1ZANL

Crystal structure of anti-ngf ad11 fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASLGETVTIECRASEDIYNALAWYQQKPGKSPQLLIYNTDTLHTGVPSRFSGSGSGTQYSLKINSLQSEDVASYFCQHYFGYPRTFGGGTKLELKRADAAPTVSIFPPSSEQLASGGASVVCLLNNFYPKDISVKWKIDGSERQNGVLDSVTDQDSKDSTYSMSSTLTLTKAEYESHNSYTCEVTHKTSTSPVVKSFNRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab AD11 Light Chain
publication title Dissecting NGF interactions with TrkA and p75 receptors by structural and functional studies of an anti-NGF neutralizing antibody.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 54
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zanL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zanL01
3UMTA 1A6VH 1Z9MA 3QHZH 2YZ8A 3CDGA 1NMAL 1P5UA 4ZFGH 3KVQA 3V7AE 3B8SA 3G5XB 3EJYC 5EORL 2OZ4H 2NY6C 5HDQH 5BRZB 3SKJH 5HD8D 3WSQL 1CICD 4MJ5B 5JHLH 4XVSH 3BP6A 4DUWA 5AAWA 3QO0B 5HHVH 3GMMA 4DVBA 2QSTA 3QQNA 4N8VA 5EC1A 3WFDH 4K94L 2X44D 4JFDA 4K7FB 1LGVA 1MCCA 3V9FA 1RFDL 3D69B 3DX7B 3U4BH 1J5OL 4OLZH 3DRTA 4PJBE 2ICEB 1DZBA 3QUZA 3QUMA 3ARXA 4EZMA 5MENB 5KZCD 2YD7A 2FD6H 3O6KL 4JVWA 4Z7UF 4EUPH 5ACMA 3DOSA 2ZOLB 1OCWL 3WHXA 2EKSA 5L8LB 3FFCA 1NCBH 1NCTA 1WFNA 2X2YA 1IE5A 5IB4B 1BECA 4GBXA 1A3QA 2H2PC 4JKPH 4HGWA 1QA9B 1KTRL 3I6LE 1A6VL 5E8DH 3QHZL 3MV7B 3MYJB 4OZFB 5C08D 4M03A 4ZFGL 4MNHA 3F7YA 1FNHA 1I7TA 5I8KH 4NN6B 5FM8A 5E08H 1DVFB 4YBLC 5HDQL 4OCSL 1T4KB 2EE2A 3O4OB 2VLJB 3EYQD 3I75B 4QRQB 5CP7A 4ZAKB 4Z7VA 5CEZL 1SBSL 1TJGL 3QNXA 3IDXL 1KIRA 3VXUD 5HHVL 4OM0L 3O41B 2XICA 1E27B 3TO2B 5I66A 2VXQH 5FK9A 5HGHB 5AZ2L 2LTQB 3D3VA 3WFDL 1AXIB 4P99A 5FB8B 3HS0A 1AO7B 2VKXA 3STLB 3MA7A 1QBML 3SDDD 1ZGLP 3FQNB 4WI5A 1EBAA 2BMKB 4OLZL 1C5CL 4MJ6B 1JRHH 3IS1X 4HK0A 1CLCA 4LVEA 1YN7A 3F6LA 1M6OA 3BJ91 4GRWB 2QKIB 2VZ1A 1DCLA 1FL5B 5E2WH 4NP4L 1A9EB 3TBTA 4NCC2 4LLVA 2DQUL 4H20L 4XBEH 4WEMB 1TZIA 4XPAH 4NCC1 3HFMH 3MLRH 2G2RA 1FYTE 5HYFA 3QI9D 5FOJA 4WFEE 5T1KA 5I8KL 4JQVC 4O2FA 5E08L 4NKIH 4O4YL 1IM9B 1A7BA 4MD0B 4JFFD 3TIEB 1OGAE 4HPYH 4MLIA 4PJCF 5A1AA 4DCQB 2BERA 1K2DA 2ZPKH 2NXZB 2VXQL 4HS6A 5I19H 2W65B 3EKCA 4I9WD 4H88L 4IRSC 3S34L 2PO6D 3A6BL 2Z4QA 5FHBL 4Z7WF 5D1XC 1I7ZA 1NDGA 4IRZH 4F58L 1TTGA 3KPOB 3PWPB 1GC1H 2RQ8A 2ARWA 1NC2B 4P4KB 2EDOA 5IVXA 5FCUL 2IQAA 3IFLH 3VG9B 5GQBA 4C83A 5IB3B 5TE6L 3LB6C 5F7KC 1LQSR 1BJ1H 4MSWB 1UXWA 3QH3A 2A73B 3L3JB 3X12B 4L8CA 3VFRA 4GRLB 4M9OA 5JTWA 3WLWC 4C58B 4XBEL 3EYSH 5FUOL 1AKJA 5FECA 2VOTA 4G6JH 4TPRH 3L3GA 4GG6F 5C71A 4XPAL 1J1OL 4OSUH 1KFAH 1ZV5A 2VZOA 3F7QA 4MJIA 3MLUH 2QJDA 1C7SA 5GGUB 4P3CH 1DQQB 3LKPA 3MRFA 4OQ1A 1Y0LA 4NKIL 4LCUB 1ORQA 3QUXD 4PRAA 3QDJB 2FWOA 1YEGH 3U2SB 1AC6A 4HIIA 3DECA 4HH8A 3QCTL 4WGVB 5C0AE 5KS9F 2VABA 4JQVA 1CDIA 3O9WB 2R4SL 5DJ8A 4K3JH 5HHXH 1TENA 2A6DB 2ZPKL 4PY8I 1I3GL 5I19L 4FQPA 3CFCH 3VFSA 3TYFA 2CLVA 1IBGL 3SO3B 3T0EE 1PW3A 3FHQA 4APQC 4YXLH 3CU7A 4TSBH 5A43C 5ISZB 2Q86B 4R96A 4RGNC 3CC5B 4PR5B 1Q0YH 43C9A 4XNZB 1S7SA 4IRSA 4MAUH 4PS4L 4PUBH 5ID0B 1S9YB 1QVOB 1A5FH 1MCEA 5HPMB 5D1XA 2ATKB 2XKUA 3QCVH 2W1NA 1S7WA 2Y06L 2F19H 2FX7L 3TZVA 4K9EL 3WNNA 1MI5E 4M3JA 2P24B 1BFOA 3V7MA 1GYAA 4OJFH 2AJYH 1YMMA 5CJQH 3ZT6A 1QLFB 1ED3A 2J6EL 5CEXA 2R9HD 4RQQA 4G6JL 4L4TA 3C5ZB 3JUZA 3BGMB 4NQSA 3WUWG 4JR9L 4P2QE 3RDTC 4RX4A 2NW3A 4NFDA 2VMFA 3Q1SL 5IESH 1F11A 4Z7UA 4P3CL 4WUKH 3V5HB 1YJDL 3W0WA 4Y4KD 3LEXA 2A9NL 1UM5H 2G75B 2D4FA 1LK3L 3SCMC 1GPOL 43CAA 2GT9B 3O3EB 4Q9CA 3TBYA 3O6FD 3JTTA 5C8JB 1R3KB 5DC0A 1I8IB 4KXZH 2V7HA 3F12B 2EECA 3L6FA 3CFCL 2VDRH 2E9JA 1I9RL 2ZCHH 4RGMC 5C0AB 5DC4B 2Y72A 2FGZA 1NBYB 3EDKA 3FT2B 2WBJB 2E8YA 4L8DA 4TSBL 4F15B 2P5WB 2XZCH 3PL6C 1EHAA 1A4JB 4Y4HD 1A7RH 1Q72H 4X0KB 3OJ2C 3T0EB 1JV5A 3NACH 5EBLB 3HHRB 3IAPA 4NRYA 1YY8A 4IRJC 5JPMB 3UTZA 1K5NB 5B38A 3WE6B 4JFZL 4HX1B 5I6XC 1S7RB 5CINL 2AJYL 2VDNH 1OWRM 4PG9B 4KTEL 1BLNA 3ULUE 4QNPF 5EA0L 5HI4C 4POZD 1E4JA 3QPXH 3QQ9D 4WV1B 3VGDA 4U1JA 3QO1A 1A6WH 1HNFA 1SMOA 2DIJA 1T6WA 4XP5H 1AI1H 1U91A 4GRMB 1BQUA 1M7XA 3RDTA 4GW1A 3CCHA 3D0LA 1MCHA 4E42B 4YJZL 5DJDB 2WBKA 3QXDB 5A2JH 3T4YB 4JCLA 1X6NA 2PXYC 1WIOA 1MCRA 3SCMA 3RZCA 4E5XB 1EV2E 4G9DA 4L3AA 1QR1B 2CUIA 4LLMA 2HJLA 4EI5B 2C3VA 2IADB 2CK0H 2XZCL 4MB3A 3IKCA 5C0RL 4N0RA 4PJCA 4JZOB 3UYRL 1A7RL 1Q72L 4O02H 3VH8G 3NACL 2VIRA 2MKLC 1FG9C 3B6SA 3BIKA 4HKXB 5AWNH 3V4PL 1WUNT 3SGEH 4EKXA 4ZO8A 4X9BA 3MRBB 1BOGA 3DVNB 4Z7WA 1ZLWK 4O58H 1NGWB 3CFJB 5EC2B 3ZKNC 1CBVL 4WHYG 3QQ3A 1OM3H 2XQBL 4FQHB 2JCCF 3GZKA 4PRBA 4IRJA 4TQEH 4LGSB 1XF3B 4HJGB 1AP2B 3QPXL 1A7QL 3K80A 1G9NL 2VXSL 4JQIL 1GAFL 3R8QA 5DS8A 4XWOC 1YUHB 1FO0B 4XP5L 1AI1L 3CIQA 3OB8A 3RL1B 3D39D 4JVPA 4HKBB 1ZT4B 2NTFA 4NQVA 1QLRA 4NOFA 3DO7A 5B4MD 4GG6A 5EUKB 3T0AA 3HR5A 5KSUB 1LP9E 3NFPA 1F3RB 1PX3A 5GRVK 3QFJB 3TCXA 4XHQA 5JQ6H 3NZ8B 1QSFA 3U4EB 5IBLD 2PXYA 3KHOA 4FMKA 4YHLH 3OKOA 5KS9A 4K3EL 5JHDE 4N5EC 3A67H 1JE6A 1TETH 2NCMA 3TJHD 2EE3A 1KENL 5ETUA 4OGYL 2FIKA 1UM6L 4YPGA 4XP1L 4YFLI 1TITA 1OM3L 5IMOA 3EOYG 1F90H 1A6ZB 1G7PB 3FL7A 4TQEL 3TN0B 3WJLC 4Z18A 5BV7B 1TMCB 4X6BA 3IVKA 3U9PL 1KJ3H 4GS7B 1E28B 1BZQK 