3OKEB

Crystal structure of s25-39 in complex with ko
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
217
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPTNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
total genus 41
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeB01
3MRDB 1CICC 2WINA 3TESA 5ALBH 4MDJB 1ONQB 4OLEA 3R06B 4GAGL 2P8LA 4HEPG 4LSTH 1DQTA 4R7DB 3SJVE 5D7LD 4KDTA 4OGAC 3IDNA 5IBUG 2IEPA 1RIHL 4NIKB 3FT3B 5CIPB 1P2CA 4LSPH 3X14A 2B4CH 1G9NC 2CGRL 4BFGA 4AEEA 4KZDH 3BEVB 1KIPB 4XHJD 4HKJB 3NIFF 4EEEA 1GXEA 5FKAB 1KJ2B 5HPOA 1T89A 5F7HA 2YUZA 1E28A 5AD0A 1SBSH 2VDML 1O5DT 1B6UA 1A9BB 2BX5A 2H8PA 4AEHL 4NNXB 1ZLSL 4TUJB 1JV5B 4ORGB 1U3HA 5C3LD 1IGJB 3S88H 1FVDB 2LQRA 1G9NL 1G1YA 1U8QB 2BK8A 3VMNA 3BZ4B 3BWAA 3O6KL 3CFJB 4JY6A 1XGPB 3H7BB 3I50L 4RNRB 4XCCL 5D1QA 1X5FA 4P2QA 5EZJB 1JWMA 3HHRB 4K71B 5MEOA 3OGCB 5J89A 5E8DL 4WI7A 3GO1H 4RSVA 2R1YB 1T7WA 2FZ3A 2G60H 5IHZA 1BEYH 3WEXB 2ZCKH 4U31A 5GRVK 1L6XA 1QKZL 4M48L 3SDDD 5ESVB 4Q9BA 3CDGB 4X5XA 2DKMA 1NCDL 3ULUC 3STLB 1Q8MA 2ADIB 4KV5F 4LCCC 3RWEB 1G9MC 3M45A 1S7RB 1JPGB 3ILQC 1KGCE 2GT9A 3OZ9H 4ZFOA 5ITBH 3S9DB 1LHZA 1MCHA 1MWAH 2BOBB 4M5ZH 1B0RB 1S9WA 3VRLE 1HHHB 3EOAB 5HDQH 3WS3B 1Q1JH 4BKLB 6FABL 1SYVB 4HX1B 5TDOB 1N7ML 3ZTJH 2VQTA 3I9GL 2IQAA 1OAKH 3RWIA 1S3KH 3MZTA 4UB0L 5D7KD 3VWJA 2OK0H 2P8PB 2OJZL 4JFXA 1TTUA 4YXHL 4PLJD 4TVPD 2ZCHH 4TQEH 1EA9C 2GJJA 1W72A 1HDMB 1CE6A 1W8OA 4QOKD 4OCMC 2BP3A 1SY6A 4K2UH 5K9JL 3MRGA 3S98A 3O4LB 5GJTH 2DF3A 4Y19D 4OFDA 4OZGA 2EDNA 2VIRB 2MMXA 2HTLC 3D0LA 4LGSB 3ROOA 2GITA 3MA9L 5IQ7H 3VWJB 4GS7B 3NPZB 5BQ7B 4KKLC 5KW9L 3SQBA 4JFPB 1EO8H 1JNJA 3T0VA 2VQ1A 4I0PA 4XNXH 3O45B 3WIIL 1MHCB 1A6ZB 3CXHJ 3QFJB 3O4OC 3UO1L 5I6XB 4PLNC 1IE5A 4R97B 5ILTH 1T20A 3SO3C 1R5VA 2XN9E 5DYOB 3U7WL 3GUTB 4LLQB 2JCCA 4LRIA 5ADOH 12E8L 3ARSA 3MRBB 3TBWA 1CDYA 5IB3A 4JFEE 5BZDA 3BH8A 2R29L 2R1XA 5I75B 1INEH 3U30C 2EH7L 3D2UD 3TVMD 1UC6A 1FGNL 2UWEE 3OXRA 4NUGH 4WTXA 1D9KB 4LLUB 4X5XB 2YD9A 3IJSB 4NCC2 5L8LB 1JK8B 1VFBA 1ZV5A 2D03L 2DQIH 1DTUA 3MRIB 3QEHA 5GZND 4PJFF 5DRWA 3VWKC 3C09C 5I76B 4MJ5A 1DL7H 3LKSB 3CFCL 3SDXE 4QCIB 2CDFB 1FGVL 4G8GA 1EERB 4OM0L 2WIIA 3C8DA 5FO9B 1A2YB 4O2FB 1FNFA 1SY6L 1N0XH 4GKNB 5FUZL 3IS1X 4U6YA 4AG4H 2WP3O 4QF1B 3RPKA 1MLCA 4DKFL 3DTXB 5IK3B 3MLTB 5C2UB 5IB4B 2ZUQC 5JHDD 3K2MC 4HKBB 4IJ3B 4U1NA 5TQ0H 1U6AL 1ORSB 3KHOA 1FJ1A 1JV5A 5EBLB 3QA3A 3RIFF 4YIQB 3TPUB 4GSDL 5IT2H 3G6DH 1OWRM 3O3DB 1TIUA 3MRIA 3PNWB 4BSJA 5I2IA 3QXAB 3FMGH 2D7TH 3NTCH 4RMVA 4WUUB 4NN5B 5I76A 1GGCL 2RBLA 2Y7QB 4WHCA 1QP1A 1HWGB 2DJSA 3S5LG 2BFVL 4YDJA 4KRNA 1NBZB 3OAZK 1LMKA 3OGCA 2X4UB 2OZ4H 5GGRY 5IIEA 1U93A 1XH3A 4H25A 1AKJA 1GYAA 3TBVA 1CLOH 3B5HA 2BZDA 2YPLA 3JWOL 4EDWL 3UJIH 1FDLL 4U0QB 4D8PA 4DZ8A 2BVOA 1ERNA 4L1DA 4JHAH 5AYQA 1CFNA 1WCBB 1PZ5B 2CRZA 4OCXL 3QEUB 3S4SA 1NDMB 3UBXA 1EO5A 2V9RA 5KVGL 4APQD 4G6JL 3MREB 4XVJL 1QR4A 1S78D 3S34H 2DM7A 1REIA 4GAFB 3VXRD 1KIPA 1ZGLP 3ELAT 3OKEB 2R9HC 1NAKH 3KPMB 4P3CH 3MRLA 1IQDB 4LL9A 1X6LA 5DI8B 4N0YL 2UWEA 4R3SA 2FR4A 1RZIB 4YPGA 4JHBA 2NY5L 2VN4A 4YK4C 2JJTA 1JNLL 1QBML 4LPYA 4YNYA 1XCQB 2IGFL 3EKCA 2VLMD 5E2VH 4P5KA 5DT1L 2UZYB 3MLWL 5IVXB 1L7TL 3RVWC 1SYVA 3QIBC 5I1EH 1IC1A 4UU9B 2CXGA 3IDYC 3WD5L 1F4XL 3DARA 4GG8A 2VXTH 1FCCA 1KN2H 4HUUB 3VG9C 1OGAE 4XI5D 5FXCH 4X9FA 1MIML 1VERA 4WY7H 3N0PB 3QEQB 3FRUA 4Y5YC 3PWPA 1SVZA 4ZSOA 2VLRE 1AC0A 2YPVH 3IF1B 3FCTA 1YEJL 2F5BH 3NCJL 5B39A 3QXTA 1SJHB 4Z95L 5CSZB 5JXEA 4U6VL 3EYQC 3TV3H 5I1JL 3INUH 5HY9A 3KWWA 5FUCE 4XC3L 1MCBA 4LASH 2ZUSA 2YD6A 2DDQL 5H35B 4ZNEE 5BZWA 1YMHB 3Q3GA 4IIQC 5INCB 2XXCB 3AROA 1AD0A 3HAEA 4YHZL 3CFKB 4OZFA 2AJUH 5F9OL 2GTZB 5C8JB 1KJ2H 5GRUL 3WN5B 2OI9B 4XC1L 1WIUA 3H8NA 1C1EH 2ADFL 2OR8A 4PJAE 1RUPL 1VHPA 4R0LB 5J6HA 1KJMA 4GBXA 3EFFB 4RMQA 5CINH 1LO5B 3DGGB 1PLGH 3LZFL 2BY3A 5JPMA 1YEFH 3ULVL 4P5KB 3DX8B 5KSVA 3SGKA 4HWBA 5DMIH 4CMHB 5CJXC 4HJ0C 4PJIB 1I1YB 1CG9A 2VLJE 4QNPE 4GLRI 1U8QA 3CDCA 3SGDI 5DC0A 3A67L 1U8KA 3DRTB 3GMQA 1R5IB 3LAFA 1U3JA 4J4PD 4G9DA 4Q6IC 4PGBB 4YGAB 2FX8H 4R7NB 3TIEA 4PBWD 4U2YA 3BN9D 4OD1L 1A3LH 3B6SB 3NACL 3QFDA 4ACPA 4KKBC 4L4JA 2EEDA 4NM8L 1DUZA 1OTTC 4L8SC 3VXOA 2YC1B 3B8SA 4HDIB 2FO4B 4N5UA 3DURB 3EFDH 3EHBD 1HI6A 5I1GH 5DK0B 1R0AL 1U41A 2GUOA 4UDUB 2HLFC 2P1YA 4JPKH 1OAZH 1XMWA 2J5LB 4NZTH 3SO5A 2AV1A 4AL8L 3C6LA 4ZO6A 1RU9H 5IHUH 3VFVB 4NNPL 3NVQA 2B1HL 3LKOB 3SPVA 1DANU 4Y5YB 3TN0D 3BHBB 3OG6B 2BNUB 3ABZA 4PJCB 5FK9B 3VFUA 3FONB 4AENB 5IQ9B 5DJ2A 1H3XA 2X4QB 3WLBB 5DTFB 4PJ5D 1NLDL 5ID1B 1TVBA 1NC2D 2VAJA 3LRGA 5C0AA 4GAJL 1FZJA 2A9MH 4BZYA 1GAFH 3HNTL 3UJTL 2MKLC 4IOFC 2HKFL 4X7FC 3IAPA 4ALAL 4ISVA 4P9ML 4OLXL 4Q2ZB 5HI4D 3ZSSA 3RWFA 2CPCA 4P9HL 3DYMA 3W82A 2ATKB 2BVTA 2DIAA 3ARYA 4PRBB 1KB5H 1M7DA 3UPRA 1HN1A 4G6ML 3WCYA 1K8IA 3I3DA 4U1IB 5EZOL 1TPXB 1AH1A 3G5XB 5HSFA 1AGDB 5FYJU 2PUQT 2XNAA 1LVEA 3KYMB 4PP1D 2XG4A 4DZBB 3RKDC 1K2DA 1UACL 4HUWA 4ZS6C 3GJFK 4KJPC 5AZEH 4JY5L 1F4YH 5AYUH 4RGNC 3RL2A 3SJVB 5ELIA 4M7JH 1UKTA 5SX5K 4PJCF 2X70A 