1ZANL

Crystal structure of anti-ngf ad11 fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASLGETVTIECRASEDIYNALAWYQQKPGKSPQLLIYNTDTLHTGVPSRFSGSGSGTQYSLKINSLQSEDVASYFCQHYFGYPRTFGGGTKLELKRADAAPTVSIFPPSSEQLASGGASVVCLLNNFYPKDISVKWKIDGSERQNGVLDSVTDQDSKDSTYSMSSTLTLTKAEYESHNSYTCEVTHKTSTSPVVKSFNRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab AD11 Light Chain
publication title Dissecting NGF interactions with TrkA and p75 receptors by structural and functional studies of an anti-NGF neutralizing antibody.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 54
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zanL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zanL01
2YD2A 5MERB 4XVJL 4CVZB 1X4YA 4U0RC 4XPBH 4ZODA 1C12A 2XWBA 2ADGB 3ZKXC 2BDNL 2ILLA 4KJQC 1C5DA 1RMFH 1TMCB 3ULUL 3MRNA 4YGVB 3X13A 4HBQA 2Q86B 1LO4L 2VZ1A 1U8HB 3LIZH 3SDDD 2WIMA 4PGCB 1H15B 1S5IL 1QFWI 4PGEB 3ROLB 1ZLVK 3SKOB 1IKFL 3L3DA 4Y4HD 1WZMA 4PJ5D 1GC1C 2B1HH 3QEQA 3FQNB 4C56E 1YMHB 5TE4H 3D18A 3C5SA 2XA3A 3QIUC 2LVEA 2YPLD 2HTKD 3GSOA 2IGFH 2A9MH 3AXLB 5LVEA 1UB6A 5J9PB 5IMMA 4X4ZA 1H0DA 3D0LA 3H9SA 5E5UB 3FOMB 5DJAB 3O8XD 5D7LE 1D5XA 1A7PH 2P5EB 2ADIB 5FGBA 3FFDA 4HF5H 5JOEA 4W68A 2ZPKH 5CEYB 1T03L 3I75B 1AD9B 2CDEA 3VWKA 4NJAL 2Z9TA 3EYUL 4GSDL 5ICZA 1WWAX 3BDYH 3MRBA 4YBHA 1B6DA 4ZXBC 4MJID 1OGAD 1NMBL 2W0PA 1JPGA 2QBWA 3LH2H 4AH2A 4MAYB 4OCNC 5F1IA 5ILTL 4UAOC 3MLUH 5J4MA 4GMSH 4QRSB 5LAXB 3GHEL 4XNZB 4P23C 5TJWK 1U8IB 4IRZL 3EO1B 3QCUH 5E24E 1TPXB 1DLFL 1BM3H 4ZUVA 3ZE1E 25C8L 5IMKB 4WDIA 2WUCH 2E7LC 5B22A 3TO4A 2FATL 1KCUL 1FBIL 1PKQE 1Q9LB 2YOCA 2B1AL 3NA4A 1N0XH 2QQKL 4OM0H 4X6CF 3VXSD 1V3LA 2DJSA 2ITCB 3QNZB 1H3XA 5DC0A 2DM2A 5HJ3B 4F7EB 4I4WB 2OBGA 1Q8MA 5DS8A 2CO6B 3HNSL 3G6JF 2XG5A 5J57B 1NC4B 3MCKB 1I1FB 3DX7B 4O2FB 4DFHA 3MLWH 2H41A 3LMJH 4HEPG 3VFOB 3PWJB 1TNMA 1IEBA 3T0EA 3K1KC 4D0CA 2OI9B 4HZLA 5JW4N 1OPGL 3OGOE 4NQTA 4Y4KC 1F8TH 1N3NB 5SX4H 1BOGA 2FJGA 3WFDL 5I75C 4NC2B 3QI9C 3Q3GA 3QEHA 3BPCA 5B38A 4UTBL 1J7VR 4ONGL 2RAMA 2FZ3A 4X6FA 3GK8H 4K94H 4FXKA 3U1SL 5C0CA 4P5KA 3ZYJA 4OCWL 4Y1AE 1T21B 4W81A 2EH8H 1S7VB 5JIHA 1HILB 1NFDE 4HC1H 3LQAC 3ARDC 3NIGE 1A6WH 4KZEH 5CEZL 1I1YB 4HK0B 3QCVH 3OKDA 1WFTA 3V5HB 5DI8B 3LHPL 3B5TA 1HHHB 5DR5L 1NCWL 4OT1H 2R1XB 3CFJB 1MJJA 1QUNA 1BFVH 3KG5A 1AJ7L 4M7ZC 4JO4L 4EN3B 5FGCE 2VR4A 3U2SB 1G6RH 5DHYA 2E9IA 1QBAA 1YEIL 3QIWA 1CE6A 1BGXL 1UB5B 2X70A 1QA9B 2VZSA 2C9AA 3QEQD 3EGSB 3BKJH 3DURB 1FH5H 1ZK9A 4N8VA 3NAAH 5DQJB 5GGUB 5GS3A 3GZKA 5IVNA 4FMFA 5JHDB 5J3HC 3HI5L 4WNQB 3CAFA 3BUTA 5KS9A 1YMMA 4APQB 3FRPA 4Y5VC 4R3SA 1TFHA 1OY3B 3UJTL 4G3YH 4OD1H 5DMGC 4ZFGL 2O5XL 5A3ID 3R06B 3IT8D 4K7FA 1FCCA 2EE9A 5D1XB 2NY4D 4P59H 3NTCL 4GRLC 4PJ9B 4H25B 1HCVA 3VWKD 3IAPA 1F6AB 3VA2C 2Z31D 3IDXL 1MLBA 3V6OC 4S0TD 3OG4B 4NKDA 2DLGA 2Z4QA 2DQFA 4OD2A 2F5BH 4J6RH 5E5MA 1U91A 4JFPB 3U4EB 1B4RA 3F7QA 1K6QH 3T0WA 4IIQB 2IMNA 3TLRA 4KI5D 5F7HA 1JWMA 5D7IF 5FKAB 4MXQD 4JDZA 1EV2E 2P8MB 5JUEH 5LGJB 2QQLL 4FRWA 4KFZC 1T20B 3HR5B 4XWOD 3TO4D 4GG6A 2W65A 1KEML 1I1AC 4GAYB 4PJFE 4BFIA 5FK9B 1VKXB 5MERA 4CVZA 3L7EB 3V52H 4NZJA 4NWTL 5GRJH 1RURH 1F4AA 2ADGA 1MRFH 4XAKE 1QLEH 3D1MC 2WQRA 1QSEE 3QISA 5F88B 4YGVA 3OR7B 4M8QB 1CL7H 2VQ1A 2Q86A 2NXZC 3SDYL 1U8HA 4OLYL 3OKYA 1AQKL 1ZWIA 4PGCA 1H15A 4M7LH 5EOQL 3MZGB 4OIIL 4PGEA 2ADJB 3EO0B 3SKOA 3T0ED 4P2QB 1F6FB 4HGWA 4J3UA 2DQGL 1OAKH 3FQRB 4NNPL 2BSRB 3KPOA 1U0QA 5DT1H 3RWHB 3UJJH 1T7ZA 3QHZL 1A21A 5F6HJ 1RJZA 2HKFH 3AXLA 4EDWL 1DZBA 4R7DA 1MLCB 2XRAL 4MLIA 2H45A 4TVPL 5J9PA 5C0CD 3QDGA 4XTRD 2R0ZH 3FOMA 5DJAA 5E70A 4AZ8A 1PLGH 2P5EA 3OAZK 2ADIA 1R0AH 5CEYA 3I75A 1W0WB 2ZG2A 4PLJC 2VLLB 5A2KH 12E8L 1DQTA 5FM4A 1PVHA 7FABH 1D6VL 3L1OL 1T83A 2EKJA 3U46B 2BVQB 4MYWB 4M62H 3CFEA 5FYLH 2CKBH 3MV8E 1I3GL 4DN3L 2A6DB 5HI3D 4MAYA 1LE5B 2YMXL 1MCDA 3VGAC 5A2FA 2C3GA 5I19L 4FMKA 4QXWA 2EC9U 3IAGC 5LAXA 4FA8A 3VI3F 2Q8BH 5CAYB 4FABL 1VERA 4KTYA 3VDBA 3I9GL 4NSKB 5KJRL 1J05B 1QNZL 2X1OA 4YIQA 3VFWB 4PJIB 4M4PA 2NY0D 2NY6D 1YMMD 3KXFB 2ITCA 3QNZA 5SWZB 2P48B 5F7EH 5HJ3A 1M7IB 4NFBA 4NUJA 4C54A 4F7EA 4I4WA 4IMKC 3KLDA 3DX9A 5TDNB 3P11H 2WBKA 1U8OB 3TJEL 4XP5L 5HVGB 4HXBH 4YO0A 1KGCE 3NOIA 3MCKA 1I1FA 3NH7L 3DX7A 4O2FA 3PGCA 4DEPB 2G60H 4NIKB 2Y36H 3VFOA 4N0UB 3O41B 4WFED 2J12B 4DAGL 2EEDA 2YRLA 1BWWA 1D3CA 3GSNL 5IFHH 3HFMH 3KLHC 3PDGA 2P5WA 3ILQD 2F53B 5C07E 5KZCD 4UTAL 3H7BB 1SJEB 2J5LC 4X7SH 1SM3L 4G6FD 3VG9C 4WJ5A 4Q9QL 3ULVE 2EDWA 3A6OA 1T21A 1G6VK 2NW3A 4RIRB 1HILA 3Q0HA 2KDGA 4CU8A 2X89A 1RIUH 4QOKB 5AEAA 4HK0A 2BC4B 1OQXA 3BGFB 2VLRB 4G9FB 4AEHL 3MJ8B 4GW5B 5DI8A 1HHHA 1B3JA 3BPNC 1BJ1J 1I1RA 1XT5A 2QTEA 3UROR 2R1XA 2ZZUT 1P6FA 2AW2A 3HC3L 3QPXL 3QUMB 2YUZA 4EN3A 1J86A 4JN1H 3MLVH 5BVPH 2CKNA 1JYNA 