2NNAB

Structure of the mhc class ii molecule hla-dq8 bound with a deamidated gluten peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
182
Chain Sequence
GSRDSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II antigen
publication title A structural and immunological basis for the role of human leukocyte antigen DQ8 in celiac disease
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 182
sequence length 192
ec nomenclature
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nnaB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2nnaB01
3AREB 1ZHKA 3U1SL 3V0VB 5FO8B 1HILA 1UEYA 4P9MH 3DRTB 4Y1AE 3PWPE 1HE7A 5GGQH 2Y6SD 2BSSA 5L2KA 3V52L 1DQDL 3KGRA 1D5IL 1OGTA 3P0YH 2F8XC 4GFTB 1M7DB 1NAMH 4HUWB 4JM2D 4CMHC 4TTGA 3QBTB 3CPLB 1WFOA 4Z7UA 2VDOL 3SE8L 4FQIH 4JZNB 4GUPB 4HG4K 5F72S 3FT4B 5J8OA 1JPGB 3FO0H 4ZFFB 4LAQL 1E6JH 3VFGH 5SV4A 3O2VL 3TNNB 5FGCB 5F71A 5F1IB 3BP4A 2BHZA 1TJGH 4YDVA 1CFNA 2ICWJ 1NPUA 3QPQC 3EIFA 3GM0A 1AKJD 1KIRB 1I85A 5I19H 3QEUB 3WNKA 2Z8WC 3U0TA 3GSXB 5IKCA 4J23A 2QQKL 3GSOA 4JM4H 4U6YB 3MRIB 2GSIA 3RTQA 5FGRA 3UTPD 3MO1A 1D6VH 4TSAL 3QJHB 3KYMB 2PTTB 4JQVA 4NPYA 2A83B 1X9QA 4QGYA 4YAQA 4X7DC 1PEZA 3WO4B 4LKXB 2ZOKA 1DE4B 1YMME 2WBJB 5JPMB 2A77H 3IYLW 2HLAB 2CKBA 5MEOA 3ZKXC 4APQB 3MJGX 5GSVA 3QUXA 1FJ1A 3EW3B 3ZDZE 4CU8A 2IMMA 3GBNL 4G6FD 3WFCL 4RBPH 4QT5B 3MV7D 3GB7A 2E9BA 4NN5B 1M4KA 2OXHA 5IMLB 3AROA 2WWKT 3UPCA 1TLKA 4NBZB 4FA8A 4JHAL 3MZTA 3G5YB 1N6QL 3BWAB 1S8DB 1JGLH 2CR3A 5SWSE 1RURH 5I2IB 3U6RA 4XC3H 4K94L 4D94A 5C71A 4NFDA 3QRFM 5FAAA 5IHUL 1N6UA 5T1LD 3RKDD 2NXZC 3QJFB 2Z8RA 2WIMA 1ODAA 3AFLA 1DLHB 4R4BB 5EOCH 4M48L 3J8F7 4M6NL 2IPKB 2VXUH 3DIFB 4OZGF 1FZJA 2DI8A 3VGBA 4JVUA 1LWRA 1CD8A 4Z0XA 1A6WL 1FDLH 1MFAL 3G6DH 1RZIB 5F6HJ 5KSAD 3GUTB 1T0NA 1W8NA 2WP3T 4FZEH 4G8EA 4KKLD 1HQRB 3RVUD 1SYVA 1G9MH 5BS0A 3T08A 1R24A 1DL7H 4GW5A 4M7KH 2AQ1A 3OR7B 5L7XL 4XP4H 1TCRB 5C0CD 1PQZB 3M45A 5B38G 2DYPB 4QRPE 1NL0L 5E8OB 3U36A 1KULA 5I1KL 3GBMH 2HTKD 4K3DH 4LGRB 4X0KB 5C2BH 5CLWA 1KEMH 4RQQB 3D0VA 2DQTL 3RP1A 4M1DH 3SDCA 3SGJA 3ZLQC 1F90L 3P77A 3A67H 3RX5A 5I1AB 1T1XA 2BOCB 3MBEA 4OTXL 5D1QB 5LWYH 3DX6B 1PLGL 2V7HB 1CVSC 3GSNB 3F5WA 2RIKA 1IM9A 5CHNB 4WW2F 4EI5D 1OAKL 1IAIM 4XWOC 2BRQA 2MJWA 3E8UH 2OR9L 4XVSH 4YLQT 3DURA 4JRXB 1IGYA 2HP4A 3E0GA 2J8HA 3MUHL 4F9LC 3FCTA 1P2CB 1CL7H 1JHTA 1EO8L 4LLQB 1BP3B 3FRUA 4HV8A 5DJZA 3HPLA 2CLZB 4FQJH 4EI6A 3MGOA 4HFUH 1BZQK 3DVGB 4OLUH 3X13A 1T5WA 2VDPH 2PYFB 1ACZA 3CSBA 4XXCC 4G42B 1JWMA 3QI9A 4RGNE 4OZIF 5E00A 3FN3A 4LCWB 3B9KD 1GIGH 1X5YA 2X6MA 3KLHD 1MUJA 3KYOA 3TT3L 1ADQH 4WCYL 3JV6B 4D3CL 3RUGB 4YO0A 5MERA 1YEIL 2X4NA 3C6LC 3KPTA 3P0VL 4KK8D 2VDML 3NTCL 1PAMA 1QEWA 2DQUH 4NQXB 2GT9A 4G80B 1H3PL 3FJTA 2NY6D 2PCPB 3LQAC 4P5MB 5I8OH 4QHNB 3L3KA 5IQ7L 3LN9A 5DHYA 5MENE 3O9WD 4FTVD 3D85A 2AK4E 3DSNA 2QR0A 2QSCH 3VXSE 3CFBB 3CSPA 2QQLL 1IQWH 1I1AB 1L0YA 2WM0A 1EXUA 4JO4H 3EYUL 1OQXA 1N3NB 4ZAKA 4PJBF 4I0PA 5EB9A 3GSWB 4X6FB 3GJFA 2V2XB 5EO0B 1GOHA 2NY1C 3H3PL 5IOPB 4PRBB 4Y5XA 3GMPB 5E08L 4OF8A 3I75A 3AS1A 4GMTH 4Z7QE 5KSBA 1NUDA 3MRFB 5C6PB 1NMAH 4JFFE 5BXFB 4TUOA 2EEBA 1II4E 1IEBB 3H0TA 4MAYA 5LJYH 1BF8A 1WT5A 2I25N 3MRMB 1X5IA 5KVFH 5AYUL 4PYHA 3NAAH 2I9TA 4FXLA 2IH1A 5I0DA 1QFWH 2EXYC 2H9GB 4PJ9B 1ZANH 4TYUA 2BY0A 4U1LA 2EO9A 2BDNH 1MCKA 3KWWA 1JNHA 4WO4D 2H26A 4Z5RB 5IWLA 1OW0C 5C0JB 2XTJD 1NMCC 1DVFB 4Y4KA 3JV5A 5H37H 4DEPC 1S3KH 1YYLL 4HBQA 4QXTA 4LEOA 1YA5A 3ETBF 1RIHH 5GGSY 5T3ZH 4DW2L 2XQBL 3LKQA 2IG2H 2FIKB 3UJIL 2HFTA 4LNRB 4J1UA 5C0ND 5HYJB 3VGDA 2X7LB 3HG1A 4I48B 4HQQH 5C7XH 5TFSL 2XQYG 4K8RH 3G9AB 3VD5A 2IAMC 4KHXH 1X5JA 3RNQA 5EBLA 3K1DA 1AHWB 2A0LC 3QDJA 4EJ1C 2P45B 2W9LA 2HT2C 4JKPL 5HYQB 4I3SL 3QAZC 4A6YA 1WV7T 3CMOH 4NNPL 4XX1E 1U93B 5E9DD 3TVMB 2FZ3A 1UWGH 2GY5A 2VLKD 3IJSA 1X5FA 1V3KA 5FYLE 5SX5H 3JUYA 1KTDA 2AXHA 3VXQB 1A5FL 3U7WL 3MV8E 4NRZA 5E6ZA 1H8SA 5AD0B 3MYJA 3ALPA 5D7IF 1OSZB 4QY8A 2QBWA 4U0QB 4PGBB 3BFOA 1W0VB 5DJCA 4YHKL 4O2EB 1GGIH 4HJJH 3MLRH 3IGAB 2F5BH 3NCJH 3Q5YA 2X10A 5FHBH 4JVPA 4KJPD 4Y4HB 3L7FA 3ROLB 3SE9L 2D0FA 5E8PB 4C59B 1K5NA 1B4JL 3SDXF 1HCVA 4Q2ZA 3EDDA 2Y06L 5DMIH 3MOBH 3STZB 4D0BA 4JPKL 4NRXA 3V7AG 4C83A 4G5ZL 3SBWA 4D0DB 1NC4D 2GJZB 2N56A 2XICA 3S34L 2X09A 1I7RA 2Q8AH 5DD1H 4OGXL 4OZFA 3BP7A 3ORJA 1CGUA 3UJJH 1MJJB 1EUTA 5T3ZD 3QIBB 4XMLL 4HT1L 4HK3N 5C0EA 5DK0B 2Q20A 4EDWH 5GIRA 1I7UB 4HEME 3PWNB 4DAGL 3MV9B 1WBZA 3NIFE 3QNXB 2ADIA 1AGEA 4KJQD 3WNMA 5IFJA 4YXKH 1QRNB 1HCFX 3HR5B 4PRIB 1OCWH 4FXKB 1FRGH 5F1NA 4NQDA 1PZUB 5CJQL 4PJ7B 4U3XA 4WEMB 4JPVL 1DN2A 1CGXA 1P1ZB 4NC0B 4I5BA 1AI1L 1J1OH 1ONQB 2A1WH 4BFIA 3QFDA 4NHUB 3JWOH 1R5VB 1UT9A 4YHLH 2GUOB 5HHOB 4Y5YB 2DQFB 5DRWA 5KANI 4LARL 4RFEB 4HF5H 4XXDB 5GGRB 5J6HA 4P57A 3MA7B 2Y25A 4NDMB 1FZOA 4MSWA 4FS0A 1C5DA 4K8RC 5HYIA 4XCCH 4KTEH 4LCUB 4G43B 5INDB 1L0XA 3VGHA 4PJCB 4XPFH 1OL0A 4JZOB 5IB2A 5E0QA 3LKOA 1FFRA 1JE6A 3NGBC 4K23L 1IC5H 1G7HA 1CF8H 2OM5A 3NFSL 4FP8H 4PREA 3DVIA 5ILTH 3VXME 3MZGB 2Y5TB 2G60L 1CFVL 1OAYL 1KTLB 4H1LA 5LQBL 2EH7H 2W65A 