1ZXQA 4FFZL 3T3ME 2FYYB 5GS2D 1TCRB 3MRNA 1YNKL 1HSAA 3ZSTA 5ID0B 3MLPA 4HBCH 2V5RA 1HOCA 4P59H 3F7PC 4MD0A 2FGWH 4HWBL 2DL2A 4MD0B 4W81A 2QSCH 3QQ4B 2EDDA 2QQLL 1CGSH 4JO4H 1CZ8H 3HE6B 3V5HB 5D8JH 4DKAA 4PRAB 3I02B 1MFNA 3HI1A 2NY6C 4BQCA 4EN3D 4RGND 3LKRB 1FFPA 1X4YA 3RTQB 3DMMB 3LPWA 3VDAA 3W81A 1II4E 3VXMB 3B9AA 5IB5A 5DVNA 4WI5A 1I1AA 5I1LA 4PV9B 2BVQB 5KVEH 4FOMA 4KVCH 3AGVA 1NMAL 4J1UA 4YBLC 5ICXA 1KIUA 2IPKB 4ZPTB 4Z7UA 5A43C 2VDOL 4A6YL 4GKNA 4ZO8A 4QXTB 1N64L 1DQDH 2J8UA 1A9BA 2ARJA 5T3XE 1VEOA 4I0KA 2C4XA 3WUWA 4YHIB 1KEMH 1AO7D 1DN0A 3S4SG 3VD5A 3BP7A 5ID1A 2EDJA 4OV5A 5E2UH 5J56B 4PD4K 4PJEB 4PRHA 5DJ2B 3WLBA 1FSKB 2CIIB 4GBXD 2FO1A 1X7QA 4N8VG 3LS5H 4O02H 2XY2A 1MUJB 5SWSB 2RCSH 3MUY1 3H42H 3BO8B 2I24N 1EEQA 4X9IA 1AXSB 1WBYA 4W4OC 3NIDE 5J6GA 3CSPA 3GSWA 1HDMA 4CDGC 3RWJA 1EBPA 3KLHD 3C09B 3VWKB 3VFVA 5IVXA 1HHIB 1OAYL 5CBAB 1CBVH 3CX5J 3SE3C 2YUXA 4RZCB 3RUGE 3MGAA 4YE4L 4NP4H 4XPBH 3VFRB 3IFLH 2IQ9L 3D3VA 4H8WH 3NCMA 5IOPA 4OCLC 4PB9L 2VRAA 1B4RA 2NY3D 3NBNA 4ZO9A 4K94H 3MV9D 4JFQB 4XRCA 1WT5C 4XRCB 5AUMA 1B88A 4J4PC 1S7RA 5CCKL 1N6QL 3QUKA 1BJMA 4Y89A 1F5WA 1I4FA 3V2AR 1YMME 2NY0D 1Q94B 3E2HB 1MVFA 2VERN 3L3GB 4KJQD 2IH1B 3L6FB 3X17A 2AEPH 2ADJB 4EN3B 3UTSB 1MFCL 3SDXB 5CJ8A 2NZ9D 3AM8C 3NZ8B 5I1AA 4P46C 4L4TA 2PW2B 1RULH 1N3NB 4HEME 3CVHA 3QPQC 4KK6D 3T0BA 4JHWL 3CMOH 3V4UL 1JWSA 4O58L 4OF0A 4LARH 3EYUH 4YUEL 3IJHA 3H3BC 4HMDA 5AZ2H 4S1SL 1KTLA 1AXSA 2AI0L 3FN0H 5IKCB 3BZDA 4YDVB 2XQBH 3MRKB 4WEMB 1JTOA 1IQWL 1RMFH 1TITA 4L9LC 4ODTH 4XB8A 4JDTL 1JWUA 3FQUA 2NY2C 5EBGA 5F9AC 1JE6A 1M6OA 3DLQR 1E4XH 3NCYP 3RU8L 3F58L 4H20L 1X5IA 4K7PH 2JB6A 5FUOL 3WFHA 4FXKA 4MS8C 3RQ3A 1ES0A 4LDOB 4Z7QE 1D5IH 3RWCB 4DWHA 3TT3L 2VTFA 3LKQB 4LCWA 1E28B 5GS1C 3EDDA 4G6AC 1I8IA 3IDMB 1MI5D 5KVFH 3LS4H 4U1NB 5T3ZE 5E99H 4NJAL 3S3SA 3HG1A 3JTSB 3F7VA 3GJEB 5KSAC 1BBJA 3BI9X 5FCSH 15C8H 3O0RL 3CDFA 4F7PB 5CIPA 5BV7L 2DIJA 5IKCA 1ZVSB 2A0LC 4UQ2B 3P0YH 1UCBH 3M1BB 1WV7T 2NW2B 4JR9L 4FZEL 4H1LH 3C2SA 2NX5B 2AEIT 2HG5A 3TVMC 4QXUL 2FIRT 4YZFE 4UMGA 4WFHE 2DYPD 4NQUA 4JPIB 3PQYB 2H26A 3FT4B 5I30H 3OB8A 4PBXA 1OY3B 3WJLA 3F12A 3T2PA 5EC2A 1F00I 4Y2DA 1T80A 2X9XA 4KJQC 5GRJH 1IL1A 3OV6A 3KYOA 1V7MH 2NLJA 1F2XK 2EDEA 2R9HD 1TVBB 3BYTA 4QRQB 1QNZL 3P4NB 2HT2C 3Q2CA 5DJZA 2V5TA 5B39G 5CJXA 5DMYA 3MGTB 1Q94A 3QRGH 2XN9A 4WWKD 1VEMA 1QQDB 4LSUL 1NCBH 3VH8G 4JN2A 3WMSA 1JZ4A 5DD3L 3EO9L 3ZE1F 4PJFB 4YAQB 5TGBA 3VG9B 3HAEG 3T3PE 1KC5L 3VJ6A 1TZGH 3MOBL 4O5LH 3VJ6B 1DE4A 5DO2C 3B2VH 5BQ7A 5HVFB 1OT2A 3KLHC 5CJOH 2VLJB 3IDXL 7FABH 4TRPL 3P3YA 4JFHE 2LVCA 4UINH 4OCRL 2VN7A 3L5XH 3RHWK 3LDBC 2W1NA 4TNWK 1DEEA 2OXHA 3GJFB 5CHNB 1ZLUH 4NNYA 1U93B 1I8LA 2E7HA 2BDNH 4MLIA 4U1KB 3UYRH 4MXVE 1BOYA 4PV8A 5D1XD 4XBEL 2ICES 3IRPX 4QY8A 4Y5YA 3UTTA 4MVBC 5GGRA 3X3GH 1RZJL 3NFPB 3Q0HA 3EO0B 5D7LA 1NMBH 1FORL 5DR5L 5C6WH 4LCUA 2J8UF 3TA3C 5IJVA 4GQPH 3I75B 4E41D 4JM2D 1CS6A 5J0BA 1CXHA 3OBAA 2IQAB 5E1AA 3RWIB 3U4EB 1KENL 3WNMA 2P7TA 3JV4B 4G6AD 2PXYB 1EXUB 4LVNB 4PV9A 3SDDC 2DM4A 1DANT 3QNXA 4YC2B 1F13A 1UJ3A 5M95B 3D25A 5ENWA 1UB5A 4C58B 35C8H 3IVKB 3TYFA 1MI5E 1MH5B 2FATH 3MNZA 4OZIE 3U48A 3ULUF 2DKUA 4O2FA 2XKSA 2H32B 3OAUH 2NY2D 4GRLA 3MTRA 4U6HA 4G7YL 3PWUB 2ZUVA 5D2NE 2O5ZL 4YHYB 2ATKA 1I8IB 4OLYH 5JXAL 2FJHA 3HKFA 3Q48A 5C1MB 2FBJL 3MV9A 4WNQB 1HINL 1TPXC 5LCVH 4POZC 1MRCH 1I1YA 3KPQB 2VLKA 4LHUA 1MHEB 3QNYA 3MJ9A 2EEAA 3MOAL 5F9WB 4TUKL 3GI8H 3IFPB 4XNYH 1ZEAH 1QR1A 5C71A 1INDH 4DUVA 1U8IB 2PETA 4OM1L 2X7LB 4FQJH 4AK1A 2CLRA 2XT1B 4P2QB 4FS0A 5EZJA 2ID5A 4PJGB 1ZGLM 4LLQA 2JELL 1U92A 4DZBA 5IVZA 4F3FA 2DQTH 5KZCD 1KACB 4L3EA 2XKNA 4ZTPL 4QTIL 2EH8L 5BRZA 2E6QA 4RA3A 3HR6A 1J1XH 1JGEB 1MJJA 1V8HA 2F5AL 1JPFA 1U3HB 3QSKB 1MI5A 3DETC 3DX9A 2WZPD 3O8XC 3NIGE 4MNQD 2VXVH 5GSVB 3V5DA 3RWHA 1EJOL 2HVJA 4K7PX 1SVCP 4L8BB 1D5MB 1P1ZA 4JREC 1OTUD 1S7TA 2HTLD 3O8XA 5D7IE 3TVMA 2HFEB 1YNLL 5T1DH 4NO2A 1JHKH 3BD4A 2R2HA 1ZK9A 3MBEB 5TE4L 1AJ7L 1PKOA 4ZSOE 5I18H 3OR7B 3DO7B 1JGVH 1UWEH 3RVXC 4CAGA 4YXLL 4JVPA 3FONA 1HNGA 1RIUH 5D93C 3VXNA 4F9PA 2UVEA 1AI1L 1R3IH 4K71C 5DJYB 3DRTA 1CD0A 1QTYT 3KYOB 1RK1B 2GK0A 4XPGL 5L2KB 3S36L 5T1KB 4TNVK 5E8NA 4Z0XB 4UV7H 4HK0B 5BJTB 5TF0A 5HHPB 1NCAH 1IARB 4TSAL 1Y6KR 4GQ9H 5KG9B 2HG5B 2CK0H 3QIUB 3QQNA 4BZ1H 2WUCL 4DCQA 1HHHA 3K46A 3BN9C 3CAFA 5J11C 3ARRA 4LCIL 3TBSB 5DZNA 2CLZB 3OR7A 1E4JA 2NY5C 1KEGH 2UZIH 2XZZA 3KPSD 5EBWA 4FQXD 4XMPL 4HH9A 2IAMD 1B2WL 1IGYA 5D71L 3K3QA 2BCKA 3O3EB 4HJ0D 1RIVL 1YPZA 3EO1A 5EA0H 1S7SB 4NRZA 5L88L 3CK0H 5E8EB 4L8CA 1JRHH 3I6KB 3M8OL 4DW2H 3TO4A 2WV3A 2DLFH 2B7DT 3BQUD 1GGIL 5I1CH 1NBYB 3GK8L 3BIKB 3S96B 2AQ2A 2R4SH 4YXKH 1MFDL 4F33A 5CEZL 5C8JA 1B0WA 3LIZH 3KS0H 4CADB 5GS0C 4MXWH 3GIVA 3H9ZA 1Z3GL 4MLSA 1BQSA 5GGUA 1ZGLA 2R0WL 3ZTNH 3ZT5A 4N0FA 5IGXH 4R3SB 2FR4B 3HR5A 3RI5F 2IH1A 1HK6A 3MLZL 1YZZA 5DHVA 3ARFC 1ZWIB 3LPFA 4OZ4B 5JR1L 3ZL4H 1JI1A 2K7PA 1UQSA 1LE5B 4XI5C 4UIMA 5LVEA 1BD2D 3EYOB 4OZHE 2DBLH 3SJVA 2FL5A 4WGWB 2RIKA 4HG4J 2P46B 4ETQB 5KS9A 1KJ3L 3IXTB 