1GXEA

Central domain of cardiac myosin binding protein c
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
130
structure length
130
Chain Sequence
RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytoskeleton
molecule keywords MYOSIN BINDING PROTEIN C, CARDIAC-TYPE
publication title Structure, Stability and Dynamics of the Central Domain of Cardiac Myosin Binding Protein C (Mybp-C): Implications for Multidomain Assembly and Causes for Cardiomyopathy
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2002-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gxeA00
1KJMB 4G8GB 4X5WA 3BRFA 1IGJA 1XFPA 3RZCC 2ARWA 1NLDH 1IQWH 2Z31C 1FBIL 4U0RC 3WUWA 2EC9T 1XF3B 4BK5A 4YXLH 2Y5EA 1W8NA 4JN1H 4HULB 3MYJB 4Z7WE 2C1OB 3MRGA 4MB4A 2QADC 4UBDD 5KVFL 3QUXC 1I8IA 3PABA 1JF1B 3T0XA 5MENA 1HDMB 1ACZA 4P5TC 1OTSD 2E7CA 2I24N 1T1WA 4JFYB 4JM4H 1LEIA 1WFOA 3QAZC 4MCZB 4HDIB 5FKAA 4APQD 2BSED 5KANI 1HXYB 3TBSB 4CRPA 2DD8H 4GRMB 1ZTXL 4C54A 1A1NB 3HC0A 4EDXA 3BOVA 1IFHL 3DSFL 3GJFB 1Z3GH 4KDTC 2NY0D 1A3LL 1FHGA 2HVKA 2OJZH 4PBWD 1EH9A 2CH8A 3QH3A 2IMMA 5A2FA 5IROC 1KCUH 4F7PA 1CBVH 2DQEH 5E70A 1QO3A 2UV3A 4NUJB 4QOKE 4HGKC 4LU5H 4BH8B 1YYLH 5IIEB 5DRNA 4K94C 1U3JA 4P9HH 4DJMA 1ZK9A 3RBGA 4CADA 3IFPA 5T33L 3WDJA 5GRUH 2ADIA 1KTDA 5LXGL 5LJYH 1FJ1B 3TWCL 3OMZA 4LGPB 3TFKC 1OTUC 3B2UC 4L8CB 3AY4C 4YHYC 4QF1A 3S35L 2BY3A 5HJ3B 1F4AA 3HNSL 5D70H 4PUBH 4YXKL 1I3UA 2VNCA 5E2TH 2VH5H 3NZ8B 3GSRB 4G9FD 1C5CL 3D18B 2EIDA 4GW5A 1C08B 3FB5A 3PHQA 5FIEA 4U7SA 1F8TL 1EAJA 4PRHD 4RMRA 1PVHA 3QI9A 3I50H 3MUZ1 4Z7UB 2R9HC 4OGAD 2R4RH 1NEZA 2VLJE 3AMKA 1ZEAH 3U4AA 1BZ7A 3QEHA 3MFGB 5GGQL 2PW1A 3CFBB 3OB8A 4GXUN 3TM6A 5KOMC 3P0VH 2WSKA 5DWUL 3ZDXE 5FUOH 1FC2D 3K46A 5JQHC 4P9ML 1EEZB 2X2YA 4PGEB 5B39B 4MB5A 5EWIL 3G04B 1AH1A 4P3CL 4BSJA 4PRPA 3FQUA 5ISZA 1A64A 4QXUH 3LV3A 2DLIA 4LLMA 4TVPL 4Y4HC 2VDNL 4H1LA 3JWNC 3GSOB 3H2WA 3IXTA 2A74A 3JV4A 4IHOB 4WTZG 3RWIB 2ORBH 1P9MC 3MRLA 3WS3A 2RR3A 4G43A 4H5SB 2J4WL 4AL8H 4IDLA 1DQTA 4GAYB 3Q6GH 4KK9D 1T20B 5KBNC 1QLFB 5CGYC 4TUOA 1AKJB 3VG9C 5FO8B 2B20A 4OF3A 2Z31D 4JREB 4BFGA 3RL1A 2AEIT 1OVZA 4JPVH 3VGAC 2Q3AA 1U93A 1FSKB 3LKPA 4ZFGL 5FKPA 3ESUF 3ROOB 4FQLH 5TE4H 5J11C 3FKUS 1KJMA 3HE6A 4G8GA 1KCLA 1UM6H 1AQKH 1PG7X 1M7XA 4L9LA 1ZXQA 4O2EB 5KSBF 5IHZA 2OS7A 1CXKA 4OZGA 3VE0B 3GSNL 1XF3A 2FWOA 2D9QB 4UAOC 1CFSA 4X80H 4YR6A 3KNBB 4MNHB 1MCBA 2C1OA 2OL3L 1PYWA 1NGWA 5EU6E 5E2VL 1M6OB 1BQUA 5IJVA 1VFOA 3TT1H 2OSLB 5TH2A 4YHKL 4LSDA 4YZFF 5JZ7C 1T22B 1U8NB 4PTTA 4NHCL 1JV5A 4O5LH 4H8WC 4GRMA 1N6UA 1RFDL 5BVPL 4J4PA 3ZSTA 1T83C 5FUCE 3VW3L 3MUGB 1BD2B 1MJJB 3ZSSA 4K94L 5TGBB 3RVXC 3GJFA 4RZCB 35C8L 3FT4B 5IUSA 5B21A 1ZGLM 1ACYL 5EN2A 3MROB 4ODSL 3C08L 5IKCA 4NUJA 1OGAB 5LCVH 4BH8A 4OLZH 1WAAA 2BVYA 3WSQL 1A4KA 4AY0A 1EA9C 1JPST 4HKJB 4MJID 4LCWA 4TNWK 1PX4A 1CS6A 3U7YL 4HWUA 5I8CA 5DO2C 4WFGD 4PGJA 4Y19D 3ZYOA 3BP6B 3EOBB 4V1DA 3NPSC 1UWGH 2J88L 5AZ2L 2VL4A 4XH2B 1CGSL 3VDAA 3BDBA 3ZT7A 2X4UA 1WWBX 1UQSB 4ODUB 1MRCH 3LD8C 3QP3A 3GSRA 5EO0B 1G9ML 3L1OH 1QBLH 1DBML 5C0RH 2R1WA 5D72L 4ZFZB 1UH4A 4QRRA 4C57C 3F6IA 5MEOA 2VXQL 4Y16A 1KJ2L 1OAKH 1AFVL 2WV3A 5I0DA 3LN9A 3QJHB 5HPOA 3CFBA 3MPCA 3GMLA 4BM7A 5HI3C 2DQJL 3QUYA 1JPTH 3V4VL 2VSCA 3N9GH 3EYUL 1CR9L 5E7FA 1NDGA 4M9PA 1I8MB 3G04A 2LE9A 4EI5D 1LO5A 2OR9H 4FZ8L 4HUWB 5F8QC 1S9XB 4OCRH 3JWOH 2XTLA 4Y5XA 2IG2L 5C08B 3DX7A 5IBUB 5KW9H 3L9RB 4NN5B 3ARWA 5BZWA 4LLVA 4KI5E 5CSGA 3NIFF 3VMOA 1N7ML 4CW1A 3RWIA 5FO7A 1Q38A 1UYWL 5C0EA 1NPUA 1WZ1L 3HE7B 3U46B 1T03H 2VDLL 2Z8VC 4NM4L 3TN0D 3LPFA 1HI6B 3ELAT 5E2JA 3IFNH 3A6BL 3OAYK 2DBJA 3KPRD 3RWJA 4KY1H 1T20A 2BZDA 1QLFA 2BY2A 4CMHB 1VSCA 4EBQH 1TXKA 4OT1L 2R0KL 3NIFE 2NX5E 3P2TA 5EG6C 4C56D 4NNXB 2AXGB 5K33A 1D9KD 5ESQA 4MQTB 3ROOA 5IQ9B 1UZ8A 4OCMC 2GCYA 1DJSA 2VDPL 2OLDA 3KWWB 4O2EA 1CK0L 4ELMF 4XWOD 3U48A 1JTTA 4P57B 4QXGH 4Y5VC 1X5IA 1CFTB 5JZ7D 3LKNB 1EHAA 1VGKB 3PDGA 1A9EA 3AVEA 3RWHA 4MNHA 4UNTA 1N6QL 4YHNB 4JQVC 2ICWI 1JF6A 3CSGA 4B7LA 5CFHA 1B0GA 4JPWL 2B1AH 2IGFH 4H8WL 1V3JA 1J7VR 3BDYL 4ZO6A 5SWSA 2G5BB 2DQHL 1T22A 1FCGA 1BVLA 4G3YH 4OFPA 4F3FA 1KG0A 2R69H 3PGFH 1SM3L 5DD0H 5DTFA 1DEEA 1Q72L 3O2VL 1DVFC 3C2AH 1U95B 4UIKL 5D6DC 5EBLA 2CPCA 3MUGA 1BD2A 1IGML 4PJ7A 5EOTA 3F12B 1ZGLP 1LO3H 4RZCA 4S1SL 4XWGH 3RWFB 3LKSB 3UTZB 3MROA 4K7FB 4RIRB 3O11B 3V8CA 2IPUG 2DTML 4Z7WA 3MLYL 4K3JH 4LEOA 5FECA 3CH1A 4YHLL 1JGEA 4TRPH 1NMCB 1RVFH 4KJWD 5FA3A 1U8KB 4LVHB 5BV7H 3D2UA 2EE6A 3RWCA 3C6LB 5DD1L 1T04B 1XMWA 2YPKA 4L1DA 3CZFA 4ODUA 3TZVB 1BZQK 2CD0A 2GAZB 2WMPA 1OF2B 3KYNA 2OM5A 4OCYL 2OTWA 4M7JH 4LPVA 3K7UA 4PY8I 3BIAX 1MRDH 4WW2F 4DAGH 2ERJB 5B3JF 3EO9H 5HHMD 3I3BA 4HS3A 1OLLA 1H5BB 2FLRT 12E8H 1T66D 2VMFA 3UO1H 4CJ0A 3UTSE 2R39A 3GJFK 4IRJC 3WNKA 1E6OH 5F7KC 2YD9A 3ALPA 2VDRL 3HB3D 3RGHA 5EBGA 1CLOL 3FB7B 2V2XB 5EUOF 3RNKB 5D7KD 3W82A 4Q9RH 4WFEE 1IM3A 1HEZA 5B3JE 2GW5A 4XAWH 4HUWA 4UV7H 5CJOL 3BZEA 1LK3H 1KPRA 3JUZA 1LEGA 1M05B 4G6JH 3R1GH 3QWRD 5E6ID 4YBHA 4Y1AE 5TPWH 1DQLL 1KCRH 3MJGX 3QXVA 4LSUH 3HE7A 5D96B 5EZOH 3U46A 