1WEJH 5KS9F 4ODHH 1Q9KA 1SJEB 3GKWL 4N0UA 1YN7B 4KPHH 2A6KA 4P5KB 5HDQL 1OSPL 1DBBL 3S96B 2PF6A 1NKOA 1KCLA 2PR4H 4MNGA 1PYWA 4JRYA 4IMKC 4Z7VA 4MQ7A 3IS1X 1G7JA 3NIDF 4OD2B 2R2HA 3OB0H 1U8QB 1B6UA 4OT1L 3RU8H 4Z77A 4P2RE 3SDYL 5FYJL 3GMRB 2X9WA 4R2GD 3UX9B 1J8HD 4MA8H 1LO4L 4WTZA 3OV6A 4NIKB 5JNYA 1BMGA 1HWGB 5FYKD 3MFFB 3PF2A 4XCEB 1KSRA 1KUMA 5KAQG 1BQHA 4ODWA 3DX9A 4QHLB 1RUML 2B1AH 3EJJX 5I73C 2RQ8A 5F21B 4D2NA 3ECBB 1FG2A 1B0GA 2F8OA 1OAXL 4EEEA 5HPOA 3FQTA 3K7UA 2WLYA 1D9KD 4MGXA 3STLA 3JTTA 5BW7A 4MJIB 3PL6C 2LU4A 5M7QA 4N90E 5HYFA 1C7TA 3FZUD 3DV4A 4MA3A 4OI9A 4PJAE 1NFIA 4LPTA 5GZOD 1F11B 1CXEA 2HWZL 2XOTA 3C87A 3AGVA 1QKZL 2BY3A 2NTFA 1ED3B 4LCYA 4DQOL 2BNRA 3JWOC 1IQDB 5ITBH 3LKRB 5E94A 3O4OC 1FL6A 1AKJB 1H3GA 2DBLH 3TP4A 3U79A 2E6PA 3H3BC 1QO3B 2P8PB 3T3PE 1XMWA 5I15L 5D7JC 1BVLA 4JY6A 4DUXA 2Q76B 4GSDH 1REIA 4X6DE 3MMEA 3S37X 5C09B 4C58B 5JORB 4U7MA 1ZVHA 1MFDH 4QXUH 1RUKH 1LP9E 3I6KA 4L8SC 2APBA 4LSRL 5C07E 2EDOA 3MLSH 4JJ5A 2B8OT 4PJIB 3ZE1E 2X42A 2VZSA 3FHAA 2FJGB 1RZFL 3MJ9H 1XF2B 4ZYKB 4U05A 4PRPB 1U58A 3BKML 2VXVH 3E2HB 5CAYB 3WHE0 3HE7A 1GL4B 2OXGA 4U6XA 2J6EL 3QH3B 3QWRA 1G84A 1NCDL 1CIDA 4U1GB 3TCLB 2IPTH 4CADA 1V7MH 3BP5A 1S7XA 3HUJF 1IGFL 4JN2B 4HMCA 4OM0L 4UT7H 3MV7B 2ARWA 1EH9A 1F8TH 3X3GL 5IHZB 2DQHH 3VXPA 3TZVA 4F15C 5E8DH 3CX5J 4OFYA 4Z7UF 4B7IA 4OLYH 2YK1H 1DQMH 5CBAB 1JBJA 4O5LH 3B2UD 2WUCH 4NQCA 2APVA 2D7OA 2MHAB 4XNZC 1U2HA 5DWUH 5HHPB 1IGTB 5B38A 1OWRM 2UV3A 1LO5B 4BKLB 5DURB 1BFVH 3KPOB 5T1LB 2G9HB 2Q8BL 4PP1C 3FN9A 2CMRL 4RCAA 5DRNA 5LBSL 2OR7A 3BQUA 5D2LA 5EO1A 1X5LA 5JLZA 3ZYIA 3KJ4B 1HHIA 4PRAA 3PNWA 3QHZL 4CW1A 1R3LB 1A1NB 1KEGH 2ZUYA 5KSAB 1RZ8A 2F58L 4CVXA 2XTLA 2W1NA 3RL1A 3CJJA 2IH3A 4HKBB 4LFHG 4S1RL 1IKFH 3EHBD 1P84J 1DEDA 1U95A 4NO2A 4ZD3H 3BI9X 5E2UL 3K4AA 3TH4T 3LH2H 1FBIH 5C0IB 1FZMA 3IFNL 1YMMD 5C0CB 4PY8J 2FBJH 3SGEH 2UZXB 4R26L 3VFPB 4WIQA 1QBMH 3GJEA 1BOYA 4JPIB 3UTQA 3T0BA 4XBEL 2R8SL 1PJ9A 1CG9B 3IETA 1A7RL 5TF1L 3QHTC 1OTSD 3FO1A 1XH3B 3C8KB 4XWGH 5E4EB 1MFNA 5D5MF 1QFWM 5DA0B 6FABL 3FFDA 2E7LC 1JIBA 2HAZA 5SWSD 1MI5A 2IALB 1MCEA 4WWKD 3WFBL 4EI5B 3TGXA 2DN7A 3C6LB 2RCSL 4DGIH 4BH8A 2VH5L 5EU3A 1CT8B 3TV3L 4XC1L 1I9EA 3QDGA 4LHQB 3O8XA 1P4IH 4JO2L 1WISA 1G9NC 4MXWH 4AEFA 5F3HB 2DQEH 5IBLC 2X1WL 4GBXD 4WEBH 3P3YA 3DGCR 4X8XA 3V7MA 1CFQA 4G9FA 3OAUL 5DJDB 4S1QL 1ZVSA 2VL5A 2E6JA 4L9LA 2B4CH 3BW9A 3CZFB 5ICYB 1MJ8L 2DIBA 4K3HA 3MRDA 3B9KB 1MHCB 2NY1B 2V17H 5ELIA 2OJZH 1MNUL 4XBGB 1EHAA 2EXWD 1KLUB 1UVQA 3HNTL 2W0FB 5GGUB 4DCQA 2NLJB 4H88L 1UZ8B 3QA3B 3MJ7A 2AJUL 2ADGB 5B39A 5EWIH 4MLIA 5ITFB 3AREA 3FQNB 3O3DB 4QRPD 1KXTB 3O9WB 3VCLB 4FTVB 5C0GB 3V0VA 3DRTA 1VHPA 3I3EA 3FHQA 3PWJB 4R90H 4CDHA 2EDRA 4Q0XH 1CI5A 1S5IH 4P2YA 4HUWA 4LPUA 3QO0A 4YJZL 3BH9B 4KAQL 5IMKB 1MIML 3OXSB 5CWSB 4N0YH 2DKUA 4JZNA 4H0IA 3FT4A 4GRLC 3U48A 5T1MA 5AUMB 2HT4C 4ZFFA 2B20A 2NXYC 5TQ2L 1YPZB 5F1IA 5F7EL 1EEYB 1WK0A 1ZLWH 2IAMB 4MA1C 2NY4C 3VXUA 1X5ZA 1Z3GH 2H3NA 5I1JH 1IM3A 1JF1A 2BMKA 4OD3H 1A7PL 3KXFE 2P8MA 3MXVH 3QAZB 4EXPX 5JW3L 1LE9B 5J89A 2YA0A 1P53A 4LRIA 4ZTPL 5T1KD 4RGND 3VD7A 4FABL 3MLZL 4KROD 4WO4B 3BIBX 1G7LB 3TA3D 2XTJB 1MCHA 4UQ3A 3QJHA 3ZKSD 2PTTA 2JELL 4NOFA 5I74B 2MCPH 4ZOEA 4YBQD 4NO5A 2UZIH 4LKXA 3ARTA 3KLDA 1DE4A 2WBJA 5JPMA 2HLAA 2W9EH 4HH8A 4YDLC 4FQQB 3V6FB 3CC5B 2VISB 5F1OB 4TNWK 5MEND 5ANME 1R0AH 1LEKA 1EMTH 2AK4D 1IKNA 3BJ91 2YD8A 4XNUH 4YDIL 5JXEC 1I1FA 3VXSD 2V2TA 1RZGB 2VZTA 1NFDE 5IMLA 1IEAB 2FHFA 3V6ZB 4LVEA 2R2BB 1LEGA 2B4CC 3BWAA 4KY1L 4XPBH 1S8DA 5E9DB 5FYLH 3DRQB 2VLKB 5I2IA 5KSBF 4G8IA 2R4SH 3QULA 3KVQA 4UT9L 4K3JL 5IB1B 5GS3A 4JZJA 1UCBL 1KF9B 5DSCB 4Y4FC 1FNGB 1VA9A 2CDFB 5KVEL 1FIGH 4QNPF 1JTPA 3QFJD 4ZNEE 4JFFD 3OX8B 4NC1E 2A9NL 5DUBB 4PD4K 2OI9B 4PB9L 1KJVB 2DWEB 5HHXL 2F19H 4NO3B 5I75B 1DSFH 4KDWA 2IPKA 3DIFA 5ALBL 3TJHC 4HS3B 1U8IB 4M4RA 1SM3H 4PRHB 2DKMA 3D48R 1WICA 4W4NA 5F8QC 5L2KE 4J4PD 5EORL 3QUMH 4G9DB 1HQRA 1NC4B 2DM2A 4NNYB 4MYWB 3RVXC 4U3CA 5DJ8A 3IF1A 4P23A 2BSTB 5TDPB 1EHNA 4IS6A 2R1WA 3T8XA 1K3IA 4QRUB 3F7RA 2W91A 4LK4A 3UDWC 1I8KA 5EUOA 4Z7OF 4XP1L 2NR6C 1ZLVK 3L95A 1KPRB 4LLVB 4FMKA 1PQZA 1DBML 3P2TA 1JUFB 2JK5B 1IGIL 3R0MA 5E8OA 2H8PB 3B3IA 3E6FB 2EDWA 4X0KA 1CK0H 4YBLC 3NGBB 4V2CB 5CGMA 4JR9L 3IAPA 5HDLA 3RY6A 5I1AA 2DWDB 4M8QB 5JXAH 3W5NA 3U46B 4YZFE 3OAZK 3MLVL 3RWGA 1OWWA 3DX6A 3I2CL 2DQGL 4TULH 5CGYC 2FEDC 1N8ZA 4CUCA 4GKSB 1W72H 1HH6B 4JRXA 1XR9B 1AGCB 2HJFB 5IW3A 7FABL 1NLBL 1YJDC 4PJGE 1U92A 4BH7B 2YZ8A 3A6OA 2YHGA 4HIEB 1DANU 3DVGA 1K6QL 2HVJA 4PJ8D 1N5YH 2PYFA 2XN9E 4OGYL 4U1NB 5E95B 4G42A 4LSVH 1C1EL 5BQ7B 1U6AH 5J1AB 1YY8A 4YUEH 1ZLSL 1TVHB 5FF6B 3OG6B 5HHNB 4AL8L 5C6TH 3CIQA 4HD9A 5JR1H 3WFEH 1NBVH 2XQYK 5I73B 4WU7A 5FB8B 4OGAC 4O4YL 1UB5B 4G80A 1CGYA 3NN8B 4P5MA 1HOCA 4KGLA 2R9HD 4DGYH 3QIUD 4JG1L 3T09A 3PL6B 4LSSH 5TE4L 5DO2D 4ZUTB 2J6EA 3V0AC 4FZ8H 3C09B 3F8UB 1I1AA 4KHTL 3WDHA 4R2GB 3B8YA 4WJ5A 1LO0L 3Q48A 1IMHC 4O2CA 4Z7WE 4LSPL 3GSWA 1ZT7B 2L7JA 2V2XA 4HC1H 2YS4A 5IOPA 5BS0E 3ZTJG 4ODXA 2ZCLL 3EGSB 5IB4A 1VFMA 1EJ6A 