3OHXB 4L8SB 5FM5M 5MEQB 5CJOL 4X99B 1MFAL 1KNOB 1QA9A 3NGBB 1J5OH 4V1DE 3EGSA 3DURA 2RB8A 4LLQB 4P46D 5GGUA 1XF4A 4O5LH 5IOPB 5JHDA 4BH7A 5J7CC 5D5ME 2D7MA 5JW4Q 4OQTL 2EC8A 4M9OA 4WNQA 5T1LB 1BFTA 2HMID 3H7LA 3BUYB 3C2AH 2B39A 4K23H 3QDGD 5I15L 1M05B 3W2DL 1VPOL 3CX5K 1XCQB 3TNMA 2P5ED 3QDAA 3BYTA 4JFYB 1U6AL 1T80A 4MCZB 1CXLA 4YEFA 4HEME 2DM4A 2P42B 4KXZI 1UFUA 3W11D 3Q1SH 4H25A 4QXUH 1T2QL 4ZOEA 1F6AA 2GSGB 1BOYA 1QSFA 4XPGH 5DC9B 4Z8FH 2NZIA 4WI4A 1U3JA 4I18B 2BDNH 5DURB 3U4EA 3ARZA 1QG3A 4LPXA 4MAYD 4WHYG 3ULUH 5DZOA 4DGYL 5FYKU 3KLSA 3HPLB 4IIQA 3MLSL 1LO4H 5FKAA 3B8YA 3O3AB 1S5IH 1K8DB 2JJSC 4BQ6A 2UVEA 2P8MA 2IH3A 3Q5YA 4HLZH 2FNBA 5LGJA 1XFPA 1T20A 3TN0B 3HRPA 1P69B 3CVHB 3HR5A 2ITDA 2QHRL 3U7WL 2D7TH 3EAKA 4JO2H 5FK9A 2OM5A 1REIA 3L7EA 3IDYC 4K7PL 1GZQB 3TF7C 1A9BA 3RVVD 3TIEB 1P5VA 1QRNE 2IEPA 1MFEL 1BFOA 1NAMB 2EICA 5F88A 3RWGB 2B2XH 4M8QA 3SOBL 1YY8B 3LEYL 4IOIB 4YFLI 2FSEB 1JV5B 3EO0A 3LPWA 4P2QA 3ALXA 1U36A 2BVPB 1T03H 4I5BB 1NFIB 4NDMB 1R24B 2BSRA 1XGPB 3EYUH 4GSDH 2HJKB 1F4XL 2VDRH 3RWHA 2P5WD 4EKXA 4U7SA 4YHLL 5JDSB 2Z8WC 5DEFA 3UYRH 2AJ3A 4LPTA 3N85L 1Y0LA 5DK2B 5ILTH 4L9LB 2YPVH 3IFLH 3MUHL 3KHOA 2X9YA 1CFQB 2AK4B 1FZMB 1MIML 25C8H 5CZKA 2X89D 5D2LE 3CXDH 5TQ2H 5CJBA 2OR8A 1W0WA 3QO1A 2VLLA 5KVMC 4E41A 2QQKH 4Z7VA 1FNEB 2Q8AL 4I3RL 3U46A 3GI8L 3KYMB 2BVQA 4F80A 1F42A 3MRLB 2F54E 2A6DA 1A0QL 4EN3D 5C0JB 3ARSA 5F89B 3WN5C 3D85B 3KPMB 2V17L 5K33A 4NP4H 3UTOA 2FECI 3HNSH 4Y5XA 5HYSB 2J8UE 4ERSL 1DVFC 5HYSG 5MENB 3O2DA 1YECL 2DQEL 1P84J 4PJBE 3VXTA 5JHDD 4NSKA 3LV3B 3RTQB 1OPGH 3PGDA 4PJIA 3O4OB 3QFDB 4L4JA 3WFDH 3KXFA 4F2MA 4LSRL 4IHOB 5SWZA 1JPTL 5JNYB 1DUYB 5I74B 5D72L 4MQTB 1JYWA 4AIXA 2N1KA 3BEWB 4ONGH 4UTBH 3TJHD 5TDNA 1ZT7B 5DHVB 1U8OA 2HLFC 2EDLA 5E8OA 3U1SH 3MJ9A 4HS8L 4OCWH 1GOFA 1MVUB 3SDAC 4P4KC 3MRDB 3O41A 1QSFD 2NNAA 4RMVA 5DD1L 4JFQB 4KKLC 1M1SA 2NPLX 5DR5H 1NCWH 3DMMA 5ANMA 5HD8D 1BX2B 2F53A 5I1JH 4QTIH 3HB3D 4JO4H 3H7BA 1SJEA 3B5GA 2XOTA 2AS5M 4LFHD 3UTPE 1DN0B 2FBJH 5IBTL 1OTTC 4DGVL 1KB9K 4FP8L 4MDIB 4QOKA 5E1AB 3C87A 1MCHA 5GGSA 4U1GB 5FGRA 1R5WA 2VLRA 4G9FA 5F7YC 3HI5H 4JQIH 3MJ8A 2RJMA 3AB0B 1JYVA 1F4WL 1GAFL 2DLTA 3EBAA 3N0PB 4EXKA 1RK0B 2XWJA 1UXSB 2IADB 3UJTH 3LRHA 1DP0A 2VSDA 1PZUB 2O5XH 5IK3B 3ZKNC 1JWSA 1MCRA 1C08A 3N1PC 4PRHB 3OHXA 4L8SA 4JDVB 5MEQA 1H9VA 4NQEB 2F19H 4P2QD 1T7XA 1KNOA 1KCLA 1CXFA 3NTCH 1DE4B 5EBWB 5GJTL 4LSUH 3V4UL 1OSZB 1MI5B 1J1OL 4AQ1B 3CDYA 4BZ2L 4YHML 3KGRA 2J7LA 4EI6B 3IDXH 4M7JL 3MRIB 3TPUB 4EVNA 1WCBB 3JV0A 5T1LA 5BJTB 3LB6C 4N0RA 3WKMH 5I1CL 4KKCC 5CUSH 4P4RA 2NY3B 5INDB 1BQSA 4Z18A 3DTXB 3BUYA 2R4SL 2NR6D 2V7HB 2MJWA 3EO9L 2CR6A 1M05A 3IFNL 3UC0L 1XCQA 4FHBD 3U7YL 4JHBA 3MGAA 4JFYA 5GS0H 3N50A 1CCZA 4RBPK 2XTJB 2QQLH 3A6CL 1JFQH 1GJIA 1VGKB 3GRWA 1KEMH 3TBVB 4E41D 3P4NA 2GSGA 4KMTL 5BW7C 3OKKB 4M9PA 1B0RA 43CAB 4BSWA 3TNNB 5GZOD 1GCFA 1EIBA 3VGFA 4I18A 4RGNC 3FQWB 1IQWL 3HPLA 4HFUL 4JCLA 1TVDA 2I9LA 2LQRA 4LSVL 1J8HA 1G9NL 4OLYH 1XGRB 3O3AA 2Q7NA 1K8DA 2K1MA 2BSTB 1UCBL 4M61B 4OIIH 4PS4L 2VDQL 5GRVK 3TN0A 2D31B 4ELME 3RIAK 1PAMA 1KG0B 2KL6A 2DQGH 1UADC 4NNPH 1IAMA 1R5IB 1IM9B 3KXFD 4ZPVB 2V5YA 1GZQA 5SWZD 4OCXL 3EDKA 3TIEA 1A7OL 1CDYA 1UH4A 3SDCC 4EDWH 1NAMA 4HK3N 5EU7E 3QDHA 5I73B 3L3JA 3RWGA 1EEYB 3K80A 5T5FH 1CTOA 1HOCB 4AT6A 4P3CL 2FSEA 1CG9B 4EXPX 3OB0K 3ZDZF 1X44A 3JWNC 1JN6A 1NFIA 3MJ7B 1HN1A 12E8H 4G5ZH 1R24A 2AJUL 4RMUA 2X09A 2MOVA 3WDHA 15C8H 1D6VH 2DTML 3L1OH 2HJKA 1E4KA 3DMMD 3EHBD 3GGWB 4KK9D 2F53D 4UNVA 2MKWA 1J0YA 1I3GH 5DK2A 4L9LA 5DRNA 5I19H 3QBTB 5HDOA 1Q38A 4G80B 1VFAB 1QHOA 2E8YA 3OQ3B 3RVTC 3V5DB 4FABH 1ZA3A 1FFPB 1FZMA 4M5YL 4GKSA 1S7XB 1V7NL 4QOKD 4KI1A 4X6BB 2E7CA 1MY7A 3RZCC 1LK2B 3I9GH 4G9FD 2VLRD 3KVQA 3TYGH 1QNZH 5JZ7D 3I3EA 1FNEA 1WIPA 4R97B 2XICA 2V9QA 1YYML 1J9CT 3MRLA 1A7NH 4DK6A 3NFSH 2KKQA 4PJ5E 5C0JA 5F89A 3D85A 3KPMA 3TJEH 4XP5H 4F9PC 4PG9A 5HYSA 3QNXA 1V7ML 4JZJC 1GOHA 3KYOB 2QADB 3SBWC 1KYOK 1UWEH 3NH7H 3QJFA 1H3PH 4L8DA 5KG9B 2O61B 1CIUA 1G7IB 5MENA 2HFEB 2YPLE 1A9EB 3PJSB 5K59F 3BP6B 3QAZB 3HE7A 3LV3A 4CRPA 2GI7A 5JIKA 5T1LD 4HUUB 4DAGH 1TZGL 1TDQA 3DRTB 5SV4A 5JNYA 4HCRA 3BEWA 3JZ7A 5DHVA 3VD4A 4Q9QH 1D6EB 1SYVB 4MJIE 1OGAE 2NX5B 3MRDA 5J12C 3VE0B 1JI1A 4J3XA 4JFQA 3GJFH 4AEHH 1M71A 5L7XH 3BEVB 3SQBA 2DI8A 1JP5A 1BX2A 2PCPB 5F7KC 3DV4B 2EYSA 4K8RL 1J8HD 1DQQB 4CVUA 4NO0B 2LFGA 3DHMA 1BD2B 5CJOH 2EIDA 1DN0A 3TN0D 1MFAH 2IBGA 2Y5TA 4JFFB 4OV5B 5T3ZE 1XCTA 3DX6B 5IMLB 3B2VL 3QJHB 4PGBB 4HGMA 1EHXA 2D7OA 1RK0A 1UXSA 4P0DA 2C1OB 5IK3A 5I1AB 3N9GH 5I15H 5I6XB 3W2DH 1VPOH 1TITA 1R6VA 4NQEA 1U6AH 2R0LH 4LHUB 4PRPB 2NY1C 1DE4A 3FQTA 1OTUC 1OSZA 1MI5A 5GRUL 4CVWA 3Q48A 4XMKH 4LHUG 1G1YA 2HVKB 4YE4L 2FD6L 4RDQF 2G9HB 4EI6A 4ZAKB 4JM2C 4B0MM 3GM8A 