9A 1I85A 2QR0A 5ID1B 4S1RH 4NQDB 5A2KH 2EDTA 3FL7A 3WFDL 4BQ6A 2VLJB 4YHPA 5EU7E 4IDJL 2LFGA 4LGRB 1AE6L 3RDTB 1A1OA 2AXFB 2BY2A 3KJ6H 5HPMA 3B9EA 2DQFA 5JO5B 1EJ6A 2O5ZH 3D39D 4I18A 3KLAB 1QEWA 1TTUA 4XNUL 4YDIH 4A6YH 1D5IH 4G6FB 4KZDH 4Q7DA 1HHIB 2Q20A 1B0WA 3CZJA 3MV7D 2OBGA 1M7DA 5L2JA 1NEUA 1F97A 2Z35A 3I2CH 3O6LL 4D0CA 2X7LB 4TVSa 3CVHL 4XCCH 1WC7B 3QFJB 4WV1A 4DN3L 5B21A 4KC3B 3MBXH 4HUUA 1KJMA 4NQDD 5IMMA 2VLJD 1NCDL 2ARJB 1UH4A 4JGJA 4XVUC 2KBGA 1SJXA 5TDOB 1X4YA 1DEEB 2YK1H 5HVHC 3HC0B 5GHWH 4MDJA 3LQAL 1WCBA 3IDXH 2ZUXA 3MUGB 4H25B 2H32A 2G75B 3BPCB 3CFCH 4AY0A 2DQUL 4GW1B 1KACB 15C8L 4OCRL 1DQLL 1X5KA 4IS6A 5DSCB 2H41A 4BZ2L 4LRNH 5DD0H 3ZL4H 2OJEB 4UT9H 3FKUS 4X7SH 3RWEB 4LNVA 5DEGB 4IM8A 1EPFA 3TYFB 4UDTA 2CGRL 3REWA 4PJGF 1QYGH 4Q0XH 4DKEL 3O2VL 1HHHA 1UJ3A 4HUMB 4YHOH 1XIWD 4FFVC 1GIGH 2FB4L 2H26A 5F1KC 4TULH 3MA7B 4O2EB 1IAOA 4HDIB 4EUPH 5DQ9B 3VXSB 3G6DL 2DIAA 4XMKL 5JMRA 5I15H 2NYYD 3DVIA 1U8PB 5CUSH 1CTOA 5T3ZE 1CGUA 5DMIH 1I7RA 3IGAB 2BC4B 4CW1A 3FRUA 1A47A 5GRVL 3U0WH 1KCKA 5L2KE 4PLJD 5D1XC 3G5VA 4XC1H 4C4KT 1OD9A 5I1CH 3O3DA 1RVFH 4YDLB 3DLQR 1MI5B 5JXAL 5CS7A 2QHLA 3KYNB 3PIQB 4U7MA 5CJXC 3TPUB 4DWHA 2AV1B 5DD3H 4N1CA 3X11B 4TN9A 1MF2L 3BKML 3GJEA 4BFEA 1AP2B 3VXSD 1U95A 5TE6H 2Y25A 3VXUA 1X5JA 3TLRA 2V9TA 3OHXA 4LGSB 3V8CA 2V17H 4UILH 5HYIA 4AEHH 5C6WH 1KGCD 3LCYA 4O4YL 3OJMB 5FYLL 1OM3L 1K8DB 5C0GB 4ERSH 4U1KA 2JCCF 2O5YH 2GTZA 3ULVF 3JV4B 4ODHL 2P5WD 3FB5B 3ORJA 2R4RL 5ISZB 1HILA 1WFOA 4HWEH 3QI9B 2XYCA 5ESQA 5IW6A 5F7KC 3IAPA 3QRGL 1CF8L 1ETZA 2APVA 4OI9A 2KQMA 4HIHA 2FHBA 3V4VL 2MCG1 1JCKA 3LRSA 5E00B 1MNUH 5IEHA 3T0BA 1N0XL 3NABL 4CU8A 4MJ5B 4HZAA 1T03L 2HTLC 3LQAC 3MRHB 2PO6D 2VZ3A 3P4OA 4KH2A 4OBRA 3MBEC 3R06A 2IQAB 4F3FB 5GSRB 1CE6B 1SVCP 5IGXH 4BSVA 4ENEC 2XN9B 5ISZD 4M61A 3WFCL 2C5DC 4ELKB 3VGBA 3CFJA 5B22A 4NQEB 1JRHH 4YC2C 4I5BB 4XNQB 1QHPA 5EC1B 3IFNL 3TF7C 3VFRB 5KSBE 4NWUH 1MOEA 5IHZB 3VGAC 1MUJA 4P2RB 4X6DA 3CH1A 3W0WB 4ODXA 1LP9F 1NFDF 2ESVA 3F65A 4P46B 4EQ2A 3SDDC 5C2UB 2VXSL 4OLWL 4I0CC 2XN9D 4RGNC 4NM8H 4NNPL 4S0TD 5LGKA 1A2YA 2A77L 2VDKL 4NQED 4YXHH 4UTAL 2A6JB 4OLUH 2EE9A 3ES6B 3LS5L 4Z7NE 2X4NB 5J0BA 1T5XB 3S35H 4L3CA 4NOBA 3TBTB 3DVGA 3MRQB 1RZJH 2CH8A 4AEEA 3K2UH 1J05B 2DQEH 2WV3A 3TO2B 3GMRB 3SDXB 5F9JA 3W0WD 2ITCB 3MRJB 4DKFH 3KJ4B 5EO9B 4P46D 1IGIH 2XG5A 3MJ9L 1WIOA 2X44D 3FQXB 5E1AB 1L9NA 4MA7H 4DAGH 5J56B 4ZTPH 3QSKB 5CJQL 5F6IC 1OOAA 1MIML 3P73B 1DR9A 3EYVA 2BOBB 2FR4B 1NQBA 5I8EB 4UOW0 3HE7C 2VDMH 3VXMB 5EZJB 4LCCB 3BZEA 3CMOH 4JFEA 4RGMC 1UQSA 3IU3B 5E2JA 3ARRA 4E0RB 4OBSA 4D8PB 4CDHA 2WIIA 1JV5B 5IB2B 1E6OL 4K55A 2GTWB 3VI4F 2QQNL 2MFNA 5C0BA 4FFZH 2AJUH 5LAXB 3NPSC 3BIAX 3KYOA 4KI5F 2OP4L 5FYJD 4QHNA 3SGEI 3ESUF 4U6HA 4E41D 3AS3A 4KUZH 1I1FA 2DQHL 2OJZL 3UTSD 4Y16C 2MKLC 4DUWA 2NY0B 1FVCA 4N9GB 3K1KC 1JVKA 3THMH 2Y36L 3BX7C 5CJ5A 4WI2A 4KAQL 4F2MA 1VKXB 3PV7A 5JZ7C 1A3QA 5BO1L 3PQYE 2UWEB 2XOTA 4NQCB 2IANE 2JELL 4HWBA 5FDWB 1DUYB 4R7NB 4P5TB 1A3RL 5ERWA 1IGCH 1J8KA 3AC0A 4PJ7F 1BFOA 1QFWM 1LDSA 4XP4L 3UX9B 3IJYB 5DO2D 3SDCA 4E5XA 4PLNC 2O93L 4I9WE 3HI5H 4HS6A 3BN9C 3RP1A 4EVNB 4MD5B 4NPYA 3WS3B 3IVKB 2C3XA 5DJ8A 4QOKA 4XBGB 3LQZA 4KVNL 3TJEL 3PHSA 1CDHA 2JKXA 2NY0D 2WIMA 5ID0B 3MRKA 2X1QA 4GW4A 4UDUA 2NNAA 3RTQC 1EO8L 2P4AB 2NTFB 5DJXB 2GSGA 1HHGA 4Z7VB 1QLEH 3OXRB 4NQCD 1RUPH 3DOSA 1S7XA 4LLMB 5CBAA 1MHCB 2PN5A 4NZTL 1K4CA 3QUMH 1S9YB 3L3OA 2VLKE 1KFAL 2BNRA 4LHQB 4PJXF 3IKKA 4YHZL 5AWNL 4V1DE 1CU4H 1Q0YH 1BBJA 1PG7W 5JXED 5E4EC 3QZWG 4XZUB 2BNQE 1UCTA 3VFNB 4ZOEA 3NA9H 3BWAB 4Z0XB 1B4JH 5K59F 4KV5F 5J6GA 4AH2A 3HPJA 4JY5L 4HFWA 2Q3ZA 5D96C 1EEZA 3GFUA 4C83B 4KFZC 5FGCE 3RUGB 2V5SA 1ES0A 3LAFA 1EAPB 2X70B 4U1HB 3ARWA 2VDNH 4HCRA 3HNSL 3DUUA 1CICA 4P4KB 3BP4A 3JBG7 3OKNB 4MNQA 4UV4L 4Z77B 5JOPD 1AKJA 2CKBL 3HE6D 1HHJA 3ROOA 3MGTA 4GW5B 4RMVA 1U2HA 4K94L 4TVPD 3V8OA 3IS1X 4KK6C 1NCUA 1TVHA 4H8WH 1INDL 2DQIH 4NJ9H 4JM2B 1CDYA 3MV9E 4F58L 2VO5A 3G5ZA 3S88L 1TQCB 1T5WA 4R26L 1OGAA 1KLGA 1FNAA 4PP2B 1UJTA 1QRNE 4KKAC 4LPVA 2J8HA 1VPOL 4LRIA 4NN5C 1A3LH 4P4KD 5SWSA 1UZ6E 2E5EA 5DFVD 1IM9A 1DSFH 2CIIB 