2NNAB

Structure of the mhc class ii molecule hla-dq8 bound with a deamidated gluten peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
182
Chain Sequence
GSRDSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II antigen
publication title A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 182
sequence length 192
ec nomenclature
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nnaB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2nnaB01
1QQDA 4NKIH 2D2OA 1PEZA 3KAAA 2A77L 3BPNB 3FQRB 1H0DB 4OZGA 1GOGA 5FGCB 4O9HH 4YFDB 1NGWB 3QUZC 1JF5A 1UJ3C 1DBKH 2CRZA 2EDRA 2IF7A 4UINL 1Z2KA 4ZQKA 1RZFH 1J8HA 4V2BA 1HDMA 4M5ZL 5H37H 3LQMA 3O6FA 2IGFL 3Q5TA 3P0VH 4KUZH 3VGHA 2AKRB 4OJFH 5EU6A 3DV6A 4FFZH 3V0VB 1E4KA 1E27B 3QNYA 4I18B 5GGQH 3K1KC 5IMMB 3O3DA 5DD6B 3PE9A 5BQ7B 3IDXH 1A1MA 2Z8VC 2DBLL 4U1JB 5J06A 4OM1L 1IBGL 3W39B 1U8MA 1HXYA 3SJVD 1G6RL 2YN3A 4L9LC 5HI4D 2HTLD 2O93L 3HAEA 2APXA 1FO0A 3FOMB 1T7WA 5C0FA 2QSVA 3VXMA 3HG1E 1NEZA 1L6ZA 4RCAA 4MX7B 1U91B 1CGSH 1CXEA 3NFPB 1EO7A 3BP6B 3BKMH 3LKNA 1RUAH 4P2QE 5D1XA 3UTSE 3VFTB 4CADB 4LSQH 5DS8A 5I15H 4LCYA 3QI9C 2YD7A 3CH1A 1JF1B 5FEBA 3MFGB 1LEKA 1TZHB 4YIQA 1OWRM 4I5BA 5CJBA 3F6IA 5TQ0L 4WU7A 4XNUL 3QCTL 5F97E 2XKUA 1PKQB 5JXEA 5KTEH 5INCA 3M45A 3UTOA 5KS9E 2H32A 4M48L 1F3DJ 3B6SB 4WTZA 1MCOL 4QYOB 3SO3C 2M26A 4KRMB 5JOFA 4JKKA 3U6RA 3BPLB 4MAUL 2R29L 3SOBH 1CR9H 4WFED 1KCRL 1MFNA 3WHXB 1DL7H 3HC4L 1WCQA 4C58B 2AQ1A 2CUMA 2FBOJ 3HNVH 4RWYH 2QSQA 3ZDZE 4QWWD 2YBRA 4YHML 3QEUA 3FFCD 4GRWH 4NHUB 2BRRH 3BIAX 1J9CT 1MHPL 3MOAL 1RHHB 4YDVB 1BFTA 1DQJB 4M7KH 3C6SA 4PP2A 3OKDA 1X5HA 4W4OA 3O3BB 1B6UA 1MCRA 2VSDA 4PJFB 1U3HD 1KJ2B 5JHLH 2OI9B 3RIFF 4PV9B 1M7DB 3VWJC 1MNUL 4WI4A 3QCVL 3MV9E 1W8OA 1NDMA 2LU4A 4KI1A 1MRDH 1KF9B 1BD2D 1RK0B 3F7YB 3AS1A 2WUBL 3K4AA 1ZHNA 2ICEB 2HWZL 2G9HB 4JO2H 4ZSOA 4L4TE 1QSEB 3BAEL 5F70A 1NMCB 5AAMA 3L3KB 1JPGA 5IROA 3KWWB 4J1UA 2FWOA 4BQ6A 2VQ1A 1NGPL 4OIAA 1MIEH 1ND0A 4OM0H 4X9GA 1CIUA 1Z9SA 4UIKH 5GGUA 1G9NL 4U1MA 2X1XR 1J7VR 1T20A 3AXLA 3RIAF 5J4MA 4AM0A 1OB1A 4NO0D 1JGVL 5DJCA 2I5YL 4ZFGL 2I9TB 4YBHA 1A6TA 5ICYA 3L5HA 4L1HA 4HULB 1YEGH 5EU7E 3VD4A 3JXAA 5D7LD 4UQ3B 3RPIA 1QFWI 2GEEA 4QRTB 3D69B 1MCBA 2DN7A 4I4WA 4KUCF 1TJHH 3QB7C 5B8CA 3LMJL 4D0CB 4XP9H 4YHKL 5CD3A 4ODHL 1GGBL 1NFDB 3HHRB 1X44A 3PQYB 5GRVL 4FZEH 5C07B 5I8OH 4DTGH 4H0HB 2Z8SA 2GTWA 3H9YA 3BJLA 3GSXA 5T1KB 4HHAA 5ISZE 4PJ8D 4D9QE 4KKCC 3FN9A 3GIZH 1ACYL 3FT3B 3I50L 5IVOA 2E6PA 3EOTH 2XYCA 3TP4A 1S7VB 5EA0H 5TGBA 1OP3K 3AAZB 3OKEA 1XIWB 4EI5B 4XCYB 3FRPA 3PDOA 3SCMD 1LEGA 2VDRH 4OBSA 5D96C 4FQHA 2BNQB 5C08E 4KRPD 1J0IA 1WIOA 4HH9B 1EGJL 1IC5L 3D39D 2FD6L 5HGBB 4W68A 4HWNA 4DEPC 4KY1H 1KCLA 4WFGE 3VH8B 4ZMAT 3WNKA 4KPHH 1HKLH 1A7BA 4AEHH 3BGFC 3FKUS 2FX7H 3H9HA 5ESQA 5FYKH 1EJOH 2NY0C 5CILL 1N7MH 3L95B 2HT3C 4M8QB 3RZCD 5IV2B 3BP7B 3LN5B 5E1AB 2EDEA 4XMPL 5IVXA 4ZPVA 4JQIH 3PWVA 1TNMA 5DMKB 1A5FL 3E8UL 2YKLL 4NKDB 1VENA 1AIFB 2C7UA 1CGUA 2J5LC 3SEPA 5JW3H 2BSSB 3UJJH 2GK2A 4QXTB 3MGOB 1M05A 3QDGA 2Q8BH 1EEQA 3SKNB 2Q20A 2VJXA 2FIRT 4YWGL 4C56E 4MJID 1TJGL 3TPUB 3TCLA 3SJVB 1KJMA 1MCCA 1DTUA 4U1GB 3QSKB 2A6KB 4FABL 4HKJA 3IAPA 4JAMB 2DWEB 2YD3A 1NQBA 2FEEI 5DT1H 1AO7D 3W9DA 3ZT5A 3U46B 2YMXL 3VMPA 3MCKB 2FX9L 1ZEAL 3S96B 4MS8D 5GJSH 3T0EC 3C8DA 4ELKB 4YHLH 4JFFD 3REVB 2ZJSL 1JNLH 5E2TH 3NZ8A 5CZKA 3RY6A 5B4MD 1H8OA 1XAUA 5IBTH 2Y6SC 4G9DA 2HKHH 4JHZA 4PB9H 5D4QA 4HUUA 1QKZH 3BEWB 4OZHA 1SEQL 3ARED 1FV1B 4YGVB 4K71B 4L29A 1Q9OB 5ID1A 2A73A 1DUYB 1MHEA 4XP4L 1HEZA 3U4BH 4CJ1A 1QO3B 3MRGB 2HH0L 3GHEH 2W65B 4GG6A 1U8HB 1G9EA 4LBEA 1A0QH 3DRTA 1PYWA 1IEBA 3GJFB 5DSCA 1FHGA 1K85A 3JV5A 3DI2B 5IK3A 4PJIB 2PYEE 2AQ3A 3VGFA 3GM0A 2OX5A 3FFCB 2LVEA 5DJXB 4L8SC 4HIXL 3VGAB 3BDXA 5GZOC 1CICC 5IIEA 5JDSA 1IEAB 1W2KT 3GSQB 1ZLSH 1G6RB 5GRJH 1AXSB 3KS0J 4KU1A 4LARL 4EQ2A 1YNTA 3BRDA 4NJ9L 1U3HB 3WHE1 4GRLC 4Z7OF 4ODVH 1LDPH 4NRZA 4PJBA 4AJ0A 2CKBH 1X6NA 4PJGB 5EG6C 1F58L 1LO2L 3RKDD 2AEQH 2CJUH 4ZUUA 5MEQA 1I9RH 2HTKC 1BJMA 1FGVH 2P7TB 1BD2B 1QBML 2BNRE 3PJSB 3RWIA 4APQD 4XX1G 4EDXB 1OF2B 5B39B 5F7MC 1TVDA 4G5ZL 2NTFB 2NY1C 5TF1H 3BO8A 4QTIH 2UY6A 1QHPA 4D8PA 1QTYT 2NY5H 2EIEA 4QHKJ 4I3RH 4MJ5A 4FP8H 5EOQH 2XG4A 3JV6B 5T3ZH 4OGZA 3WO4B 1N6VA 3MUZ1 2E7LC 1U8IB 4JN2A 3T09A 4P2OD 2OMBA 1Y0LA 5L2KA 4NO0B 5GSVB 2C3GA 2VDLL 2H41A 5FV1L 2AAVA 4G7VH 1HI6A 2ADFL 3GMQB 1CD9B 1RHFA 4OD2B 1ZSDB 3D0VB 3SE3C 3NA9L 3ZKMD 4HV8A 5D7LB 1IT9L 3HUJB 5L2JA 4FZ8H 4FRWA 1JWMB 4Q2ZA 2WQ8A 4JFDA 2EDJA 1YEDA 2H8PA 3ALXA 1NMAL 3QNZA 3VDAA 2AJ3B 1NGZB 4LFHD 4MWFB 3VI3F 3VDCA 4BQ8A 4YHIA 2P8PA 3VRJA 5J13B 2VKXA 5KOVC 3WLBB 5IOPB 4OCXL 3I6KA 2XWBB 1MFDH 4PJ8B 4F15B 3KPOA 2ADIA 2ZSWB 2CK0H 1H3TA 2YXFA 1NGXA 4IDJH 3UTQB 5AAWA 1KB5B 4IM8A 1H3WM 1BQLL 3OF6D 4FQPA 5F7WC 3VJ6B 4NQCD 5GGVH 4PJDE 5F7EL 1PDKA 5F89B 1WFUA 3QI9D 2CLZA 1HILB 2XWJB 2YPVL 2ID5A 3SCMB 3UTZB 2IALB 4U1LB 3SDDA 4KRPB 4PJXA 1WT5A 1FBIL 3TN0C 3D39B 3ZE0E 1UZ6F 4M1DL 1GRWA 3L3GA 5ACLA 5D2NA 4UILL 1T0MA 3G08A 3MACL 1SBSH 2KZ1B 3H9SA 4RAVA 