1GXEA

Central domain of cardiac myosin binding protein c
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
130
structure length
130
Chain Sequence
b'RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN BINDING PROTEIN C, CARDIAC-TYPE
publication title Structure, Stability and Dynamics of the Central Domain of Cardiac Myosin Binding Protein C (Mybp-C): Implications for Multidomain Assembly and Causes for Cardiomyopathy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytoskeleton
total genus 8
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2002-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gxeA00
3M8OL 4L8DB 3LZFH 3PE9A 1X4ZA 1I7UB 3ELAT 4NHUA 3I9GL 1JYNA 1UQSA 1TQCC 1J8HD 4BH8A 4X9IA 5HHMB 5K93A 1VACB 3O2DA 4L4VE 1J8HA 2DWDB 1IAOB 1EXUB 1T66C 4HXBH 1P7QB 3VGAB 4AY0A 2EH8L 4NUJA 2IANE 1TCMA 3QUMA 1LDPH 1NC2B 5EG6C 3WNKA 4TSCH 1DQQB 3U0WH 2W65A 5DRZA 2AJXL 4TPRL 2CJUH 3C2SA 1MRFL 2BVTA 3WL9A 3PWPB 1UB6A 4KV5F 1NBVH 1JNHB 3AAZB 1FYTA 1VENA 4JO2L 5I0DA 2OMNA 4B50A 5EIQA 3H9HA 1YJDC 2QKIA 3RHWK 3T0EB 3P11H 1VA9A 3MRDB 4HJJH 1F4YH 4M3KB 4D0BA 1XIWB 3K81A 3V0AC 2BVUA 1UACL 1VGEL 4LVEA 4QRPE 4UDTB 1I9RH 1T7ZA 1FQ9C 3G9AB 1FZMB 3L6FA 3MRKA 4L8BA 5CUSL 3V2AR 1QFWH 5EBLA 1W0VB 3RWGB 2XWTA 4X0KA 1HCVA 4P2RB 3MJ6A 1GC1L 3TV3H 4GG6F 1DBML 1JGVH 4LCCC 3VWJB 2J8OA 1YEDA 4NRXA 1BLNB 1TVHA 3NZ8B 2R1XA 4JDVA 4LCYA 4XCEA 5ERWA 4LSRL 5JXEC 1FZJA 3QIUD 4NC1C 4WV1A 3INUL 1J0JA 3ARDD 3LEYL 2IQAA 3QDHA 5FYKH 3SE4C 3QIUA 3BKJL 1MCPH 2J12B 3WFBH 3ARDA 1IKNC 5GZNC 1PZ5B 1OT2A 4IRZH 1S7UA 1TQBC 4OLVL 5FYKE 3REWA 5IV2B 1MEXL 4YGAB 4I3SL 5BOPA 5K9QG 3RY6A 5BRZB 2VLJD 4QRRD 3GHEH 3B6SA 2M8XA 3QIBD 4GRMB 1CLYH 1HXMA 5F1NB 4N0YL 4MB4A 4N0UA 1G1CA 2AV7B 1JZ3A 1NFDB 3HE6C 3N0PB 3EDKA 1YC8A 2HT4C 2X4PA 1D5BB 2E6JA 4ALAH 1LQSR 5FO9B 3LEVL 3FB5A 4PJXB 1L4IA 3BO8A 3GJFB 5GSVA 1OM3L 2I9TB 2CIIA 4XWGL 4C83B 4RMWA 1EEZB 1IL1A 3UYOD 2ZCLH 1YEEL 5CEZD 1YEGL 3C60C 4R0LB 1CF8H 3OR7B 4ZXBD 4JVPA 1U95B 3VFGL 4HF5L 5IVXE 5K9KB 2DQTH 4GRWF 2E6PA 4LGSB 1WT5A 5DZOA 4ZXBA 1CICB 1C8PA 1ZVSB 4K94H 3LB6D 3QG7H 1IC5H 4Y5VA 1NAML 4OTXL 4PJEA 4GW4A 5HYQA 4XNZB 2IQ9H 3MROB 1J11A 4HS6B 3GMMA 5EORL 3NFPB 3LAFA 1S5IH 2Y6SD 2D3VA 3JTTA 5D1XD 6CGTA 3BKCL 3B4NA 4NBYB 3QISA 5D1XA 2IADA 5SX5H 5GGSY 4NO5A 2BMKA 3MMEB 2J2ZA 4HUKB 3ARGD 2AERT 2BJMH 2Y4SA 1P1ZB 4CMMA 1UJTA 5AAWA 4ZFOL 2EYSA 3ARGA 4K3HA 1FBIL 2LFGA 1OY3B 4X4XB 3IDXL 2EDHA 3TBWB 4KRPC 4NWUL 1QBML 1XF5A 1ACYL 2QSTA 5ELIA 1EDQA 1KXQE 4L9DA 5IB5A 3O0RH 1KCVL 2LU4A 1F90L 5AAMA 3UTSE 1LE9B 2CSPA 1JFQH 2CLRA 4JKMA 4LPWA 2R69H 1RUKL 3EOBA 4XB7A 1JWSA 1N5YH 1Z0MA 3FB8A 4POZD 5AYUL 5I17A 4X9FA 4ZDHB 3VFMB 4ZQKA 4WFFD 5HVFB 4MNHB 1KB5B 4KKBD 4FFVC 4WI5A 5D71H 2QR0A 5HI3C 1C5DA 4WCYL 5E24E 4NHUB 1PLGL 3ZKXB 1UQSB 3RL1A 2G9HA 1N0XH 3Q5YA 4BUHA 4BH8B 4PY8I 1A6ZA 4HGKC 3WS6A 4HKXB 1J8HB 4DJMA 1N6QH 3NN8A 4NUJB 2Y07H 4XNYH 3U46A 4R2GC 3QPXH 2MPAH 5HHOD 1RJYA 3D3VE 1PKQA 2HKHH 4XXCA 4LCWD 3MUGA 5IVNA 5LXGL 3WL9B 4JFPA 5HHOA 2JB6A 1UB6B 4LCWA 4N90D 2X2YA 4PJHE 1FYTB 2NR6D 4K7PH 3G6DH 1T21A 3V5HA 3H9HB 5KG9A 2QKIB 4U0QB 1NPUA 4W6XB 2FSEA 2HFEA 5J8OA 5D7LD 4D0BB 5L8LB 1NDMA 1P6AB 5TE7H 1IEAA 1JZ5A 2EXYC 2FD6H 4PJCE 4FQQA 4V2CB 4L8BB 4UIMA 2G75A 5EBLB 1S7VA 3LKQA 4X0KB 2RQ8A 1IILE 1J10A 2V9RA 3EGSA 3EJJX 1ZLSL 2DJSA 4PBVC 2ZOKA 3UMTA 1Q0XL 4YHNA 1MHCA 4LEOA 1G0DA 2NZIA 3K2MC 2R4RH 3QUKA 1YEDB 4OCRL 4RAHA 1BWWA 4Q9QH 4QHUA 5D70H 2R1XB 4JDVB 5SV3A 4Q7DA 4LCYB 4XCEB 4MS8C 5ERWB 1J0YA 1CLCA 1RUPL 1NGWA 2PN5A 3H9ZA 4HD9A 3OKLB 3P9MA 3QZWA 2X41A 4WV1B 2IQAB 1X3DA 5HI4C 3IXTA 3QIUB 1NBYA 2WINA 2CKBH 3ARDB 5T33L 1KBGL 3RPIA 4M1DL 4Z0XA 1S7UB 3Q6FA 4BQ9A 3VMPA 2N1KA 5GS0D 3FONA 3REWB 4HIEA 5DWUL 3EYSH 3O3DB 5FHAL 3WV0A 3B6SB 4GOSA 3VXPA 5DMGC 4UU9A 3VXSD 1YMME 2ENYA 2H45A 1UB5A 3SDAC 1A6WL 3IJHA 1F8TH 5E03A 3W11D 2X4PB 3VXSA 4OQ1A 1CE6B 5E4EC 3U9UA 2X4UA 3FB5B 3H9YA 5I18L 1AR2A 4KMTL 5T3XH 4UTAH 3BO8B 1NMBH 4OD3L 3U6RA 4EIZC 2CIIB 2CLVA 1RUAL 1BD2D 1FZOA 1IL1B 4RISL 4KKAC 2C3VA 4JO3L 1SVZA 2VC2H 4FNLL 4RMUA 5T5NF 3BYTA 1BD2A 4FFWC 5T3XE 3BPLC 3CFJA 3V0WL 4ZXBB 3MLYL 5HYEA 1IEHA 5F9JA 1BAFH 3O6MH 3WN5A 3H42L 1JRHH 5DMIL 4Y5VB 1PG7H 4NM4L 4YZFF 5DUPH 4LPVA 2BNRE 4PJEB 4GW4B 5HYQB 3GMMB 3OGOE 2OTWA 5F9OL 1IC4L 1KTDB 5J0BA 3OAUL 5EUOA 1I7TB 4QHNA 1JK8A 1D6EA 5GRXG 3S34H 3FQNA 5D1XB 2IADB 2GIYA 4NO5B 4UQ2A 2WBJC 2VH5H 2YPVL 1X9QA 5ACZB 4R4FH 5KSBB 1JTOA 1V5JA 3PGCA 5FYKU 4CMMB 2D7TL 5HYSG 2J8UA 1YEJH 1NEZG 5GRVK 2EYSB 3KR3L 3ARGB 3O45A 2BSTA 3QP3A 4NFDA 1XF5B 4G6FB 4GXUN 2W92A 3KPQA 3HC4H 3RGVC 4UOW1 2HMID 2DD8H 2CLRB 35C8H 4M5YH 5I1HL 3EOBB 3IETA 3W5MA 1INDH 2QQNL 1JWSB 3FB8B 1A9BA 1WCBA 1DUYA 2PTTA 4S1SH 5I17B 4ZQKB 3CIQA 4WWKC 3MUHL 1MCCA 3OTTA 4NWTL 1C5DB 2IC2A 4K9EL 3HFML 2JB5H 3RL1B 2G9HB 1M71A 3RVVD 5A16A 4PTUA 2FHCA 1A6ZB 4NN7C 2R29H 3Q1SH 1I8KA 4OKVA 5HDOA 4FA8A 3V79C 4BKLA 5LJYH 5C6PB 5I8CA 1K6QL 1U58A 3BZFA 4EI5C 4HULB 3PWJB 3KDMA 5GHWL 3NN8B 1IGYA 4WUKH 3FN0H 4OZFG 3U46B 1I85C 4TUKH 2VN4A 3ZMRA 4AMKL 5CBAA 5IBTH 1AGCA 1AHWC 1PKQB 5F7KC 2LVEA 