1Z9LA 3MRIA 4XCCL 4Z7UA 1WCBA 2KBGA 4E9LA 1JRHL 5SWSE 3ULVL 1ADQL 5INDA 4KKNA 5L0QC 4F15B 4NKQB 1WWCA 2AP2A 2WMPA 5L8KB 1VGEL 1LGVA 3EFDL 3IDIA 3QWRA 5FO7B 1TETL 3MLSH 3VRJA 2I60L 1RZ8B 1I8LA 2JJVA 3MRMB 5ICYB 1G0DA 5KVEL 4PRDB 3D2UA 2CXKA 4JKMA 2QHRH 1VGKA 2PTTB 3U7WH 3KR3L 5KOVC 2D2OA 3U4BH 3OKKA 2D4FA 2XY2A 43CAA 4NT6B 4TNVF 5FOJA 4MCYB 4QGTA 3BPOC 2A38A 5I8EB 3FQWA 3QUXC 1P2CB 5F1SA 4XWGL 3SOBH 3WBDA 3LPGA 3CMGA 5C7XH 1MHHB 1RULL 4LNRB 1XGRA 1FIGH 4M61A 5MEND 2MHAB 2D31A 3HE7D 4LIQE 4PFEA 5EG6C 3AUVA 1KG0A 1U3HB 4NCDA 4GRMB 3EDFA 5T1KD 2RHEA 1R5IA 1IM9A 1EZVY 3DSFL 1ZS8A 4WGWB 1F4XH 1G7QB 2VC2L 4GMTL 3R1GL 1P7KA 4AEFA 3N85H 2BJMH 4HAFA 4PJHA 2VXVH 2D7PA 2QL1A 4FG6C 3OSKA 4JJ5B 3TA3C 3HPJA 4G6JL 2WLYA 2WAHA 5H37H 2X5PA 1WV7T 1YJDC 3WIHL 1CG9A 2ZUVA 4ZG1A 3HLAB 1KTKE 1MIMH 3RP1A 4LLWB 1T1YB 2AJSL 5C09E 3QRGH 3KWWB 3ZSTA 4ODWB 3FN0H 1NBQA 3RVWD 2Q8AH 4JRYE 5CINL 3GGWA 4BKLB 4J8RB 4Z7WA 3DGGA 4P9HC 5HI4D 5E9DB 3TT1H 1A0QH 1NLBL 5I8OL 3QCTL 3FQUB 2V17H 4WUUB 1D9KC 1BVKB 4XP6L 4PG2A 2A0LD 4G80A 1VFAA 3KYKL 4P48A 3WLWD 2ESVE 4LOUD 1CBVH 3CVHH 1EO5A 5ADPL 4X6BA 2X4RB 2DQEH 2J1KA 4F7MB 1LK2A 1JUFB 35C8H 4ZMAT 2JIXB 1AIFA 2G2RA 4DUWA 4LSRH 4AL8L 3BFOA 4PV8B 2WNGA 3S36L 5D1ZB 5D72H 1YY9C 3EDDA 1FGNH 3GNML 1HHJB 3KYOA 5JXEA 4QRPB 3RWDB 4HS8H 4PYGA 5KG9A 2O61A 1G7IA 2HFEA 1MI5D 4HJ0D 1HH9B 1UA6L 3PJSA 3BP6A 4J3VA 1A1MB 2G5BB 5IF0B 4UQ3B 5C0CE 5DEZA 4UOW1 3DRTA 5J1TC 2J6EL 3RA7H 5TFSH 1IM3A 4PGJA 5EZIL 5EUOE 3FHQA 1QRKA 3OX8B 4UT6L 2YEZA 4RFNB 3QWRD 4UILL 1J0HA 3HUJF 4PJCF 1VENA 1EXUA 1D6EA 5HHPA 4KGLA 2FDBP 2XTJD 1UKTA 3DNKA 3D2UD 4M48H 1PQZA 3L3GB 4M6OH 5IBTH 3LDBB 4DGVH 1SYVA 2WINB 2NX5A 3WLBB 2PYFB 4FP8H 5JPNB 2Q3ZA 4ZUSB 1I7ZB 2R39A 3VRIB 3MLXL 3VE0A 5DJCB 5F6IC 5KVGL 1FC2D 2EECA 5FXCH 5C2BL 5IHUL 3MCLH 3BEVA 3BZEB 3OAYH 4O9HL 2XZAL 3SGJA 2C4XA 4WV1B 4YXLL 3DV4A 4L3EB 2VSCA 3T2QA 2JF1A 4PJAF 1DQQA 2DQDL 4U6HB 4HUWB 1OTSD 5DVOA 1J87A 3GHBH 4NO0A 1BD2A 5B3JF 1HIML 3AS3A 5E2UL 1DBKL 2V2TB 2EE6A 4DZBB 4JFFA 4OV5A 4KVCL 5GJTH 4XHJC 3RNKB 4BZ2H 3DX6A 4MLSA 4F37F 1A4JB 1HNGA 1NDGB 1FFQA 2WWKT 3JTSB 3QJHA 5I1CH 4PGBA 5FYJD 4MAUH 2R4SH 4HKBA 3CFBB 4IM8A 3EO9H 4XXCA 1WBYB 2C1OA 3IFNH 4MQSB 3UC0H 2GHWB 1X5HA 2ED8A 3IDNA 4JFZL 3U7YH 4HHAA 2AXFB 4PRPA 3A6CH 4LLDB 1YC7A 3DPBA 4FTVA 4X6DB 2HVKA 4Q6IB 4ZAKA 4PJGE 3V7AG 3BH8B 2YRZA 2ICEA 1AKJD 1C5BH 3FFCB 3LKQB 5IVZB 3GMOB 4MNQB 1EJOL 1NAKL 3JUYA 3BIKA 3SKUD 1KXTB 3MXVH 3OKEB 1SY6H 2AEWA 1DANT 4D9QD 4HFUH 1RVFL 5FO7A 2E9BA 4LSVH 3RNQA 2EKSB 1RZ8A 1X7QB 4BELD 1FLRL 1K2DA 5ICYA 5H2BB 1UCBH 4AK1A 4PRDA 4ORZC 2VDQH 4FS0A 2BVUA 4PJ7B 2PTTA 3BD3A 3GSWB 4LARL 3CFIC 4K3DL 4HUNB 4WU5B 4MDJB 4Y2OA 3AREB 4NT6A 4OCXH 3TM6A 5BMFL 3MXWL 3TESA 1A7OH 3CC5B 4MCYA 4MWFB 4OLVL 4P2OB 1G9MC 3N1QC 3G5VA 3LRSB 5F7MC 3BRFA 5TQ0L 3IRZA 2QADD 4XXDB 3ZYZA 5JXED 1MHHA 1A14L 5DD0L 5FYLD 5I75B 2MHAA 3T77B 2IBZY 2NY5C 4N9OB 1U3HA 2ADFL 5E8NB 4Y4HC 3QDGE 5I16A 3JBG7 2BSED 2DTMH 3WIIH 5GPRA 4WWKD 1S7RA 2CDGB 3PHOA 2DQHH 2PYEB 2HTKC 3ARDB 5GGRB 4NZRL 1Q0YL 3BP5A 3S88H 2IWGA 1NCBL 1OAXL 3SJVD 4OGYH 1U42A 5KW9H 1CICA 2NX5D 4Q9RH 3QDMB 1T1YA 4XHQA 5ESQA 5JXAL 4CBPA 5JOPD 3LKNB 3DUUB 4OF7A 4LPCA 5IQ9B 4ZS7L 5JMRA 3WO4C 5T3XE 4BKLA 1YYMH 4ODVL 4NHUB 1PD6A 3FQUA 1MCCA 4WUUA 3GBML 4QRRA 4NO0D 1BVKA 1BD2D 4CAGA 3L3KB 4LMQE 2UZIH 1BFSA 4HG4J 1WWBX 5D4QA 1Q1JL 3F8UB 4KJWD 3KPSA 4Y5VB 2X4RA 3WIFB 5LBSH 1JUFA 2GTZA 4ZUWB 1TTGA 3UCRA 3FAXA 1S7UB 4NUGL 3GMNB 4LPVA 5D7JB 2CMRH 4B50A 3PF2A 4M7KL 4PV8A 2ZUTA 3VGEA 1F45A 1R3IL 2EDFA 3OJVC 2DTSA 3SN6N 4FXGB 4LP4A 3TWCL 1RIVL 1HHJA 3UPCA 3HZYB 4JFDB 3PUCA 4KVNL 1RAMA 4QRPA 4XBEL 4PRPD 2ZG3A 3P9WB 2P5WE 4FTVD 3O4LB 2R2BA 1M6OB 1UXWB 5D6DA 4ZAKD 1A1MA 2G5BA 5IF0A 5GXBB 2DL2A 3LCYA 4TNWF 2IMMA 3RGVB 4DFIA 4IRSC 1F00I 2L7JA 5FHBL 3KPRD 1LHZA 4EOWL 3V8OA 4F9LC 2YD8A 3LQAL 4CVXB 3OX8A 2QSCL 1I3UA 3RJQB 4GXVL 1TCMA 2VLKE 3DIFA 3L5WB 2VDOH 1FFRA 3L3GA 4KRMB 2WINA 2DKUA 3NCEB 2PYFA 1ND0B 5JPNA 4ZUSA 4XH2B 5HHMD 1IAKB 4ZOBA 4J3TA 1CDBA 1VADB 5DHXB 2NMSA 4LRIA 3BZEA 5C8JB 4YFLF 5CZXD 5KTEL 1UZ6F 1NL0H 4WV1A 4L3EA 3PV6A 5JHDE 4KZDH 2EXWD 4HUWA 4NZTL 4FQ1L 3PHQB 3DVGB 1F11B 4XBGB 2IPUG 3ULUD 1U3HD 5GRUH 1ZVHA 1NANH 4IMLB 2FD6H 1L6XA 1P4IL 4HT1L 2MKLC 3C6LB 5A40E 1QKZH 4XCCH 2Q76B 3KLAB 1JRHH 3OJ2C 4YPJA 4GOSA 3VW3L 3REVB 1ADQH 1EHLH 1FE8L 1DUZB 3KYAA 2L7UA 5FYKL 3SDXB 1FL5B 5DJ2B 4L3CA 3RU8L 1WBYA 3EFDH 3ZHDA 3MFFB 4G8GE 1QSFE 2I60H 1CICD 1RFDH 4ONFL 5C86A 3NA9L 4JFXB 5KVEH 2AXFA 3IDMB 4UBDD 5FGBC 5CBEB 3FB8A 3NMEA 2R23B 1KJ3L 3KR3H 2NY4C 2E8ZA 1FL6B 4Q6IA 4X6DA 4WTZG 3VWKC 3BH8A 4MJ5A 5IB5B 3LKQA 3FFCA 2AK1L 4CN1A 5IVZA 1VDGA 4OZ4B 4MNQA 2W0KA 2Y25A 1UJ3A 3OKEA 4WUUD 3FTGB 1KCKA 4QRRD 5DQDL 5TDPB 1X5GA 3C9NB 1VSCA 2NY7L 4CMHB 5C6TL 2EKSA 