3DSFH 4NC2B 3IYLW 2NR6C 4XNXH 5JDJA 1HIMH 4KHTH 4K8RD 3FFCB 1A1NA 1AGCB 2VUYA 3GSNB 5DYOA 3GRWH 2F53B 3RVWC 1TJIH 1FN4B 3LEYL 4ZD3H 4R4BA 3GSRB 1A02N 4QHUA 3GMMB 43CAB 2UZYB 2HVKA 4Z95L 1CXEA 4LSSH 4EUPA 3C5ZC 4RMUA 2JJSC 4PGEB 4Z78B 3RNQA 4TQEH 3MMEB 1U3ZA 5T1LB 1WZKA 3DMMC 4FS0A 1MCLA 4P0DA 2FBJH 1NDGB 1RZIA 4M9PA 2GJZB 4LSUH 1EEYB 5FHBH 5MEOA 3DX6A 2HLFD 2AEWA 3FFCD 4ZUSB 1N2RB 3O3UN 3F7YB 4Y5YC 4AEIH 4XCEB 2F53D 4WEBL 4EDXA 5C0RL 1LE9B 2OM5A 1GGCL 3RPKA 2NY5H 2HN7A 3LY6A 1RU9L 5I30H 3SDAA 3FQTB 5SWQA 4OD3L 1S9KC 3NIFF 1JFQH 4HUKB 2IGFL 4M7LH 4YFEA 5T1KB 4HMEA 4NN6C 5ALCH 5EORL 1BJMA 4XPFH 2WUBH 3RIAF 1NGYB 4HUWA 2VSDA 2R4SH 1JUFB 4Y5VA 5T1LD 1PYWB 3WJLC 1PW3A 1F4WH 2BRQA 3G6JB 5E6IA 1KCUL 1RJLB 4TUOA 1IC5L 1YQ2A 3ECBA 5T3XD 2D03H 3QEHB 4PRDA 2R0WH 4TNVF 5L0QB 2VABB 1N5AB 3ZKND 4HXAL 3UTTB 3M8OL 3QNXA 5IG7A 5EPMB 4L4VA 5F7MC 4M48L 4K94C 3ZTNH 4PGDB 3CSBA 5GISH 4EI6A 5T1KD 2XKUA 3TIDB 2XTJB 4CJ0A 1JIBA 4MMXC 1H3TA 1OTUD 1CQKA 3R1GL 4MJ2A 3WDIA 2XY1A 2AJSL 1A22B 3X3GH 3N1FC 3QCUH 2OTWA 5DLML 5IW1A 3BFOA 5EOCL 1BLNA 2Q76A 4MD0A 4RAVB 1NCWL 4M8QA 3CXHK 4QTHA 2B4CC 2SEBB 3UTTD 3LIZH 5GZND 1LEKB 2A83A 2X1PA 4M1CD 5K9OA 4F9PA 3BEWA 1YEKH 4M9OA 1JGVH 4K7FB 5KTEL 3KPRE 2C26A 4JY6B 1C08A 5FM8A 4P23B 5A40E 1CFTB 3P0YL 5ANMB 4MA8L 5HJ3A 5H37H 5I73C 4NRXB 3S36H 4Z76B 5I75C 1OTTC 1SM3H 1VFOA 1OSPL 4LF3B 4JJ5A 4ODUB 4R90L 1ZT7A 4AEFA 4CU6A 5LGHL 1DUZB 5BRZE 2HFFA 5CJBA 1L4IA 1Y18B 2DQCL 5GRJL 1NLDH 2VIRB 3C5SA 4KKNA 3B2UC 3IFPA 4MX7B 3X3FL 3IB4A 1WVZA 2PYFA 1KENH 5CD5D 3P9MB 3V6ZA 3RX8A 1KIQA 4FMFA 2CRMA 1MCKA 3OKEB 4N0UB 4G8GE 4P23D 3VWKB 4G7YH 3GI8H 4LVNB 1OAQH 2Q3AA 3FQNA 4QHKJ 5BS0A 3KPSA 1B9ZA 4R0LC 1DBBH 1FSKB 1IBGL 4X6DF 1RSFA 1RULH 2YN3A 3MLUL 2VKXA 5MHSD 4HH9B 4BZYA 5EU3B 3WO4C 1V3JA 1D5XA 3U4EA 2AGJL 3ULVL 1SYVA 5BVJB 4JKPL 5JHDB 4KZEL 2VTFA 4LAQH 3STLA 4LSPL 2A6DB 1UVQB 1DQTA 4Q9CA 3UTZA 1T7ZA 3M17B 2GAZB 5CWSA 1U8KB 3BIKA 5I71B 1Q72H 3IDMB 4RMQA 1U93A 1FBIH 1GGBH 2P45B 1CXFA 4J6RL 5BW7C 5HGBA 4HAFA 5GGRA 1NC4A 3ZYIA 3BW9B 3VWKD 1EDQA 1KLUB 5GRXG 4LP5A 2VDRL 3OB0K 3QIUB 3CSPA 2Z31A 1R5VB 3B43A 3MJ6A 1AQKH 5B39G 3UJIH 2VWEE 1CDIA 4H1LH 1INEL 1N6UA 1O7SA 4BQBA 2CDEB 4LKXA 3BP5B 4IJ3B 2R0LL 1MLCA 1HXYA 5GRUL 3G08B 2ZCHH 2X4PB 1TNMA 3EYQC 3K4ZA 4FFWD 4XAWH 3OR6B 5I8OL 3VI3F 4UZGA 3SGKA 3QHTC 1QPXA 3CFDB 4HUNB 3QIUD 1CR9L 1D9KB 3PV6B 4KQ3L 1WWBX 1FFRA 1EHXA 2HG5B 4M5YH 5I1LB 4XBPB 3IXAA 3U9UA 5IKCB 4MQXC 5DD6B 5EZLB 3WS6C 2ICEB 3ARGA 4WW2B 1C5BH 3FRPA 4P9HH 2FJHA 3L7EB 1UENA 2RGSA 4N0CC 1SQ2N 5DHVH 2DQTH 3E0GA 1N6VA 1XF1A 4ZXBB 5BZWB 2DLIA 1ORQA 5KANI 3Q0HA 3QIWB 2FJFB 3D0LA 3N85H 1JNNL 3QUMA 1IEBB 3EFDH 3RBGA 4UINL 1QRKA 4LSRH 5TFSH 1DDHB 2W9DL 5BZDA 1CDJA 1G7LA 5ALBH 1MJJA 4ZUVA 1JN6A 3FQWB 2F58H 3BDYH 2VL4A 1R5IB 4RQQB 4WU5A 5CSZB 1R0AL 2FDBP 3MZTA 3D2UA 1DANU 1UWXH 5T5FH 3TBWB 5HY9B 2EIDA 3SY0A 3OAYK 3MQIA 3NFNB 2H8PA 4MCZB 2WNGA 2XA8H 1JTTA 3ARPA 2QJDA 4FTVB 4MAYA 3AUVA 1KBGH 1NLBL 2QSVA 4R8WH 4AM0A 2FJGA 5KAQF 3QIWD 1T7XA 4CKVX 2YWZA 3FO9B 4QXTB 2D31B 2I9TA 2AKRA 1MCQA 4K2UH 5GRWA 5ETUA 2W0FB 3U79A 2NY3C 4KK5C 5CZVH 1RZ7H 1YEJL 3PF2A 3QCVL 2RJMA 1W0WB 4YK4B 2ZJSH 1LEGB 1GL4B 5IROA 5IJKA 5JPMA 5D8JL 3BZ4B 3GIZL 2F5AL 1XCQB 3DRQB 3STZA 3R0NA 3GGWB 5I18H 3RHWK 2H2SD 2UYLA 5SX5H 5HYJE 3RGVB 1KYOJ 1EK3A 4JZNA 2X05A 5IK3B 3F7QA 4MJIA 1GVIA 2NXZB 3IDNA 3QT2A 1BBDH 5I19H 2C7UA 4PREA 4P4RB 5TH2B 4LCIH 4OCSH 4ONFL 3WJJC 4S2SB 3BO8B 5DJ2B 1K4DB 1MJ7H 3SBWC 3HG1B 4IMLA 3K8MA 5BQ7A 2ZOLB 2VZUA 4LLWB 1CIUA 3RIFF 4GLRH 4CN4A 1BQHA 4UB0H 5MEPA 3O9WB 2A6IB 2BXYA 2XKNB 1NMCB 4LASH 3MUJA 5KVFH 1WBYA 2V2XA 5FOJA 3S8WA 5CLTA 1DVFA 2APFA 3RGVD 2QADD 3I9GL 2X4OA 1CFQA 3VRLF 4PB9L 2EC8A 5CD3A 2CDGB 3VRJB 1KEML 2VZTA 3W9EB 3OPZH 1KCRH 1OAXL 1T89C 4YBQC 1LK2B 4XH2B 1KLFA 1N6QL 3BKJH 3VXTA 1WGOA 3H0TA 4YEFA 4Y2DB 1ZGLB 1ZT1A 1RJYA 3HG1D 2JTDA 4IRSD 3RIAK 5DMJB 1GAFL 3QXDA 1KXTB 4HGMA 5GGUA 5ESAB 2DM3A 3W2DL 5DD1H 3FO2B 1MRCH 4BZ1L 3QDMD 3O9WD 1S9VB 3L5JA 4Z7QE 1N26A 4P2QB 1XGRA 1QSFD 3C2AL 5J1AB 4X6DE 2FH8A 3JUZA 1JMZA 2ESVE 3DO3A 3QHFL 4LLQA 4JHZA 3QPXL 4ETYA 1NKOA 1XEDA 3HMWH 