3MUGB 2H6PA 5KBNC 4JFPB 1NBQA 5HHOB 2JB6B 1UGNA 5T5FH 4POYA 4PJDE 4LCWB 2HT2C 3IDYC 4BZ1H 4XNXL 5I19H 1DSFH 4RA0C 1B0RA 4FFZH 4OGYH 3GSRA 4GXVH 3RTQD 5HHVH 5DQDL 1T21B 1Q8MA 4JFDD 5KG9B 1O7VA 3RTQA 1AD0A 2IFGA 4BFIA 1IT9L 2FSEB 4LQ1A 4JFDA 3VCLA 3T0XA 2IGFH 5J9PA 1S9WB 2AABH 5JOFA 1RFDH 1UC6A 1NDMB 2BY0A 4JCLA 1IEAB 3BGAA 4FQQB 4UIMB 4WVRA 2G75B 1S7VB 3LKQB 1J1PL 2E7BA 4NZTH 4P9HH 3SCMD 3QAZC 2W91A 3EGSB 2VL4A 4PJBA 2ZOKB 3QEHA 3NCYP 3LKNB 1MHCB 3FMGL 3UBXG 4LEOB 5JW4M 1JJUA 4BZ2L 2PNDA 3K2UH 3SCMA 3QUKB 4L4TD 2QJDA 1A8JH 1KEML 3P73A 5LAXA 1XGTA 3PWVB 4QHUB 3ME0A 3KPMA 1SJXA 3K4AA 3IAPA 5BZDB 3C6LA 1RU9H 1NGWB 3AS3A 4ZNCD 4LNRA 5SWSD 3QZWB 5GXBB 3BZEA 1NUFA 5DO2C 3KLAA 1S7XB 3MRIA 3IXTB 5C8JA 1BQHA 5SWSA 3HG1E 1T1ZA 4EQ2A 1NBYB 2WINB 5JW3L 2VZVA 4NN6B 2BERA 5DT1L 3RPIB 2XZQL 1AY1H 4Z0XB 1V3LA 1N64H 3Q6FB 3FFCD 3RQ3A 3FONB 4G3YH 3S9DB 4HIEB 3FFCA 2LE9A 4MZ2A 2Q8AL 3S97C 4Z7UE 5GS2D 3MRLA 3VXPB 2BVOA 1PGRB 1D5IH 3DX6A 4UU9B 3KJ6H 4S1DC 5CZXD 5DHVH 1RZ8A 1UB5B 1OAQL 2EDYA 5DR5H 1ORSA 1GSMA 1GAFH 3IJHB 4OGAC 3L5XL 5E8OA 5D8JL 3V4PL 3MLRH 4YDVB 3U9UB 2X4UB 4M1CC 4JFEE 4LSUL 2AKRA 1W72A 4DN4L 1DVFC 3U6RB 2YPLA 2AXFA 1XIWC 1FZOB 5EZOL 2C3VB 2DLHA 1CZ8H 4KTEH 1BD2B 3TF7C 3QJFA 1TJHL 4PV8A 3CFJB 1YNKH 3MCKA 4OZHE 3UJJL 4D2NA 3B9KD 5F9JB 1R3JA 4M8VA 3WN5B 3K8LA 1UADC 4WO4D 3T2QA 1HSBA 3QFJD 4M7KH 2VABB 1BGXL 3B9KA 2L7UA 4WO4A 3HZYA 3DXAA 1GIGL 3QEQD 3QFJA 2OTWB 3GJFK 3JBG7 2CGRL 1YYLL 5EUOB 4QHNB 1JK8B 3QEQA 4QKXB 1D6EB 4LK4A 1DLHA 4JG0H 3FQNB 2P44B 1RAMA 5C07E 3WNLA 1OSPH 3S35X 1ND0A 3LKPA 4UQ2B 4TQEL 3DX7A 3H7LA 1DE4A 4DGIH 2W0PA 4JO4H 15C8L 3PGCB 3KHQA 4PRIE 2J8UB 1K85A 4ZS7L 25C8H 1NCCH 3MOBL 1MCKA 2V5TA 3O45B 4LRIC 3PWLA 2FH8A 2BSTB 1JYWA 3WJLC 4ZTOH 1FORH 1ZANH 5CJXC 4YUEH 5J6GA 3VW3H 4TVPH 2DLEA 4LSPH 1TITA 3KPQB 3VH8B 1S7RB 3GB7B 5EO0A 1A6UL 1FH5H 3QXWA 2DDQH 2Z4QA 2PO6A 1MWAA 2EKJA 4MNQE 4YR6A 2VIRA 5I15H 5L8JB 1KIRA 4NQCE 2A6IA 5E6YA 4TVPE 3IETB 1KYOJ 3O6FD 5H2BA 3UYRH 4DW2H 5J1AB 4R0LC 5E4IA 4RGND 1A9BB 1WCBB 4Q6YA 1WBXA 3MBED 1DUYB 1OAUH 2PTTB 4H1LG 2FX9L 1KFAL 1OD9A 1OAKL 1ZOXA 2K9UA 3KJ4C 3CNKA 5EU7C 2FBJL 3ZDZF 4P3CH 5DQJA 3MBEA 3WUWA 4DGVH 3MRBA 4JAMA 1JGLH 3WD5H 1JVKA 3KPPA 4ODHL 1IGTA 5A16B 4PTUB 4NQUA 5HI5C 1I8KB 4LP4A 4XPAL 1I3GH 2NY2D 4OKVB 5BV7L 1LP9F 4BKLB 5I71B 4GKNA 5I8CB 1U58B 4MA1B 3BZFB 2ICES 1A6PA 2DQIH 3RVWC 5ALCH 5FFLA 2FO4A 3KDMB 1IGYB 1Q94A 3SY0A 3B5HA 3WO4B 5CBAB 3VFVA 1M7DA 4YHKL 3HE7C 4G43A 1AGCB 4QXTA 1IQWL 3IFNH 2H6PB 4OM0H 1BFOA 3OQ3B 5GS1A 1RK1B 1MF2H 3GSRB 3UAJC 5GQBA 4YHYB 4I0KA 4H8WC 4KI5F 3EW3B 3RTQB 1AD0B 5CIPB 4BFIB 5DUBA 2P42B 4JFDB 3VCLB 2FEDD 3S37H 1P7HL 4DKFL 1FRGL 5JOFB 4PG9A 3TCXA 3NAAH 4GS7B 4LKCA 4Z7OF 2FJHA 3EFDL 4M61B 3NGBC 5I8OH 4JR9L 4TUJA 3RKPA 1A64A 4PJBB 2J1KA 3QEHB 4M8QA 4L4JA 1KCUL 2F19H 4ZNEA 2OMBA 3GMNB 3HRZA 3RBGA 1MPAH 4S11A 2MKWA 3TWCH 4KMLB 4JDTH 1TVDA 1YEKL 3P73B 5E6ZA 5F8RC 1ZS8A 4X7DC 2J6EL 3FO0H 4V1DE 3T0EE 4L9LA 3KPMB 1CIDA 3C6LB 1QNZL 2CK0L 1EGJA 2F58H 4LNRB 2IBGA 1GGYA 3BZEB 3O6LH 3KLAB 4RDQF 3MRIB 5C8JB 1BQHB 3B2UD 5SWSB 2FGZA 1T1ZB 5FO8B 2N7BA 3EYQD 5J3HD 2P8MA 4YK4B 5A43C 2D4DA 2P5WD 2YRLA 2A9NL 3RDTC 1L9NA 2V17H 3QEGH 4WEBL 1KACB 1F42A 3FFCB 1XGQA 4NQVA 2Y06L 1MJ7L 3TH3T 1A0QL 3DX6B 5HPOA 1RZ8B 1UWEH 2XXCB 1ORSB 2LQRA 2A38A 2CLZA 2RR3A 1MJUL 4Z7WF 4OFPA 1D9KD 4Q9BA 2AKRB 1W72B 2YPLB 2EO1A 2AXFB 1BQLH 4UILH 4XP1H 3BDYL 1D9KA 1Y18A 3RPKA 1N7MH 3CJJA 1J87A 2HJFA 1U41A 2DBJA 3QJFB 2P7TB 4PV8B 3VRLE 2FDBP 5BRZE 3MCKB 1SY6L 4DFIA 2QHLA 3O6KH 5MEQA 1DQDL 1R3JB 2L4OA 3GJFH 1KTLA 4ZUSB 3W9EA 1HSBB 2F54D 3OG4B 1EFQA 1NFDE 1KJ3H 5A3ID 3VXMD 5D6CA 2A74B 3HZYB 4WO4B 1CFVH 1VHPA 4ODUA 3DXAB 5TQ0H 3TBYB 2K3TA 5F9WC 1RZFH 3VXMA 5EBMA 3QEQB 4R6UA 1JNNL 3RX7A 4KK9D 2DI8A 2DI7A 3LPWA 1ND0B 4DVRH 3LKPB 2E9JA 1ZVHA 3DX7B 4N1EA 2VR5A 2B1AL 1WAAA 1DE4B 4Z7NF 2BSSA 5IEHA 3OJMB 4OSUH 5TDNA 1CVRA 3PWLB 4P2OD 2YRPA 1HNGA 1T4KA 3T3PF 1MQKH 1GYAA 4P2OA 3MLXL 5J6GB 3IDIA 3C5ZD 3LEXA 2MMXA 5EO0B 2R2CA 2Z4QB 3TT3H 5I1CL 2PO6B 4LGRB 1MWAB 3C5ZA 4P4RA 4R3SA 4YR6B 3P0GB 4Y19A 3B9EA 4N8VA 4XTRD 2VIRB 1IFHH 2A6IB 3ZYIA 4P3WA 3ARYA 5H2BB 1UA6L 3REVB 4OCYH 4BA8A 1FFQA 1V8HA 1GOFA 1WBXB 1QVOA 4ZUVA 4DGYH 4Y5XC 2RBLA 2YUVA 1WTLA 2FX8L 1FGVH 3ARZA 3GSQA 5DQJB 3DVNA 3MBEB 1R5VB 5D2NE 4IOFD 3WUWB 2VWEE 3MRBB 2HLFD 3CMOH 2ADFL 4JAMB 4U1NA 1S7SB 5L9DL 2C9AA 2KDGA 4EN3D 3EJZD 3KPPB 1IGTB 1CQYA 2QQKH 2R4SH 1G7LA 1RURH 1NGZA 4FABH 4EN3A 4GKNB 1MHHA 4Y2DC 1KB5H 2EDEA 5I66A 4I5BA 2NY2B 3ALPA 4GQ9L 2F15A 3UPCA 3JVGC 5D2LF 2CD0A 5E6ID 2BFVH 2DQUL 3CX5K 4ZAKA 1DZBA 4KXZH 1Q94B 3SY0B 4G5ZL 5E6IA 3VFVB 1M7DB 3WSQH 1NGYA 4XCCH 4G43B 5D5ME 4QXTB 4AM0A 4GAJL 4N5ED 3O2DH 3SHSA 5B38G 4EUPA 1BFOB 2F53D 3SBWC 1UT9A 5EWIL 5GS1B 3CVIH 3FL7A 4C54A 1HHHA 3RI5F 4OIIH 4Z0BL 2F53A 3BD5A 2LAGB 3QUMH 1J8HE 1MCQA 1FSKB 5JQ6H 5IQ7H 2H1PL 3CDFA 5DUBB 4QXUH 4PG2A 5HDBE 4ZD3L 4PG9B 1ZHBA 4LKCB 2AEPH 5KN5A 5FKPB 3STZA 2F5AH 2NXYD 4IIQC 3P9WB 1OL0A 4TUJB 3R4DA 8CGTA 3K4ZA 4PGBA 4WTZA 2R0LH 4M8QB 3PDDA 2ORBH 1FAKT 4R90L 3HRZB 1JZ6A 1FYTE 5MI0C 