4WI7A 2D03H 3FAWA 3IFOB 5E4IA 2GYSA 2R0LH 2UWEB 3RZCB 1MJUH 3FN0L 1T1YA 4JM4H 4X6CB 1FVEB 1QBAA 5FA3B 2RCSH 8FABA 3DV4B 1S8DB 4LSUH 3LSOB 3F12A 4GW4B 3U9UB 1IM9A 4HMEA 1GH7A 4WU5A 1BM3H 5BO1H 5ETUA 2ITDA 3RVTC 1CIDA 1YQ2A 4OIIL 2RQ8A 3WFBL 4LCIH 1F3DH 2X1PA 4HWZA 3LZFL 4MJIB 1BF8A 4HBQA 2F54A 1MCDA 2FGZA 3WIHA 4G8EA 4FTVA 4KTYA 1DQDL 3TV3H 2VR4A 3KPPB 1PSKL 1GGIH 4TVSa 3U0PA 2EXWD 4PLNC 3ARWA 3GHBL 4AG4L 2NQCA 1AO7B 4Y8AA 3HZMA 1G7JA 2BXYA 4QHUA 3I85A 3DVNA 1KENL 2XG5A 4Z7WE 5ESAB 2AJSL 9CGTA 4JVWA 4CVZB 2ORBH 3K8MA 1JYVA 5LBSH 3H9ZA 4JFFB 1WFTA 4IS6B 2RFXB 1WSST 3PIQA 3OG6B 3VXQA 3F58L 3MRLB 3ECBB 4OGYL 4F37K 2B0SH 2NW2B 3E6HA 3AREB 4LPUA 3L7EB 1BVZA 5A1AA 4OCYL 3IDGA 5K9OA 2JJVA 1INDL 2DM3A 3RTQC 4ZO6A 1MY5A 4ELMA 4GKNB 3TFKD 1JWUA 4JDTH 3Q3GA 4YE4L 4OCWL 2FX8L 1WWAX 4Y19E 1GL4B 1D5XB 2H26A 4AENA 1MIML 1FSKB 2F5AH 3LB6C 5LKNA 1I1YB 2UUDH 5D2LA 3MRMB 5HGHB 3QHZL 4L4VD 1RU9L 4OLXH 3MREB 2ZP0T 5C0CA 3MRDA 3KHQA 4F7PA 4DVBB 2VLRD 3BGMA 5CSZB 3ULSB 2V7NB 2O61B 4UT7L 5IVNA 4CN1A 1OTSD 3IJSA 2IQ9H 4RAUA 4M5YL 4YZFF 5FYLE 4KJPD 3K8KA 1KELL 1GC1H 2V2WA 5E6IA 1E6OL 2YWZA 5E70A 4KMTH 3UPRA 4M7ZB 3V8CA 3D5OF 5A2KH 2X4PB 4G6JL 3U83A 1NCAL 2Q86A 4ORZC 1N59B 1T3FA 3RVWC 3TBYA 5KSBB 1DLHA 4PJ7B 4O2CB 4RGND 1HN1A 3O6KH 4ZUTA 3SKUD 4MNGE 2W0PA 4D0BA 1FG2B 4DWHA 3AY4C 5TDOB 4ZFOL 4APQB 2HFFB 5JNYA 2OM5A 3VFGL 5C0BD 4W4NA 3P4OA 1CT8A 1M71B 4JCMA 4P4RB 4O2FB 3MXWL 3U30B 4Q97A 4MSWB 1C1EL 1DEEA 3TWCH 1FCCA 5I76A 5I8EA 4JFQB 2DQFA 3LN4A 2X70A 5HI3C 4K7PX 4R90H 2Z0BA 4P2OB 4X5XB 3EYUL 4R96B 2EH7H 1XH3B 2VWEE 4ZO8A 5IQ7H 5ALBL 3PWNA 2FJHB 3RUGB 2I9LA 4QOKD 3IS1X 2QV2A 4X98A 3P11L 4OKVB 4JZJB 5D7KE 4Z9KB 4DQOH 3N06B 1OM3L 3B3IB 2RB8A 4UAOC 2IAND 2DI7A 1VB9A 1AH1A 4RBPH 3V6OE 4ODTL 2X1QA 4QRRE 5J56B 1LP9E 1MREH 4LLUA 4N1CA 3VFRA 5IUSA 3SQOH 1XGRA 1YEKH 3T65A 4R3SB 2ZUUA 1OAXH 3QIWC 3DECA 4IRJC 4LAJH 4QF1A 4NN6C 2P5WE 4EXPX 3T3PF 5BV7H 4OF7A 1BFVH 3PF2A 4NQCB 3P4MA 4KKBD 1S7XB 3LKOB 3QO1A 4PG9A 3QDJA 3QI9B 4JPVH 2VABA 4X0KA 5AD0B 4OT1H 1UC6A 3QG6A 2BHUA 3SE4C 4K3HA 4XCCH 3MRJA 5IT2L 1FL3A 4OLZH 4N5UA 2DMBA 4PJHA 2ICCA 1JGUH 3DROB 3WSQH 5IF0A 2EXYC 3CLEH 4E0RA 5DHYB 4PJAB 2QQQA 3B5TA 4KROC 3FONA 3SY0A 1MUJB 4H25A 3BWUC 4LMQI 3VFWA 4JRYE 4KRNA 3JWOH 3QQ9C 2VC2H 2EDOA 1AKJA 2J6EA 5DA4A 1T5WB 1S3KL 4R7DB 5CJ5A 4PRID 3RX8A 3V4PH 3EHBC 1G9MH 3VXSD 1KCUL 3Q5YA 3BH9B 4BQCA 2R2BA 4N68A 4OLWH 2FYYA 1BJ1J 1IILE 3HZVB 3KDMA 1WEJH 1FFPB 4LGPB 5D7IE 2FO4A 2MQCA 1CU4H 1TNNA 3QIUA 4K7PH 1OTUD 4JPWH 1PKQE 2XRAH 3KPMB 5FKAB 1U3ZA 4OLVH 1NGYA 1UM5L 4QXUL 2VNCA 1VEOA 4K94C 3R8BB 2AJVL 12E8L 1A64A 2Q87A 4CNIB 1DBBH 4F8QA 3WEXB 2KQNA 1NDGB 5I19H 1IAOA 4HIEB 3Q0HA 1KIQA 5HHXH 5DMYA 3KS0H 3ULVL 4LPWA 1X7QB 3HFML 5I8KL 1A9EB 2EC8A 3VG9C 4LCCB 1YMHA 1EEYA 1PG7L 4PD4K 3MZTA 2JTDA 1X5KA 4HUKB 3AU1B 1T66C 1I3GL 3UYOD 1QFHA 1EEZA 3LQAH 5IHZA 3MBXH 1W0VB 5F8QC 4JO3H 5E7BA 2NY2C 3MRPB 3OZ9L 1KN2L 4HIHA 3VI4E 2WP3O 2J1KA 2QJDA 4TTDC 2IEPA 1V7MH 3P40A 3O9WD 4HK0A 3NABH 1JN6A 4L4VB 1GZQA 4O2EA 2OJEB 4OZIB 4EN3C 4N0CC 3FB6A 3GK8L 5KANG 3WBDA 4ZUWA 1L7TH 4LASH 2VLRB 3MA9H 4KXZH 1YEFH 3VXUA 5IESH 4HF5H 1NC4D 5DK0B 3NIDE 1F6AA 1EEUA 3SGJC 4A6YH 5HJ3A 1I7TA 3OR7B 4RDQG 3WS6C 3TIDB 5LGHL 4JFOB 4U7MA 2A0LC 4N5ED 1OW0A 1KPVB 4K2UL 1AQKH 2R56L 1YEHH 4KMLB 3FO9B 3KYOB 4P9HL 4ALAL 4U1HA 1KJ3H 4LGRB 4XP5L 2KBGA 4L1DA 3VXOB 1P1ZB 3SDYL 3TESA 3K80A 4LLMA 2PO6A 3FT4A 5EUOA 1N4XL 4RGNB 1OOAA 3QO0B 1T2JA 4RIRA 5DQJA 1S7WB 3ULVD 1P7QD 3IDMB 3LKQB 1IFHH 4KK9C 1ZA3B 4K3JH 4WTXA 3SPVB 2IPTL 1FZJA 1ZT7B 2JELH 5TQ2L 5C0BB 2K9UA 4AMKL 1LNUB 4NP4L 4RWHA 2AP2A 3QHTC 2F8OA 3NH7H 4YXKL 4UV4L 1CG9A 2RBLA 1HNFA 3KVQA 1JGDA 1QOKA 2DQIL 5HD8D 1KT2B 3BGFB 3ULUE 5AG8A 3FTGB 3AS3A 1J8HD 5E8DL 2C26A 1TTFA 1N26A 2J8UB 3O6FD 5C07E 4LPYA 4O58L 4NGHL 4Z7VE 3C08H 3TJEH 2YD2A 3MJ8B 5EU6D 5CP7B 2R1XB 4FHBD 3FT2B 4QOKB 4ZOCA 4YK4B 1RZIA 4ZAKC 5CUSL 5FUZL 4NJAL 3T0XA 2B4CC 4H88H 3RVTD 2YUWA 7FABL 2G5BA 2PW2B 5FYJU 4HD9A 2IANB 3V52H 2VH5L 1T4KA 3MLSL 3BZ4A 3N85L 3RNKB 1Y6KR 3PHOB 5E2WH 4B41A 5DYOA 5DD5H 3VXMD 4MD4A 2HLFD 4Q0XH 3WIIL 2Y4SA 4S2SA 1VFAA 5DEGB 1R5WB 4N0UB 4YXHH 3QPXH 5A2IH 1WICA 1K5NA 1OGAA 1MAML 2YD6A 2DKMA 5D1XD 3QFJA 5F3BA 2D9CA 4EBQH 2VISB 1J0ZA 2Z31A 4GSDH 5D6CB 2IFGA 3C8HA 5DD3L 1RIUH 2HLAA 3IKCB 1CFNB 4PRBA 3UBXI 4LPCA 4EOWL 1XFPA 1KCSH 4J3XA 5DTFB 3QCUL 1OD9A 4NC1C 4PGBB 2BFVH 5JXED 3OXRB 4HS8L 1ZE3C 1OP5K 3QIBA 2Q76A 3CPLB 1AGFA 1OAUH 3T0WA 4X6EA 5L88L 4U1NA 1ZA6A 2H6PB 2Q3AA 3LV3A 3LB6D 3A6BH 4MHHG 1K2DA 5E6YA 5CD5C 5ADPH 1VGEH 2P8MA 3MRBB 1IGFL 3WV0A 1BLNA 3GI9L 3TIEA 4PRIB 3QXVA 3VXSB 1EV2E 3WKML 2HT4D 3FQUB 2A9MH 4BZ1H 4R4BA 2Z4QB 4R7NB 4RGMC 4M43H 4XPBH 1AY1H 4F9LA 3SN6N 4FQJL 3EYFB 3G9VA 3RVWD 5C1MB 4WHTB 3W9EA 1NCWL 5L7XL 4RGOL 1MPAH 3P0YL 5HHQB 3CSPA 1IM3B 1NAMA 3FQWA 1QBLH 2X40A 4U7SA 2ZPKL 4OGXH 3L1OL 4MCYB 1MRCH 4UUJA 5FO8A 4LVNB 5CBEA 1J1XH 5I74C 1JPFB 3KYMA 4PJFF 1UWGH 3MLYH 1U8OA 4UI2A 1LO3H 3VE0B 3PP4L 2EDXA 3G5XA 5T3XD 3VI4F 1NLDH 1KUMA 1KC5L 1NCCL 3MLWL 5DHVA 1A14H 1W72B 1RZKC 