3N06B 1TLKA 2UZIL 2YRPA 2VLJA 5GSRA 3BESR 3MRCA 3RX8A 3CDYA 4FOMA 5AG9A 2DM7A 3IAQA 1JNLH 5JQ6L 3UXFA 4R4NC 3OF6A 3CU1A 3PWUB 4HCRA 3ULVC 4J8RA 5FM5M 2VN4A 3ARDA 3OAUH 5TE7H 1JWSA 3G6DL 3C5SB 3LZFH 1RK0A 2H9GA 2AXGA 5JTWA 1ZT7A 4U6XA 3O3AA 3S9DB 1R5WA 1FL5A 1C16A 1KCSL 1OT2A 5L9DL 1BGXL 1DBKL 3T0EC 5JLZB 4M1DH 2CRIA 4P57A 5K9QG 2HTKC 2LVCA 3OXRB 4LF3B 5I15H 1B4RA 2IFFH 2EDTA 4NP4L 3VFNA 4P23B 1R3JB 4JQIL 5EU5B 1RIUH 3TO4C 2VWEE 4ZAKC 5C0CE 2FH6A 2Y7QA 4I0PC 1DVFD 4Z7OF 1YEGH 4YDLB 3ZE2E 2YPLB 3O8XA 2KQMA 2YMXH 1BJ8A 1N26A 3RGVC 4ZUSA 3QNXB 4EN3D 3IDJB 4M1GH 2JF1A 3GSXA 1BBDH 4DQOL 1MWAA 2HKHH 2Q20A 5DK2B 5F1IA 3VFTA 3UC0L 4G8IA 4NKMB 3WNLA 5C0DA 2VE6B 5IEKB 5E4EB 1AGFB 2WINB 2FHBA 3T2QA 3G5YB 1VKXA 3BPCB 4FMFA 2EYRB 1ZSDA 3L3IB 2GTZB 3D48R 1PD6A 4GOSA 3RWFA 3Q5OA 1SBSH 3H9SE 4JO1H 3UTZA 4IJ3B 1UKQA 3O11A 1KCVH 4RGNE 1F6AB 2CKBL 1TQBB 4I2XE 2V9QA 4MDIA 4KV5E 4NFCA 4XP1L 1J1OH 1KT2A 4QXTB 1S3KL 5JR1L 4OV5A 5C6PB 3WFBH 4QLRA 3C6LA 1T04A 2FD6L 1EDQA 2DQTH 3F5WB 4IRJD 4U31A 3MCKA 4Z0XA 1PLGL 3AS2A 3HUJB 4LPUA 5CD5C 1RZFL 3HPJB 3I6KA 4Z5RB 2L7JA 2X4TA 1RU9L 2BCKB 3W81A 4OZIF 2OP4H 3U4BH 3UROR 2VLMD 1MY5A 3C9NB 1X4ZA 3LEVH 5C0BB 3T4AB 1S5HB 3FB7A 4NYLA 4OD3L 3OSKA 3GMOB 3VRIA 1OQXA 4RMQA 4X7TB 4IRSB 4PJIB 1KJVB 4JFEB 2NLJB 4H0HB 1L7TH 3QQ9D 1F2QA 3HLAA 3ALXA 2CRZA 4CNIA 3CIQA 4P4RB 2BVEA 15C8H 4TSCH 1JE6A 2XZQL 4O4YH 1DUYA 1FL6B 4OD2A 5SX4H 4OZFB 3E6FA 2A9ML 1U8IB 1XIWA 3ULVL 2DM3A 3VWJD 3PL6A 3MV7E 3I02A 2DL2A 1JFQL 3LEXB 2K1MA 3TYGH 1WBYA 3TCLB 3TVMC 1Q0YH 3HAEA 4LVNB 5I71C 3HI6L 4ODHL 1ZHBA 5FCUL 1A4JB 1ZA3A 5KSUB 1GC1H 4RA3A 4M6OL 1BWMA 4NKOA 1OGTB 4WFHE 3RA7L 3V7AE 2ZPKL 3TBTB 2XOTA 3BGMB 5E1HB 3QIBA 1RZ8A 4JDVB 3VFOB 5DD5L 2R23A 3K2UH 5GXBB 2DMKA 4OFYA 5T3ZL 1MREH 3OXRA 5IVXF 3ARGB 2KBGA 1NSNH 4JFHE 3UJJH 2DM4A 2FO4A 4K2UH 1UWEL 1ZVSA 4HBCH 1ZLUK 3MJ7B 4K3DH 4PY7A 2AI0H 1BZ9B 3GKWL 4XCYB 3VG0H 1FZOB 4LDEB 4RRPG 4NKDB 2VO5A 4EVNB 5I1CH 3O4OB 4P46C 3SCMB 2JE8A 1CZ8L 4PJEB 3KPNB 3LIZH 5D5ME 1Q9WA 4KXZH 4ONOA 4PS4L 1MFBH 2GEEA 3TPKA 5KSAB 3MOBL 2NX5A 1YNKH 1F4XL 1XEDA 2VE6A 3H7LA 3MLRH 5JW4N 3O6MH 5I8OL 3G5YA 4O51B 4D8PA 5B22A 1HNFA 2EYRA 4MQ7A 3L3IA 5ID1A 1VERA 4ONHB 1YEHH 1UB6B 1C1EL 2CKNA 1YMMD 2H6PB 3E8UH 4QTHB 1NGPL 5F9OH 1L0XA 1KJ3H 1TJHL 5I6XC 3OKNB 3HPLB 4KJQC 5MERB 3F58H 1I9IL 3RBSA 2GJJA 5H35B 1AGBA 3OWEA 4S11A 5DRWA 5ITBL 1I1YA 2FEEI 4OJFH 1H3GA 4QRQA 1HILB 4PRNB 4TUKH 4UB0L 5EC1B 1FORL 2R0ZL 2R4SH 2MCPL 3A6CH 3HA0A 5C0AD 1H3XA 5FYJL 1PX3A 5D1ZD 3MZGB 5FYKD 3QNYA 2DQCL 4UTAH 1RJCA 5MEQA 4DGIL 2VXVL 1KB5L 1JCKA 1XGPB 5FYKL 3SKUD 3GSUA 3BPNB 5FOBB 5D9SB 2V2TB 3FRPA 5C0GB 2BCKA 4X6CE 3IETB 2BVPA 2VABB 1LP9E 3T1FA 1RSFA 3FAWA 2UWEB 2MPAH 4PJBB 3KAAA 2YWZA 1S7XB 5HDBF 3MLSL 5GGVY 4YDJB 1G6VK 1Q9OA 4MA1C 3T4AA 1IZJA 4GXVL 5DJ8B 2EDWA 4CN1A 5LAXA 3U9PL 4Z0BL 3HNVL 3MRMB 4E41B 3GGWB 4PJIA 4R7NA 1KJVA 3CFEB 3L3JB 4GJTB 4JY4B 3GHEH 5LWYL 2ZSWB 1KFAH 3BHBA 3L95A 4XNQA 4D9LH 5HVFB 1FNGB 3STZA 4N8VG 4IS6B 4LLWB 2PYFB 3MNVB 4ONFL 3A67H 1OD9A 5JIHA 3TA3B 4O00A 4YFLF 4ZPVA 5HDBE 5JIIA 1PKOA 4YWGH 4MXWH 1NCCL 4I4WB 4WEUD 2R0WL 4BA8A 3QULB 3SDYH 4JM2F 1FO0B 5D1QD 4KQ4L 4NNPH 1FN4B 3O3BA 1KPUB 4D0BB 1EFXA 3TCLA 4PJ8D 3OKLB 1S7UB 4HFWB 1KEGL 4TVPE 4KK8C 1OM3L 1AC0A 3RUGB 3BRDA 2H8PB 1TCRB 1OW0C 3QB7C 3VXUE 4PJGB 2APTA 1T89C 5HHXL 1JZ5A 4MVBD 3FRUA 4KUCD 4Q58C 3MYZA 4WW2A 5C1MB 5KVEH 2YD3A 4WUUB 4XNZC 5FV2A 2NXYD 4YIQB 4YGAB 1VFAB 4JDVA 1GOFA 5HY9A 2EH8H 3MRBA 4LAQL 5KTEH 5J6GB 4E42B 2NW2B 3QEQD 3GNML 4Y1AA 2EE9A 1K3IA 1H8SA 4R90L 4FZEL 4XXCC 3VWKA 3BWUC 1QBAA 5E6ZA 5JW3H 1E4XH 1TZGH 1CGWA 3L6FB 3I2CH 3EHBC 5GHWH 3VD9A 4AJ0A 3PHSA 4XP4H 3JZ7A 4JHBA 1FZKA 2ZJSL 1F02I 4QGYA 4PRIB 4I3GA 4TTDD 3MBXL 1KPVA 2BOCB 4YDKL 3NFSH 5F6IB 1CN4A 2AABL 2ADGA 5CBAB 3SCMA 4F2MB 1I1AB 3U4EB 1JGDB 4YX2H 2CDGA 4JPIB 4POZD 5HD8C 1A7RL 5GGTA 3QXDA 3SQBA 1DBJL 5L0QB 1NMAL 5TQ2H 2A0LC 2IWGA 1UZ6E 3O6KH 1JGLH 3GB7A 4MAYA 1MCPL 3DXAE 2ADFH 1YEIH 4HIJA 4HS6B 5DQ9A 1A6AB 5BS0E 3B8YA 1ULVA 5ALCL 2JLLA 1WCQA 2F54E 4ONHA 4GBXD 1UB6A 1AR1D 2UVEA 5D6CB 3IF1B 3G9VA 5JXEA 5I1GL 5DI8A 5HI5C 1GOHA 1VESA 3ARFD 3EYSH 5FXCH 5HI4D 4R96A 1QA9B 4XX1E 3OKNA 3HPLA 2Y07L 5MERA 1UM4H 4U1KB 4CDHA 1LK2B 3LS4L 1NFDE 5L8KB 4OB5L 5IFAL 3SDDB 2FIKB 1Z9LA 4JEGB 1EEUA 4PRNA 3MOAL 5IBLD 5IVZB 1R6VA 5ID0B 1A6VL 5D5MB 1S7RA 3VXSE 4XNYL 5BCAA 2VAJA 1OGAD 5CJQL 3S96B 1MPAH 4ZDHB 4Z76A 2A73B 3B6SA 1EV2E 1UEMA 5GJTH 4RAVB 1J12A 1A0QL 4BZ1H 3V5HB 1KTLB 1EBAA 1XGPA 3ETBF 3NCCB 5D9SA 2I9LA 3V6ZA 4FTVE 5HYJD 5FDWB 4G7VH 1KB9J 1J0IA 3H9SA 2XXCB 3QO0B 2OYPA 3BD5A 4HZLA 4HUXB 1S7XA 4QYOA 4I2XA 3PP4H 4XPHL 4LHUA 5DJ8A 3QIWA 5HGAA 3S37L 1Z9OA 1D5ZB 1GIGH 3UTTB 1AHWC 4G8FB 4DW2L 4FG6C 2W60A 1QLEL 3PWJB 2FSEB 4UT6L 4B0MM 2O5YH 3IAGC 2W92A 2H2PC 4OGXH 4F9PC 4HF5L 5LBSH 2IPKB 3LRSB 1HHHA 1A1MA 5C3TA 1RURH 2E5EA 3LQAH 3C87A 4IS6A 1MCEA 4JFOA 4WGVB 3E2HB 2F5AL 3U1SL 4LVOB 4MD0B 5J3HC 3BE1H 4P2OB 1KLUA 3BN3B 1X7QA 2CLRB 2IAMA 2BC4A 4D0CB 3NMEA 1S7QB 4NT6B 3WKML 1FO0A 4DK6A 2YS4A 5KS9F 4JJHA 2P5ED 5E08L 3Q3GB 4K23L 2G60H 