1V3KA 3SHSA 4JFHE 5E6ZA 4IS6A 2AXFA 3HMXL 1D6VH 4B7IA 3D0VB 3EO9H 1U8NA 2VL5A 5DHVB 5ANMA 3VWJD 3EOAA 5EWIL 3G5YA 5J13C 5GGVL 5C1MB 1U8IA 4ODHL 1KLFA 4LVHB 1BJ8A 5DEFA 5GRZA 4QF1A 1MFAH 1VADA 3CXHK 3CFBA 4CBPA 3SDCD 2J8UF 4FP8H 4UBDD 4F8QA 2JTDA 5HI3C 1T22A 1NCDL 4QRTA 4PLJD 3SDXF 5EU3A 5JQ6L 3QIBC 1LP9B 4D8PA 4MDJA 3BAEL 3BN9C 3MCG1 1HHJB 4OGXH 1HHKA 2E3VA 3HZKA 2HMID 3ILQD 5D7KE 3A67L 3QHFL 1ZEAL 1WBXA 4ZUWA 5I1CH 2H41A 1E4XH 2B5IB 1X7QA 1UACH 1PGRB 4RAVB 1JFQL 4DFHA 4QT5B 1I8MA 1MCIA 4JPKH 4PYHA 5JHDB 2ZUSA 1F90L 2GJ6A 1MFDL 4RA0C 3S5LG 1JWSB 2V5SA 3N1GC 1BFVH 4KPHL 2VDMH 2UZIH 4GG8A 2EDYA 1FNSH 1KJ3L 4YAQB 2VLRA 3CFKA 3LKQA 3S36X 1AGBB 2E6JA 4FQCL 3NH7H 3UTPD 2W9EH 4ZUUB 3VD9A 4H5SB 5BZWB 1DQDH 5T3XE 1ZSDA 5IB1B 4OKVA 3WJLA 2BNQE 3GRWA 4I3GA 2YUVA 1CLYL 5JIPA 4MAYB 4RRPA 3DSFH 1CFNB 2HJKA 3PHOA 4L3CA 4X99B 1A7NH 5MEQA 3INUL 5CIPA 4C55A 5DHYA 4M4PA 5EU7E 2IGFH 5F93C 1CQYA 3K46A 2V5RA 4FZ8L 4FP8L 1R24B 3FB5B 1R3LB 1N5YH 4PY8J 5DD1H 1MVUA 3UTSA 5GS0D 1DE4B 1O7VA 4PRIA 5F7DB 2X05A 2Y5EA 1EO8L 2PCPA 4YE4L 4D0BA 4U1LB 2EEDA 5FM5M 3DGGB 1BREA 4F2MB 1FCCA 3OAYH 2X4TA 1RSFA 4G43B 1UQSA 5DD6A 5I1CL 5CCKL 1OVZA 1E4XL 3CNKA 4BSWA 4G9FB 1A14H 3O11B 5DJXA 5IBUB 4UV7L 1DVFD 3QAZB 2BRQA 5AG8A 5ITFB 2ATPA 1HHHA 1OOAA 4ZPTA 4ZAKD 5D7LE 1XF5A 5K9QI 1BFVL 1PX4A 5H94B 4Q7DA 1RJCA 4GAYA 1FNSL 3RWHA 5I73B 4Y5VC 2X1QA 4QHMB 3VXMB 4XNYH 3RPKA 5MHSD 3A6OA 3Q6GH 1RAMA 2JCCA 3L3OA 3U46A 5DD0H 3PHSA 1K8IA 4QOKB 5T1LD 2VDPH 5EB9A 4UDUB 1I1AC 4X7SH 1C7TA 2DAVA 4JHWH 2IGFL 3VFNB 2FHCA 2HAZA 3BKCL 2X7LA 2BNQB 4RMUA 5TPWH 1TFHA 3GM8A 5DD1L 4YR6B 2VE6A 4K71B 4PP1C 4QY8A 2VERN 2HT3D 4Y2DC 3BXNB 4NO5B 5IG7A 4HFWA 1A2YB 3HZVB 1S9XB 1T7ZA 1CE6B 4XP6L 2G5BB 2GFBA 3B5HA 5IHZB 4I2XE 3DUSA 3DJ9A 5ESVB 2W07A 4KRPB 3WEXA 4ZSOA 4MA1C 1Y6KR 5IJVA 4TSAH 4R8WH 5IBTH 4R4NC 3IJHA 5DTFB 3S88L 4FQXB 2DLTA 5DEZA 1C08B 2H6PA 2K7PA 3X14B 4EN3C 2BSRB 1IM9D 1MH5B 5GIRA 1U93B 3IDIA 3PP4H 1CDYA 4HUVA 3QWOB 1K8DB 1L6ZA 3AXLB 4FQQB 4D0CB 3FB6B 5HVGB 2PYED 1PKQB 3BISA 5C9JB 4KI5C 1BGXL 4XGZB 4LF3B 3U7WL 2GUOA 3KPRA 5SWSE 4XNYL 3RUGF 4PB9H 1MJ8L 5F96L 1EUTA 1W0VA 1DQMH 3C9NA 2VDKH 1RZKH 4Y5VA 2VDPL 3GBML 3UP1A 3KPTA 3LY6A 3BP5A 2FR4B 4JHWL 1NC2D 4M1GH 3QULB 2VH5H 5SV3A 1OW0C 5GS1B 1S3KL 1OAKH 5HDBF 3K4AA 1PKOA 5HHOE 3HUJF 4A6YL 1DDHA 5DUPH 2A6JA 5EOCL 1KB5B 5FYKU 5GISH 3K2MC 4UQ2A 2QADD 4PGDA 3P73B 1MFEH 1P7KA 2A83A 4ZOEA 4LPWA 1MQ8A 4UQ3A 5KSAD 5KW9H 2H8PA 5I16A 2Z93B 1FJ1B 1SBBA 4EUPA 3QG6B 4NPYA 1LNUA 2J8UA 4TSAL 3PGFH 4R8WL 5IBTL 3MUHL 5HPOA 3SDXA 2BOCA 1I1CA 2FJHB 1A1NA 1XIWD 1JF1B 3DUUB 1RUPL 1N7ML 4N90D 5E95B 1IAOA 2EIZB 3OKDB 3S4SA 1FYTD 1CD9B 1LO4L 4BUHA 1UXSA 15C8H 4WFED 1EO7A 5L2JA 1CE1L 4K8RD 4S0TD 3SDAA 4EN3A 1FP5A 3WV0A 4KK9C 3BESR 4JO1H 2NXYC 3BGFC 3B9DA 5HGDB 3IXTB 1OGAD 2NX5D 5J7CC 4PB9L 4JKLA 1GGUA 3GIVB 4GXUM 5CP3H 1DQML 4JQXC 4OD3L 3T2NH 1SY6H 2YPLE 4XCFH 1SJVA 4W81A 1I9JH 4M1GL 4OZHE 5ILTH 3SKNB 1G1YA 1OAKL 1FLRH 1DLFL 4NUJB 4I48B 5J11C 5DUPL 3WFEH 4AH2A 4K9EC 1A21A 1JGLH 5B3NA 3GFUA 1MFEL 4OD1H 1Q9KB 5DD5H 2YUZA 1U8OA 5KW9L 4ODUA 2AQ1A 4W4NA 4U49A 2IG2H 2F53E 4Q2ZB 5FIEA 1NGXA 3PDDA 5M94B 2C7UA 4NT6B 5GRJH 1CFBA 5D2NA 1OAUH 1YJDC 4HMDA 4QGTA 4G3YH 2ILLA 3MNWA 4JDVB 3L1OH 4KZDH 5GGSA 1G7LB 4S1QH 2YD5A 4XC3H 1RZIA 1CL7I 4XB8A 2LAAA 4JO1L 1I3UA 3ILPB 3WHE0 4ZPVB 4DGYH 1NC4B 1ES0B 1UYWH 3KPSD 3RVWC 3FO1B 2YBRA 3F6IA 4NM8L 1ZA6B 3RVTC 3T2NL 3W9EA 2PW2B 5EFIB 1QTYT 2CMRH 4XCFL 2AEWA 3RWIA 3UPAA 4Y5YC 4R4BA 3UTQB 3FQUA 2A9ML 4MD5B 2Z31C 3ARTA 3T0ED 1FLRL 5L8KB 4TULH 5DFTA 2EYTA 3C08H 3MGAA 1S9WA 3V4VL 3HE7B 4UU9A 4KJWD 1HSBA 4BQ8A 1JGLL 3OXSB 4L3EB 1LMKA 4OD1L 4PGZA 5DD5L 4LQFH 1TVBA 1QRNE 5I8OH 4PY7A 3P9MB 1MI5D 2IG2L 1MLBA 3PWJB 3BZ4A 4U1MB 1OB1B 1WK0A 4NN7B 5ITBH 2I26N 4UB0L 1S5HB 5GRJL 2J6EA 2W92A 4HUWB 2WIIB 3QNYB 4X7TB 5TF1H 5HDLA 2D03L 2NQCA 1KT2B 4G3YL 3HE6C 4P2QD 4U1SA 1WLHA 2X4PA 1CT8A 3L1OL 5HYSB 3HAEB 4PP2B 4TUJA 1I1YA 3M8OL 1FAKT 2R56L 2C9AA 5IK3B 1MLCB 4OAWB 4U6XB 2X4NB 4ONHB 4Y89A 3P40A 4HJJH 3CMOH 3ULSB 1UYWL 5K59F 3PNWB 3ARDC 5F7MC 3HC3L 3DRQB 1IGTA 4DKAA 3K8KA 3U4AA 1VPOH 5DRXA 3MBEB 4G8GA 2J1KA 3OB0K 4ZFFB 1ZA3B 4HUXB 4F7PB 4NKOB 3RUGA 2OI9C 2NY3C 4Y5YA 2AK4A 4ZUSB 2HT2D 3NCBB 2E5EA 2Z31A 5FM5O 4F33B 1D5IH 1FZJA 2EDLA 1LO0L 2HA1A 3PJSB 3QDGA 3ZDYF 1OTUD 1MIMH 4AQ1B 1QEWB 1D5ZB 4LVOC 4LQFL 5IF0A 4KHTH 3ZYIA 3TO4B 2APBA 5I8OL 1OP3H 3O2WH 4CKVX 5D7IF 5ITBL 3TBVB 1G9NC 3LKSB 4AEHL 3HUJA 5ID1A 3GMNA 4C56A 3ULUD 3WFBH 5LGJB 1QRNB 1YEKH 3TH2T 1U3HD 1X5YA 5AZEH 5TF1L 2P7TA 2ICWI 4XP4H 2BSTA 2R1YA 2F5AL 3VFGH 5KBNC 4LCWB 5E00B 1W72L 1YC8A 4KRMB 2C1PB 2FEEL 3HE6A 4YWGH 1XGRA 3TPUB 4HJJL 5A2KH 3WKML 4HZLB 4I77L 4OFPA 4L5FH 4FQ1L 3OMZA 4OLYH 1OHQA 5AUMB 4XH2A 4BZ2H 1J1XL 3MUGB 1G7JA 1SJHB 1VPOL 1WFUA 3GKWH 5ADPL 1LO3H 3AMKA 3FQWA 4YHIA 4L8SB 2KL6A 3U79A 4WIQA 1NDMA 3ARDA 5EU4A 5L2KB 3QXAB 5C86A 4X6CF 1P53A 4WENB 5DJ2A 3AAZA 2HTKC 3QUYD 1FRGL 2ZOKA 2DOCA 4GW5B 3P0GB 1D5IL 1G6RB 5IHLB 2I07B 4UILH 3GJFK 5GSVA 2ZUQC 4KHTL 4PJDE 3UAJC 1HHIB 1J18A 3KYKL 1Y6NR 3D1MC 4QEGA 2O61B 