5DO2C 3BW9A 3OXSA 3SO5A 4HIJA 1HSBA 5CGYC 1I8MA 1BQSA 1RURH 1ZHBB 5F71A 3B2VL 1UZ8A 3HPJB 4BUGA 1AC0A 4JPIA 4R0LC 5I16B 4NQUA 2FEDC 3O9WB 4RMQA 1INQB 2DQJL 2NR6D 3MRKA 2ENSA 4K23H 5GZNC 2UY7A 1U3JA 2IAMA 3FZUC 3PWLA 1O5DT 4OZFB 5IB4B 3C60A 1VKXB 4LIQE 2OLDA 5D9SB 1OPGH 1NC4B 4NFDA 4GXVH 3T0VA 5D1QA 1BFOB 1CWVA 1A8JH 5DJYA 1XGUB 4NYLB 3HN3A 4OZ4B 4JKLA 3DBXB 5H2BB 3PV6A 4FQ2L 4M62L 4K8RH 5C0RL 3V0WH 4GH7B 4XHJC 1J8KA 3G5VA 4JFYA 4BQ9A 3VFMA 4JY5H 5GS0H 2VDNL 2Y36H 4YLQT 25C8H 3I6LE 1NLBL 1S5HB 4Q9BA 5GJTH 3SGDH 1P7QB 2I25N 1F4WH 5ESVB 4YQXH 3HMWH 4TVPL 1QQDB 5D7LE 3O11A 1NFDF 4UDTA 3KPNA 4MA7H 4DCQA 4OZGB 2VTFA 1MFCL 2OZ4L 1YDPA 4LF3A 1L7IL 2GFBA 2CR6A 4FFYL 4NIKB 4ZQKB 4PP1C 4WDIA 5FHBL 4WWKC 1J8HB 3P30H 1HDMB 1L9MA 1KXQE 1RK1A 1JPSH 3O6FB 2EYRA 2QHRL 3BGAA 1FE8L 1KPRA 5IHLB 5H37G 1K8DA 5EU6B 3R1GH 4CVXA 3DV6B 4XPTH 4IMLA 3OJMB 3QNYB 2WIIA 2EDYA 5A43C 1IQWH 2OSLA 35C8L 3O3DB 3UJTL 4QHLA 3EO1A 3RVXD 3MV8A 1PZ5A 2W91A 2EE9A 4DGVL 3OJDA 3QDGD 1A1MB 1Y18A 4Z6AT 4UU9A 4YJZL 1U8MB 1HXYB 1DLFH 4XPHH 2XOTA 1SMAA 3HAEB 2N7AA 1FO0B 1KJ2H 1T1XA 2YHGA 3HB3C 4G6AC 2IPKA 2D7QA 3UO1L 1B0GA 1G1CA 3EDJA 2E27L 4OFYA 3VXMB 4JJHA 3PV7A 1NEZB 1TCRA 5JHDE 5DZLA 1I9EA 5LXGL 2UWEE 4LDOB 3REWA 4ZNEA 3LKNB 3V5HA 4LLWA 4PGJA 1CDCA 5D1XB 1KEGL 4X4YA 3N1PC 5E4EB 4HKZA 5DS8B 4LCYB 4TVPD 4U3XA 1BJ1H 3CH1B 2EH8H 1WZLA 1ETZA 4OCRL 4XTRD 4ODWA 1NBQA 1LEKB 1H3VA 1WZ1L 1CZ8L 4YIQB 3GZKA 4I5BB 3LS4H 1RZGB 2J3SA 4KTDL 4TPRH 4WU7B 4TNWF 5INCB 2H32B 5DVNA 2VMFA 4MNQE 2B2XL 5E08H 5JOFB 4I2XA 3U6RB 1BIHA 4F7CA 2AJUH 4ZPTA 2F5BL 4Y4KA 3ARQA 3CFBA 3RAJL 2KPNA 1CD8A 1JRHH 4RMUA 5ALCL 3VXTA 4XXDA 3KR3L 2YBRB 1HHJA 3QEUB 4DKAA 2ZNXA 3L3JA 1ZKAA 1QLFA 4YHZL 2A74A 4UTBL 2HT2C 5C2BL 2X7LA 1C16A 1H3PL 3C6SB 4PP2B 3OKDB 4G6MH 1QPPA 2OR9H 1EO8H 5INDA 1JNHA 2Z93A 2FATL 1Q1JL 1MJ7L 2NY3C 3S35X 4TNVK 4P23C 5MERA 4PJIF 1CFVL 1BQHG 5CLWA 1NDMB 5C0JA 1HYSD 1PY4A 2X09A 3M07A 5KOMC 3GSNA 1OTTC 5EC2B 1ZHNB 4H0IA 1B88A 5EU3A 2MCPH 1JHLH 3OKLA 3QUKA 4ZSOB 5GISH 5IHBA 2V2TA 1FAIH 3B5HA 4MQXC 5ID0A 3OJVC 5CFHA 3G6JE 1JPGB 3E2HB 4HJ0C 4J1UB 2VQ1B 2XZCH 4S10A 4MAYC 3RY4A 2SEBA 3MRQA 5SV3A 3GDBA 3DX7A 1EUUA 4J4PA 5GGUB 1K3IA 4MA8H 4U1MB 4PRHA 5AZEL 5I1DA 3T2QA 1T20B 5CLTA 3MXVH 3AXLB 1FC1A 4AM0B 5L2KD 1OB1B 2ZCKH 2YRLA 3LKSA 3MBEC 4KDVA 3D6GA 5DJCB 3X14A 3ZKXC 1U95A 4R8WL 4HFWA 2F15A 1A6TB 5KSBE 5ICYB 3RWHA 4GKZA 1DN0A 3H3BC 2DQGH 4PLKC 2YS4A 5IKCA 2H1PH 3IETA 3RPIB 4XC1L 2G60H 3GSOB 3OBAA 4KTEH 2VLME 4I4WB 3RI5K 1M6OA 3TYGH 5B8CB 4UAOB 4JFDD 3O2VL 3T4YA 4I8DA 3IAQA 5D1ZA 1DUZA 3UTPD 1YEIH 3SDCA 5GGTA 2IMMA 5CD3B 3WIHL 3KLAA 1FYHB 2V5TA 3DSNA 3LDBB 2GTWB 3GSXB 4HHAB 1RZ7H 2Y9RT 4C83A 1KIPA 1ZGLP 2V5MA 2NNAA 5EULV 3OQ3B 2PO6C 4J12A 1CBVH 3HUJF 1B0WA 2WBJA 4NN6B 4U6YA 1F11A 5GXBB 5HBBA 1BPVA 4HC1A 2XI9A 4U3HA 5TGBB 3BESR 3OKEB 3RUGE 3LCYA 3PDOB 3U7WH 4XWOD 1LEGB 4PBWD 4P3CL 3GIVA 4FQHB 3MZGB 3SDDD 5C0AA 1MCEA 3CVIL 5JPNA 4Q9QL 5BZWA 2YPLA 4UINH 4XBPA 5DJ6A 4UOJA 2KZWA 1RUPL 3H9HB 3RWCA 3H9SD 5ESQB 4M5ZH 2F8VA 4F7MA 4Q9RH 5CJQH 1A3RH 4HS6A 1TXKA 5JOPD 2H45A 4JB9H 5IVXB 3UXFA 1J1PL 4ZPVB 4RSVA 3PWVB 2OJZL 1DBJL 1IM9D 3C6LA 2C7UB 1H5BC 1CLCA 1R5VA 5IQ9B 1XF3A 1FIGL 4PGEA 5FA4A 4DKFH 3MCG1 1R3LA 4TYUA 1M05B 3QDGB 1IBGH 2FZ3A 1ZLUK 1G6RH 2YWYA 3TCLB 2F54D 3H3PL 3O8XC 2UWEF 1KJMB 5DUPH 1VDGA 4FTVD 3GB7A 3MUJA 2CXGA 4X6CF 4HKJB 3I2CL 5IGXH 4FG6D 1VHPA 3W9DB 4PJEE 1JPTL 4XRCA 4GT7A 5KSAC 3QWOA 2B1HH 5FYKU 3WUWG 2KDGA 2O5XL 2Z31C 3P9LA 2V9RA 2MMXA 3NZ8B 4WUKH 5E99H 3Q6GL 4LIQH 1QYGL 4G9DB 1OT2A 4WHYH 3S5LG 1LO0L 4HUUB 3KJ4C 3T0AA 1UQSA 2NY5C 5TQ0H 4XNUH 1U92A 4OZHB 3OGOE 4RISL 3JWNC 4NC0B 4Z7QF 3C5ZA 4L29B 1T03L 4C55A 1MCOH 4UT9H 5ID1B 1MHEB 1HEZB 5D7SL 5DVLA 3O2WH 1KB9K 4GG6B 4FQIH 5B38A 3IU3B 1KCRH 3MUHL 4LBEB 1FNSL 3RVVD 3DRTB 1PYWB 5DSCB 5CEZE 4PG2A 5GGVY 4ZD3H 4YHMH 5IK3B 2E6QA 3JV4A 2H9GA 1DBAL 1HOCA 5TPWH 5C0CD 1AHWC 1MHPH 3TGXA 1A6WL 1U58A 5DURD 5IIEB 5JDSB 5CZXC 2XTJD 3ZYIA 5IMOA 1J0JA 5ILTL 2B7DT 3K4ZA 1YNTB 4N1HB 3MLVH 1G7QA 5E6ID 1GOHA 1BGXL 4Y5XC 1Y6NR 3DLQR 4YC2C 2NX5E 1P69B 2WWMC 4NRZB 4PJBB 2D31A 1OQXA 4F9LC 2GHWB 4GAYA 3U7YL 5MEQB 4ZUUB 2WK2A 3WL9A 4ENED 4IJ3C 4RMRA 1RZJL 1KB5H 3I6GA 2J8OA 3RWIB 1YZZA 3JWDH 2GQHA 3H8NA 1N5YL 2LU7A 1T21B 1U8NA 4NCDA 4L4VE 4ZFFB 2J8HA 3HZYA 3BAEH 4IBLT 2G75A 4JKPL 3BO8B 1RVFL 4D8PB 2GIYA 5EOCL 4MJ5B 2YD9A 4U2ZA 3S36X 3TA3A 3ARRA 4WO4C 4LVOC 4OGAD 3O4OC 5KSBF 3S34L 5AWNL 4PP1D 4PJ7F 3WDIA 4JN2B 1Q0YH 3EOYG 1JGVH 3BKCL 4M1GH 5CEZL 1Y0LB 5ELIA 5FB8A 5L2KB 5IJKA 3FQTB 5C09A 4LVEA 3R0MA 1QZ1A 3KLHC 1R3IH 1HI6B 1CXKA 1YY9D 4HV8B 5J12C 3AS2A 5J7CC 1DANU 4HG4K 4ZFZA 2QQLL 4X7FC 1IZKA 3VXRE 4CN4A 2LV4A 4FN0A 4Q2ZB 4JFDB 2OQJA 5K9QI 3OWEA 1YEDB 1BEYL 2XPGA 1V7NL 2H8PB 1RY7B 4ODHH 4RBPK 2C3WA 3QNZB 3DX6A 2A6IA 4YHIB 2P8PB 4G6AD 3VRJB 1DBMH 1N8ZA 2ESVE 3RUGF 4JE4B 2WMPA 3I6KB 1CTOA 5FIEA 1F5WA 4GUPA 3KPOB 4PV8A 3IJHA 2UZYB 1PZUB 1CDBA 4ERSH 1NGXB 2ERJB 5DEFA 1AGDA 3U48A 1JHKH 3CH8A 1MCWW 3IYLW 1R3KA 4XCFL 3QDJD 5HDBE 2CLZB 1AGCA 1KCVH 2LTQC 4LLAA 4QOKE 