1X7QA 4JRXB 2YD1A 1CT8B 3PWNB 3DECA 1GGBH 3KPSD 4KI5C 2K7PA 4ZO6A 2W60A 4MXQC 1NUFA 4DN4L 1BLNB 1BHGA 1J88A 4PJ7A 4D94A 4QXGL 2HH0L 5AG9A 3U0TA 3GSWA 1CS6A 1D5ZB 4TQEL 4XWOC 3TO4C 1FVEA 2XXMB 4ZFOB 4WU5A 2DAVA 4MDJA 2UWEF 3DSFH 3AREA 3O11B 2VC2H 1QFOA 3CC5A 5JR1L 4MWFA 3MV01 3R1GH 1ZMYA 4GMTH 4M8VA 4P2OA 1SJHA 3LRSA 4RQQB 2Z91B 4GRWE 4JO1L 5IW6B 4WIQA 2HT2D 4QRPD 1UM6H 4J3SA 3WIHH 2R29L 3H0TB 2JJWA 3MV9B 5LKNA 2AJSH 3BW9B 3BKYH 5E8NA 1JZ4A 3T0EC 1HH6A 2PW1A 4NN6C 4K9EH 4TUJB 3RUGB 1ZHLB 5CSGA 5F44A 1KFAL 1QOKA 5D70L 4U7MA 3ZTNL 2CO7B 2GIYA 5HGHB 4HIXH 1NLBH 4BYHA 5I8OH 2PYEA 5FUZL 5GGRA 4E41E 1KUMA 1HYSD 4Z7VE 5HHOB 5LGHL 1R3JB 4XP6H 4Z95H 4F7CB 3KYKH 2DB8A 4KTDL 1MHCA 1CLYL 3JV4B 4XTRC 1QFWH 4E42B 1WCQA 3IYLW 1SBSL 5IFAL 1FVDB 2CIKB 3FO1B 5DZLA 5F9WC 3LKNA 3DUUA 2WUBH 5EORH 5IQ9A 1MHPH 4PR5B 1IC5L 1TIUA 3CK0L 4X8JB 3V95A 4AL8H 4C4KT 2WQ8A 4LCIH 3EYFB 2X4SA 1YNKL 2I25N 4NHUA 4L3ED 5CEZD 5EOTA 3TEUA 3WXWL 4LIQL 4U1IB 5M94B 3GNMH 5HI3C 4PJ8B 1DQLL 1CFTB 5SWZE 3VFTA 3QIWC 1F4YL 1EA9C 2ZKHL 1KJ2H 4YR6A 3A0OA 3WIFA 4YDJB 3O3EA 4ZUWA 1WZLA 2FHBA 2DQJL 3PABB 3WS3B 3MYJB 1N4XH 2DLEA 5D7JA 2R0KL 1KIRB 5HY9B 1P7QB 2DYPD 4C56B 5EZIH 2J4WL 3ECBB 4HK3J 3LZFL 3QA3B 4NFDA 3TBYB 3IDJA 1X3DA 4FXGA 3T2PA 3BGMB 5T1DL 5EIVA 4MXWH 3HZYA 4JFDA 2VE6B 2ARJB 3DLQR 4PJXE 5ANME 5C0DA 1KULA 1EGJL 1KBGL 5IKCB 5D7LB 1M6OA 1UXWA 3Q6FB 3K2MC 3FFCD 2ZNWA 3RGVA 4DJMA 5IHUH 2UZXB 2ENYA 2ZUQC 5ENWB 3GJEB 1BMGA 1LILA 1YEEL 1IAIL 4CVXA 3QUZB 3W5MA 1NGWB 3ILQC 1P7HL 4UZGA 1AGBB 3GKWH 1ZGLA 5CP7B 5AYUL 5HDBF 1SHMA 1HIMH 3IDYB 5E2UH 3GSNA 4UT7L 1G0XA 3NCCB 4H0IA 2AJZA 1NGXA 4OUUB 3O81A 1ND0A 4BK5A 5GRZA 4XH2A 3WDJA 1MCSA 4NM4H 3ARED 2XN9E 1VADA 4PRAB 4P2OD 5FECB 4H88L 1PKQB 3ARUA 3BHBB 1CDIA 2EYTB 1HSAB 3KPTA 8FABB 4RMTA 1W72L 4NCC1 2B4CC 4OFKA 4XMLH 4PJDE 3B8SA 4JR9L 5J13B 4MS8D 2ZG1A 3IS0X 4JFZH 1WF5A 1IC4L 3PHQA 4PJEE 1F11A 1U92B 4XBGA 3O45A 4DQOH 1MWAB 3UPRB 1FSKB 4IMLA 1A7BA 3C6LA 3RX7A 5LXGL 2Q76A 3KLAA 3E3QE 3CFCL 3REVA 1NAKH 2EE2A 1DUZA 2HMIC 2PYED 1XF5B 5E8PB 1IGIL 4H1LB 4ZPTA 5BV7B 4Y4FB 3S7GA 3SDXA 3FHAA 4QKXB 5DJ2A 3L3HB 5EU4B 1RVFH 3MFFA 5CIPH 1PG7X 4H1LG 1EUUA 4OQTA 4J1UB 2P8LB 4ZD3H 4WTZA 1E4WH 3B3IA 2VKWA 3MNVB 4Y1AB 2R23A 4TVPD 5K9OB 1FL6A 3EJYD 1NFDB 3W11C 4F3FA 4LARH 1J8HE 5DMJB 5IB5A 1QQDA 3MXWH 4OZ4A 5I2IB 1N6QL 1T83C 4NO3B 2VKXA 2VDKL 2CRZA 4W70A 2Z93B 4RMQA 3C5JA 3BD5A 4L29B 1F3JB 2C4FU 3V5KA 3FTGA 5DVKA 5TDPA 1TXKA 1GC1H 3C9NA 5TQ0H 4MAYC 5ACZB 4JRXA 1B2WL 2UYLB 1A14H 4OZIF 3DX8B 3RZWA 3PWNA 3UYOD 5FGCB 5GGTL 1MAJA 4U49A 4J2XA 4EZMA 5HDQH 3OXRB 5TF1L 1BLNA 1TPXC 2YRPA 1FAIH 5CJXA 1BZQK 4BK4A 3QO0B 3SHSA 2MTPA 2ADFH 3E1F1 1D5ZA 2A6IB 1CDCA 1OD9A 3VXUE 4G7VH 4YJZL 5D7JD 3BGAA 3RIFF 1AHWB 1F90L 3MODH 3O11A 4U1MB 4M00A 4UOJA 3P77A 3RVVC 4RQQA 2Z91A 1KB5L 3WKNA 4NZRH 4ZYKB 1Q0YH 4RWHA 1NCBH 1QFHA 1OAXH 3J7HA 4OLEA 3WD5L 1RI8A 3EKCA 3H0TA 3CXHJ 3GSQA 4KK6D 2VDLL 1FFOB 5KSUB 3O6MH 4P57A 5AZ2H 3IFPB 4OLWL 1QYGH 3KJ6L 3BW9A 4GS7C 2J3SA 3RGVD 1JCKA 1RPQA 2APWA 4TUJA 1GGCL 1IFHL 4NKMB 4ZS7H 5GGQL 3BRGC 2HKHL 4JRWA 1KLFA 4Y8DC 2X40A 4BFEA 3ET9F 4BZYA 3DXAD 5HGHA 1XH3B 1KELH 4K3JL 3IKCB 3GBMH 1R3JA 3B4NA 1SQ2N 4F7CA 1J1PL 3JV4A 4BA8A 4PB9L 4OKVB 4E42A 1DBAL 3PWUB 2BERA 3D6GA 2JLLA 3UTZB 1CGYA 1UGNA 4G7YL 3H2WA 4HWBL 4V2CB 1QBML 1FVDA 2CIKA 3FO1A 1EH9A 4X7CC 1GGTA 1MREL 4NUGH 3RAJL 1Q9KA 4PJFB 3GMLA 4PR5A 1KJMB 1RZKC 4KUCD 1MH5A 3T09A 4CADB 5MENE 4M7KH 3RKDC 3WHXB 1R3IH 5C0AE 5H8DA 3JVGA 5DUBB 4U1IA 1QSEB 4EN3C 3AMLA 2WANA 4NBZB 4PJ8A 4KVNH 5EA0H 1CFTA 2D9CA 3P0GB 5JO5B 4POUB 4RFOL 4U0QB 4AQOA 1K3IA 2VWEE 3GMMB 1ODAA 3MOQA 1IZJA 3C6LD 3T0VA 1OOAA 4LLYA 2H2PD 5F7WC 3PABA 3WS3A 3MYJA 4Z78B 2V5TA 4S2SB 1UACL 5HY9A 1BWMA 1P7QA 4C56A 4D9RD 3U9UB 5C9JB 3QSKB 3LQAH 2YN5A 5B8CB 3ECBA 1P4LB 4CGTA 2QSCH 5GGRY 3QA3A 3TBYA 4NWUL 4GXVH 3HC0B 3TJHC 2VE6A 2ARJA 1XGUB 2GSIB 2X9XA 4KH2A 5KSBF 5CILH 3E8UL 3X3GL 2DIBA 1IBGL 2HJFB 1NBZB 1B90A 2R2HB 2DQIH 5T3XL 1IGML 4X7DC 5D7LA 3P9MB 3GI9L 4PD4J 4OCRL 2DQTL 1LO2L 4HIIB 3QT2A 3Q6FA 2C3WA 3V8CA 4QRQA 2M1KA 4Y89A 4TVSa 5D9SB 3C09C 1XMWA 3GJEA 5KTEH 3QUZA 1NGWA 3IDGB 1LVEA 1I9RL 4BSJA 5HD8C 1LP9A 1ZTXL 3MV8B 4OLXL 4JRXD 1U93B 2FB4L 4NZTH 5CP7A 4WHCA 3HB3C 4IIQC 5GS1B 5IESL 5ESVB 1U58B 4FQ1H 3H8NA 2QEJA 1O0VA 1P6AB 1PW3A 4PRBB 4XRCB 3TH4T 5L2JB 5ITFB 3UTQB 1X5YA 2AI0L 2OL3L 1P4IH 2HG5B 4NO2B 2AV7B 4PRAA 3TT3L 1NGPH 3VW3H 4LVNB 2BX5A 3BHBA 1HSAA 2GTWA 1RZGB 4HLJA 8FABA 5FYKH 1FORL 4MXVF 4JFEE 4WEUD 1BBJB 1Y18B 4Z7UE 1K85A 4A6YB 1YEFH 3NA9H 2WP3O 3E2HB 4LMQI 3UMTA 4U1NB 1MSPA 2AKRA 4FFWC 2GY5A 1KJ3H 3UPRA 5D5MF 3OB8A 3MNZB 3K0WA 1JZ2A 2AK1H 3FO0H 1CGWA 3TYFB 3QG7L 3MA9H 3WNLA 1XF5A 5E8PA 4H1LA 4Y4FA 3TCLB 4DZ8A 5I1HL 5DQDH 3L3HA 1OGTB 1LO0L 1S7SB 3M8OL 