3ELAT 3U9UA 3GJEA 2C3XA 2L7UA 5GJTH 4ODBD 3WFBL 1NCCH 5IQ9B 5DGRA 1NBZA 1YEKL 2R4RL 5HJ3B 4NC2B 3H9SE 2RFXB 1UC6A 2ZNWA 4S1SH 4FTVA 2CKBB 3QYCA 3MRRB 5INDA 3OAUL 4MWFB 5EPMB 1IC4H 1VEMA 3IXAB 4N1CA 4YX2L 1KPUB 1UM4H 3OHXB 3G6DH 4YWGL 1OP3K 1AD0B 4HCRL 5JA9A 1T1YA 1KF9B 4OZFH 5DO2D 1JUFA 4HUNB 1JPGA 3ME0A 5INCA 4WEBH 4XPGH 3T65B 1U95B 3GKWL 5DJZA 2ZUYA 3DBXA 1LO3L 3FQXB 3PQYB 1A6AA 1CICC 5HD8C 5JLZA 1YEFH 4FXLA 5E8EA 4KKLD 2R69L 4P46D 4TUOB 1RIHH 5TDOA 1V7MH 5BJTA 5JHDD 1MY7A 4K7PY 3DIFA 5FHAL 3GKZA 2CIIB 5D72H 4Y2OA 3MNVA 2X70A 3BP6B 5K9QG 5HSFA 1QNZH 3QSKB 2EDBA 2BX5A 2DB8A 5EULV 3WFHA 1RMFL 3GUTA 4N8VB 5EC1B 4GRWH 3VD5A 5GJTL 1NCCL 3ORJA 4JFDB 2BSSA 5GS0L 4Y1AE 1J86A 3BW9B 4L1HA 4S1SL 4U0RC 3AGVA 2N4IA 1MHCA 3D85D 3SQOL 1JHKL 5CFHA 3P77A 2C1OA 3DMMD 3HA0A 4FXGB 5D71H 4KKCC 4JFEB 4JFHD 4Q9BA 1DANU 1BX2B 3QUMB 2VLKA 5DC9B 1UM4L 3HMXA 1D7FA 2XKNA 1BQHA 3O8XD 1IEBA 3WNKA 2IPTH 1LHZA 4OBSA 5CJOL 1BZ9A 1IQDB 1DQJB 5C0JB 3VXOA 3WHXB 2DQEH 4XPGL 5DVLA 3MFFB 3FFCB 4QRPA 4PGCA 5EBMA 3EYQC 3LPFA 4NDMB 4K7PX 1MCBA 2XA8H 2UYLA 2XQYK 3UC0H 3HNSL 4HGWB 1BM3H 2C3HA 1YEEH 1RUMH 2XWBB 1U41A 3ZT7A 4YO0B 4WTZA 4D9LH 4DEPC 1QFHA 1RIHL 1JWUA 3F7YB 1T80A 1CICA 4LP5A 4M6MH 4Z7VB 5D7KD 1T1WA 5D72L 1KIRB 5C0IB 3SDDC 1DBMH 4HKZB 3SJVD 2NY6B 2FEDD 1PFCA 4GKOA 5I66B 3V52L 2UY7A 1PG7W 5FK9B 3VGFA 4Z7OE 5KSBA 3QQ4A 4YBHA 4YHOH 1BAFL 2FATH 3BOVA 2X10A 1VACA 1ITBB 2XT1B 3THMH 1HI6B 5E03A 3VGHA 1WZ1L 5F6IC 3OG4B 4HW6A 3X3FH 2WUBL 1CLZH 1KXTB 5GXBB 1GGBH 3U0PA 1ZWIA 4HK0B 1EA9C 3CMGA 3GMPA 5D7IA 5C0ND 2BNQD 4MHHI 1NCAH 2VWEC 4HWZA 1B0RA 5E6ID 3QI9C 1U2HA 3TBTB 1HXMA 5I76A 1ZAGA 4ZS7L 2DQEL 2W60B 4JDZB 2NLJA 2XA8L 3UC0L 4RNRA 2G2RB 1RUML 4K8RH 5C08A 1MF2H 2DQHH 1CGYA 4YFEA 4M8VA 4A2MA 4O2FB 5C0BE 3STZA 1BIHA 4PJXE 1GHFL 5HHNB 2Q3AA 1CXEA 2PO6C 1L0YA 4RFOH 3VXUA 3KYOA 1KCUH 3ZDZF 3O0RH 2B8OT 5GGRY 1FSKC 3HLAB 4YBLB 4XWGH 2AEPH 1K2DB 5J06A 2D7OA 1MVFA 4X6CA 2Q7YB 3MJ8A 4ODWB 4YHOL 4HF5H 2V2WB 5D7LD 3SDDA 4UIMB 5EN2B 1I7ZB 1T2JA 1NDGB 4CNIA 2F74A 3EIFA 5HHMB 4XPHH 4YK4B 5EU6E 4R97C 4X6DE 2J4WH 3HI1A 3S37X 1EBPA 3LKNB 3ZSTA 5DI8A 2VSCA 1UXWB 5E99H 1BWMA 3QH3B 1INQA 3FCTA 1IM3A 4ZTOH 5JW4M 3HC4H 1LWRA 4LEOA 5IP4A 3BDXA 2B20A 3QUXC 4YDVA 1AKJB 4ELMB 2OBGA 3LS4H 3HC0A 4K8RL 2E7LC 1MF2L 1J88A 4MX7A 5D1QD 4JO3H 1GRWA 5GGQL 3NIGE 5IQ7H 3TYGL 4LCIH 4XXCC 4OT1L 1WGOA 4JFFA 2BK8A 3LKPB 1W0WA 1ORQB 2FWOB 3C8KB 4HIIB 4RFOL 1NMBL 3WCYA 3H42H 5FUCC 4OD2A 4I0PD 1J0YA 2VABB 1EVUA 1ONQA 5DJ8B 4NO0B 2D7MA 5C0BB 1IAIL 2AEPL 3HG1E 3I50H 3S3JA 5D7JD 2XY2A 1FIEA 2R39A 4HF5L 5DVNA 3R4DA 3LOWA 5TDNB 1KJMA 4DZBB 2KKQA 2M2DA 4JFOA 3UBXB 3OR7A 1RZJH 4MZ2A 2DBJA 4XPHL 43C9B 3BE1L 2ICWJ 3FONA 5SWSD 4KROD 2R9HC 2J4WL 5D1XB 1ZANL 1QSED 3T3ME 3I02A 4UTAH 3QEQA 3TP4A 5E99L 1SYSA 2BOBA 4YNYA 4ZTOL 4MXVF 5JW4Q 5E2UH 3HC4L 1FE8H 3FFDA 3BT2H 3ULVH 5KAQF 3MOAL 1TZHA 4X80L 1MFBL 4Y4KC 4Z95L 1BVZA 2IAMB 5HHOD 4F80A 4NQSB 5HYJE 1M7DB 1CU4H 1DLHB 3B9AA 3O6FC 2XTLA 2NW3B 1MHPH 5TFSL 3QUXA 1LEKA 4Z7UB 1I8KA 3O3AA 4WU7B 4LASH 2I27N 1BEYL 4NQDD 4M43H 3LEXB 1PZ5A 2E7LA 3NGBB 4WWKC 3TBYB 3WKNA 5JOFA 2ADGB 5CBAA 1AY1L 5CGTA 5EBWA 3CUPA 1JYWA 4XMLH 1GH7A 4WI7A 4HK3N 2DM3A 4YHYC 4NWTL 3EFFA 3NZHH 3NPSC 2AEIT 3HG1B 3VXSE 3HPLB 1X9QA 3VXRD 2ITDA 1AJ7L 3PWNA 4QXWA 5ICXB 2NY7L 3ZE1E 4APQB 1JV5B 3X3GL 5L7XL 3MYZA 3ARYA 1L0QA 4ISVA 4POZC 4JG0L 5EZLA 1VFAA 1JI2A 4PV8A 3QQ9C 3WO4C 4RGNB 1YY8B 3SQBA 2DIBA 3UTZB 3IDJA 2X1OA 2BNUB 2YPLD 3GMOA 5B38B 3HE7D 1GOHA 3H7BA 1FO0H 1CDBA 2L4OA 3N1FC 2K7QA 2JJVA 1V7NL 3T0XA 4Y8AA 5DMKA 2FECI 1VA9A 1L7TL 4JVUA 2W59A 4NQCE 2WMPA 5C0DA 2DS4A 5FV2A 5JDSA 3W2DH 5D5ME 3ALPA 1RZ7H 4JPWH 4F57L 4OLVH 4E41E 1RU9H 2NY4D 4JRXD 4Y4KA 2ZCLH 4PJ5E 4QXTA 1WC7B 3AU1B 1U91B 3KPPB 1KUMA 4LSQL 1UH4A 5I1HH 2F53D 4RA3A 2X1WL 3O6FA 1QFWH 4GOSA 5MEOA 3CCHB 4NZTL 4XNUH 3MLPA 2AXJA 4OFYD 3TEUA 3JV4B 1KTLA 1R5IA 4XMLL 4EDWL 4XCCH 2LU7A 3SCMB 4WWKA 1KJVA 4G9DB 3VGGA 1EFXB 5F3HA 3NZHL 1V3LA 2C3VB 3KLDA 5I1AA 3HI6H 3IKCB 5DJCB 3VXQA 4ZS6D 1DBKH 1B9ZA 2X4UA 4RGMB 1YN6A 3MBED 4LGPB 4IIQA 3RL2B 4RCAA 1TQCC 2VIRB 4L29A 4RDQG 3QPQD 3B6SB 3ET9F 1IC1A 4TTDD 3U36A 3PL6B 4G6MH 4M93C 1QKZH 3VXSB 1WWCA 3V6BR 4WTXA 4N9GB 3OF6D 1SY6A 5LQBH 1ORSA 1FO0L 3H2WA 4WHTA 3ULUL 1DQTA 3QQ3B 5ICYA 5F3BB 3GMRB 2AKRB 4PGEB 5J6GB 4PRPB 4MA7H 5DHVH 4PRBB 4IRJB 1FAIH 4FXKA 1EXUA 4Y16D 1NEUA 1T66D 3LAFA 3ZTJG 1RZ7L 4GSDH 5I6XB 3QIUD 2YR3A 2VR5A 1JN6B 3U0TA 3BP4A 1VGEH 4X9FA 2DIAA 3KJ6H 2ZCLL 3Q5OA 1CFSA 1CF8H 5HHQA 3NCFB 1FZOA 4O9HH 3DHMA 1QRND 2CSPA 5D5MB 4MNQE 4XMKH 2QQLH 4KKNA 3H3PH 2NTFB 1WBYA 1XH3A 2JJTA 2R2EA 5CSBA 1KPRA 4E41B 5IBLC 4N8CL 4RWYL 1CIDA 2QBWA 1N2RA 5E1AA 1CCZA 4YHNA 2A38A 4YHPB 3FZUD 4YXKH 1HXYA 4LOUD 4QHKI 2AEQH 3TH3T 3O2VH 5ERWA 4ZD3L 4J3VA 2SEBB 4ZNCD 2PKDA 4QGYA 2AJVH 2ERJC 3VW3L 5EO9B 1DBKL 3CZJA 1FGVH 2K3TA 4UT9H 4LCYA 4EIZC 1QKZL 5ETUB 1UCBL 3PGCA 3R8BB 5LBSH 3JXAA 3WUZA 3V5DB 1U0QA 3ESUF 4PRHE 3E2HC 1MEXH 4MA7L 1FAIL 1IC5L 4M4RA 5TH2B 1OAZL 4OLUH 3VWJC 1P69B 5EUOB 1PYWB 5C2BH 5FFLA 4LBEB 5K9JH 4GRWF 1ZS8B 4X6BB 5IROC 1VGEL 3GK8H 