3DYOA 4WHTB 1F5WA 3CVHB 1JZ4A 5JW4Q 4UDUA 4YGAB 5FCUL 3RWIB 3SEPA 5BXFA 4FG6D 4LIQL 3T0DA 4LF3B 2D31B 5IT2H 1TQBC 3MRMA 1C08A 4M7JH 4O00A 4PV9A 3DUUA 1F4WH 3X3FL 2H9GA 4PJ9A 3WXVH 2UYLA 3BPNC 2PYEA 4UOW1 4HLJA 3K2MC 4Z5RA 4X6BA 2C4XA 2EDFA 4HWNA 3RWHB 5IESH 2Y07H 3VXMD 4WW1A 1QYGH 3MODH 4KK5C 3FQUA 4ELME 4HXBL 1PG7L 1S7RA 3VFTB 5FUOL 2FIKA 5J13C 3MRNA 2P46B 4Z7VF 2H2PD 1IC7L 1YMHB 3QPXL 4PLJC 5KZCB 1ZSDB 4L5FH 5GRJL 2H1PH 5E8NB 5AWNL 1S7QA 1MFEH 1AHWA 3LV3A 2XPGB 5D9SA 5DJAB 5EZLB 1P7QA 1FVCB 3HMXL 3TC9A 1NGXB 1JI1A 1K4DA 4OQTH 5HHME 3IAQA 1RK1A 5LCVL 4RRPG 4P48A 1T04B 4GAJH 5I9QB 3RL2A 1NANI 1P6AB 2J8UA 3OPZH 3V4VH 1MRDH 1OSZA 4S10A 4ODVL 4TOYL 1W0VA 3C5ZA 2F74A 4WW2C 2BVPA 3EZJB 3HTLX 3DPBA 3IGAA 2IQ9H 4TSBL 3VI4E 1J0YA 2CK0H 3OJ2C 1TZGL 4I2XA 5EU4B 4HKZB 3ROLA 4PP2A 4Y2DD 1T89C 5E8PA 4N8PA 4Y1AB 1G6RL 3PWPB 4N90D 3QQ9C 1NCWL 5SX4I 2O5XL 4WRLA 3LPFA 4QRTB 3CGTA 3STZA 3P9WB 5TGBB 5AAMA 4UUJB 4LPXA 4D0DA 2ZKHH 3TM6A 4MD4B 2HLFD 1JMZA 3KPSE 1JHLH 1AR1C 4YX2L 4TTDD 1NBYA 1NLDL 5E99H 1A14H 4N5ED 4LSQL 5DK0A 1S7VB 3LRHA 1I7UA 3CU1A 4KUCD 3PWNA 3MV9A 4HHAB 2XNAA 3QG7L 5CSGA 1WCBA 5KTEL 5JW4M 4PRIA 4QF1A 5F7WC 5DDHA 2PW2B 1J0HA 4MB3A 5EBWB 4JG0H 4PJ7A 1NBZB 1QLFB 3RDTC 1CZ8L 4S2SB 5JW5B 5C07D 3ROOB 1RUQL 2I26N 1DEEB 4DN3H 1G0XA 5I8KH 3IAGC 4NHUA 3ARRA 2XT1B 3QWOB 3CCHB 5HHOA 1A2YA 3ULUE 5DK2B 2DQFA 4MNHA 5L8JB 2CSPA 1RAMA 4RISH 2AJXL 3EOAB 3MNVA 2GJ6D 1EHLL 3IKKA 3GIVA 1YMMB 2DLGA 2NYYC 3D69B 3ARDC 2VN4A 3MA7A 4ONFL 3BUYB 4NDMA 4X9BA 2DJ4A 2UVEA 3K81A 2R15A 2RJMA 2BHYA 1F45A 2YUVA 1INDH 3AU1A 4IRSD 4LCUA 4OFKA 5INDA 3QDJE 3REVB 1JPFB 2BVUA 2YOCA 4YXHH 4MCZA 3EYQD 1P4BH 1DQTA 4U0RB 1SBSL 4QHUB 5HD8D 4WWKB 4DTGL 5TE7L 3VMOA 4OCSL 2IMNA 4CKVX 4IBLT 2ICWA 1DBAH 4PJDA 4TNWF 5D7SL 4UAOC 3AB0C 4LRNL 3BN9C 1SBBA 1B2WH 2IANA 4P5KA 1EJOL 3FO2A 4L3EE 3IDYB 2ZG2A 1IGCH 3ZT5A 3A0OA 3F58L 5T1DL 5FM5O 1OAZH 2VIRB 4Z95L 3GSUB 3BE1H 2FWOA 4HH9B 5J3HD 4NJAL 2ENSA 3HC4L 3OR6B 4JO3L 4C57C 2MKWA 4XHJC 3G08B 3HFMH 1H15B 1VEMA 3VA6A 1YEHL 3FB5A 3T4AB 5F7FA 2AEPL 3MFFA 3MXWL 4XCEA 2FB4H 4X8JA 5JPNB 1YQVH 4XTRD 1EFQA 2NXYB 4BZ1L 2FHBA 5E56A 3S36L 3JWDH 4KRLB 1MJ7L 2PXYA 4BUGA 1FO0L 1H9VA 1SJVA 2GTZB 4MA1B 4IIQC 2CLRA 2DBJA 5CILL 1CE6B 3ZDYF 4PTTB 3RIFK 3MCLL 4BK5A 1GXEA 3TO4C 2COQA 1HDMB 4ODSL 4UZGA 1TETH 3BWUC 3INUL 4QRPB 2AV7B 2B39A 1RUAL 1HXYA 4QXGL 2FJHB 3KLAB 3SOBH 3LD8C 1TPXC 1QFHA 1TIUA 2J1KA 1WIOA 3MNWA 1MCWM 1M1SA 32C2A 4NQDE 2DI9A 4JM2A 3U82B 3QUZD 1WLHA 5LXGH 5BV7B 4FFYH 3C6SB 2CUIA 5GISH 4JFZL 3TCXA 3Q6GH 4D8PA 1ES0B 3LAFA 4CVZA 3ARFD 3H9SB 4O58H 1YNKL 5HY9B 5KBNC 1AKJA 3IFPB 5GGTH 1DQJB 3KYKL 3S97C 2VLME 5IG7A 1T6WA 2Q76A 5H94A 4X5XB 4OM1L 1KCUH 4ZUUA 5T1KB 5JORA 1XGQB 2BSRA 4RGNB 4FOMA 1U8MB 5DR5H 4KROB 2Z93A 3DO3A 2ORBH 3TA3B 1KG0B 2DQJH 1A6TB 5EIVA 4Z76A 1D3CA 3KG5A 4ZYKA 3UZVB 4U1IB 3DYPA 2F5AH 1K8DB 4M03A 2OTUA 2FX8H 2A6DA 2QHRL 3SQOH 4MHHI 4I9WE 5B8CC 5HVFB 1XGUB 5HI5D 3BJLA 3FB7B 5D70L 1GH7A 3IDMB 1A4KA 4YIQB 1RMFH 3TCLA 4LHUB 4X4XB 4K07A 4RAVA 3FT3A 3IDXL 3QRGH 1ZEAH 3MOAH 5MENB 5FYKL 4NQUA 4JN2A 1SQ2N 5JOPE 2FR4B 2VXTL 3MV7A 2CJUH 5IHZA 3VXSB 4RIRB 1SJHB 5H35B 3QNZA 2Q7YB 1CFSA 3CVHL 1EVTC 4MJ6B 5D2NE 1GPOL 3LVEA 4UTBL 2YRZA 3IB4A 5FK9B 1MCIA 2MHAA 5HHPA 1CQKA 1IGTA 2MCG1 4UV7L 1LO5A 1RZKH 1NDGA 4TSCH 3IJHA 3KPOA 5T1LA 4RZCB 3BPOC 1FE8H 2VDKH 5I18H 3JWDC 1Z2KA 2K3TA 4UILH 2CUMA 1OPGH 3Q5OA 1A1OB 5JHDE 2H6PA 4ELKA 4Q58C 3PHOA 2G75A 3PABA 3WSQH 3RIAK 1NSNH 1TVBB 2HRLA 2A6IB 3KXFD 3KPMB 2YPVL 3KPRE 4DWHA 3N9GL 2A74B 5KSAA 1M7IB 4QWWD 4ZXBC 4PRDB 1OARL 2VDNL 4M5YL 3MLUL 4XI5D 2BSED 1MCQA 1YEKL 5F3BB 4ONGL 2JB5H 4MNQE 1DUYA 5I1CL 3P9MA 3QXAB 2MSPA 2VDQL 2HFEB 5ALCL 2Q86A 3SKNB 5C0CA 3ULVE 1T66D 4R9HA 1JGVH 3VFPA 1FVEB 2DM3A 3WFHA 1IGML 2D4FA 3WIIH 1AY1H 1CD1A 4WY7L 4NM8L 2R56L 3MRKB 1V3MA 3PGFL 4HULB 5J6GB 5A3IC 5IMMB 4I3RL 1CG9A 4HIXH 3ZKQD 5LAXB 1YEEH 1XH3A 2LQRA 4KVCH 4UOJA 3CFCH 4QXWA 1NCNA 3L5JA 3K2UL 1AD0B 3QEGH 3MV8B 4OD1L 2LFGA 3RZWA 2EDDA 5EIQA 3T1WA 3PXHA 4P49A 4P46C 5SWZE 3VGFA 3IXTB 2CKBH 1URLA 5ISZA 3OJMB 4X7SH 4FQHB 4MS8D 3DI3B 4UNTA 4MVBD 4NHCL 1A7OH 4U1SA 3GSVB 3O6LL 1BQUA 4IRJC 4GXUM 4TNVK 1YZZA 3W11D 2F8VA 4S1DC 3QCVL 3WMSA 5DJDA 3ZSSA 3HI6L 1MF2H 5E1HB 4PJ8B 2YN5A 3CZFA 5DD6B 5ICYA 1A6UL 5L2KD 2J12B 2XWBB 1INEL 4EN3A 1BEYH 1INQB 4PB0H 2WINB 3VXOB 1T20A 3KPNB 4XBGA 2YD4A 1GYAA 4RAUA 4JQIH 3VU2A 3N85L 3HMXA 1KLUA 2Z91A 2MFNA 3U4EB 3UYRH 5GGUA 4EOWH 3P73B 3G6JA 3MA9H 1FL3A 1RZKC 2RR3A 3HC3L 4WU5B 3O6FD 4XP5H 2R0WH 2HKFH 3QA3A 4C54A 3UJTH 3DO7B 1OM3H 2XA3A 3FKUS 3QIUB 5TQ0H 3O3BB 1TQBB 3AS0A 2L7UA 3CH8A 5D2LE 3C2AL 3FQNA 3FOLB 5BVPH 5IIEB 1HYSD 4XAWH 1MREH 2AI0H 4FTVA 5C0GA 3RVVC 2LVEA 4KI5E 4HWZB 4AJ0A 2BNQA 4ONHA 2D9QB 3ARQA 3PWJA 5HI3D 1S78D 3U2SA 2D0GA 5K9QG 1BREA 1JWUB 3TESA 3RTQD 4W6YB 2VSDA 1JNLL 3WD5H 5CWSA 2FH6A 1G6RA 4ZFZA 3Q2CA 5EU7E 2VAAB 2AKRB 5DMYA 1NEZG 4W4OA 4X83A 1FPTH 1JJUA 1X5AA 1W72B 3GIZH 3FTGB 4ODUA 4YE4H 5FM5M 5ACLA 4R0LB 1PDKA 4X98B 3MACL 3IRPX 3GSQB 3EFDL 5F89B 3BKJL 4KK9C 1E6OH 5KAQF 5GJTL 2XIDA 