2FZ3A 3QSKB 5DZNA 4OF8A 5LGJA 4LVHC 1ZS8B 5EU6A 4L9LB 3PXJA 3KPLA 5GRUL 1WTGT 2OJZH 4R9HA 2BRRH 4I3GA 2GCYA 4FQIL 2DQCL 1G7QA 5F3HB 4X6DA 4U6TA 3FOLA 1G9MC 2EC9U 3L3HA 4GKSA 2P8MB 2JTDA 3Q5OA 1OPGL 3H3PH 3RA7H 1WEJH 1QR1A 5IESL 1XGQB 4NQVB 3MREA 3SDCC 4EVNA 4G6ML 3NIFE 3HNTH 5JMRA 1OT1A 3SPVA 4HUWA 2YOCA 1KN2H 2H8PA 4WEMB 2XI9A 4QCIA 4JRYD 5IT2H 3IJSA 1LK2B 3MLUL 4JRYA 1AJ7L 3P77A 1PEZA 4LF3A 1NMAL 2HKFL 1D9KB 4KFZC 3EJYC 3L1OL 1Y18B 3IT8D 1HI6B 2XV6B 3H7BA 4K07A 3AS2A 2HJFB 4DAGL 1EIBA 4MAYD 5CCKH 4OD1H 4KVCH 3MGAA 4MAYA 4Y2OA 1KTLB 4N0UE 4QRRE 1F11A 3TN0B 4RMSA 4Y4HD 1MCBA 3C09C 4OLYH 2NY6B 1X5HA 1MUJA 3HI5H 4ODUB 3V6ZA 3NBNA 4JKKA 5IEKB 2CRYA 5CEZH 4LOUC 5EBMB 1MFAH 3WNNA 5KVEL 2NPLX 3TBVA 4K3EH 1NCBH 5D7JB 5HGBA 4NQDD 4PYHA 5CEZE 3HZMA 4D9LL 3A6BL 3T3ME 5EOCL 4UAOB 3L95A 4P48A 2BXYA 5JORA 2BSSB 4HXAL 5IEHB 5TDNB 4KJPC 4NKIH 4FFYH 1HWHB 1EJ6A 4PJEE 1EHNA 2APWA 2E5EA 1FG2A 3N85L 1F3RB 1U2HA 2XYCA 5GJSL 4Z7QE 2Y1VA 1T4KB 2H2PD 2W60A 5C2UB 5K9OB 1FFOA 1ZTXH 4P2OB 3IDIB 4TULH 3LEXB 1RMFH 4G8IA 3HI6L 2MNUA 4HEME 4K8RD 4NDMA 3S37X 5GZOD 2B0SL 3F58H 3C5ZB 4R3SB 2RGSA 4WW2A 4Y19B 1ACZA 4N8VB 4YIQA 4GQPH 4NM8H 2HJLA 4RWYL 2YD2A 2IFFH 4X7EC 4MJID 5KOMC 4DWHA 2D03L 1QVOB 4ZUVB 4WUUB 4NUGH 4BQCA 1C5CL 4HLZH 3BSZH 2E8ZA 2PR4H 3H0TA 4MJIA 5D93C 5D1QC 1JHKL 3DVNB 1J1OH 4L5FH 4M93B 3WN5C 3IFPA 5FXCH 4XNQA 1YDPA 3D48R 3V7AG 4PB9H 4U1NB 5SX4I 1DBKL 4P4KD 1MIML 5B3JE 5K9QI 3QULB 4APQD 1G7LB 3MUZ1 3TCLA 4P4KA 5E7BA 5GRWA 5LBSH 4EN3B 1S8DA 1MHHB 4APQA 2EE2A 4NBZB 4K2UL 4LLUA 5I66B 4I5BB 3H3BC 3FTGA 1NAMB 3U7YH 4ZAKB 4IDJH 1A3QA 5D96C 3X12A 5JLZA 1QKZH 4PJ9A 2NY7L 1A14H 2CMRL 4MQ7A 1ZAGA 1NGYB 5I1EH 3U7WL 4AM0B 3GSNL 4WFFE 1MFEH 4S2SA 4RMVA 4IDLA 4FN0A 2ZUQC 4Y4KC 1HHHB 2VDLH 2F53B 1G0XA 2ZKHH 4PJIF 3BMVA 1NCDH 3QCUH 3CFDA 5EZJA 3D25A 1QR4A 3ZT6A 3ZE1E 2ZSWB 4F2MA 5C0RL 1XGPA 3X17A 3PGDA 4UQ3A 1U8QA 4J3WA 1M7XA 2EDXA 1SJVA 2NYYD 3RZCD 1PKQE 5KN5B 3STZB 4NQSA 4JFYA 4XCNA 4O9HL 3EYUH 5HHOE 1MFDL 4PGBB 5EN2A 4R4NC 1MY5A 4LCWE 2QHRH 4C58B 4LLDB 2FZ3B 5ENWA 2YKLL 3KYKL 4N90E 1TVBA 5LGJB 4WU5A 1I9JH 5EU6B 3KPLB 3NCEB 1UEMA 3QXUA 1CK0L 1SEBB 2ICEA 3GBMH 2EDLA 2GCYB 3NH7H 1G7QB 4X6DB 3MLPA 3FOLB 3ILQC 2JJUA 1MJ8H 5FDYA 3L3HB 1WFUA 4EOWH 4GKSB 1K3IA 1UM5L 4NKDA 3VI3E 3G6JA 1QR1B 3OX8A 4WENB 3BKYL 1YJDL 2J88L 3GIZH 1FDLH 5CGYC 4EVNB 5ECJE 1YNLH 3SPVB 4HUWB 1RUMH 3BP6A 1HCFX 4QCIB 1OWWA 1N8ZA 3IJSB 3A67H 4TVSa 1MQ8A 1B3JA 1L0YA 4JQXA 4JRYB 3X3FL 4TNVK 5CHNB 3P77B 2XKSA 4F37F 4LF3B 1KB9K 4XGZA 3T0WA 5GS0H 4TRPL 4OZIE 4R97C 4FRWA 4GS7C 3H7BB 1BECA 3U83A 3ULVC 4U3XA 1IAIM 1FNLA 1WGOA 1KLFA 2YA0A 4K3JL 1IGCL 3S35L 1AH1A 3SGDI 4MAYB 4I2XA 3CSBA 4PGJA 1MJJA 1FE8L 5E56A 4XPGH 1F11B 1OGAD 4OD2A 5CJOH 5IG7A 3VXSE 3CXDH 1MUJB 3C2AH 5L7XL 3V6OC 3V6ZB 3C6LC 2J8HA 1OGAA 3P30H 1ZV5A 1FO0L 4Y4FD 2V7HA 4JQIH 5C09D 3TBVB 1NJ9A 4M6ML 3BT2H 5HGBB 2Z93A 3E6FA 1BD2E 5E1HB 3VI4F 3DSFH 4Y4FA 4U7KA 5C09A 1TTGA 3ESUF 3HZMB 3S5LA 2CH8A 4YK4C 3OZ9H 3L95B 1FGNL 2XWJA 3QFDA 2PYEA 4O4YH 5JORB 3EIFA 3GO1L 3WKNA 1FNAA 3HUJA 2DMCA 2HAZA 1MHPH 4G6AC 1OSZA 1A7QH 1FG2B 2YZ1A 3CLFH 3I50H 1ZLUK 1QUNA 2FLRT 4XNUL 2Y9RT 4EI6A 2PTUA 4XPHL 1KIPA 2W60B 4OF7A 1NMCC 1FFOB 5EUOE 2A0LD 5TFSL 3VGHA 4QWWC 5EBWA 1PX4A 4G8IB 2DWEA 5FCUL 2R2BA 2B5IB 3MTRA 1UWGL 4X5XA 4WW2B 4HQQL 4YIQB 2HYMA 1AKJD 1I1YB 2HJLB 4UINL 1G9NH 2EIEA 4HPOL 3P4OB 1JNLL 4OGXL 1AKJA 4YAQB 4HK3J 1XT5A 3H0TB 3KHOA 4MJIB 5I30L 2Q8BH 2P49B 5FK9A 3IFPB 5C0JA 3ES6A 1HKLL 3VFOA 4XNQB 1LEIA 5KTEH 3DO3A 4OAWA 1KCSH 3KPSB 1T0MA 1IBGL 1GL4B 1CBVH 3UCRA 4Z7WA 3TCLB 4P4KB 1FFRA 1S8DB 4APQB 2F8OA 5DRNA 4LLUB 2G60H 3BDBA 3QQ4A 1N6VA 3FTGB 4DVBA 5CP7A 1NL0L 5L8KB 1MCRA 4K23L 1DBJH 2HWZH 4FOMA 4YXLL 3E2HC 3X12B 1C7SA 5EU5A 4BK4A 4PJ9B 4R4BA 2WQ8A 4ODWA 4MQ7B 3AB0C 1N59A 4P2CG 1NLBH 4S2SB 1T0NB 3EOAA 1A6VH 1OWRM 4JJHA 4ONGL 5EZIL 2B39A 5ANMA 1QLRA 3UJTH 4Z77B 1P4IL 4FQXD 3CFDB 5EZJB 3D25B 5E99H 2NXZD 4JPWH 4XP6H 4FQXA 1EVUA 3RWFA 2EIZA 4F2MB 2PO6C 1XGPB 3PGDB 4UQ3B 1U8QB 5IHUL 2B1HH 4XVUC 1I8MA 4U1GB 5ADPL 2VZTA 1N5AA 3UEZA 1AE6H 4BSWA 1U8MB 2NTFB 2FIKA 1A7RH 4NQSB 4M7JL 4JFYB 2V2XA 4XCNB 4UV4L 5C6TH 1CFTA 5EN2B 5JO5A 5C0AB 3QWOB 1QO3B 3C87A 3VA6A 4LSTL 1HDMA 1ZVYA 4CVXA 1TVBB 4FXGA 4WU5B 1J1XH 1AFVL 1D3CA 3BXNA 4CDHA 1D5XA 3MX0A 1TTUA 4DKAA 4U1MA 5BVPH 4JFDE 1BOGA 2AJYL 4YDLC 1P9MA 1JUFA 1RY7B 5M95B 5CSGA 4PB0H 3VG0H 5GS3A 3MJ9L 3QNZA 5EOCJ 4ZFZA 3O41A 5JHDD 3QYCA 4M1GH 2CKNA 5E8NA 1IGML 5TF0A 4PJBE 3SKJL 4O02L 4NKDB 5JHDA 2AVGA 3G6JB 3PABA 3OB0H 3L9RA 4G8EA 2KUTA 1BFVH 1J0ZA 1P2CA 3QNYA 1AQKH 4NHCL 4UTBH 1T1YA 3BP6B 4WI3A 4J3VA 4HH9A 3C9NA 3VWKD 4OJFH 3MNWA 2DIBA 1N8ZB 2B2XH 4LARH 5GGRY 3V6FA 3ZE2F 8FABA 4S0SD 5SWSE 3D85D 3VWKA 3TPKA 2E7CA 1RPQA 1RZJC 2FIRT 4PJAF 3SDXA 1S7QA 4XGZB 2YA1A 4U1IA 3D85A 3MC0A 3OV6A 1P84J 2X1XR 2SEBA 5J06A 2YA2A 1ZGLM 4MA7H 3QI9B 3FFCE 2C3XA 4RCAA 4WFGD 1G7IA 4XMPL 1A5FH 1W72H 5GRJL 4I2XB 1MJJB 4OLWH 1E4XH 4R7NA 1II4E 4DZBA 4OD2B 4EKXA 5IG7B 4NCDA 3HNSL 3MSPA 4IRJD 1OGAB 2D7QA 2GAZA 2YPLE 4PRHB 3RU8L 1WJ3A 4H20H 5F6IC 3E8UH 4PLKD 