2AJXL 3J8F7 1MFNA 2V9TA 1X5JA 1CF8L 1A3LH 1GL4B 4YDLC 4PJBF 3ZE2E 3SDCC 4EQ2A 2AXFB 2AJSH 5GGTL 4UBDC 4MA3A 3DXAD 4XMKL 1CD1A 2QQLL 4PLJC 5BVJB 1U8NB 2VL5B 5ANMB 2XIDA 2MQCA 3C60D 4HDIB 3LEVL 2MSPA 1U8IB 4MCZB 3GIZL 4HV8A 3TJEL 4P57A 3IB4A 8FABA 2OL3L 5DSCA 3KXFA 4P23D 1RK0B 5C6TL 4C54A 1MREH 3ILQC 1F4XH 1JZ7A 2BHUA 2HMIC 1QR4A 2AEQL 4QRUA 4QRTB 3DX9A 4YDJA 2O5XH 3NCJH 3U1SH 5B3JE 2BDNL 1XF2A 2GAZA 1A6TA 4QRRE 3TBSA 1NGQH 4MDJB 2MJWA 5F7NC 1R0AH 1S8DA 1HHKB 3HZKB 1QHPA 2C4FU 1YYMH 1WBXB 4F37K 3DX6A 4EBQH 1Z0NA 1B6DA 5D1ZD 1X7QB 2O26U 3NMEA 3KDMA 4AMKH 4K55A 2VAJA 1I8MB 3FOLA 2H9GA 3RVVD 1U8MB 3GBLA 3P0YL 3GO1H 3BQUD 2GJJA 2DI9A 1DUZA 4R7NB 4WY7H 3DGCR 1K4CB 4S2SA 1X5GA 4I8DA 1OPGL 1RJZA 4J8RA 5T3XH 1L6XA 3LKQB 3MLZH 3QZWG 1KXVC 3IU3A 1H5BC 4KMTH 3QR2A 4F3FB 1ZSDB 3ECBB 3L5XH 3VWJA 2AJSL 1KTKE 1KLUB 1RY7B 4GMTL 3VFOA 5GS0C 3PHOB 5DHYB 2I9LA 3SDCA 4JHZA 3GEWB 2F8OA 3V4UL 1N4XH 4X7EC 1KIUA 3H9SD 1F4XL 3OV6A 2N7AA 4GXUN 4MHHG 1A8JH 4NO3A 2O5XL 1MWAH 3Q2CA 2DI8A 3OR6B 1MCOH 4QXUH 4X9IA 5JPNB 1DVFC 1NGQL 4HS3A 2HFFB 3Q5YA 3P4NA 2Y36L 3V6ZB 3O4OC 1WIPA 4ZAKC 3NFNB 2WWKT 3NVQA 4HCRA 3PP3K 2ORBL 1UQSB 1YYML 1HYRC 5DD6B 1PSKL 3G5XA 3QIBB 2EDQA 3VI3F 5F7WC 1UEMA 4AMKL 5DJXB 1OP5H 1IAMA 5HDOA 2Z91B 1HHHB 4XP9H 5B8CB 3S35X 3QO0A 3OXRA 1XF5B 2HKHH 2X4QA 1INEH 2O93L 5CZKA 5JW5B 4WY7L 4EOWL 5T3XL 4UUJB 4DUVA 1FORH 3RWHB 4N1HB 4XRCB 5GGRB 3MLZL 3BPCA 2B39A 4LU5H 3DX7A 3L5XL 2X9XA 2BJML 1F45A 2ZNXA 1KB5H 5CUSH 2IC2A 3VGBA 3QG7H 2HT3C 3L3OB 1K8IB 5H2BA 4OUOA 3RKPA 4HLZG 1T3FB 5E5MB 2ICWB 1VDGA 1FQ9C 4Y1AD 5TDPB 5GGVY 2WP3O 2PTTA 4W70A 1MWAL 5IG7B 6CGTA 3S7GA 1MCOL 4QXUL 3MGTA 5FYLH 2FH8A 1QA9A 4G80A 3REWA 2P49B 3MV7A 3WEXB 3MYJA 5I30H 2D2OA 5C0CE 5IJVB 1DVFA 1TLKA 4Y0GA 4HIXL 1X5ZA 1H3UA 3I75A 4QRQA 4ZAKA 3FB7B 2MCG1 1JYVA 3TESA 3ZSSA 2DQDL 3MODH 3IDIB 2XRAL 1JNLH 4HUVB 2HKHL 4QWWD 3TO2A 1TJHL 4FRWA 2UUDK 4DVRL 4P4KC 3GB7A 2LABA 2R0WH 4OGAD 3GMLA 3STLA 5IFJB 4NFCA 5FYJH 3KYAA 4M7JH 1GIGL 1KB5L 4DW2L 4V1DE 3QJFB 1CXHA 1C8PA 2CJUH 3VJ6A 1FL5A 4YIQB 1ZGLB 3QCUL 4P2OD 4HG4J 1NANI 5IFAH 4AG4H 4G8IB 4PJBA 1HYSD 1I1AB 2A6JB 4R3SA 4H26B 5KJRL 4PGDB 1P7KB 1DEDA 1BWWA 1XIWC 2YOCA 4UQ3B 1NKOA 3CDFA 3JBG7 2H8PB 3RAJH 4Y2DB 2AW2A 2GSGB 4NPYB 2IBZY 1LNUB 4MS8D 4K8RC 3W11D 1IM9A 1JPFA 4MD0A 3MV8B 1A1NB 2CUMA 4N0CD 5JOEA 3BD3A 5F9JA 2V2TA 1WICA 3SO3C 4MA1B 4PYGA 3OPZH 4DCQA 4H25B 1IAOB 3T1FB 3S4SB 1UXSB 4WFGE 2W65A 5GS2H 4NO0D 2GTWA 5C0BD 4EN3B 1KGCE 3G6JE 3IJSA 3FO2B 4M48H 1F5WA 5DURB 3MOBH 3KPOA 3PWPA 2FZ3A 5LXGL 5DQ9A 1NC2A 1S7TA 1J0ZA 4P4KA 1II4E 4IMLA 4ZOCA 4E9LA 1MCPL 1BBJB 3QEGH 5IB3A 5FF6B 5I8CB 3H0TA 3DTXB 1C5DB 4MSWA 3I6GA 1WEJL 2LU3A 2A73A 4UTBL 4Y7MA 3X12A 3ULUF 3R06B 4AG4L 2IBZX 3CK0L 5EU6D 3UYOD 4AH2B 35C8H 1DBJL 2DLFH 2PW1B 5DMYA 4QHKJ 3BKYL 1U9KA 3LRGA 3Q5TA 1U8OB 1MHEB 2VJXA 2IAMD 3DVGA 3RAJL 3B2VH 2XOTA 3BSZL 5GGUA 4X6FA 4XBGB 3MLTA 3VU2A 3K8MA 4U3CA 1T21A 4WO4B 3BRFA 2C7UB 5BS0B 3NFSH 3ZYJA 3FOMB 4KVNH 4M6AA 4XPTL 3U2SA 2D7PA 4JG1H 3K7UA 1T89A 3O2DL 3MLVH 2XTJE 4XNXL 4AEIL 5I1KH 3RIFK 4WJ5B 3N0PB 3O9WA 3MRCB 2A6DA 5GGSB 4OM1H 3JWOL 1JNNH 2YMXH 3H9YA 5DHXB 1RZIB 3T0EC 5ISZA 2YN3A 5DZLA 1DFBH 2Q86A 4U6YA 3ARPA 3QZWB 4PR5A 2VDQH 4KJWC 3W9EB 3O6LL 3HG1D 5ID0A 1S9YA 3BGFB 2EC9U 5E0QA 5E5UB 5I1GL 3P11H 1CD0A 4YHKH 2HWZL 5C0FA 3NBNA 4AIZB 4WV1C 1S9WB 1F4WH 1RZFL 2EIEA 1QLFA 1U2CA 2WQ8A 4HUUB 1G0XA 3C5ZA 1BD2B 4KWUA 4XHJD 3I3BA 5J11B 2P8PA 3AUVA 4KGLA 2YPKB 2YK1L 5DVMA 1NPUA 3RVXD 4Y88A 4NUGH 2OYPA 3V5HA 2O5YH 2F15A 3S36H 5KTEH 1G7MA 4OTXL 5C7XH 4JG1L 4WW2C 3MLVL 5HYJD 1T7XA 1HE7A 3OL2A 1LP9F 5I1KL 2GT9A 3O3EA 1BMGA 5F9AC 1D9KB 5C8JA 3LQMA 4HGMA 3TNMB 5DZOA 3W82A 1CT8B 2QTEA 4OM1L 4HD9A 2YMXL 1I1YB 2E27L 1RUQL 5C0AA 2XTJB 1ZK9A 1NBYA 3FT2A 4BFGA 1DFBL 2P5WA 2QSCH 1Z6JT 3VFTA 1A4JA 1YECH 1G6RH 3T0EA 1QLEH 5DRXB 25C8H 1LDSA 1OTUC 4M02A 4Q6IC 5EBLA 2ENSA 1S78D 1OF2A 32C2B 5JPMA 2DI7A 2DMCA 3NAAH 5AYUL 4FZEL 3WE6A 2NY5L 3RUGB 5JDJA 1NMCC 4HX1A 1CVSC 2FBOJ 2VXUH 1S7RA 4M7ZB 3KHQA 1J0JA 1MAKA 4PG9A 3W5MA 4ZYKA 2Z31B 1FZJB 3W81A 3QDGB 3ULUC 3BPNC 2B2XH 1U3HC 2Q1EA 4WV1A 5I1IH 2CKBH 1B3JA 1QACA 3LDBC 4N5UA 1CGVA 4GAFB 4WDIA 3A6CH 4NUGL 2G9HB 4ORGB 4Y19E 3L5IA 5F1IA 5F7FA 5GHWH 5KTEL 3EDJA 4GRMA 4NQCD 3SE8H 5C7XL 4EVNA 3GMNB 4P2QA 5CLTA 2IANE 5DJDA 2BSTB 2CPCA 2R1YB 4LAJH 2Y9RT 3MJ7A 2BXYA 4C4KO 4MDIB 2J5LB 3T4YA 3EOBA 5IVZA 1L4IA 4PJ5D 4QHNB 4WHDA 1Z3GL 1G0YR 1QR1A 2KZWA 3HE6B 2WZPD 2IADA 1KC5H 2QSCL 2ZUVA 3DV4A 2ED9A 3J7HA 5LVEA 3ARFD 3VMPA 3QUYC 4ONOA 1HQRA 4I3RH 3L7EB 4ENEC 25C8L 1A7OH 3VA2C 2XZQL 2RGSA 4HKXA 1NDMB 3NAAL 2N7BA 3BUTA 3DV6A 2X4OB 1BZ7A 4OCMC 4GQ9L 3CFJA 3HI5H 5CZXD 3IDUA 2I5YL 3AAZB 3MCKB 4NGHH 2ESVE 4GS7C 4Q6IA 4R4FL 2QR0A 4NJ9L 5E8PA 5E2VH 3F7VB 1JZ3A 5CEYB 1XF3A 4HJGA 2B2XL 1AP2A 5GSVB 1F3JB 5I1IL 4X4XA 2NY3B 3WN5B 1I4FA 3A6CL 1AC0A 1IZJA 1FO0A 1YUHA 5GHWL 3QUMH 1R5WB 3GJEB 3SE8L 3RL1A 5DA0B 4R90H 4UZGA 1YEHL 2FH6A 1T20A 5DO2C 5DT1L 1DSFH 4FTVB 1HKLH 2APVA 1WZKA 1C5BH 5INDB 3H8NA 3SGKC 3GSOA 5HVWA 2DQJH 2IJ0C 2N56A 5C07E 3QFJA 4K23L 1MJ7H 1S7VA 2HP4A 