1M1SA 1UKSA 4Y5VC 1EGJH 3SDDB 1UH4A 1FLRL 4PJXB 2N56A 1INEL 3RFZC 3L3GB 4J3WA 5D2NB 1T0MB 4BH7A 2OP4H 1D5IL 2R23A 3G08B 1A2YA 3T0BA 3NCYS 3IXTA 4S0SD 5CILH 5FOJA 2CXKA 4RAVB 1TZGH 1LWRA 5HHOA 4XMPH 2DDQL 3ARGA 4ODXA 1ZTXL 1T1YB 4LCWA 2OXHA 2DF3A 8FABB 4JFPA 3F12B 1IM9B 2BVOA 4GAGL 5C0EA 3KYNA 3THML 4WU5B 4J3SA 5CSBA 5TE4H 5ETUB 1KFAL 2ITDB 3T0EE 4BSVA 2GJZA 1AKJD 2D0HA 4U0RB 4O4YL 3AM8A 1A7RL 4YWGH 8CGTA 4KHTL 4HWZB 3S36H 3UMTA 3RGVC 1WVZA 1CYGA 1GC1C 5JZ7C 2F54B 4PJAF 2DOCA 2I27N 3QIUD 4G8EB 4FTVB 3U0PB 3CDYA 1IKNC 3K46A 4X6DA 4V1DE 5ACZA 6FABH 4JQVC 3HZMB 1H3XA 2FX9H 4RFOL 1QLEL 4QHUB 4DAGH 1ZEAH 1DJSA 4UT6L 3DVNB 5IM7A 2BOBA 3GGWA 3J7HA 3EDFA 5FM8A 3WYRA 1SY6H 2CIIA 2ZJSH 4AQ1B 2HFTA 3EJJX 4JGUA 4FXGA 5B3JE 4I77H 4GAJL 4GQ9H 5I18L 5LCVH 1L0YA 4TTGA 3PXHA 3PIQB 2DS4A 2ZZUT 3VXQB 4XPAL 3UTTE 1Q9KA 2GSGA 4KWUA 3E6HB 1EK3A 4WJ5A 5JO5A 3EFDL 3BEVA 4HGMA 3VXSE 3IDGB 4XB8A 5K9OB 4NUGL 2HH0H 4S1RH 4ELMB 4AEIH 3ILQC 5KG9A 1JWUB 3Q3GB 2XQYG 3KPRE 3QG7H 2YZ8A 4G43A 2DLIA 2H26B 4AENB 5D2LB 3TBWA 1CF8L 2AJXL 4LKCA 1IC1A 2NY7H 3MRDB 5C0CB 3MODL 4F7PB 3BGMB 3VXUD 4M93C 5DURB 3VFVA 4ODSL 2FGWL 3IJSB 4RAUB 3QJFA 5F1OB 3A0OA 4TRPL 2V2WB 1DVFC 5E6IB 2JK5A 3Q1SL 4ISVA 4G9FA 3ZKND 1S78C 1GGTA 3P2TA 3NFNA 3UPRB 5E00A 2P24A 3E6FA 1F58H 2EICA 4OD1L 1S9WA 2IQAA 2IBZY 1U93A 1ZT1A 1T3FB 3QAZB 3TBYB 1DLHB 2PO6D 4OZIF 4KJYA 4Y2DC 4HQQL 4ZUTB 1TQBB 1OARL 4KDTA 1T7ZA 1B3JA 4D0BB 1G7MA 4G6FD 3ARFA 3PABA 4RMWA 4G5ZH 3MRCA 3GFUA 3QULA 5JNYB 3WO3B 3PGDB 5AYUL 3P4OB 1CT8B 4GBXC 4NQSA 2CGRL 1IGTA 2UZIL 2WUCL 3WJLC 5CCKH 3LY6A 1BQHA 5EBMB 5GHWL 1DEEB 5AZ2H 4MB3A 1AD9A 4QKXB 5I76B 5I8EB 4QGYA 2DQFB 1IE5A 3LN4B 2WANA 2X70B 5FUCC 5J6GA 2APTA 5C0ND 4WEBL 3QEQA 3MJ9L 4ETYA 1K4DB 3PWNB 4YBLB 5EORL 4X4ZA 1CFSA 1IAIH 1Q9WA 2I9LB 4IOSD 5IVZA 2GJ6A 1NUDA 5C71A 3JWOC 1IT9H 1AGBA 1D5BA 4NHCL 3HE7A 4X98B 4XGZA 3MYJA 1LO4L 5E9DA 1FL5A 5KBNC 1NMAH 2CK2A 5TE7H 3H6JA 1BREA 3O8XD 1YPZA 1NBVH 3OX8A 2DKSA 4F57H 1JYNA 2J8UF 3ARYA 4OZGE 3UZQA 2VXUH 2QLVB 4LLUB 3VFRB 4OCXH 1XGRB 3SE9L 3T65B 4BM7A 4OQ1A 2R4SL 1XGYL 5HDBF 4P4KA 1U0QA 5JIKA 4M4PA 4S1QH 2R0ZL 4Z76A 4JHAL 4QF1B 4P5KA 1BQLH 1OGAD 5GRUH 3TT3L 5F7EH 3QFJD 4G80A 4J6RL 2Z31D 3P4MB 3BHBA 3QO1B 1CVRA 1NAML 2AK1H 2RAMA 3QDJB 1E0OB 1N6QH 4CMHC 1DQLH 1JFQL 2VABB 1QLRA 4X0KB 1FBIH 5JQ6L 3BN9D 1UADC 3P0GB 4M1DH 2CPCA 3QG6B 4ORGA 3F8UB 1WC7A 2Z91A 4UILH 4TN9A 2PKDA 2E3VA 4Y8DC 5K9KA 3DMMC 3MACH 3NCEB 3MRJB 4CGTA 1FL3B 2E7HA 5CP3H 3QIBD 3LQAC 4PJHB 5IF0B 3MOBH 4R26L 4E0RB 3WDHA 1NCBL 3FONB 4HX1A 3SY0B 1RQ5A 2OXGA 4H25B 4NQXB 1T0NA 1MCLA 5CGTA 2A6JA 4HT1H 5D71L 3FOLA 3VFWB 5EU5A 4WW2A 5GGSA 4LOUD 3EZ8A 5F21B 5BRZE 1AKJB 5HYEA 2EDQA 3GO1L 3TVMA 5JDJA 3BZDA 3LZFH 5CZXD 2Q8AL 5T33L 5C6TL 1HNGA 2R2BB 4NPYA 4NCC1 2FYYB 5F1NA 2IC2A 3KDMB 4HFUH 1RUKL 2FO4B 3QIUB 4ESKA 1EERB 1NGYB 4P57A 2WWMD 3GRWA 2YXMA 4YBQC 3L3HA 3CVHL 3GUTA 3LRSA 4JFZH 1I8KA 4MXQC 5BS0E 2AJSH 3MJGX 4KVNH 5MI0B 4N0YH 3LEVL 2LVCA 2VZ1A 1XF4A 5CMAA 1IAOB 4LRNL 1KIQB 4JQXC 3LEYH 4WUUA 4DUXA 2DTSA 1RJZA 1YN7A 3EYVA 4AEEA 4A2LA 4R4FH 4G8GA 1C8PA 5JW5A 3O45A 4M61A 4MXWL 1E4XH 1YMHB 4DN4H 1EEYB 1MCJA 4OCYH 1ONQA 3C5ZC 3BH8A 5LVEA 4L3AA 2IPUG 1YC8A 5IHZB 2YA0A 3BXNA 4M7LL 4ZTPH 1REIA 4OCWH 1WBYA 3RPKA 3QZWA 4HIHB 3MLPA 1FQ9C 3KLHD 4JM2A 1YEJL 1WF5A 1ZANH 4EEEA 4FQXC 2AK4A 5HHMD 4HK0B 4PYHA 2FBJH 1JN6B 1GZQB 1HH6A 2F58H 2OMNA 4O2EB 3T4AA 3KPSA 2P5EE 5IW6A 3FB6B 2IAMD 4ZUWB 4JHBA 2OR8A 4J3VA 1CGVA 4WHCA 3BZEA 3OKMA 4UT7H 3C60D 3VXUB 4M5YH 1HZHH 2B5IB 5EFIA 1KELH 4NKMA 1HXMA 1F6AB 5D1QD 4R2GD 1A1OA 4Y4FA 5HJ3B 2VXVL 1I7TB 3WN5C 1A4KA 1ZLWH 3Q2CA 4E9LA 3WJJC 1ADQH 3MLRL 3IAGC 3ARDA 2YA2A 1NCAH 4U1HB 2PETA 1MI5A 1QBBA 1RUQL 2C3VA 3DGCR 5I6XB 5CJOL 4LLMB 2PO6B 3FT4B 5EUOB 2CR3A 3HR5A 5I1EH 2DLFH 4NM4H 5H8DA 5DQJB 4RIRB 4G6FB 1AGEA 5L0QB 2Z8RA 2X4RA 3KG5A 3VFGH 4CL7A 5HI5C 1LD9A 1FZJB 3OAZK 2NXZC 4LU5L 4NNYA 2HRPL 1Q72H 4N0RA 4NQVA 4ZUSA 1I1CA 4OLYH 2EO9A 3GBNH 1LK3H 5E95B 1CG9B 1JGDB 4FFVD 3ZL4L 1TDQA 4CDHA 4YHYB 2V17H 1NCTA 2N1KA 5D6DA 3F62A 2WBKA 3EYUH 4GOSA 1WAAE 5ALBH 3NA4A 1FNEA 3ULVF 2O5YH 2J7LA 4KHXL 1RZIB 4XAWL 1S5IL 4OZGF 3CXHK 1OM3H 2FECL 3MV8D 2G5BB 4H5SA 4OFPA 3HG1A 1T4KB 4IOFD 3BZ4B 3U0TA 3O8XB 5J1TC 2MHAA 3V5KA 4P2QA 5DYOB 5ABDE 3UTSA 5T1LA 4HGKC 4OFYD 2BY3A 4MD4B 3D3VE 2ZSVA 3P9WB 4HPYL 4S2SB 4DJMA 4HUXA 1VFAB 2EIZA 5T1DL 1K5NB 1OGAB 3GSWB 4LLDA 5IMKA 1ZLVK 1EHLL 4IDLA 3QFJB 5F3BB 3IJYA 4PTUA 1KPUA 3RWDA 2Z31B 4YHPA 3DTXA 1A02N 3GSNL 1I8IA 1OVZA 5KS9A 5SX4H 1I7UA 3MJ6A 4PRBB 2HLAB 4JCLA 2QQNH 3V6OC 1MY7A 3MNWA 1FRGL 3QDME 1Z3GL 2DD8L 4L3CA 5IT2H 4YR6A 3LKRA 2APVA 2JB6A 3KGRA 1CFTB 3QIBB 1W72H 4WFHD 4YDIH 2Q76B 3DO3A 1Y6MR 4MD0A 5DUML 2DQTL 4N8VG 1AGFB 1IGMH 5D8JL 4X6EB 4MQ7A 4QHMA 2HKFH 4U1NB 3JTSA 1ZA6B 3LV3B 4Y4KD 4Z0BH 4LHJB 4WFFD 5JW4R 3ISWA 2EKSA 2VR5A 4I18C 5JORA 1CGTA 15C8H 2P8MB 1BLNB 4X8JA 5CJXC 3TIEB 4MA1B 1KCUH 1OL0A 4OZFH 5SX5K 1NAKL 1AP2A 1JZ7A 4K9EL 3PWUA 4PGCA 1PQZA 2B1AL 4DGYL 2D4DA 3MV9A 1T2QL 1AJ7L 4R4BB 5FCUL 2GW5A 1UACL 2EEAA 1G7LA 4RZCA 