2EDOA 2NY7H 4U33A 4UDUA 4XI5D 2NR6C 5C07B 5C6TH 3MREB 1LO5B 4GO6B 3SGEH 3MNVA 2PO6B 4WVRA 4ONOA 4QXGH 3N06B 1NFDA 3GSUA 4FNLL 1XGQB 2X41A 5IB3B 5I2IA 5CCKL 5JR1H 1MCJA 4NO3A 1QHPA 4D9LL 3FQXB 5GZOC 1RUML 2Z93A 2GT9B 4JO1H 4L29A 1F3JA 5D2NE 4M4RA 4M6NH 4F33A 1VCAA 5D71L 4TSCL 3G5YA 3I84A 4X8XA 5TE6H 3DX8A 5I76B 3QUYD 2R29H 2ICWA 3OXRA 4KXZH 4NM8L 4OGXL 2FEDD 3QO0A 4PJHE 3MOAL 2CRYA 3PL6B 2A6IA 5TDOA 4V1DB 3KDMB 1AHWA 1MJ7H 2CLRB 4U1MA 4Z7NF 1P7QD 4C56D 1KFAH 3KPQB 4HPYL 1JNJA 4JM2F 3ZTNH 3GKZA 2KQMA 4ACPA 2DL9A 4ZYKA 4YPGB 5LGHH 4P2YA 3ROOA 3QUKB 4Z7WE 4KRNA 4MSWB 1FFOA 4DEPC 5KSUA 4WWID 1SBSH 1SEQL 4HAGA 5IFAH 3J8F7 3D39E 3FT4A 4GW1B 4J4PA 1G7HB 4TSAL 2EH7H 4NKMA 2E9JA 3WE6A 1IC5H 1OL0A 3CK0H 3WMSA 2X10A 3ZYIA 1KACB 4U1HA 2HFFB 2UV3A 3DMMC 3EHBC 4KK9C 3IKCA 3C8KB 4YDKL 3CNKA 1RJYB 3V0WL 2XI9A 4HH9A 4MA1B 1QVOA 1DQLH 1E6OL 1MF2H 4WCYL 1CGSL 1E27B 2ZKHH 2NXYB 3PWUA 4KQ4L 2V5MA 2JB6B 4X5LA 4ALAL 4F8TA 1AP2B 4Z7QE 2DQJH 1MEXL 4FQQB 1CIDA 2OP4H 3BGFC 4PJFA 4WI6A 1KJMA 2R0KH 4CADA 5JZ7C 3FL7A 4YUEH 5D93B 5FYLE 2DKSA 2FH6A 2W9EL 3WHXA 4HUVB 2J4WH 5JQ6L 4HX1B 1HDMA 3VD3A 3RY6A 2WBJA 1QRNB 2J8UF 3LZFH 4FQXB 5DUBA 5T1DH 2F8VA 4TUKL 1NGYB 4LCCB 4OZGF 4K7PY 4YZFF 5JO5A 4L8SC 3RWEB 3HC4L 4PJBF 3GMMA 5DSCA 5L0QB 1Z0NA 1EZVX 4X4YB 1X4XA 4P5TB 4BUHA 4YFEA 1BQHB 2JCCE 4LEOB 5IJVA 3U6RB 3E6HB 3VCLB 3SJVE 4Z78A 4S2SA 3ARPA 2GKIA 3HG1A 3U9UA 1YEEH 5B8CA 1P4LA 3VXPB 2NTFA 1GPOH 3L9RA 4OZFH 5JOPE 2OZ4H 4PTUB 1CU4L 3HC0A 4HJGA 2GSIA 1XGUA 4UT7H 4OIAA 2HJFA 4YHPA 1QFUL 1NBZA 1AXIB 3P9MA 4TTDD 4HIIA 3T4YA 5D2LB 5KAQG 3MRQA 5L6YL 1JZ7A 4H88H 1OAZH 4I18C 3WFZA 4IJ3B 3IDGA 2H1PH 1M7DB 2Z8SA 1B88A 4XNMA 3MV8A 4JR9H 1YPZF 1U93A 3DJ9A 2F54B 5GS1A 3CFDB 4KRPB 5ESVA 1U58A 1TZHB 3V6ZA 1LDPH 4X0KB 1IC4H 3EYQD 4XRCA 1NUDA 3TIDA 5L2JA 2AABL 4WW1B 3TN0C 4NGHL 3NCJH 5GSRB 2EDRA 2HG5A 4NO2A 2AV7A 5IB2B 4JO3L 3CFCH 5HGDB 1IMHC 4PRPE 2MQ0A 3NPZB 3VXQB 5F9OL 5HGAB 4FTVE 1RZGA 3WEXB 1P4BH 5E00B 5B39A 2UY6A 2YSSB 3S35X 4A6YA 4JG0L 1WBZB 4UQ2B 3GJFK 5CJQL 5EIQA 3QHTC 3KPRE 5EZLA 1X5LA 2HA1A 1BVZA 3MGOB 1CF8H 4WENB 3P4LA 2DMKA 4J4PD 1JF6A 3RWCB 3STZB 4O4YH 3RDTB 2CDFB 3EYVA 2UUDH 3ARFB 4RZCB 4P3DB 2VZ3A 5J0BA 1E4KC 4LCWD 2VDKH 1UM4H 3TCLA 1RZIB 2W38A 4QO1A 5HHME 3HI6L 3LEVL 1OGTA 1R3KB 1S7SA 2IPTH 4ISVB 4L9LC 4W4OA 1JBJA 1B2WH 3MREA 4MHHI 5E6YA 5GGTH 3T1FB 3E6FB 1KT2A 2YWYA 4GBXA 2FBOJ 2DQCL 4XC1L 2PO6A 1CTNA 1MNUL 3K74B 4BQBA 1FYHB 1OP5H 3ZE2F 1XGQA 5IB3A 1CD1A 3U36B 3UJIH 4TPRL 2BVEA 5D96B 2GT9A 2WBJD 3ULUE 2JJTA 4XAKD 3ZDXF 1CLOH 2JB5L 2A6KB 4PB0H 1A3QA 5I76A 1GHFL 3OL2A 3AS0A 1ZXQA 4OLWH 1DR9A 3KJ6H 5JMOC 3PL6A 3HE7C 3RTQC 1GGCH 1IFHH 1NUGA 3OR6B 3KDMA 2CLRA 2HKHH 3O4OC 4YEEA 2AQ3A 3HG1D 1YJDL 5FKPB 1G7LB 4LASL 3KPQA 5J11B 3RX8A 2YD5A 1LD9A 4GFTB 4K3JH 4ODTL 2FO1A 4EJ1C 2YZ1A 5E7BA 1V3MA 2A1WL 5CBAB 5E5RB 1I75A 3QUKA 4RMWA 3BPLB 4MSWA 4PB9H 4PY8I 4LK4A 5FHAL 3VRLE 3W39A 3O2WL 1DBAH 2VUYA 1TZIA 4P9HL 4G7YH 4HWBH 1QBMH 1AGDB 4FQIL 4AY0A 4QRRE 4GW1A 5HYEA 1F97A 1MREH 3HZVA 1G7HA 3RAJH 3SQOL 3KPSE 2X05A 1TLKA 3RVWC 4R96B 2X4TB 4AJ0A 3MV8D 3D3VE 1MFBL 2R9HC 5I9QB 3I2CH 1AXSB 1YN6B 3AFLA 2YD6A 4G9DB 5IBUB 3ZKSD 4HWEL 2ZNXA 4RFOH 5LWYH 2A0LC 4XPBL 5IBUG 1T0NB 2JB6A 2QQNH 3WLWC 1NSNH 1II4E 2H9GB 2NW2A 3DUSB 4LOUC 4JPWH 4K8RD 2W0FB 1RMFL 1ORQA 1K8IB 3IVKB 4FQQA 4ELMB 4U1GC 4OZHF 3P3YA 1KN4L 4L4TA 1Z3GL 5J6HB 1MCWW 3LIZL 2I26N 5GHWH 4HUVA 4HX1A 1QRNA 4FQXA 3ALPA 4LCYB 1H5BB 2B1HL 4LCCA 3STLA 1VFOA 2IQ9L 3RWEA 3E8UH 2XXCB 3X3GH 1KGCD 3ZT6A 3O6FA 2LVCA 1IGMH 3GI9H 4OCRH 2DQTH 1NC2B 4X9IA 4HJ0C 1S8DA 3P30H 3G08B 1ZANL 4LEOA 4XNQB 3U6RA 1MUJA 1SBBA 3A6BL 3CU1A 1E0OB 3QQNA 3VXPA 4HF5L 1I9RH 2VQUA 1ZTXH 2ZPKL 4OLXH 2GJZA 2FB4H 5DJ6A 3L3OB 5IESH 4GBXD 1MCEA 1I8LC 4C83B 3ULVD 2J6EA 2WWKO 2C3HA 2PO6D 3UPAA 3CJJA 4QTHB 2XTJC 1EAJA 2JTDA 4L3EE 5CEZE 2AI0H 2OL3H 3WXVL 4U1SB 3LH2L 4XT1C 3MLUL 4GMSL 4U6YA 1BBDH 1L6ZA 3AVEA 3SDDB 4KK5D 1M7DA 1BM3L 4KKAD 2VNCA 4PJ5B 1ZVYA 3CFDA 2BSSB 3NIFF 4N5EC 1TZHA 1MCPH 4X0KA 1OTSC 3DV6B 1CXKA 4WW1A 3PL6D 4JPVL 2YPLB 5GSRA 4UUJA 5I1KH 3NFPB 1WAAF 5HYIA 5IB2A 5HGDA 4WHTA 4MQXD 3VXQA 3QG7H 5D1QD 3MLPA 5HGAA 2H3NB 1LEGB 3T3MF 3O8XB 5E00A 3MLWL 2HJLB 5I73C 2Y5EA 4UNTA 1LO0H 3M8OH 4LF3B 4RAHA 2LE9A 1AC6A 2DMCA 5DJXB 1WBZA 4UQ2A 3QFJE 3K8KA 3PWPA 1NKOA 3RPIA 1HHIB 1H3GA 4U05A 3MGOA 4L1DA 3OAYK 3IJHB 2K3TA 3STZA 1I7RA 1FNLA 2XZCH 1OGAB 4MJIB 3RDTA 2CDFA 3MUY1 3ARFA 3WFEL 4K94L 4P3DA 1VACB 3GMRB 3CX5J 1A6TB 1IGCL 1S7TB 5DJZB 4D9LH 2P24B 1UWGH 4HWZA 1RUMH 4Z76B 3C5ZB 4PREB 3BH9A 3OPZH 1P9MA 1RZIA 4LSSH 1R3KA 4ISVA 4KZEL 5D71H 2XPGB 4TSCH 4TN9A 3RRQA 4PG2C 3T1FA 2W1NA 1NEUA 3E6FA 3V0VB 4WI7A 3RVXD 2AJVL 4OSUL 3MOAH 2BNUB 2Y6SD 3Q6GH 4OT1L 2YBRB 4UV7L 2YUXA 3RY4A 1MCOH 5CIPA 4L4TD 4HJJL 3U36A 