4AIXA 4IRJA 4EXPX 2VR9A 1EZVX 1NJ9B 3BGFB 4JY5H 3I6LD 1R0AL 2Z93B 3E6FB 5ESAA 5DLMH 4YX2H 2DL2A 2J6EA 3AY4C 4Y4FB 4NRZB 3S5LB 4JO1H 3TO2A 1ZLUH 3QFDB 2PYEB 3EZ8A 1EEYA 5DMKA 1MH5A 3HUJB 4DZ8A 1KJVA 5E5RB 4I0PD 3HR5A 1OSZB 4KU1A 4QHKI 1H3VA 3QFJE 3UBXI 4EI6B 4MXQD 5IWLA 4I0PA 4J7RA 3MCLH 1QSZA 3QEQE 5HYJD 3QQ3A 2DWEB 4P9MH 2R2BB 4BH7A 1S3KH 3U4BH 4ZFGL 5HYJA 4X5XB 3OSKA 4PLJD 4KAQH 1QBLH 4QNPF 1X5ZA 5J7CC 1AKJB 3PHSA 7CGTA 4G7VL 3UJIL 2BP3A 3BP5B 3MUY1 4PJFA 1JN6B 4X4ZA 1VDGA 4HDIA 5FK9B 2VQUA 3ES6B 3VFOB 1MWAH 1SBSL 4LSSH 1LEIB 3MCG1 2A6JA 5E2TH 2DIAA 4OAWB 2EC9T 5I9QB 1UKSA 2EXWD 3TN0C 2NY6C 5KVDL 1T0MB 3CLEH 3F6IA 4MD4A 1JPTH 1SY6A 4Z7WB 1GC1C 2MFNA 5LGHH 5TH2A 5DRNB 1N4XL 5CBEA 3QQ4B 4U3HA 2MCPL 1Z3GL 5HBBA 1CLOH 5D7JC 2LAAA 4DVBB 1OVZA 3IFOA 4N0RA 5CP7B 2YD6A 3TJHD 1I3VA 4KHTH 3EZJB 3UTPD 5EU5B 4R4BB 4RGNE 4UAOC 1H3PH 4ODWB 5DA0B 1N59B 1DEDA 3GMQA 3EOAB 4XAWH 5DVOA 4UMGA 5ANMB 1QLRB 1PD6A 4OZGA 4I18B 3ULUF 2C1OB 4FQXB 1KXVC 3RWFB 2EIZB 4QHKJ 4NO2A 1A3RH 3V0VA 1I8MB 2NXZB 1M1SA 5DVMA 1N5AB 3R1GL 4BSWB 4N68A 1QRND 4I8DA 4YQXL 2FIKB 1FNHA 1XR8A 2V2XB 1PW3A 5HHPA 1CFTB 5JO5B 4J8RA 5F7MC 4ZPTA 1J18A 4LL9A 1HDMB 4CVXB 1A7OH 4FXGB 1WZKA 2IF7A 2NTSP 3BXNB 3MFFA 1D5XB 1NCWH 3PIQA 4U1MB 7FABL 3LIZL 1BOGB 2KZWA 3CK0H 1CT8B 1I9EA 1JUFB 1R3HA 5FYLL 2AQ3A 3AREC 4PRAA 4F8QA 3LHPH 3QNZB 4ZFZB 4P57B 1VPOH 4YJZL 3O41B 4QXGH 2ZOLA 1L9MA 4ZAKC 3RIAK 4N1HB 1Q38A 2E9IA 5E8NB 5BV7B 2O93L 3IU4H 5JHDB 4ZNEE 3PABB 3L9RB 5C0CA 1LVEA 1EGJH 3B43A 1G7JA 5FUOH 3M8OH 3I9GH 1T1YB 1NAKL 3CFIC 4HH9B 1GH7A 1MLCB 3MNWB 2X89A 2GQHA 5CEYA 4ZUWA 4HJ0D 5IBLC 1VEPA 8FABB 4PUBL 2H2SC 3X3GL 2RHEA 4Q0XL 1GOHA 2JCCE 4HFUH 3BWAA 3DROA 5D7KD 3SDXB 1S7QB 4JJ5A 4KWUA 4U1IB 4QHLB 3HI1A 4YBQC 1M7IA 2SEBB 3E3QE 5IBUG 3S7GA 1JHLL 4S1QL 1KXTB 2P5WE 1GGBL 4JHWL 4TPRH 3S98A 1MRFH 3LSOA 1GGCL 1DUZA 1G7IB 1IC7L 3LRSA 1DN2A 4OBSA 4HC1L 1CD1A 1HN1A 3DV4A 2VITA 1XEDA 4R7NB 4DZBB 4JO2H 5IFAL 32C2A 1LO2L 2P1YA 1UJ3C 1I9IL 4M62H 2GAZB 5KSAC 5DFVD 5DD3L 2E27L 5FM5M 5B22A 3EHBD 4JZNA 2X6MA 3WJJA 4IRJB 1OB1A 1UACH 1VGEH 3IDJA 3AUVA 3VFSA 3IU3A 4UZGA 5BJTA 4CU7A 2PW2A 5E94A 1JZ2A 4KK8D 1FC2D 2DQHL 4JDZB 3TO2B 3D39D 2V5RA 1DBMH 3FAXA 5DMKB 1FNGA 1NEUA 3VXNA 3FN9A 2NW2A 3CCHA 4DZ8B 3D39A 3HR5B 1BVZA 3GI9L 2F54E 5HYIA 4OB5H 2IH3A 2WLZA 3VXME 4I0PB 5DEGA 2Z35A 1URLA 3QQ3B 1Z9LA 3WUZA 3LEYH 4BH7B 5HYJB 4P46C 4LDOB 5I1LA 1F4XL 4JFOA 3ISWA 1SJEA 4EQ3A 2WUCH 1WAAE 4CN1A 2RFXA 3MRRB 4PS4L 4UNUA 2R0ZL 3QPQD 5EBGA 4J4PD 1MEXH 3V8OA 4I3SH 3VGDA 4HWBL 4PJFB 1HIML 3JTSA 1YMHA 4HDIB 5HXMA 2JJTC 2YMXL 4J4PA 4OCSL 1QBAA 3UTQA 4GFTB 2A6JB 4R96A 4DN3L 1X44A 2WWMD 4MD4B 2W9LA 3LEVH 5DJZA 5FGSA 4Y19E 5CBEB 2JJSC 1A4JA 3ARFC 4CADA 1YEEH 4AQOA 1YEGH 5HGDA 2FRGP 1HZHH 5JR1L 1IGJA 4KUZL 4YDIL 5EH1A 3GMQB 5CWSA 4XB8A 4MVBD 5DURB 3WDIA 4OZGB 2HRPL 3BQUD 4JHAL 2HT3D 5EORH 1DEEA 4TSAL 3BQUA 1FV1A 3FT2A 3WFEH 3W0WD 4NO2B 5D1ZD 2B5IC 3BKCH 4GSDL 5MHSD 4EUPH 2P46B 3BRFA 1VKXA 5BW7A 3V0VB 2VSDA 4PD4K 3WKML 1EAPA 1C12A 2PXYC 4WI2A 3IRPX 3LOWA 3OMZA 1XR8B 5IJVA 1DL7H 2A6DA 1I75A 5HHPB 1L0QA 2FYYB 1Q9WA 3MBXH 4WEUD 1JGEA 4J8RB 3T08A 1FBIH 4ZPTB 2F53E 5IHZA 5L6YL 4NWUH 1QBMH 1ACYH 1QYGL 3MFFB 3PIQB 4EJ1C 1R3HB 1F90H 1Z0NA 2VZ3A 4PRAB 1BBDL 1BEYL 1MCOH 1KELL 1RUKH 2A83B 4JZJA 3CSGA 2ZOLB 3VXRA 3VMNA 4PJ9C 5AYUH 2I5YL 3RUGF 1D6VL 5C0CB 5IVOA 3LRHA 4OQTA 1G7JB 1ZWIA 1PLGH 1S7WA 4FZEL 1TETL 4NO0D 5HYSA 1T5WB 2WUBL 2DQGL 2XKNA 2YK1L 4N8CL 4NNYA 5CEYB 4ZUWB 2VDQL 3QB7C 4HT1L 4JG1L 4WNQA 4NO0A 5JW5A 4X6DE 3V4UL 4GBXD 2VXTH 1BJ1H 5EU3A 2CO7B 2HFGL 2QSVA 2ZNXA 4O5LL 3ZTNL 3BWAB 3DROB 3VFRA 3R0NA 4JJ5B 1T04A 4GBXA 2VL5A 4QGTA 5HD8D 1KC5L 1VFUA 4LCUA 3HI1B 4YDJA 1AXTL 1M7IB 1CXLA 3F62A 1CDYA 4KUCF 1WQVT 4MMXC 5I1JL 3QBTB 5I1KL 3T2NL 4WY7L 3TGXA 1P4BL 1FYHB 4OT1H 2QSQA 3LRSB 5CZVL 1CD1B 3DV4B 4L8SA 3W82A 2GSGA 5I16A 3HAEA 1OTUC 2QBWA 3MV7D 4JRYE 3CH1A 1WIOA 1NSNL 4N8PA 3MODH 4XWOC 1T66D 4MHHG 4G6JH 4JZNB 3MV7A 4YE4L 1OB1B 2Y7QA 4L3ED 3IDJB 3GRWA 4FQ2L 2W59A 2BSED 2YPKA 3VFSB 3GNML 3IU3B 4XMKL 4QOKD 5IB4A 5BJTB 1BM3H 3CUPA 3MZTA 1QOKA 4L3EA 2PW2B 5C0NC 2ZJSL 3JWDC 4QOKA 4R8WL 1ZLSH 1Q0XH 1HH9A 2NX5D 1TXKA 3GZKA 1PKOA 1FNGB 3VXNB 2Z31D 2NW2B 1NUDA 4ZO9A 4MJ6A 1EV2E 4FTVD 2BCKA 4FQJL 2CDEA 5DEGB 4KHXL 1IGIL 4FTVA 1TPXC 3WFCH 4JN2A 1ZA6A 4CN4A 5DVKA 2WK2A 1H15A 4X9GA 5I1LB 4JFOB 1QA9A 1SYSA 5T33H 3THML 1KBGH 4NQDE 4M1DH 2GYSA 1MREL 3HC0A 3QI9C 3H3KA 4HWZA 5DWUH 1CDCA 2A6KA 3C6SA 5FHAH 1YMHB 4PRBA 3O8XD 1T7WA 4LCCA 4ZMAT 4YHZL 4G9FD 1A6WH 5JXED 4R96B 3UBXA 2XN9A 3NABL 1JIBA 4RNRA 4KI5C 4EXKA 5DJZB 4J6RL 4G9FA 5JXEA 4KMTH 4OD3H 4F57L 1X5LA 4KKBC 3SGKC 3TH2T 1CR9L 2AAVA 5C3LD 4NGHH 1A4JB 3BGFC 4CADB 3SE4A 5GZND 5J4MA 5HGDB 3CMGA 4UDUA 4GUPA 1IKNA 2GJJA 4MJIE 3MRCA 1IGJB 1A22B 5DDHA 1KPRA 1G84A 5CWSB 1OF2B 3ARWA 4MQSB 3F7RA 5I8KL 3DI2B 3H42H 5DMIH 5K9JL 4NM4H 3F7VA 1HEZB 2VSCA 5GGVL 3HE6D 1CGWA 5F7UA 4HAGA 4H0IA 2P47B 5F9OH 1PDKA 1IC4H 3CVHL 3NFSL 1DEEB 3HE6A 3MACL 3BQUB 4ZO7A 1PBYA 1FV1B 5HDQH 1MCHA 3KPNA 3FT2B 4X7FC 3FHAA 3LMJL 3U36A 2XZCH 1B6UA 2DYPA 