3UJJH 4MNQD 2IANB 3MZTA 5IGXH 1N59B 2PR4L 4KKLC 3NZ8A 4P46C 4FFWD 3UTTE 1RK1A 3RNKB 1AQDA 3TWCH 1JPGB 4I3RL 1XCTB 3VXTB 4M3KB 3CVIL 5DJZB 1ZT1B 3DBXB 3PDGA 3ZKQD 4OIIL 5DZNA 3IFNL 4JKKA 2V5MA 5E8EB 4LSVL 3HI5L 3NTCH 1G9ML 3IDGA 5JW4N 3WD5H 3EJZD 4RAUA 1T83C 5BJTB 1G7PA 4NZRH 4J6RH 4YGAB 5E2VL 1FZMB 3DIFB 1CXFA 2Q8AH 3MNVB 2X70B 2DD8H 4MAYC 3KPLA 2ESVB 5DEGA 3HNTH 3DMMC 3U82B 1CGSH 3WFHB 4PRHD 3C6LD 2EDRA 3D0VA 5FDYA 3O8XC 2BVOB 1FBIL 5I0DA 2ZG2A 4D94A 2YD2A 2ZSVA 4O2EA 3LPWA 4XB7A 1HKLL 2HRLA 4NZUH 2W0PA 2JKXA 1BHGA 4JRYE 1C5BL 4LMQI 4OLEA 2C1OB 1QFUH 3B8YA 4LSTH 3D2UB 2EH8H 5ESQA 2VLKB 3ARGD 5H8DA 3UJJL 3TF7C 2XKNB 1BQHB 5GGTA 3SEPA 4C57C 2GK0A 1IARB 2FYYB 1LP9A 1JRHI 4WUUB 1CDCA 5I9QC 2EYRA 2OL3A 3LH2L 1IKFH 4PGCB 3EHBD 1MCSA 4XMPH 4EXKA 2DKMA 4OF7A 4RAVA 1KLGA 2FEDC 4TSCH 1FG2B 5JHDA 2W91A 4QRRD 2UZYB 5I73C 5J57B 1JWUB 3IYLW 1CICB 7FABL 4J6RL 4J7RA 1NLDH 4L1DA 1JWSA 5IMKB 2Q8AL 1ZLVK 2DD8L 4YAQA 3BO8B 1T83A 3G08A 3HNTL 4ZUUA 5BZWA 3FN0H 4JHAL 4YZFE 5IB1A 5KSBB 3F8UB 5C0NC 1A6UH 4MAYA 3AS1A 1VACB 1CFNA 5IHUL 1C16A 3ARVA 4X99A 3VG0L 1DP0A 3MRLB 5E6IC 4OLXL 5IVXE 2VQTA 5EU7C 1FFPB 1QFUL 3T2QA 4RFNC 5AEAA 1ZWIB 5KZCB 1R24A 3RIFF 3GMPB 5D7IB 2GY7B 4U0RB 1TDQA 1DE4A 5F7DA 2ADFH 5ABDE 4HWZB 1B0RB 3N1PC 1XFPA 1HXMB 3HRPA 3LN5B 4CU8A 5I76B 2V7NA 4WI2A 4LRIC 4LKXB 4Z7QE 4JGUA 3DGGA 5EDXA 4NKDB 2M1KA 5SV4A 2NLJB 1NFKA 2J12B 4XMPL 4RNRB 4B41A 1MHHA 5C08B 1U8LB 3O11A 3OKEB 3IFOB 4PJHE 5TE4H 5ITFA 1PQZB 3I84A 3STZB 2YD4A 5SX4I 2VLMD 3CSPA 4MA8H 2BNRE 5I1JH 4ODXB 3VXUB 4BUGA 1S9KC 5T3ZD 3KYOB 1JGEB 4MXQD 1TVHA 3O3UN 4WW1A 3QWQB 4UV4L 2GIYA 2GITA 1RHFA 3D87B 2D0GA 3KYNA 4OZHF 3SDDB 3Q0HA 4UDUA 1S7QB 3AFLA 4S11A 1EHXA 1H3VA 3VFNA 3WJJC 4OIAA 3D25B 1CZ8H 2BNQA 3HNVL 2R29H 1UWXH 4YR6A 3HI1B 3X13B 2EIDA 3BXNA 5F6IB 4U3HA 5DI8B 4KHXH 5D1QC 3T77B 1INQB 2G5BA 1LO2H 1UKSA 4HS8L 3EOTH 1QOKA 5ESVA 4AIOA 4PJAB 1P4IH 4J1UB 2E6QA 3HC0B 3QI9B 4I0PC 1F6AA 4N0UE 1MWAA 2HRPH 3W0WE 1CTNA 4X5XB 5TE4L 2BSRA 5D7JC 4AQOA 4ETQA 4V2CB 4JFFB 5DF0A 3ARED 3QWOA 3IJYA 4BM7A 1B6UA 1MQKH 5J1SC 5BMFH 3M17A 4FQQA 3FB6A 4J2XA 4OIBA 3AS3A 5D6CA 4OD2B 5C0CD 4YDIH 4I1NB 5C9JA 4OB5L 4XGZA 4LF3A 1ONQB 5DJAA 1N6UA 4KROC 2PO6B 1YDPB 4R0LC 4IHOA 2YPVH 2AERT 1FHGA 1KJMB 4G6AD 5J9PA 4JFOB 1FSKB 3OR7B 1HOCB 1KV3A 2Q76A 5CBEA 4KXZI 3QULA 3NCMA 5GS1A 4LFHG 2J88H 1NGPH 5ALCL 3FONB 1GZQB 1CFQA 5H35A 2X89D 5ADOL 1AR2A 2Q87A 3X17A 2DM7A 5KVDL 3VFWB 1KB5A 4V1DD 3WJJA 4KHXL 2WQRA 3RVUD 1LO2L 3RI5K 3L7FA 4JHBA 1FJ1A 3QG6A 3O6ML 2Z0BA 1X3DA 4LGRB 3S8WA 4A6YB 5KVFH 2VC2H 1O5DT 3HR6A 3WYRA 1VESA 2HRPL 4I2XA 4PV9B 3DUUA 4WO4D 1LEKB 4RSVA 1I8KB 2HFTA 3QIWD 1YY9C 5T1DH 3SE4C 1MQKL 2EIZA 5BMFL 4Y8DC 4I0PA 1Q1JH 3QXTA 1PZ5B 1KIQA 1A3RL 4N0UB 5F7HA 3C5SA 4YDIL 5D7JA 5E9DE 5JOFB 1T5XB 4RIRB 5CBAB 2F8XC 3IXTA 3U48A 5EBWB 1FH5H 3CUPB 3GIVA 3JWOC 4DGVH 1DQLH 3B4NA 2YPVL 1IRAY 4HWBL 2J8HA 5IKCB 4WFGD 2N1KA 2Y7QA 3HE7C 5SWSA 1JGUH 4IMKC 3SKNA 2DJSA 4CMHC 2J88L 2MPAL 3LKRA 2ITDB 3PWNB 5TJWK 3G5ZB 3VDAA 4JO4H 5F8QC 1VENA 4UT6H 4WGWB 4LLWA 4ISVB 4KQ4L 1VFAB 4PV8B 3T0VA 4CN1A 3MPCA 4BQCA 4PRDA 3IDJB 3GMOB 1Q9KA 2NY4C 3MO1B 1NEZB 1X44A 5HHOA 5DMKB 1CS6A 4CRPA 5BO1L 5C0DB 4Q2ZA 4M7LL 4OFDA 5BXFB 1D5MB 3VFVA 1J11A 1KCVL 2YA0A 4LSPH 1KJ2B 4Y4KB 4M61B 4QXTB 4P2RD 1DN0A 3CSGA 5I8EA 2QQKH 1EAPA 3L3DA 3CXDL 1R3IH 1LVEA 4GG6E 3O6FB 4JDVA 1D9KD 1BVLA 1JPTH 2LV4A 5MEOB 2I25N 3NIDE 2B4CL 4OF6A 5B39G 2EDTA 4PBWD 1DUYB 2ICCA 4HXAL 4ZS6C 3SE4A 1KTLB 3OZ9H 3IDNA 1FH5L 3MBEC 1NC4A 3LEYH 2XTJD 3O2DA 1R5IB 2XPGB 1DQLL 2LVEA 4KJYA 2BFVH 3QPQC 4RMRA 4TTDC 1KJVB 1ZA6A 5FA4B 5F3HB 4Y4HB 4NSKA 2DWDB 1JGUL 2IMNA 4AL8L 4MD5A 1XGYL 5IW6A 4XCNB 1XCQB 2PTUA 4MB4A 4OV5B 3LHPH 4YHYB 2EZ0D 4IOFD 3SE3A 2YPLA 3RNQB 3MJ9H 4W6XB 3HE7A 3TO4C 5JXAH 3OKKB 4Y16C 1T66C 2QL1A 4IMKA 1VKXA 4OZHA 3OXSA 4PJDF 4BH7B 2UVEA 1XR8B 2NY5C 1JMXA 4PREB 3CX5K 5DUMH 3D39E 4JY4A 5C70A 3PWJA 4R26L 4N0YH 3UJIL 4HPOL 1EXUB 4WFFE 3WS6C 3OBAA 3G5VB 1KPVA 4DUXA 5FO9A 1CGUA 5CGMA 4ZODA 3BP4B 1HNGA 4ZO9A 4HUWA 3EJJX 3QNYA 4X7TA 3L5WB 4GT7A 5HHQB 1PLGH 1OAXH 4NNPH 3F62A 4LOUC 1R3IL 1FL3B 3MRIB 2COQA 4LVNC 1M05A 5HYSA 1I7RB 5CSGA 2AV7B 5T5FH 4Q9RH 4U7MA 1XH3B 2R2EB 2DLGA 1HIML 5IK3A 5LGHH 1MLCA 2EIBA 3HZMB 4U6XA 2X4NA 4ONHA 2V5YA 5SWQA 1J0HA 2I60H 4L8SC 1VSCA 2VR4A 1KYOK 3PNWA 4S1DD 3F7RA 1TNMA 3DRQA 1ADQL 1ZVYA 4U33A 5ERWB 2J2ZA 4PJ7E 4AEEA 1WV7T 3I9GH 4NHCH 4WI8A 4MYWB 3OG6B 3MBEA 4XAWL 2BY1A 4F7PA 4NKOA 1LDPL 4K7PL 3ZDXE 3MZGB 3MXVL 5J1AA 2FX8L 1RJYA 3ETBF 3OF6A 4EUPG 4ZUSA 4P0DA 3TV3H 5CILL 3NA9L 4LNRB 3S3SA 1ODAA 5HHPA 1HH6B 1ACYH 1QEWA 1ULVA 1D5ZA 4WFHE 1TQCB 4RMSA 3VXPB 3TO4A 1AIFA 4M93B 4Y16A 1WTGT 2VLRE 1ZXQA 3C60C 3LKSA 4YPJA 1HZHL 1NGYA 1BJ1J 1V05A 2EDHA 4GKNB 3ZKSD 5CD5D 1S5IL 5LGJA 1QRNA 3D39B 2YXMA 4P23C 1PLGL 1OAXL 4FABH 3FTGB 5C6WH 4MA3B 3BKML 1R6VA 2WK2A 1CD1B 1WITA 1Z9OA 1CL7L 4Q9RL 2ED7A 4Y19D 1UWEH 1QPPA 1C12A 5HBBA 4HV8B 4B0MM 5DJYB 3PDOA 4JN2B 5DSCB 5J12C 2FO4B 3TPUA 3UTOA 2UZXB 3EYUH 2IAND 3LCYA 1PG7X 3DX9B 4RISL 5HYEA 5A2IH 1ZTXH 5D1ZC 3MUGA 3I9GL 1W72B 1XF2B 1A6TB 