3QO1A 2J88L 3TBWB 3TJEL 3F6LA 3BO8A 1F3JB 4ACPA 2XN9D 2ZCHL 5F7UA 4HGMA 4MXVF 4Z8FH 5DVKA 5CZVH 1HZHH 3RUGF 5AZEH 2FD6H 3VXMB 4NKIH 3PQYB 1ITCA 4ZPVB 1CBVH 2DMKA 4JQVC 1RSFA 3DMMA 3LKPA 4EDXA 4WFHE 5BZWA 1AC0A 3R06B 3QDGE 5DD5H 4TRPH 2IF7A 3TPUB 1QFUL 3LRGA 3MRHB 4KRPC 3MUGB 4FQQA 3ZL4L 3EO1B 2HH0L 3EO0B 3LEYH 4K3EL 4G9FE 3QUXC 4LLMB 2AJ3B 4P2RB 4QTHB 1RZGA 3D25B 2B1HL 1YUHB 2ED8A 3RPIB 5DT1L 3V6ZA 2MMXA 2AXGB 3U9PH 3SKMA 5E9DA 3RAJL 4Q6IA 1HIML 2VLKA 3K4DA 2FX7L 3SKJH 4MB4A 5GPRA 5IB1A 2EKSB 5E03A 1MRFH 5FHAH 4U49A 1T0PB 2YXFA 3BPCA 1FNGA 2APFA 2CDFA 4I77H 3BKYL 5IEKA 3OX8A 5KW9L 5DUBA 2X9YA 1UH2A 1RUPL 2WW8A 1KJVA 2DWEA 1PKQE 4NO3A 1P7HL 4Y2DB 4KFZC 1CR9L 5BV7L 1H0DB 1NJ9A 4HS3A 1U8IA 5JDJA 1EBAA 3RDTB 1Q0YL 2IADB 3EZ8A 1F3DJ 2W0PA 4KTDH 2X1XR 2FGWL 1AC6A 4PJAB 3SDCD 43C9A 5BZDA 5EZJB 4LHUG 4RBPK 4BSWA 3GJFH 1MCWW 3RIFF 3C5SB 5DVOA 5FDYA 3MLTB 5IGXH 2VQ1B 2IGFL 1YY9C 2R1XB 3S4SB 1W8OA 3MV01 1S7UB 5HJ3A 43CAA 4PJXE 5DGRA 5I1LA 4LLVA 1NBQA 3W39A 5H8DA 1JV5A 2BVQB 5FUZL 4OLXH 3VXUE 4JAMB 3HZYB 3HMWL 1CLZL 4GKNA 4OLVH 5KG9A 1FO0A 5HGAA 5JO5B 2CLVA 1AXTH 3TYGL 3KS0H 4AM0B 4X6DB 1GGBH 5ACZB 5GS0H 3KR3H 1KYOJ 2YXMA 1IEHA 1L7IL 1LP9B 3SDAC 3VI3E 5C07B 5I17B 5HHMD 4M8QA 3SGJC 2FL5A 4WV1A 3MBEC 1IZJA 3P4OB 4WFEE 3TN0D 4XPAL 4KVNH 3AB0B 2X4PA 3VFSB 4WI6A 2O5YH 2LU3A 1NEUA 1GC1H 5MP6H 1F2XK 4KUZH 1AGCA 2W07A 3ARVA 1KFAL 3GSRB 4PGDB 4G3YL 5DJ2B 1BWMA 1TFHA 4BH7A 3T2PA 5J56B 4P2QA 4NRYA 3N1PC 4ODTL 3RWDB 2ZJSH 4D9LH 5EOTB 5GJSH 4PJFA 4U1NA 1SEQH 3WFZA 4A6YH 1J1XH 3NCYP 3WLWD 1UM5H 4FMFA 3UROR 5J1AA 5DMGD 2XKNB 3QI9C 3V4UL 1A7BA 4ZAKD 4GMSL 4I0PD 1CXHA 1GRWA 2YA2A 1A3RH 5FF6A 5HHNA 3OJDA 3EDKA 4HLZH 2BOBB 1SMOA 2X4OB 3KPSD 2B5IC 3OZ9L 3R8QA 5FB8A 4XX1G 3BKCL 3QUKB 1RULL 4FFVC 3EAKA 2V7NA 2O5ZL 2UUDH 4NZUL 4Y16C 4JO1L 1CQYA 4UIKL 1A8JH 2UWEE 5LVEA 3EO9H 4PJ7F 4ZUTA 4ETYA 5CJ5A 4D0CB 4M7LH 4PG2A 3ZO0A 4TQEL 3IFLL 1V7NH 3B9VA 1J8HA 3B2VL 2APXA 4G8FB 4OLEA 1RU9H 1T5XB 2P1YA 1ZT7A 4NC2B 4R97B 5IBTH 1MJUH 1AFVH 4MD0B 2BCKB 4L8BB 3EGSA 5FYJE 3MRBB 4OZFH 3Q1SL 4Y5XC 3ULUD 4WHTA 5JUEL 3CVHA 1NMBL 3RIAF 3BD3A 3GMNA 1SEBB 1NCBL 1YECL 4DGVL 3RWIA 3RNKB 3MQIA 2YD3A 4I4WA 3ESUF 4PJCF 4IOIA 1TJIH 1D9KA 3BGMB 4YC2B 4XNQB 4M9OA 3NCFB 3QEHA 4MAYC 2ZPKL 1WT5C 3T0ED 3QDJD 4AIOA 1CL7I 2P24B 2Z92B 4OZHA 2AJVH 1MAML 3D5OF 1IAIL 1RVFH 4PTUB 4YNYB 5GS0C 3QUZB 3CSYB 3U1SH 5I6XC 3NPSC 4NP4L 2Y36L 3OKDB 5IWLC 4HFWB 3V52H 1DQDH 1D5IH 4Y4KC 1MRCL 5B8CB 4XMPL 3VFTA 3BDYL 3M1BB 2VDOH 3SE8H 1L6ZA 4L3ED 4PLKC 2OJEA 4KZEL 25C8L 4LPVA 1A64A 4LAQH 2NY3C 5J1SC 1X7QA 1A9BB 1HYRC 2YRPA 3VG9C 3O2VH 5DJAA 5EU5B 2HTLC 3ZE0E 1FL5B 3GEWB 3HNVL 4MQXD 5DFWH 4CRPA 3PUCA 5GS1B 4PPTA 4UNUA 1A6AA 1HN1A 4LPCA 4HJGB 3BZEB 4Z0BL 1A7NL 5FM8A 2QQKH 1CGWA 4LCCB 4OF7A 1OTTD 3RJQB 3BPOB 4TNVF 3IDNB 4UU9A 5ETUB 1LO3L 2AQ3A 4TSAH 1CVRA 5DLML 1NCAL 2ZUWA 5HHQB 5IW1B 2DAVA 3LN4B 3BD4A 3KPQA 4HX1B 5EU4A 4HKZA 4CBPA 5I76B 4M93B 4EQ3A 1R5WB 4OF6A 1FVDB 4QRTA 4KZDL 5KSUB 1QQDA 4NQDD 1RJLB 5TGBA 3GBNH 4IDJL 3WFCH 3QHFL 2CDEB 5F6IC 4QHKJ 8CGTA 3SBWC 3SDDD 1FV1B 3S37L 4ENEC 5EG6C 3H9YA 3RVTC 4DFHA 3LQZA 3JWNC 4JHAH 1N6QH 4ORGB 2IBZX 4K94H 1UWEL 5E24E 2AGJL 4DKEL 4ZG1A 1S9KC 3DXAE 5FUCE 3VFMA 4I0KA 1EO7A 2N1KA 3NACL 2R0KL 1MH5B 1NGPL 3C60D 4IOFD 4HHAA 1RJYB 3C9NA 2VLMD 3LKNB 2A73B 5GS2H 3KPPA 4GH7B 1CU4L 3L3DA 4OZ4A 1ZLUH 5LGHH 5LKNA 2OMBA 4M48H 1GGUA 4PJIF 4M6NH 1XF4B 1ZHBA 2PYEE 3WV0A 4S2SA 5JW5A 5EN2A 1EGJH 4GKOA 3ROOA 1T7VA 3BYYA 4O9HL 4CU7A 3T2OA 5F9WB 1VEOA 3EJZC 2NNAA 1A6WH 5IB5B 1MFAH 4CN1A 3QWOA 1BQSA 2VLJE 1KCSL 3UBXA 4GT7A 4S1SL 2QKIA 3EOAA 3F7QA 1G0YR 5AZ2L 3FN0H 4I9WD 1YMMA 5IFHL 5LGJA 1PX4A 4JANA 1MHHA 5A2FA 2OQJB 3BUYA 4YPGB 5C0RL 1QSZA 2WP3O 2DIJA 5L7XH 3RBSA 3BEVA 5ANMB 4XP6L 5AEAA 5JOPD 3S4SG 3CX2A 1CGSL 2VQUA 1T03H 3VE0B 1NFDB 4F80A 1TNMA 3UTZB 3S3SA 2GJJA 1NL0H 2D7MA 5I1KH 2BNUA 4HUVB 5SWSA 4PV8B 4WWKA 1J1PL 3OBAA 2DQTH 1VPOL 1F90H 1BX2A 4PJ5E 2J8UE 2YEZB 4OTXH 3VFWB 3HA0A 4DUVA 4Q9BA 1PLGH 4QHMA 4GBXA 1OAKH 3WS3B 2WLZA 3WIFA 1D5XA 2OR9H 3QUYD 5JHDD 2VIRA 1ZHKB 4I2XE 3A6BL 1UJ3A 4HUMB 1NEZA 3OR6A 5GS2D 1U3HD 1EO8H 1QLEL 3CX5K 1BFTA 2BSSB 4POZC 5L2KB 3KPRD 1OGTB 1EBPA 3T4AA 1DJSA 1CICD 3HNSL 3SGDH 1GZQA 5JPNA 4MNQD 5L9DL 3UPAA 1FH5L 2YPLE 4LOUC 4RAHA 1C5BL 1N4XL 1N7ML 3O6FB 2GTZA 1CE6A 3TT3H 3ULVD 3BP4B 5D93B 4YDVB 1IFHL 4D3CH 4W81A 2OK0L 1OD7A 1YEIH 4L3AA 2C7UA 4QRPA 2AV7A 4OCMC 2YKLL 4N1EA 3P0VH 3CXHJ 2VDMH 5GGQL 3NTCH 2FJHA 1XGRA 2VE6B 3BZDA 5GHWL 5I71C 3SKUD 3U0WL 1F6AA 1J8KA 1DBKL 4FQXA 4B5EA 2CRYA 1F2QA 5IQ7H 3RTQB 3OB0K 3PV7A 4K7PX 3MO1B 4HUUA 4QLRA 2P8LA 5DJXA 4BM7A 2GSGA 5IW6A 3BRGC 2QQLH 3W9DA 4M1CD 1KLGA 4NKMB 3EYUH 1ES0A 4MXQD 4YAQB 3SCMD 4X99B 5D5ME 3HE7D 5HGBB 4W68A 3DUSB 4DJMA 3H3PH 5SWZD 2HFFA 5E08H 2CKBB 2QL1A 2EDLA 5E5UB 2CD0A 3IVKA 1DQJA 5GSVB 3O3UN 3WLBB 4ZUWB 3LEXB 4BQBA 3MTRA 3GB7B 2XN9B 5T1KA 1D6VL 1FN4A 3TZVD 2ZUQC 4OFYD 4JFDA 3TA3A 1KG0A 1YNLL 1A6TA 4DK6A 5AYUH 4EVNB 4BA8A 4WNQB 4U1IA 1ZLVH 1MY5A 4PJDE 3DETD 2IEPA 3VWKC 5C8JB 3ILQC 3WN5A 2IANE 2PW1A 3CAFA 