1VKXB 4HKZB 2EDTA 5E5MA 2ADJA 1CXIA 1EAPB 2ENSA 4U2YA 1U92A 2YPVH 3C60A 5F9DC 3U79A 1XMWA 5IJVB 2V5SA 2A6DB 2D7TH 5ESQA 1Q9WB 5TGBA 1JGEB 1JBJA 1H8SA 3KR3H 5BVJA 5E2JA 1FC1A 2WM0A 3ARQA 1INQA 5MERA 4KDTC 2W1NA 1LDPL 1YPZF 1E6OL 5I1IL 3TT1L 5L2JA 1AXSA 3U0WL 4C4KT 4RAVA 1E4JA 3DMMD 1VGKA 3PDOA 4UNVA 2BOCA 4OV6F 2UY6A 3BKML 1A3LH 2Y72A 4JZJB 4XC1H 2ZG2A 4ODTL 3VXRB 1HQRB 3RY4A 1XCTA 4LLYA 3MRFA 3QO0A 3OR6B 1QBBA 3PP4L 5LWYL 1XFPA 2R56L 1A47A 3LS5L 1T7XA 1ZWIB 2OS7A 4K9EH 1WC7A 3HFMH 4KRPD 1S7WB 4PJ7A 1XGRA 3PHQA 5HYSB 1MI5D 4I18C 1FZKB 2XKNB 3GSNB 4NNYB 1PQZB 4WNQB 4NO0B 1K6QH 1MI5A 5JW5B 1XF2A 4MX7A 1QSED 5EU3B 4PRNA 1SVCP 4GMTL 3MOQA 3MA9L 3VFRB 2HP4A 3DBXA 4GBXB 2VL5B 5GHWH 1QSEA 4LCUB 4YDJB 3G6JE 5DHYA 5JIKA 2PETA 3RWJA 1UXWA 4FFVD 3CFEA 2XTJC 1AO7D 4M7ZC 4XP4H 1JGDA 5HSFA 1UG9A 2XWBB 5J56B 5HI3D 4OLUL 1UVQA 5FYKL 2H32A 1CGVA 1WBYA 3UDWC 4F7TA 4H1LA 4XNXH 3SDYH 1NDGA 4L8SB 3BRGC 2GSGB 5I16B 1TQCB 5DQDH 3N1QC 2QSCL 3CH1B 1G9ML 2ITDA 1IT9H 1BOYA 3U9PH 5H35A 3G5VA 3ZL4L 3MV7B 4PGDA 1WIPA 2Y7QB 2YPKB 3LPFA 4R2GD 3CUPB 4L3EB 5BV7C 2OK0L 1K2DB 4XI5C 4QOKB 3MJ9A 1HH9B 3QRGL 4I2XE 4MXVF 3FMGH 3B83A 4F9LC 2VDKL 1RHFA 3DPBA 2UWEF 4MJ6B 1KEMH 2YBRA 4XPFL 2BCKB 2V9TA 1OGAE 1SYVA 2CDEB 5D7IA 2GFBA 2DQTL 4FTVB 4Y5YC 2V7NA 4JN2B 3X14A 1ZA6B 3PWNA 4B53A 1QQDA 5ISZD 1FL6A 1F97A 1H15B 2EXYD 5C09E 4UT6L 1QA9B 3NIGF 1SYSB 5JW3H 1BMGA 1CXKA 3GHBH 5DT1H 2IQ9L 2M2DA 5FOJA 3HC0B 3ZZ1A 1P53A 2VE6A 3PWUB 3HUJE 4NT6A 1EVTC 4HKJA 2A6KB 3C6SB 2Q8AH 1OTSC 4PRBB 3NIDE 3T77A 4OCWL 3VGGA 5FV1L 4BZYA 3GKZA 1J7VR 4BM7A 4LCCB 1OAQH 4MS8D 3UBXB 1YQ2A 2XN9B 3L5XH 4RNRB 3MNZB 5D8JH 3V4PH 4G9FB 4LSUH 3S4SG 4JM4H 2XQBH 5HI4D 1KTKE 4M43L 4CVWA 3N06B 3RKDC 1CG9A 1M05A 1T83C 3QEUA 5EZOH 4AEIH 1T7YA 4MXWL 2X1PA 4ELMF 4UDUB 3AC0A 5FM4A 2MOVA 1TJHH 4GUPB 1SEQH 3STBA 3VXTB 4YLQT 1JZ7A 3AGVA 4RRPG 3MRCB 4OI8A 4X9HA 1TQBB 1RULH 3GMPA 1FO0B 3UJJH 5DDHB 3QWRD 1KPRB 4WDIA 5DMGD 3QWRA 1X7QA 3F7VB 1BGXH 3SDAD 4OLEA 1T3FA 3VA2C 4DTGL 5EO9A 3SDAA 3HE6B 2CGRH 1YYLH 3DUSB 1FPTL 2W9DH 5F71A 3KPNB 5D71L 3VD9A 3U36B 4LEXL 4KKAD 2DYPB 4HIIB 2ADJB 4OV5A 5TE6L 1U92B 9CGTA 4TQEH 2IPUG 3C60B 3RWEA 15C8H 1V7ML 3HMXL 5ESQB 1T5XA 5TGBB 4X6BA 4ZS7H 3HS0A 3S88L 4M48L 5ANME 3VE0B 5BVJB 1N6QL 1I8IA 5MERB 1INQB 1UZ6E 3VGBA 2K7PA 4XNYL 2J5LB 3ZLQC 3GSOA 3QPXL 4Q6IC 5L2JB 1UM6L 1AXSB 4L1DA 2XQYK 3BPNC 4RAVB 1AXIB 1A6UH 5CJ8A 1T20A 2KZ1B 1VGKB 3PDOB 4DKDC 3ETBF 2WBJD 4K7PL 1CWVA 1NKRA 1XCTB 4LLYB 3QO0B 4XBGA 2FX9H 5F7NC 2WBJA 1KFAH 4JY4A 1HNFA 1OAKH 4GJTB 4U49A 2FBJH 4U6HB 4PREA 2GJ6A 5ACMA 1A7BA 3ZKMC 3SDDC 1WC7B 1NCUA 4PJ7B 1XGRB 3PHQB 1G6VK 4ODHH 2EZ0C 4D94A 5FUZH 4KRPB 3RGVD 4W70A 1UM4L 1MI5B 1XF2B 4MX7B 1EO8L 4M00A 3BE1L 4PRNB 3C8HA 3IDNB 3W9DA 3RGVA 2WAHA 5CS7A 3B5GA 1MCNA 1MCWW 2X1QA 3DBXB 2YD5A 1QSEB 3MOAL 3OPZH 3JWNC 4HW6A 3VMOA 5JHDE 5D70L 3MV8A 5DHYB 4ISVA 3RWJB 4YHKH 4WWKD 1UXWB 3BI9X 3CFEB 4ZUUA 3RIFF 1IQWH 1JGDB 3FB7A 4PP2A 4KH2A 4PRID 4WWKA 1UVQB 4QYOA 3LQZA 2H32B 1WBYB 3RVTC 2AXHA 4WHYG 4F7TB 1G0YR 2WIMA 4H1LB 1DFBL 2CKBL 1NDGB 2FHFA 1DQLL 2C4FU 3BIKA 4LFHD 4Z95L 1WISA 4U6YA 4YDKH 3OBAA 4D0CA 4PPTA 4EI5D 1TNNA 5IVXF 3SDXE 5H35B 3G5VB 5HTSA 3L3GA 3LKSA 3NZHH 4DKFH 1FRGH 1NUGA 4EI5A 3KS0H 5F6HJ 3I2CL 4XZUB 2ICCA 2VN7A 4Z7VA 1H8NA 1JYVA 1I85A 3DSNA 4XC3L 4UTAL 1KCUH 3VD4A 1NMBL 1AHWA 2HT2D 4WFGE 4Z76A 1AIFA 1YEKH 2GUOA 2YBRB 3GSUA 3EFFA 1QZ1A 3HC3H 4H25A 2J6EH 2WBWB 1NBZA 5FKAA 1SYVB 5D7IB 1QNZH 2CK0H 3MXVH 2V7NB 2BY2A 1UXSA 3X14B 3L5HA 5GRYA 3PWNB 1BAFL 1WFOA 3O6ML 4JHBA 4ZOAA 4HLZG 3N1PC 1N0LA 4UUJA 1F2QA 3QDGD 1PG7L 3FO1A 3W39A 3MLZL 5EA0H 3I6LE 3PP3K 2R0KH 5IOPA 4X7SL 4KK6D 4QRQA 3QDGA 5E08L 4KQ3L 2B4CC 2A9NH 2VE6B 4WEBH 4KKCC 4NT6B 4HKJB 3MRGA 5K59E 1XGUA 1MJ7H 2Y06H 3S34L 2D0FA 1A0QH 2Y5EA 5HHMD 1I7UA 3MGTA 3ZSSA 3O6FC 4OFYA 1YY9C 1U36A 1MJUH 5CJQL 3MLWL 1VACA 5DO2D 5HYJE 1U8HA 4M3JA 3QHFL 4HC1A 4XBEL 1X5FA 2EDQA 2VLKB 1M05B 3ZKSD 1MRCL 1NC2D 5D7SL 3QQ9C 5C0DB 5DGRA 3D2UD 3PV7A 4Y8DC 5ICYA 4ETYA 4PJFE 4RFEA 1C08A 1SY6H 1FJ1B 3GMPB 5T1DL 3D2UA 1YYML 2JLLA 3PWPD 4WDIB 1DQDH 2QV2A 2XXMB 5E9DD 4S1DD 35C8L 4CW1A 1CGXA 1INDL 2EDJA 4OGAD 1T3FB 1RD6A 5E9DA 4CJ1A 5MEOA 4M1CD 5EO9B 2VLRD 1FL3A 4JGUA 1DVFD 4N0CD 3GMLA 1XIWD 3IVKA 4RA3A 5C0BD 5E4EB 2VLRA 1TJIL 1DVFA 1XZ0A 4HJGB 4OV5B 1JNNH 1YC7A 3NMEA 5C0BA 3IJYA 2PW1A 4ENEC 3HB3C 4UT9L 4PJHF 2KBGA 3FFDA 3Q1SL 4P2RD 3RWEB 2B1AH 3UTPE 2ERJC 4MA3A 3BPLB 1IAKA 1T5XB 4X6BB 1JTPA 3RHWF 3HS0B 1F45A 2K7QA 5L88H 4OZGE 2VERN 1I8IB 3RVXC 2CK2A 4U33A 1BVLA 3FN0L 1KEGH 2IBZX 1EK3A 2AJ3A 5IMOA 3MLXH 3WFDL 5JDJA 1PJ9A 3NZ8A 4PJCF 1JMXA 1I1RA 1Z2KA 2Q7NA 1A7NH 1T20B 3CXHJ 3IDGA 5AG9A 3IAQA 3BIAX 5T5FL 1PY9A 3ZKQD 2BHUA 3DARA 4UT7L 4F7CA 2ITCB 1UA6H 5HHVL 1TCRA 1QRNE 1H5BC 4X8JA 1O5DT 1PZ5A 4H88L 2WBJB 2ICWA 4B0MM 4GT7A 2GJ6B 3HCVA 4IJ3C 3FCTA 2ADFH 1CQKA 4KKNA 4U6VL 4LRIA 1I7ZA 1OD7A 4UBDC 4NZTL 3WJLA 4NFCA 5CJXA 4RAUB 5DUML 5FGBC 3TFKC 3W9DB 1U2CA 4GQ9H 4LLQA 3K2UL 4PJXA 3KYMA 5I1AA 3TIDA 2DQUH 2QADB 1F3DH 5GISL 3S3JA 2BZDA 3DIFA 5DJYA 3MV8B 4JPIB 4LSVL 4ISVB 3E0GA 