3AREB 4L8SC 2F5BL 4XVSH 1KIQA 4JR9H 4LNRA 4FQXD 3RWGB 2W59A 3AM8C 3MBEB 1TCRA 4LKCB 2P49B 1QVOB 4I8DA 2Z8SA 4AZ8A 5ICZB 5CHNB 3GMQB 2IPTH 3L3HA 4YIQA 5CMAA 5E8OB 1Y6MR 3VXPA 5D71H 1S8DB 2B1HH 5F1NA 3H9YA 1TENA 5DC0A 4HKZB 2AK4B 3RTQA 4EKXA 3DX8B 2EDNA 2N7BA 4LPTA 2Z91A 1A3RH 4LLDA 3B5TA 4PRAA 5HD8D 1QSFE 1BQLL 1RUPL 3WFCL 3WFDH 3EDEA 1M71B 4PRIA 2V5MA 1ED3B 1OLZA 3MV7A 2BOCA 1YPZF 5IB2B 5JHDB 4KPHH 1NC2B 5CBAA 3UPRB 4HGWA 1I1AA 5KVDL 1JGDA 1UJTA 2NZ9C 4GRWB 3BFOA 2CDEA 1MHHB 5AZEL 3S35X 1FG2B 1TIUA 4QT5A 4HUNB 3O9WC 4AEEA 1M7IA 3L5IA 1X5GA 1YEFH 2YUXA 2IF7A 4TNVF 1A6TB 2NY3B 5DHVA 5CEYB 1E4KA 1HYRC 2DM2A 2HG5A 1FNHA 3NFPB 5GS1C 2VIRA 4N68A 3BZDA 3D85D 4HPYH 3MV9D 3IF1A 4XCNA 1XF4B 1E0OB 3GIZL 2ZOLA 1QA9A 1N59B 1JWMA 3GMPA 3T08A 1NC4A 1UACL 4JRYD 5DVMA 4U1KA 3GBNL 1LK2A 4F7CB 1QBBA 5FHAL 3SE4A 3MRFA 3U7WL 5D7JD 3MREB 1N64L 2FR4A 2I26N 4YE4H 3LKOA 1K6QH 5D5MA 1FZJB 1ZT1B 2YKLL 3EAKA 4N9GA 2A73A 3OHXA 4R3SB 4RAVA 5HPMA 3VH8B 3W9DA 5CEXB 5IT2H 3V5HA 4NNYB 5DMGD 1FVEB 3LHPH 3GO1L 4RFNC 1XCTB 5E00A 4HG4J 4ZSOE 2YUWA 1MHPL 3QO0A 1UCBH 4C4KT 3UAJC 4NSKB 1FNFA 3CJJA 4MX7B 4OZHF 4AIOA 5DHYB 1CU4H 3ARPA 1N5AB 2P48B 5F9WC 4KAQH 4A6YL 4URTB 5IEHB 4G8FA 1XGTB 3KPOB 2FSEA 1G7QA 1CF8L 1JHKL 2P8PA 1YUHA 4J7RA 2PKDA 4JG1H 2IPKA 1XZ0B 1OQOA 2SEBB 2BNRB 2F53E 1RJLA 4OQ1A 4HMEA 1Y18B 4WHTA 1KGCE 4DOHE 4MD0A 3FFCE 4DVBB 4MNQB 3DO7A 4YHPB 2ZG2A 2CLRA 5E8DH 3DVIA 4ETQA 1U41A 4X6CA 1INDL 1G7MB 3EYVB 2UY6A 4FTVB 5FYKU 3HFMH 3MC0A 3P4NB 3W0WE 5CINL 2V5YA 1TTUA 1LP9A 1QZ1A 1IEAB 3C8HA 1MHCA 1XGRB 1NBZA 4OF5A 3EGSB 5LVEA 1H3UA 1RUAH 3ZHKA 4MCYB 3D25B 5FA4B 2XTJB 3FQTB 3S34H 3SGJC 4LKCA 2EXYD 3H9HB 4GRWH 2WUCL 5ICZA 4PREA 2R1YB 1RJZB 5CHNA 3STBA 4HS8H 3GMQA 3REVB 5E8OA 2IQAB 3CU7A 3C6SA 2E6QA 1XF5A 3KPMA 2QQNH 4GUPA 1R5IB 4WVRA 4HKZA 4PLJC 4NZRH 2HKFL 3DX8A 4O2FB 4XPGH 2DBLH 3IFOB 4ZTOH 2XFXB 3EKCA 3GMMB 3PWLB 4PJXE 4EUPB 1HHGB 2QQLL 2NZ9D 5E6YA 1HINL 1BAFL 4JDZA 4I5BB 5E9DE 1CLZL 2JK5B 2AJYH 3RWDA 1CQKA 4LSPH 2Y36L 4AEIH 1M71A 2HVJB 1ED3A 2Q7NA 3O45A 3OKKB 4FQ1L 4QHLA 2FX7H 4EQ2A 4RGMB 4W6XB 2ZCHL 3QCTH 1ZOXA 2ZUQB 3A6OA 2PXYC 3CXDH 3MO1B 3QCUH 2VSDA 1CDUA 1FDLL 1FAIH 3VXUA 1INQA 4RA0C 4M4PA 5L7XH 3NOIA 4OKDA 4UT9H 1A6TA 1HKLH 4JM2A 5D7SH 1NGZA 4L5FH 1K2DB 2V2WA 3NA9L 4OQTA 1MCIA 3EYOB 1VENA 1T4KB 4BKLB 4LSVL 1IC7L 3PQYB 3RRQA 2XWBA 5AWNL 1XF4A 3WUZA 1MCOH 3ARBB 3UBXA 5TQ0L 3GMNA 1QLRB 3C8KA 2XZCL 3O3DA 3D9AH 4LRIC 1H15B 5L2JA 3HC4L 2J6EL 3MV8E 5IFHL 3HMWL 1AQDB 5C86A 1LO0L 4WU5B 3HMXL 3PUCA 4JHZA 3CCHA 3O2WL 2F74B 3DBXB 4Q7DA 3FT2B 5T1KB 2CIIB 3BXNB 3ZKSD 1JPFA 3RDTC 5IESL 4QNPF 2F19H 3BKCH 1FZJA 3FMGH 3ZYJA 3P9MB 4RFOH 3GSNA 4P5TA 1MJUH 4R26L 4O02H 4R3SA 1WZMA 3DXAA 4ZD3H 1C5DB 4RAUB 3CGTA 2OL3A 3VI4E 1F97A 5JPNB 3G6AB 2HT3C 1J87A 1YNLH 1IC5L 5BS0A 4DN4H 3MLWL 5ABDE 5D1XC 2WBJC 32C2B 2V17L 5EIVA 3SDXF 5DLML 2DKMA 3MRDB 4OGYH 3M1BB 2I07B 4G6KL 2E6PA 4YHZH 4KMLB 2G9HB 5DRZB 1KN4H 4XVJH 4TSBH 1VHPA 1IM9B 4QNPE 3N85L 2AJ3A 5HHVH 3BISA 1BF8A 4KDTA 5AAMA 1PG7H 1RZ7H 2NY5C 4EI6A 3KPQB 3BZ4A 1NFDA 5I74C 3BGFC 4FABL 1VEOA 4NGHL 4EQ3A 4X4XB 5I8KL 2HYMA 4QCIA 4KC3B 1U3HD 2WWMC 2OZ4H 4PJAE 3V0VB 1X5LA 4R0LB 1XZ0A 3SDXE 2SEBA 4P0DA 5E1AA 4N1HB 3VXSA 1I9JL 3QDGD 1Y18A 3NTCH 4WO4C 4P4KA 3RIAK 1AD9B 4AG4H 3NN8B 4ERSL 5IOPA 3AY4A 4JKPH 3WLBA 2CSPA 2X1QA 4UUJB 1FVDA 4DVBA 4XPFH 3DGGB 3NIGF 2VL5A 1T5WA 3ULVF 4JFQB 3OAZH 2NY1D 1VFMA 4IBLT 1G7MA 2DLFL 3KHQA 3MNWB 4NQDE 2BSRB 4FTVA 3SO5A 3P4NA 1CDYA 1EXUB 4RQQB 4BFIB 4MJ6B 1IEAA 5DS8B 4UNUA 1XGRA 2EDHA 3PF2A 4JCMA 3ARTA 1G7IB 1MY7A 5B38B 2XN9E 3FO0L 4N0YH 3O81A 5B39G 1HSAA 5CSBA 4L4VB 2FB4L 4YDVA 3C5ZB 1OPGL 4ODXA 3ULVE 3LRHA 5F9JA 3IJYA 2DI9A 2NXZC 3WJLA 3QEUA 1MUJB 1LNUA 1KJ2A 4L4TE 1R5IA 4FXKB 4P59L 1FE8H 1A1OA 2AJUL 3RAJL 1W72L 3MR9B 4J12A 3ZDZE 1MNUL 3C60C 2PXYD 1QNZL 1EGJH 4I5BA 3OQ3B 2JK5A 4Y4HA 4NQCD 4LCYB 3T0EE 3I6LD 3WFEH 4HKBB 4NDMB 2D0FA 2DS4A 4XT1C 3QIUB 1A14L 2NY4D 4NJAH 3AGVA 4HXAL 5EIQA 5T3ZE 2BVOA 4NN7C 3WIFB 2BVQB 1J10A 2ZSVB 4YHMH 2DQFB 4H26B 1GPOL 4X6FB 3U30C 3VDCA 3B9EA 5FYLH 2M26A 3ULUC 4JDTH 5F7EH 1NFKA 3TYFA 5F88B 1SJEB 5M95B 3QUZB 5GISH 5FOJA 1YY8B 2DIJA 1UXSA 3WD5H 3B2VL 4X4YB 1DBAH 2VZTA 3BQUD 1QSFA 2NW3B 4LCCC 4QO1A 4S2SA 3BWAB 1AI1H 4M8QB 5HGHA 3RKDC 1H15A 3UYPA 2VR5A 4LCIL 2D4FA 4JVUA 3P30H 4WU5A 4XMPL 3TO2B 2F74A 4NQTA 5D1XD 3SQOL 3DBXA 4XRCA 3RWEA 2CIIA 1K85A 1XGYL 3P9MA 2AXHA 3C09B 2YUVA 3FOLB 3MA9H 2FECI 4P2RB 4ZXBB 1S7SA 1T0MA 2DYPD 3O6FB 3G6AA 1E4WL 2H45A 4XCFH 1U8JB 1MCQA 1QBML 1DR9A 5SX5H 1D5IL 2W9DH 4DKFH 1LVEA 4X6DF 32C2A 4QRPD 2NY5L 3MRDA 5I1HH 4XC3L 2GSGB 1SY6A 4NBXB 1FPTH 4R2GC 3X3FH 1QFPA 3W2DH 4OCNC 5FYJE 5HHNB 4I9WD 4Z7NE 2MCG1 4F57H 5E2UL 2D7MA 3VFRA 1HIMH 2MMXA 5KSBB 3IDYB 2APXA 3DPBA 5ERWA 2PR4H 4NN6C 5DEFA 3V0VA 4CAGA 3LKRB 1S9WB 1G7JA 2WBWB 4LEXH 4BSWA 4JY5L 5T5FH 3MOQA 2LU3A 4JY6A 5DRXA 1CDCA 3FQNB 1OWRM 3NACL 4UMGA 3SY0A 3NN8A 2APFA 4UUJA 4F7MB 3KJ4C 2X1OA 2PO6D 4M62L 3WDHA 2ESVD 4ZS7H 5IQ7H 3L7FB 4I18B 1AXSA 4JZNA 4G6MH 5E99L 1ZA6B 5E8PB 3MNWA 4M1CC 4WWKB 2AV1A 1Y6NR 4ZSOA 