4KVNL 3QXUA 4CVWA 4P23C 5EIIA 1J8HE 1GOHA 2F54E 3VDBA 3RAJL 3FB7A 3QWRD 3LY6A 1X4ZA 1RHHB 4JJHA 1EHXA 3HZVA 2YD8A 1PYWA 3PGDB 5C0JB 2DQHL 4Z0BH 2MJWA 1RURL 3PV6B 2XTJC 1OW0A 5DQDH 5C0IB 2DD8H 3MACH 3MLRL 4K3DL 3GMLB 5C0AE 4FQXB 2C1PB 2CLVA 1JHTB 3CLFL 4HFUL 4XP9H 5F88A 2XRAL 1MHPL 4V1DA 1CK0L 1MCSA 1S78C 1G6RH 3NGBB 1EEUA 9CGTA 4RCAA 3W0WE 2DWDB 1BGXL 1H0DA 5FECA 3VMPA 3X11A 2VDKL 3ESUF 5HDBF 5M94B 3D87B 1EUTA 1D5MA 4PPTA 4MZ2A 5MHSD 4I3RL 3AREA 4LSRL 4JKLA 1KELH 2R56L 3H3PH 3I6GA 3SKMA 1OGTA 2HAZA 1IJ9A 1WIOA 3WFCL 4HIHA 1Q72H 4D9RE 5K9QI 2ICEB 1BJ8A 1BX2A 1IBGL 3SGDH 4QF1A 1PQZB 4U6XB 4ZYKA 2XN9B 5HHXH 3ZYJA 1AGBB 3QR2A 5D7LE 1MELA 1IFHH 4XPTL 1BVLA 3QUMB 2AJZA 4I9WD 4EQ2A 4ZDHA 3EYFA 1FO0H 5JTWA 5IVNA 4PJHE 4GMSH 3RWEA 1YUHA 2NW3A 4POZD 2JF1A 1KPUA 2RFXB 5C0CE 1AIFA 2J2ZA 3ARXA 3U79A 4N0FB 4WNQA 3PV6A 4OLWL 2W92A 2Q8AL 1D3CA 4M43L 3CFDA 1TENA 3MYJA 2AXGA 5ESAB 4MAYC 4XVUD 3QIWB 5BZDB 1T89C 3KAAA 4JO2L 4MD5B 2VXUH 2WIMA 4I2XB 3REVA 4IDJH 5BV7B 1JYVA 1EGJL 4XWGL 4CU6A 5H2BA 3F7YB 3K1KC 4KMTL 4WI6A 1QSVA 4ZMAT 4NZRL 4KHTH 2OQJB 3DSFL 3C5SB 4NOBA 4LLMA 3GRWH 1CDIA 3IB4A 2HLAA 3BZ4A 1DLHA 3FRPG 1T83A 1R3KB 4ENED 4CL7A 1QLEL 3VWKD 3RFZC 2VL4A 1I9IH 1IAOA 3HC3H 1SHMA 3LKSA 5I8OL 1HIMH 1UM6H 1TJGH 2C9AA 3FQNA 3H0TA 4OJFL 4NPYB 5EOQL 1WF5A 5D72H 3O9WC 5EZIH 5J1AA 1P69B 3HNVL 3OKLB 4MVBD 3GSOB 3FB8A 5BVJA 1OAXH 1LE9A 3TH3T 1Y6MR 4FXGA 2X2YA 4TNVF 3GBNL 3TO4C 3OJDB 5BRZE 1KCSH 2CXKA 4UTBH 3LPGA 1VFBB 5KOVC 4FFYL 5LQBH 1YJDC 1D9KA 4LLUA 4NO0D 5C0AD 1DN2A 1A6WL 3PWNA 3LD8C 4QRTB 1I7TA 1GIGH 4JY4B 2BSRA 3IT8D 2VLME 3BT2L 1DQQA 3JV5A 3IFNL 4PLKC 1HXYA 4LDEB 5J06A 1E4KA 4LVOB 5I1IL 2APFA 3BVNB 3MLYL 4JFFA 4LLDB 4LQ1A 4X7EC 4KTDH 4QHLA 4HPYH 2BY2A 4YHMH 4K94C 4MJIE 2C3XA 5D7JB 1KLGA 1ZVYA 3L6FA 1IAIH 1U2CA 3G6AB 1A7PL 2DBJA 4WGVB 1J0ZA 3VFPA 4ZODA 1FC1A 2RHEA 4BFEA 2Z0BA 1FZOB 3D0LB 1WFTA 2VUOA 4I18A 2B0SH 4ZNEA 1W2KT 4G42A 3JXAA 1F11A 4WEBH 3SE8H 5F93C 3C6LD 4FQQB 3PIQB 2WUBL 1CQYA 2CMRL 2R0KH 3EYVB 4M7LH 5FM5O 1BZ7B 1CG9B 4JB9L 4KV5E 1F3DJ 2GW5A 4XNQB 4JFFB 4LLDA 4RFNC 3VFWB 3L95B 3QUYD 3MRDA 4OUUA 3OQ3B 5K59E 1ZTXL 1DDHA 4RIRA 4P4RA 2RR3A 5JHDB 4XPAH 5IFJA 1XF1A 1OD7A 4MA3B 2FJFB 3BKML 5C0GB 4G8IB 3KVQA 1VFMA 4MQTB 5C0ND 1A7RH 4KI1A 4Q6IB 3LEYH 3DMMD 1X7QB 1NAMB 5IMKB 2DS4A 4MAYB 3O2VH 5SV4A 3U36B 3QZWA 4NM4L 4ENEC 3NGBC 5LGJA 3K4DA 1RUAL 4RFOH 2VDQL 1EFXA 2FECL 3C8KA 3FB5B 1NFKA 5IV2B 3E3QC 1A47A 4YDLC 1J1PL 1B0RA 3Q3GB 1YMHA 2OMBA 4Z77B 3CLEL 4KK8D 5HJ3B 4AEIH 5ISZA 4NKMB 3FN3A 4DGVH 1Z9OA 5T3XH 4M1GH 3QO0B 4GT7A 5F72S 3LEVH 3AS0A 4XVUC 1H15B 3D39D 4O9HH 1JGDB 2DWEA 1WLHA 3W9DB 4N8VA 3L3DA 5EUOA 1K85A 3MUGA 2XKNB 4M3JA 5C0BE 1VCAA 5I19H 1X5KA 4WFED 3QIUA 1JPTH 3IJHB 2DI9A 1MIEL 3HPJA 4R4BA 2W0PA 5FO9A 2DMCA 2Z92A 1RSFA 5KVMC 5DEZA 4FTVA 1FAKT 1MY7A 1SQ2N 4P3WA 2WBJC 5DHXB 1KTRL 1LO0L 1L6ZA 4WJ5A 4PJIE 4NQEB 5CD3B 4JRYA 4EN3A 4N0UE 5GGRB 5EN2A 4UAOB 1J0YA 5BW7C 1YUHB 4KI5E 1RFDH 4WUKH 1YEHH 4J8RB 5IF0A 5E8PA 3FQWA 3V7AG 1VACA 4KK5D 2VKWA 2EIEA 4KFZC 5ERWA 1Q0XL 4KUCD 2BHZA 4XT1C 2IPTL 3PWLB 4RMSA 5FKAA 1M1SA 5HGBB 4DAGL 4GW5A 2HTKD 3MJGX 3MXWL 1LO3L 5C08E 4HMEA 5DS8B 3MZGB 1RUQH 3GSQA 5IP4A 2CQVA 4CMHC 4RAVB 4L4TD 4IMKC 4HGKC 4MNGE 4ZAKD 1UXSB 5CILL 3RNQB 4JQXC 3HC4L 5FA4A 1MJ7L 4DZ8B 2A83B 1UM5L 4H1LA 5DJ0B 2BSRB 3QUZA 3HFMH 5IUSA 1P4IL 5FDWB 3D18B 1FZJB 1XGTA 4BFIB 4JKPL 4PJCE 2N4IA 3BESR 5FHAH 5E56A 1AGEB 3MRGB 3T4AB 5DSCA 1DVFC 2ZUYA 2PYEA 3CH1A 5I74C 1A0QL 3OKNA 2Y7QA 3QPXH 1H3VA 1ZSDB 2ZSWB 3CZFB 2FB4L 1V3MA 1FRGL 1FN4A 3QB7C 5DUMH 4NN7C 5F7FA 3O2WH 1K9TA 1ORSA 4OIIL 3VG0H 4CVXB 1WEJH 4QHUB 1IKNC 3E8UH 2YEZA 1V7NH 2L7JA 4PJ8D 3DURA 1EEZB 3B2UD 1KNOA 4NT6B 3FKUS 3ARGC 3QI9D 5DFVC 1QUNA 4PJAA 4EN3C 1LK2B 5C0FB 4OZHA 1H5BB 1C8PA 3TCXA 1GJIA 3U1SL 1AGFB 4JFDA 4NC0B 4WU5A 2DLEA 5HGAA 1QRNB 3VFOB 5IR1B 2DQJL 1D6VL 1OAUH 1JGUH 1LDPL 4MJ5B 4J3TA 2VMFA 1D5XA 5A16B 1L7IH 4XP5H 4YHYC 5EN2B 2NY6B 4QOKE 4MJ4A 5IROC 3O2DL 4P3DA 5E6IC 5HYJA 2JB6B 3VI3E 3F7RA 2QHRL 3SGEH 4PJBF 2F9BT 2C1OB 3OJMB 2DQFA 4PRPA 4ONGL 5FYLH 4PB0H 3N85H 4LQFH 2Z93B 1TXKA 4GBXB 1JZ8A 4RX4D 4TVPE 4DK6A 1LP9E 1CICB 3ARDB 3SDAB 3GJFA 5CHNA 2GTWB 5D7SL 1N4XH 1MCWM 4NGHH 2AV7A 4JM2B 5TH2B 4ZFOL 5EIVA 5L2KE 2F53A 4JY6B 4Y4FD 5T33H 1CGTA 5D9SA 4PYHA 1CFTA 4NKDB 4L4TE 2BSTA 4TPRL 2A9NL 2DWEB 5L8JB 2AJYL 4BSWB 2I26N 3U9PH 1UYWH 3DV6B 4M5YH 1N8ZB 1YPZB 2XFXB 5EULV 4N0CC 3OB0K 3O3BB 3HI6H 4NQCB 4WTWA 1SJHA 1MLBA 1L4IA 2E9IA 2ZKHH 5IV2A 1QVOA 1I7UA 1U8NA 4NZJA 3P0VH 3TZVB 3UBXG 4YDKH 2V2TA 2MQ0A 1WSST 4LAQL 3V0VB 2X89A 2YK1H 4XPHH 2FEEL 4S10A 4AY0A 1FIGH 1JMZA 2D0FA 3GMPA 4YHNA 4G43B 3GMLA 5CP3H 1VADA 1UT9A 2BNQA 2VDRH 5HI5C 1J0IA 3RVXD 3V6FA 1J5OH 3LV3B 5EOCL 5KS9F 5AAMA 1IILE 3QUXB 4MXVF 3UJJL 2HVKB 5E8NB 3MV8A 4NOFA 1CGWA 4RGOH 1AFVH 4JFZH 4P5MA 4PIRF 1OCWH 4ODVL 1SM3H 3O4OB 4FQQA 1ZHLA 5F9JA 4LVEA 4PRNB 4UIKH 4UT7L 4MHHI 3AB0C 3GSWB 4LLVA 1F90L 5HHNA 3EJZD 4DN4H 4H88L 4P23B 2VDNH 1A9EB 5DMKA 4I13B 2HRLA 4KKNA 3V0VA 3ULVD 4ZAKC 3QJFB 3MRJA 4X6FB 2GT9B 