4ZUUB 1U95A 4GAJH 3FB7B 1F3JA 4P5TC 4PP2B 3GMOA 4WWKB 4QYOB 3LQZB 5KS9A 4FMKA 3IB4A 2M1KA 2Z8WC 4X98A 4I13B 5HI5D 4Z0BH 3BIKB 5T3ZL 1AY1L 4U6YB 4HWNA 4D0CB 1OQOA 3MROA 4G3YL 4IS6A 4NN7B 5DVLA 1JCKA 1T03H 3RVWD 1VESA 3L3GB 4HG4K 5BQ7A 3LKSB 3WNPA 4ZD3H 5D7KE 3B2VL 4EI5B 3I3EA 1KPVA 4FHBD 5TF1L 3EAKA 1U3JA 4WFHD 3HE7D 2ED9A 4Z7VB 3MMEA 2HH0L 3MLRL 3VFTA 1EPFA 3HE7A 4RMTA 4ODVH 4R90H 1AHWB 4Z76B 1AIFB 3UAJD 2GUOB 3GSUB 3EFFB 4KZEL 1CZ8L 1RZJL 4H25B 1MRDH 1B4RA 1NBZB 4XVSL 2R1WA 3PP3H 3RAJL 4K55A 3U30C 4JY6A 1UXSB 4OF3A 1WZLA 4X6CA 5FAAA 4FQIH 2D31B 2DQCH 4UUJB 1E4KA 1F13A 3SGDH 3FO1B 3W39B 2W0KA 2EDNA 1LO3L 3KXFD 5IOPB 4P0DA 4QRQB 3OXRA 3QDGB 3BD4A 2FCBA 2FLBT 3KXFA 5IESH 2NY1C 3QAZB 5AD0A 4E41D 3D39E 4Y16B 5DYOA 1KENH 2AGJH 1QG3A 5JOPD 3MRGB 1XGUB 4ESKA 1CFSA 4XTRC 4E41A 4MQTB 1GJIA 3MGTB 1OQXA 5DVNA 4M4PA 3S36L 2Z91B 5KJRL 2E9WA 1AJ7H 1U8HB 3F6LA 25C8L 4HKXA 4F7PA 3NACH 4LU5L 1VADA 1EZVY 3UO1H 2X4SB 3AMLA 1FORL 3RDTD 1KCKA 1YEHH 2ARJQ 4NSKA 4DAGH 1MFCL 5ICYB 4LSPL 3QDMD 1X5XA 4RFEB 1C08B 4Y89A 1FH5L 3D2UB 3RDTA 2DDQL 1RIHL 3QDMA 1FYTD 2J7LA 2AXGA 2IMNA 4CW1B 1ORQA 1SMOA 5E9DB 5BZWA 3U4EB 5MEOB 4R7DA 5J13C 1FL3B 1E0OB 2HJKA 5I75C 3GMLB 4XP9H 3IVKB 2EH7L 2VLRB 1G7HA 1ZK9A 2VXSH 1DVFB 1XZ0B 4CDGC 5JIHA 1UFUA 5C0BB 3IJYB 4JREC 3WD5L 2PW1B 3TZVC 2XKUA 2OM5A 4PJDF 1RIVL 4G42A 3A6BH 3FFDB 4KQ4L 4KMQA 4NZRL 1DP0A 4MA3B 4HXAH 1IAKB 3X13A 3BW9A 5ALCL 2X70A 3SKUD 3N85H 4XPTH 1BVLB 3L3KA 5GJSH 1RZ7H 2AJ3B 5IMOB 4JM2F 3TNMA 1FLRL 3HI6H 2B0SH 2OJEA 3IDGB 3OKLA 2X4OA 3W0WE 5MHSE 1GGUA 4RWYH 1CXFA 1MF2L 2I60H 4F7CB 3K0WA 3ZTJH 1TCRB 2PYFA 4G9DA 2E7LC 4X8JB 3QDAA 3C08H 2ICWB 1C5CH 4U0RC 1B2WL 5ESVA 4RQQA 1Y6MR 3O3DA 4GMSL 3HCVB 5F96H 3FCTB 2WZPD 1DBKH 1L6ZA 1MIMH 4RIRA 1I7ZB 1T89C 4HKBA 5I8OL 2VLLA 3DYOA 2OYPA 3K1KC 1ZMYA 4D3CH 4K2UH 1CE6A 4LLQB 1MPAL 3LQMA 4OQTH 3KYMB 2UZIH 3VXRE 3IAGC 5I1AB 2DLFH 5F1IA 3TIDB 4ELMA 4Z7UF 3DIFB 5T1LD 1RZGA 3CVHA 2WW8A 5DJYB 2NY7H 3GI8L 3KNBA 2CMRH 4Q97A 1OHQA 2AJSH 5T1LA 5MP6L 1F3JB 4U31A 4GRLA 4Y5XA 1CL7H 3O6LL 4L4VA 3GMOB 3KJ4B 4M9PA 4LLWA 3KPOA 5KS9B 1HH6A 4X98B 5J1TC 3IDMA 4NNPL 2J5LC 3U48A 5ITFA 4Y2DD 5DJ2A 2V17L 4IS6B 3SQOL 5A2KH 1KTDA 1BZ7B 2B7DT 5C0RH 4Y2DA 5BQ7B 4OZHF 1I7TA 3HTLX 3Q6GL 5LQBH 5I1GL 3GBLA 4J3XA 1KPVB 3JVGA 1UWEL 1JMZA 3TA3C 3HAEH 2HN7A 1HYSC 5FUCE 2VZ1A 5IROC 3VFTB 3HE7B 1FL5A 1K4CA 2VZSA 1Q0YH 4BJLA 5KSBA 1U8JA 1BQLL 1J8KA 2YKLH 4OBRA 3KYKH 1XF4A 4HBCL 3SBWA 3GRWH 4QXWA 1OP9A 4G6FD 5F93C 1JL8A 1CVSC 2R1WB 1NGPL 4GW1A 3MV7E 3NVQA 4JY6B 4PFEA 1XF1A 3GBNH 1CK0H 4X6CB 5F88B 2Y5TA 2J3SA 1QSFD 1P5VA 5DD1L 1ERNA 3B8YA 1TDQA 5A2JH 4L3EE 2FX7L 1QSFA 1KJ3L 4QOKE 2MTPA 1UM5H 3BOVA 3OXRB 5TQ0L 1RVFL 2H2PC 1KJ2L 4YFEA 1ZT4A 1RZFL 4AEFA 3KXFB 3V7MA 1Q9LB 4IIQA 3NGBB 5AD0B 3QQNA 1YJDH 2J88H 5DYOB 2NX5E 4K8RC 5E8EA 5A2FA 5GZOC 3R06A 4LHUD 4LQFL 1CFSB 3IXAA 5HHQB 4E41B 2FL5B 5DXWA 2NY0C 4FTVE 4PBWD 4LHUA 3BAEL 2ATPA 4J1UA 3ULUC 3EOTL 2CDFA 2DTMH 4F7PB 4HPYH 4Y1AD 1B88A 1J5OL 1VADB 1FLTX 1NGXB 4H0GA 4TRPH 1LHZA 3MV11 3PWJA 3P0YH 4Y1AA 4YGVB 4NSKB 1IGCH 3S35H 3SDCD 3RDTB 3QDMB 5ABDE 2YN3A 2AXGB 2IJ0C 3SDCA 1ORQB 1W8OA 1C1EH 2XN9E 1MELA 5DI8B 4F33A 5BZWB 5L7XH 4G9FE 4URTB 3OKOA 4R7DB 4GW5A 4DGYL 1NCNA 1FGVL 4NC1E 2HJKB 1WF5A 2OTUA 5DD5L 3STLA 2PUQT 4MB3A 3EJYD 1G7HB 1DJSA 43C9B 1QHOA 1MIEH 3CMOL 2BK8A 5H8DA 3EYVB 1S9WA 2C4FT 3QWQB 4MHHI 2P8LA 1XR9A 4G42B 2R4SL 2IAMC 4JRXA 4RFNC 1PYWA 3GO1H 2OP4H 3MJGX 3X13B 4B7LA 2B8OT 2O5YH 3LKNA 4ZG1A 2UWEB 3BW9B 4Q58C 3W81A 4Z18A 1HHJB 2X70B 3IGAB 4N9OB 4XNUH 3L3KB 3KGRA 3RZCC 3PWVA 2DJUA 3VFWA 1J12A 1QFPA 1QACA 1E4WL 2A77L 2EC8A 4LOUD 4A2LA 4XCCL 3DURA 4JKPL 1KGCD 3TNMB 5BZDA 4DEPB 2FNBA 2OJEB 1MCLA 4O2FA 5F9WB 1F4WL 5HVHC 2X4OB 3DX9A 4HQQH 1S7XA 3ULSA 3UPRA 1QEWA 2NY5C 4HPOH 3LD8C 2VB5A 3FQXA 2COQA 2PYFB 5EO1A 3QUML 4G9DB 4OGXH 1BVKB 3V5KA 4P99A 1BP3B 3LH2L 4XCFL 4KJPD 3F8UB 5I30H 5ESVB 4RQQB 5ITBL 4RFOL 1HKLH 3FQUA 4WHDA 4AL8L 4RIRB 1IBGH 1SJHA 2AEPL 4QRUA 4HKBB 2VLLB 3ZT5A 2R0LL 3BN9C 4YDVA 1T2QL 1F6FB 4YHPA 5EC2A 3RRQA 1NL0H 5F1IB 4K23H 4ELMB 2GJZA 1RZGB 3CVHB 3K8KA 3KNBB 5D1QD 3G08A 2OJZL 5T1LB 4GRLB 4Y5XB 1Q1JL 4L4VB 4KK5C 4WI4A 4LLWB 3KPOB 4PJ7E 5D1QA 5HJ3A 1HH6B 4WFED 5EZIH 4OCXL 5DQ9A 3IDMB 2DBLL 2VABA 4U1JA 1KCRL 2AEQL 5ITFB 1MI5E 4LPYA 3H3PL 3S96A 3HMXA 3SKOA 5DJ2B 1KF9B 4JVWA 1A2YA 3VRLF 1QSEE 4Y2DB 5IHUH 1L6XA 5ADPH 3HNTL 2H32H 4HMDA 4NKQB 5IIEA 1ZHNA 1GGTA 5EU4A 4H1LH 3RJDA 4C59B 4XX1E 4XMLL 1TMCB 1NFDF 2HN7B 2A9MH 3I3DA 5AWNL 4UV4H 1JWUA 1AO7E 1FL5B 1K4CB 2WV3A 3D5OF 2DQJH 1U8JB 4JQVC 4Y4KD 2I07A 5JHLH 1XF4B 4HX1A 3IS0X 4Y7MA 4O2CA 2O5ZH 4Y4KA 2HA1A 2G2RA 4GW1B 4I77L 5CCKL 3LDBC 2AJUL 1DLFH 1EJOL 3P4MA 1RHHA 1OAYL 2Y5TB 3VH8A 1S7RA 4QF1A 3MJ9H 3GB7A 4PRDB 3DO7A 4DUVA 4LBEA 2QADC 3VGFA 1QSFB 4OLYL 1Z9SA 5AG8A 1IGMH 4FZ8L 4N8VG 2BVPA 2KPNA 5J1AA 3SKJH 4O02H 5DD6A 4R4ND 1ZT4B 4POUB 3RFZC 1RJZA 5CEZL 4LRNL 3B5TA 4IIQB 4J23A 5E8EB 4NHCH 4K3EL 3R06B 1NCBL 3SQBA 5TQ2H 3IXAB 5JMOC 1QFOA 5MI0B 4UI2A 1GGIL 2XY2A 5D7IE 1Y6NR 4LHUB 4LVHB 2ATPB 4J1UB 2VLMD 3SOBH 1V7NH 3MJ7B 