1X5ZA 1K8IA 4QRSA 2C1OA 12E8H 5HVHB 5GS0C 4L4TA 4FQCH 3W9EB 4DZBA 3BDYH 3L5XL 5BXFA 1X5YA 4Y88A 1NAMB 1WUNT 3EFFA 4POUB 4NBXB 4P59L 2YRPA 4HC1L 1VPOL 4P49A 3ULVH 1MCFA 5FO8B 4UUJB 1UA6L 4UB0L 5CBEB 3KYMB 4TSAL 1ED3A 2P4AB 1U8OB 3JBG7 2FHCA 3G5XB 1IL1A 1H15A 2AEPL 1LEIA 3VGBA 2NW3A 5DHVB 4J4PD 4P5MA 4WV1A 3BP5A 3BW9B 3FFDA 3BKJH 3CMGA 3OXSB 4PRHD 4HIJB 4K94L 1HSBB 4OF3A 2BY1A 2VZ3A 1I8MB 4LAQL 3BPLC 5FYJL 4JO1H 1J87A 4POZD 5DRWA 1J10A 5C92A 3RWJA 3IU4H 1RUMH 4YEEA 1UZ8B 3V7MA 4BFIA 5MP6L 5HHMB 3MRKB 5I1HH 4TUKH 5D5ME 1KTLA 2IAMB 3EOAA 3PWLB 3MRRA 4K3EH 5I9QB 1OAQL 2F53E 4KJWC 3JVGA 3C60B 5D1ZD 4KK5D 3SDCD 3V95A 2CLRA 4KK6D 4QNPE 5D1QB 5DVKA 4OD3H 5LGHH 4YXLL 3TBVA 4R2GB 5DJYB 1XF5A 4P5TA 2D7TL 3RHWK 2AEWA 4K2UH 4JFXA 3HAEH 3PV6B 1FO0H 4FXLA 1TQCC 2OI9C 2NY4D 3MGTA 1UYWH 1FFQA 3F65A 4P9ML 4ALAH 3UAJC 4UTAL 4XP5H 3G5VB 4JFYB 1BAFH 1WWCA 2E6JA 3VFMB 1FH5L 1N4XH 2WBJD 4ZXBA 5L2KE 2ATPA 4KDTC 2IPTH 3CCHA 3IDNA 1NCUA 3WNMA 5C0AD 3K1DA 2YA1A 3O11B 3PHQA 4UDTB 3KPNB 4UV4H 1QSFE 3F5WA 3OKKA 5CHNA 3CAFA 2YPLD 1YDPB 4UMGA 4LF3B 2F19L 2GFBB 3CIQA 3DETD 4NQEE 2H32H 4ONFL 4WDIB 2NZ9C 1RK1B 4WY7L 5A16A 2EYRB 1D6EA 4PUBL 1KPRB 1P9MA 1K8DB 4CVXB 4XI5C 4U33A 3C6LD 4C56A 3NBNA 3S37X 5CUSH 2ZUWA 4IMLB 3L5WB 2WIIB 1CLYH 3NFSH 5ECJE 5JUEL 2OSLB 4Z7NE 5HDQH 4QHLB 3S6CA 3EO1B 3MV8B 1PZ5B 3OJDB 3S4SA 3O4LA 1Y18B 4UU9B 2P47B 4KVCL 1HQRA 1YY8A 4H20L 3GMOA 4KAQH 4XT1C 3CU7A 5IVXF 1T1XB 4NC1E 3IVKA 5GSRA 2IPKB 1B0GB 3BPCA 3WIIH 2OK0H 1YEEL 4YBQD 1OCWL 3CMOL 3VFSA 1TCRB 4KKLC 4MDJA 4MXQD 3LKPA 3V5HB 1N2RA 5JOPE 4LLWB 5BW7A 2X6MA 5E2JA 2B4CL 1QFWM 4X4YB 4GMTH 4NDMA 4NN7B 4HKZB 4EI5C 5L8LB 2OTUA 5GGSY 3L3OA 2DIJA 4XP6H 1L9NA 1P84J 1ETZB 4ODWB 3D18A 1MJ8L 3WFCL 2FECI 3HNTL 4D9LH 2R2CA 5I1IL 1C08A 4JLRA 4F3FA 5T3XH 3C5ZD 3ARTA 3QUXA 2EYTA 3BD4A 2VLLA 3RGHA 5L88H 4I2XB 2PYEA 5LWYL 3IF1A 2D7OA 3BP4A 1WWBX 4F7CB 1DQQA 3WCYA 4ZPTB 2VXSL 3DYOA 4Y4KB 4RA0C 3CFBB 2DIAA 3LS5L 1KV3A 2AXFA 3T2NL 2MNUA 3VXTB 3GI9H 2WNGA 4XXDB 4QO1A 1F90L 4OZHF 1HHJB 4DVRL 3TVMC 3L3JB 2ZOKA 4PLOB 4FQ1L 1QLFB 2A74B 1CDUA 3VWKA 2X7LB 1C16B 4OQTH 2IFFL 2AABH 1FORL 3OB0H 2MWCA 4NOBA 5HI4C 2O5ZL 4GG6F 1UH3A 2HTLC 4U1GC 5KVMC 5INDB 4FS0A 1JNHB 2BNRA 4QRPE 2Z93B 3DVFA 5H94A 3RDTA 3RWEA 3V79C 1NCWH 3JZ7A 4X8XA 4ELME 3EO9L 5F9OH 5MERB 3P0YH 3S37H 1YJDH 5C0JB 1J18A 3ZSSA 1BIIA 3IRPX 3EBAA 4CU6A 3DARA 5HPOA 1LMKA 3GSNB 3CX5K 1K4CA 2CRMA 4XBEH 4AZ8A 5EU3B 5DFVC 3OKLB 3QUKB 1UCTA 5T5NF 2VZVA 4XP1H 2V2TB 4P2RE 4HSQA 5ID0B 3PP4H 2X2YA 2B39A 4JREB 2X9WA 5GS1A 1KC5H 3TA3D 5IP4A 3MLWH 3KPTA 4PJBF 3HE6A 4YUEL 4K71C 2SEBB 2WAHA 1CK0H 1ZWIA 4D9RD 3DX7B 2A9NH 3OAUH 1DFBL 5JW4N 5I1DB 3T2PA 4LPVA 4PRHB 3QUYA 4WCYH 3W0WE 3LKSB 1I7ZA 3MV01 5C09D 5EO1A 5KANI 1NUNB 4S1SL 3X14B 1U95B 1F4XL 4HFWB 4JR9L 5TF0A 1IVLA 4WNQA 3RWHB 4GKZB 1DN0B 2MTPA 3SKMA 4QNPF 3DSFL 1DDHA 5IGXL 5IKCB 1SHMA 4NKIL 1CDGA 3IETB 4H1LA 4QWWC 2YUZA 3ORJA 4O9HL 1UM6L 3VGAC 4NZTH 1M6OB 4J23A 3T4YB 5D1ZB 2JJTA 1DBKL 3SDCB 1IGJA 2QSTA 1U3HC 1OY3B 3O3EA 4M62H 5C0RH 4OLUH 3KLAB 1F13A 5MENA 5DFWH 3ARDC 2NY4B 3D0LA 4PJDA 3P0VL 4KUZL 3MGAA 4LCUA 4C83B 1KIPB 2VDNH 2NNAB 4FFZL 2D7PA 4AT6A 2WBJB 4U6YB 1F11B 2DQHH 3KYKL 2VOTA 2YN5A 3IDXL 3TH2T 1RSFA 1R3JA 3GIVB 4CMHB 3DIFA 1S7UA 5C0AB 4A6YA 4AIXA 1MFCH 3NN8A 5JPNB 3G04A 3OPZL 5BZWB 2GKIA 1L7IH 2YPLB 4XBPB 4FFYH 5DJ6B 4V2CB 1FPTH 2CKNA 2IADA 4WWID 3WO4C 3RWCB 1KNOA 3RBSA 5D6DC 1JMZA 4F7MB 5HHOD 5KVGL 5C9JA 1CGSL 3MJ7A 3OAYK 2FSEA 2QHRH 3ARGD 3BKML 3NIGF 5F7KC 4Z7NF 4LCWD 1RUAL 2COQA 1I7RA 1I4FA 1PBYA 4E41E 1JHTA 4LQ1A 3EAKA 4LSQL 5I15L 5A3ID 5J6HA 3C6LB 1TCMA 1S9VA 4PJXF 5EO0A 1R5VB 3U79A 1XF2A 2EECA 4PGEB 4U1SA 3O3UN 4EKXA 1D5MA 5F9WB 1R3LB 3WLWD 3QDJE 2FZ3B 3CSYA 2ICES 4R9HA 2QTEA 3RQ3A 4Z7WA 2A1WL 4Y5YA 1F4YL 3GB7B 3UO1H 5J13C 3KXFE 3EJZD 5E24E 5IBLC 2X5PA 2XA8H 3DYMA 3SOBL 1FAKT 1CR9L 3QFDA 4PJ8C 4F15C 3KYAA 5LXGH 4XRCB 3GKZA 5J8OA 1B4RA 3QWOB 4PB0H 3CFIC 3HNVL 3O6LL 1KEGH 4XWGH 1P2CB 4ZFOA 3RA7L 3DI3B 3JWDC 5IFAH 3P9LB 2HJKA 2BRRL 5EPMA 4Z78A 3WXWL 3CZJA 3B9EA 2GAZA 5K33A 3SCMC 4LSRH 1N5AA 5I2IA 5J57B 3VD3A 4KRPC 4XNXL 4QXGL 4M7KL 1UQSB 1RJYA 4KTDH 1D5ZA 1U92B 5B39G 5E5MA 1JYXA 5ANME 5JHLL 3A6CH 4E5XA 4Y19A 3C5ZB 3NIFF 1GCFA 1TFHA 5MEPA 1EZVY 1HCFX 4MDIA 3KHOA 3WS3A 4MHHI 3RZCC 5I73C 1MQKH 1T1WA 4GS7B 5B38B 3IFNH 4EJ1C 1I8LC 4XAKE 5DD1H 4BZ2L 3ZHDA 4EI6A 1I1RA 1ZVYA 3KR3H 1BQUA 3JV4B 5F7LB 3UBXA 1HOCB 2R1WA 3HC3H 4PR5A 4DOHB 4UTBH 5C2BH 1U58B 1MIEL 3UPCA 5IMOB 4OM0L 2YPKA 1JGLH 4UIKL 4PJ9A 4ELMF 3CGTA 1G7QB 1EAPA 4G9FD 1AR1D 1D9KA 1IZJA 3WN5B 5I17A 3BKYL 1EXUA 2PCPA 4MNGA 4BK4A 3UAJD 2FATH 5C6PB 4YFEA 1NH6A 1MJ7H 2D31B 1F45A 4WI6A 4GAYB 5D2LF 2WSKA 3WL9B 2PR4L 4QY8A 3W11D 4FFWD 3D1MC 3NACH 4MS8C 5DMJB 3ARFD 3K2UH 4OFVA 1G7IA 3M17A 3L5IA 4LLYA 1U8NB 5B4MC 3QJHA 5FKPA 1DQML 4RA3A 3HZYB 1XCTA 2G75B 4XP9L 5DJ0A 4YDKL 3AREC 3SGEI 3TC9A 4FZEL 2WLZA 3TA3B 4UOW1 4DTGL 3WIFA 3ARBA 1KULA 3S3SA 5LGJA 1FVDA 1OP9A 1TIUA 3QEQD 4MQTB 1FNHA 4PY8I 5F1KC 3HCVA 3SE8H 5FB8B 5CZVH 3DX9A 2OS7A 3KJ6H 3EOTL 