1EXUA 5BQ7B 4R4BB 4F33B 3Q1SL 3FZUD 4UU9A 4PV9A 3GBML 5FV1L 4L3CA 4LCUA 2JKXA 3O2DL 5DQDL 1FFNB 4CJ1A 1UM5H 3G5XA 3NCBB 2B7DT 5I1JL 2VJXA 2MJWA 4FP8H 1R3IL 3GUTA 1NGXB 2P46B 3QHFH 3ZDYE 4HIIA 5GGVH 1PFCA 4KTDH 1BBJA 5IBUG 3VGEA 2JB5H 3F65A 4KKBC 2XG4A 1XF2B 3IDMA 2AQ3A 2VAAB 2YBRB 4TUJB 4AEFA 2EYSB 1ZKAA 1GHFL 4D0DB 2C7UB 4N0FA 2NCMA 4LP4A 2H26B 1JPSL 4HJ0C 3FFCA 1B2WH 1NCBL 5BRZD 1ZLSL 4YLQT 2MFNA 4LCYA 4KMTL 4HKBA 2IANB 5DDHA 5AD0A 5IVOA 1A6WL 2H2SD 3WNPA 1G0DA 4H20H 1PJ9A 4MXQC 1AGDB 4TVSa 4UT7L 1JNHB 2GSIA 1AE6H 2CIKB 2XYCA 3ULUL 5CLWA 4U1NA 2XN9B 5CD3A 3KYOA 4LSQL 4K7PY 3V6OC 3TEUA 4QY8A 1G9NH 4OLYH 5CZKA 3VFPA 2E7BA 4M7LT 1SBBA 1WTGT 4I48A 4RFEA 4HMCA 4FXGA 5D8JL 2EXWC 1IEHA 3QHZH 1IC4H 3BI9X 1YY8A 1JUFB 3UJTH 4PJXA 1FFPA 5LKNA 4PJCB 2EC8A 2KDGA 4HT1H 5E9DA 5GGUB 4ZNEE 3IJHB 4Y5VA 1OB1B 1YJDC 5ESAB 4W81A 3SPVA 1B6UA 4ZUTB 3TO2A 5MI0C 3GHBL 3U79A 1DL7L 2XI9A 1BREA 3B3IA 3Q48A 4EOWL 5HHOD 1JTPA 5EUKB 3SJVB 1Q9KB 2GI7A 3DTXB 1EMTL 5MEND 1J1XL 2O5XH 3Q6FB 4OIIL 2WK2A 3VXRE 2AERT 2BRQA 4YPJA 1TETL 3K4ZA 2ICWB 2A9NL 2X40A 4NO3A 4F58H 3KLHC 2VLRE 3MRRB 3OKOA 4AIZB 1ETZB 3G9AB 4HUVA 2V5SA 3DVGA 3FFDA 3MRNA 1OAUH 5HHNA 5FCSH 3RVTD 3QEGL 4JQXC 4WUKH 5FAAA 3QA3A 4MS8C 3PWPD 4I13B 1U8HB 1QSED 3QFJB 5FUZL 4JFFB 4ELMB 3NH7H 5T5NF 5I66B 4HWNA 3OBAA 5I30H 3LKRA 1S9WA 4OCXL 4PJ5B 3I85A 2W91A 4PJ9D 5EPMB 4YNYB 3FQNA 3WL9B 4KJPD 4MA8L 4QHKJ 4B41A 4I3SH 5J1AB 3V5KA 1FLRH 1IGIH 1I1FA 4X7SL 3QZWG 4P99A 4PV8B 3MLTA 4U1GB 5MP6L 2ENSA 3O41B 4KHXL 3TBYA 3LVEA 4KKLC 2X9WA 2BY0A 2Y5TA 1ZA6A 1NAMA 4WWKA 3BP4A 5D7IF 1QR4A 1CICB 1QPPA 3TPUA 5DD6B 4R4BA 3UPCA 1J5OH 1SMOA 1FNLA 2CDFA 3VXTA 3QUMB 2RHEA 2FLBT 5CILH 5F44A 5T1DL 3O4LB 4OLUH 1HHIB 1A21A 2XZAH 3QI9D 1YQVH 1NH6A 4KZEH 4HJ0D 4DEPB 1NGXA 4HK0B 4ZUWA 4N90D 4KU1A 3V0WL 4ZO7A 1WZKA 3BSZH 4PJAA 1U3ZA 1WEJH 1LGVA 2XNAB 3SDXA 4DN3L 1CE1H 3ARQA 1YYLL 5D7IE 1QOKA 1UJ3B 2JIXB 4TUJA 1FV1A 2BNQE 3ARED 2EYSA 4UDUB 4ZS6D 2EC9U 4DFIA 2C7UA 4UOW1 4MXQD 2VLKB 2H26A 4LLYB 2Q8BH 2Z92B 4Y16C 3F7RA 2X42A 1U92A 1I8KA 4NPYB 3PGDB 5BVJA 5LGKA 5ISZD 4YH6A 1Z5LA 1GGIH 1EO8L 1MEXH 1XGQB 4NQDA 2H32A 2PYEE 4PUBL 3BMVA 1BEYL 4XMLH 4Q2ZB 5BO1H 3HR5B 4XNXL 1AGDA 3M07A 2ED7A 2YUZA 1JNHA 4WIQA 1FYTB 3MRPA 4LSRH 4ZQKB 4WTWA 2RIKA 2XN9A 3GJEA 1IQDB 2ENYA 5FF6A 1IT9H 2R4RL 5FGSA 3WDIA 2Z35B 4M4RA 2OBGA 2R2HB 3DX9A 4KHTL 3HI5L 4XVUD 5EZIL 5JHDD 4O58L 3SGDH 3GSWA 3JV6A 3O3EA 3L5XH 4ZPTB 1NCDL 5I2IA 4L4TA 3K74B 4Z18A 4M02A 4U3CA 1F6FB 5EUOB 2VQ1A 1YJDL 4LMQE 5IF0A 4PJCA 1T5XB 2I27N 4PTUA 3HE6D 4M48H 2CJUL 3T0EA 4QRSB 4WTZA 1WBZB 1RIVH 2HMIC 2ITCA 5ESAA 5HVGB 1LDPH 3CK0H 1W0YT 1F58H 2P5WE 4LGRB 4KJYB 4PYGA 2OTUB 5DJXB 1FSKC 4YUEL 4I0PA 2YC1B 3CVHB 3PIQA 3KLHD 4XC1H 3LCYA 5HYSG 3B9KB 1PQZB 1NDMB 1Q9KA 4G5ZH 4AL8L 2MWCA 3SKOB 4XI5D 4UNVA 3RGVA 1TCMA 1OTTC 1QRNE 4KUZH 1IBGH 1X6NA 2FECL 2ICWA 5LGJB 1IAIH 4QTIH 5DEGB 1PZ5B 4ORGB 4Y8AA 4AIZA 4LLQA 1ETZA 4GG6E 2P44B 4J4PD 4K71B 3ABZA 5EZJB 5D2LE 4DCQA 1FC1A 1GZQB 3QUMH 1MI5B 4FQLL 3ZL4L 1NGYA 4MXVF 1YY9C 4ODVH 5B8CB 2CK0L 1XR8A 5L8JB 4ZG1A 1G6RH 3DMMA 3CC5B 4OV6F 2HJLA 3IFLL 1CFQA 4LQFL 4BH7B 3VXNA 3QDAA 2DIAA 5JO5B 4NJ9L 3IU4H 3OJDB 3MXVL 4Z8FL 4NWUL 5EPMA 2Y23A 5K9OB 3WL9A 3IDIB 4LCWD 4U6VH 3UZQA 1NUGA 4G80A 3BPOC 1VACB 3KDMA 1CXLA 2PTTA 4V1DD 4LARH 3U82B 1BM3L 2F15A 4KROD 1E28B 4EIZC 1UB5B 5F7DA 3QDJE 1A6PA 3CSYB 5HDQH 3VA6A 1ZMYA 3SDAA 2OK0H 3MSPA 1FNSL 4QRRD 1HHIA 5ACZB 5TFSH 2WQRA 3W9EA 1EHLL 2AEQL 4D94A 4Y16D 1KB5A 1N2RA 4HK0A 2FBJH 2DRUA 1HHKB 3ROLB 1RPQA 4PRHE 2IBZX 4D3CL 5DURD 1IGCL 1T7VA 5ANME 4X5XA 2XNAA 1I9RL 3QUYD 3TBWB 3MRKB 4PJFE 1UJ3A 4ODTH 4LPXA 1ITBB 5K59F 4FFWC 1M7DB 5JW4Q 4Z77A 3KYAA 2DF3A 5KJRH 2Z92A 2XTJD 4BUHA 2R8SL 5DJYB 4JAMB 4L8BA 4NPYA 1UA6L 2DQGH 4HH9A 4QWWD 1JGUH 3TJEL 3ZTNH 4R7DB 4M7KL 5T1LA 3LH2L 5BXFA 1YEKL 3F7VB 4R6UA 4XNMA 5DGRA 5GS3A 2V7HA 4PGBA 2HFTA 3JTTB 5K59E 1MFDL 2NYYD 1NBQA 2D7TL 1F00I 3TVMA 4YJZL 1YECH 2FATL 1MIML 2Z35A 5C7XH 3R06B 3D0LA 3H7BB 3GRWH 3P4LA 4XBEH 5AYUH 4ZPTA 4WW1B 4TOYH 3GM0A 4L8DB 3MRJB 3HE7C 4LOUD 5DUML 5DR5H 4CVWA 2KH2B 4L3EB 1FIGH 5CJXC 1FFQA 1EZVX 1RD6A 3I9GL 1R0AH 4K3GA 1OP3H 4FFZL 1S7TA 4GRLB 4CMHC 1DQQB 4TSAH 4OCRL 2UYLB 5SX4I 1S9YB 4HWBH 1LEKA 3FHQA 3RP1A 1JVKA 4L29A 1F4HA 3ARDC 4WI8A 1JBJA 5H2BB 43C9B 3VXMB 2DQUH 2IH3A 3GI8H 1MHEA 4BZ2H 4HEPG 1PQZA 1NDMA 2P8MB 4GW4A 4D9RE 1ZHKA 3NVQA 4P46A 1X5KA 2XWJA 5SWSD 4GAFB 1K5NB 2ZUSA 4PJHE 5DEGA 2DDQL 3MRIB 1CE6B 2AK1H 4HSQA 1KEMH 4J3UA 1BVKB 3O8XC 5DJDA 5FYLD 5DK0A 4ZNEA 4CN4A 2VUOA 4FNLH 4Y4KD 3FN0L 3CC5A 4PJDE 4PYHA 2JTDA 3QPQC 3RVVC 1VCAA 4QXGL 1LE5B 5IVXB 4OM1L 4GMTL 2HRPL 4GKZB 5I75C 1G7PB 3IU3A 5FFLA 4KK5D 4XZUB 2P24A 1IM9D 3MJ9A 3IDIA 3T4YB 2D7NA 3BUTA 1BQHG 4JRXE 2XXMB 3MFFB 1ORQB 1EAPB 4KXZI 3WXVL 4MJIE 1MH5B 3D2UD 2WZPD 3IT8D 4ZO8A 2UZYB 4NCDA 3CSYA 4APQB 2CXGA 3QFDA 3LSOB 3G5ZB 3FO1A 5GRJL 2F58H 1NCAL 2R29L 3DYMA 4HAFA 4RNRB 3IRZA 4N0UE 5AEAA 1AY1L 5D2LB 1NMCC 2M8XA 3KJ6H 2IADB 4LVHC 1Z9MA 3C6LC 4MWFB 3LEYH 2X1XR 3PJSB 2CLZB 1GGCH 3TZVC 4QOKD 3V5DA 2NY0B 3U9UA 3TBWA 1CD1B 