1XR8A 1NGZA 3JTTB 2B1HH 4NKIL 1TQBC 1FL3A 4ZO7A 3KPOA 5D6DA 1F8TH 1PFCA 2E9BA 1KPUA 5JLZA 3WFBL 4Y2DD 2EICA 3I6GB 3BRDA 4PJIB 2C1PA 3AU1B 3BPLB 4MXWL 4JRXE 1JP5A 5I1AB 3S97C 2GFBA 5C2BH 1R3IL 4RDQF 3QDJA 2BSSB 1JPGB 3JWDH 5DEFA 3RFZC 4ZPTA 1J10A 3FO1B 2H3NB 2APXA 4KI5C 2VXVL 5IBUG 1LD9A 2W07A 4QHKI 2YRLA 4PB0H 4JZOB 1P4IH 2Y7QA 1AGEB 4QT5B 1AGBB 3CFBA 2BXZA 3QUXC 3ZTJG 2DN7A 1PSKH 3IU4H 3V52L 3QNYA 4W4NA 3E6HA 2VDPL 1TZGL 3TWCL 4JDTH 1P84J 4D9LH 2CRIA 3WHE1 3WD5L 4F7CA 1YEEH 1RJZB 2DI9A 2HJKA 4NQTA 3CIQA 5FB8A 4NKDA 4KRMB 1OLZA 3VI3E 4FA8A 4H0HB 3DGGB 1XMWA 2V2WA 2WLYA 3PNWB 3S34H 5LGJA 5C0BE 2R29H 1GZPA 4YDKH 2EDQA 3VXNA 5E08L 4IMKC 4KJYB 3D87B 3VWJC 3SKJL 3B9AA 4NRZA 1NMBL 1MHPL 3SCMC 3L3IA 4RZCA 5D2NE 3GSOA 4X8XA 3BPNC 5CP3H 5JR1H 1WUNT 2HVJB 4XCFH 1WT5C 3KLSA 3P0VL 4FNLH 2AJZB 4WUUA 1OP5K 3GMLA 4H88H 1R3KA 2WINA 3QWOA 3V4UL 5D9SA 1L7TL 5AD0B 4XMLH 3O4LB 4U2ZA 5IF0B 5DJDA 5LWYL 1ZA3B 4P2OC 5FCSH 5IQ7H 4AIOA 4YHLL 4WTZG 1JWSB 5JW3H 4F57H 4WJ5A 1MFBL 5DUPL 5J6HB 2JIXA 3OJ2C 4QOKE 2EIZB 5F7DA 5AUMB 4X4XB 5DEZA 1RK0A 4GXVL 1JPST 5EU6B 2IMMA 4HIXL 1MHEB 1HEZB 2ZSVB 2OI9B 2E7LA 1LO5A 3RWDB 3AM8A 3MNZB 4NRYB 1AGFA 2Z91A 5CEZE 4X99B 1F90L 5F7FA 2OR7A 5DJYB 1A7QH 4HHAA 5C0DA 1CD1B 2BNRE 3U36B 1OTSD 3LKOB 1A1MA 2Z8VC 1KJ2L 5BV7B 1N59A 4ONGL 4HPYH 2YZ8A 5IB1A 3B3IA 4QRTA 3CK0H 4B50A 1JYWA 3O6FD 5E5MB 3BZFB 5JDSB 4I18C 3UP1A 1I1RA 1DP0A 3OV6A 1LDPH 3O0RL 5I66A 5EU6D 1GRWA 2WBJA 2IPTL 5GS1A 1JGUL 1M7IB 1QBBA 5CZXD 2AEPL 2CUIA 4LSDA 2P1YA 5HHNA 2NQCA 2CLZA 3FN0L 5C3TA 4JFDE 2KKQA 4LNRB 2B2XH 1FDLL 4MNQE 1A6TA 12E8L 4TSBL 4AQ1B 1CZ8L 4KK9D 2H1PH 2VL5B 3FT3B 5JPNB 2DKSA 3T04D 3QWQB 1E6JH 4Y19A 4GKNB 4BQ8A 4D94A 5E8OB 3NCBB 2FEDC 4ZFGH 4CUCA 2JJUA 3T4YA 4M3KB 1T80A 4JLRB 5L8JB 2X41A 5C08A 5C0JA 1FC1A 2AXGA 3QJHA 1OGAE 4IRJA 5DHVA 5FYKD 2PW1A 4U6VH 4PR5A 4KDVA 1KIRA 4FQXB 4UTBL 2JB6A 2ID5A 5AAMA 3QZWB 1WICA 4JFHD 4N5UA 4P3DB 3RWIA 1F00I 1S8DB 4YXKH 1YC8A 3RVVD 3MROB 3EW3B 5GPRA 3KWWA 3EYUH 1C12B 3EOBB 4NCC1 4JFXB 4Z7UF 3SQBA 4HXBL 1P1ZA 1QFUL 2DICA 3VFWB 3PJSB 5C3LD 1RZFH 1MCWW 5J13C 1XF4A 1FZKB 4PJAB 5HHXH 4LP4A 3GKWH 1OWWA 1UJ3C 5FUZL 4ZPVA 2MSPA 2EH7H 3LKQB 4F7EA 1YPZA 3ULUL 3QUYD 4JN1H 4U1LA 4U49A 3JVGA 4Y4FA 2FX7L 2CK0L 4YHMH 5TQ0H 2YPKA 2G2RB 3K7UA 4GS7C 4RNRB 4FQXD 1F3RB 5DI8B 1GGIH 3SE3A 1NAKH 3S4SG 3JZ7A 5JTWA 2APWA 3ZKXB 4GUPA 5GSVB 3BESR 4HQQH 4X83A 5HHOB 4XXDA 5SV4A 5DT1H 5GIRB 1LWRA 2ORBH 1TETL 2VR5A 3NTCH 4JB9L 4NHUB 3VDBA 1WZ1H 2KUTA 1NANH 2IAMB 4HS8H 5D7IA 3AFLA 3NFPA 4OCWH 4P2RE 5ADPH 4CNIA 4MJ6B 4E9LA 3BE1H 5MEQA 3KS0H 5DS8A 3PDDA 3O6KH 3D3VB 1IZJA 1GPOH 4LEOB 4MA1B 3KHQA 3OKLB 4FQJH 2B1AL 4RMSA 4PD4J 1RZKH 4XX1E 5HGAA 1UB5B 3WIFA 1RPQA 2HFEA 3HUJB 3SGDH 1GGTA 4Z0BL 1T1ZA 2BRRH 1MRFL 5HHOD 1G0DA 1QFWL 2W59A 3MGOB 3C08L 4JFZH 5DRNB 5IM7A 3C60B 5C07B 1AJ7L 1Z9LA 3RVXD 1XH3A 1A7RL 4I13B 4ZMAT 4L4VE 3VFOA 4KRNA 1FFOA 2PXYA 1WBXB 1EMTL 5I9QB 2A0LD 2LU7A 4X80H 3WLWD 4XCYA 1TCRA 3DUSB 4LLVB 4L29A 1SHMA 4PRAA 2J8UB 5E99H 3D3VD 4J3OC 5GRZA 4JFPA 4HPOL 4QRSA 3QEQA 4UV7L 4PGZA 3TNNB 5TJWK 4XHQA 2IPKB 2VXUL 3VXME 1YYML 4L8SA 5AEAA 1TZHB 2B20A 1EZVX 3C60D 5C07D 2WANA 4LHUA 4OAWB 2J4WL 2V5TA 4P3CH 4DUXA 5JIIA 3OAZH 5IB3A 5ESVA 3LV3B 3FO0L 5EH1A 3EFFA 2Q8BH 3HRPA 1U8NA 3TVMA 2DQDL 4GQ9H 2Q7NA 1WITA 1J7VR 4U1MA 4JPIA 3MLYH 1B0RB 2ITDB 1G9MH 4XGZB 3GSQB 4WU7A 3WXWL 5D2LA 4QRQB 4DOHE 1K8IB 4P49A 1ZWIA 2Q86A 4R9HA 1J1OH 1W0VB 1BHGA 4XP9H 2X4TB 4XNMA 1TVBB 5C0AA 5T1DL 4XP1L 1SJEA 4N0YH 3CNKA 5KVDL 4M93C 4O51B 1Z3GH 1K2DA 4S1RL 2FIKB 5A16B 5I6XB 4JY4A 3T77A 3NCJL 1Q9OB 1FIGL 4PJHB 5HDBE 5J1SC 2Q1EA 3KPSE 4DN4H 1JYVA 3KJ6L 4FHBD 3MOAH 2O5ZL 4J4PA 3K3QA 4PY7A 1KN2H 5GGVY 4YDIL 5E8PB 3QXAB 4A6YL 3P9LA 1I1AB 4ZAKA 3GJFB 1D5IL 1AR1C 3QUKA 4L3EB 5CKAA 4JFFB 4YHYC 4KZDL 1R24A 3T8XB 4NDMB 4PBVC 3I2CL 4Z7VE 1V7NH 2EYSB 4C58B 1NBYA 4IOFD 4XCCL 3S96A 1AD0A 3FHAA 5T33H 3L5WA 1T66C 5FM5O 3OGCB 3IETA 3QRFM 1D5ZB 3ZKQD 2QKIA 5DGRA 5ICXB 3GBNL 4N5ED 1G7IA 4DCQA 5E2WH 2KH2B 5EWIH 3TN0B 3IDXL 2F54E 2EXYC 1EERB 1FFNB 4NC1C 4RIRB 2Y5EA 4JFFD 4M7ZC 5CP3A 3CFCL 1WBZB 3MO1A 5IHUL 1I8IB 1AD9A 