5C09B 4R8WH 5EA0L 4P2CG 4M6OH 2GJ6D 4CAGA 2VDRL 4G8FA 3HE7D 3LEXA 4QRRA 1LP9A 1B90A 3MTRA 4L8CA 1IGYA 4ZFZB 1NGWA 3O2VH 5E9DD 4KY1L 4XH2A 3V6FA 4Q6IA 4KPHL 1HKLL 2OQJB 4GLRH 2FX7L 2XPGB 4JZNA 5FYKL 1EJOL 1QR1A 1N7ML 3WIHH 3DX6B 2P5WA 1U42A 3WXVH 2DIBA 1N8ZB 4O5LH 4NKQB 4FNLH 4F9PA 5K9QG 4XPFL 4PRNA 4JQIL 3OR6A 4P4KD 3V4VH 4GUPB 3RKDC 4PV8B 3IJHB 1NMBL 4TSCL 1EVTC 4N1EA 5DEFB 1AGDB 1CVSC 43C9A 4NQDE 3UJJL 4XVSH 1R3KB 4APQC 1AGCB 2Q8BL 5JW4Q 3X13A 3ZO0A 3FMGL 3O0RL 5IJVA 1KN4H 3N1QC 4Q9QH 3LH2H 3U30C 4U6TA 2XKNA 4BH7B 2R23B 1A3QA 1JTOA 3VA6A 3BUTA 1A2YB 3IXTB 1RZKH 5DT1L 3DVGA 4JRYA 5HHOB 3JTTB 2FEEL 2ZCHL 5JIIA 2I60L 4P2OC 3ARGB 4ODXB 1J1PH 1J86A 2OJZH 2X4NA 4LCWB 3Q6FA 2YSSA 1DBJH 5E94A 4YHLL 4J3UA 4JFPB 4YAQA 1JNLL 2BVOB 5C0EB 3FAXA 3ZKMC 5KW9H 2XA3A 4NT6A 1FIGH 5IBTL 2EC9T 5F9AC 1UXWA 2X1WL 2FNBA 5D7IA 1NANH 2GJZB 4BSVB 2FH6A 3QFJE 4JZJC 1IARB 4JJ5A 3TVMD 3V8OA 4GJTB 3GKWH 1T80A 1OSPH 3EGSA 4KI5C 1EPFA 1D6VH 4JN1H 5ERWA 3U4BL 2D9QB 3D25A 3CFCH 4NRYA 4U4BA 3GHEL 3HI1A 3DHJA 1WITA 3NZHH 3I2CH 3L5JA 5T3ZE 5FECA 3TNMA 4OLEA 1KACB 4PRAA 4X6DB 3NCJH 1ZGLM 1HK6A 5ACZB 1B2WH 43CAA 4ZTOH 5ACMA 4W6YB 1A0QL 1B6DA 2CDGB 4NUJA 5IM7B 4OF5A 2BOBB 3GGWB 5F44A 4Z95L 1UEMA 4NNPL 1VACA 4FXGB 3P4LA 4HWBA 3TBSA 4YDVA 1QYGH 4WUUD 5FCSH 3CUPA 5DFVD 1ZLSL 1LO0H 5SWSE 2EEDA 1NC2A 3EYQD 1I3RA 4G8GD 2BDNL 4RISH 1Q9KB 2GSGB 3X17A 4WJ5B 2VZOA 5CIPA 5JO5B 3BEVB 5BJTA 3UZVB 1JK8A 1GXEA 2ITCA 1Q94A 3BD3A 2XFXB 5LQBH 4X80H 1FNLA 2CJUL 4CW1A 1KGCD 2VUYA 5KG9B 1FGVL 1GYAA 1UEYA 5SWQA 4LRIA 4JM2D 4G43B 1DCLA 2QBWA 2QL1A 3PDGA 2AK4D 3H0TA 3TBWB 1A7NL 4N8CL 4HMCA 1WBZA 4G8IB 5TF1L 1Z9LA 3KPSD 4LKCB 1UB6A 4QTIL 1AR2A 3TZVA 2NY5L 1A6WH 1YQVL 3E3QC 4FP8L 4N90D 4JRWA 4HGWB 5T3ZL 3VFVB 3LQZB 2CQVA 5HYJE 1T89C 3QJFB 5CKGA 5T5FH 4Y4FD 2DLGA 2APBA 2JK5B 4ISVB 4G9FB 3RBGA 4ZYKA 3ZDYE 3NFNB 5E00B 2KKQA 2P24B 3MRFA 1TQCB 3ARDD 2EXWC 3E6FB 1J05A 1VADA 1S9WB 3U7YH 1BBJB 1PD6A 2IQAB 1MI5D 4G7VL 5ITBH 4LFHG 3G9AB 1V3KA 1IKFH 1U93B 1ZT1B 1CDYA 1RZJH 3K8LA 4NCC2 4KJYB 3B9KA 4Z7OE 1G7MB 3CFJA 3ARFB 1WLHA 4B7LA 3T0DA 5DHXB 1O7SA 5I0DA 3MRCB 3QULB 4S1DD 4JKPH 1RVFH 1TITA 4NQSB 3FQNA 4AK1A 3CZFA 5EOCH 4JANA 2I24N 4LCCC 5JW4M 1IGTB 5C07A 1ZAGA 2XN9E 1BQHB 2QQKL 4Z7VA 1AD9B 5AWNH 5J6GB 1MFDL 4FXKA 3MX0A 3QUYC 5EUOF 5DZOA 4O51A 3STLA 2CK0L 1I9JL 3QEQB 4OFDA 3TFKC 1UB5A 3VG0H 1IC7L 5KAQF 4PY7A 5HHNA 1CFSB 1Q9WB 4NBZB 4LHUG 5IVZB 3CC5A 2GJ6B 5EB9A 4L3EE 1AGBB 1D5BB 3QWQB 3HE7B 4XGZB 5MHSD 3RWFA 2QQLH 4NM8L 5E8EA 3MYJB 2J6EH 1HH9A 5E9DB 1FL5B 3G5ZA 4H8WL 1BEYH 1C7TA 3HG1D 1OTSC 5K9JH 1SBSL 3EYSL 4J8RA 4KJPC 2DQCL 4ZG1A 1YPZB 3OX8B 2D03L 2R0LL 4P2QD 1MJUL 4PFEA 1MFEL 4ZUVA 3UTSD 5T1LD 5F96H 4ZS6D 5IBLD 4PTTA 3EDDA 4P4KB 3MLXH 1FFOA 1FJ1A 2BVUA 4P3DA 4Z76B 1CDHA 4P5KB 5FGBA 3GI8H 2FB4H 3VI3E 1MHCA 1P4BH 2EZ0D 4RGNC 5I75B 4U05A 4G80B 3MGOA 3BHBB 1NBZA 4I0PA 4IIQA 4TQEH 3SDXA 5C3LD 2XXMB 1QLRB 2M2DA 3TPUA 1INEH 5DR5L 4ORGB 2QADD 1WC7B 2Z91B 3NAAL 3MV8E 3TV3L 5K9KB 3MNZA 3PGFL 1HSAA 1UWXK 4HLZH 3QPQD 4NFBA 4I0KA 4DKEH 1JL8A 1EIBA 1I1AA 4EQ3A 3FB7A 3PHSA 2DDQH 4BUHA 3SGKC 1CGXA 1ZTXH 1UZ6E 2LU3A 5DWUH 2KH2B 3ZKSD 1U36A 3W2DH 1J0KA 3REVA 2ORBL 4HX1B 5LBSL 3THMH 1NPUA 1T0NB 1R24A 2A6JB 3FOLB 1OAYH 1KIUA 4ZNEE 1KYOJ 1KFAH 4WW2B 4YK4C 5GGSB 1G84A 4O4YH 3TVMB 1U6AH 2E5EA 5F7YC 3WNNA 4KHTH 3MC0A 3DOSA 4NPYB 4Y4HA 5FXCH 5F1NB 3EUUA 3GMNA 3MV9D 3O81A 2DWDA 4JDTL 1RMFL 4OSUH 4P57B 4MCZA 4ZODA 3L3HB 4EIZC 1QLEH 5CWSA 3GUTB 3LRSB 1I8KB 3G6DH 4UT6H 1LO5A 2F5AL 4L4TD 5CJ8A 1SBBA 4KKAC 1C7SA 4W6WB 4OLXL 4GAJH 5I18H 1XF4B 5CMAB 1FYTE 5CEYA 4KKBC 3P73A 4WFFE 3K4DA 4HK3J 4WUUB 1RJZB 1YN7B 1WQVT 1UFUA 3EYVB 2IQ9L 4XPAH 4G8GB 1SVZA 4JDZA 4P46A 3O45B 5EZIH 5HYQA 5JW5B 1GC1L 2OZ4A 3EFDH 2G2RA 5EN2A 4QLRA 1ONQB 3ZE2E 3K3QA 3BH8B 4FQQA 5HVGB 1A6ZA 3FO0H 2C4FU 3LIZL 5TDPA 3BXNB 4YNYA 4XMLL 3S98A 1WBYB 4MJ6A 3QZWB 4HJJH 1HKFA 2NCMA 3ZZ1A 3O6KL 4F7TA 3PJSA 5L6YL 4CMMA 4JM2B 1TPXB 4NKOB 3TO4A 2AK4B 3A67L 1FNAA 1HH6B 4YHOH 3T4AB 4HWEH 5IW6B 2MKLC 4LEOA 3MODH 1PLGL 3WNLA 3ZDYF 3VD9A 3BZEB 3OKMB 5DRXA 2FGWH 1VFOA 3TWCL 1HHHA 5EFIB 5CGMA 4NKMB 1HXMB 4D9QD 3Q1SH 4P5TD 4Y4FB 4R90L 2ARJA 4XHQA 1EFXA 1A4KB 3CFEA 1OTUC 3G5YA 3ARDB 3RWGA 3NGBB 4GG8A 2EH7L 5I1KL 5IQ7L 5A2LH 5FUCE 1MI5B 4YZFE 4PRHE 1GGCL 2C3VB 4XNZB 1MEXH 4HQQH 5F72S 1W8NA 4ZXBD 3KPQA 3P9MA 1L4IA 3HR5B 3GMLB 3SDAA 4WFGD 1AGEB 2X4RB 2YC1A 5AYUH 3N1MC 1LD9B 4LVNC 2D4FA 4NNYB 2EKJA 4NQVB 4ZUSB 2UZIH 5DC0A 2AV1A 1CQKA 4G7YH 2R2EA 4AYFA 1X5LA 1YEKL 2ADGA 1OAXL 4WEBH 1L0QA 1S7RA 1ITBB 5FFLA 1MQ8A 3B83A 1QFOA 4EUPH 4JFEE 5J3HD 5EORH 3MR9A 5BV7L 1FNEB 2DQUH 1OP3H 1BFVL 3SBWA 3DXAE 4QCIA 2BSRA 4IRSA 3V0AC 2FH8A 4C56D 2WBWB 3O9WC 3TEUA 4OT1L 1HIMH 1LO4H 3L6FA 5F6IC 2Y23A 4XCCL 1AFVH 4H5SB 5HYSA 3HTLX 3O4LD 4KI5D 3HMXA 3HG1B 1F3RB 1I9IH 5C0AE 5JHDA 4OLZL 3CFKA 2K1MA 3U0TB 1JGUL 3WSQL 4MGXA 2UWEA 2Y1VA 2MHAB 3V5KB 5HVWA 5KJRH 4P2QB 1BVKA 4N5EC 5IWLA 3UTSB 5T1LB 4F9PC 1HWGB 2W1NA 1SJXA 2ZSVB 2R0ZH 1W0WA 3S88H 1JZ5A 4HUXB 2HN7A 1AI1L 2DQEL 4GRMA 4D2NA 3MRNA 2EIZB 