1C12A 5IW6B 1TJGH 4HKXA 1ZS8A 4XPAH 3SOBH 4HD9A 1A6UH 4XBGB 3V52H 2Z0BA 2ERJC 3GI9L 1RZJC 1ADQH 3SKNA 3QRFM 1D6VH 1YDPA 1TZIB 5DJYA 3AMLA 2NY2D 2JJWA 4QHMB 4H0GA 3CPLB 3BN9D 3MRQB 2OR7A 4F7TB 1GAFL 3DROB 5DYOB 2EIBA 2ZKHH 4G7YH 3H3PL 1ZLVH 5KN5B 1UADC 1EEQA 3O6LL 3OJMB 4G9FB 3JTTA 1BX2A 3IS0X 2VLJD 1K8IA 1YN7B 3CX5J 1DFBL 12E8L 3QDME 4JHWH 3FHAA 2O5ZH 3KR3L 3H7BA 1WQVT 1OW0A 1CFVH 5D7IA 2RFXB 1MCHA 3GZKA 2R56H 1GJIA 1TNMA 2BNQA 4HCRL 1MFEH 1RZIB 1MCCA 3JWDC 2Q87A 2JELL 3P77B 3PDOB 1P4BL 1FRGH 1IGTA 2UYLA 4AH2B 1NANH 2PYEA 4XXCA 1GGYA 3T65B 2YEZA 4RISL 5H37H 1RAMA 1FBIH 1A3QA 3D39B 1CL7I 1IZKA 2EZ0D 4Q6IB 1BFOB 3J7HA 3V9FA 1KELL 2VITB 5KVFH 1W2KT 2DLTA 3CUPB 1MIEL 3O8XD 5INCA 3QBTB 5SWZE 1QR1A 2A6IA 2F8OA 4P23C 3DX6A 3X12B 3BEVB 5KZCD 3L5HA 2OCFD 3QPQD 4Q0XL 5CIPH 1MWAL 3ZZ1A 4U1IA 2FEDD 3NGBB 2Z31B 5AAWA 4Y8DC 3B5GA 1JHTB 1ZTXH 4NWTL 3BH9A 5F93C 5INDB 3ZE0E 1IFHH 3DSFH 1E4XI 3QUXB 3VCLA 4YXHL 3B43A 2P5WA 1A3LH 1J8HE 4HHAB 1LE5A 3RVUD 4HXBL 3VRLF 1U8QB 2VERN 5I17B 2JCCF 1RIUL 3QAZB 3SKJL 5E4EC 5L2KE 5EU6D 1BOGA 4ELKB 5LXGH 1ORQA 2EICA 1EAPA 4D9QE 3BKYL 1QRNA 3TWCH 4IJ3C 4LGSB 2IQ9L 1E6JL 4J6RL 4G8EA 5HGDB 1TQBC 3S35H 1ROWA 3SE9L 4XMKL 1UVQA 5F70A 3HNSH 3CX5K 4GG6A 4ZUVB 4XAKE 1RZGB 5D2LA 5C0IB 1C5CH 4P5KB 3KVQA 5C92A 2BSTA 1WIOA 1K4DB 5JHLL 3BP5B 5EBWA 1T0NA 2QHLA 1F8TH 1RZJL 3TC9A 1P69B 4AMKL 3EOYG 5I73B 1CD1A 1DBBL 5IW6A 4YHYB 5GGQH 4GLRI 4J3SA 4XBGA 4JZOB 5BZDB 1GCFA 2FX8L 3DSNA 3WHE1 1NEZG 2GITA 5DWUH 2X4RB 3FQRB 2FJFA 4P9MH 2EDDA 2GT9A 3NA4A 5EWIH 2X70B 5IB4A 1CXIA 5ICXA 1K4CB 4Y19B 4CU8A 1EVTC 8FABB 1KXTB 3L3GB 3ULUF 4NHUA 4IRSC 5DQJB 3VFUA 1SEQL 1XIWD 3QJFB 3PL6D 4YPGB 3BZFB 1WSST 5DSCA 2J4WH 3EO1B 4PP1C 4L8SA 4PRHA 3DYPA 1FVCA 2EKSB 3JWDL 1PY9A 5ANMA 5I76A 3HG1E 3L3DB 1KLGA 3AM8A 2Y72A 4PJFA 1GZPB 5JW4R 5IP4A 1A22B 4O9HL 4XTRD 2H1PL 1KBGL 3FB6A 3KPSE 4DGYL 1DQMH 4G6AC 1RZIA 3L3OB 2G75A 3ULUE 1OSZB 3LQZA 1K3ZA 1I1RA 3OKDB 1BFTA 4N8VB 4XP5L 5EB9A 3QIBD 3PDOA 5L88H 4ZFGH 2ZNWA 1QFWI 2EO1A 2FH8A 1MVUB 4IIQB 3S36L 4EI5B 5CGMA 4X6BA 4PRDB 4KI5D 1DTUA 3E6HB 5FM5O 4NQED 3DHMA 2W07A 1IGFL 2A77L 3LAFA 4YO0B 3GIVB 5IHBA 3GSNH 5ADPL 3DUSB 4UILL 4XCCL 4PR5A 2LV4A 2MQ0A 3VG9B 1HHJA 1NGQL 1B6DA 4UDTB 2OL3H 2DB8A 2HLAB 2VITA 5F7LB 3BO8A 5E2VH 3OZ9L 2R0LL 2XWTB 5HYQA 2YXMA 4WTXA 1NQBA 4HC1L 3VGAB 5GS2H 4MAUL 3TN0B 3VWKC 3ARGC 5JNYB 4YHKH 3KPRB 1BIHA 1V3LA 3X12A 2NX5D 1JRHL 4NHCH 3UYRL 2AJZB 1HQ4A 2AJSL 4PG9A 2O93L 1ND0A 4DVRL 3T04D 5BVPH 3X3GH 4DKAA 3SCMC 3OV6A 4C56B 1JPGA 3VW3H 1D9KB 4WCYL 4U1MB 4K94H 4U1HB 4I3RL 35C8H 3FO2B 1KYOJ 4X9BA 4MAYC 4XNUL 4ODSH 5BW7C 3C08H 3FCTA 5IM7A 3VFMB 4OI7A 3EOTL 4RRPA 1ZLVK 2GUOA 3VH8G 4WHYH 3WSQH 3FQWB 3T77B 1MCFA 3MGOB 4K3DL 5J8OA 1YPZB 4R4FL 4ZODA 5JXEC 4AT6A 4RWHA 5I1CL 1IAKB 1OAYL 1JZ7A 4JKKA 3HMXA 3WLWD 4PJHA 3TCXA 2IH1A 4PJ5D 2J88H 5AZ2H 5EIIA 2ZUYA 3HZKB 1CGSH 1U8MB 5DJ6B 2Y4SA 5C0IA 1WBXB 3OGCB 1HXMB 2ARJQ 2AXFB 1K4DA 4OLWL 5ECJE 5D72H 3PNWB 4UV4L 1MELA 2ARJA 3RJQB 3TIEB 5C3LD 4PJDA 1YZZA 1UFUA 2MSPA 3OKEA 4J23A 4MA3A 3QPXL 1IMHC 2VXQH 3T1WA 1AFVH 5DJAA 3U0PB 1ZHLA 1T7YA 5BZDA 3G6JB 4WDIB 3BPNC 4J3TA 3QWOB 5EO9B 2A38A 4JRXA 5DJCB 3FQRA 1TQCB 3C5JA 3V4VH 4MJIA 3EYUH 2R2CA 1CR9H 3ZTJH 1BJ1J 3BPLB 3ZKND 4RGNC 4FZ8H 3A6CL 2R2BA 4TPRL 1QACA 3LN4B 1WITA 2IG2H 3QIWC 3REWA 2EYTB 2JIXD 4N0UA 3MLZH 2PN5A 5DQJA 5IB5B 1N7MH 2YD2A 5CJ8A 2BNUB 3QJFA 5F6HI 4UQ2B 1CD9B 1UYWH 4M5ZL 4YPGA 2AV7B 2J3SA 1EFXD 4TN9A 4HJJL 1Q1JL 1D5MA 1DSFL 2VDLH 3EZ8A 5HHMB 4P48A 4NM4H 3UTSD 5EOCL 5I19L 3NFNB 2MPAL 3A6BH 4RDQF 1VB9A 3HZVA 5A16A 3V6OE 3FT3B 1D5XA 3D3VD 2PCPB 4OZHB 4DZ8B 4ONGH 4Z78A 4NQVB 4WFED 3BH8B 2MHAB 1A6ZB 4OT1H 4KVNL 2R0KH 3TJHD 3S97C 3OKDA 3INUL 4BZYA 4M93B 1KYOK 1NMBL 3TNMA 5EO1B 1MVUA 2HTLC 1OAQL 4HZAA 4D9LL 4Y1AD 4LLUA 3WIHL 1DP0A 3MXWL 1CK0H 3VWKD 4OZGF 4YO0A 4JFDE 1KOAA 5E6IB 4ZFFA 1CT8B 1OP9A 2ATKB 1N6QH 3SDYL 2PW2A 2EECA 1CL7L 4NZTL 4B50A 2FJHB 2XWTA 3QDMA 5CZXD 1H0DB 2NZIA 4JPWH 5JMOC 2Z93A 3MUHL 5JNYA 3BDYH 4ZFOB 3ECBB 4KRPD 4G8GE 5DHXB 1X5ZA 2DQHH 3VXQA 5ILTL 4MAYD 1SM3H 1BF2A 3ET9F 5F6IC 5T1MB 3O2VH 4G6FD 4UIKH 2P8LA 2ZOKA 1I1AC 2BDNL 1D9KA 1RJYA 1IGMH 3P4OA 2YD6A 4S1SH 3RL2B 4GG8A 4GKNA 1QG3A 4P3DB 5ENWA 1RK1A 4LRIA 4YGVB 5C0CD 3VFMA 3ORJA 1WAAF 5DK3A 1HOCB 1P53A 1UKTA 1N3NB 2DTMH 3FQWA 3T77A 5MEPA 1RIHL 2K7QA 2ED9A 2BJMH 3MGOA 3VD7A 3DRTA 4ALAL 1DVFB 3Q2CA 5SWZA 5F1SA 4YHLH 5KAQG 2EDQA 1J0HA 1X5FA 1EJ6A 5C07B 4YX2L 4MQXC 1MCSA 5JOEA 5DVKA 2VTFA 4RMSA 3QNZB 1I9EA 5GJSL 4CU6A 2W38A 3DETD 5DD1H 3RVWC 4HPOL 4EN3B 1RZKC 3S3SA 3SE4C 3O6KL 1Y0LB 4Y2DD 1JGLL 2WBJA 1KIPA 3R0NA 4K3HA 4OCYH 2VISB 3PP3H 3TIEA 2VLLA 3H9SD 1AXIB 1MAML 1KUMA 1J8HA 3QT2A 4RGND 5EU7E 3UEZA 4JPKL 25C8L 2CKBB 3EYSL 3V79C 5L2KA 2VDRH 2FJGB 4LFHD 1EO7A 4LHUD 3SKMB 3QIWD 1CLOH 3IRPX 1FGVL 4MYWB 2J8UB 2BOBA 1JP5A 2FNBA 3CFJA 1BMGA 2YA1A 3OKMB 3K81A 4WO4A 4AYFA 5CJOH 2XQBL 4Z7UE 2MKLC 3SDCA 2YSSB 3UTPE 4DKEL 2EYTA 3DV6B 1QD0A 2PTVA 1ODAA 4AQ1B 1NEUA 2IAMD 4IRJB 1DQLH 2HFEB 4HJGA 3G08A 1OSPL 2YK1L 2UZIH 1FO0L 3MNZB 3E2HC 3DUUB 4LVOC 1JYVA 5CWSB 