1J05A 2ESVE 1DUYB 3VRJA 1CFQA 4B5EA 1NCNA 1FYTB 4YHIA 5KN5B 1KCUH 1OF2B 2X4SB 5I8CA 4XGZA 2QQKH 5CWSB 3B9KD 2VLLA 3BUYA 4OZIF 1XCTA 5IBUB 4MNHB 4KRPD 2YMXH 3I2CH 4XBPA 2WAHA 1G7LB 1D9KC 3AMLA 4OCSH 3U9UB 3TBTB 4NQXB 4KK5C 3WL9B 3BGMB 5JPNA 5E2TL 4LSSL 4NWUL 5C92A 3TCLB 3VXUB 3HPJB 2VH5L 1IEAB 4R4BB 4JFOB 2DQGL 4JN1H 2DM3A 1F4WH 4KKCC 4GLRH 3RGVD 4FQPA 1BD2B 4Z18A 3MCG1 4ZAKA 1J8HB 2F54B 3O9WA 1G6VK 2Z31A 1NBZA 1CF8H 1RY7B 4Y16C 3L3DB 1SBBA 4DGYH 3MPCA 5KSUB 4LRIC 4JFYB 3BP7B 5EORL 1B90A 4Y16A 4FXGB 3IS0X 4LCWB 2R1WB 4ZXBC 2Z91A 5KANG 4HULB 1OLZA 1R24A 1YA5A 1B0GA 5FB8A 1NEZA 4EI5B 1MCFA 1UKQA 1UH2A 1H9VA 4JDVA 3RPIA 1AC6A 4JFDB 3T2NH 3AFLA 2V9TA 4FNLH 2A73B 3BEVA 2X4RA 4QRUA 2D4DA 1JTTA 4UV4H 5E5RB 3LDBB 3T0EE 4S1RH 2E9BA 4WWKB 4JE4B 5B22A 4G8IA 2AJSH 4IRSD 4X0KA 5EIQA 2EDYA 3V6OC 2HVKA 4GMTH 2DRUA 3R06A 3RVTC 1WTLA 1M7DB 2P24A 3NCFB 3UPRB 3BE1H 3NIFE 3QIBB 3TBTA 5JQ6L 2WINB 4AH2A 3FZUC 2L7UA 3MXVL 1HHKB 43CAB 3BZEB 3FB6B 5T1KA 3V52H 3VRIB 3LCYA 1E4WL 3HMXA 4LMQE 4IRZL 4EKXA 5GS1B 4NDMB 5BMFL 1I1AC 1U8OA 5SX4I 5FYKD 1IC5H 1T66D 5K9KB 5K9OA 5J13C 2CGRH 4IRJB 3WUWG 5HGHA 1RVFH 4LK4A 4S2SA 2FYYA 3DO7A 3QDJA 3AREC 3MRJB 4GKSB 4X6FA 1IRAY 2IBZX 4Z7OE 4WHTA 1ITBB 4GG6B 2G2RB 4U1LA 5FUCC 5TPWL 5HYQB 3VD3A 1FBIL 5F70A 5INDB 4WWKC 1BWMA 4C55A 3SEPA 3ES6B 5F7MC 4UT6L 4J12A 5GGVY 4F7CA 1NGWB 4OI7A 1C12B 3VFGH 3WDJA 5F7KC 3CVHH 3GHBL 5DJ8B 1UFUA 4PJFE 1SEBA 4HJGA 4TTDD 4MDIA 4PJHA 2HFGL 3QI9A 4EXKA 1QSFA 2VOTA 5SX4H 1R3LA 3BDYH 2VKXA 1IKNA 2X4NA 5IROA 1AHWA 1U3HC 3OJVC 3OMZA 1DQQB 3QISA 1QFUH 4XX1E 1D5BB 3FQRA 1NAML 2XZAL 4U33A 1HQRB 5T1MB 3HUJA 1ULVA 4RX4A 2YA1A 1AE6L 1UB6B 3M07A 3EOTH 5E8DH 5KOMC 5F88B 2IBGA 4PS4L 4TVPH 2VDPH 4LVHB 1IL1B 2X4PA 5IW3A 2P8PA 3BN3B 5DD5H 5KSAD 2EXWD 1KG0A 3C2AL 4FQCH 3S35L 5ICZA 1A02N 1W0WB 5ALCH 1XGQA 4PJ7A 1TQBC 3PHOA 3FO9A 3VFTB 1OSPL 3GSNA 3KXFD 5ANMB 4U1SA 3WXWH 1OP3H 3SJVD 1IKFL 2VABA 4HQQH 4Y4HA 1KGCD 5ICYA 4RRPA 3HC0B 4Y4HB 2AJXL 4K3HA 5H2BB 4LF3A 4BH8B 4C4KT 3G5XA 1N7MH 3GIZH 1CR9L 3KNBB 3R1GL 5IEKA 2BRRL 5D1QD 4UB0H 3G9VA 2VDLH 2XIDA 1KG0B 5ICZB 3F5WB 4R4ND 1I9RH 2R23B 2BNQD 4XP4L 2GHWB 1E6JL 2W9DL 4HZLA 2ED7A 3N9GH 4LDLB 3CNKA 3DX8A 5KSVB 1KIQA 1RUKL 3QWRA 1ROWA 2O5XH 3DUHA 1A6UL 4U1KA 3K4ZA 4ZUWB 5JIIA 3NCCB 4XH2B 4MB4A 1K4DB 4AENA 3P9WB 1SMOA 1AD9A 4KTEH 1J7VR 5HGDA 2BXZA 3O6FC 4FTVE 3TNNB 5B38B 4NT6A 1A5FH 1KXTB 3DV4A 4KKCD 3X3FH 2VLJA 5L2KD 3MA9H 1MQ8A 4MWFB 4Z78B 4RISH 2WK2A 4C54A 1YN7A 2H2PD 3PP4L 4P2QD 4G6KL 2YKLL 3PV7A 4CN6A 2EDBA 4ESKA 1AXTH 4JRXA 4GXVH 1VA9A 2JJVA 1PG7W 1RZGA 3B9KC 2EDFA 2W0KA 1IGIL 3IU4H 3U82B 5ADOL 5C6TL 12E8H 5EWIH 5T1LA 3VMOA 2G2RA 4U1LB 1MRDL 2I60H 1U3HD 2ILLA 2E6JA 1F6AA 5FOBB 4MCYA 3MGTA 1CICD 3QDJE 1K6QH 1BLNA 1ZA3B 2K1MA 3WIHA 5MI0C 3LQZA 2VB5A 2EH7H 3VFPB 1X5JA 1DBKL 4U7KA 5E6IB 3SOBL 3ULVC 2O93L 3DUUB 3MFFB 3FO1B 3Q6GL 3TGXA 1GHFH 1PVHA 3I3BA 1P7KA 3CZJA 1FO0A 5D6CA 1AR1D 4O4YL 2DQCH 5E9DE 5CGTA 4HKZB 2Q7YA 3HS0A 3SDCD 4QWWC 4PUBH 4KAQL 3KYKL 4GBXC 1FL3B 3LMJL 2HWZL 4KTYA 1G6RA 3VE0B 2JJUA 2W65B 3MV8D 4OFKA 3BMVA 2C3WA 3LQAC 4V1DD 3ZHDA 1DBBL 1U8MA 3KPPA 1PY9A 3H9SB 1FV1A 4IRJD 4M6NL 3M1BA 4PY8I 5FF6B 1D6EA 4AG4L 5KSBB 3WO3B 3NPSB 5LAXB 2MPAL 3K2UH 4EUPG 3FQXB 1AQKH 5GRVL 5EFIB 3PXHA 4NWTL 3W9DA 5TQ0L 2HH0H 2VL5A 1J8KA 2VYRE 4EDXA 3CH8A 5EOTA 4F7MB 1WAAF 4LBEB 2OTWA 1MCOL 3G6DL 5SWSE 3KPRE 1QSFD 2FHBA 1KXQE 1MPAL 4JRXB 2AJ3A 3G5VB 1U58B 1TTFA 2R4RL 2V7HA 1YECL 1QSZA 4OLUL 3FJTA 1EK3A 1QYGH 3LEXA 3VXME 3BH9B 4G8FB 4B7LA 3U2SA 5D9SB 1UM4L 2PTVA 3JWOH 4J3WA 1GGBL 3W9EB 3QWOA 2B4CC 2YPLB 3V0WH 1RZ8A 2HT3D 2FJFA 5MENE 5JW5B 5A2KH 2YBRB 3MODL 1WAAA 3PHQB 1X4XA 4ZFGL 1T3FA 1NUFA 5CLWA 4YBQC 3EYSH 1G7LA 3V4PH 1XGRB 4PJXF 4Y16D 4TUJA 1J11A 1UJ3C 3BKJH 2HT3C 1HOCB 4APQA 4KHXL 3QG6A 1S7UA 4QOKB 1PEZA 1I8LC 4JFEA 3BQUC 1I9EA 1F97A 4AMKH 3QEQA 4YC2C 5HI4C 4P3CL 4LLMB 3HI5H 3MLUH 1CVSC 3AM8A 4Z7UE 4XXDB 3QP3A 3FOMB 4FQHB 1T1ZB 3DIFB 3S4SB 4EOWL 3O6LL 5F7NC 4ZS7L 5EU4A 3QCTH 1XR8B 1OAQL 2W9EH 2PO6B 1PBYA 4M3KB 1WC7A 4QHMB 1ADQH 1UA6H 3TJEL 3ECBA 4JG1L 3ROOB 4Z8FH 5LKNA 2VXTL 2X1PA 4NC1C 1MJUL 4IRJC 1YPZE 3MFFA 4XMLL 4KJYA 4MA7L 3H7LA 4OKVB 2AAVA 4IM8A 3U0TB 4BM7A 4GRMB 4NQED 2D7OA 2GFBA 3GSNH 3QUMH 4P99A 4LSVL 2P8MB 3Q5OA 1OTTD 2D4FA 4H0HB 1CFSB 4N0RA 4KKBD 2ZUWA 4PR5B 1RZGB 3T8XB 1P7HL 2PCPB 1GRWA 1L0QA 4YHPA 2QSTA 5KSBF 1NDMA 3TF7C 4WW2B 5HYFA 3DROA 5KAQF 3K8KA 5C07E 3GB7A 3ARWA 3HRZB 1XR8A 2EIDA 2YPLD 4OSUH 4Z7VA 1WWWX 1A6TB 3UMTA 5KJRL 1JYNA 4TOYL 2F19L 4KY1H 1F3RB 4QTHA 5CMAA 5F9OH 3W11D 2X4TB 4MA8H 3CC5B 1MLCB 1XF5A 2FGZA 4HIIA 1A14H 1BVKB 1HILA 3C5SA 4WI9A 3U0WH 4JPWH 4XC1H 4XXDA 1YEGH 2OZ4A 3AXLB 3PWVA 5JNYA 2CR3A 4KJWD 1S5IH 4GRMA 1F45A 3BGFC 2EDTA 3MR9B 4LCCA 1QFOA 1VGKB 1PLGL 4HIXL 3LZFH 1ODAA 2B8OT 2JB5H 3VGFA 4K3GA 2YXFA 1XGRA 3CFDB 2H6PA 1CL7L 3GSVB 2A1WH 2W0LA 1WWBX 4P48A 4CMMA 3V79C 1I9JL 4Q9QL 5I73B 1K4CA 3U4BL 5TQ2L 4FQLH 5BRZD 1G7IA 2ITDB 5KSAA 5CLTA 5JUEH 4OGYL 5IMLA 2H26B 1JNNL 3ISWA 3KLSA 1E27B 5IVXE 3W2DL 3C87A 1UH4A 5HHOA 