1IL1B 4F37K 4YIQA 1MY7A 4DW2H 4GXVL 5MENA 4NOBA 3UJIH 3ZMRA 4QYOB 2AK4A 3TF7C 4KI5D 3OAZH 5TFSH 4Z0XB 4Q9QL 4JJHA 4OCXL 2XG4A 2Q7YA 3SJVA 1T0NB 4MJ6A 2OX5A 2JCCA 4Z7WB 3GMQA 4G8EB 4GQ9H 1SYVB 3PDOB 4JKPH 5BS0B 5FK9A 3O3EB 3WS6A 4I3SH 1YPZF 3LQAL 4NNPH 2C1PA 1R24B 3AXLB 5CIPA 3EJYD 1RIVL 1DTUA 2V5MA 3QFJA 4JFFA 4KQ3H 3H8NA 4IJ3B 4I8DA 4JN1L 1A5FH 3OTTA 3U7WH 4LKCA 3S5LB 4Y88A 2VXUL 1A3LH 4L4TD 3VWJA 4KJYB 3BQUC 1BD2E 3HS0A 1FDLL 1YNTA 1KACB 1TVBA 3G6DL 4YHKH 3QYCA 2A6IA 4EUPB 3KPMA 3D0VB 5DVMA 4FZEL 4V2BA 3SDCB 2A74A 3PWUA 4J4PA 2XRAL 6CGTA 1M7IA 1ZWIA 3K8LA 3MRRA 3P77B 3PWVB 4OCRL 5EO9A 1T1XB 3MBEB 2K9UA 3SE9H 2IFFL 2R0ZL 1B4JH 3F5WB 3H7BB 2Y06H 4JPKH 3VG0L 5MHSD 4G5ZH 4KU1A 5ID0A 1CLYL 2Q87A 2EE9A 1F42A 4KV5E 4LLWA 3QXAA 4WFHD 2HFEA 1T6VN 1M6OA 3FCTB 3RPKA 1GGTA 3CFEA 1VEPA 4WI2A 4OGXH 3FRUB 5DJZB 3HPLB 4LVHC 4EI6B 3MGOB 4PGZA 2YWYA 5J6GA 3KYNA 4XMLH 2QSQA 4HT1H 2XZCL 5IMMA 4G9FD 4KJWC 5DMKB 1HINL 4FQ2L 1T5WB 2ERJB 4OF0A 1DQLL 4ONOA 4E42A 1JRHL 2H45A 3KNBA 5M95B 4DAGH 1JWMB 3NCYS 5FKAA 5HHMB 2P5EA 5J7CC 5IMOB 4XVSL 3NA9L 4NQVB 2VXSH 3QDMA 4P5TD 5CJQH 4JPVH 4YO0B 5E7FA 5MERB 5HVWA 2X4NB 3ZKND 3ZHDA 3O4LE 1AI1H 3O2WL 3G04B 3ARGA 3CDYA 1JMXA 3FT2A 2GT9B 3L5WA 3O8XC 3L3KB 3GSVA 1D5ZA 3VDAA 4L4VA 3P0GB 4LARH 3D85B 3I84A 4PJ8A 5B4MC 2QR0B 5EC1B 5T5NG 1NANH 4L9LC 1GGYA 5FOBA 4YDKL 4JQXA 5DC9B 4ZAKB 2NY0C 4I0PB 2WINA 3VXOA 3VXTA 1TTUA 3KPNA 3GJFB 5CD5C 3AY4A 2ARJQ 2LABA 3ALXA 4E41D 3I75B 2VLLA 3KPSB 5A2KH 4K23H 2EH8L 3P73A 4WU5A 3C08H 3NFSH 5TF0A 2YD2A 1Q72L 2CIKA 5K93A 4P4RA 2G60H 4TUOB 2DTML 2XXCB 3MR9B 1OAYH 5DUML 5LQBH 5IIEA 3VXUD 5C0BE 3FOLA 3GKWH 4P4KD 4IMLB 3GZKA 3AREC 4HWZA 5HDQH 1OSPH 1DBBH 4OCYL 1JP5A 2I9TB 5K9JL 3O2DL 5JA9A 2I9LA 4ORZC 4FXGB 4BJLA 1DN0A 4OT1H 4GMTL 4K7FB 2ZCKL 2X41A 2VAAA 4WFED 3SDYH 5FYJH 1LO4H 5D6DA 1P5UA 3LKQB 3VFRB 3BN3B 3MRLA 4R0LA 4CVWA 1KNOB 2IPUG 1D5MA 1FYHB 4MLSA 2NY3B 1ZMYA 3RNQB 4MB5A 3TBWA 3QDJB 3WDJA 1RUMH 3PE9A 3ARXA 4PJHA 4GRMB 1OAXH 4KKBC 3NA4A 4A6YB 1P7KA 4I13B 2VR4A 4LRIC 2DL9A 3BGFC 3IJSB 1T7XA 3UPRB 1S3KL 1LMKA 3VXMA 4S11A 1KTDB 5DD0L 4WFGE 4ZPVA 2IG2L 1UZ6F 5IV2A 2P44B 5C7XL 1AGBB 2HWZH 4K8RL 5DJCB 3TBSA 1QKZH 4L3EB 3WO4C 3TPUA 5ESVA 2P5WE 5ISZE 4DQOH 5B21A 2WBJC 4LPWA 5INCA 3T4YA 2D9CA 3EO1A 1F13A 3FFCE 4BQ8A 4APQC 3JV0A 3NVQA 4Z18A 2NQCA 4AIXA 3L5IA 1IT9L 4LLMA 5DZNA 3D25A 1T3FA 1YUHA 3RPIA 1IKNC 4NRXB 1J0KA 1U8JA 4C83B 2AXGA 4NN5C 5KSVA 3J7HA 3T2NL 5I15H 3T2QA 1CDUA 1ETZA 1NC2D 3X11A 4N8VA 4PLNC 4LSRH 4P23D 4OZFB 1Y6MR 4KK6D 1K2DA 3G6JE 4JZJC 4KKCC 4ERSL 3TFKC 1EV2E 2F5BL 1RZFH 1ZT4B 1WWWX 1T0MA 4XGZB 5C0EB 4OKVA 3BKMH 1I7ZA 5GIRB 1MCOL 3HKFA 1UGNA 2X5PA 3TBTB 5A2JH 1WBZB 4GS7C 4Y7MA 3SO5A 2ADIB 4Y2DA 1AGEB 5IFJB 1F4YL 1NCDH 3HPJA 3MOBL 2BNQE 3JTSA 4PJAA 1P9MA 4NQDB 4ZS6D 5C1MB 2FATH 1MSPA 1UCTA 5EPMB 5EZJA 1IGFH 1Z9OA 4LLYB 4I5BB 4OM0H 3C5SA 1MFBL 4BFIB 3X3GH 3L7EB 3QFDB 5CJBA 3WE6B 2VQ1A 1BJ1H 3WEXA 4HPYL 4IM8A 4O2FA 3MREA 5I8CA 5JMRA 4J3TA 2I07B 3TBVA 5T33L 3G5XB 1MEXL 3WIHH 4G6AD 5EULV 4F9PC 2NY2D 4P57B 2BVQA 1FZOB 4YXKL 2DJUA 3HZYA 4MSWB 4X80L 4LLUA 3I85A 2JJUA 3KHQA 5JO5A 2Q8BH 4X6DA 2CMRH 3W9EA 5LBSH 3X17A 5ACZA 4LDEB 3LKOB 1CLCA 3S5LG 1QSEA 4O02L 3RY6C 3Q6FA 3QHZH 3NABL 5C9JA 5D1QC 4PREB 2OBGA 3P4OA 3DOSA 5J4MA 4H1LB 2F58H 4EUPG 3D18B 2ZUSA 5JTWA 2GJ6A 2GQHA 1X5XA 4N0UB 1CLOL 3CK0H 2A6KB 3GSRA 5DJ2A 4PGDA 4BZ2L 2G2RB 1JN6A 1OOAA 3MUY1 2F53E 1JPSL 4BYHA 5E2UH 3UTTA 4IRSA 2FCBA 2R2HB 4Z7NE 2PUQT 3IFNH 1UKTA 4R26H 4U6TA 3EFFA 1BIIA 2AXFB 1FNHA 4FP8L 5D2NB 3VMNA 5EOQL 3CVIL 1CFTB 5J12B 4XBEH 2R8SH 2XKNA 4F37F 1Q38A 4XPGL 2QLVB 1A7RH 1GSMA 5TF1H 4HWEL 1OAQH 4OV5A 3PJSA 1C8PA 1M7XA 2X4OA 4HDIA 1BQHB 6FABH 4ODWB 2FO1A 3DX9B 1I8MA 3WFBH 1RPQA 5I1EL 3DXAD 3TH3T 2RCSH 1FG2B 1B0GB 2VH5H 5JHDB 1OTUD 4WI8A 3FQTB 1YN6A 3TV3H 3BAEL 4XC1H 1E4XL 5I71B 3STLB 3JTTB 4HUXB 3OSKA 1U3HB 4MA7L 3DV4B 4X7FC 4MA3B 3GHBH 1NFIB 5BJTA 4G8FA 1I1AC 1CICB 3OAUH 1T5XA 4S1QH 4EBQL 3WFDL 5JQ6H 1MCCA 2NTFB 3OKKA 1UM6L 4Z6AT 1ZTXL 1U8PA 3MRBA 5HHVL 1MJ8H 1VACA 2VLJD 3T65B 2E5EA 1MNUH 1ZK9A 3RNKA 3ZDZF 1ZGLM 3WJJC 4AH2B 4OLZL 3HNTH 2D7TL 3BGMA 3NIGF 4XNQA 1BVLB 3MLYL 5FA4A 1I3VA 4UBDD 4UQ2B 2AJUH 1P7QD 2P24A 2ZUQB 1BZ9B 3I6KB 1NGYA 4J6RL 2IC2A 4ZUVA 4PJ9C 2J8OA 3GI9L 3DSFL 1R3IL 5J06A 1G1YA 1U0QA 3GMOA 4QOKA 1WBXA 1U58B 1DVFC 4PJ5D 3ZKMC 4FQ1L 3ARFA 2VL4A 4XRCA 1FGNL 3HE7B 3BIAX 4KAQH 1MIMH 3M1BA 4U6XB 5SWZB 3LSOB 2E7BA 5CEZH 4CADB 2JKXA 1U3YA 1GAFH 4WI3A 4P2QE 5TQ2H 1CS6A 1S7XB 2YD6A 4XMKL 5F7LB 5F7EH 1FL5A 3GBLA 1AHWC 3VXPB 3TZVB 2BX5A 4PJFE 3BDBA 5GS1A 1F4XL 4U1MB 3DUHA 1VCAA 2JJTA 3B9AA 3HB3D 1A7PH 5JW3H 2LTQB 4LCCA 1G9NL 5B38B 4JKWA 5F7MC 1U8LA 2YPLD 4FABH 3MLZH 4P0DA 3MGTA 5ETUA 1X44A 3HHRB 1KN2L 3DTXA 2JELH 5HHQA 2XZZA 3BQUB 3C5ZC 4HX1A 5D2LB 1C7SA 2FEEL 5EO1B 5C3LD 3IDGA 1HHHA 4HLZG 5JLZB 3BZFA 1HHIB 4PRAB 1FG9C 5EFIB 3PNWB 4CW1B 4Y4HC 4HK0A 4NZJA 1FVDA 3VXRA 1H3UA 4L1HA 5I0ZA 3ULUL 5AG9A 1LK3H 1RZ8B 1LD9A 12E8L 2NY7L 3BT2L 2AJZA 1YEJL 2ZNWA 5FYKE 1FV1A 4YDIH 2ILLA 2DQDL 4NO2B 2RFXB 4KY1H 4ORGA 1FZMB 