3L5HA 3D0VA 1PLGL 3HNTH 2RFXA 3MFFA 3FQRB 4WWKA 4LRNL 5DTFA 5DD0L 3ZL4L 4X6BA 1LGVA 4OV5A 3WMSA 4RRPA 3CDFA 4X7SL 1YEGH 2B7DT 4I1NB 3TEUA 1QYGL 4Q0XL 1NGWB 3UC0H 3TBSB 4NSKA 1J0ZA 2AJYH 4YHOL 4W70A 1GIGL 1ND0B 3WV0A 1U3HA 4TULL 2EIBA 5F1NA 3TN0D 3QHZH 4WHYH 5I15L 1MFCH 4MD4B 2OL3B 3NZ8B 2X89D 3B6SA 1FVDA 3PWNA 1DQQB 5CUSL 3P11H 25C8H 4HIIB 3QNZB 3IFLH 2V5MA 2YBRA 2FO4A 1JGEB 2DJSA 3U0WL 4YIQB 3D39A 3VG9B 1NGXA 1CTNA 4XC1L 3I3EA 5I1CL 1RVFL 1I1YA 1N3NA 1PG7X 2PW2A 5JW5A 5B39B 2Y07H 3SKOB 2J88L 2ZOKA 5ITFA 5HD8D 3MV7A 5KG9A 3ARZA 5C8JA 3BKCH 3GMQA 3T0ED 5HHVL 4K71B 4OZFA 4C54A 3KYMA 5DD3L 3UAJC 5I74B 5TE6L 5ID1A 1H5BB 4OIIH 4NQDA 2UV3A 2VLJA 1FIEA 2OCFD 4P59H 3AAZB 2V17L 2VXQH 4UILL 5FGRA 5CLWA 5ICZB 2BHZA 4ZFOA 2E7CA 3H8NA 2AXFA 4ERSL 2O5YL 4G9FB 3HCVA 4AJ0A 3KLAA 4HWEL 1P6AB 3MGAA 4M7LT 5JHLL 43C9A 1CICC 1NJ9B 1HHIA 5JQHC 4O2FA 5CEYA 3BQUD 5E0QA 3LZFH 2AQ2A 3VH8B 2DM2A 1MCSA 3NAAH 2AP2A 2EDFA 2CXGA 1MNUL 3VCLB 5AZEH 3ARDB 2UUDK 1CE1H 4FXGB 2ARJA 2XV6B 1QG3A 3AVEA 4IOIB 1AO7B 4K8RH 1IC4H 5TDOA 3SQOH 1DEEA 3M07A 3W39A 5IGXL 4HH8A 5KS9E 6FABH 4KRPD 1YZZA 1XIWA 2R9HD 4JQIH 1FYTB 3MUGA 4LRIC 4U05A 1D5BA 1RUAH 3C6LB 5FO8A 2DTMH 1RFDH 3TO4B 1YMHB 4M6MH 2XPGB 1BQLL 1MIEH 1DLHA 35C8H 5DSCA 4YBHA 3ARDD 1A5FH 2EDOA 2XTJE 5B3NA 5DUML 1HXMB 2OJEA 1D7FA 1CDCA 2X10A 3RWEA 2IPUK 2X5PA 2YA0A 4QHMA 4QEGA 1GOFA 1AO7D 4RWYH 4H20H 4KGLA 4NQVB 3REVA 3GSNH 3WKMH 3TIEA 1B0GB 3V4PH 4NM8L 4U1GB 3MA7A 4O02H 4F8TA 3NPZB 4HDIA 2WWMC 4YXHL 3VXSA 1Q9KB 3C6LD 4Q58C 4ALAH 2DM4A 3EDDA 3BPOB 4OLUL 2XZQH 5D7LD 3L3DA 4KUCD 1KUMA 4OT1H 3S35L 5F44A 1UWGH 1XGTA 4EZMA 5D5MB 1RZJL 1NBQA 3IGAA 2P5WA 4I77L 3ZMRA 3K2UL 5JQ6L 2DQEL 3ILQC 3SDAC 5FIEA 4DKFL 4NYLA 3SPVB 2A9NH 3ROLB 5T3XH 1IGIL 1KPVB 5JIHA 4GRMB 3RY6A 3FZUC 4DAGL 4MA7L 1YPZF 2HKHH 3KYNA 3PIQA 3ARFD 4ZTPL 3TPUA 3PDOA 5MP6H 3NGBC 3I50H 4G9DB 2DBJA 2X4UB 2R2BB 4UIMA 4Y5VC 3X11A 3WNPA 1AP2A 2EDDA 3KPQA 1J8HB 2VDML 4PJEB 2UY6A 1F6LL 2PO6A 4FXKB 1EHNA 1EV2E 3CMOL 3F58H 1Y0LB 2MKWA 2OZ4H 3BISA 5C0GA 2P7TB 3DX8B 4PV9A 3JV4A 3FB5A 5ISZA 5E2TH 2R1XB 1F13A 3T3PF 2DM7A 4FFZL 5ILTH 5D7IF 2AJUL 5T5NF 1H3UA 5BXFB 3QPQC 1BPVA 1SBSH 4PJBB 1T6WA 4L8CA 5E6YA 1BZ7A 4YPGB 5ECJE 4EN3D 5GJSH 3PWUB 3X13B 5E00A 4OZIB 4ZDHB 1X6LA 2A1WH 5JHDE 4GRWB 1J8HD 1HHKB 2ZSWB 2R39A 4K7PX 4MDIB 1MQ8A 2E6JA 3MRHA 2XNAB 1KB9J 3L95B 3TV3H 2VISB 2IQAA 4F3FA 5GSRA 1CE6A 3FOMB 1P5UA 2GHWB 1ROWA 2XN9A 1IGCL 1YQVH 4ODSH 4X4ME 2PTTB 5TE4H 4A2LA 4NQEA 3JWNC 3TM6A 4D2NA 3HI5L 4XHJC 1AIFB 1T0PB 5EC1A 3TCLA 5K9KB 4QHLB 4MHHI 4JQXA 5IHZA 2NW2A 3RI5F 4F7PB 5CSGA 1W8NA 1D5MB 1PZ5A 3W0WA 3KXFB 4PLOB 1QLEL 1NC2B 5F9OL 3SO5A 2BP3A 4P46A 1IL1B 5C0IB 1KULA 1RUPL 2H45A 3ULSB 4PRPE 4TOYH 1A7NH 3MREB 4TTGA 3QUML 4LVHC 2R1YB 4L4JA 4XNYH 5DQDH 4LU5H 1CU4L 3MRDA 4DFHA 2ZWLT 4BJLA 2EC9U 4HLJA 4AENB 2Y6SC 3NA9L 4TNWK 5C0EB 1B4JL 3L6FB 3TBTA 5D93C 3KDMB 1BJ8A 3MRQA 1J18A 2K3TA 5FA3B 4HUXA 3ZHDA 5D1XB 3CSGA 3MLWH 5D2LF 1J05A 4EOWH 5MENA 4PYHA 3DO7B 1BM3H 3SDXA 3TO2A 1NC2D 5EO9A 5GGVH 2VDNL 3FQXA 5E1AA 4QWWC 2EE6A 5E2UH 2EDLA 4E41A 2IADA 1XGUB 1KTKE 4QXGL 4Y2OA 3UTSA 1PKQB 3Q5OA 4FG6C 3LRHA 5I8EA 1IJ9A 32C2B 1HE7A 2R1WB 3BEVA 4LCCA 2OK0H 1T1XB 1BFTA 1YMME 2V5YA 4H8WL 2DQIL 4NJ9L 3X12A 3IU3A 4HKXB 1CBVH 2Z31C 4GG6B 1G0XA 1EFXB 4HGKC 1JV5A 5IB2A 3C9NA 4CVWA 1QSEE 3BUTA 4U4BA 1U8JB 2R2CA 3ULUD 4JE4B 5LAXA 2IWGA 1G0YR 3SKMA 4FTVE 1A3LL 1Q38A 1IE5A 1JL8A 3SDYH 4G6KH 1DSFL 4FMKA 4HKJB 2Z93B 1YNLL 4PFEA 1EJOL 2YD1A 3P40A 4PS4H 4XNXL 1HIML 4KHTL 4N9GA 4GXUN 4BUHA 4OV6F 5DMGD 5I0ZA 1TJIL 3MLVH 4WFFE 3SGKC 4ZD3L 3BD3A 4URTB 4U1JB 1VKXA 3PGFL 4HJGA 3Q2CA 1P7KB 3RWJB 2UWEA 4NQCA 4PRNA 3RWCA 3OG6B 2PYEE 1U8IB 2GUOA 1KC5H 4YC2B 1UEYA 4PP1D 3ARGC 3BMVA 1NFKA 2RIKA 1T04B 1G1YA 5D7SL 4TQEL 4OJFH 5JXEA 4XAKD 4OFYD 3IVKA 4PJDB 2FBJL 4XP5L 5GS0H 1R6VA 4NM4H 2YMXL 4ISVA 4LSUL 5FHBL 5ID0A 5BMFH 5F3BB 4AEIL 5F71A 5GGSB 3QIBD 5FOBA 3HMXH 1FL6B 2NY5L 3WIIL 5I30L 5E9DD 5HGHA 4E42B 4GLRI 5FFLA 1JFQL 4M7LL 3U2SB 2XA3A 4LLMA 2RB8A 1MHCA 1P4LA 4XPFL 2WUBL 1NDMA 3MRPB 1I8LA 1A7PH 5E8NB 3HE6A 3PP4H 4M02A 1QFPA 1MAKA 4QF1B 5I76B 4XZUA 