1QUNA 1KTRL 2XPGA 4P2OC 5JQ6H 3H0TB 1J1PL 1AC6A 1P5UA 3QRGL 4ISVB 1YMHB 5FGRA 3O2DA 1M4KA 1MQKH 3G6DH 5EULV 4X98A 3QUKA 1WWCA 1T3FB 4OGXL 5DVLA 1Q8MA 4WU7A 4EZMA 4F8TA 4NKIL 1KCSH 3RTQD 3C60A 5L9DH 1BGXH 3MBEC 2VZOA 5CBEA 1DBKH 1QFWL 2IALB 3FOMB 2XACC 3VGHA 4W4NA 3QWRA 5E6IA 3BE1L 3QEQE 5E5RB 4JGUA 4JO4L 2XA8H 4NP4H 2C3WA 2HT2D 3SE8L 2OXGA 4JQIH 2X7LB 3AU1B 3NPZB 3MV7D 1NCNA 1FH5L 2HT4C 3IXAB 3JUYA 1MFAL 3FB8A 3VWJB 3LN5A 5TE6L 1ZT4B 3KPPB 3E0GA 3KYKL 2G60L 5E94B 4Z7VB 1ZV5A 2MNUA 4JR9L 3VFVB 4DZBA 1DLHB 3KPSA 3VGBA 4DQOH 4WFHD 1U58A 3UC0H 5IK3B 2ICCA 4IDJL 1T1XA 4LK4A 4CVZA 1P7HL 2W0LA 3HZYB 1TDQA 3UYOD 1HWGB 5D71L 3TO4B 2B1HL 3RI5F 3WNNA 1F11B 1ORSA 2G5RA 4JFHD 4PB9L 2J12B 1FGNL 1NC4D 5KAQF 2CKBH 2NY3C 1J05B 3S3PA 2YRZA 5CCKL 4Z7WF 5JORB 1F3JB 4U1LB 2XV6B 4XP1H 1RZKL 5FM8A 5ESVB 4LBEB 1S3KH 3DVFA 3MGTB 1L9NA 3AFLA 2WLYA 4Y4FD 4XPTL 1N5YL 2L7UA 2YA0A 1QYGH 1MCWW 3KXFD 1OGAE 4NC1C 4JFPB 2W65B 5GGSB 1YEFL 2X4PB 1CWVA 4MSWB 4HH8A 4YBQD 1PLGH 1OP5H 5ACLA 1T1YB 3EJYC 1RZFH 4U6HB 3S6CA 1YEEL 3KHOA 4S1QH 5HHPB 1RU9H 5IMMA 1F4WL 2DIBA 1LE9A 1X4XA 4ENED 4GAJH 4PGDB 1A7OL 3K8LA 1YMMB 2C1PA 3SKMA 5DJ0A 4OD3H 3V95A 2WWKT 1R24B 1JZ4A 2OTPA 1AD0B 1DQJB 3CVIL 3GSVB 3AC0A 2BFVL 2JB6A 2XZQH 5GGRA 5C0AB 3DV6A 4MD4B 3EDDA 1N4XL 1TVHB 5DFVC 5D1ZB 3FONA 4U7MA 1E4JA 3SGEH 1GGBL 2A9MH 2FX9L 1FFOB 2HFEA 4KKCC 1NFIA 3BYTA 3ULVH 1TPXB 2UZXB 5MHSE 2BRRL 3HNTL 1VFBA 3MNZA 2I60L 4GT7A 3BEWB 4P4KC 4TNVK 5TJWK 3D69B 3PV7A 1JFQH 4PGZA 4J1UB 2E27H 5EC2B 4IMKC 3ULSB 3OR6B 3HI6H 1U8LA 5C08E 1YEJL 4ISVA 4ODHH 3MJ8B 1YMHA 5FCUH 4QGTA 1CLYL 3BAEL 4POUB 3ZDXF 2NR6C 4NO0B 5TDOB 3O0RL 1A7QL 4M6OH 3IAPA 4X0KA 1R3KB 3OX8A 5B4MD 4BYHA 2ITDB 3RA7H 5DEZA 1GXEA 2ZPKH 1T3FA 3CSBA 3QQ4A 1TMCB 1W0WA 4S1DD 4GXUM 2C3VA 5DD5H 1UCTA 1G9MC 2O61A 4OD1L 3EO0A 2ADJB 3UX9B 3LB6C 4OCLC 1H3TA 6CGTA 4E5XB 5T3ZH 4QHKI 3VU2A 2ICEA 5I9QB 3HCVB 1X5HA 4YDIL 3WJLC 3E3QC 4Q9QL 2AVGA 1UWEH 3DJ9A 4K8RC 1V05A 5D1QB 3VFGL 1MVFA 2XKNA 3GKWH 4FQHB 1I7UA 4TVPD 5E94A 5I8EB 5DMKB 1ZWIA 3ARUA 3V6OA 5TDPB 1E27B 2VR9A 4G9DB 4PJ8B 3HZMB 1CZ8H 4MZ2A 3VXUD 4HFUL 4YK4B 5C9JB 4KKAD 3D39D 4PS4H 2X4OA 1B4JL 3VDBA 3MOBH 4KTYA 1F4XH 3HZYA 4JM2D 1GVIA 4HS8L 3AS1A 5HHQA 2NQCA 4NO2B 2NXYB 4LHQB 4NZUL 1AGEA 1F11A 4OQTL 1HSBB 4XPGL 4TTGA 3BKML 4NUGH 4XPBL 1C1EH 4JFDA 5IGXL 4CVXB 3Q0HA 3QEQB 1Q94B 4XVTH 1TTGA 3MV9E 1NGPH 4WNQB 3UTQA 3RZCD 4AIXA 1TJHH 5JORA 3MLPA 1I9IH 5JXAH 3OKYA 1F3JA 2CUMA 4GKOA 1I7TA 4X6EB 4R9HA 5ITBH 3BD3A 5TF1L 5ESVA 1F5WA 2QADD 3QUXD 3MA7A 3MGTA 5FO9B 4UB0H 4HUKB 4P5TD 1FORH 2R0ZH 2MCPH 4Q9CA 3KLAB 3DXAD 1IAOB 3OG6B 4M7LL 2W65A 5GGSA 5KSVB 3NZHL 2DQCH 5BS0D 1T1YA 3ZHLA 5H8DA 5JIKA 1HKLL 3MYJA 4U6HA 2BX5A 2E6JA 4U1SB 5GS2D 4DGIH 2VXVH 1KB5H 1JZ6A 2RQ8A 1I8LC 5FYKH 1JF1A 3L5JA 2F54D 3U36B 1HDMA 2Q76B 5A3IC 4AEHL 4BQ6A 4YAQB 3ILQC 4JFYA 4K7PL 4LASL 2Q8AH 1NBVL 1AIFB 5CKGA 2W1NA 4JQXA 4MCZA 2BERA 4FN0A 4GBXB 4HDIA 1HXYA 3MLSH 3FRPG 4JJ5B 4LLAA 3TT3L 1C8PA 3TBSA 4PLKC 3ARFB 4LPWA 3WCYA 1OAZL 4GXVH 5DUBB 3U9PH 3HNVH 1A1NA 1XH3B 5F21B 3T2OA 1DQJA 3VXSD 4M3KB 5LWYH 2NPLX 3L3KB 3KPLB 3TFKD 4RFOL 1OTUD 3B2UD 3MMEB 4I0KA 4U1JB 4HLJA 4ONFH 1J0KA 5IIEA 2WP3T 4MLSA 4N5EC 1H3PL 3SN6N 2PETA 4NCC1 1HK6A 1NCCH 4NQSB 2R0WH 1FJ1A 4K3EL 1I3VA 1WZLA 1NKRA 4KQ4H 4OGYL 5KG9B 3T0VA 4L8CA 5HYJB 3RY6A 5HDOA 5HJ3A 3ZT5A 4N9OB 3ULSA 1KEGH 2R9HD 3OR6A 4MMXC 5HYEA 1WGOA 3V6FB 1OM3H 3VA2C 1RZ7L 4X8XA 4Y2OA 3LB6D 3NZ8A 1XR9B 3I3EA 3D18A 1C08A 1R3KA 5HHXH 3R4DA 1OARL 5GS0C 2WIIB 1I3GL 4NRXB 3V8OA 3T8XB 4Z7UA 2ZP0T 4NM8L 4X7DC 1L6ZA 4MDJB 4LAQH 5CS7A 4JKPL 3GNMH 3VFSB 4K8RL 4KI5F 4E5XA 2XY1A 2WIMA 2VDKL 4IOIB 4FZEH 4R90H 4XPFL 1MCKA 2NTSP 4Y4HD 3HI1B 5JA9A 3K3QA 1C5BL 4JG0L 5C0NC 1LQSR 1OP5K 3RY5A 1A9BB 4IRZL 3S7GA 5C8JB 2ZJSH 5C6TL 3DI2B 1EEZA 2CR3A 4OTXL 3MBXH 4PGEA 5DVNA 4YDKH 1NUNB 5B39A 5BV7B 1J0ZA 1NCTA 2W0FB 4WI5A 1CYGA 2R2EB 5DMKA 2AABH 3STLB 4XNZB 5TDPA 2P5EB 4HUMB 4M8VA 4PBVC 3CSPA 1A7RH 1DBJH 3GSOA 1NMAH 3UZEA 4FQXB 5CGYD 1GGTA 2RGSA 4IHOA 3QDHA 1MCPH 1INEL 1JN6B 3TNNB 3QIUC 4H5SA 1S7VB 4RGOL 1T7ZA 1WUNT 1F2XK 3PWNB 5ALCH 4P2CG 2GTWB 4BELD 4GAYA 4HIEB 2YPLE 4A2MA 2OMBA 1RMFL 1AKJA 4CVXA 1QSFD 3QEQA 5I1GH 3NCFB 1CIUA 4OLEA 5FO8A 3S5LG 4NRZB 5IR1B 2Y07H 5ACMA 5C2BL 3U7AA 3QUZC 5GGRY 2OMNA 1Z0NA 5A43C 3LS4H 4OB5H 5IFAH 1IL1B 1ZAGA 5E8NB 2HFGL 4EEEA 3OJVC 1CI5A 5I18L 2GJ6B 3MOAH 4NJAL 2H3NB 5A3ID 1A6VH 4XNYH 1LWRA 5I1EL 3VE0A 1AO7D 1DE4B 5CJQH 1EEYB 1G84A 3SGDI 1MJ7L 3KNBA 5C09D 1A0QH 3DURB 5K9JL 1QQDB 1A47A 1M6OA 3P4MB 3C09C 4PP2B 5HSFA 2OSLA 3T0WA 3JSSA 2FGZA 3RVXD 2A2QT 4ZXBC 2OQJB 1V3MA 3BKJL 3D85B 1SY6L 3O6FC 4KQ3L 3MV9B 1U8NA 2D3VA 2RJMA 2ZWLT 2YXFA 4JJ5A 4RSVA 3ARFA 3BIKB 1RI8A 4XPHH 4JRYB 3S37H 2X44D 3HUJE 2ILLA 2HWZL 4O2CB 1B90A 1QLEH 1WCBB 1MJJA 1X44A 4PJIF 4ZTPH 5TGBA 1VPOL 4AQOA 3KPLA 5D7JB 4LHUG 3LRGA 5J12C 3FT4A 3DHJA 5DO2D 2FL5B 2D31B 4GKSB 1JWUB 3ILPB 4OKVB 4U1JA 1OGAA 3IDYC 2F5AH 1J0YA 3U1SH 5C2UB 1IAII 5C0BE 1SYSB 3DGCR 1RHFA 4LPYA 4M5YL 4HKJA 4W4OC 1PG7W 4FQQB 5EFIB 3WKMH 4HK3N 1F42A 5HYIA 3FN9A 5KG9A 5IV2B 