1YN7A 2CDFB 3JWDL 4FFYL 4CU6A 3ILQD 5ISZE 1IEBA 3QXAA 4NN5C 1DBAH 1G7MA 4Y1AB 5D72H 4CNIA 1JI2A 1S9XA 3DTXB 3K1DA 5CGYD 5GJTL 2OSLB 2NMSA 2YS4A 5GRJH 2H41A 3BUYA 3QUZB 3SDCB 4EUPG 3DWTA 1K8IA 4BELD 4G7YH 4MB5A 2OZ4L 1DDHA 1RK1A 4KVNH 4F33B 4HSQA 5AZ2L 3HNSH 3OKOB 5BMFL 4GW5B 5C0IA 4NUGL 3RU8H 3PUCA 2OTUB 1KT2A 4L5FL 3STLB 5D5MF 5CIPA 4RBPK 3CD4A 4UIKH 3LKRB 4GXUM 5IVZA 3ULVD 4PB9L 5F7WC 2GTZA 4RX4A 2P8LB 3JUZA 5MEPA 5ADOL 1XR9B 4PJGA 4PTTA 1NGQH 2Y36H 3VD5A 2CO6B 4JRXB 4M61A 1PYWB 4Y16C 4NFBA 3GMNA 2WP3O 4NJAH 4IDJL 5HDBF 3R8BB 1NCAH 3C6LD 3VFNA 1C16A 3C09B 4YHOH 3VFWB 1A14L 2ZUSA 3DURB 3V6OA 5DA4A 1OAZL 1MFEL 1S9KC 4O2FB 3TLRA 4LPUA 1IAIL 4L3CA 5E2WH 3DX9B 5C9KA 3ULSB 5I6XB 3UPRB 1QEWB 5FO8A 2JKXA 1UH2A 3O3AA 3FQXB 5EO1B 2GI7A 3MYZA 4G7VH 3UJIH 3V5KB 2GKIA 4ERSL 4LMQE 1P69B 3NOIA 4G6AD 5AZEL 3O2VH 3FQUB 4U1LA 3TJEL 3PNWA 2X42A 1CDUA 3MLTB 2APTA 5JXAL 3RWIA 5KVDH 4QWWD 1SJHB 4QRUB 3MA7A 3LN5A 5HDLA 1CCZA 4HUUB 2YPLD 3ZSTA 2AQ1A 4C55A 2D9QB 2MCPH 4YHPB 5EC2B 5KVMC 1J0IA 5CLWA 2QTEA 2GJZB 3NIFF 1RZKC 4JRWA 3NTCL 2GJ6E 2P7TA 3G08B 4JKWA 1I1AC 3D0VA 3H9SD 5D93B 5D1QB 5HJ3B 3H9SA 4ZUSA 5DQ9B 5T1KD 3DXAD 5FYJL 3MLVL 4U1JB 3SGEH 3S96B 1OW0C 2A74A 4NNXA 3SKOB 5T1KA 3KLHC 3TBYA 1A2YB 3GIZL 1FDLL 1J05A 5J11B 4NZJA 1YNLL 3IKCA 5IIEB 1ZHNB 5F9AC 5EU4B 1JPST 2NY4B 1UCTA 1BFSA 3QIWA 2DM3A 2IG2L 5D96B 4WWID 4YEFA 3A67L 5D9SA 1JWUB 1O0VA 2BHZA 3JV4A 4GG6A 3HNVH 4TNWK 2R2HA 3FAWA 4PLKC 3RBSA 2I07B 2OI9C 4HX1B 3CFBA 4XNMA 1TENA 4O2CB 3SO3C 4D0DA 2ZUQB 4Y4KB 5J12C 3UYPA 2G2RB 1EFXB 1XCQB 7FABH 3LIZH 4WGWB 2PO6D 3TPUA 3P4MB 3T3MF 1LGVA 1RHHB 4XVUD 4QF1B 2CPCA 2OQJA 5HPMB 1GZPA 4LAQH 4ZPVA 1U3HA 3DO7B 1OCWL 1QLEL 4LBEB 4Z7VE 3IYLW 4PJEF 3CXDL 2BVPB 1Y0LA 3REVA 1LILA 5DD6B 4Z7QF 1RJZB 2EDOA 2YWZA 1YA5A 2DQFA 3ILPA 5F7FA 3BT2L 1R5VA 1CE1L 4W4OA 3V8CA 3DSFL 1NAKH 4J3SA 4ELKA 4AT6A 1S7SA 1SM3L 2ZSVA 4UB0H 1A9EB 3I02A 4HAFA 4MZ3A 4PRPD 5DMJB 1WVZA 2DMBA 4Q0XH 4X5WA 1YN7B 2FGWL 5T3ZD 1IM9A 4O58L 2AI0L 3ZE0E 2CKBB 4IBLT 4PRPA 1IEBB 1A7QL 4LP5A 3QDGE 3QXAB 2FWOA 1G7MB 4CNIB 1CXHA 2C4XA 1S9XB 4JHZA 1JHLH 4S1QH 5KW9L 1GGBH 4JHWH 5B3JF 2HTKC 3QHTC 1EHLL 4B7IA 4KY1L 4U1KA 4EIGB 2F9BT 4TYUA 1IC7H 4HC1H 1GPOL 3BUYB 1K8IB 5IFAH 4RBPH 1LO2H 1BZ9B 1DDHB 4X80L 5HHME 4MD0B 1I9IH 5C0IB 3LQAC 3FQRB 1UZ8A 5EDXA 1BQUA 2NZ9C 3BJ91 2Q87A 1KT2B 4OZHA 5BOZG 3L7EA 3VFUA 1JV5A 2UV3A 1E4KC 1DCLA 2EDDA 2V2TA 5IVZB 2GTZB 3RL2B 3T4AA 5MEPB 4PJGB 5KSUB 2BNRB 4R97B 2R8SL 2BVQA 5FM8A 4KJQC 2DQHH 3O3BB 4PTTB 5FKPA 2W9EH 4G6KL 1H3XA 1YEIL 4PP1C 3TYGL 3PWPE 3ZE1F 4LVOC 4NO3A 5IBUB 2AJVL 5E9DE 1PZUB 4G8GD 3GI9H 4WHTA 1DBJL 3VFNB 1C16B 1QFUL 3AS0A 3MLSL 3AFLA 2VAAA 1AR1C 4G8GA 4OLXL 2VLRE 1A6AA 4DQOL 3QNXA 1A6VL 5C0BE 4L3CB 2QLVB 3CFCH 2DAVA 5F3HA 3O3AB 4PS4H 1MAJA 3AY4A 2R0ZH 2NCMA 4P2RE 5E99L 1IZKA 1IZJA 1HIMH 3QCTL 2YMXH 4KRMB 2B1HL 4OF6A 4YC2B 3B9AA 4U1LB 3PNWB 2C3HA 3DHJA 4I4WB 5CJBA 1U8IA 3ABZA 3DETC 3RWIB 5ILTL 3UTTD 4DN3H 3MA7B 3LN5B 1S5HA 1I1FB 1NMCB 3VDBA 4C57C 3UTTA 4XPBL 3VI3F 1LK2A 1ULVA 1PEWA 2G5BA 2WBKA 3SE3C 1VEOA 1J1XL 1NC4B 1HI6A 3T1FA 4DKEH 3UC0L 4YDIH 3PL6C 2VDPH 1IAII 3ZHDA 3D0VB 4PB0L 3VG0L 3QUYA 1B9ZA 1OARL 2EE9A 2Q3AA 3TN0D 4RZCB 1I1CA 5TPWH 2NY6D 5E8DH 3H9SB 5I74B 4RGMB 4M1GL 2ZUTA 4F58L 3ECBB 1ZEAL 3TN0A 1INEH 3G5ZA 1J86A 2QQLL 4OZIF 5IK3A 3T04D 4NNXB 4PJ8C 5T1KB 5CD5C 2UYLA 4PJXE 4DEPC 3TP4A 5IEKA 5D7JD 4GSDH 4NOBA 2D4FA 1J05B 5DGQA 3WKMH 3IKCB 3WXVH 4JN1L 3O4LD 4HEPG 5D7JA 3HRPA 4GKZA 1MAKA 3QIWB 4Z78A 1AGBB 3E2HB 3O4LA 5F7YC 4IOIA 5D9SB 5EU7E 2CUIA 3KYNA 2XFXA 3MV9D 4MAUL 3JV4B 4DFHA 5KS9E 3AB0B 5DFVC 4GG6B 1G9EA 2R2HB 1YNTB 3MV9A 4AQ1B 4X7CC 3CFBB 3TNNA 4XNMB 4D0DB 4FQHA 5L6YH 2DB8A 3MRPA 4KJWC 5CMAA 2HLAA 2R0WH 4MA7L 1R3IL 1A7PL 3E6HA 5K9OA 3TPUB 4Y19D 1BBDH 2OQJB 1GZPB 5E5UB 1JP5A 3CX5J 4ZPVB 1U3HB 1KELH 2GK0A 4OLWL 1E4XL 4HLJA 1S9YA 2ZG3A 4OF0A 3WS3A 1UENA 4WUUD 3ZKNC 3G9VA 4WFHE 3V4VH 1H8OA 1Y0LB 3U7AA 4V1DA 1D6VH 3MXWL 3UX9B 4WUUA 4GRLC 5EUOF 5FA4A 4H8WH 2DQFB 2AW2A 3ILPB 3Q48A 4MJ2A 1JPGA 2UVFA 3LY6A 4FZEH 1TETH 3V6BR 2WUBH 4AT6B 4ELKB 4TUOA 2ZSVB 2DQGH 2YK1H 4JO1L 4N8CH 4X6CE 3QULA 1QP1A 3I02B 1MFNA 4HT1H 4JG1H 3ARED 3PDGA 3V4UH 4X5WB 1EMTL 3BFOA 1IM9B 4YDLB 3ZTNH 1IKFL 5C86A 3J7HA 4ZAKD 3AREA 4PRPB 1KC5H 1NAMA 1QFHA 1U8PA 2FWOB 1AXTH 3FKUS 2ZPKL 3GKWH 3KXFE 5I1JH 4XHJC 2DQEL 3SKMA 5I1KH 3T2NH 4GRWB 4U1KB 4WY7H 1P4BH 1AC6A 4OIAA 4JFEB 1AI1L 4E41E 5CZVH 5DHVB 5JOPE 2EYRA 3TIEA 5E7FA 5IBLD 4EDWH 2X9WA 2H2SD 2XRAL 1NSNH 4PGZA 1UZ8B 2A73A 2O26U 4ZFOA 2B4CL 4OZHB 4YE4H 3L7EB 2ZSWA 3VFUB 1JV5B 4YFDB 4YBQD 1RSFA 4LSSL 4MVBC 1U6AL 2V2TB 5CILL 5E2TL 3GNMH 4XMKH 4NC0B 5FA3A 3T4AB 2OBGA 1U91A 2ZP0T 3K80A 2BVQB 4GLRH 2ZJSH 3M17A 4CMHC 4R8WH 5LGHL 4BSJA 3ZDXE 3QDME 5A2LH 2VUYA 3CXHK 5TJWK 1M6OA 5D1ZC 4NO3B 5IW3A 2E7HA 4LLDA 2DF3A 4FQJH 5EU6D 4WHTB 5C2BL 5IGXL 1ROWA 1KJ2A 5FHBL 2VAAB 3K74B 3OJDB 4G8GB 4MYWB 1ADQL 2DQDL 4WI6A 5SV4A 2XG4A 1UJ3A 1A6AB 3KG5A 5KSAA 3QNXB 4F80A 1K5NA 5F6IB 1SEBA 3SKNA 5B3NA 2Z8RA 4TTDC 4XAWL 3IDUA 4F7EA 2APVA 1J0KA 3P0VL 1OOAA 3THMH 2I24N 2MCG1 