4MWFA 2DTSA 3WFHB 1F4WL 3KPPB 1CK0H 3EYOB 5SX4I 2OYPA 4MAYC 3MRGB 5D7KE 4TUJB 4KROC 4C83A 2D03L 4JO4H 2BY0A 4X7CC 5MERB 1F11B 4XWOC 4U1HA 4OQTH 4P2QE 3L3HB 3UCRA 5D72L 2DS4A 3ZTNL 1MCCA 5GISL 4P4KA 4Z7WA 5IROC 5IJKC 3KS0J 1J12A 1B4RA 1QLFB 3OKNA 1VEMA 4Z77A 4JZJA 2MHAB 5C0CD 1NBZA 3MNVB 1AGDA 4RGMB 1AC0A 3FB8B 3X3GL 3QCUL 1FP5A 1HH6B 1V7MH 3FTGB 1ED3B 1I7TB 2GKIA 1CIDA 1LK3H 3MRFA 4JRYE 1BQUA 3H9SE 4ELMB 3MV8B 5EO1B 4ZYKA 3VMPA 4GAJH 1LO3H 2X4QB 2FX8H 2ADFL 4L1HA 2C4XA 3LIZL 4Y88A 4PP2A 2P5EE 4JVWA 5F97E 4Y16B 3EJZC 4HGWB 5ITBH 2PCPB 3OJVC 4LKCB 3S4SB 2CIIA 3MRBB 1QPPA 1C1EH 4WI8A 2E27L 1KELH 3FFCA 3BGMB 2FLBT 5EBLA 4O58H 1AGCA 3S36L 4WW1A 1DVFC 2VDOH 1SM3L 3UBXB 1AQDB 3GSRA 5IVXE 3QEQE 3GMMA 3MV8D 43CAA 4QRRB 5C7XH 1NLDL 4OUUB 4L5FH 5DVLA 4PGEA 3SO3C 3S37X 4POZC 5F6HJ 5I8CB 3WYRA 5T1LA 2ZG3A 5FF6A 4KMQA 4G7YL 1NDGA 3GI8L 1OAQL 5TDPA 4M4PA 4L9LA 1EEYA 3BXNB 1DBBL 2VC2H 1N2RA 1RULL 1ZT4A 3DX7A 4XCEA 1LE9A 3EYFA 5F7LB 4X5LA 2YEZA 4LMQI 3WCYA 4PGBB 3GHEH 1JZ6A 1QBML 1NCCH 4QRRD 1EHLH 4JR9H 2LAGB 5T1KA 1N64H 5D6DC 3TH3T 5LQBL 3HS0B 2MQ3A 3K8KA 1ACYH 5E4EB 8CGTA 1Q72L 4UT7H 4MXQD 5CKGA 3U0TB 2XWTB 1GGBL 1OPGH 1PYWA 2IALA 5GGQH 1NEZA 5EG6C 3BD4A 3CPLB 4NKMA 5D96B 4OCNC 1NUDA 3G6JA 5D4QA 3HZMB 5FHAH 1YEDB 3RWFB 3QEHA 1FVEB 3DIFA 4ZTOH 1RURH 1EVUA 2VABA 1N5AA 4JHWH 4D3CH 1QA9B 3V7MA 3UTTA 3EYSL 1AQKL 3QBTB 4JFOB 3MC0A 4S1QH 4XI5D 3QQ9C 3UJIL 3T09A 2WW8A 3DETD 4FN0A 2EE2A 2J1KA 1MCOH 2ZCKH 4N8CL 5SV3A 4KJPC 4MVBC 1IARB 4KJWC 2CRYA 4L4TE 1U0QA 5DRXB 4AIZB 3AGVA 1Z5LB 1MCPH 3QO1B 4PRHE 4D9QE 3CFEA 3MRMA 1GXEA 2ZCHL 3NCCB 3B2VH 2Q8AH 4MXVF 4XAWL 1MCHA 4UQ3B 3CDCA 1YYLH 4HZLB 1DL7L 4RAVA 3O3EB 4JANB 2P48B 3DI2B 4NN5B 3RPIA 4J3VA 3LVEA 4Y4KB 3D25B 3K80A 1ZK9A 1C5BL 4AL8H 4FXLA 3MXWH 1S7SB 4K7FA 1N7ML 4P9HL 4WEMB 4XPBH 5KSVB 5FECA 2BVQA 4JY6A 2DQTL 4P23A 1T7WA 5TDNA 3DXAE 3LKPB 1CFTA 3UMTA 3H6JA 4U6YB 5ANMA 5KANG 1F3DJ 4XPHH 4ZQKB 4ODUA 1G7QB 2Y06H 3N85L 4RWHA 1DUZA 3C5ZB 4UIKH 4JCMA 1BZ9B 1JI2A 3EFDL 5TFSL 2VIRA 3HLAB 1RIUH 5ALBL 1FCCA 4MX7A 4NBYB 1H0DB 1R3HA 4YZFF 2I60L 3BDYL 4Y4KD 3P9MA 3H9HB 1RHFA 2C3WA 1U8MB 5M95B 2XQBH 4N0UA 3OKEA 4PLKC 5L2KB 2R23B 2CMRH 5T5FL 3VWKA 4P3WA 1BVLB 3GSUB 4G8FA 4Y5YB 4KTDH 5E8EB 5FA4B 4TTDC 3RVWD 2XA8L 4YHKH 3S3JA 1KBGL 4R8WL 3D39E 4ESKA 2E7LC 3AM8C 4BELD 3ARQA 4NN6B 4K2UL 3DURB 5BVJA 3ZE1F 3MV7E 3DV4B 1KB5B 4PJAE 5CZVL 1RZ7L 1WK0A 1A6ZA 2ZJSL 5IJVB 4XPTH 2GAZA 5T3ZD 1QP1A 3IDMA 2Y5TB 1OP3K 3MODH 1G7PB 1T20B 3IDGB 5I18L 4U1NB 5L2KD 1CLZH 3NIGE 4BFIA 4CDGC 3E6FB 5IEKB 3WEXB 5BV7H 1KLUA 3P30H 3QIUA 4TSAH 1HCVA 1J11A 1R5VA 2WBJC 3SDXF 5GS1C 2BSRB 2QQKH 1BBDL 4UBDC 2IH1B 4LCIL 5C0ND 1BJ1H 1MJ7L 2GT9B 4LSVL 4NO0B 1NAMA 2HLAA 3ET9F 2CDEA 3RL2A 3MLXH 4M43L 4X6FB 4UB0L 4QNPE 4PJCA 2IBBA 3B5GA 6CGTA 1ZLUK 5HI4D 2A38A 1QVOB 4LASL 2FX9H 2HJFB 5KVFL 3OGOE 1VDGA 4NC0B 1MHHA 3HAEA 3CFDA 2AJ3B 3BT2H 1FAIH 5TPWH 1ZHBA 3OPZL 1KCRL 2GY7B 4IRJC 1S7TB 2FWOA 3BKJL 1AXTH 4XBPA 5KSBB 2J12B 3HI6L 3K1DA 5IKCA 3D9AH 3SGDI 1ADQH 3A6BH 3LOWA 2IQ9H 4DGYL 4OZHA 4RFNC 2X4RB 3L7EA 2XQYG 5DD1L 5I75B 3HMXA 4D9RE 4P5MB 1N4XH 1U36A 2G9HA 3QIWA 2IMNA 5BJTA 4L3AA 4NZUL 2UWEF 2GITB 3QQ4B 3V5KB 3HMWL 3JVGC 3TZVD 4LBEB 2WLZA 4Y4FC 5GGTA 3WHXB 2B1HL 5EUKA 1OY3B 4PGJA 2W38A 4Y0GA 1S7VB 5H35B 1TZIB 1ZLVK 1F8TL 2VKWA 4MGXA 1I4FA 3SE3C 2BNUA 5F8RC 1SBBA 1Q94B 5C9KA 1Q0XH 5DHYA 5CSZA 4KJQC 4RMTA 3Q6GH 3I6LE 4R0LB 5C2BL 3PL6D 1UH2A 1OHQA 3JWDL 2XWJB 1IT9H 3NFNA 4OLEA 4MCZA 3FCTB 4BK5A 1OCWH 1ORSB 4OQTA 1NFIB 1CL7I 4RGOH 2DIBA 4HK0A 1OGTB 1H15B 1T0NB 3NZHL 4CRPA 2W0FA 3ETBF 1BX2B 4PB0L 2AK4E 1P4IL 4R4NC 1LEIB 1W0WA 4RAUB 1LEGA 1UT9A 1PSKL 2YD3A 3IU4L 4QKXB 1J0YA 3BZ4A 4JDTL 4D9LL 1JZ4A 1ZXQA 4AK1A 3GGWA 4YXLH 4UAOC 5KAQG 3RGVA 5INDB 4M1DH 4XRCA 1LNUB 3MJ9A 5D71H 1YEFH 3RUGF 2E3VA 1U92A 3S34L 4X8JB 3RNKB 4WY7H 2R29L 5TF0A 4YDKL 5I1HH 2WK2A 3WUWA 4P4RA 2PXYC 5TH2A 2BY3A 3EO0B 4S2SA 5DJ2A 1K4DA 4KMLB 1FJ1B 3HG1A 1G6RB 4IRSA 2N56A 5A2FA 4YNYA 2ZOLA 4LLWA 2VR9A 3QA3B 3PQYB 3QDMA 3O9WA 2A6IA 3ZSTA 2IANB 4XCFL 1CGSH 1QSFA 4FNLL 4KMTH 4RCAA 4L8BB 5CILH 4LLDB 5LKNA 4RFOH 2CDGA 2ZUVA 4XMLL 