4HPYH 5SX4I 4MNGE 4R97C 5A16B 3SCMB 1QRND 2VLJE 4X6CE 1ORSB 3V9FA 3DVNB 1RUKL 1KEGL 5EU3B 2A6KA 1ED3B 3RI5F 1RZ7L 3O6FD 1DQJA 5JXEC 1MJ8H 2QADC 1FO0B 1NDMB 5T33L 3G6JE 1DEEB 1SEQH 4QRUB 2IAMA 2BRQA 3CSPA 3DGCR 1W8NA 4TSAH 1S9WA 1HCFX 4Y0GA 3UDWA 2OJZH 5FKPA 3QNYB 3JWOC 3IKKA 2E6JA 2MPAH 3VFSA 5SWSB 1CFVL 1QLFB 4YDKH 4TVPE 2VO5A 2UVFA 5GGVY 5CBAA 2AEQH 3ZTJG 4AM0A 1E6OH 1WEJH 4WCYH 5EO1A 1CGSH 1Z5LB 3MV11 1C12B 2F5BL 5J1AB 3FT2B 4J6RL 4S1DD 3NCYS 4XPTL 3VG0H 4ALAH 1AGDA 4KI5F 1C5DB 1I9JL 5CP3A 3GSVB 2DD8L 5LCVL 4AENA 1FGVH 1YA5A 2GW5A 4M43L 2X4TA 3SGJC 5JUEL 3S4SB 3L3DB 4I2XB 1UVQB 5EC2B 3IF1B 3MUGB 3BP4B 3P73B 4G9DA 5C6WH 5DJ0B 3S4SG 3AU1B 4HQQL 4P23A 2VZOA 5GRJL 1RURL 1T0NA 3JTTB 2FGWH 2H9GA 3NCBB 4KJWC 5E6IA 1MCFA 2BP3A 1A22B 3RWJA 1K3ZA 2IF7A 3IVKA 4ELMA 2X4OA 1ULVA 1CL7L 4JY4B 3OKMA 1WWWX 5J6HA 4DKDC 5HGBA 1YQVL 1D5XB 4HSQA 4LCYA 5C3LD 4XXCC 4Z7OF 1H5BA 2VISA 4EBQH 5I6XC 3T1WA 1MQKL 3PWPD 5KOMC 2X4NA 2Z31B 5ICZB 5TGBA 1LMKA 3DXAE 5CGYD 1H8SA 2HKFL 3RDTD 2DLFH 3G08A 4IDJH 3ARFD 4XNQA 4ZAKC 5F1IB 5C09B 1KIPA 3V0AC 4MJ2A 3FKUS 4UB0L 2R0ZL 4K2UL 1PLGL 4JRYB 3TFKC 5H94B 3VFVB 4LGSB 5B4MD 3H6JA 3VFNB 3L3OA 4NZDA 2HN7B 4RSVA 4C83A 4CMMB 1ACZA 2JELH 7FABL 2AJYL 4QTHA 1NLDL 3UTPD 1U8JB 2AABH 1NH6A 2BHUA 3L3IB 4UDTB 2CKBL 2ESVB 5D7IE 4U1SA 1PKOA 5DS8B 4XVUC 3L6FB 2VR5A 5CEXB 5F9OH 3SDDA 3JXAA 1N2RB 4GLRH 2Q20A 4MMZC 5CZXC 1KB9J 4OQ1A 5KS9F 2H32B 1GYAA 4D0CB 4PJ5A 2BSSA 2H6PA 4JG0H 2EXWC 1J8KA 5CJQH 5E0QA 3B9VA 3DV6A 5CLWA 3HMXA 2Y4SA 2IAMD 2ZUYA 5F7EL 4PBXA 1PGRB 2WBWB 5B38B 1U3HC 2BHZA 1FCGA 2FZ3B 1DJSA 4YWGH 2F8OA 5B38G 2F5AH 3NFNA 3ORJA 3QIUD 5F8RC 4FXKB 5C0CB 2OTPA 2H3NA 3O8XA 2BFVL 1BECA 2Q3AA 1RZJC 3C6SA 1Q9WB 3LEVH 4JHZA 3MPCA 4LF3A 3PQYB 5EUOB 5DJXA 1CICC 1J1XL 2PN5A 2X9WA 2MMXA 3WNNA 5IFHL 4XC1H 3HFML 1JF5A 1C7TA 1RD6A 3IJHA 4LVHB 4O00A 1MJJB 5FYJU 1OGAA 4BFIB 2N56A 3BZDA 2OTWB 4X7SL 4YHYB 1ZE3C 3PP4H 1VACA 3GMRA 4JG1L 5DHYB 4GG6F 1CR9L 2ATKB 5DJZA 4ZXBD 4TPRH 4Z0BL 1RJLB 1C1EL 3C5ZA 4PREA 4LSTH 1X6NA 1NJ9A 2JB5H 3T3PF 4OCLC 2BY2A 2XPGA 4P23D 5DGRA 3HA0A 4S1QH 3V0VA 4YH6A 1WK0A 4ENEC 2NY0B 2NY6B 5E6ID 4BSVB 4G6AC 2BNUA 4WFGD 4X7EC 3VI3E 2YBRA 2DOCA 3CCHB 3F12A 4U1KB 4I0PA 1T1XB 1YJDH 2MSPA 4M3KB 4LASH 4LKXB 4IOSD 3SCMA 1ORSA 1Q0XL 3DVNA 3K8LA 3TV3H 5GIRB 3UTTA 1ZA6B 1JPST 3FN3A 3MV7E 1U3YA 3ULSA 4R2GB 4M6MH 1MLBB 1DQML 3VGHA 1KN2L 5FHAH 1NDMA 4C4KO 2CRMA 3BDBA 3O2WH 2ZUQB 4P9HH 1FRGL 2KZ1B 1A4KB 3JSSA 4WUKH 5D6DC 4PLNC 4HS6B 3C2AL 4QEGA 2I07B 1JGDB 3EYOB 4K23L 4Y4KD 1NGQL 3SQOH 1FZJA 1SMOA 3QNYA 4ZDHB 1JWMB 4G6FB 4PJGB 2E5EA 3GIVB 3QI9D 3Q5OA 1LK3L 1DLHA 5SWSA 4XX1E 1KTRL 1QLFA 3SO3B 4D8PB 2ZCKL 4HKXB 3LD8B 1V3JA 1HYSC 1IARB 2O26U 2ZP0T 4HWEH 4FQPA 1I85A 1Z5LA 1P53A 4XPGL 2YS4A 4Z8FL 5J1AA 3FT2A 4YC2B 3LDBC 4NQXA 1O5DT 3MRRB 1F58L 1IZKA 1F3RB 4YFDB 4M02A 3B9DA 3GSVA 1MCKA 2OMBA 2VQ1B 4M1GL 1KN4H 4X7FC 5DVLA 2HT3C 2MCPL 1Z3GH 2VTFA 5GRWA 1ZWIB 4LRIC 1Z6JT 2VDPH 1JK8B 3D87B 3S4SA 4WV1C 3WS6A 1GSMA 4I2XA 1UVQA 3O9WB 2D7TL 3IF1A 3MUGA 3BP4A 3P73A 4HGWB 4JO2L 4TUOB 5DJ0A 3AU1A 5T5NG 2IQ9H 1T5XB 3O3UN 4P46B 1IGFL 3KPOB 2OJEB 3T8XB 5DA0B 1NUNB 2X1WL 3JTTA 4ZO9A 1RJZB 4R7DB 3PGFL 1ZANH 2E9WA 2V2XA 2B2XL 1IEAB 3A6BH 1ZHKB 4JY4A 1IVLA 3QDGB 3CZFB 1FZOB 4JHWH 1IC7L 3F62A 5C0EA 1KXVC 4NPYB 4JY6A 5I1LA 2LTQC 3SO5A 2AERT 2Z31A 4ONHA 3D48R 2VDRL 4GRLD 5FYKD 3MMEB 1JGVL 3CFEB 1LP9E 3WXVH 5BS0E 3UYRL 2Z8RA 4NYLB 4Q6IC 4NRXB 1XF2B 2YPVL 5C09A 3IFLL 5KANG 3PDOB 2E6PA 2APXA 3CSYB 3C5ZD 5IV2B 2ZJSL 1EGJA 4JRYA 4XNYH 5H94A 1QPPA 2AGJL 4KKBD 4L8BA 1UJ3C 2X42A 3VFVA 5TQ2L 3CXDL 1QSZA 3VFNA 4OM1H 4IBLT 4X98A 3RL2B 3S37X 4NN7C 2HN7A 4IOFC 1UQSA 4YIQB 4CMMA 5FFLA 3WJJC 4J7RA 4EUPB 1U8JA 3L3IA 4JPVH 3PHSA 4UDTA 2ESVA 4NUJB 5T3ZD 2B4CL 4OD3H 4MVBC 4PRIE 5IG7B 4EUPG 3DX9B 4I0PD 5F8QC 3PWLA 3TBTA 4NP4L 5DMKB 2IJ0C 3L6FA 5CEXA 3AREC 4YDLB 4YO0B 1HE7A 3SCMD 4P2OC 5GQBA 2JKXA 1N2RA 3PGCB 4GS7B 2H32A 2YC1B 5E8EB 4AMKL 2EDKA 4F58L 3Q2CA 4JREB 3QP3A 3DOSA 4L4VA 5HGGS 2P5WB 1W72A 2UWEA 4R8WH 5F70A 4OF8A 3SE8H 4OB5L 3W81A 3WFEH 4TNVK 2FLRT 2ICES 4WJ5B 4KU1A 1H3VA 1IGCH 3MBXH 4Y16B 5SWSD 3BIAX 2FJFB 2NW3B 2BK8A 1JE6A 1Q9WA 1CD8A 3OBAA 3PQYA 5EUOA 1DL7H 5EU5B 1IRAY 5AYQA 3MA7A 3WCYA 1G9MH 2VXUH 1DBBL 2AJVH 4OSUH 5GS2D 2VLKB 4UV7H 5I1JL 4QTIL 4MD4A 2OTWA 3EJYC 4HJJH 5DLMH 1F2QA 3F6IA 2ATKA 2C3VA 4E0RB 1RJLA 5AUMA 2FBJL 2HVJB 3WFCH 1HKFA 2NY5H 1RUKH 1H8OA 1KEGH 4YDIL 5HPMA 1CDGA 3DROA 4OV6F 1XF4B 1RZ7H 4BH7B 5EN2B 1UJTA 1MAKA 3V7MA 5T33H 4JQIL 4KAQL 4G42B 4BSVA 4MJ6B 4I3SL 4OCYL 3U9PL 3ZDYF 3CCHA 4JZOB 5DUMH 5DD5L 3DBXB 4U1KA 2GFBA 4XP4L 1T1XA 2VH5H 1S5HB 5D7JC 3TNMB 4LKXA 4AEIL 1G7MB 1CFBA 2F19L 2PW2B 1CFVH 5GIRA 4G8EB 5ISZE 2FCBA 4LSUL 1ZA6A 3VD5A 1ERNA 4E5XB 1I1CA 1I7UB 2NZ9D 4G8GB 