5B8CC 5C3TA 5FO7A 1MREH 4K3DH 4EDXB 4PJ5D 4MCZA 2NY3C 4G8FA 4U3CA 5F70A 3EBAA 3LCYA 4ONOA 4EBQH 4PJ5A 1NLDH 4JLRA 4JCMA 3QUZC 1FP5A 4RGOH 1U8IB 3FQTA 5DJ8B 3QUXC 1T1XA 3SEPA 1S5HB 4MSWB 5BXFA 1DBBL 3FOMA 4J6RH 5JA8B 3UTTB 4P2YA 4PJBF 4F57H 4P46D 1Z5LA 1CR9H 1H0DA 4HHAB 5CHNA 4Q9CA 2DS4A 5D2NA 2BNQD 2G5BB 1HHGA 4LDLB 2UZXB 4P46A 5IB3A 2YUWA 1A7OL 2IPKB 1IQDA 3DV6A 4LHJB 3EDEA 2BNQA 1FVCA 4U1HB 3I75B 3T1FB 1UKTA 2YZ8A 1MVFA 2XA8L 4Q2ZA 1KPUA 4K94C 3QUYB 3LHPL 5I8KH 5K9JH 4TNVF 12E8L 2HTLC 2JJTA 5F1KC 5GGVH 4NP4L 2F5BL 4A6YL 4CVZA 3G5ZB 3QHZL 3CVHH 3NFSH 5E00A 5IK3B 4HUNB 3BH8B 2UYLB 5C9JA 2MKLC 5D5MA 3ARFD 3WIIL 3OGCA 1R24A 4ELME 5J89A 3OL2A 2JJSA 5I6XC 3ARFA 3S4SA 4GKZB 2NQCA 4Z78B 1KTRL 3O4LB 4IOIB 3KYNB 2XFXB 4FQCL 1RQ5A 1Q72L 5IM7A 3LS4H 4HFUL 4J3OC 5DF0A 1LK3H 3HZKA 4ODSL 3MV9B 5FB8A 3FZUC 4J3UA 2R9HC 4RRPA 3TNNB 4FQHB 3MRPB 1E6OH 5CMAB 5I1IH 2HLAB 4U1SA 3TT1H 3HKFA 2OR9L 4Z6AT 1DR9A 3E6HB 3O3EA 4P59H 2EDWA 4WGVB 4C4KO 5EIIA 4E9LA 2R1YA 2JELL 4KGLA 4I9WD 2GK0B 2PXYD 3BKMH 2Z31C 4HBQA 3HZVA 1S9YB 3ARTA 3IKKA 4ODTH 4RSVA 3WS3B 3JUYA 2VR4A 1I1YA 4JB9L 5H37G 1CGYA 2PXYA 3O9WC 4M62L 3P4OA 3VG9C 4OCMC 2DOCA 4V1DB 5KSBE 1VFMA 1PFCA 3PP4H 5LWYH 2R56H 2H9GA 1ZLVK 4YAQA 3WYRA 3LS5H 5FA4B 3QR2A 4AIOA 2BY3A 4JKLA 1JPGB 3KPSD 4M03A 4JPVL 1L7TL 3Q5TA 2KQNA 4BFGA 5GGTL 4TUOB 1T80A 3KPSA 4TSBL 1KIUA 3O4OC 4M5ZL 4YWGH 1YECL 3AU1B 4GMTH 4KJYA 3MA9H 4FQ1H 5J11C 1QSFE 3AREB 5M94B 1UCBL 3O8XC 1U8PB 4PJ9D 2NY4C 4OB5L 5B4MD 5DMYA 2E6QA 3GK8L 2P4AB 4GAFB 3SKMB 4OLUH 1E4XI 1T0NA 2O5XL 4M7LH 2WUCL 2R15A 2EYRB 5DZLA 3D9AL 1ZKAA 4Z77A 3TIEB 3RNKB 2QSCH 5ETUA 1G9MH 2FH6A 2A73B 3WEXA 4ZFOB 3ZL4H 3D1MC 4NOFA 1ZHLA 4Y1AE 1NUNB 5JOEA 1R3LA 1CD9B 4XVTL 2XQYG 2VLJA 4QRRA 1R5WA 3BISA 5FA3B 2OK0H 3QIBA 1U91B 4M4RA 5JDSA 3L5JA 4CBPA 3M17B 1U8MA 5C0AD 2NTFA 1TZGL 5LKNA 4AG4H 3QRGH 1A4KA 5E2VH 1ODAA 3FT3A 4YXKL 2VDKH 3F12A 4LCIL 5EOQL 4XCYA 5C0AA 3QWOA 1M6OB 3ARRA 1YQVL 1QO3A 1OTUD 4XPFH 3B9DA 3I6GA 3V52H 5CJ5A 2R23B 1HZHL 1KJ2B 3NCJH 4XWOD 3R8QA 3GUTA 1UJ3B 1E27B 1N2RA 5KSAB 1XF3A 2LV4A 1KB9J 4PLOB 3VRJB 4N1CA 1K5NB 3SKNB 5DEFA 2HG5A 2P24A 4UT6H 4XHQA 4F7EB 4PGEA 1K8DA 5C0ND 3Q2CA 1FCCA 5FO7B 1UWXK 4AK1A 4JRXE 4MCZB 1HE7A 2ZCKL 2DKSA 4G8FB 1EUTA 2DM4A 3WFEL 3MO1A 4PJ5B 3DMMC 4JLRB 4OCWH 3IS1X 4E42A 4X4MA 3BPCA 4NZUL 3FQTB 5TE4L 2BXZA 3OB0K 1T1XB 1QLFA 5BXFB 3DRTA 3FOMB 1DL7L 5LCVH 1LP9A 3MBXL 1KGCE 3D6GA 5F8QC 3WXWL 1Z5LB 4TOYL 4M43H 4JFQA 1H0DB 5D2NB 4ZOBA 2OZ4A 1HHGB 1ZLWK 5IB3B 4P46B 1X5JA 4LGPB 4MXWH 1IQDB 3X11A 1U3ZA 3DV6B 3QI9D 2BNQB 2FB4L 1FVCB 3T2OA 2VKXA 4Q2ZB 3GM8A 3QI9A 1KPUB 3HMWH 4KPHH 1MCOL 2JCCF 2BRQA 4MJ5B 4KI5D 4DTGH 4ZTPL 4CVZB 4PRHD 1Z9MA 3O3UN 5C1MB 5E00B 4YHML 4HZAA 4MWFA 1FPTH 5C9JB 5I73B 2B20A 5D5MB 4PRHA 4LEXH 4OM1L 5KVGL 3OGCB 1R24B 3SGKA 1NANI 2IMMA 5C0GA 5TE6H 3RVUC 3ARFB 1VERA 4P2QD 3S4SB 4X6FA 5JZ7C 4NRZA 4ONHA 2PYED 3DUHA 2XNAA 1I8LA 1V7MH 1TTFA 4P2QA 4J2XA 3HMXH 4LPXA 4PGCA 1CDIA 2VXTL 2DICA 5IM7B 3S88H 2LVCA 1X6LA 4M48H 5B21A 1CLZH 4HS3A 3HZKB 4YC2C 3WO3B 5FB8B 2C1PA 4WFEE 3QUMB 1V3KA 3GFUA 2VXVH 4U1SB 1UM6H 2W65B 5DRZB 1WZ1H 3O3EB 1X5YA 2IPTH 5EIIB 4Z5RA 4R26L 2R1YB 2V5MA 3P4NA 1WCQA 4OT1L 1ZLVH 3B3IA 3HZVB 4B41A 4BFEA 1CGTA 2VO5A 5F7EL 2PXYB 1WWAX 3MODL 2J8UE 5CKAA 5CINL 2H9GB 1HINL 4G6JL 3BP5A 2DLGA 1JN6A 3T8XA 1QD0A 3BJLA 3L6FB 5I74C 3MRKB 3VXOA 4RGMC 5I2IA 1BM3L 5D7LA 1T7VA 4KDTA 2XWTB 2AQ2A 3WIHL 1WAAF 4MJ4A 4KKLC 1UM4H 5FYJD 1B0WA 4ZS6C 1EO8H 4ACPA 3BE1H 2FO1A 3NA9H 4KJYB 3T09A 1OAXH 3MOAH 4NRXB 1TVHB 1S78C 3QIWC 3SGJC 1LO4L 1FZJB 1EA9C 3WFCL 3PQYD 5FECA 2IEPA 3PQYA 5IHLB 4G80A 4PY8J 5SWQA 1DFBH 3CU7A 1DQLH 3ZYOA 4Z95H 5DJAA 3MJ8A 4OZIA 4ETQA 5ETUB 4JM2C 4I18A 2OL3L 3NPSC 2Y25A 3MR9A 2VLME 3WEXB 3CZJA 2ADIA 2C1OA 1AGFA 3BEWA 5CZKA 2DLIA 4HUVA 1ZHLB 1U3HC 4MD5A 5ICXA 1HXMB 4PLNC 1I3RA 1R3LB 3I2CH 3SE9L 3ZDYE 4N0UB 2VLJB 4QRRB 2AXJA 1R5WB 4K8RL 3M1BA 4P9HC 4S1RH 2XTJD 3QIBB 3MRHA 5JDSB 1RUQL 1MAMH 5ALBL 4XC3H 2DTSA 3O2WL 4YHLH 1A4KB 3PV6A 3FT3B 5GSVB 1U0QA 3F12B 4XCYB 3ULUL 4NGHL 3QO1A 5CIPH 3ZHLA 3W2DL 4W4OC 3CFKA 3UDWA 3DECA 3HN3A 1G7PA 2F8VA 3I6GB 1X5IA 4LVNC 5EUKA 3ZTJG 1R6VA 3TVMC 3GUTB 3ULVH 2N4IA 4HWEL 1UWXH 1N2RB 1XF3B 1CT8A 5DEFB 2HG5B 5HHXL 4MDJA 2P24B 4PGEB 3MLZH 1K8DB 4PJGE 5LVEA 4P57A 2VXQL 5GGSA 3ULVE 4X7SH 2C3WA 5E08H 1MFBL 1L7IH 4XI5D 4KQ3H 1BZQK 1F6AA 1U8LA 2YXFA 5B39A 4QTIL 1JZ4A 3JTTB 5INDA 5HDQL 4CU8A 4F3FA 3MO1B 5IW1A 2XZCL 4F9LA 2WIIA 4E42B 1OLLA 3BPCB 4IRSC 3TO4C 2GY7B 6FABH 2Y23A 2BMKB 3BP7A 5CLTA 1PSKH 1T1WA 4X5LA 4ZSOA 3V6OE 3RIAF 2W0FA 1BX2A 2X4QA 1ZLWH 4B5EA 5IFHL 4Z8FH 1MLCA 1QLFB 3MLWH 3DRTB 3QCVL 5CJQH 1FIEA 1LP9B 4KI1A 3QHFH 4Y5YA 4XBEH 1TPXB 1YEFH 4JFQB 1KOAA 4HIXL 3EUUA 1MRCH 3BPOC 4NJ9L 1ETZA 5D7SH 5D2LA 1WUNT 4YPGA 4MQXC 4QHLA 2NW3A 4U7SA 3X11B 3NPZB 2D9CA 4WTXA 3ARBC 2LTQC 5T1DH 5IB5B 1OTSD 1YYMH 5JPNA 2A1WL 2P5ED 3IFLL 4X6DF 5KZCD 1A3LL 3JV6A 5IW6A 4XC1L 1XAUA 3VDCA 2P5EA 5JW4N 1UYWL 1IGFH 4MWFB 5IB1A 2NY5L 4NKMA 3LPGA 3HAEG 3RKDD 1E6JL 1SQ2N 4LNVA 3GDBA 4KROC 1TJIH 2QR0B 2I26N 5E8PA 1IE5A 3G5YA