3TBSB 4YFLF 4L8SA 5DRZA 3RVVC 4DKDC 1FFQA 5C09E 1GOGA 5FM4A 3QXAA 3BD4A 1S8DB 3BQUC 2W9DL 2IFFH 2F54E 3GJFB 4PJ7B 5D93B 3TV3L 2ERJB 2IBGA 3HRZA 4GW5A 4LSSH 5EORH 1G6RA 1G9MC 2NY0D 4HH9A 3WSQH 2H9GB 3KS0H 4TVPE 12E8L 4Z7OF 1INDH 5GZND 4NRXB 2CXKA 1RJZB 3E2HB 1URLA 4AENB 4WVRA 1G7HB 1XGQB 2QSVA 2JCCE 4FABL 4KUCD 1UZ8B 1H3XA 4KJQD 3TGXA 3TNNA 4AM0B 3MRRA 4ELMF 4MWFA 3VFOB 5EPMA 2AS5M 2FJFA 3IXAA 4X6EB 5A3ID 4P23A 3I3EA 5D2LE 2ZP0T 3O6KH 2BVPB 3B9KD 1AD0A 3D2UD 2X4RA 4U7KA 3S37L 3EYUL 1OCWH 3E3QE 3DYMA 4NO3B 3T65A 3QUZD 3TFKD 3H7LA 3LD8B 1ZLSL 4DKEL 2WV3A 3PQYA 3WS3A 5C07D 2AGJL 1JVKA 4ZSOE 4M6NL 1BQLH 4PJXF 4TN9A 4BQ6A 2IFFL 5D1ZA 4OFVA 5J56B 4TUOA 5FKPA 4L4JA 3UTTD 1T1ZB 4P2YA 5LG1A 4LSSL 3V6FB 4Q9QH 4GBXD 4OCSH 1DBBH 5CEZH 1SBSH 2CIIA 1TJGH 5MHSE 3F65A 3IDXH 2FSEB 2F54B 1INDL 1Q0XL 3V0WL 5EG6C 3OXRB 4OM0H 1AE6H 3KG5A 1P2CA 2X4QB 3RI5F 5AZ2H 2NYYD 5DRNB 3ZKXC 4ELKA 3BPCB 4EQ3A 4PJDA 4U1IB 3BW9A 3H9HB 4JJ5B 1QBMH 3EJYD 1N6QH 3N1QC 2ZUUA 3D3VD 3OAZK 4FXGA 1C5CH 3Q48A 4JFEA 4TRPL 2HLFD 3QWRD 3KPMA 1H5BB 1BX2A 5H2BB 1WAAF 4WI3A 1F58L 3H9SA 4OZGB 4N1EA 4KTYA 3LPGA 4M1DH 1IQDA 1DQJA 5A16B 4NP4H 5C0JA 1HK6A 4JRYD 2PTTB 2CLRA 2DQUH 2Y25A 3MFFA 4H20H 3SOBH 4NDMA 3JTSB 3MGTB 3NIGF 4CVXA 2XWBA 4G80B 1BQLL 4YO0A 3REWB 2J8UE 3ZKMD 4CVZB 5EZJB 1F42A 4QWWC 3G04A 2PYEE 2AK1L 1U36A 4Q9QL 4O4YH 1DBBL 4G6FD 5CGYD 4OGAC 3K4ZA 2O5ZL 4YBQD 5C0IA 3WLBB 4HKZA 5T1KD 3PABA 3JWNC 1AE6L 5EBGA 4P5KA 4JZJC 4YK4C 4H88H 3S34H 3GB7B 3A6BH 3HCVB 4HFUL 1L9NA 4V2BA 5FHBH 3DSNA 1B0WA 4JKWA 2CRYA 3GMLB 4F7TB 2YS4A 3SE9H 1N6QL 1EEYB 1HI6A 4P2OC 4F58H 1SVCP 5T1LB 3T3MF 4LMQE 5FCUH 3UJTL 1MCWM 2JF1A 5TE6H 4DKFL 3VJ6B 2HYMA 3WHE1 1MRDL 4M1DL 5HGBB 3MLYL 4KKBD 2EDEA 3T3PF 4PJBB 5KG9A 4MS8C 4R3SB 1ZHLA 2W60A 4JDZA 3SOBL 5FUOH 4HJ0D 3W11C 2XKSA 4LAQH 2OP4L 4N0CC 1IKNC 2I24N 5F1OB 1J1OH 4JLRB 4N90E 4PJFE 1ZHNA 1OLLA 4KUZH 3FJTA 4LKCB 3UYPA 4I5BA 5HHNA 5D2NE 5F1SA 3PGDB 4X98A 1JPFB 4PIRF 2RIKA 2NX5E 5F9JB 3QCTH 2V2TB 4HXBL 1EGJH 4MJID 5CHNA 3NABL 2PYEB 2R4SH 3HLAA 2EKJA 1I3GH 2Q7YA 4ODWA 5SWZE 2GTWB 1IBGH 2BNRD 2V2WA 3IJSB 3OJMB 4UIMA 1TQBC 5EN2A 1XT5A 3ZE1F 1H3PH 3SE9L 4NCDA 2FZ3B 2VR9A 5DQ9B 5IB2B 1S7TB 4PS4H 1N0LA 4M8QA 4IMLB 5E8OB 1UVQB 3DPBA 3LKNA 2Y06H 3H0TB 4KDVA 2FX7H 2X41A 5EOQH 4K9EH 1NJ9B 2IAMC 4CJ1A 3I6GB 4NBXB 4IRSD 4H1LB 2DL9A 1U6AL 5L9DH 2QADB 1P7QD 2NNAB 2FL5A 2UY6A 5D5MF 1DL7H 1IZKA 3ARUA 3ZO0A 2J6EH 4ELMA 4LAQL 1RZGA 2OTPA 5KSAB 4B7LA 3TZVD 1O7SA 1A1MB 5D9SB 1SEQL 4OCXL 4GMSL 4JR9H 3NGBC 3DVGB 2QSQA 4KUZL 5ESAB 1YMMD 3Q1SH 4P2CG 4X6FB 3MLTB 1YJDH 4L4TD 1F4YH 1IKNA 1WBZB 1T21B 1XIWB 1RJLB 1YC7A 3T0DA 3W39A 4PLNC 3C8KA 1P4LB 2A9NH 1JGVH 4PJFB 5LWYH 1LK3H 3P0VH 1EGJL 1FYTB 1GPOH 3KPSE 1B0GA 4HWUA 1R3HA 4AJ0A 3CFEA 3MRDB 4MB5A 3NPZB 4NO0A 2CGRH 5C0BA 3W0WD 4PJXA 2RHEA 3TVMD 4HIEB 3N85H 1OGAB 2NX5B 1I9RH 5TDNA 3RIAK 2XA3A 4DZBA 1U8QB 2HFGL 1H3PL 3UBXA 1NUDA 4U6YB 3REVA 3STBA 1QBAA 1QBLH 4H0HB 3RWDA 5EUOF 3T0WA 1PAMA 3RJDA 2BVQA 2NPLX 5I1EL 1ZHKA 4QTHB 4XHJC 3WIIH 4R9HA 1NAML 5EOQL 3BH9B 1J87A 5C0FB 2AJZA 2YWYA 2HVJB 3G9VA 3RVXC 4WTZG 4JFZH 3TLRA 3QHTC 5L9DL 3O3BA 5CINH 4AEFA 1DL7L 3ARWA 4CW1A 4KTEH 5EA0H 2IAMA 1M7DA 2VDLH 1XGTB 1WAAA 2P8PB 1DLHA 1QQDB 1KBGH 4J23A 3UZEA 2PN5A 4JM2D 2NY1D 4W6WB 2X09A 1E4WH 1F4YL 2L7JA 4WU7A 1G7MB 3O3DA 4PRNB 3MROA 4MXWH 1JGVL 5LWYL 3P0VL 2J3SA 1I75A 1P7HL 2NMSA 2CGRL 1ZLWH 2ADGA 4HUKB 1UB6A 4KRNA 1XR9A 3N85L 2B4CC 3RDTD 2MQ0A 1S78C 3KPSB 3JUYA 1CIUA 4X9HA 4H8WH 3HG1A 3VFTB 5E9DD 3HPLA 5C0RH 3BN3B 1QBLL 1HEZB 3UYRH 3KWWB 5ICXA 1WZMA 3RZCD 4APQA 4OZIE 3WIIL 1OF2B 3V4PH 2BNUA 4HWBA 1CBVH 4ZDHB 1NCWL 1U3ZA 2XQBH 4OCWL 3K1DA 3PUCA 4UT7H 5AAMA 3AC0A 1A64A 4ZYKB 4RWHA 3UPCA 3K1KC 1MI5B 2VDLL 3S35H 4XC1L 1A7QH 3S3PA 3ZE2F 4U2ZA 1G9NH 1CDGA 1KBGL 4NHUA 2VXSH 4JQIH 1GAFH 4WDIB 3LRHA 4OUUA 1E4WL 3P2TA 5F1IB 2HKFL 4KDTC 4J3UA 1WC7A 3AU1A 5HYJA 3MJ6A 3KPPA 3MCLL 5CMAB 3A0OA 4EVNB 4MXWL 2MWCA 5GRYA 4MCYA 4P2QB 1JI1A 4Z0XA 4LCCC 4ALAH 1CG9B 1U8KB 3ARFC 1WCBB 3MJ7B 3JV4A 5J6HA 1P4BH 1XF1A 3EOBB 4MQSB 4WW2B 5IVZB 1N8ZA 5B3JF 2GCYA 4W6YB 5AD0A 1EFXA 5DUBA 1LD9B 4NFBA 2WSKA 4H8WL 2A0LD 2R0LL 2AXHA 3DV4B 3EW3B 4MGXA 5CZXC 1SVZA 5DJCA 4ZTPL 3QISA 1HQRB 4RMQA 1SEBA 5GRUH 4K3EH 2A77H 3RL2A 1BPVA 3BZFA 1UJ3C 3PL6A 4U1GC 3VFMB 3VXSA 1QSFD 1HILA 1KENH 4OGYH 3DV6B 3P4OA 4N9GA 1BZ7B 1UM6H 4XP1H 4OGZA 1I8LC 3RX8A 4Y4FD 3ZMRA 4OZIB 4UT7L 3GHEL 4Q6IB 5F3BA 2QR0B 3GMRA 3RGVD 2AKRA 4PGEA 5J6GA 4PRPA 4ODTL 5E8PB 1EPFA 5A2LH 4CADA 5GRVL 3S35L 3MR9A 3BWUC 3V6OE 1NMCB 4IM8A 1DANT 4X4XB 1CI5A 1I4FB 3U9PH 1JN6A 3VRJB 2YZ1A 2P8MB 1TCRA 2OTUA 4DOHE 2VXVL 5DD3L 3C5JB 1T0NA 3BPNB 4ERSL 2YD1A 3HMXH 2MCPL 1U3HB 5D5MA 3LDBB 4WFFD 5EWIH 5JXEC 4ALAL 1T20B 4ZQKB 4E41A 5GGVH 2YRPA 4FFWC 4ODHH 4KDTA 4LRNH 5CZVL 4LPCA 1P4BL 1UWGL 3GSOB 4YHPA 3R0NA 2DWEB 4UNTA 1LO5A 1XF4B 1K6QL 1S7VB 1NCDH 3ARFA 5B21A 2SEBA 2VAAA 4JFXB 4IJ3C 1QO3B 3BX7C 4QRPE 1RK1B 1AQDB 2YA1A 5EO9A 5BW7C 3BAEH 3EJZC 5GRUL 3HB3D 2A77L 4MNGE 3BJLA 2QV2A 2YEZB 3DURA 3QHFH 1ZEAH 4CL7A 3QUYB 4LFHD 1FVDB 4HHAA 3KJ4B 5H37G 2FECL 