1E4JA 4FQLH 5IMKB 2ICWJ 2VC2L 3IJYB 4PTUB 1KPUB 1NAMH 1BWMA 3RWDB 2VERN 4YHPB 2GJJA 3DTXB 3ULVC 1JFQH 2VO5A 3V4PL 1T0PB 1G9ML 1I8IB 2AW2A 5JQ6H 5KS9B 4G3YH 1HINL 1I7UB 4XC3H 3BN3B 1F8TL 4I13B 4OLWL 4W81A 1A1NA 4LSVH 4MNQA 1WEJL 2QADB 1P4IH 3MNWB 2VKWA 3T3PE 4RRPA 5GRWA 3BT2H 4K7PL 5ENWA 3W5MA 1ZMYA 4L3CB 3BRGC 4YR6B 2R4RH 3LKRB 5HD8C 2XRAL 2JB6B 4OLVL 4NSKA 1EDQA 4DFIA 4M02A 5DHVH 3QUXD 3HZKA 4P0DA 4MD0B 3BD5A 4PJ5E 5IB1A 2EDNA 2PYED 1NCBH 2CMRH 2CSPA 3O6FC 4GMSH 4MQ7B 5I73B 4QHMB 3JTSB 5C7XL 4D0DB 3WUZA 2DBJA 4NFCA 1BP3B 2JB5H 5I19L 5I1GL 1QR4A 3MLZL 5HHXL 1PFCA 2EKSB 1E4KC 1MWAA 2P8LA 5JORB 5TE6L 1T6VN 1VFUA 2EDDA 3GO1H 4X8JB 2AXJA 1LQSR 1A6VH 2FR4A 5C6TH 2BHZA 2V6HA 3VWKD 3O6ML 1AP2B 1RUKH 4GXUN 1BOGA 3CDGA 4YX2H 3PWUB 3LQAL 1PQZB 4PGCB 5F6HJ 5C3TA 3MV9B 5EZOH 1GHFH 3KLDA 4ZS7L 3WFZA 4JO3L 3PP3K 3GNMH 3ARXA 3HI5H 1SEBA 2AXGA 3BWAA 2WW8A 1G7LB 2BNRD 2A38A 4RZCB 3RDTD 2HLFC 1NCDH 1K8IB 4QRSB 2C1OB 5DXWA 5J1AA 1V7ML 4H0GA 3BQUA 4NZUH 3MLUH 4L4TB 4DZBB 3NABL 5BXFB 5D1XC 3TCXA 2MKWA 3EFFB 3G6JA 4LRNH 3ZE2F 4LASL 5E4EC 4M7LT 1B4JH 2CRYA 4M3KB 1H3UA 5IESL 4HF5L 4MXWH 5GS2D 1ZVSA 5D7JA 1GAFH 1ED3B 1WIPA 4HJGA 4A6YL 4TULL 5K93A 5JXEC 4PD4J 3KPLA 1U3YA 3HE6D 2E7CA 1H15B 4HAFA 1AQKL 1LEIB 2NW3B 4HS3A 1ZVHA 4P5MB 4WV1B 3BP5B 3FFDB 5KSBA 4M7LH 4XMKL 4NC2B 3QUYD 4KZEL 4O2CA 3QQ4A 4ONHA 3NVQA 1KXVC 3KLSA 5DRWB 1YEJH 3RWJB 3ALPA 5IFHL 3MRIA 1BMGA 4BFIB 1WIUA 2JIXA 2BOCA 3SHSA 3GJEA 3GMPA 4M6ML 4KGLA 5B3NA 3LPWA 1KTLB 2VLKA 3EOAB 1AXIB 1BJ8A 3TNNA 1FZMA 3MRRB 3UCRA 3QUZA 2EDHA 1JE6A 2NY6D 1UJ3A 4P99A 3BZFA 4ZOAA 4OTXH 1GOFA 2CLRB 4W4OC 3TBVB 2HT4C 4XNMA 1XF5B 4P5TB 5I30L 3DRQA 5E6ZA 5D93B 3MLRH 1XEDA 4JFXB 4X5LA 5MEND 3MGTB 3CXDL 1G0YR 3ARZA 3EYOA 3C08L 3TJEL 4EXKA 3HAEG 1L6XA 5JMOC 5I1CH 2IBZX 3QHFL 4ZXBB 4F37F 2ATPB 2A6DA 4RQQA 4H88L 2VN7A 3RX5A 3CCHB 5DUBA 3IDNB 1N0LA 2VL4A 2HRPH 3V52L 5SWZA 3P3YA 3PHQB 4L9LA 3F5WB 3OKKB 5CHNB 2Y06H 3E2HC 3HI6H 5IROC 2E7MA 5E2WL 3ZL4H 1N3NA 4Q0XL 3DO7A 4HUWA 1J1OH 1IGIH 4YXHL 2KUTA 3QXDA 3QPXL 5A16B 3DNKA 4OCMC 4MYWB 2HFGL 4GW1A 4WTZG 1D6EB 1BOYA 2R0KL 5BVPH 1CE6A 4KHXH 5AD0A 2ADJA 4C56B 4XAWH 1MLBA 2DLHA 1PX4A 2NR6C 5FYLL 3IFLH 1KG0A 1KCSL 1G7PA 2EEBA 5HHVH 5B8CC 3S4SB 3O4LB 4HKBA 2ARJQ 4I9WD 2VE6A 4PJEA 1HQRB 3UYRH 1F3JA 1YY8B 3GMOB 4LHUA 5FGCE 3ILPA 2YD4A 3IVKB 5GSRB 3LDBC 5CKAA 3TT1H 4RMSA 3BPCB 4HPYH 4X4XA 3VFSB 4MDJB 3LKPB 2HRLA 3U9PH 4G6KH 1YJDC 1N2RB 4KKAD 5ADPL 4FMFA 1VGEL 4X99A 4LCWE 4M4RA 1MCHA 5C8JA 3QH3A 1JUFA 5JIPA 2OTUB 3INUH 3L3OB 5AEAA 3D18B 4PRPA 4YEFA 1FRGH 1NGQH 1Z3GH 4JG0H 1QP1A 1C08B 4IOIA 4BZ1L 2W38A 4KK8D 4JLRB 4F3FB 4Y19D 5D70H 3VWJA 4HUVB 4XPBL 5DK2A 4JGJA 1AY1L 3QXUA 3QXWA 4F33A 3QUXB 2EYTB 5D8JH 2VLLB 4YFLF 1F97A 5BZDA 2PYEB 4YHNA 5L8KB 3IF1B 1NDGA 3BP4B 1UCBL 4JY4B 1CFQA 4L4JA 5AYQA 1ORQA 3D9AL 2AXFB 5FYLD 3ZLQC 4MLIA 1IC4L 2W0FA 2E7BA 3MCLL 3LOWA 1UWGL 3MLYL 3RVXC 2NX5A 4PBVC 2ZOKB 2P46B 1NLDL 1CL7H 1X4XA 1A14L 2B1AH 4PJ9D 5GGTH 1D9KD 1C12A 1UACH 3DJ9A 3LVEA 3B8YA 5DQDL 2BNRB 2BSED 5H94B 3QR2A 3RDTB 2DKUA 3RWEB 1GGUA 2X4TA 3DGGB 1JV5A 3QNXA 3RKPA 1Z6JT 4NRXA 4CBPA 3Q48A 1BIIB 4DGIL 4U0QB 1CLOH 4HC1H 4NO3A 1MFAL 3LPGA 3QISA 5HGDA 3BJ91 1AD0B 3RY6C 1R0AH 1KTDA 5DZNA 1OPGL 4XTRC 4GXVL 5DRNA 1T1ZA 4J3TA 5HVFB 1TTUA 3P4NA 3N9GH 2MPAH 4RAHA 5GS1B 3T1FA 4LK4A 3HE6B 4K8RL 1ZWIB 1TTGA 3GSVA 3ARBD 3V0WL 2V9TA 4WI5A 1SMOA 2HFEA 3BMVA 4PJFE 3QUYB 4Q74A 4JY5L 4F58L 1X5FA 1QSZA 1I7ZB 5D7KD 2Y36L 4HAGA 25C8L 5EO1B 1S7SA 3VXRA 4KV5E 2B20A 5MP6H 2CIKA 4WNQB 1F4WL 3DUUA 3SKMB 1ODAA 4YQXL 1DDHB 4QHKI 4HH8A 4ZOEA 4QRRD 4H1LB 2M1KA 4MA7L 3VMNA 2Y5EA 4C57C 1WGOA 4KXZI 1FFNA 2NY6B 3QRGL 5FK9A 2ESVA 4Z18A 1RAMA 1XR8A 1TVHA 4YXLH 1K6QL 1IGJB 2HJLA 1QSEE 1OGTA 3PNWA 2P5WD 3P30L 3O3EB 1BZ7A 1JPSL 5MENB 4U6XA 3D0LB 4PJDB 2J88L 4LCUB 1S9KC 3R1GL 4XPTL 2C4XA 3D85A 2FDBP 4AT6B 3SQBA 1IQWL 1YNLH 1HYSC 1MAKA 3L9RA 1OWWA 4HCRH 3O3AA 2GJ6E 4U31A 1R3JB 4HWBL 5JPMA 3DIFB 1S7UB 4A6YB 1M7XA 1DLFL 4XPHL 3W82A 4PJCA 1FL6A 4I3GA 5HYIA 3NN8B 2DQDH 3G04B 1WJ3A 1KJ2L 4L5FL 4UDUA 2IADB 1AXTH 4JO4L 5DJZA 1KNOB 1YPZE 2R2HA 1R5WA 1NFDE 3QA3A 2APFA 4JRYD 4PGDA 5C9JB 3MJ7B 2VDQL 2FSEB 3PQYE 3T0EA 4PUBH 2CLVA 5TH2A 1I7RB 1A9BA 1I4FB 3SBWC 1JHTB 2EIDA 1JI2A 5J6HB 5EO0B 1S9VB 2RGSA 4OCSL 2EH8L 1B0RA 1VFBA 5JUEH 1XF2B 3RNQA 2YUVA 4U1SB 4UNTA 1D5MB 4URTB 4GO6B 1CXIA 4ODBD 3BE1L 2UV3A 5FM5M 3CSYB 4V1DA 4KVCH 4JG1H 2BNQE 1SJHA 4H20H 3FCTA 3FO1A 1UT9A 3ZHLA 4Z7WB 4Y5YB 4DW2H 3T77A 4FOMA 4KJQD 1YEEH 2YOCA 5FDYA 1OCWH 2AJUL 3ROLA 5T5NG 1A4JA 5ICXA 3VDBA 1YYLH 5KVFL 3QFDB 5GQBA 1YECL 4UBDC 5EIQA 4DZ8A 2ERJC 3MRBA 4LSSL 3UTTA 4ZFOB 2UYLA 4L8SA 2HJKB 3QEGH 1SM3H 2BJML 3ROOA 3UC0H 1CICA 4Z78B 2FLBT 1ES0A 2GAZB 4XWOC 5FO9A 3WFCH 1VGKA 1N5AB 1NC2D 1RZ8A 3SDDC 5I2IB 5I1IH 1WT5C 4LQFL 3ULUL 1RJYB 1D5ZB 5D2NC 5E5MB 4GRLA 3KPRA 4CU7A 3ARSA 4X6DF 2IH3A 4E5XB 1U8PA 4Y19B 5MEPB 2VQUA 3R4DA 3SJVE 2ZG3A 4MDIB 3MJ9A 3WS3B 5KSUA 3NPSC 2NXYD 2VXSH 1CFBA 1T1WB 2BMKA 2OL3A 2ZUQC 4XNQA 1VEMA 3T2NH 3U0WL 4EI6B 3C2AH 2MCPL 4XVTH 1F90H 4YDJA 