1IVLA 4GRLB 4G80B 1DLHB 4MJID 4FZ8L 3DX6A 3BDBA 5CZXC 1JHLH 4K3JH 4ODHL 4NM8H 1G7HB 5HHOE 3Q1SL 2P5EB 3HMXH 3MRHB 1RV6X 1T03L 1C08B 1HCVA 5DJAA 3W0WA 1T20B 3UC0H 3ZDZE 1LO2L 3CVIL 3IETA 3D0VA 1EXUA 4JQIH 3VXSD 2AJ3B 2LAGB 3G5VA 4DVRH 2CDFA 3VGGA 5HHQA 2M1KA 3CD4A 1NLBH 1FN4B 4X5LA 5E5UB 1G7IB 3IYLW 4JRYD 3OWEA 3SDYH 3OKOB 5IBTH 3ARGD 4Q0XH 5EBWB 3VGDA 3WFBL 5GGUB 4PGZA 5C0CA 3PGFL 5T3XD 2GFBB 2XWTA 4LKCB 3GM8A 1UWGH 4BQ9A 2ESVB 2FD6L 3WSQL 3NOIA 4O2EA 5C7XL 1Q9WA 5ECJE 4ZFFA 1IGFH 5DQJA 4DCQB 3KPRD 1NFDB 3GHEL 1GAFL 4G3YL 5C0IA 1UWXK 1A1NB 4OLXH 4NBZB 3BH9A 3HLAA 5IESH 2FHCA 1DBAH 3LVEA 4F7TA 2AK4E 3LOWA 5D1XC 1G0DA 2QV2A 4XVTL 1YEEH 5E6IA 3GJFH 1IC7H 5DJ8A 1B4JH 1PY4A 5DHVH 2ZCLL 4UT9H 3ZYIA 5MEPA 1NFIB 4EQ3A 5GGQH 5DZLA 2Z8SA 1MSPA 4TSCL 2HFFB 2E27H 5EOTB 3L3IB 1FAIH 5IJKA 1WK0A 1LNUB 3O6MH 4NKOB 5D70H 3HMWL 3W39A 1OT1A 2I27N 5I8EB 5T5FL 2H1PH 1HKFA 4QNPF 2Y5EA 3TN0B 4P23A 5C3TA 1BZQK 5FF6A 5DEFA 2YN5A 2HTKC 3VXQB 4L3EE 3TZVC 3JWDC 2VJXA 3VXRB 1CZ8L 1P7QD 5TE7L 1FZKA 1K8DB 5I1KH 3ZKMD 4RZCA 1NC2B 5FO7A 2VZOA 4XCNB 1YN7B 2E6PA 4LEOB 1F8TH 3WNOA 3C5ZA 1KJMB 3T0EB 4NCC1 2EDRA 3QO1A 4KQ3L 2JE8A 1T66C 1RJLA 1BFOB 3ILPA 1X5LA 3BO8A 3FO1A 2DJ4A 2J1KA 2ICWA 4PJBE 3QDMB 1NDGB 3CFJA 4KVCL 5EU5A 5BXFB 4AIOA 2WBJD 4GG6F 1BVZA 3G5ZA 1U8LA 4JZOA 2J4WH 4NO2B 3GNMH 3TO4D 4LMQI 2JIXD 1OB1A 3WHXB 3IXAB 2UYLB 4L29A 3MRCB 1KBGL 1OQXA 4IRSC 3T77B 5TDPB 2WW8A 2X89D 4WI8A 2UYLA 3KDMA 4PJXA 3NABH 2HVJB 4LF3B 5B4MD 4BH8A 1OPGH 5HHMB 3DV6A 2R1YA 4HS3B 1T04B 4I77H 4OLZL 4NQSA 1MFAL 1F42A 1GPOH 2AK4A 1LILA 3D0VB 4EI6A 4C56D 4UOJA 1I1AB 3WXVH 1TJIL 3VD9A 1TQCB 1CLYH 3SQOL 3NN8B 3MX0A 2VQUA 4KRMB 3BPLB 5B4MC 2J88H 1V3KA 4Y4KA 1BQUA 4X9HA 4UU9A 3LQAH 2V2XA 5D2NC 3WE6B 5C07D 3HE6C 3SCMC 3SKOA 4OUUB 5HD8C 5ALBL 1NC2A 2DI7A 5FHBL 4XCYB 4GAGH 4Z7WA 1O7VA 5F9DC 4CW1B 4LSTL 4WI4A 1T0MB 1J18A 2A77L 5I1HL 1XCTB 2IG2H 1UGNA 1CI5A 3NFPA 2DQDL 1BQLH 2DM2A 4XGZB 2AS5M 4OIBA 1OOAA 2IC2A 2YHGA 4N0UB 3EZ8A 2B1AH 4AYFA 2B4CL 3MRLB 4R4FH 3G9AB 3RWDA 4GKZB 3PWPE 5FOBA 1I7ZA 1U8PB 3BXNB 2HFEA 5GGTH 1FE8H 3VU2A 4KI5F 2AEPL 1GC1C 1AQDB 3DYOA 3KLAB 5GRZA 3MRMA 1ACYH 4PJ7E 3ARBD 3SDXF 5KTEH 3FOLA 1SEQL 5I71B 2C4FT 3I75A 5CIPH 1TTGA 4P46B 1TMCB 2BNRA 4O58H 5GRYA 1KB5B 3T8XA 3FAXA 3KG5A 3NA4A 1TETH 2CKNA 4OFYA 4OZIB 1J1OH 3H9HB 1MHHA 2I07B 3GBMH 1NANH 1G7MA 3CH1B 2XZQH 4F9PC 4KZEH 25C8H 4KPHH 1V5JA 2GJ6E 1VENA 5KAQG 2WWKT 2GIYA 2ZPKL 4HFWA 2Y4SA 3N06B 3OL2A 5D1ZA 1JHTA 2V17H 3OHXB 5E2WL 3WUWB 5GS3A 3FB8B 4H1LB 5DJ0A 5F96H 1QKZH 4M48H 4RFEA 2QR0A 1I1AD 4JCLA 4FQ2L 5I15L 4XP1H 1FIEA 4KQ4H 2JK5A 3DVFA 3SGJA 4WTZG 2R39A 5KVFL 4MCZB 4MAUH 1DBJL 2NY0B 4WRLA 1GVIA 4G5ZL 4EI6B 4U1HB 3GFUA 5MENB 4KGJA 1MWAL 4M5ZL 2VR5A 1NJ9A 1ZVSA 1OGAA 5DJCA 2XACC 1R3HA 3QNXB 4Z5RB 3OTTA 5GXBB 1WZ1H 5D2LE 1UQSB 3T77A 4HXAH 1XF4B 2FSEB 4S1DC 3MV7A 4MQSB 4PGDB 5EZLB 1S7UB 5HHVL 4BH7A 4JFYA 2XA3A 3UTSE 4HBQA 3VFNA 1ITCA 3IKCB 2PNDA 4HPOH 1BECA 5DUBB 1T7XA 3LH2H 1T0NA 3KPRB 5KANI 2LU4A 3A6BH 3ME0A 4K7PY 4MB3A 1KTDA 2Z92B 1IEAA 3GMOB 5E94A 3P77A 4JAMB 4RWYL 3TA3A 1YJDL 1NCBL 1UB5B 3IVKA 3ZKQD 5E9DB 3SE4A 3HE7A 1R5VB 1BVKA 1HILB 5E6ID 1X5AA 1KT2B 3JVGC 4MJ6A 5IB1B 2SEBB 2P45B 5EUOB 3O3AB 5D7IA 5IQ7L 4PGEB 2GSGA 5HDBE 3IU3B 3TIDB 3P30L 1FL6A 4MCZA 1X5GA 3PWJA 1AY1L 2VISA 3D39E 4HD9A 4MNHA 5IJVB 4NNXA 5CJOL 1HH9A 5I66A 3QHZH 4J3XA 3MNVB 1OARH 4OGAD 3ZO0A 4ZS6D 5T5NG 1IC4H 2HJKA 5HYEA 4J3OC 3ULVF 1UEMA 4HWEH 1CDGA 4NQCE 1ZT1B 3MLVH 2EIZA 1GZQB 5CGYD 3QIUC 4WHDA 4U0RC 1R5WA 4BA8A 3OAYH 4ZXBA 5EG6C 3BIAX 4NUGL 4HS8L 4WV1C 5GISH 1BM3H 1KCRH 3H9SA 5D96C 1BQHA 1N5AB 1W72L 1IM3A 3ULUE 1BFVH 1I3RB 2D31A 2DQIL 4ZQKB 5BVPH 4Y2DB 3FFCA 3MJ6A 3VCLA 1EFXD 1ONQA 3QI9B 3QNZB 3O6FB 1KIRB 3RUGF 4C56E 4G7VL 4PJ8B 5FYJH 3B43A 1MNUL 1N0XL 1U9KA 4QWWD 3RWJB 4LFHG 4G43A 2FNBA 1FL5A 1PKQA 5SWSA 4HGWA 2XTJD 4YZFF 4YR6A 5A3ID 4WHTB 4NN7B 3HNSH 2FDBP 4V2BA 1I3GH 4JREB 4XWOD 4CBPA 5HYJE 2AKRB 2GYSA 1RJZA 1B0GB 4YFEA 1EO7A 5ESVA 1ZHLB 5FO8B 3CUPB 1QBLH 1ZT4B 5C0EB 5GSVA 3BZEA 4UILH 4C59B 3WS6A 2EYTB 5HXMA 3FO0L 3GI8L 3DVGA 4F8TA 3C08H 4F7TB 1HHIA 1QEWA 4JJ5A 3R8BB 4G8GD 2OZ4L 3FN9A 3O9WB 3SY0B 3ARFD 3WE6A 4MJ6B 1W0YT 3TP4A 2LVEA 3BRFA 1MCNA 5JA9A 3BP4B 4MSWB 1FDLH 1CQKA 4L3ED 2X4UA 2CD0A 4QTIH 5BO1H 3VFSB 4NN5C 2V5MA 3MNWB 5HI3D 1J1XL 4L9LA 3BGMA 4QHKI 5JPNB 4GO6B 2QTEA 1MHEA 1EJOH 1PGRB 1VGEL 4MQXC 5FB8B 4YHLL 2UUDH 5I2IB 1ORQB 4IJ3C 4MZ3A 3RRQA 4LHUD 4OQTH 4QXTA 4XVJH 4X4ME 4Z77A 3RNKB 1NJ9B 5DJCB 5IW1B 1QO3A 2MCPL 1KJ2A 1U8LB 5I0ZA 3GKWL 1XF4A 1RI8A 4J3VA 4N9GA 4M93C 5IJKC 4GAYB 2UZXB 4YFLF 3IDJA 4C56A 1JZ7A 4ONFH 2DLIA 5LAXA 4N9OB 3BP4A 4GW4A 4N0YH 5D5MA 3D5OF 3MRFB 5CGMA 3C8HA 5CZVL 2E8ZA 5HHOB 1Z0MA 3WBDA 4QHUA 2W60A 1QSEA 1CLCA 2RGSA 1JCKA 4M1DH 3MV01 4UV7L 4HF5H 3BP6B 4MQ7B 3ARZA 5TDNA 4XNQA 3P9MB 4PREA 2FX7H 2BHUA 3B9VA 2GK2A 5ISZE 2MTPA 3EIFA 1T4KA 5K59F 4NO5B 2CK0L 4Y1AA 4BZ1L 4EUPA 1G7PA 4YHNB 1RIHH 1WIPA 2HYMA 1D5XB 5A16A 2J6EL 3QIBD 2QKIA 4WY7L 4ZUTB 1JPSH 3G04A 4H1LG 1IGTA 4LNRB 2YPVL 3ZTJG 2UZIL 