1QSFB 2YD7A 3C09B 2D0FA 4HDIA 4LCWE 3WKML 2YUVA 4XPTH 5DDHB 4DUVA 4J12A 1HSBB 1A4KA 5CUSL 3VFGH 3SKJL 1KB5A 2YR3A 1I9JH 4GJTB 4HS6A 4XNXH 2A83B 2I07A 5C09D 1JGDA 5IGXL 3EYOA 1TCRA 5L9DL 4N5UA 3RGVC 4ZTOL 4ZDHA 2C7UB 2DD8H 4PJGA 3GIVA 5LCVH 3VXME 4JRYD 4X80H 2NCMA 4Z7VF 5GS0L 4M43H 5CKAA 1S9VB 2IH3B 1X5JA 4D8PA 1JFQL 2BRRL 1FJ1A 2ITDB 3NZHH 3NABL 4HKXA 3BQUB 4LFHG 1NGZB 4HQQH 1ROWA 1RZKL 2XZZA 3VWJB 4BZ1L 4H26A 5E2VL 5F1KC 1U2HA 1A9BB 1UENA 5C9KA 2ESVD 4W6XB 1HXYB 3MRRA 4NC1E 5DRXA 3HTLX 1BFOB 3CH1A 4JB9H 2RCSL 1JGUL 5BO1L 1YQVH 2ENSA 1JNNL 1JK8A 3CD4A 4PJIF 5I1GL 1TQBB 3WN5A 4GRWB 3O9WA 3QDJA 4TUOA 2CJUH 1MQKH 1T5XA 3F6LA 4OBSA 3DHJA 4P46A 1FO0H 3HG1E 3IB4A 2OJEA 3T8XA 4L4VD 3F7RA 4GKZA 5DEFB 3P4OA 2AJ3B 5K9JL 1Y0LB 3ISWA 2BNRE 3C6LC 5T5FL 4U3CA 1IEAA 2H2PC 1ZHKA 4QWWD 3CZFA 4UB0H 4LAQL 1FZOA 3G6DL 4K2UH 5F93C 4J3WA 4NPYA 4JY5L 3PQYD 1XF1A 1U8KA 1OCWL 3QO1B 5FCSH 3ABZA 4E41B 5E6ZA 3RBSA 4G5ZL 4I77H 4Z7VB 15C8L 2AJYH 1KENL 1NLDH 3SE9H 3MMEA 1FNFA 1AE6L 4F37K 5JHLH 3KS0H 4TSBL 4YK4B 2COQA 1JGEB 4NYLA 5I1IL 5BRZD 2V6HA 4N8PA 4NRXA 4OFVA 1XF2A 4F7TB 1NCCL 4KROB 4Y5XB 5ICXB 3PDOA 2HP4A 3CSYA 5IV2A 2VDNH 4JEGB 3T2OA 2VL5B 2BY1A 4HPOH 2RBLA 3K4AA 4BQ8A 1A5FL 3VXTB 3RL2A 3ZKMD 4FQCL 4CMHC 5ACLA 3TYGL 3VDAA 3PGDB 1CD0A 4RX4A 3BVNB 4F2MB 3MQIA 4EUPA 1Y6KR 5CJXC 3ZT5A 1A7NL 1BIHA 5IG7A 3NFSL 1FV1B 5DMKA 5E8OB 1H3WM 4Y2DB 5IVOA 1UWEL 2BFVH 1H3PL 3K1DA 4DKFL 5HYJE 4K7PX 4K55A 2YC1A 4R2GD 5E8EA 3RHWF 4UI2A 2V5RA 2NNAB 4WW2B 1J1XH 5EC1B 5F9JA 3O3DB 4R90L 4PJXB 4YBQD 1CE1H 4MHHG 2VABB 3DI3B 3DMMB 5ANMB 3MR9B 1GGYA 3QWOB 3W0WA 3MYZA 3ZDZE 1OB1B 5IW1B 4JG1H 1T89A 1CR9H 2E7BA 1RHHB 4Y16A 4LGPB 4Z0BH 1TJHL 2X1PA 1C1EH 2FJFA 1DANU 4XCFL 5ELIA 4YBLB 4N0FB 2NLJB 2H2SD 5EU5A 5DUPL 4XI5C 5GGSB 1R5WB 1A7RL 5JW5A 2EDDA 5L7XL 4PY8J 2VLKA 1EHAA 3PP3H 3H3BC 1MIEH 2DJUA 3D25A 5HHVL 3UTSE 5EIIB 2FX8H 2XWJB 2GCYB 4UV4L 3GMQA 1FNAA 1JWSB 2DN7A 1C08B 5C0BA 4OLZH 5C0FB 1DEDA 2XN9B 4E0RA 1CXEA 4PGZA 2Q87A 3SPVA 3VFRB 2HVJA 1RHFA 1Q0XH 3O2DL 3TC9A 3IGAA 3O9WD 3QDJD 4RFEB 3JVGC 4PJ8C 2CK2A 1DQMH 1T2JA 4PJDB 1KN2H 4EEEA 5EN2A 4EVNB 1T3FB 4CU6A 2V7NB 2HRPL 4G42A 4LSDA 1FRGH 4P4RB 4MJ6A 4LSPL 1PBYA 4K3HA 4PJEB 5FDYA 4FQ2H 4JZOA 1BZ9B 3DBXA 1NGQH 3GSXA 3N9GL 4NZUL 5ETUB 5K59E 2XZQH 1S5HA 2OLDA 3I6LD 3BI9X 1CLZL 1LK3H 1G7MA 1NEZB 2KQNA 2OMNA 5H35B 2PW2A 2R0LL 2VAJA 4G8EA 2ZCKH 1NEZG 3QR2A 4XMKL 3HS0B 3P4NB 4E5XA 1RK1B 1I7UA 1MRCL 4LVOC 4G8GA 1BZ7B 1XIWB 3QULB 1B0RB 2CIIA 4BSWB 1OWWA 5DDHA 3SGKA 1HSBA 5DVMA 1FN4A 1F58H 3BMWA 4OGAC 4DKEL 2A83A 1SMAA 4TULL 4MNHB 4M1GH 1CLCA 2I9LB 1J8HB 1IAOB 2C7UA 2MCPH 3MRKA 3QXWA 1ZKAA 5T3XD 4I13B 3G04A 1S9VA 3QUZC 4UIMB 1GOGA 3QIBB 3M07A 4OF6A 1PJ9A 3VGDA 3BQUA 1NGZA 4ELKB 4RX4D 3DETD 2C5DC 4L4TE 2Y72A 1IGFH 3U4BL 3VWJA 1SEBA 4C58B 3HAEB 1HXYA 3MLRL 2HTLD 4R0LB 4TNWK 3PGFH 3PWVA 3QUML 3L3JB 1HWGB 3HAEG 4XPHH 1RU9L 2Q1EA 4NFCA 1QBBA 4JKKA 5C7XL 2N4IA 3VXUB 4AT6B 1IC7H 1FIGL 4XC3L 3EOBB 1UEYA 2BCKA 5C92A 1V3KA 4GAJL 4B5EA 5IHBA 2MQ3A 5F72S 1JN6B 5J13C 1L9MA 1OAYL 2W9DH 1JGVH 1YQ2A 4R26L 3U30B 3W0WD 1FSKC 4HV8B 4RMRA 2BJML 2VXVL 1XAUA 2WV3A 1S9YB 5I8CB 4MB5A 5DRNB 5JW3L 5JIIA 4Y16D 4JKPL 4GG8B 2ZJSH 5INCB 1ZA3B 1E4XI 2AGJH 5BV7C 4GKSB 4Y4FC 3UAJD 4ODXB 4XB7A 4XCNA 5DRZB 1EUTA 3QRGL 2P8PB 3FN0L 2VLKD 2YD9A 1NCAL 2I9TB 3ZE0E 2G75B 1FZKA 1JGEA 2B4CH 3TT1L 1G0YR 3EDJA 4TTDC 4NQCA 1CVRA 4F7TA 1YDPA 5C0BD 2HRLA 5IVXA 5ICXA 4F8QA 4PG9B 3WSQL 5KN5B 3QNXB 3BIBX 3OZ9L 3QJFB 2XG4A 1NMCC 4L8DB 2VL5A 3MRPB 2B0SL 4HULB 1CBVL 3CVHL 5EPMB 1A47A 4AMKH 3HE7B 3BWAB 5C0AB 35C8L 1EFQA 4F58H 4JQVA 4LL9A 1A1OB 2VL4A 3IXAB 5J89A 2ZCHH 5T1KB 1B4JH 3BVNA 4P5MB 2BNQA 4JDTL 4R7NA 1I9EA 3EYQC 1NAML 4QHNB 3HZMA 4OB5H 4U7KA 1FGNL 1FV1A 5F21B 1G9NC 1AHWC 4PGDA 3PWPE 1QLRB 4Y2DA 4Z7UF 3S35L 5I1EH 3NPSB 1Y6MR 3PV7A 4S1SH 4N0YH 5IJKA 1J12A 4G8GD 2BVTA 5L88H 4WW2A 1FIEA 4NHCH 5EC1A 1DBBH 1M71B 1RUPL 3O3DA 3RA7L 1CFSB 4PJXA 5TFSL 1KPVA 4YHKH 2VABA 3MR9A 3QWOA 2GAZB 2EYSB 4J4PC 1OB1A 5C71A 5IW1A 2QKIB 2CLZB 1RHHA 2QR0A 1T66D 1IL1B 2UY7A 5K93A 1A6AB 3O2VL 2PKDA 4M48L 2Y5TB 4M6OL 4YDIH 4Y7MA 2FIKB 3BQUD 1S7QB 4N0FA 1HZHL 3HMWL 1XCTB 2NLJA 1H3TA 3VFMA 3VWJD 3ZHKA 4KAQH 3MCLL 3LS4H 4X5WB 4I3SH 4OCYH 4NQSB 1GH7A 3U9PH 5EIIA 2F74A 2GCYA 3L5XL 2GEEA 1BPVA 5DD5H 1JZ5A 4XP4H 1T0PB 3GHBL 5C0FA 2XN9A 4AEIH 3VFRA 3GBNL 2VAAB 3JWDC 3FQTB 3RY6C 4RFEA 3LEXB 2WBJC 3EUUA 2B20A 4X4XB 1KJVB 1T22B 3WV0A 3ZZ1A 4JFEB 1HQRB 1OLZA 4PJDA 4Z7UB 1G6RB 2CLVB 2UUDK 1T3FA 5J6GB 2V7NA 5E56A 2BHYA 1G7JA 4Y19E 4ZOCA 1T4KA 4U6XB 4HCRL 4MAUL 4PJEA 3SKJH 5BXFB 5IGXH 5L9DH 1BZ9A 5JLZA 3IDIB 4OLUH 5FM5O 5ETUA 4ZTOH 3VRJB 1CXIA 5CHNA 2CUHA 2XT1B 1NEZA 5H35A 5B8CC 3D2UB 1RIHL 4GW4B 2BRRH 2R0WH 4U6VL 4EQ3A 3NABH 4Z7WF 1HHGB 3HS0A 3L5IA 1OP5K 