1IQDB 3W9EA 3TH2T 4Q6YA 1LK2A 3F6LA 1AHWC 4XH2A 3N9GH 2A6KB 5IQ7L 1LILA 1U8HA 4HWZA 4UOJA 2W0LA 5JW3L 1MCIA 4Y2DA 1I3RA 3TVMC 4F57L 2F8VA 5L7XH 3DYPA 2DMCA 1W0YT 1L0XA 2B8OT 3PQYD 4LLUB 3VGDA 1O7VA 2HTKC 4DGVH 3OJDA 1S9VA 2IAND 1CN4A 5EO0B 4LFHD 1C8PA 3QDHA 2YHGA 1FC2D 4OCLC 5C0FB 5DA0B 2VLKB 4OSUL 3UYRH 3HZVA 1FLTX 4V1DB 3VD4A 1BVKB 2OX5A 2MTPA 4MQXD 3ZKMD 2BNQB 2EYRA 3ZE1E 4FQIH 1A7QL 4LSTH 1A0QH 1C5DB 2VLRD 3JWDC 2XFXB 5JIPA 2ED7A 4YGAB 1I7ZB 1J0IA 3LKNB 4HPYL 4PJIA 3AU1A 3SE8H 2JCCB 1UH3A 5HHQB 1JE6A 5FGCB 4HULB 2E7MA 4ZUTB 5I1AA 2J6EH 5EIIA 4MB5A 1J0KA 3CK0L 2YD4A 5EZOH 2BSSA 3BHBB 4K3DH 1JPGA 3TYGH 4J4PC 4R2GC 3OKDB 4EUPG 4FQQB 2D7NA 4EJ1C 4ZFOL 1T6VN 3KAAA 5DK0B 5MENE 1ZGLM 5DUBB 1RUMH 2H3NA 3V6OE 2LU3A 3UXFA 2VLKD 4QRUB 4V1DD 1UXWB 4P57A 5FYJE 5KJRH 1NCBH 3PGCB 1NKRA 4JZOA 1P2CB 2NY1D 1AGEA 3QISA 4QT5A 4E41E 3GJFH 3UTSE 4RDQG 3VE0A 3VJ6B 3MV9B 4NNXB 2H1PL 3OB8A 1NUNB 1YUHA 1E6JL 2YPLB 4OFDA 3G6JF 4O5LH 3AY4A 5HYQA 1RJZA 1T21B 1VACB 5IQ9A 2NZ9D 4K9EC 4ZFGL 1S3KH 4HG4J 1MPAH 3QH3A 1QRNB 1OAZH 3DGGA 2DLHA 1AY1L 1BFVH 2BZDA 4H26B 3OAZK 4MYWB 1FNEA 4G9FE 4CBPA 1FQ9C 4KJYA 2YUXA 2NX5E 1HOCB 3MLSH 4BKLB 3BAEL 1RD6A 4YXKL 4WWKC 4MNGB 2GI7A 1UG9A 1DBJH 2DYPB 4LQFH 1RZFL 2QTEA 5HHXL 1I9JH 3GKWL 4GO6B 3LSOB 3D18A 3RKDC 1QRND 1U3HC 3RVTC 2EH7L 3HN3A 1IKFH 2IFFH 5AD0A 4Z8FH 4JN1L 1A6WH 1BFSA 1ZA3A 3AREB 3QXWA 1C16B 2HH0H 5TQ0L 4YHML 4GMSH 3I85A 4W6XB 2J5LC 1NAKL 3UTPE 1FYTE 4WRLA 5J6HA 5IVZA 1IGMH 1ZMYA 3O6FA 4YR6B 5AUMA 4HQQL 4X4XA 5L8KB 1WFUA 4X98B 4G43A 5DT1L 2OL3H 3NTCL 2ORBL 4G42A 1U58A 2DYPD 3L1OH 2VXTL 2BX5A 1D6VH 5EU6A 1BIHA 1WZ1L 3L7FA 3FN9A 4XCNB 1OF2B 2I25N 3O11B 5E94B 1MHEA 4HS8L 3Q6FB 1T83A 1HEZA 1DN0B 2ZSVA 4Y1AD 5GGSY 4YBQD 4OCWL 3MNZA 1H3VA 5ADPL 1P4BH 3K4AA 1ZHLB 4NUGH 5D70H 1F4HA 3S37H 3H7BA 3ARED 1GPOL 5JOPE 4HV8A 1RZGB 3LKOA 4FQJL 4ZNCD 1RZKL 3Q3GB 1YECH 3QG7H 5HI5D 3ZZ1A 1A6VH 1IQWH 4LOUD 4OGYH 1OLLA 2YKLH 1FFPB 3T2PA 2B39A 3SKUD 2BRRL 3BZFA 1SEBA 3WLBA 4JFZL 4KHXH 2ZPKH 3RJQB 4ZFFB 4GAGH 2VNCA 4NN7C 5D5ME 1M7IA 4LCWE 4PJ5E 1E4XH 2JLLA 3QUXB 1CFNB 4Z7WE 3BI9X 1ERNA 2ADGA 5E99L 4NZJA 1C5CH 5IFJB 1IAIH 3FT3A 2PUQT 1DN2A 1XR9B 1MY5A 1U91A 5EOTA 2O5XL 3JV6B 4JKWA 2B0SH 1XIWC 3JWOH 1N8ZB 3OAYH 1ADQA 3EOYG 3C8HA 1UYWH 3KPRB 2BCKA 3QUYA 4EI5C 3VFSA 4QRPD 3SCMB 4P3CL 2NYYC 4AG4H 4P2CG 1VCAA 4FQXA 4I48A 2J7LA 2Q8BL 3BPNB 4C56E 1I3GH 3FAWA 5DQJB 1S8DA 3MLTB 4Y4HD 1UC6A 1VFAB 4PJBE 4ODTH 3ARBD 2XKSA 3MROA 5BRZB 3PHQB 3MLYL 4OLVH 3V5DA 5DR5H 4PLJC 3VFWA 3PJSA 1HDMB 2DLFL 1ZHNA 1FZKA 3GMPB 4HIJA 1PJ9A 1J1OL 4GRWE 3H3PL 3LN5A 4XP9L 5DRWA 1I7UB 4P2OB 3LN9A 3LKQA 4JDVB 4U3XA 4Z9KB 4G8GB 1IGYB 4KXZI 3S5LA 3VRIB 4JO2H 4WW2F 3MFGB 4PJ8D 2G2RA 4MQTB 4YHIB 4RNRA 5DI8A 3LB6D 4BH7A 5DVKA 3GBML 5BRZD 4JFYB 3WNOA 4DN4L 4KTYA 5A2JH 5HHOA 3HC3L 3RAJH 3BKYH 1QOKA 3Q48A 4BQCA 4PUBH 2HMIC 3V5HB 3RY6C 3PXHA 3KVQA 2LVEA 1CG9B 2FD6L 4P2OD 2P42B 2NY7L 3OL2A 4MJ6A 4X6CE 3O8XD 4HJ0D 4YHPB 1V7NL 4G8GD 5F1IB 1HYSD 5CBEB 2IFGA 5AYUH 3D3VA 4LEOA 1HQ4B 1A1OB 2DI8A 1PEZA 2PO6C 5IOPA 5T33L 4YO0B 5HPMB 1UB5A 5CINH 2WM0A 1QEWB 5IUSA 5F9WC 5I1IH 1KN4H 5E2WL 1M7DB 5EWIL 3C60A 5C07A 3ARSA 5IVOA 2W65A 4D0CB 3U30C 5F88A 3B9DA 4HUUB 1BAFH 1N5YH 3BN3B 2V7HB 2YWYA 5FO9A 2NLJB 1HH9B 1S7WB 3MNWB 3HNTL 2VSCA 3U0PB 1JGLH 2FBOJ 1QBLL 4PPTA 1F58H 2B5IC 3K81A 3ZT7A 1JZ7A 1NMAH 1YEGL 4LARH 2WAHA 4JGMA 1WCBB 1ITCA 2EH8H 1VADB 2FATH 4GRWH 4RX4D 2YD5A 1A4KA 4HS3A 4LK4A 2H32B 3UC0L 2AJYL 3U7AA 3HC4H 4CADA 2ATKA 4I0PD 2C3HA 1GC1H 1BQSA 3NFSH 4OAWA 1C7SA 4KKBD 2X40A 5J57B 4IS6B 4N1HB 1ZANH 1MFCL 2MJWA 2YSSB 4JQXC 3P11L 4K3EH 1IKNA 3O2WH 1BD2E 5D7JB 2K9UA 4UDTB 5J13B 1FGNH 1VEPA 2ITDA 3IFLL 3WBDA 4XGZA 5DJAB 9CGTA 4J23A 2FEDD 4N90E 4QRQA 2XICA 2H26B 2ICES 4N9OB 4P46C 4UOW1 2EDYA 1NFDA 2BVEA 1KCVH 1W0VA 1IAOB 2Y07L 1IGFH 3MPCA 2NMSA 4BFGA 3MR9B 2FH6A 3V0WH 1OARH 3ZE2F 3QEGH 1IM3A 3RVUC 2J6EA 2LTQC 4O51A 3HKFA 1BQHG 5CHNB 5LBSL 4OIIL 5FKPB 5L6YH 2FIKA 3SOBL 1I7RB 5A16A 2YPVH 1Q9OA 4PJHA 5D7JD 3I84A 3UJJL 4TVPL 5JIKA 1ZVSA 3KJ4C 2VYRE 3QXAA 1ZLWH 5F7NC 1CGXA 1H3XA 2EDJA 2YZ1A 3FFDB 4JFFA 1IC7H 1KPRA 3UO1H 