5I16B 2NTFB 1TZHB 1P4BL 2AK1H 4U1GC 4F37K 3TV3L 4P5TA 5JOEA 3GDBA 4JZNB 4R96B 2ZSVA 4LP4A 4XC3H 2Y36L 1YY8B 2WLYA 1HH9B 1R3LB 1KJVB 1WBZB 2DDQH 4TVSa 1ED3A 3TT1H 1NL0L 1A6ZA 1XGYL 4PTUB 3WNNA 3BIBX 5DO2D 4M6MH 1DP0A 2ZOKA 4PTTB 3DROB 4DQOL 2GUOB 4Y5VC 3K0WA 1KOAA 3I3EA 2NX5E 1KJ2L 1I1RA 3I50H 2MCG1 1NGZB 1BQHB 5TH2A 1NGXA 1F4HA 3QCUH 4APQC 2CJUL 2VZ1A 1U95A 1RUPH 1UCTA 4MX7B 5D6DA 5CD3A 3O8XD 2CH8A 2H2PC 5JLZA 3HAEH 4X6CF 5DMIL 4PLKD 1XIWC 4OBSA 3P2TA 3EGSA 3ZTNL 4CJ1A 4M6OL 3QXAA 4DKEL 3QBTB 4H0GA 3MLZH 4XCEB 1PYWB 3O6FD 2EC8A 5GJSL 1DSFL 4QRSB 3WFEL 2OR9H 2ZOLA 3NN8A 2P47B 5FV2A 5ICXB 5AG8A 2WANA 5TDOA 2XV6B 3RVTD 2A74B 2IALA 2SEBA 5D5MB 3NACH 1T1YA 4TSBH 3MA7A 1WZLA 5E9DA 4UAOC 3MA7B 4AQ1B 5GIRB 3P9LA 2Y9RT 3BPLC 1PFCA 1KSRA 3RDTA 1CU4L 3BAEL 2AK4B 1KTDB 3I9GH 1JPGA 3RAJH 1PG7L 4WFFE 4YH6A 1CD1A 1WFOA 2NY4C 1IGML 4X7SL 4BZ2L 4NNPH 1BBDL 1RURH 1S8DB 1KPRA 1NQBA 2IAND 5DMGD 3O81A 5CP3A 1NC4A 3P4MB 2O26U 8CGTA 3CLFH 3RX5A 3MV7B 2EDLA 1FV1B 1MHPH 1RHFA 3FO2A 5HYIA 3QO1B 1HSBB 3NZHH 3CXDH 3SKNB 4P4RB 2QADD 4UNTA 4LEOA 3JUZA 1XEDA 4JM2C 4P2RD 3S6CA 4ZOAA 4ZNCD 3DRQA 2R0LL 1PX3A 4KGLA 3T4YA 4M7KH 1K2DB 2ATPB 2OL3L 4XB7A 1K3ZA 3V4VH 4BFBD 3VI4E 3TCLA 2QQQA 2Y6SC 3GI9L 4JJ5B 2EO9A 5KW9H 1C5DB 2IMNA 2E7LA 1RAMA 1M71B 3H3PL 3RI5K 1HHGB 1GZPB 4WFGD 3WFCH 2V7HB 3UO1H 3OAZH 4YAQA 4FMKA 3JWNC 4PRHD 1YEDB 3CFEA 5ILTL 2P5WD 4N68A 5IFAH 1UACH 4HCRL 4R26H 4UTAH 3C6LC 4NUJA 5AZEL 2GJ6B 2ARWA 1LEGB 4NUJB 5D1ZB 2BMKA 1IFHL 1HYSC 4HKXA 4I4WA 4MD4B 2HKHH 1NSNH 4FFZH 3PABA 2X4QA 4FP8H 4HK3J 1VPOH 4NN6B 3DOSA 1INEL 1MCIA 3REWA 1F4AA 3WIFB 1YNKH 5K9KA 3ARGB 4OV6F 1FH5L 5SWQB 4CU8A 4PJ7F 4OLWH 2F53E 2ESVD 3NAAH 4D3CH 3RIAK 1KT2A 5D8JL 2WMPA 1EZVY 4CW1A 4Z7WB 1NGYB 4J6RL 4HV8A 4L5FH 5HGDB 3TNNA 1FNAA 3GSQB 4WVRA 5CAYB 5DMJB 1FZMA 3SKOB 2IBZY 3UZQA 4W6WB 4AZ8A 1CE1H 2EC9U 4IDJL 1HSBA 3VGAC 2BJML 1N5AA 1SY6H 2E7BA 5E24E 3Q6FB 5HI5D 5B8CB 2E8YA 3AMKA 2I9TA 1PAMA 4M1CC 5LG1A 4NCDA 1X9QA 3TFKD 5IF0B 3QQ9C 1I9IL 3HC3L 2W0FA 4N8CL 2R2HB 4JDZA 5DHVB 3FTGB 1UM6L 1LE9B 3CX2A 5J1AB 2C3VB 3VXSA 2AEQH 1URLA 2XFXA 5EU6D 4HZAA 4D9QE 4E42B 1KXVC 4X8XA 2CDEB 3GIVB 1KCSL 4HCRA 1FNGA 4OD3H 3PWPB 1F6LL 5IK3A 2BVOB 4MJIA 2VC2H 2NY7L 3NIGF 3BD5A 3MROA 4ZUVB 4S1QH 3SGJC 3NH7H 2V7NB 2P5EA 3ULUD 3VXMA 1GIGL 5EU7C 3EDFA 5C0CD 4R97C 1H8NA 4RNRA 5FGCE 3WFDH 4XNUL 5CZXD 4K3EH 5C08A 1JMXA 2B39A 5F6IB 4JHAL 2OL3A 5ESAA 1IAKB 2ZJSH 4AEFA 4EUPH 4OCXH 4NP4L 3CMGA 4YX2H 4FN0A 3OKDA 1J86A 3IFLL 4HSQA 3CCHB 3U7YH 5CJBA 4OGZA 2OBGA 2Y06H 4NQDA 3GRWA 5ETUA 1FJ1B 5IBLC 3IF1A 1P9MA 4K94L 1QFWH 4X6EB 1R3KA 1OM3H 3X13B 3QPQD 3U36A 3PDOA 4PJ9A 2HLAB 4P46D 3S3JA 5AEAA 3L3IA 2KZWA 1RZKC 4PTUA 4XBGB 2P42B 8FABB 3HZMB 4R90L 4HWZA 4M7LL 1KJVA 2WIIB 3NFSL 1CWVA 1JNLH 3ZKXC 4FQXC 4P0DA 4P57A 4ZD3L 5E2VL 1I1FB 4PRBA 2V6HA 4PG9B 4XP6H 1TCMA 3MLWH 3CMOL 3V4UH 2OM5A 3QDJD 1RPQA 3DPBA 2UWEB 5AZ2L 3WD5H 1JFQL 2AJVL 1CIUA 1FFNA 1KN2L 2EKSB 2AI0H 4X98B 3QYCA 4X98A 4GRLC 5SWZB 2BVPB 2FHFA 4LRNH 1A6VH 1DBMH 4ODTL 2A6DB 2CIIA 4WFHD 4G6FB 4JFDE 2VDQH 1ZVHA 3PGDA 3TC9A 5C0JA 4Z95H 3CLEH 2NPLX 4I5BB 1GGUA 4GKOA 2JCCB 4JG0L 2OMNA 2COQA 5I1JH 5GS2H 5D7JA 3BPNB 3MV8E 4DGVL 5TF1H 3CFEB 2JIXB 1QFWM 1DQML 1S7QA 3I85A 1QBAA 4CU7A 1I8MB 3C5JB 4MGXA 3MLSL 3L5JA 5E6ZA 3D85A 3IU3A 3TIDA 3TM6A 1T2XA 4FFVC 2HLFD 3BQUB 4MJIB 5C07A 4UI2A 5EU7E 4TN9A 3EDJA 4LKXB 4PLOB 3VXPB 1AP2B 5FECB 1C08A 3SN6N 4NQSB 1CXEA 3P0YL 2MQCA 1OVZA 2AABH 1Z5LB 5ABDE 4XH2A 4KC3B 3QDHA 3L1OL 5FA3B 2RQ8A 1OSZB 1T6VN 1E6OL 1SJEB 1EMTH 2ITDA 5KSAB 3RA7L 4X7TB 4BSVB 2A6KA 4G9FE 1KN4L 1JJUA 2DOCA 2I9TB 1DVFB 3WJJA 3QAZB 4OCWH 1PSKH 4ERSH 5I8KL 4LKXA 3VXPA 5IB4A 4LU5H 1ZLVK 1Z5LA 1Q0XH 5C0FA 4MB5A 1S9XB 4KKAD 2IPTH 3D39A 1NGYA 1S9XA 2EYTA 4IIQB 1FSKC 2JCCF 2YUVA 4M8QB 1WITA 4W6XB 1LO3H 2BY1A 1O0VA 4EIZC 1YYLL 4YDIH 3K81A 4FTVD 1FVEA 1QLRB 2B2XH 1CDJA 1CFQB 5HBBA 2OS7A 5GSRB 4M7ZC 1J0HA 3CDGA 5E08H 3KDMB 4J7RA 5D7LB 1ES0B 1M4KA 2YD2A 3VA6A 2Z91B 3ET9F 4HH9B 1MJ8L 3SKJH 3RKDD 2GKIA 5L0QB 5L9DL 4R8WL 5B39B 3B2UC 4DUXA 4HC1H 4FXLA 1EFXB 4JKPH 3G6JB 4LLVB 4PJ8C 3UTTD 3ULUL 2R8SL 2BNRD 3UYRL 4NJ9L 4KWUA 1A0QH 3X14B 2ICWB 3R0NA 1D5BA 4OTXL 4DGIL 4YHKL 3HNTH 2JJWA 1NFDE 5DJDA 1TQCC 1EHLL 3CC5A 2PYFA 4P2OA 1FRGH 1ZKAA 2X4OA 4KMLB 1XFPA 4HIHB 4NZUL 3V6ZA 4WDIA 1KB5L 4OIIH 3CFBB 1SYSB 4X9BA 5EZOH 1NUGA 2VLLB 3BUYB 1ZMYA 5IFHH 1HI6B 1MCPH 3J8F7 2CKBH 5SWQA 4R96A 4UOW0 1U8NB 4IS6A 3MV7D 1F3JA 4MNQB 3RWGB 1AR1C 1CFSA 35C8L 3FFCE 3KPLB 2BSED 4I48A 1I7ZB 2ITCA 5DJXA 5FM4A 1ZAGA 4WCYH 3K8MA 4X9GA 1NKRA 4JQVA 3FHQA 3CPLA 5GHWH 2V2WB 4L9DA 2V5YA 1R5IA 4WUUE 4HIJA 5F3BB 1NFIA 5DWUL 4WHYG 3VFRA 5BRZB 2EDOA 3B83A 4HWBH 3TPKA 3SDCA 4L3EB 4OCNC 1T0MA 3RY4A 2G5RA 3VXRE 3P9MA 4ETYA 3MRHA 1RHHA 2P5ED 4TUKH 5D4QA 5IMMB 1TVHA 4ODSL 3CX5K 1JGEA 1MJJB 1GCFA 4D8PB 4HWZB 2D7NA 2VE6B 3BDXA 3QFJD 4NKIL 5SWZD 4DKDC 5IM7B 4J4PA 1M05B 2OSLB 4M62H 2VSDA 5JXED 2ZWLT 1NCCL 2F53D 5EUKB 5D6DC 1NBYA 2MHAA 2PR4H 3K4AA 1X6NA 5H37G 3MBXH 1BP3B 3QXWA 4OZFB 1S8DA 3PP3H 1VFUA 