3L5WB 3KLDA 4PJIE 2W9LA 5GS0D 4JFEE 4WFFE 1AHWB 2Z4QB 3BP6A 3EOBA 5E08H 3W2DL 4K23H 4NQUA 4XGZB 4XH2A 5GS0L 4HUUB 3V6FA 1BECA 2F5BH 4I18C 1L0QA 1I7RB 1UQSA 3JTSB 2EDFA 5EO0A 4WWKC 3KLSA 1HZHL 5HI3D 2MTPA 4YQXL 4NC2B 4ZFZA 2F53D 1O7VA 4OLXL 4AENB 3QZWB 2EKJA 2LTQB 5DT1L 1RHHB 1KGCD 3BVNB 1OAXH 3DNKA 4GMSL 3FFCD 3QJHA 5EH1A 3FQXB 2VZUA 5T3XL 3DECA 3PHOB 1SQ2N 3KS0H 5FGBC 3W0WD 1RUPH 3I84A 3WFCH 2KL6A 1PSKH 4E0RB 4LKXB 1I8MA 2NY6C 3VI3E 3NCYP 1S9XA 2R2EA 5F89B 2I9TB 3MCG1 3KGRA 2P5EA 5C08A 4M00A 2RAMA 3L9RA 3LS5H 1CFNB 5FGCB 4FQXA 1TFHA 4U7KA 3DRQB 1KN2L 3QHFL 1T6WA 1MCJA 4Y5YB 1HI6A 5CJXA 3U2SB 3GM8A 3V7AG 3OPZL 3H6JA 5GIRB 2CMRL 4H25B 4PJEE 4MD5B 5E9DD 1A2YB 3GIZH 5IR1A 1X5JA 2E8YA 1UACH 4Z95L 3GBNH 4NNXA 5FHAH 1B0WA 5IQ9A 2DN7A 3ZE2F 3ZE1E 3U7WH 3TESA 1CG9B 5F1KC 5IBTL 1N64H 3KWWA 1AE6L 2DI7A 2YKLH 4LQ1A 1CFTA 1EEYA 3LKNA 4MJ5B 1VGKA 4OCSL 4ETYA 1CD0A 5FB8B 2DLGA 4YHNA 4IOSD 5H37G 3FO9B 3VJ6B 4RWYL 3GSQB 3AAZB 5C07D 1BOYA 4NBYB 3EDJA 3UJTL 5LQBH 1MHPH 2G5BA 1FCCA 3D85A 3MV9A 1DANU 2VOTA 3MV8D 1RUKL 3MQIA 1T7XA 4KV5F 5E2WL 1U95A 1JHLL 5HYSB 4A6YH 1OCWL 1BFVL 3F12A 1CF8H 1CGXA 2EDOA 3K2MC 2FYYB 2IFGA 5F7MC 4N5UA 4RFNB 5JMRA 5IMOB 3MLXL 1CGVA 4M7ZB 5J57B 2FL5A 3LKSA 2Q7YB 4K7FA 2UWEE 4PJBE 4RIRA 5IW3A 3DMMC 3VFWB 1IKFL 3S36X 4JZJB 1HKFA 1NCWL 5EORL 5K9KB 1UXWB 4ZMAT 3VD5A 1INDH 4WV1B 4E41E 2BHZA 3G5VB 5IV2A 3L5WA 1NAML 5CINH 1U8KA 5IMKB 5CEZL 1HYSC 5HTSA 2LQRA 4WY7L 4U1GC 2RCSL 4XGZA 4HUUA 4D2NA 1G0YR 4F7EB 2Q86B 3TZVA 4OF0A 1MLCB 1CICC 2GAZA 1OF2A 3WMSA 2WUCH 1A7PL 2B4CC 5I30L 3L7EB 3SDAC 2DL9A 1U3HB 1H5BA 3KS0J 4OM0H 1OY3B 5CLTA 4DEPC 2VXSL 5JOPE 3QDGB 2HKFH 1FNEB 4GAGL 4ESKA 4CUCA 1T1ZB 2QQLH 3RUGE 1N6VA 5DUPL 1HINH 1BAFH 4NQDD 2V2XA 3RNKA 3VRJB 2VQTA 4PJGE 1CLZH 1UJ3C 2C3XA 5M94B 2H41A 2Y36H 4OUUB 1O7SA 2NY1B 4LKXA 4FQ1H 4WUUE 3U0WL 5CILL 3NABL 3V2AR 1M05A 1CFNA 1FDLH 3DRQA 4R4ND 3WYRA 2X4NB 3JVGA 3ULVD 2AEPL 1SYVB 2Z8WC 1HH6B 1HQRB 5DF0A 4L4TD 3X11B 4JO3L 4YHIB 4PRIE 5CJBA 3NA9H 2GK0B 5IB3B 4LSVH 2DLEA 1L7IL 1IC7H 4LL9A 5E8EB 3MLUL 5AWNH 5EZLB 3PWUA 2NY7L 3U6RB 3TH4T 2YHGA 2UUDH 3T0ED 3WHXB 2DKUA 5TQ0H 2QV2A 2ZUUA 3C5SA 2PXYB 2HTKD 1IEBB 2XZCH 1MLBB 1J0JA 3WFHB 3HC4H 4NQCB 2J6EH 3HMWH 3TO4D 4ZAKD 1LO0H 1VADB 1Z0MA 3HMXH 4JHAH 5BO1L 3CMGA 4I0PD 3O2WH 2QR0B 1CG9A 5T3ZD 5SWQB 5D5MF 5IESH 2NY4B 3HRZB 5JLZA 4HIHB 4LF3A 3RGVD 1U2CA 4R26H 4P23A 4WJ5B 1R3JA 5DZNA 5EU5A 3NBNA 3DV4B 5DMJB 3H42L 3EJZC 3ARZA 3MLWH 4JRWA 1AXTH 1N0XL 2HLFC 3AXLB 4HC1A 4M6ML 3AAZA 1BLNB 3B9KC 5DLMH 1P1ZB 2YPLA 1D3CA 4G6KH 3QNXA 4YC2C 5K9QI 3IDJA 5JW4M 1NANI 3N85H 4LIQL 5DK2A 5A40E 3BQUB 5CP3A 4NKMA 3PGCB 3BT2H 3P3YA 5HYSA 4FABH 4JFZL 4PFEA 5IEKA 3PWPE 5I8KH 4K71C 1AGFA 4XX1G 2WINA 4QHNB 3BPCA 1WFNA 1OWWA 2VC2L 3CH8A 4X99B 1LD9B 5D1XB 2GTZA 4DK3A 3VMNA 2NTFB 1I9JH 4OAWB 2APBA 1VDGA 3CLFH 1IJ9A 4M61B 1FNAA 3MUJA 4ERSH 1F6AA 4JZJA 4KUZL 3IDXH 4X9GA 1WICA 2DYPB 4XB8A 2AJXL 3IKCB 4X6CF 5CD5D 3UTTE 2DLFH 4QXTA 4WHYG 3V4UL 1P7KB 5I74B 3BGFB 1LP9F 4QRPB 4HWEL 3SDAD 5FYJD 5GSVB 1R5VB 2BMKB 2B2XL 4WHCA 2B4CL 4LSSL 4XHJC 3BP7B 2Q86A 3F5WA 3DUHA 4Q97A 3RFZC 3HUJA 1NBYB 1LO2L 4MB3A 3MJ6A 5CZVH 3HPJA 1DN0B 1OPGH 1BQHB 4N0CC 1S9VB 4Z5RA 4CMMB 1U3HA 1JGVH 1UENA 2A6DB 2JCCB 4M6NL 3QO1B 2GJZB 1OHQA 4U6VL 4AK1A 4P59H 1X5AA 4R8WL 3H3BC 3C9NA 2AJUH 2AW2A 1FNEA 1W72H 5D2NE 3RAJH 1FAKT 1MNUH 5B3NA 4NO0D 1VFUA 4KRMB 5C0BA 1S5HA 1SEBB 2WANA 1QNZH 2ZCKL 2PO6B 3GMOA 5T1LD 2ESVB 2FRGP 5DJZB 5J6HB 1RUML 4X7TA 4IRSA 1TVBB 4HQQL 4JFEA 2NLJA 4OCWL 1U8PB 3CX2A 3EDKA 4P4RA 3IDGB 3OR7B 3J8F7 1X3DA 1A14H 3ZTJG 2NXZB 2P7TB 5F3HB 1FL6A 2AK4E 5E4IA 4QRUB 3TVMD 4HXAH 2B0SL 4OZFA 3T3PE 2FBJL 4IOFC 1IGYB 4ACPA 1TZHB 5IB1B 2GIYA 1GPOH 3ES6B 5ALBL 1U8IA 2GYSA 3HS0B 3X11A 1DLFL 2VR4A 5I1AB 2C4FT 2DMCA 2GK0A 2APWA 4OSUL 5JHDE 3LEXA 4CBPA 5E8EA 5IHUL 2CLVB 4WEBL 1A4JA 4GRWE 5KSUA 1DDHB 2ED8A 5BRZB 1JGUL 2AGJL 1OGTA 3WFHA 4NN7B 3TBTA 3BGMA 2Y6SC 4LCIH 4YFLI 4NFBA 4XMPH 4GW1B 3TBVB 3IVKB 3VFOA 2QR0A 1T0PB 3WIHA 5SWQA 1XCQB 4GRLC 3CVHL 1XGYH 4KGJA 4UINL 3RNQB 4P46D 1UZ6F 1V8HA 3ARGA 2I5YL 2V7NB 1T2QL 1E4WH 1YYML 1QBMH 2HN7B 4LCCB 5C9KA 3EFFB 1D5IH 3MJ7A 2EIZB 1BZ9A 4NC1E 4XCYA 1FZOA 2NY5H 4NKDA 4EVNA 3M8OH 4XC3H 4OUOA 4G42B 2OI9B 4PJEA 3KPNA 2W9EL 3V6BR 1VGEL 5KSAA 3BQUA 4TSAL 4K9EC 5FHBH 3PGCA 1B0RB 5E2UH 1NFDF 4I77L 1JYWA 5EU4B 5BW7A 2D0GA 4KJQD 4O51A 4QHNA 4JB9L 2N1KA 3GKZA 3WUWB 4M3JA 4X99A 4JY5H 3NCEB 5HHOB 2H6PA 1L6XA 3MRGB 3VXRD 2YD5A 3NACH 1I8IB 1F90L 1P4IL 2J1KA 3MJ9L 3PABB 4QTHA 5MENB 4M62H 1LEIB 5JOFB 5H35A 3IKCA 2VLRD 5E99H 5KVGL 1P7KA 3Q5YA 2J8OA 1HILA 2FO1A 4N0CD 5EC1A 4QRPA 5ETUB 3Q1SH 4NN6B 4UBDC 1KC5L 1R5VA 2BMKA 2BNRE 3O2DH 5DQDH 1OTSC 5I1JH 1C7TA 3HC0B 4EDXB 1R3IH 4FNLL 1EUTA 2X89D 4APQC 1FQ9C 2R1XB 4MNQE 3PWPB 2HVKB 2ZUWA 2PF6A 4UZGA 1QSEB 1DQDL 1CDHA 5FOBA 5J1SC 2V2TA 4F7PB 5C0GA 1QO3B 3T09A 3IETA 5DRNB 4F37F 4OI8A 2VABA 4PJ9B 5IMLB 4PJBA 2UWEA 4JANB 4CADB 1AJ7L 3IFPB 2ADIB 4U0QB 4OF6A 1JPSH 4YDJA 2CGRH 2OJEB 1TTFA 2XTJE 1ZLSH 1R3LB 3JBG7 2VXTL 4QF1B 5DJZA 5J6HA 4KMTH 3MRMA 4E41A 3GGWA 