1OP5H 4LIQH 1U95B 1P9MA 4X5XB 3T8XA 4WO4A 4NDMA 2I9LB 5SWZD 3LZFL 3RZCB 3OHXB 4KKLD 3NAAL 4RGNE 5J9PA 3MJGX 5HYJB 3VFUA 1XF3B 1V3LA 2D7OA 4PJIF 4U1KB 4LCCC 1CE1L 2EXWC 1WFTA 1HILB 2GJ6E 3BOVA 5DK3A 1Z0MA 1D5ZA 2GSIB 5CGYD 5IW6B 4K8RL 5F7YC 3SQOL 5FCUH 6FABL 1WF5A 5JOFB 5DO2C 1TIUA 3CCHA 1E4KA 3TN0A 2CRZA 1FFNA 3LRSB 1CGVA 1RUAL 1JNLH 1W2KT 4Y8DC 2DTML 1RFDL 4HBCH 5CFHA 4M6ML 2MNUA 2X89A 1MIEL 4J3TA 3RZCD 5J11B 2NY0C 3UPRA 3P4OB 2J3SA 1I8IA 3R06B 1RHHA 4YDJA 5HYJD 35C8L 3LH2H 5FYLE 1A8JH 4PJCE 2FSEB 1A5FL 1WIUA 1EUTA 4BSVB 2HWZL 3BH8B 2KL6A 3LQAH 5EUOA 4TRPH 4J2XA 3CFJB 4H20L 1NGWA 2WUCL 3WKML 1T0MA 3V4PL 1JZ8A 4EIZC 3T0EA 2WQ8A 3HFMH 5KVGH 4IDLA 2YRZA 4G3YL 5JXEC 2HT2D 3T3ME 4ALAL 2WZPD 2XWBB 1T3FB 4MD4A 2OL3A 3NZ8A 2VQ1B 2XZQL 4OZHE 4NNYA 4X6DB 4OT1L 4HIIA 3CH1B 4MAUH 3ZDXE 1UWGL 2ESVB 1ZV5A 3DX9B 4DKEH 5HVFB 2JJVA 3O2VH 1OQXA 3H7LA 4W4OA 3HI1B 4LDOB 1B6UA 2A9NL 5T3XL 1A2YB 2HKHL 3P0GB 3RWHA 4M93B 3BQUA 1I8LC 4DFIA 4XMKH 5DJZA 4GG8A 4JRXB 5H37G 3HE6C 1M7XA 1K85A 4I2XE 3B83A 3GK8H 5IMLA 3DVGB 1H5BA 1GGUA 1T22A 4JKLA 1ZS8A 5IFAH 3DVNB 5HVWA 3F58L 2OZ4L 2CLRB 4XTRC 5F9JB 4MCYB 4GT7A 3KG5A 3L3KA 3LPFA 3OAUL 1HQRB 5E2TL 1AXSB 1N0LA 1ZVHA 2DWEA 3BP7A 3KPMA 5ILTL 4ZSOE 3LDBB 4P4KC 1NJ9A 4P5KB 3WDHA 5DFVC 3HZKA 3VXOA 4JZJC 4JRXD 3VH8A 5GJSL 3BZEB 2BK8A 1ZHKA 4K8RC 3V79C 2IG2L 2A1WL 1UQSB 3VCLA 3OXSB 2A73B 3ARDA 4LPUA 3N1PC 4YFLF 4FXGA 3TV3L 4GMTH 3C87A 5C0BB 3U82B 2OMNA 1AO7A 3O45B 3ZYZA 3QFDB 1X6NA 1E4JA 4B0MM 1EEQA 4QHNB 1K3IA 4M7ZB 1RY7B 4ODSL 5D2NB 1I1FB 5TE4L 1F6AA 2HA1A 4ZNEA 2FNBA 3RX7A 3C6LA 1FVCB 3IKCA 3EDJA 2F74B 3NABH 5GS2H 1YMHA 2MQCA 1IAKA 4QYOA 2XPGA 5D7LA 3C8KB 4F2MB 4MHHG 2HLFC 3F5WB 3VXRE 1OAKH 3QDME 4WFGD 5B38A 1QSFE 3EDFA 1YY8A 5ERWB 3RDTD 5C0BD 1IAIM 3HHRB 4NQVA 4APQB 1B0GA 3ARFA 3BMWA 2VQUA 8FABB 4HS6B 1A7NL 2RAMA 4M8VA 4QOKB 4G6FD 1HWGB 4XNYL 5DQDL 4LU5L 3I3DA 1Q9KA 4OCMC 4CMHC 3MRKB 4GW4B 2NNAB 1BREA 3MX0A 4QCIB 4L9LC 2R69L 1EX0A 3QFJD 5KOMC 3MJ7A 2VN7A 4CVZA 1FORH 3QAZC 3IJHB 4HFUH 3MLWL 3ZKNC 2VXSH 1WTLA 4OLWH 3U4BH 3MRCB 5CBAB 1BM3L 4U6XB 1K4CB 1DQDH 5A43C 5JMOC 3L3OB 2BNRB 3GMNB 5GGVL 3FONA 1LQSR 3H42H 4APQD 1MQKL 1BBJB 5E2UL 3IDYB 3HZYB 1OTUC 4EN3A 2R2HA 4QOKD 3CXHJ 2X4UA 2PF6A 4AH2B 3F7VB 1J8HA 1EEZB 1S7UA 1TLKA 3CU1A 4PJEA 3LMJH 2OK0L 4FXKA 1FRGH 4Q9RH 1RK1A 4G6ML 4DK6A 1WCQA 2E7BA 1CBVL 3IFOA 2P7TA 2IH3A 1NCAL 3DX8A 3X17A 5L0QC 2DQJH 3DRTA 1ZLSL 5CEZD 2R1XA 5GZNC 2BHUA 4OGAD 4JFDB 4M1CC 5I1JH 4R97C 2KZWA 1MIMH 4MNQB 5BXFA 1HHJB 1OT2A 2Z8SA 1KJ2A 4YPGA 3UAJD 4G6KL 4MQ7B 3PWUA 2W0PA 1TVHB 4ZDHA 3LKSB 3G6AA 4PS4L 1NAML 3HUJF 3L95A 3O6MH 3PWJB 3NIDF 1OGAB 2VLME 2YD7A 1HZHH 1KC5L 1JK8B 1XF5B 3HB3D 4JFDD 1IM9B 1MI5D 2DQHH 4O9HL 4NZRH 4OJFL 4P23C 1AIFA 1A1NB 4YFLI 2Y36H 1E0OB 4NZDA 4QHLA 5GS0L 4NM4L 4PRBB 4QHUB 3DV6A 3BRFA 2VMFA 4F7PA 5BMFL 4PJ9B 5HHPA 1TNNA 4NO5A 4PG9B 1D5MA 1T1WB 3VA6A 4FABH 2H6PA 3HMXL 3S7GA 1OGAD 1NC2A 3RNQB 4EQ3A 1IL1A 3QQNA 5C0IA 4XP4H 5CJOH 1BGXH 3ULSA 2UZIH 3QI9D 4MS8D 1A7PL 1RZIB 3PP4L 4GXUM 3DHMA 4KWUA 5GGTL 3VWKC 2NY4B 4LVNC 1CK0L 3INUH 5T3ZH 4EDXB 3L6FA 3GKZA 1X5ZA 3GZKA 3SDAB 4NCC2 5SWQB 4PJ9D 2AJXH 4JO4L 3E8UL 2BJMH 4NHCH 5B3JF 5F7HA 4LHUG 3DO7A 1VFBB 1YEHH 1EGJH 4OQTL 1KFAH 4UU9B 1JHTA 5AWNH 2Y1VA 4OZGA 3NGBB 5HDQL 1EBAA 5KN5B 4Y5VB 1EEUA 2CIKB 4UNVA 1KB5H 1U2CA 4FFWC 4OM0H 3ECBB 3CZFA 2NY4D 3DHJA 1V7ML 3DYOA 4PJHF 4PRDB 1MCWM 3UEZA 1T1XA 5DWUH 5IG7B 4GG6A 4X0KA 4X4YA 3E2HC 4L4VB 3B9KC 4GAJL 3MLRH 4P2RD 1LO3L 3TBYA 2FX8L 4XPGH 4WI9A 4EI6B 3P4MA 4PRIE 4MMZC 4V2CB 1Q9LB 1RQ5A 4OB5L 3RJDA 5ITBL 2GIYA 4IJ3C 4OFYA 3CC5A 5DRZB 5CSBA 1V5JA 2OTWB 5BCAA 2ICWA 1G9NH 4PJFA 3ZDZF 1KELL 2BFVL 5IW1B 1QTYT 1BLNB 4O58L 2Q76B 2VDOL 3CX5K 4M8QB 1T1YB 2FHCA 4U1JA 3QIBA 4DVRH 2JJTA 1M6OA 1P7KA 5E9DA 3RWJA 1G7JA 3CVIH 2A83B 3RU8H 5K9OB 5C7XL 1U8IA 4JO1H 4ORGB 2M8XA 4I0KA 2X2YA 1Z6JT 5CEXB 1T04A 1P7QB 2B4CH 3PWVA 4GAYA 1AXIB 1FO0B 5HJ3B 3HRZB 4DOHB 2PR4H 1QR1A 5IESH 4PJDA 4JJ5B 4HKBA 1FL5A 1KTDB 1D6EA 2VC2L 3QIWC 3VXMD 1S7RB 3U7WH 5KSAC 2UUDH 5EUOF 1F4XH 1MCRA 3IFPB 1F4YH 3O2DH 2ADJB 3A0OA 4PJGE 2PYFB 1NCCL 3PWLB 3ZT6A 3V6ZB 1EHLL 