3MBEA 4QRPE 4HLZG 4A6YH 4BH7B 3ZT7A 1A7QH 3IGAA 4EIGB 1NC4B 4M5YL 4XAWL 2H9GB 3CCHA 4KXZH 1MFEH 3T09A 2PYED 1M7IA 2ZUQB 4NBYB 2RAMA 3IFOB 5T1DL 1S9VB 2ZKHL 1FLRL 4QXWA 2ZUTA 5KVDL 1NCUA 1MY5A 2AGJH 3P0VL 5TE4H 5CUSL 1RZKL 3MMEB 4OZGE 4OKDA 5I18L 4LAQH 4YEEA 1JL8A 1NAMA 2MHAB 4AT6A 1OW0C 5F89A 4J3UA 2DTSA 3CSGA 3C5JA 5KSBE 5C0GA 4L3AA 3TYGL 4WW2A 5FYLE 3N1MC 3U2SB 1MCEA 3T1FB 1CBVL 2ED9A 2ED8A 1GOFA 4X99B 1I7RA 4EVNA 1QD0A 4XCNA 3G08A 3V5KB 4ODXB 1P4LA 5F6HJ 1TVHB 2VXQL 3QHFH 4NSKB 4YWGL 4OT1H 2AXHA 5EU6B 1ZT4A 5B38G 1Y6NR 4HKZA 5LGHL 3PABB 5FYJE 4NQEE 3FFCD 1AIFB 1G7MB 1C16A 2YRPA 4LVHC 3ZKNC 4HAFA 4KZDL 4Y1AB 4LCCB 3UTQA 1AHWB 3QEGH 4D9LH 4JZJC 1AO7A 4WO4B 2NZ9C 3OSKA 1GL4B 3PQYD 1NGZA 4QLRA 1SBSL 1S7VB 2VZTA 4KUZL 3HUJE 3ARDC 5MEPB 1Q9LB 3SDAC 4P5MB 4F7CB 4KDTC 2NY0C 3TNMA 4P5TB 1DE4B 3STZB 4M8VA 3S88L 2NTFA 4ONOA 1TDQA 4JHWH 4Z6AT 2DLFL 2I25N 1GGIH 4LARL 2WBJB 3O6KH 4TTDC 2Q7YB 4PRDA 1F4WL 1EJ6A 2CR6A 2DTMH 5D1ZC 4NRYB 4PYGA 5FGBC 3FN0L 2WNGA 3T65B 1IQWH 1VEPA 2X7LA 5L7XH 4KUCF 5GGSY 3MJ9H 3QG7L 4OKVA 3ARED 1VKXB 3OJDA 3T1WA 2XTLA 1F6AB 2HT2D 2XA8H 3O11B 4OZHF 5GPRA 1DN0B 3QIBA 3KYNA 2G60L 3W0WD 4K7PL 3QUZB 4HGMA 2ARJB 5IGXL 4WHYH 3MNVA 1MCKA 3MV9B 2YBRA 2NMSA 5FA4B 3ARQA 2NX5D 5D5MF 3BKCL 3BPOB 4Y4KB 4OI8A 1YYML 4KK9C 1QSEB 3KR3L 5DEGA 2PW1A 4NJAH 2V9QA 5F1OB 3UAJD 2KH2B 5F89B 1INQB 5DS8A 4R2GB 4I3SH 3AU1A 2YPLE 3QUZC 3RZCD 4Z7WE 2ZNWA 5FGRA 2A73A 4S1RL 2DBLL 4B41A 2CDEA 3JWDH 4GXUM 5HDQL 4PJGA 4QRSA 1AD9B 6FABH 3B6SA 32C2A 3S36X 4NFBA 1LE5A 1K4DA 1FHGA 5JIKA 1RJZB 2P4AB 5I30L 3IDMA 5EO0B 4OF6A 3BZFB 5DQ9A 4E41B 4PJEF 4EI5A 4FRWA 3L3OA 1QFWI 4HLJA 2QQNH 4LCYB 1V7ML 2ICWJ 2AXFA 1KPUB 43C9A 2X41A 1PKQB 3ROLA 5DUPH 3RGVA 1Y0LB 5JPMB 4K2UL 5FA3A 1RVFL 4O2CA 1A1OB 4MA3A 1L0YA 2PTUA 1KLUB 1P84J 2VWEC 5GJTL 4H26B 5J4MA 2QLVB 1H5BA 2L4OA 1G6RL 3WNKA 5T1MA 1LGVA 2D7PA 3MRBA 3HC0A 3LRHA 3QRFM 4MXQC 3OF6D 2DMKA 2VDKH 3TNMB 3VCLB 2P44B 1NUNB 5IB2B 1HQ4B 4WU7B 3CUPA 2FH6A 2AERT 3F62A 4I3RH 3HUJF 1MHCA 3PG2A 4L4TB 3WO4B 1ZLWH 5MERA 1NCDH 3I6KA 1XGQB 3PGCA 3GB7B 4DJMA 3REWB 3BFOA 4L4VD 1ZE3C 1ZHBB 4Y88A 1YEKH 3FQTB 4XCEA 1J05B 1JNHB 2PCPA 2DJUA 1FG2A 3U7WH 3L5XL 1MWAB 4HXBL 3D9AH 3KGRA 1M6OB 4XPTH 1G7PB 5B3JE 1AE6H 1YN6A 1T1WA 2DIBA 1ZA6A 2IANB 4GMSL 3MV8B 5SWZA 4QXGH 2HT4D 1QSED 4XZUB 3AS1A 1KTLB 4TVPL 3X3GL 4DEPC 3IDNB 1YNTA 4IOFD 3AVEA 3SCMB 2OK0L 2WBJA 3SCMA 1KYOK 3VWKA 4PREB 3C2AH 3RHWF 3S35H 1MQKL 3DXAE 3FB7B 1OP3K 1DL7L 3VFWA 3TA3B 2LTQC 4UDUA 3RUGB 1XR9B 3IDGB 1T5WB 4H26A 3HCVA 5M7QA 2N56A 5K9JH 3UTSA 1A64A 3ZHLA 4KMTH 1IKFH 4HQQL 4N9GB 5LGKA 2UY6A 4PRIA 4OGXL 3VI3F 1J87A 5GRXG 3P4MA 3R4DA 3WKML 5I16A 3JTSA 4K23H 1AKJD 1H3WM 3BYYA 3L3OB 4G9FB 4X6EA 2Z8VC 3TBYA 5DQ9B 4LPUA 2HJKB 4P23D 2IPKA 4XP4H 1N0LA 5T3ZD 5I1LB 5ACLA 4LHQB 1OTUC 4U3XA 1V3LA 1A7NH 5C86A 1MOEA 5MI0B 4I2XE 3MOAH 3HE7B 1A3RL 3PQYA 1A6UH 1HXYB 4F15C 3ILQD 1KYOJ 4FFYH 4I2XA 5E00B 4AIZA 2XWJB 3T0EC 3QIWA 3ALXA 3VXUE 2VXSH 4F33B 1Z9SA 5J3HC 3S37H 1FGNH 3LKNA 2DQTL 4P2RB 3MROB 5ADPL 5C0EA 5DUBA 2J6EA 4LCYA 4HJJL 5DC9B 3MBED 3CSBA 2P48B 2VXVL 4PY7A 4WUUA 1AXTL 3QQ4A 3QDAA 3CFCH 1VGKA 3I6LD 4HPYL 5I1DA 3JV0A 1HEZA 4YHML 2FX9L 7CGTA 4ELMF 4L29B 4QRRE 1IGIH 1OF2A 2IFFH 4A2LA 3OKKA 4DUWA 1IEBB 4I18C 4PGDA 1JHKL 5EZLA 4F57H 5FUZH 3OAYK 1CDBA 4N1HB 4LHUG 5KSUA 5BV7C 3MNWA 4Q74A 5JHLL 4DKFH 3ZZ1A 3WNLA 1BAFH 1J8HA 2F54A 1CXLA 4M9OA 5AG9A 2B0SL 1RIUL 1XZ0A 3DUSB 3DWTA 4NHCH 1TJHL 4ODWB 5IB5B 1AI1H 1R3IL 1GHFL 4EI5D 5B8CA 4MDIB 4O4YH 5F9JB 1KNOB 5GGVH 5IT2L 3PL6C 3S36H 3PWPD 4I8DA 4PP1C 1JWSB 3VFTA 1QBMH 1LP9A 3RUGA 2CO6B 5DD0L 1E4KC 2HT4C 4LEXH 2X6MA 5EU3B 2OX5A 1XCQA 1GGCH 4Y8AA 1K8DA 1NCAL 3ZE0F 2PYEB 3V6FB 2J8OA 1L7TH 3MRRB 1XIWA 2IAMB 2KPNA 2NY1C 4M6NH 1RK1A 2YD3A 4ZUTA 2EIZB 5JW4R 2YZ8A 1CLOL 4N0UA 5LBSH 4LCIH 1MIMH 3VRJB 4YQXH 4PRHE 1AGEA 4ZDHB 3HTLX 5EU6A 2K3TA 2HH0L 2OLDA 4JRWA 4MD4A 1HHKA 1T6WA 43CAA 4OV5B 3P11L 4QT5B 2ITCB 4X6CE 5DMKB 3GSUB 1JP5A 2UY7A 2ENYA 3MO1B 4XMPH 1P4LB 5MERB 2X1XR 1G9ML 1F3JB 1B2WH 4JFFE 4ODUA 4Y5VA 1KB5A 3ARFB 3RZCA 2R4RH 3QDMD 5FEBA 4M1GL 4OFYD 1GZPA 3M8OH 3BVNA 1HZHH 5IVXF 4YHZH 4ZPTA 4PJXE 3HLAB 1FFQA 2E3VA 5D7IB 3VXUD 2X9WA 5I1CL 1MF2L 5J1SC 3TWCH 2XWBA 5IB2A 3CFIC 5DJDB 5D2NB 5GRUH 3KLDA 1VADB 1WGOA 3H9YA 5FYLD 5CP7B 2NQCA 3VXMD 5ESQB 5BS0D 5HHMD 3RTQA 2BHYA 4X4MA 1WFNA 2ERJB 4MNQE 2ESVA 2N7BA 3AAZB 3DETD 4S0SD 1KIQB 5C09A 1KB9K 4Q58C 2QSQA 3RL1A 5DURD 2IGFH 2Y07L 43C9B 1JN6B 1LO0H 1U3ZA 1UVQA 5BVJB 2KDGA 2ZUXA 5EU5B 2OJEA 3MJ7A 1DEDA 4P2QE 2J8UB 2VLKD 1DQLL 1R3HB 1UZ8B 1FPTL 3PWJB 5ACZB 3D69B 3WN5A 3ZL4L 2FX8L 4U6TA 5J13B 2M2DA 4HMCA 2XWBB 1Q0YL 4OLVH 3UAJC 4BKLA 4N8VB 3P9LB 1S5HB 5D5ME 3DVGB 4HUWB 3VXTA 1EX0A 1YEJH 1FFOB 3KPSB 3QFDB 1KJ3H 4YHOL 1CICA 2B5IC 4U6VH 3MXWH 1R0AH 4OQ1A 4M93B 2GAZB 3F7VB 4JANB 2XPGB 4JPKL 1IT9L 1DFBL 4LASL 3UPAA 1P6AB 4NZTL 2GCYA 4PJDB 3TH2T 3SE4C 1CXFA 2R2EB 4W4OA 3RWFB 4HIEA 2OJEB 3MJ7B 5A2IH 1QFHA 5DQDL 2QEJA 1GC1H 3IXAA 3HFML 4U2ZA 4HGWB 3PHSA 3EYQD 5C70A 4Q6IA 2GY5A 4KK8C 3GMRA 