4UT9H 2E9IA 4IDLA 3QIBC 4K3JH 2DRUA 4OFVA 3GJEB 1UCBH 3QNYA 4FFWC 3QCTL 1RJYA 5KVEH 3P4NA 3LKNA 2C3HA 1V8HA 3WXWL 4OZFG 3F7VB 2HT3C 2GHWB 5DGQA 3KXFA 5EIIB 3IETB 3A6CL 4OZHE 4B53A 3S35X 2BVEA 4PB9H 1KN4L 1XF4A 4F8TA 5HHXH 3FO1B 3MPCA 1PFCA 2CRMA 4PJEA 5ALBH 3FFDB 4OFIA 2OSLA 4RX4D 1XIWD 1KJ2B 2X05A 3O2DA 4BH8B 1JWSB 4I3GA 5C92A 2W60B 3QDGB 3TBYA 1RY7B 4L8DB 1U9KA 2IAND 4CN4A 2QADD 3QEQA 4HXAL 1BFSA 4ISVB 2NZ9D 1L6XA 2OQJA 1G9EA 2CXGA 1I9JH 4M7ZB 2D03L 4U3HA 1CFQB 5C08E 4G9FB 4LLDB 4XP1H 3IFOA 2YR3A 3MRJA 2EC8A 1ZVSB 3VE0A 4L9LB 1DBMH 1NFDA 4CN6A 1IGIH 3N50A 1YEGL 2NY0B 4Q6YA 2C4FT 3MRDB 4Z7QF 1NGQL 2EDJA 3HRZA 4H0GA 4CL7A 5B22A 4KDVA 4UB0H 5J9PB 4L29A 4JR9H 2WMPA 3I02A 1UVQB 2YEZA 3VFWA 2OZ4L 3MLVH 3E6HB 3I2CH 4DCQB 2DQGH 4ZNEA 2F54A 1UH4A 5JZ7C 3MJ7B 2FYYA 2DM4A 5DFVC 1J10A 4C56A 5B39B 1PKQB 4WHDA 2XACC 1PY9A 4H1LG 4J3VA 1BD2D 4P3DA 1SYSA 3D6GA 2DOCA 7FABH 1FGVL 4R96A 5KVDL 1ZE3C 4XCYA 4KKAD 5GZND 3QO0B 2VR9A 4LAJH 1K6QH 2FECL 3V8OA 4HS6A 3JXAA 2IBZY 4OGYH 3KDMB 3JVGA 5T1MB 1C1EH 2VB5A 4NQEE 3O6FA 1DFBL 1TITA 1ZLSH 2E27L 4PJXB 2PXYC 3M8OL 2G5BB 1FQ9C 4WTZG 4AL8H 4M7LT 4IRZH 4IHOB 4RGOL 5IK3B 2H2SD 3VXUB 1FFPB 1QVOB 4JY5L 4BQ9A 2H3NB 4P4KB 5DRZB 3ARSA 3M17B 1IM3B 1JF1B 2VE6A 4O4YH 1BQHG 3AUVA 2BMKB 2E6QA 5HVGB 2P8MB 4L9DA 2Y72A 2JIXD 4MJ2A 4JG1H 3BGFB 2Y6SC 5TE4H 1XGYL 3EYOA 4JM2C 1H3TA 2C1OB 5D6CA 4UQ3B 2MKLC 4KHTH 4NKMA 3GO1L 3GMLB 1ZA3A 1LO0H 4G8GA 4LSPH 4X99A 4NO5B 2V6HA 3ILPB 4NSKB 3O4LD 5HGBA 3DUSA 2Z31D 4PJGA 3DROB 2ZCLH 1XZ0A 3REWB 5KVGL 2WWMD 3WLBA 4OV6F 4ZUWA 1TQCC 3LEXA 4R4FL 2R1YB 1LEKB 5FCUH 3O6ML 5JOEA 4LIQH 3VW3L 2V2TB 2CK2A 1I1FB 2XN9A 1ZS8A 4ZOAA 5DI8A 4E5XA 1A6VL 4PY7A 1LEGB 2AEWA 4K9EL 4F7MB 1RK0B 4EVNA 2DM7A 4G8IB 4WNQA 3QULB 2Q1EA 4M8VA 3X3FH 2DLHA 4OJFL 1YJDL 5DUPL 1AE6H 4JZJB 4OI7A 5C8JA 4RA0C 3E2HC 1LE5A 4JDTL 5E2WL 1S5HB 4BSVB 1IL1A 3NIFF 2VZVA 3LEVL 4HXBH 4GS7B 3SY0A 4U1GC 1PG7H 4WUUA 5C0BD 1YQ2A 5FUOH 2UWEB 3ABZA 4QYOA 3ZTJH 1IC7H 3QPXH 1QG3A 1C5CL 5GRJH 3RA7L 2O61A 4PLOB 5AWNH 2R4SL 3U0PA 2CGRL 4Z7WA 4D9RE 4YQXL 1BBDH 1DUZA 3PDOA 3ULVL 3NFNA 3H9HA 1U91B 1NC2B 3O3EA 1KXQE 3HMXH 2HRPH 5DJ8B 3IF1B 4P23B 3NBNA 3AXLA 4IS6B 1JYVA 2R1WB 5LCVH 3T8XB 3D39E 5DHXB 1I8KB 5EUOB 3RKDC 3L95B 1MWAB 2F19L 5DJ0B 3S5LA 3SN6N 1N64H 4KJYA 3G6AB 3B3IB 4ODVH 4TOYH 4JREC 4TVPE 1NUFA 2XZQL 3KJ4C 4EUPA 3VFNB 4K7PY 3RVWD 1FAIL 4TSBH 4GLRH 3PWVA 1TZGH 1R3KB 5KSAC 3VRLE 4NN7B 3I6LE 3RWGB 2HG5A 4KKLC 3RVUC 1CYGA 1F58L 1G6RH 1NCWH 3H7BA 2O5XH 1N8ZB 3F12A 4ELMA 1BVKA 4WFGD 3KS0J 3CSGA 4MXVE 2C3VB 3PG2A 3RUGE 4MX7A 4WI4A 3DX7B 4YEEA 2AJSL 2NY2B 2P5WD 5ISZD 1U92B 1AP2A 1IC4L 1S9YA 3FFCD 4YX2H 1NLDH 4P59L 2CKNA 2HTKC 3EYFB 2HVJB 5DMKA 1QPPA 4LSQH 3MGAA 3ZDXE 4X4ZA 4CNIA 3QG7H 1Z0NA 4HPOL 5CJ8A 4EN3D 1JPTH 1YY8B 2EDEA 5KTEH 4JFDE 5E4EC 3P9LB 4RA3A 5IMOA 3TN0A 3VMPA 4NQVA 3HZKA 1CZ8H 4YK4B 1QD0A 1D5BA 2IPUK 4EI5C 1QFPA 1RUQH 1EEQA 3HAEA 3S3PA 4WU7B 3G04A 4LGPB 3DVFA 4L1DA 2AK1L 1HOCB 1MCPL 4NQSB 5IVXA 2AJXH 1EHLH 2GI7A 4PJAF 5A16B 1WTGT 3RGVD 2BNQD 3E3QE 4YFDB 5EC1A 4ONFH 4YHPA 1X5GA 5ID1A 4WJ5B 2M1KA 2K7QA 3SJVE 1I3RA 4O2CB 2JCCE 3QXVA 1Q9LB 5FFLA 2E7LA 3B9KC 1WFNA 2VLRE 3KLHC 3HI1B 2LV4A 4ODXB 1G9MC 3KPSA 4WHCA 5IB4B 4XH2A 2VZ1A 4H8WL 1SBSH 4KUCF 2L0DA 3EKCA 1XCTA 3QFJE 4OSUL 4UDUB 4DTGH 5TE7H 3DNKA 4KK8C 5F97E 3T3PF 1KGCE 3MR9A 4OCSH 3SE4C 3IDJA 2NY6C 5D7SH 1IGJA 4X6DF 1Q94B 4LRNH 1G7PA 4IMLA 1AQKL 1LP9F 1C08B 1EJOH 4UT6H 4GG6E 3OJVC 3CZJA 3O9WC 4LL9A 4PV9B 3ZYOA 3DUUB 1JHKL 3ZE1F 3F58H 1KJ2L 5F96L 5T1DH 4GAGL 2UYLB 2PYEB 5I30L 2W59A 4Z95H 4FXGA 2WV3A 3ZYJA 4TUKL 4NJAH 5B39G 5I1HL 3HC4H 4X6BB 4K7FA 35C8L 4JO3H 1CDYA 4MD5A 4WW1B 4GOSA 4NZTL 2R29L 3FQUB 2UY7A 2NW2B 1YEHH 1S7RB 4FQPA 3AAZB 2YD1A 3QIWD 4W4OC 3DMMD 3VFRA 2AEPH 4V1DE 3MRNB 1K8IA 3MXWH 2WAHA 1KNOA 4U6HA 5IT2L 3HE6D 4BZ1H 2F53D 5D71L 3S36H 1SVCP 1MJ7H 2ATPA 1FO0H 1S7QB 3LV3B 3T0EA 2ADFL 5D9SB 5CILH 1P7QB 4GRMA 2GAZA 5D1ZD 3MCLH 4LBEA 2D0HA 1ND0A 5EZIL 4ODSH 1K4DB 3INUH 1LGVA 3U30B 1RUAH 2P5EE 1BVZA 3B5HA 4QXGH 1RK1B 5E4IA 4NO0D 1MIEL 1MCFA 3UPRA 4WO4C 3T3ME 1KPUA 4QTIL 1EERB 1QRKA 2HJLA 3RL2B 4RMUA 5ADOL 5CZKA 3QDME 2XTJC 4B41A 4QRQA 4PJ5B 4I1NB 1B90A 4CJ0A 2J8UB 4GRLA 1XFPA 2APWA 5EZOL 1AGBA 2C9AA 5I74C 4ZTOL 5HGDB 5TPWL 4L3EA 2XKSA 1FNSL 3C5ZB 2F74B 2BVPB 1IILE 1MFEL 5C0NC 4JFZH 2A6JA 5T5FL 1RFDL 4I2XB 4L4VE 3LPWA 5FO7A 4PP2B 3DGGA 1YNKH 1OT2A 1CGVA 3U4BH 1BPVA 4H25B 5IM7A 3FB6B 4HZAA 3KYKH 1A9EA 1HNFA 4Q6IC 2V9QA 2YPLB 5CBEB 5DRXA 1PGRB 2GYSA 4G7VL 1GGCL 2QJDA 1MCRA 1NBYB 1H3VA 3C2SA 5DA4A 1ZT4A 4XGZA 1J87A 2B2XL 3P4MB 2V2WB 1V3LA 2VTFA 3TBTA 3ULSB 2OI9C 2XNAB 4HS8L 4Y19E 1WCBB 3HZVA 4KJPC 4OCWH 2OZ4A 5I75C 5CSBA 4QF1B 1BQLL 5D70H 5DDHB 4BFEA 1Q0XL 4XCNA 4WUKL 3V6BR 4ZQKB 5JXEA 1FYTE 2DICA 3IDXH 5C0DA 5EPMA 5FYKH 3PDGA 4LLYA 2VXTH 3SKOA 3SDDA 3EOYG 1ORQB 4FNLL 5GGSB 3L7EA 1UQSA 3WE6A 4M6AA 3L5XL 1A2YB 3QXTA 4MNHB 3CVHH 3V8CA 4NNXB 1GPOH 2W0KA 2I07A 4KTYA 3MNVB 4Y4FA 3GIVB 3G5XA 1B0RA 4HGWA 5BRZA 4UV7H 3F65A 3C60A 4NWUL 5BO1L 3GMMB 4P2QD 3AU1B 4P2OD 4KJQC 1LNUA 4PJHE 