3BYYA 4JR9L 2X9XA 5CIPA 5TE7L 3ZE0F 1KIQB 1N64L 1ACYL 3MRPA 1Q1JH 3EO1B 4UT7L 4NKQB 4X5WB 1P7QD 5C0CA 2ATPB 4IOSD 3KPSB 2H2SC 5I2IA 1KIPB 4PTTA 1OPGL 4QF1A 5GGQL 2V7NA 3EO9L 4RRPG 1DBKH 3KPPA 3HTLX 5ACZB 4DJMA 2P24B 5LCVH 2MCPH 1D5XB 1G84A 5FHAL 4TUJA 4JKKA 4OD3H 4U1SB 1SYVB 2IGFH 4ZTOL 3STLB 1RURL 4DZBB 2KDGA 4D3CL 5MERA 1F11A 5CWSB 1VGEH 1OW0A 1KCSH 3P2TA 4P5TD 1LO2H 1U93B 1MCOL 1UM6H 5TGBA 2XXMB 2ZCKL 5ICYB 4H0GA 4MZ3A 1GJIA 4UI2A 1QLFA 5GGRB 1NC4B 1FFQA 2HAZA 1MCPL 2Y6SD 2MHAA 4CVXA 4GKSA 3VFGH 3MNVA 3KPSD 1W72B 1NBVH 2Z31B 4W68A 4KK8D 3FTGA 3B2VL 2QADC 3LN4B 1ED3A 2Q8AL 3RGVC 4Q6IB 1MAJA 4IHOB 4A6YA 1OB1B 2F54B 4RMRA 3MV8A 1S5IH 3NIDE 2JCCE 3ULVE 1KG0B 2X4QA 4XNZC 3U9PH 4OZFG 1QO3A 4LKXB 4IRSC 4AL8L 2RR3A 3R1GH 1MLCB 5HHME 3TA3C 3MXWL 4XPBL 2IBZX 4AZ8A 4FG6D 1U8LB 2Y4SA 3MRBA 3O9WC 1FCGA 1J86A 1G6RH 1NMCC 2YD6A 4J3WA 1XGPA 3W9DB 1CVRA 3BGMA 2BERA 3GNML 4XPHL 2Z31D 3KNBB 1A21A 3UBXA 2Y06L 1AQDA 4UIKL 2F54D 4JO3H 4K07A 1QSZA 3SGJA 2YPLE 3G5YB 4QRRA 2AQ1A 1JHKH 3O4OC 4YHNA 2FJHB 5E70A 2BSED 3G9VA 5I8CA 2DL9A 4MA8H 2ZG2A 4KUCF 3TCXA 3PWPE 2CMRL 1UZ8B 1JNHA 4KTDL 3LHPH 4JG0H 3RHWF 4AMKH 2VITB 3BXNA 4YHKL 2DQCH 1WZMA 4MNGE 5BZDB 3MRIB 1G7LB 3L3GB 4HX1A 1VGKB 4JM2D 4YEEA 2X6MA 1HI6A 1LP9E 1NFDE 1MJJB 4DEPB 2ZUQB 1RZ8A 1JYXA 4PGBA 4U0RC 4WU5B 5TQ2H 3BIBX 5IWLA 3WE6A 1MLBB 4XB7A 5AAWA 3BPLC 4K3GA 3MODL 1I9IH 3SGEH 3CPLA 3MLUH 1CLZL 4J8RA 3T0XA 4KROB 1LO4L 5BV7L 1G7HA 1JF1A 1NUFA 4NFBA 5HDOA 3KPNA 3P30L 3HZMA 2AKRB 4TSAL 4YUEH 5ETUB 3RWFA 1FVEA 4KZEH 2E9IA 2QQKL 4JVPA 5JNYA 4JFOA 5JPMB 5B8CC 3STZB 2R8SH 5LXGH 3SE4A 4D0BA 5FYKL 3MLXL 4JM4H 4MQSB 2UYLB 5D1QC 4FQ2H 5DRXA 1GHFH 1Z5LA 3QO1A 4PJEF 5KS9B 2VDRH 3AY4C 2FX9L 2GJJA 4KROD 3ELAT 3M45A 4PREB 4UQ3A 4JJHA 2FEEL 4GKZB 1FAIL 4ETQA 4IMLB 5C09E 4YH6A 3VI4E 3O3EA 5BOZG 1FV1B 1AXTL 2BY1A 4HMCA 1IFHH 3D9AL 4Y4KA 3D25A 1KIUA 1ADQL 4ZS7H 3A6BL 2DLEA 2IQ9L 4KI5E 5MEPB 2VAAA 5GXBB 4Y8AA 5T1MA 5KSVA 4OZIF 4ONHA 3OKOA 1TENA 1MH5A 4S1DD 2VE6A 3JSSA 3LKPA 1DVFB 2EEAA 2X42A 3MRRB 2X4OB 1CFQB 5CD3B 3LEVH 1N4XL 3KPLA 1CR9H 3CSYA 4ZQKA 1E4XI 2ICWJ 1NCNA 7CGTA 5FAAA 5EUOE 3VXTB 2JJSA 1BZ9A 3CDGA 4HLZH 1RI8A 1ZT1B 4I4WB 3QG6A 3SJVE 3HLAA 1OTSC 3QXDB 1HSBB 3T0EE 4LAJH 4PJ7E 3EJZD 1H0DA 3WXVH 1Q0XL 3BD5A 3H9HA 7FABH 3QDGA 2XTJD 1AC6A 3O6FC 1XGRB 1X5YA 3Q6GL 4OCXH 3QDAA 2K1MA 3GSUA 5FA4A 5E8EA 4LLQB 2VDLL 1OCWL 2CUMA 3IDIB 1NGZB 1T83C 3DROB 2W9DH 5CZXC 4RGOL 2OI9C 4CGTA 3KPOB 3FAXA 4Z5RB 5JLZB 3GJFK 3DURA 2YC1B 5JW4M 5IBTH 3DV4A 1DZBA 1KB5A 3HNVL 4CU7A 4KK9C 4U2YA 5BV7C 4DTGH 1U6AH 1UB6B 4ODWB 4PJXE 3ZHKA 3QDJB 2Y5TA 5DEFB 4LEXL 2J8OA 5TF1H 5EFIA 1VSCA 4ZPTB 4YBLB 3T4AB 4YXLL 4U1NA 4BH8B 5K59E 1PQZA 4KV5E 5HGGS 5IEKA 4J3UA 4M1DL 3F12A 2ZG1A 5D71L 4I3SH 3FJTA 3CAFA 3ULUF 1Z9OA 4PGCA 4WY7L 2BSRA 1TJGH 2HKFH 2Y7QB 3QCVH 4N8VA 5ENWB 4OZGF 3MRNA 3E6HB 2GT9A 1DLFH 4EDWH 2XG4A 3RVVC 4CJ1A 2OTUB 5IT2H 4L8DB 4OF7A 3TNMA 5FGBA 4F7CB 2HJKB 1V3MA 1JPTH 5FB8B 4UUJA 1CGSL 1VFMA 1FNLA 1QVOA 1FH5H 2HJFA 4KMTL 3IAQA 4WGWB 4GG6F 4LPTA 1EUUA 5ADOH 3VXNB 4RFOL 3B8SA 3QP3A 3QUYC 3TZVA 3F7PC 1BF2A 3QQ9D 1S7TA 3N9GL 3L3IB 3MRLA 5KSBA 3GSOB 3AS0A 4ZNEE 3LD8B 5JHDD 1P5VA 3H3BC 3ALPA 5L7XL 2X4RA 5D7LE 5IV2A 3PL6A 4PJFF 4WUUB 4Z7UA 1VENA 3GMLB 4DGVL 3O2DA 1R3KB 2WINB 5FUOH 3QWOB 5MI0B 4J7RA 1T7VA 1KEMH 4PRPB 1OAXH 1N6QH 3QQ4A 2GITA 4U7KA 3V5KA 3WN5B 4LBEA 4WJ5B 4FQIL 4LSTL 1GAFH 1A0QL 2JIXB 5F7DB 1CLYL 2CR3A 1H8NA 3SE8L 3ZKXC 2OXHA 3O41A 1RK0B 4PJDF 2J6EL 5EZOL 2R0KH 1XGQA 2GYSA 3TYGL 4GSDH 3FCTA 4JG1H 1ORSA 1NFIA 1AGFB 2P8MB 2Z91B 3MACL 1HYRC 4PRPD 1FPTL 1RUML 3S3PA 2V5RA 4HHAB 1JGDA 5C0DB 4W81A 1FZOB 2W92A 4L1DA 2A0LC 1D9KD 1T0NA 3WLWC 3P77A 3NBNA 3NIFE 5KJRL 1BX2A 1NCBL 2HRPH 1KTRL 4MA1C 1LEIA 3NVQA 4RAUA 5I17B 1YMMB 5GS0D 1Z0NA 1QLRA 2VRAA 5BW7A 1IILE 1PVHA 3CX2A 1QSEB 1SJHA 5CCKL 4O5LL 1CFSB 5I66B 3QEUA 4P2YA 3ULVC 3MCG1 1S3KL 3GSVA 4N0FA 3WFEH 4ZXBD 1A9BA 1MPAL 1U41A 1OAZL 3C60C 4MA3B 4DZ8A 3QUZC 3DBXA 4ZFZA 1BFVL 4X8JA 1IGJB 3RNKA 3U6RB 5HYFA 1RIHL 2BOCA 5I9QC 1A6TB 3EO0A 4U7SA 5GZOC 5L8LB 3TWCH 1G6RA 1X7QB 3FB7A 1TVDA 1S9WB 4Y19B 4FRWA 1YMMD 3FOLA