5IMOB 5FHAL 1C1EL 5E1HB 4JGUA 3E0GA 3QH3B 3V8CA 3T0EA 3CSYB 4YGVB 2XKUA 4LAJH 3TA3D 1RZFL 5GS0L 3DMMC 1YEFL 3ULVH 4PJGE 4LLWA 4OCYH 5MP6L 4P9MH 1C7SA 5C0NC 2YN3A 3EYVA 3X12B 3OXSA 4DTGH 4P9HH 5DUML 4LIQE 4M00A 4HHAA 4U1JA 2F15A 3P40A 3WS6C 3VG0L 4O51A 4JHZA 4ELKB 3VXNB 4X80L 2BVUA 4HKXB 1A3LL 5FM5M 5HHXL 4NO0B 1S5IL 4NQVB 3P4LA 5DTFA 5J12C 3T0DA 3QJFA 4JZJB 2CRIA 5I1DB 5TE6L 4LPXA 3P4NA 4PD4J 5D2LF 4F2MA 2YRZA 1CL7H 2A2QT 3MREA 3VFMA 3ZDYF 2CLVB 4YFLI 2GJ6D 4JFED 2OL3B 1CGVA 2R69H 1LK3L 3U4BH 3ZDZF 1RU9L 3U30B 3VW3H 1CGSL 2Q8AH 2F53B 2HJFB 1QHOA 4M43H 3SGEI 5HDOA 1KTKE 2BC4A 2Y25A 3DRQB 1QRND 4LQFL 3UROR 3ZLQC 4XCFH 4ZUVA 4M7LT 4R0LA 5JIPA 3KXFB 2B20A 4G80A 1RZIA 1I85C 3AB0B 1BIHA 3FOMA 2APWA 1JBJA 1XAUA 3G6JA 4QRTA 1T7VA 3Q1SH 2ICCA 1KCKA 3KJ6L 3GMMB 3QNYB 4WWID 5MEQA 1BIIA 1LO2H 4WUUD 5T33L 3E6HA 3GSOA 3UJTH 1CLZH 5F7DB 2HKFH 3M17A 2R23A 5JZ7C 2AJYH 4I0CC 1AD0B 4OIAA 1UYWL 4PJDA 4G9DB 3F65A 1VESA 3QO0A 1IEBA 1C5BL 1DQDL 5EOQH 1U8KB 1CFVH 1PDKA 4NQEA 32C2B 2A0LD 4JRXE 3HI6L 4Z7QF 3WDIA 3A0OA 4XCYA 3GBNH 2I5YH 1YQVH 3PDGA 2HFTA 2X9YA 1JF6A 4ZOCA 2XOTA 2LU3A 1S9KC 5L6YL 4O02L 4Y1AD 1XR9A 1BQHG 1HKLH 1MRFH 3HZYA 3WHE1 3LHPL 2XZCH 4HBCL 1IM9B 1WZKA 3BWAB 4KRLB 1NCWL 3D6GA 3HAEB 2NY6D 4HIJB 3I02A 4C57C 3D48R 3MLYH 3QIWC 4HFWB 4WV1B 1IC7L 4YE4H 1BZ9A 4P5TD 5HYSB 3C60C 1VKXA 3JV6A 5GZNC 4ODVH 5HYJB 3EYFB 4ZG1A 3MGOA 1XGTB 1F3DH 2R0ZL 4N8PA 4DEPB 1F11B 2HFFA 3FTGA 5F8QC 5I8EA 4HKBA 4CVZB 4RMUA 4F9LC 3BJLA 5JMOC 5C6PB 3MLXH 3THML 1PKQE 4K55A 4ONHA 5BCAA 1NDGA 3QDMA 4Y4HC 4MMXC 2C3HA 1I1FA 4O51B 5LWYL 4AM0B 5E4EC 5E7BA 4IOSD 4KJPD 5HHOD 2WWKO 3CU1A 3IJYA 2GITB 2FEDC 2NY1D 4LPCA 1K8IB 2FEEI 1MREH 1T2QL 1ZHKA 3A6CH 4K9EC 4LSQL 5BW7A 1SYSA 5CZKA 4WO4A 4HW6A 3HZKA 3V6ZB 1ZTXH 4XHJC 1WISA 5IHBA 4NN6C 1Q9WB 1IGTB 2VH5H 4V1DB 5E2UL 5E2JA 4JM4H 4CVZA 2QSVA 1YNTB 4PR5A 3RJQB 2VZSA 4BUGA 4JO3L 2R2BA 4ZFFB 3KPTA 1RMFL 3D1MC 3JUYA 5C0DA 2HRPH 3T4AA 1WVZA 4NM4H 4UQ3A 1T7YA 1H3PL 3Q5YA 4W4NA 3O4LE 1C5CH 1ZT1A 5FUOH 5DHYB 3SDDB 3RDTB 4U3HA 1OPGL 3N1PC 4JKWA 5T3XL 1RZ8B 5EO9B 3BISA 1WCBA 4M7ZB 3O41B 1BFSA 4UOW1 3OPZH 4LSPL 1A1MA 2Q3AA 3WXVL 3IXTA 3UPCA 3GJEA 4GAYA 5T5NF 4RMTA 5F7EL 5CCKH 1N6QH 4JY4A 2ADIA 4JFFD 1N2RB 2AJSL 3LQAL 1QG3A 4H5SA 3VXSB 2E7LC 5KS9E 1MFCH 1A1OA 4JFEB 3MUZ1 1N6UA 4AEHH 5C2BH 5FHBH 4Y16B 5F7YC 1ZLSH 2O61B 4JPVL 2C1OA 4F7EB 1T3FB 4IRZH 2EDXA 4BUHA 4D0DA 3UTTE 3VFNB 1CD9B 1BIIB 4YIQA 1J10A 4WW2C 4XCCH 5EO0A 1F2QA 3U6RA 4R4FL 5ISZD 2IANE 2Q8BH 3NCYS 1AXIB 4PRDB 1Q9KA 4KDVA 4D9QD 3GGWB 2NX5A 4PFEA 4Z5RA 2W65A 1A7BA 2NW2A 4WW2F 4ELMB 4LSUH 5DA0B 1OGAB 2Q76B 1UJ3B 1S9WB 1JTPA 3A6OA 2ORBH 3L5WA 3QDME 4UT6H 1XF5B 2VR9A 1ACZA 2XNAB 5ANMA 2JIXA 4L8DA 2GTZA 4MA1B 1T5XA 1KFAH 4XXCA 1WT5A 5ITFA 1KC5H 3LEXB 4FFWD 2VAAA 1D5IL 4LBEA 2HFGH 1ZANL 1EUUA 3ARPA 5CILH 5F71A 1JUFA 1U58A 4BJLA 3IDXH 1UM5H 5JDSB 1IGYB 3KPNB 5FOJA 5LXGH 4I48B 4CMMB 4PRIE 4I5BA 3JTTA 1G0XA 2XZAH 3FRPA 2IAMC 1FCGA 2D0HA 4NO0A 5DDHB 2XZQL 1UCBL 4QRRB 5C0RL 4JR9H 1CD8A 2BSSA 4DVBB 2ZPKH 3TBSA 3IDGA 4XBEH 5EBMB 1WTGT 2V17L 3VFUB 5E2WH 2XY1A 3WIHL 2VDPL 1RZJH 4HIIB 1MAML 1JF1B 1UG9A 1NMBL 3WJLC 2BNRB 2OJZH 4K9EH 3RVWD 4FQCL 2GK0B 4YXHH 1S9YB 1CVRA 3O2WL 4MJ2A 3ZT6A 2Q1EA 4F37F 2DLHA 3IRZA 4G5ZH 3EOBA 1SEBB 4HJGB 4FABH 5DK0A 4GW5B 2DQEL 4BQ8A 2CDGB 3BOVA 3MMEA 1GZQA 4R2GD 3TN0C 1YMMA 4DN3H 5DRXA 1P5UA 3QRGL 2VUYA 4MXQD 2O5YH 1CR9H 1PJ9A 4HK3N 1EVTC 5DD3H 2DKSA 4P5TC 2FRGP 2BRRH 4D2NA 4UUJA 2VDLL 4OLYL 5JXAH 5ETUB 3UTZB 4XNXL 4KDWA 1KCLA 3O2DH 3EHBC 3B2VL 3S97C 5IEHB 1HQ4A 4LP5A 3FAWA 4R7DA 1X3DA 4LLWB 5DJAB 1U8JB 2YR3A 4M4RA 4HWUA 5JW3H 3KS0J 1ND0A 4ONGH 3L5HA 1RUKH 3MFGB 2AV7B 4JM2A 5C0BD 3T4YB 1Y18B 3CIQA 4K8RH 1S5HA 3N85L 3DMMA 3UX9B 4GXUN 5DK3A 3BSZL 4OM1H 1QEWB 1MAKA 1F6FB 2BDNL 1CCZA 3QDGE 1DLFL 4NGHL 3HZYB 2CLRB 1A5FL 4LOUC 2Q6WB 3PXJA 4ZTPH 4XNZC 2EH8H 3RBSA 2D03H 3DNKA 3IKCA 2A9NH 4GRWE 2F5AH 4IDLA 1FORH 3LN9A 5DR5H 4JVUA 2X05A 3S5LA 4MHHG 4YO0A 3PP4H 3UTZA 2YKLH 1S7WB 4Q97A 5CJ5A 1EGJA 3KPQA 1Q38A 2UVFA 4KK9D 4L3CB 4G9FA 1R24B 4GXVL 1OARL 4M1CD 2BCKB 3O3EA 3RVUD 1KULA 1MCRA 3TYFB 1U91B 2I60L 4OFIA 5DRXB 1U42A 1FL5B 2PXYC 4JLRB 4UDTA 1JWUB 3FQUB 4RBPK 1AJ7H 5C9JB 3GSNB 2NY1B 3E6HB 5FYKH 2WBWB 3L7FB 3U46B 4XPHL 4G7YH 1YC7A 1BM3L 2CUIA 4HV8B 1KCVL 3JSSA 1E4XI 2DQCL 1I1CA 5J1TC 4GSDH 5IW6B 3WJJC 4XPFH 1NGWA 1I3RA 2D31B 2FBJH 4ZQKA 5EOCH 2MKWA 1FVDA 1HINH 5I0DA 3KPSE 3NTCL 3VGAB 1UVQB 5K9QG 5A2FA 4YFDB 3AY4A 4L4VA 4X4YA 4Z7NE 1FNSL 1U0QA 2BFVH 4XNYL 1ZEAL 1OCWL 2EICA 4LLYB 1SM3L 4GH7B 3N1GC 1INDL 4UT7H 3S37X 1PD6A 5DEFB 2OP4H 4FQJL 4Z76A 1HQRA 4RQQA 2VDNL 2YA0A 1F02I 4EDWH 2ZG1A 1WUNT 2YOCA 4CVUA 4NWTH 1ZA3A 4L8SB 4B7IA 3RZWA 4HIEB 3L3HA 1I3GL 4MCYB 3WO4C 5JIHA 5JMRA 1IGCH 4AH2B 4PG9A 2EXYD 3BEWA 5E5MA 2ADGA 5EIIB 1NBQA 1S7TB 1QBLL 3BPOC 4MWFA 2KQNA 4C4KO 1NGPL 3V5DB 4UILL 2ZSVB 2YMXL 5L88H 2F58L 3D39B 3B3IA 1CFNB 5T3ZL 1YNLH 3WKNA 1H8SA 2X10A 4GFTB 4PGJA 2X4RB 3HA0A 3QXDB 1F58H 4KKLD 1UM4H 1CTNA 2J7LA 5IVZB 1JGVL 4P2OC 3DXAD 5IMOA 2R4SL 2VIRA