1TVBA 3CFEA 3L3JA 4JY4A 1A6WH 3CFCL 1U8PA 5ADOL 1T80A 1X9QA 2ZSWA 3IDGA 3E3QE 4GW5B 4XBPB 2XT1B 2B8OT 1FNGA 3THML 2P7TA 3V4PL 4UT7H 5F3HA 3ULUH 4LLWA 2PYFA 5I1IL 3MNVA 3PHQB 2K3TA 4LSQH 3TA3A 3F62A 2QQQA 1IKNA 4KK8D 1F4YL 3QI9B 1EIBA 1JZ8A 1NEZB 1V7ML 2DJUA 4I4WA 2GY7B 1UEYA 3QULA 1BZ7B 5D8JH 3QEHB 2BNQD 5C6WH 1FN4A 5I1AA 2PW1B 1KPUA 3P9LB 4KI1A 4D0BA 2Y6SD 4XCEB 3OKLA 1S7UA 4HFWA 5D2NB 1D6VL 5C0JB 2EIEA 1I7ZB 3RUGA 2H8PA 4OGAC 4PJGA 2Z8RA 2PYED 3ZKXB 4PRPB 3FQUB 3MODH 2BHUA 5F97E 3EHBD 5ISZB 5D93B 4WUUA 4LLMB 4GW1A 1VFAA 3IXTB 2A74B 3JV4B 1DL7H 3P11L 1JYNA 1U91B 4EOWH 5J6GA 4E42A 2NW2A 3PQYE 3MRLB 5E95B 3WS3B 4G43B 4KMQA 1EMTH 2V7NA 3L6FA 1J1XH 4OIIH 2A6KB 2A0LD 2AXJA 3WXWL 3EFFA 1TETH 4TUOB 2R56L 2EIZA 1FL3B 2GJ6D 4HEME 4K9EL 4F2MA 3RL1B 3U4EA 4N8CL 1RULL 4JPIA 5MI0B 1U93B 3WIIL 5BMFL 4KK9C 5HI5D 3QEGH 4S1RL 2P5WD 1KB9K 3HE6B 5EU4A 4L9LB 3VD4A 3DVNB 4HS6A 5FUZH 5IHZB 4KTEL 1P7QD 1A6AA 3NGBC 4OZGB 4P2YA 1ONQB 3C2SA 4OCXH 2FWOB 1P5VA 1CFSB 4YR6B 1A7NL 5D6CA 5GRVL 5HHOA 4YEFA 1OL0A 1REIA 4MA8H 1PYWB 1NGWB 1QRND 3RJDA 4XXDB 6FABL 2J5LB 4X7SH 4Y88A 1S5IL 5IJVB 5MP6H 3UMTA 5TH2B 4HIXL 4KHXH 5JOFA 2LFGA 5KOVC 1QSZA 2ZG3A 1BWWA 3SDDA 3CAFA 4RX4D 2FIKA 4PTTB 4JE4B 3ZHDA 1JV5B 5ETUA 5IVZA 5ID0A 2FEEL 4XP9L 3V0AC 1MSPA 4RMTA 3S96A 4ZDHA 5T1DH 2NMSA 7FABL 5JA8B 4LNVA 3DI3B 1T7WA 1N8ZB 3OAYH 2R1XA 3AROA 3PWPA 1KTLA 4C55A 1QSEA 3V0WH 1MRFL 3WE6B 5EN2B 1IRAY 5LGHL 5IKCB 4DN3H 4FG6D 4GS7C 4Z7QF 2E9IA 5FDWA 5DD3L 1CQYA 1A4KB 1Z9SA 4PJ9A 5IMLA 2H2PD 4JANA 4HUXA 4LCWB 3TLRA 2OJEA 1AGCB 2D7QA 5I8CB 2EDJA 3B4NA 2FHCA 5I73C 1R3LA 1D5ZA 3QDJD 1UH3A 4L4VE 4V1DB 2ZCLH 1EO8H 3UTTA 4GSDL 5J3HD 2A1WL 3PWJA 1MQ8A 5DMIL 4KROB 2BVTA 1BEYH 1KF9B 2KPNA 2VZSA 4ZO9A 2X4UB 1QKZL 4NFDA 3LRSA 4XNXH 4H1LH 4Z7QE 5JDSB 4XBPA 1TJIL 1CVSC 3VXOB 5CP7B 2R1WB 4HV8B 5T3XE 4QRRB 4ODWB 4P2OA 5FYJU 5MEOB 1ES0B 4Y16B 2BXYA 4D0CA 1S7QA 2JJTC 3HI5H 4KHTH 4NT6A 4GQ9L 5EZIH 5DURB 3P9LA 4O58H 3GMLB 1NCDH 3QUYB 3BDXA 4XCEA 3Q3GA 5D2NA 3AREA 4PJXF 2P4AB 1EJOH 1YJDH 4XP6L 5C0JA 3IS1X 4K7PX 1I7ZA 2X10A 3BRGC 3RWGA 1NDGB 3MBEA 2KKQA 1QVOA 3UJIL 1LO5B 2CJUH 1T21B 4S10A 4Y5XB 3DX7B 3MACL 5BZWB 1S8DA 1WIPA 4LLVB 3HN3A 4YUEH 1EVUA 1T2XA 1U91A 2AK4A 4CW1B 2L0DA 5FO7B 1K9TA 5C0EB 4IIQC 3P40A 4EI5C 2N4IA 3PXJA 5A2JH 1PDKA 4NO5B 2QSQA 2A6KA 2Y06L 3GFUA 1A5FL 3RWJB 3O9WD 4U05A 1V7NL 1KNOB 1LO4L 2JJUA 1MF2L 1FL3A 1KIUA 5IB2A 5JHDA 3HC3L 1Z6JT 1DQML 1NC2A 4YBLB 3UPRA 2VDML 3TN0C 5L88L 1MHHA 5ESQB 1FG2A 4HG4K 4WENB 3ZL4H 1UZ8B 5J13B 4P2RE 2GCYB 1EX0A 2CK0H 4JGMA 3DVNA 4NOBA 3GJFH 3IFLH 1GSMA 1DCLA 4LQFH 1KENL 5CEYA 4UOJA 4NJ9H 1TNNA 1ONQA 1BVZA 1ZVYA 2D03L 3MXVH 5I1KL 3NFPA 4Z8FH 1G7HB 4NWUH 1OD7A 1A9EB 3RWHB 1ZANL 1D9KC 3PXHA 4D9RD 4FQ2L 1MJ8L 1I1CA 5A2LH 1QPXA 3EYFB 4XXDA 1B0GB 4EXPX 3VI4F 1N59A 5C0FB 4XWOC 3SE3C 4F7CA 5SWSB 1BM3H 5KSBE 5IFJB 1BVLB 4A2LA 1J11A 4F3FB 1KG0B 3MREA 3VD3A 3K0WA 5DTFB 1LHZA 1DEEB 1T2JA 3MX0A 1ZT1A 5EBLB 3X3GL 2CR6A 1FNSH 5EOTB 4PJ7B 3UAJD 4S0TD 2HJKB 2DJSA 3S4SG 1EHLH 2AEQH 5JIPA 3VH8A 5F6HJ 1N8ZA 5CEXA 2EDXA 3BPOB 4NNYA 4R97B 4Y4KB 1FVEA 3WE6A 2YN5A 4PJAF 1XCTA 4D3CH 3RHWK 1IGCH 4YZFE 1I9RH 2AQ2A 2IEPA 4HMDA 5CEZE 1RUQL 3ZYIA 1IC1A 4JRXD 3WS6A 4Z7WB 4NSKA 4LEOB 5FECB 3CH1B 4MX7A 1PZUB 5IWLC 1AGCA 2R8SH 1JGEB 5DHYA 4AM0B 3CLEL 1N5AA 5FA3B 1UA6H 3D2UB 1UGNA 5IEHA 3RWCB 3TJEH 1XGTA 3KPOA 4M7KH 3N1FC 3LH2H 2YPKB 1YEKH 3CZFB 1TQCC 5HYFA 2BNRA 5JDSA 1NLBL 4YHOL 3BPLC 2QQKL 1CIDA 3KYNB 2OTWB 3VXOA 5CP7A 4KJWC 1MFDH 3MCLL 4HV8A 5JUEL 3SDCC 4EDWL 2D7TH 4KVCL 4ODWA 2DWDB 2FATH 4HS3B 4IMKA 4MNQA 4YHPA 1ES0A 1MIMH 1W8OA 3EYVA 4QOKB 2IANE 2QHRL 3RU8L 2XRAL 3EGSA 1JNNL 5DUMH 4X7EC 3ZDZF 4DTGL 4PJCF 4BFBD 4MCYA 1IM3B 4PLJD 1HEZB 3D25A 2VQUA 3I9GH 3FQTA 5FA4A 1T66C 4FFZH 4P3WA 3H9HA 1FZMB 4ZOCA 2NY2B 3BZEB 2EEAA 3T2NH 2OZ4A 4X4ME 1GYAA 1T21A 2R1YA 1RJZA 4ODBD 1KPRB 3F7YB 3HB3C 4DWHA 3SGEI 1LEGB 3REVA 2IQAA 4PB0L 5C71A 1MCLA 3MLZL 3NCJL 4M93C 1HE7A 4NQEE 2P1YA 4O2FA 1QFUL 3IFOA 2XFXA 3GMMA 3PWLA 3AB0B 3QDMD 4EUPA 2HH0L 1HHGA 2VXUL 4PJCE 5E0QA 4NO5A 4DGVL 5F9DC 2VLJB 5GSRB 3MRCB 3U0TB 2CXKA 3KYMB 5E6IC 2HVJA 1KNOA 2B39A 3OKKA 4ONGL 4J8RB 4DUWA 2DDQH 3ARDB 2DICA 1JWSB 2GFBB 3BYYA 5CUSL 5L6YL 1RK0B 3HKFA 3MO1A 2H9GB 3F6LA 1ZT7B 1A8JH 4U6XB 3SJVE 3O3AB 1R5WB 1FL5B 1C16B 3FAXA 3FN0H 1DZBA 4W6YB 4KZDL 2VDOL 3GK8L 1K2DA 4U3HA 5GQBA 1U6AL 3EYOA 1T4KA 4BKLA 1CCZA 4OM1H 1G7HA 4GMTH 3VFNB 2HRPH 4OBSA 4FQIL 3PQYA 2Y7QB 1EGJA 3RDTD 5SWZD 3LMJL 4H88L 3ARBA 3EYFA 5IW1B 4LIQE 5C0FA 1EHXA 1QLRA 3WXVH 1UG9A 4LRNH 3O8XB 1AQDA 4ZUSB 3QFJE 2HT3D 5D7LD 4JFFE 4ELME 5IFJA 3GSXB 1MWAB 2WBJD 5F1IB 3FT2A 5T1KA 4PJ5E 3VFTB 3BXNA 5GRJH 4DKDC 5KZCB 1NCAH 2R29H 1I8LA 4G8IB 4MA7H 1AY1H 2DKSA 3CZJA 4P2QD 5C0DB 4Z7NF 5I75B 5SV3A 4C4KO 2JJSC 4N0RA 3EW3B 1VKXB 2HJKA 2LABA 1J8HD 1C5DA 1NL0L 4RAUA 5JPNA 4EN3C 5HVHC 1ZSDB 4Y4KA 3MLVL 2XG5A 5L2KD 1S7WB 1Q9LB 3M1BA 2I07A 2WWMD 2G9HA 3GI9H 5DRZA 4MDIB 2YPVL 4D9QD 3NAAL 2BJML 1SVCP 5EU6B 1IM9A 4UTBH 3UP1A 3EZJB 1KT2B 3O4LE 4WO4D 4AM0A 4OV5B 3KPQA 3SDCD 2X4QB 4IEFB 4X4XA 4ZNCD