3NZ8B 1J0ZA 4MCZB 4J3XA 1WWAX 1F4AA 3ARUA 1RHHA 5FDWB 2YPVH 1XIWB 3FQWA 3N9GH 3EOTL 5CEYB 1YYML 4U2ZA 3CMGA 2ICWB 4PJDB 4NUGL 3D18A 3GJFK 1OARH 2VDNH 3QXUA 4M5YH 2IANB 2R23A 3MLUH 3S9DB 1YEKH 2G2RA 3FO2B 4ONGH 2ADJA 2VMFA 5ESAB 1BAFL 3CFKA 4L3CA 5I1CH 3M07A 2VXQL 2O93L 3K74B 5I8EA 2VDQH 4PBVC 4DOHE 2FWOB 1XR8B 1MQKL 1MHPL 1U3JA 5ALCH 1P4BL 1QBAA 1CXKA 4KMTL 3LB6D 5DZLA 2AXFA 1IGMH 1X4XA 4MJIE 1R5IB 4Q74A 4WY7H 4NM8H 5D2NA 2R56H 3PGFH 1CFTA 3RRQA 4GRWE 3FB5B 1AJ7L 3BISA 4I3RH 2ITCA 5FO9A 1DBAL 2E7HA 5MI0B 1MWAL 2UY6A 4X8JB 3PGCB 4K2UL 1WAAE 3T0AA 2PXYB 2BHUA 4MCYA 2CLRB 1PEWA 3K2UH 1TMCB 3BE1L 4OD1H 3QUYA 5JHDA 3PHSA 2DQIL 3IU4L 4Z78B 5T3XE 1HXYB 4HUXA 1IAKA 1TJHL 1U3HA 2EZ0D 2VAJA 4YXLL 4MJ5A 3KPRA 4NHCH 3MNWB 5EC2A 32C2B 4PG2C 4JM2B 3O6LH 2AV1B 3WKNA 3C09C 1C16A 4OIAA 2QTEA 1CICA 4R2GC 3QCVH 2E7MA 3CUPB 3HI6H 4W6XB 1HKLL 4LVOC 4MNQA 3JWDL 2BVTA 4J8RA 5E2JA 1A6UH 5T5NF 3LKSA 5GRUL 3GDBA 1INEH 4D8PB 3T65A 1VKXB 5F7NC 4CVZB 4M00A 2IJ0C 3V6OC 5DC4B 3N85H 4AH2A 2ED9A 2VN7A 1ITBB 1TQCB 3EOBA 5C0FB 2J4WL 1NFDF 4KKNA 2DIAA 3HC3H 5EBMA 5IG7B 4PD4J 5C08D 1D9KC 5H94B 4UQ2A 2UUDK 4HMEA 1BZ9A 4X5WA 4ZUUB 4AK1A 2DTSA 3FZUC 2BSRB 2IQAB 3C2AH 3PGDB 2KUTA 1QSEE 2Z93B 1D6EA 4G7YL 1Q9OA 3ARBD 5GZOC 2ED7A 4Z76B 3DBXA 4O58L 4H20L 4LCIL 4Y5VB 3SCMA 2OTUB 2A6DB 2GJ6E 3O4LB 3V95A 2AS5M 1EEZB 5GGTL 5SWZA 1MVFA 3NZHL 3LSOA 1P69B 2Z31B 4AZ8A 1OGAE 4YHOL 1A4KB 4F2MB 1VGEL 5FXCH 1MPAL 4RAVB 3FT3B 1HI6A 2BFVL 4ZNCD 1R3JB 3UTTE 4G6FB 3MACH 3EFDH 4N8CL 5F70A 3WUZA 3BKJH 1CDJA 1WFUA 5GJTH 4U1MA 3QNZB 1CFSB 2J88H 3TJEH 4NN6B 4RMVA 4X9FA 1RQ5A 4LSTL 3UTSA 3GRWL 3H9ZA 3OWEA 3UAJD 3QG6B 2ZCHH 1AQDB 5CJOL 5I9QC 1NDGB 1YC7A 1TZIB 3IJHB 1KB5L 4K7PL 4LASL 5ABDE 2BXZA 2AAVA 4NQED 3MCKA 3B83A 4LMQI 2DLFL 3BHBA 3DVNB 3BXNB 4N0CD 4JREB 5HGHA 1IZKA 5C0BB 2HMID 2H6PB 4ELKB 3PHOB 1OP3K 2G75B 1J86A 3PABB 5EFIA 3DYMA 3GK8L 2DD8L 4NBXB 1ERNA 1QFUH 4XNMA 1JZ7A 1QP1A 3ZL4H 1Q9WB 2HH0H 2VERN 2PO6D 1QBLL 4K3EH 5CLTA 1N0LA 1KBGL 1HHKA 4TSCL 3B2UC 2B1HH 2V5TA 1DUYB 5DT1H 2RFXA 4HCRL 4PJGF 3P9MB 1HIMH 4HIHA 2JB6A 4B0MM 1IC1A 4DKDC 2ICEA 2Q86B 1KC5L 2W0LA 2YD9A 4WW2A 1RIUL 4JY4B 4L4TA 4GKZB 5DK3A 3WFHB 1CD1B 3BKYH 5TH2B 3F7VA 3RWJA 3T1FB 5EIIA 1T89A 5KW9H 3IXAA 2VDLL 2FGZA 4XNYL 1CR9H 5BV7H 3ZTNL 3I9GL 2X4TA 1FNEB 3BZ4B 1Q0YH 1U2CA 4QOKE 2GK0A 1KJ2A 2YN3A 1W0WA 3TIDA 3EHBC 2X1QA 1JWSA 2PTUA 4LEXL 3GFUA 2W60A 3WBDA 4L8DA 3D0LB 4ZUSB 1WC7B 3WYRA 1FHGA 4ISVA 5ISZB 2IGFH 4U1SB 4M1GL 2EICA 4PGCB 4RSVA 4RMQA 3WCYA 3FFCB 4LLDA 5D4QA 2W92A 4Z7WF 5SWQA 4NJ9L 4P2CG 5FUZH 4CGTA 4RMTA 3HMWH 1CLZH 1HSBA 1KCVL 1OTSC 4EN3B 4D9RD 4DK3A 1ZLUK 3TYGH 4BZYA 3EYSL 1T20B 4U0RC 4P5TA 5HYSA 5J9PA 4OUUB 4RAUB 3AC0A 4WWKC 1L7IH 1T4KA 1MVUB 2EYRA 2Z91B 5GSRB 5HI4D 1IAOB 3G6JB 3E6HA 1FL3B 1Y0LB 3D39D 4OLWL 5L2JA 4LGSB 3TEUA 5J1TC 5EBGA 2NY6B 5K59E 4XPAH 3MRCA 3IDYC 1YPZE 4GBXC 1PKQA 4M62L 3UP1A 5E5MB 1B88A 1KFAH 2Q6WA 4G3YH 2BNQB 4TVPD 4ONHB 1UJ3C 1DLFL 5ESQA 1TZHB 3QZWA 3U2SB 4GJTB 2Z8SA 3VXRE 3B5TA 3IDIA 4FQXD 4YHML 2JJSA 3L3IB 4ELMF 5FV1L 4JQIL 2OP4L 4ODTH 3HI5L 3I6LD 4UINL 1G6RB 4ZFZB 4E41A 1HWHB 3KDMA 2EXWC 2Z4QB 5CIPH 2I5YL 3L9RB 1FC1A 3K46A 3V4UH 4ODUB 4GMSH 1QR4A 1WZ1L 4N0FA 4XBPA 4PJXA 2G5BA 1ZHNA 4IHOA 2X44D 5IK3A 1FFPA 1OP9A 1QVOA 3UCRA 4WWID 3OZ9H 4P4KA 2EDKA 5DRZA 3M17A 3QO1B 1FCGA 3BKCH 4U2YA 3BO8B 1RULH 5JIHA 2O5ZH 1CXFA 1H8OA 1I9RL 5DEFB 4JO1H 4UIKH 4Q9RL 1W2KT 4QRSA 4DVBB 4PJEE 1WUNT 3UC0L 2C1OA 3L3OA 4JFDD 1JZ2A 2VDRL 2HJKA 4TQEH 2BERA 5BV7C 3IFLH 3GMLA 4DZ8A 3B2VH 2EYSA 3QIWB 3DMMB 3LKPB 4EDXB 1I1CA 3ILPA 5BZWB 4NSKA 3VI4F 5IR1A 3VH8G 2GTWA 1EAJA 4E0RB 3PP4L 5BOPA 4IIQA 5KVMC 5D1XD 3QEQE 3DROA 4OB5H 3REWA 3Q1SH 5JUEH 3TO4A 4UIMA 1NMBH 1U8OB 1EZVX 4B50A 3HR6A 5KJRL 4PUBL 1NCBH 5F88A 1YECH 2R1YA 4JDZA 4DGVH 5D1ZB 2BVYA 1JZ8A 4X4MA 2JJWA 2WIIA 2CO7B 5AZEL 3VDCA 1OP5K 3SKMB 3SJVD 4NO0B 4RGNC 4J3WA 1E27A 1RK0A 2ZPKH 4Q6IB 4F7MA 4KROC 3RFZC 3D9AL 1CBVL 3FAXA 1A0QL 1MAMH 5TDOA 3TA3C 2VLRD 3DHJA 4X4YA 2KZWA 3BPCB 4GAFB 3OF6D 4YBQC 3SGDI 1OAUL 4NP4H 3LRSB 4BSVA 1S5HA 5IEKB 2F54E 2Y36H 5B3JF 1Z6JT 3WN5C 1KGCD 3FAWA 4C56E 1MRCH 1JGDB 4XMPH 3VWJD 5IVNA 2UWEA 3BDYH 1YDPA 3U9UB 3LHPL 1NJ9B 5IJVA 2D2OA 4U1JA 1HHGB 4KZEH 25C8H 3OKLB 4RMRA 43C9B 5BZDB 4PG9A 1EEUA 4ZMAT 1VDGA 4BSWB 3LN5B 3ULUF 1MRFL 3KAAA 1U91A 1NC2A 5FECA 1CDHA 2H32A 2VABA 2BY1A 4AENA 3HNVH 1A6ZA 2EDXA 4HEPG 2WQRA 5DFTA 2NX5E 3DLQR 3TVMD 3V0WL 3WS6C 3RZCD 1T7YA 4G6ML 4JPWL 1I1RA 1A7NH 4V1DD 4Z0BH 5HJ3B 43CAB 4RWYH 5I1LB 1MWAA 3W39B 5DJ0A 1JV5B 1RZJL 3UTOA 2ARJB 3G6AA 4GKNB 2UZYB 1LO3H 1O0VA 5KG9B 1FO0B 5HGAB 4XPHL 2CLVB 4F33B 2GCYA 5DLMH 3VFNA 1AIFA 1NCAH 3GHEL 2AP2A 2VZOA 3T0VA 4F8QA 4JFYB 2DKSA 1R3KA 2P5ED 4J4PC 5CJXA 5IQ9B 3MFGB 2FL5B 4WV1B 2YMXL 5KN5A 5CZXD 4KZDH 3QDMD 2X4PB 1UM4L 5E6ID 2C3VA 3O11A 4G8GE 4IDJH 3GI8L 3QCUL 3QHFH 2MPAL 2XFXA 4GQPH 3S37H 3ARGD 2Z35B 3DX7A 4YHIA 4F7TA 1BM3L 4KDTA 1KJMA 5KS9A 4P2QB 1KCKA 2ZSVA 4L4VD 4NRYB 5TDNA 4P2OB 1UWEH 2AGJH 4HJ0D 1AGFA 3EYFA 3JV4A 3LS4L 2DLIA 3NACH 4PJFB 2R0KH 1NGPH 4JCLA 1QRND 4RMWA 