1JFQH 2E7HA 3IDGB 4LSUL 3ESVF 3V5DA 1T7WA 4RAUB 1HQ4B 3C6LC 2VISA 4S0SD 1B2WH 1MFDH 1YNLH 5TH2A 3E0GA 5EUOA 1T1XB 2F58L 1PYWA 4KPHH 2ITCA 4LBEA 3MJ9A 4TNVK 1I8LA 4HZAA 1ZS8A 3BKJH 3KPLB 4N0FB 2XY1A 4FQCH 5DEGB 4LP4A 1QD0A 2GJ6D 4WFHD 2NY2B 4QYOB 2VZTA 3WO3B 1RUKL 3ARGC 5BVJA 4OF8A 1CLYH 4HDIA 5GSRA 2VLRD 5FKAA 1FIGH 1KN4H 2ZSVB 4O2CB 4MCZA 1RUAL 3INUH 4O2EB 4LRNL 5C0GA 3MXWH 5D6DC 2R0KH 1TXKA 4UAOB 3TBWB 1RK0A 4MNQA 3EYOB 4FZ8H 1HSAB 3EHBC 5JXEA 4LL9A 5ESQB 5ICZA 2GK0B 2BY2A 1EO8H 4YE4H 4OBRA 1VHPA 3BPOC 2EYRB 3OKNB 2XWTA 2OL3B 2RB8A 4HG4K 1CK0L 4PRID 5B8CC 1NFIA 4P46B 5CCKH 5JORB 1IVLA 5BW7A 3SJVE 1KLGB 4UV7H 2ED8A 2ZKHL 3RWGB 1U8MA 4FQJH 5C09D 1B2WL 1YNLL 4KI5F 5IEKB 2F54D 2B1AH 4R7NA 1K4CA 2DKSA 3AROA 1I3RA 4E0RA 3BKJL 1M7IA 4PRHA 3G08B 4BSVB 3IAQA 3WUWB 4YHMH 4F3FA 3ECBA 5F7UA 4TVPD 1KLUA 3WNPA 3D85B 2WUCH 1C16B 1FIGL 1KN4L 3DMMB 3EO0A 3MXWL 2R0KL 3ARGA 5F21B 3BKCH 5D8JH 4P5MB 3O8XB 4PD4J 4Z8FL 4UOW1 5IV2B 5IW1B 3OR6A 5K9KB 4XP6H 5JPNA 3RIAF 2HFFA 2H45A 3V6ZA 2V7NB 3TT1H 2XACC 2EO1A 3B5TA 2BZDA 3NFNA 4LLUB 2Z9TA 4O00A 3BYYA 4FFZL 4AK1A 5HYIA 1U8JB 4Z76B 4NM4H 3QIBA 4KK5D 4MXQC 1MHHB 4QRRA 3S88H 1CTOA 5I9QB 3QJHA 2Z91A 1I1RA 4FQJL 5B8CA 5IIEA 2R2BA 4Q97A 4XX1G 2J8OA 5JW5A 2B1AL 4M7KL 2IBBA 3SJVB 3UX9B 1D3CA 1TJIH 4UUJA 4XRCA 5GGRA 1YPZE 4M5YL 1BGXH 4NQEE 3U7WH 2G60H 1TVHB 3E8UL 4WW1B 4YHML 1FGNL 3V8OA 4MQ7A 1MJ8H 2GITB 3BPLC 5F96H 5KOVC 3KYNB 4GKZA 1FNEA 4KK8C 2GQHA 2WUCL 3GBMH 1MUJB 3PV6A 3KNBB 4HK3J 3KPRD 4JY6A 3RFZC 1T3FA 5E5MA 1S3KH 2ICWA 5J3HD 4U6TA 5D8JL 3IT8D 4FOMA 5TDPA 3QEQE 4A6YH 5E6IB 5CD3B 5EOCH 1NAKH 1ZT7A 4JB9L 4RFNB 3OGCA 5MI0C 3RZWA 4PJ9B 3TT1L 2WWMD 1J05B 2H3NB 4PTUB 4PJIE 4NM4L 3VH8B 1F6AB 1MWAB 3V0VA 5F6HI 5CAYB 3FB7A 1LE9B 3R0MA 1AR1D 1PEWA 4ETQB 1RUPH 5T5NG 3IJYB 1N7MH 4GO6B 5DMIH 5I15L 1AFVL 4G6AC 3M17B 1JP5A 1LO4H 3FRUA 4UNVA 5A40E 3MRKB 3DHJA 5D6CB 1CE1H 3Q6FB 4F7EB 1TJIL 2DTSA 2MHAB 4JJHA 5C3TA 2JLLA 3O4LE 3SGDI 5DJAB 2G60L 3U6RB 2BVYA 3JV6B 5DMGD 3QDME 5D7LB 5IFJA 3IDMA 1QSEE 4IHOB 1JF5A 1J8HE 3QJFA 3SDAD 4OD3H 4FHBD 5J9PB 3RVUC 2Q76B 2WAHA 1RIUL 5CBEB 2NR6D 5CWSB 1MAMH 3LZFH 3RU8L 5L6YH 1HDMA 4YIQA 1ZGLA 1CFQB 5H35B 1DLFH 1FVEA 4G8IA 3EFDL 1ZVSB 1I1AA 4H26A 1NAKL 4IDLA 1BP3B 3K2UL 2P5EE 1KJ2H 4NC1E 4WO4C 1P5VA 3DI2B 2FX9L 3L7FB 3QIWC 1DR9A 1I7UB 4NQDE 4Y2DA 3PHQB 2ZG3A 2GSGA 4RMTA 2DBLH 1AXTL 5D1QB 4TOYL 1RIVH 1DN2A 5EZOL 4I2XB 4P9HH 3KLAB 3MV8A 1IGMH 4I18B 1OAYH 2EXYC 4J4PC 4PJIB 2R2CA 2R23B 5DMIL 4H25A 5E2TL 1KULA 1VEOA 3T1FA 2JIXD 4I0PB 1F8TH 1KIQB 3C5SB 5D7JB 2QEJA 3VXRE 3CVHB 2VNCA 2XZAL 3C87A 3FO2A 1BOYA 3JVGC 3QUKB 5DJ0A 3FO9A 1QFWI 3DETD 4NM8H 1ETZB 1U58A 1S7XA 1GJIA 1P9MC 2Y7QB 1BBJA 5SWZD 4K07A 5SWSB 4KROB 5I2IB 5K9OB 2A9MH 5FF6A 5I8CA 4R0LB 2GJZB 3LKRB 1MAML 2X89A 3DTXA 1C5DA 3LZFL 1QSEB 4UINH 4BFIB 5L6YL 3UXFA 1EZVY 4V1DA 3R06A 4LLWB 3K74B 3V4VH 1FNGB 1OW0A 2PW1A 4YEFA 4PJEE 4PRDB 1KJ2L 1HHGA 4JRXE 5FGCE 1MHEA 5F70A 5HHOB 4PGJA 2CRZA 2DYPD 3V2AR 1TPXB 2DBLL 1D9KC 4XBGA 2CRIA 3HZYA 4R6UA 4WO4A 3VFVB 4CDHA 1RIVL 4RZCA 5BS0A 4UB0H 3FOMA 3MRGB 4P9HL 3CFDB 3QIWA 1IGML 1KSRA 2WLYA 1OAYL 4NQDB 2XTJC 3OB0H 2D03H 1DN0B 4WJ5A 1CWVA 5I8EB 5IJKC 1EAPB 3L3DB 1ACZA 3NOIA 3MRCA 2VZSA 3CLFH 4X5WA 1F8TL 1BVLB 1IILE 1OD9A 5JMRA 3M8OH 3S5LB 2R56H 3DYOA 4J4PA 1RD6A 5KVGL 3IDNB 5K33A 2EZ0C 2XN9E 4TNVF 1WCQA 1EZVX 4IOFC 4KJYB 1EGJA 3QZWA 5LKNA 3LQAL 4U1NA 3HC3H 4D0DA 4ZXBD 3VXRB 4M7ZC 4NSKB 4I0KA 4ZOBA 1G84A 3SO5A 1LEIA 2ID5A 4UINL 5IW6B 3IDYC 3B83A 2B0SH 1PD6A 5TQ0H 1GGTA 4JQXA 4AIZA 1K4DB 2UWEE 2ARJB 2YPLB 1P9MA 1UH2A 4OZFG 1VKXB 4OZHB 4HUUA 4G8GD 4CMHB 1BD2A 1LO0H 4OZ4A 3MBXL 2GW5A 5BZDA 1G6VK 1NUGA 2DQGH 2YPKA 4FA8A 5CKGA 4JY4B 2AK4D 3BI9X 1RVFH 3GI8L 1KPVB 4N8PA 5FO9B 2NY4B 4AEHH 1IL1A 2J5LC 4JRXB 1FC1A 1YEIH 1ZVHA 2AAVA 1YMHB 2Z8WC 1MRFH 5CJ5A 2F53B 1A4KB 1D9KA 2F5AH 2HG5A 4OFKA 3CLFL 4S1DC 3TNMA 1B4RA 4FG6D 1M05B 1W72H 2FB4H 2APTA 4C56D 4G7VL 5F8RC 2C4FT 3KXFE 4PBVC 4WI4A 5IJKA 1EDQA 3FQTA 4XAKE 5SWQB 3GJFH 4IOSD 3CPLA 4KQ3L 3O45A 2HJFA 3WKMH 3S98A 3SKOB 4I77H 6FABH 4YC2C 4FQ1H 2IPUG 4H8WC 1J1XH 5ADPH 3PWLA 2VZVA 3LS5H 3QNZB 4QHUB 2XN9B 32C2A 1YEDA 4GXVL 3T4AB 5IEHA 2B0SL 5TQ0L 4LHJB 5J1AB 5KSBF 1RJYB 4ZFOB 3RBSA 3WN5C 1PEZA 5IM7B 2VDOH 4Z7NE 1FRGH 1A7PL 4GKSB 5IHBA 5HHPB 4PBXA 2R2HA 5CD5C 4QRSB 4KRLB 2DQGL 1AIFB 3DXAE 3MLWH 4Y16B 3KYKH 4MQXD 4DAGL 1RVFL 1DBAH 2G9HA 4ORGA 2W0FB 3QIUB 3SDYH 3ROLA 2KUTA 1NGYB 1YEIL 1UEYA 1MRFL 1AHWC 1FC2D 2R4RH 1QHOA 5FEBA 1QFOA 2A74B 2OTWA 4AT6B 4BFEA 3RKDD 4DZ8B 2WLZA 4MDIA 3OAUH 2FB4L 3ZL4L 4HBCL 5D96C 3MRQA 5IMMB 3E6FA 4QHNA 3ZT5A 1C12B 2HFEA 2YD3A 4Z6AT 4ODVH 4YX2H 4CVWA 4NZDA 2I9TA 3PDOB 3MRHB 4HCRH 4LVNB 1QFWM 1EHNA 1Z0MA 6FABL 5EO0B 2VQUA 3L7EA 1UT9A 1W8NA 3LS5L 3OKYA 4K2UH 2NY0C 4IDJL 5DQJA 5DRZB 4M5ZH 4P3DB 2APXA 4DQOL 2X4OA 4Q74A 2Z8VC 5JA8B 2R69H 1CGXA 3EGSB 3LN4A 3QP3A 1T04A 3MCKA 2Q8BL 2VDOL 1MJUH 3VI4E 5BRZE 3HRZB 1D6EB 5E4EB 1SQ2N 4TVPH 3F7VA 5LJYH 5CEYA 4HH9B 5FHAH 4X7FC 1F3JA 4YZFF 3T04D 4JGMA 4KJQC 3WN5A 3MLWL 5FGBC 5EZIL 1DBAL 4JPVH 4R7DB 1S9VA 1UCTA 3SDYL 1W8OA 