2Y07L 4DVRH 5GISL 3S97C 4GXUM 1FAIL 4JFHD 3TZVD 2R1WB 3UBXB 5C0IA 4PR5B 4OCLC 1KLGA 4U0RC 4FQ1H 5DVOA 3VXPA 5TFSH 1OSZA 2XZCL 5KVEH 4H26A 2A83A 5IR1A 2E7LA 4PJ9B 1ACZA 1PW3A 2X4QA 4MA8L 1EAPB 2HVJA 1D9KB 2WQRA 4U1IA 2DB8A 5I17B 2BZDA 1EXUB 2PCPB 5DLMH 4MNGB 2ZCKL 4LSTH 4QTHA 4FG6C 1OAKH 3OKNB 2PYFA 4NWTH 3SE3A 1CN4A 2VDMH 1CGWA 1UJTA 1N0XL 2DQGL 3B9KD 4HPOL 2G60L 1JVKA 4NZJA 3M1BA 4KTEL 1G7IB 4KKNA 4WFEE 3LHPH 3M17B 1YA5A 1CXHA 4LLYB 3TYGL 3ULUD 2AK4E 3QJHB 3H2WA 3ELAT 4N0FB 4PJIE 5EWIL 1VFMA 3NMEA 1XCTB 1YNKH 3FFCE 5C07D 5DJ0B 1X5IA 1JNNH 4YUEH 1O7VA 4N90E 1XCQA 3STZA 3OHXA 4KV5F 4QRQA 2ATKA 4KQ3H 3HPLA 5D72H 3WIFB 3ARBB 1I3VA 1RZ7L 5IBUG 3F7QA 5LGJB 1FVDB 1IMHC 4CRPA 2H3NA 2BCKA 2YK1L 5DGQA 2VZTA 3HCVB 3DX9B 4M7JH 1F4XH 2C1PA 4JR9H 2W07A 4PJGE 1QRNA 2HVKA 3RVVC 4WGVB 3DSFH 3QXAA 4G8FB 3LEXB 4QRRB 3TN0A 4NZRL 1LP9B 1P7KA 4BJLA 1UM6H 1BD2E 1IGYB 5KVDL 5F6IB 1J12A 4L8CB 4RFNB 4XH2B 3WHE0 3V6FB 4Q6IB 3WNOA 4Y0GA 2XTJC 3P77A 1EBAA 4MMZC 2CO6B 1A7PL 4JZNB 2JCCB 4R4ND 5IEHA 4R97B 1QR1B 4YO0A 5E6IC 4Q9RL 1HE7A 2AJYH 2P5WB 3MNVA 5CJQL 1A3RL 3S35L 2GUOA 3CVHA 4JB9L 4BK5A 4PRNB 5J89A 3OR6B 4M00A 2J4WL 4K07A 2HMID 1PAMA 3QAZC 2FJFA 1SVCP 3D48R 1EMTH 4OV5A 1NL0H 4ENEC 5IEKA 1TQBC 1GZPA 4RFEA 3F6LA 43C9B 4XNYL 3SGDI 1GIGH 4DKFL 3KYKH 3U7AA 5EZJB 4I0PD 3N0PB 2OTWA 1YPZF 3X13B 5MHSE 1MH5A 5IJVB 3HUJE 3OPZH 5DUPL 4L8DA 2HJFA 4HMDA 1LGVA 2XKNB 3MSPA 3RU8L 3IDYB 4OGAC 5CINH 1I1AD 1EVUA 2MJWA 4BKLA 4HXBH 4EVNA 5SV4A 3DVGB 5KVGH 2V5SA 4ETQA 2N4IA 1FNGA 3B5GA 4JRYB 2B1HL 2R69H 1MFBH 1U8KA 1FNFA 1FDLH 5BRZA 2X4NB 3AVEA 4P48A 3Q6FB 2YSSB 3RIFK 3H7LA 1E4WH 1IAMA 4YBLC 5E94B 4AL8L 4YDLB 4YAQB 1OLLA 5ADOH 1YY9C 4WUKL 4NT6B 5E5UB 4LIQL 5E99L 4BYHA 3HNSH 1UXWB 5D7IB 1TETL 2VXQH 1GGYA 1RZGA 2W59A 1LE5A 1A7QH 4JJ5B 1I75A 4X7CC 3EGSB 1OP5H 3RTQA 4Y4HD 2Y7QA 1ZV5A 3WE6A 4UIMA 2A1WH 4UT9L 5BS0A 5ERWB 1P7HL 3D39E 1F4YH 3D25B 3S3JA 4NRYB 2ZUVA 3O2WL 4NQTA 3HI1B 3VRLF 4FQIL 5FECB 3TNMB 1IAIM 2WLYA 5C0FB 4PRAB 5E2UH 43CAB 1YYMH 2BXZA 4WW2F 1RZJC 3O6LH 4NUJB 3OKOA 4HUNB 4ZD3L 3RA7H 3RIAK 2QKIA 4X6CE 5TPWL 1VACB 4QHNA 3WXWH 3L3IA 4NWUL 3MYZA 5I1AA 3TBSB 3CUPB 4XNXH 1KLUA 4MQSB 4QXGH 1NC2B 1BVLA 1ORSA 1I3RB 2IBGA 4P46D 1UWEH 4IEFB 2CUHA 3MLVL 4XVJL 3HLAA 5CIPB 5BJTB 1JK8B 1UKTA 2AGJH 1AE6H 2ITCB 4MJIE 1Q94B 3UPAA 4CW1B 2E9BA 2NXYB 1KB9J 2P5EA 1KBGH 2W9EL 5SWQB 1RIHH 4Z7QE 1KB5L 3AY4A 5EC2A 4BZ2H 3JWDL 3TO4D 1JRHI 5FDWA 1AO7E 5IB5A 5GGRA 1MCPH 2EC9U 3V4UH 3H0TB 4JPKH 2VYRE 1XGQA 1UXSA 1WBZB 1UB6B 3F7VA 4UV7L 3TZVB 4X7SH 4KFZC 3O2DA 4JFFE 1BBDH 5DJAA 2AERT 1LE9A 2YUXA 4ZDHA 1PG7W 3HMXL 2XQBH 5GRYA 3BSZH 2DM2A 3BKYH 3QIUC 1EFXD 4Y7MA 1Q0YL 4ZYKB 1GVIA 2UVFA 1ZK9A 4M1GL 3I84A 3MRFB 3I6LD 5FUOH 1J05B 1VADB 4JM2F 1R3IL 3CNKA 2PR4H 4TOYL 5MI0C 2NYYD 5JLZA 2JJWA 3GSOA 1UVQA 3B9KB 3SDAD 3CFJB 2Q6WA 1P5VA 1GPOH 1RIVH 3HA0A 3JUZA 1QFWH 1DQMH 4OQTA 3QQNA 2R39A 3FQNB 3CZFB 4K7FA 4C59B 4YDKH 4JANB 4X4ME 32C2A 4HIIA 1WAAA 4NN5C 1ZHKA 4Z7VB 2FWOB 1DBML 3UJIH 4PJGF 2C9AA 1ND0B 2GTZA 5F93C 4XCEA 3FO2A 4RMTA 3FL7A 3QIWA 4FXKB 4IRJA 4MVBD 4O51B 3STLB 1UB5B 4ERSL 3DUSA 4PY7B 4BFEA 1JHKL 5HHNB 3R0NA 3ZSTA 5DJDA 4IRSD 2FL5A 3HRPA 3GMRA 3EKCA 4K3GA 4MB4A 3CC5B 1KCVL 4PJ7E 5DJ8A 1LHZA 4OKDA 3RWFB 3SE4A 1MWAL 4NOFA 5E8EB 2I07A 3WFDH 2AJZA 4HG4J 1A6AA 1HH9B 4OCNC 5I0ZA 1GJIA 1R5IA 2OP4L 3G5ZB 4HKXA 2CRIA 5C0GA 3ZTNL 2B5IC 3D3VA 5JHDD 4TNVF 3AB0B 4XBGA 4J8RB 1A7OH 2C5DC 4N9GA 1TZGL 4BA8A 3ZKNC 4D3CH 1OW0C 4ZUVB 4HXAL 4XPFH 1U8QA 1NSNL 4BFGA 1JZ4A 3GRWH 4PTTB 2I26N 1IGCH 2ZUXA 3VGEA 1NMBH 1FFOB 2PTUA 1FJ1B 4TSCH 2IJ0C 5I6XC 4P3DB 3JV0A 4UBDD 5IQ9A 2XZAH 1TMCB 1U2CA 4QRUA 1MHCB 2QSCH 5TE4L 1RFDL 3QDMA 2BRQA 5L0QC 1NBZB 4I0PB 4IIQB 2R9HD 3SDXB 1VCAA 3FMGH 3O0RH 1IJ9A 3S36L 2A77H 4MNQD 5E03A 3MNZB 1HSAB 1XMWA 3O4LE 4KI5E 2DMCA 1ZS8A 4YHYC 1A3LL 1I1AB 1P4LA 5MEOA 1I1FA 6FABL 4OF8A 2ZCHH 3FB7B 2DI8A 3VW3L 4P3WA 5C0NC 2I60H 4HLZG 4DAGL 2IGFH 4Z7UA 1MHHA 5BMFL 3PWJA 1SY6L 3RI5F 4I77L 4GQ9L 5KS9F 5IMLA 1R24B 4ONGL 3NCFB 3GJFH 5LCVL 5T1MA 1XGPA 2EE3A 5HGGS 1MF2L 2W60A 2ED7A 4NQCE 1NEUA 3CFDA 2DBLH 4OM1H 2VDKL 5E1HB 1NJ9A 2XZZA 4WEMB 4Y4HB 4OFIA 4X5WA 3GMNB 3ZDZF 1HWHB 4S1RL 4Z8FL 2DWDB 4AEIL 5I66A 3IU3A 3QG7L 2EE6A 4MCZB 1Z0NA 5CWSB 3RL2A 3B9VA 1LO5B 4XCNA 3BQUD 4PJAE 4Z95H 4NNPH 2AI0L 4EN3A 4Z77A 2NY7L 2Q7YA 3NCBB 1DANT 5CEYB 1K9TA 3C5JA 2JLLA 3P73B 5DJ2A 5EC1A 3QQ3A 2BDNH 2VDPL 5KAQG 5D7JD 3BN9C 5HGAA 3SGJA 4P46B 4JDZB 4Q58C 5HYQB 5E8PA 3VCLA 3WS6A 1R3HA 1FCGA 3AROA 3QCTH 3E3QE 2G2RB 5EN2B 4Y89A 3MRHA 1J88A 4M48H 1WBXA 2XQYK 4FQQB 1FZKA 3QIBC 1A6ZB 5I8CA 5ITFA 2A73B 5TDPB 1TVBA 4YNYB 1EZVX 2VLJA 3AC0A 5J9PA 4MAUH 1Z5LA 4MJ6B 3LPFA 5D5MA 2R29H 4F7TB 2VLMD 5EBLA 1O0VA 3HC4H 4CMMB 3VFUA 2F53A 4LLVA 3W81A 3TO4B 1T21A 1A7NH 2UUDK 4LP4A 4N8CH 5BVJA 1IEBB 2JIXD 4LMQE 4ZFFA 1C5CL 3TPKA 4LEOB 4LOUC 1YQVH 4CVWA 1MLCA 2VLKD 3QUZD 3U4AA 4MA1C 3MOAH 5DRXB 3MV7A 4DFHA 5CCKL 5AZ2L 3QUMA 1HHHB 3DVIA 1IEHA 3VFPA 1SYSA 4CDGC 4XB7A 1WCBA 2ARJB 4M9OA 1EFXB 3CFEB 5DQ9A 3G5YB 3FQTA 4J7RA 1MNUH 3RWGB 3BRFA