1L7TL 1OQOA 4RNRA 3WNOA 4ZXBA 3N1MC 1CU4H 3P9LA 1UJTA 3I3BA 3BDXA 3OJDB 4X6CE 1Z9LA 2GY7B 5E2VL 4O9HH 4XVUD 5MEQA 1A47A 15C8L 4NYLA 3IS0X 4X7CC 2OL3L 1S7SA 2V7NB 1T1ZB 4NQSA 1IBGL 5I1GL 2WBKA 4WUUE 5DEZA 5AZ2H 5A16A 4NFCA 4Y19D 1T83C 5GGTA 1PSKL 5J57B 5IFHH 2ZOLB 4PJ8C 3W0WA 5C0RH 1FYTD 1J8HB 3GGWB 3IKCA 4XP6H 3MCG1 3ARZA 4LVOB 1Q9LA 1CGSH 2VYRE 1BZ7B 1FFNA 3HI1A 1ZA6B 3AY4C 3FL7A 4R7DB 5IUSA 1VFAB 2FNBA 5F9AC 3O45A 3GMNB 3QXDA 3AM8A 2ZSWB 1J1PH 3G5VB 3DXAA 1WITA 4P46A 3GRWA 1VPOH 5A1AA 4I4WB 3MV11 1KB5A 2R9HC 4IOIB 4R4ND 1D9KB 1Q94A 1KPVB 3QIUC 5TE6L 4EIGB 3QEHB 4RGMC 4IRJA 5DO2C 4M4PA 4YGVB 1VERA 4OZHB 4YDJB 1RU9L 3WHE1 4PGEA 5D72L 3A6BH 4P99A 2BK8A 3O3AB 1CDIA 1NAKL 4KMLB 2NW2A 2VLJA 4NT6B 4AQOA 3AAZA 3HNSH 1XGPA 1TJIL 5L9DH 4R0LC 1FH5H 2OJEB 4JFXB 5F9JB 4DN4L 4FG6C 1E4WL 4M5ZL 2YSSA 1C5BH 3QPQD 4U7SA 2KBGA 4HCRA 4YWGL 3RWCB 1TTFA 2V9RA 1N7MH 5C08B 1X7QB 1MAKA 2OK0H 3I6GB 1IFHH 5GXBB 1MLCA 4YR6B 2YD7A 4MJID 5JOFA 1A6AB 2YKLH 3HUJA 1EPFA 5A2LH 4NKOB 3ARBB 3TT1L 5GHWH 2ATKB 4Y0GA 3U0WH 3IJYB 2WQ8A 1DBKH 4PJ5A 2YUWA 3LDBB 5CKGA 4UU9B 2ESVA 4M61B 3WJLC 5HGDA 1XF3A 1BBJA 5HVHB 2BJML 2E3VA 2H2PC 5BVJA 4IEFB 5FGBA 5IVXE 5T3XD 3KPQB 4JB9L 1J5OL 4H25A 1GOGA 4ESKA 4ZPTB 3MLXL 2EIBA 4F58L 1QQDB 3FB6A 4BFBD 4ETQA 5DD3L 5C09D 3T0XA 4GAYB 2KH2B 3ET9F 4M43L 2I27N 3D3VA 1UA6L 2DDQL 3LQZB 2YPLA 5CBEA 3ULVF 5EDXA 4NQEB 4OF3A 1YNLH 3DWTA 1CDGA 1H5BA 5F1SA 4PRPD 2NXZD 3VFMB 5D8JL 3P4MA 2V2WA 4GG8A 3ULSA 1DDHB 2FRGP 2QEJA 4M6ML 3C9NB 1OB1A 3MRGB 3KPPB 3QT2A 3L3DB 4OZ4B 4G6KL 4Y2DC 3W2DL 4ZQKA 3NCMA 1ZHBB 4F57L 4GXVH 5DC0A 1ZGLP 2PO6B 5EN2B 3NIGE 4X7TA 1JNNL 1P9MC 1QSED 3V5HA 5GGSA 1ORQA 3NFPA 3BGAA 2NNAB 3V9FA 1HQ4B 4MDJA 4Q9QH 4OCXH 1UYWL 2HLFC 4NNXA 3UBXB 4JDVA 5D5MA 2QKIB 2B7DT 4I18B 1HSAA 4TTDC 5LGJB 1OGAD 5DURD 4JANB 1MHHB 1I8LA 3LQAH 1KIPB 4N5EC 3ES6A 2MTPA 5GRYA 2AERT 3FRPG 5LGHL 4DZBA 3GMMA 1RIVH 3UTTD 3BEVB 1UACL 4U1HA 5C6WH 3V4PH 3T0EE 1OT1A 4JN1H 5DQDL 1EGJL 3NZ8A 3MX0A 5D7KE 2BNUB 5SWSB 4RX4A 1UH3A 5GGVY 4LQFL 5FDWA 4FQCL 5DF0A 1XIWA 5CEYA 3ALWA 2XRAH 1BX2B 4U6VL 4OCRH 3FN0L 4JFEA 4XWOD 1ZXQA 1CE1L 4HW6A 2IFFH 1P4LB 2R0ZH 3QB7C 5CS7A 4ZS7L 3HC0A 3IRZA 5D2LF 2YD5A 4QHMB 4YPJA 4GBXB 1FFOA 1FFQA 5ESAA 3VG0H 3FQXA 4KI5F 5CUSL 3WIFB 1D5XB 2RBLA 1CLYH 4QCIB 2OYPA 1T03L 1SY6L 1FC2D 3CNKA 1XR8A 2OS7A 1UJ3B 4X9IA 1NEZB 5I16A 2E9JA 4IRSC 1QLRB 1PZ5B 1X4ZA 1MHEA 1R5IA 1J11A 3EYQC 3SDAA 1FSKB 1KTRL 2XZCH 5JHLL 3JSSA 4HWUA 4HZLB 5FGSA 5A40E 1GZQB 1HINH 2Y23A 4FQ2H 4LLAA 4AG4L 3S35L 1DQLH 3PGCA 5HD8C 3RX8A 3OKMB 1JRHH 3ZHLA 2PTVA 1ZAGA 3EYVA 4GW1A 3D39B 3C6LD 2R0LL 2D4DA 3NA9H 3H9SE 4Z78A 2C7UB 2MQ3A 1BD2A 2OR8A 3O2WH 1ACYL 1TCMA 2F9BT 1XGRB 5J3HC 3R0NA 1F6AB 3ZZ1A 4FQXB 1IARB 5L0QC 3V2AR 2AV1A 4UNVA 3BH8B 1I9IL 5FV2A 3VH8A 3WO3B 1JZ3A 1TVDA 4HWBL 3CUPA 4HUUB 1LEIA 2P8LB 5DJXB 1A4JA 2GSGB 5IW6B 2R2EA 3W9DB 4R97C 1Q1JL 4X9HA 4QOKD 1KLGB 1LK2A 2NY1D 3WUWA 2BC4A 3IU3A 4XTRC 1UENA 4YDKH 1KELL 1VKXA 1B9ZA 5GRZA 2HFFB 5IEHA 5BRZE 3BIKB 5C0FA 3IVKB 2EH8H 3R8BB 4Y16A 3THMH 3D87B 4WVRA 1SHMA 1OD9A 2OTWA 4A2MA 1Q72H 4KRNA 4YC2C 3S6CA 2AJYL 4TUJA 5J11B 5EA0L 2DTMH 2JIXA 5BMFL 2AQ2A 5DUMH 1MQ8A 3IT8D 1BECA 1FN4B 1NDMB 5EU6E 2IQAA 2HA1A 3PGDA 2OTPA 2EXYD 1J88A 2PN5A 2X9XA 1BJMA 4JFDB 3G9VA 3QUZC 4OCYH 4NZRL 5HPMA 3NH7L 5K9JH 3O2DH 4ZDHB 2ITDB 3PV6B 4Y5VA 3O4LA 2MQ0A 2FX9L 3WN5B 1EEZA 3WL9A 2PW1B 3ARFC 2XY2A 1BGXL 5D1XB 2Z31A 1VADA 2ZCKH 3PHQA 4XB8A 4F2MA 1JZ5A 1UC6A 1R3JA 5E8EA 3B4NA 3L1OL 2IAMD 3UO1L 1JGUL 1LO2L 2CQVA 3TNMB 2AK4B 4UTAL 2A0LD 4NBYB 4J12A 2HT2D 3VXRD 1FORL 3MRPA 3OKNB 2YPKA 5EOCJ 1OF2B 3SJVB 2CRIA 2JCCB 3GMQB 5GS1C 4NZDA 3RX7A 1HXMA 2JJTC 2VLRB 1S9VA 2APTA 2XZAL 3QG6A 1S9WB 4YFEA 1AQDA 4LCCC 1TZIA 4PJXF 3S8WA 2C1PB 5L88L 2GITA 5CIPB 5HTSA 3QFJB 3LPGA 4OAWA 4JFFB 2N4IA 4P3CL 1CD9B 1C12A 1WIUA 2MQCA 5DJ6B 3DVNA 5DD0H 4LKCB 4XNXL 5HI5C 1KJ3L 3K8KA 3BXNA 5C0BA 3VWJB 4ZFGL 2E7CA 3PWLB 3HS0B 1HKFA 3VI3F 4GG6B 1YNTB 4JCMA 3OG4B 2K7PA 1XGTA 1WBYB 3MYZA 3QQ3A 4M93C 2OL3A 1KCRL 5GGRY 4GQ9L 3PWUB 1AO7A 1ZWIB 1ZOXA 3MRRB 5EO9B 1Q9WA 1JI2A 3DX8A 3WNNA 1IT9H 3LS5L 4M3JA 3CLEL 2NY5L 3RZCB 3T2NH 4KQ3L 5ID0B 3EBAA 5IROC 2XA8L 4KXZH 4RFNB 4LLWB 4V1DB 1A3LL 1M6OB 4EZMA 3CFEB 3QEQD 4JY4A 4LDOB 4GKZA 2DB8A 1E4KA 2VSCA 3O0RL 3K0WA 4ERSH 4WHYG 3KYNB 5TH2A 1NQBA 3T1FA 4DKFL 5DHVA 1CDCA 4E42B 1MCOH 3KNBB 5FKAB 3W82A 5CEXA 4PRHD 2P5EB 1S9XA 4QWWC 1JGEB 1F4YH 5D7LE 1FNEA 1R3HA 3BZ4A 1KLFA 3AS3A 3QDMB 4XI5C 5F9WC 5CP7B 1N0XL 4ODBD 5E6IB 1RJZB 3VGGA 3V5DB 3H7LA 2VR5A 5I66B 1MFBH 3ARGB 4LDLB 3D0LA 5F9OL 4ZUSA 1WC7A 3FT2B 4EKXA 2F54D 3L5WB 2UWEF 2P5WA 3KJ6L 1HEZB 1T66C 2ICWI 3MLWL 4HPYH 1F3DH 1D5ZB 4C56D 4PGCA 3FFCA 4L4VB 5IBUB 5HGGS 5T33H 3UBXG 1MEXH 4K8RD 3TLRA 5JDSB 2FLBT 1X6NA 4PS4H 1RJCA 1GCFA 4X80H 3OHXB 2X4UB 3RWEA 5FOBB 2VXSL 3X14A 3VXTB 1AXSA 4HBCL 4OZGE 1DBJL 1WJ3A 4RFOL 3UTSE 4OUUA 1MVUA 2VLLB 5EUOF 5GSRA 2W9DL 2NX5D 4O02H 3QISA 1WIPA 3HLAB 1IAOA 3RBGA 3MBXL 5JA8B 1H3WM 1Y0LA 3NABH 2CIKB 5ACMA 3WHXB 4P4RB 5ADPL 4YHZL 1UXWA 4JKKA 4YHYB 4MS8C 4NC1C 4RGMB 1DR9A