1R5WA 2JJWA 1RMFH 2RCSL 5A3IC 2QHRH 3T2OA 2NY2D 3B9KC 2HH0H 1H8NA 3DXAB 5GS0H 2H32B 1MCNA 2X9YA 5F6HJ 3C60B 3TNNB 3SQOH 1JHKH 1CR9L 3MQIA 3QUZC 4PJAF 3TFKC 5MENE 1G9EA 2FJFB 3UAJD 1B4JL 1NLBH 4ODVL 3IFPB 4P23B 2BC4A 4YDKL 2IANA 5FA3B 4JREB 4HUMB 2X4RB 4Z7QF 1N59A 5CJOH 1NKRA 3L3IA 3RNKA 3FAWA 1XCTA 3VXTA 3MV11 5DXWA 4GBXC 1ZT1A 3CX5J 5J12B 4K2UL 1N5AB 3WS3B 4NNYA 1Q38A 4M5ZL 3IF1B 3HNSH 2GEEA 5D1ZB 1I9EA 5FKPB 3BDBA 4CMMB 4QRPD 1MJUL 2VLJE 3RRQA 1KEGH 4TVPL 2NYYC 1FZMA 1JZ4A 2DLHA 2BHYA 4XCEB 5IFHL 3BQUB 2DM2A 3RY4A 2ESVA 4JPVL 5C0EA 1P2CB 3QEHA 3V52H 3IGAB 4G42B 2HLFC 4KFZC 1SHMA 1H15B 1AO7E 2QHRL 4LARH 2HVKA 4WNQB 4ELKB 3VDBA 1BAFH 1MCJA 2BVOA 4PJDB 5FGBA 2HH0L 1X5LA 1N64L 4DN3L 1KYOJ 5DLML 5J4MA 4IOIA 1WZ1H 3BRDA 3HMWH 1Z5LB 2WUBH 3CSYA 4BQBA 4GRWE 7CGTA 1NLBL 3B9KA 3D2UA 3KPMB 3ZE0E 2UV3A 4YLQT 3H9SB 2IQ9L 1H9VA 8CGTA 3ZKMC 2FYYA 4EDXB 4WUUA 2KBGA 4ZS7H 2CLRB 1AQKL 5C07A 3VE0B 2RAMA 5TGBB 1LK2A 5CGYC 2OM5A 4ORZC 5BVPL 4YBQC 1P6FA 3MRNB 3UTTA 4CVXB 4KKCD 2FHFA 2PYFA 4HC1H 1FG2A 5DA4A 3JWDL 3G04B 5JZ7D 1KEGL 2AI0L 1GHFH 4U6HA 2R15A 5IMKA 2OZ4L 3MGOB 3BO8A 3H6JA 3PABB 3SKJL 1JNHA 5JHLL 4P5KB 4XVSL 4WU5A 3S97C 2ZZUT 4LARL 1FNAA 4WHCA 1QUNA 5JIKA 4OCNC 4P5TD 4S10A 3PWPE 4H1LH 3BYTA 3NCYP 3MRLA 4KKBC 4YEEA 3HMWL 3QWRA 1CFTB 1KACB 1FFPA 3ZKXB 4HIJB 4HJ0C 3U4BL 1D5XA 4JM2F 2X4SB 1L7IH 4Y1AB 1IAKA 3D48R 3QBTB 1QG3A 4MVBD 3IAGC 1FDLH 4JRYA 2JB5H 3LQZA 3LN5A 5KG9B 2FD6L 1HH9A 3BWAA 1ZHLB 4LKXA 5IW3A 4NKDA 1KTDB 5JIIA 3QEUA 5IOPA 4PJ9D 2VN4A 1NCBL 1QSVA 1U8LA 4HC1L 2E7CA 1ZHNB 3OKEA 5DK0B 5GGQH 3FT4B 3IFOA 3QDJE 3TYGH 1PQZA 4JKPL 4OT1H 1EAJA 4JPIA 4I5BB 3IKKA 5E8DL 4X98B 4ODXA 1NMBH 4PJ8B 1JGEA 4L8BB 2EC9T 5CHNB 4OKDA 1BIIB 1U8PB 1IAIH 2X42A 3RPIA 3VI3E 1A1OB 1KCLA 4NOBA 2E7BA 5ISZE 1OGTB 3GMQA 3ZHDA 3WNOA 1S7QA 4G5ZH 4JZJB 2P47B 3PV7A 3BE1H 3D25A 4NQED 4OI9A 3I2CH 5F1NA 1U8HB 4M8QB 4KAQH 4U31A 1ZANH 1L7IL 3TZVC 4NIKB 3X13A 4P2OB 1ITCA 1JRHL 4PLKD 1FDLL 2JB5L 3T77A 5CKAA 5F9DC 5MERA 1MJJB 3MX0A 3LMJH 2FL5B 3MOAH 4I3SH 4X80H 1F6FB 1RZGB 5E2WL 1MFBH 3DARA 3QEQD 4PJAA 4Z95H 1JL8A 4J1UA 3QI9A 4BQ9A 4XCYA 1N26A 4LPXA 3GBNH 4Y5XC 2H2SD 4X5XA 5SX4H 5TFSH 2B1HH 3HFML 3MLRL 1T2XA 3TVMC 1CQKA 2OJEA 5EIIB 3S6CA 5JNYA 3NIDF 3W39B 1BEYH 4JAMB 2AABH 2X1PA 1BVKB 1B0GB 2YD8A 1R3HB 4OQTH 2HT4D 4PJHA 3CFEB 1SJEB 1KIPA 3PIQB 4PJXB 2BNRA 4HPYL 1AY1H 2PO6A 1YDPA 1JHTA 2V9RA 5L88H 4Q58C 2BCKA 2P5WE 4NWTH 4RFEB 4RMVA 1HOCA 1QZ1A 1PG7H 4G5ZL 4UMGA 1HCVA 3REVB 4GW4B 3O4LD 1QPXA 3BMVA 3I2CL 4O51A 1AJ7H 4UIKH 4KAQL 2NY7H 4IRZL 1GZQA 1I1FA 3QDMD 4HAFA 4PTTA 3RWDB 3ARRA 3SKMB 1TQBB 2BVQB 3X3GH 4B53A 5L7XH 1O0VA 3L3KA 1J8HD 1GC1L 4JG0H 1ZHKB 4P4RB 3VFWA 2Q20A 4AZ8A 2QQQA 5ENWA 2AJZB 1P7QA 3IFLL 5EU6B 2V9QA 4JM2C 2NY1C 3LMJL 3O3BB 4X6DB 1V7NH 2IALA 4I3SL 1L7TH 1SYVB 4CW1B 2D0HA 1A02N 3AB0B 2ADIB 3CZFB 4ZUVA 3EYSL 4A6YA 2EC8A 1VGKA 3GBNL 4F57H 5FXCH 2P5ED 4TPRL 5ACZA 4PV9A 2B1HL 3ULVE 2EE9A 4D3CH 4OSUL 1EO5A 1KFAL 2DMBA 3O3DB 1Z2KA 4DK3A 4LPTA 4P9HC 3P4LA 1OQOA 4LSQH 3MLUL 3MROB 3BEWB 2VSDA 2AABL 4Y5XA 4N0UA 1MY5A 1RHHA 4OQTL 2EYSB 4NZTH 4XXCA 1FFNB 3TVMA 1T5XA 1YEGL 4RIRA 4Y4HC 3BDYH 5F44A 1UB6B 1JYNA 1XR9B 3CJJA 3RZCC 4PJ7F 3FRPA 5FCSH 5L88L 4EDWH 3RBGA 1FFOB 1WWAX 1R5VB 4K3JL 4QXGH 5HHXL 4KTDH 4XNMA 5IKCA 3WNMA 4KK6D 3ZDXF 1PG7L 2FNBA 3CDYA 3EYFB 3LSOA 3LQAC 3G6AA 1KB9J 3UCRA 4UIKL 3G5ZA 4YXLL 1X5HA 4WWKD 1X5FA 4FN0A 5DR5H 3VWKD 2WINA 3WDHA 1Q0YL 4MAUL 4PUBL 4XZUB 3EO1B 1A5FL 1WVZA 1IQWH 3QCVL 3ULUH 1NH6A 1EJOH 2F19L 4NO2B 3MO1A 1F3DJ 2AJ3B 5IBUG 1NEZA 1XMWA 4AYFA 4LLQB 1JK8B 2P8LA 4OJFL 4PJGE 5BXFA 5CJQL 4JM2A 1D5MA 4LLYB 4NHUB 4OUUB 4AY0A 1KJ2A 1UA6H 4D3CL 4M61A 4F7CB 5CSZA 5HYJB 1UGNA 1DEEA 2WWKO 5IESL 3GSQB 1VEPA 4MCYB 4WUKL 3WXWH 4Z0XB 2A0LC 2ZUXA 3BRGC 1KXQE 4N8CH 4BK4A 4RWYH 1DUYA 1UM5L 3BDYL 5J6HB 4G8FB 5E8NB 1CFVH 3QFJE 3DUHA 3RWEB 4KV5E 2XPGA 1T5WB 5C6PB 1N8ZB 4EEEA 2M26A 4QXGL 2GCYB 4KTDL 5FA4A 4CDGC 5AD0B 1IMHC 5E9DA 5DUBB 4Y4HA 1U3JA 1OAQH 4ZD3H 2VDRL 2DWDA 5I1LB 2ZCHL 5I75C 3VW3H 5HYQB 4XCNA 4Y4FC 1XCQA 2EDFA 1SEBB 4OV5A 3RGVC 5DR5L 2XN9D 3I3DA 3RNQA 3W9DB 3BZFB 2ARJQ 4I4WA 1N6VA 3OKKA 4NKQB 4XVUD 1HILB 4KZEH 4BH7A 1UCBH 1XR8A 1KNOB 3P4OB 4PREA 1IQWL 1I9IH 1EJOL 4WI6A 1NUFA 3M1BA 1NGZB 1WQVT 2H1PH 1IC5H 4LHQB 1OAZH 4CADB 3G5VA 2VDNL 3MR9B 4XVTH 5B4MC 4LSRH 1BFSA 4HIHB 4BSJA 4OZGF 1MCWW 2P46B 2XWJB 1TCRB 2OTUB 5KOMC 1UA6L 2AJXH 4NQCB 5C92A 3L5WA 1T0NB 3LRSB 3SPVA 4JY5H 4PJGB 1A6WL 5GGTH 3MRIA 1FL3A 4GJTB 5D2LF 1I7RA 3MOQA 2AV7A 1E6JH 1MSPA 4TNWK 3WXWL 3LEVH 3GIZH 1BFTA 3ROOB 4PJ5B 3HZMA 2A6IB 3TJEH 2XFXB 2OL3H 1CFVL 3GHBH 3HB3C 2C26A 5C6TH 4L4VE 1LO5B 2EDXA 4LCCB 3ARFB 3TJHC 1ERNA 3C09C 4NQTA 1OAQL 5IWLC 2VAAB 5D93C 1R3JA 3OX8B 2BDNH 4UDTB 2YUWA 1CXKA 3KXFD 2VZUA 1P84K 2PNDA 4X4ZA 2CK0L 1GCFA 4XAKD 5EOTA 2BVUA 3VXNA 3DURB 2BP3A 1TTFA 1F97A 5JIHA 4O02L 3HN3A 4KZEL 4LNRA 3LN9A 4RBPH 4ZO6A 4Y4FA 1HH6A 4HHAB 1I9IL 3RGVA 5ELIA 5AWNL 3VXPA 3P0YH 1UJ3B 2VISB 4ACPA 2H1PL 4U1GB 4O58L 4XVTL 2ITCB 5HGAB 4LSRL 3QDHA 1OPGH 4GKNA 3EYVB 1Q9WB 4CU7A 3D39A 2L0DA 3FTGA 4JY5L 2X6MA