1RK1A 2A2QT 2VLME 1RZKH 1BZ7A 1XIWA 4BZ1H 5DEGB 1C5BL 3QULA 3HUJE 5E2VH 4PJCE 1HEZB 4N1HB 5I18L 4NQCD 3MXVL 2P43B 1SY6L 2RCSH 4KROD 4MNHA 3WHE0 1JGUH 1IAOA 4ZO7A 5BO1H 1JNNH 1A8JH 5I1GH 2FEEL 4UIMA 4WFGE 4RWYH 3QIBA 3QYCA 3S97C 4OJFH 4M7LT 5E8DL 5D2NB 1D9KA 4ELKA 4U2YA 5GS1C 3LAFA 4OAWA 2BNQD 1ZLSH 1ZS8B 4PJAE 3DARA 1PEWA 4F57L 3SE4A 3HAEA 5B3JE 1P7KB 4R0LA 4PY7B 5K9JH 3I50L 4PJHB 2DIAA 4OF0A 4K8RC 1FNSH 2CH8A 3HPJB 4Y2DD 3VXUA 4LAQH 4LVNC 2ICWI 3G6DH 3VXRE 1RV6X 3EOBA 2GY7B 1VFUA 4JY5H 2R56H 1EPFA 3ARQA 1OCWH 3GEWB 2O5ZH 1MOEA 4MA7L 4PP1D 3E2HC 3HRZB 1KENH 3WIIL 1AKJB 1AE6H 1OTUD 3OV6A 4Z7WB 3DGGB 4TSBH 2CR3A 4HV8A 4HS3B 2OK0L 5I1IH 1TENA 2DQHL 3B2UC 1S9YA 5I8CA 3D39B 1NCCH 3S88L 2VOTA 2FX9L 3V2AR 4GG8A 4OGYL 5KW9L 4YHZL 3LPFA 5INCA 2PNDA 3HCVB 1LNUB 4Q9RL 4ODXA 5DRZA 4ZFZB 1A5FH 3ARBB 4W4OC 4FQCH 1TJIL 2X4QB 4OCSH 3T65B 1IJ9A 2P8PA 1WC7A 3KPNB 1AIFB 4DVRL 2G2RB 4GBXC 1IC1A 2I9TA 3ULVC 5EOCJ 2G75A 2CQVA 2PO6C 5IHZB 3IETA 4LLUB 2XYCA 1J0ZA 3IRPX 3F65A 5KN5A 2XN9D 3STBA 2UZIL 5AZEH 4P2RA 3CIQA 4DKFH 3MRPA 5EPMA 2JJTC 3CLFL 4GRWH 4KK5C 5IFJB 3BWAA 5LBSL 5C0AA 4KKAC 1DSFL 4NNYB 3UO1L 1A1OA 2ZUXA 1A3LL 3IXAA 5T1KA 4K71B 1E6JH 4KHTL 4P5MA 2CMRL 3BKCH 1OT1A 4R90H 1IGYA 1IM3B 3W9EB 1U95B 3DYMA 2IH1B 4WWKB 3GB7A 4QHNA 5FYJL 3QQ4B 3PL6C 5E1HB 2YEZB 2EO1A 1ITBB 1EXUB 5A43C 2JCCB 4GQ9L 1QLRA 5HHPB 1TJHH 2WM0A 4MQXC 3SJVB 1ES0A 5E4EB 5FYKE 1PQZB 4XCFH 3QG6B 3BDXA 4ORGB 2I24N 2R1WB 3V6OE 3OWEA 1XIWD 4KJPD 5DUPH 1A7RH 2FHFA 5DVNA 1JWUA 4WFFD 1CFSA 1JNLH 3V6FB 3O3BB 5JORB 5HHVH 2H26B 3IS1X 4RA3A 4UV4H 2GAZA 1O7SA 1UWXK 1JI2A 2QKIA 2CLZA 1IL1A 2X4UB 1A6AA 2M2DA 3QIBD 2VDOL 4ETYA 1F02I 3O2DH 4KQ3L 2FIKA 4Z9KB 1S7QA 5IW3A 1D9KD 4X9FA 1VEMA 4MA1C 1A6PA 2WSKA 4QHMB 3WJLA 2HRPH 4WI9A 3ZMRA 2NXYC 5BZWA 4X5WA 2QHLA 4LSPH 4NQSA 4HC1A 4Z5RA 4HKBB 1YEDB 1NL0L 2Y6SC 2XNAA 4KZDL 3VXUD 3BT2L 4NZUH 1T1WB 3MJ9H 3DRQB 3IDNB 1CLZH 5D93C 4I9WD 3RX5A 1OM3H 4HHAB 2QQQA 2VAAA 2R15A 4GAGL 4ZNCD 3LEXA 4WHDA 4FQXC 2A77L 4FTVB 4YAQB 5C1MB 4X4XA 1I3VA 1KJVA 1T22A 1FNGB 5IUSA 4JFEA 4Y8AA 3S36X 1HQRA 1MCNA 4LCCC 1KTLB 1MRCH 1QKZL 1G6RA 2CLVA 5HHQB 5J6GA 2ICEB 3FRUA 3JWOL 1YUHA 5L2KD 4HKZA 5EZJB 1I4FA 2VITB 1EHLL 2ZUUA 4U6XA 3BIKB 3KPLB 3KPRB 1W8OA 4HWNA 4DKEH 5BXFA 4P5TC 4OZHA 1TQCB 4TULH 3UP1A 4OGZA 3QB7C 4Y5YA 3RNQB 1SVCP 1RFDL 1WJ3A 1K2DB 4WFHE 1CYGA 5EBLB 3TBWB 1Z2KA 4GW4A 1NPUA 1ZSDB 3OKLB 1HHGA 5GGSY 5HHMB 3S34H 5DEGA 1FFNA 4X9HA 1HEZA 1PFCA 3MLRH 4CN4A 3S96B 3G5VB 2ZSWB 4I2XE 4S1DC 3QUMH 1RU9H 2P7TA 1JRHI 4P2RD 3OAUL 4GKOA 1GGBL 4XC3H 5D8JL 5C08A 4NRZB 4GAJH 4IJ3C 2J8OA 1MAMH 4NN5C 3UTTD 4KJYB 5C0GA 5GRXG 2EZ0D 5C0AD 1Z9MA 2VERN 5D2NA 2GUOA 4PLOB 1UZ6E 4KRPC 1NMAL 1OAYH 5I16B 2R2EB 2CUMA 1UM5L 3EFFA 3MRGA 1FYTD 1BJ1H 4R26H 4XHJD 1S7RB 1EERB 3BD4A 5FF6B 1N8ZA 4YGAB 4PY7A 3PHOB 4H0HB 5HBBA 4CNIB 3P0VH 3IXTA 5JW3H 2VMFA 3BP5B 1J0IA 5DK3A 1UYWH 4HLZG 5KSAB 2DQUL 1UM6L 4JKPH 4KRLB 3LN5A 2HLAB 1CICB 3HHRB 1K5NB 3GRWH 3OGCB 4JPIB 5ESQB 1S9KC 2MNUA 3BKYL 43C9B 4RA0C 3RQ3A 1YC8A 4K9EL 4WHYH 1ZHBA 2GJ6A 3HRZA 4N9GA 1NCAH 1AKJA 1R3HA 5J06A 3H9HA 3QPQC 4HS3A 1GZPB 2NY2B 4HIXL 3G9AB 5CGYC 4LHQB 4F7PA 4UT9L 4X83A 3RDTC 3D39A 3ARFC 4JFHE 4QRRB 3WSQH 4LVEA 3W9DA 4Z95L 3OZ9H 1QFWL 3HCVA 2B0SH 3KPSB 3P40A 1LNUA 2FH8A 4XBPB 3VI4E 5KSVA 1C8PA 4LCUB 1P9MC 3OKOA 4WU7B 3MLZL 4ZFZA 3ARBA 5B4MC 2X4QA 2GTZB 4MMXC 2WIIB 3LQMA 3D3VB 2WUBL 3QXAA 5EORL 3KPNA 3T65A 5BCAA 1MHPL 1W0YT 4KHXH 4JDTH 4LCIL 2DWDB 5HVWA 1JPFA 5IHZA 3C60B 1NAMH 3OMZA 4LLUA 2G5RA 2KZWA 3TO2B 4G43A 3THMH 2Q6WB 1Q9OB 3VFUB 4MA8L 2KPNA 4L4VE 1OAQH 3P4MB 3S35H 2UWEE 5D96C 3UBXI 2CKBA 1KJ2L 2R2BB 4NNXA 5IFJA 4JFED 4NNYA 4RGOH 2APFA 3G5ZB 2M8XA 1N4XL 1RUPH 3ARVA 5DA4A 5I0ZA 1D5MA 2V9TA 3W9EA 4OCMC 1U95A 3KJ4B 2YA2A 2IH1A 2IAMC 1RZJL 2EEAA 3I3DA 3QH3B 3QQ4A 3PQYE 4WWKA 1OHQA 3BISA 3UDWC 4MXWL 3VA6A 1QR1B 2JCCA 1OAUL 4X6DF 5J11C 4RGMC 3SJVA 3O2VH 4RRPG 4OI9A 3DIFB 2YWZA 4L9DA 4ESKA 2OQJA 4C55A 1MFNA 3QG6A 1OD7A 2ED9A 4ORGA 2R1WA 5ERWA 5BRZE 1HZHH 3HMWH 3SE3A 2BOBB 3NIDF 3VMOA 1KC5L 3I02B 3OJMB 3BPLC 2R4RH 2R1YB 4RISH 5IBLC 4PLKD 2OS7A 5LQBL 3V6FA 3O3BA 4FZEL 5JORA 2H26A 4XAWL 3L5XH 3PV6B 4PJ7F 3GKWL 1SYSB 2EIBA 3WNKA 3QWQB 2DWEA 4KDTA 5C08D 2X4UA 1HI6B 3GBNH 5K9KB 3FZUD 2FL5B 3RFZC 5EC2A 2AQ1A 4U1JA 1QSVA 5I9QC 4NM4L 3CH8A 4QHMA 3GIZH 2IANE 2FRGP 4Q74A 4HCRH 2DYPB 5E6IC 5HHXL 1YEDA 5DHVH 3T0AA 3GO1L 4L3CB 1N5YL 4XMLL 2LTQB 3TZVA 1T1WA 3DRQA 1GIGL 4U3XA 1DBJL 1RIHH 3FB8B 4DQOL 4U6VH 4YAQA 1BF2A 1HYRC 1A7QL 5EU7C 1FNGA 1JMZA 1H5BC 5HYQB 1KTLA 4RAUB 2GJ6D 5HHQA 5FA4B 4MJ5B 3R4DA 5TH2A 2XQBH 5SX5K 1U8MB 3BZFA 4U4BA 5EZJA 2VITA 1BIIB 3QFJB 2XA8H 3KPLA 4KDVA 5I18H 2OR9H 5IEHA 1DQDL 5JPMB 3ALWA 3KPRA 1UJ3B 4XVSH 3D39D 3KPPA 4U3HA 4IRSD 1WT5A 3TH2T 3B9EA 1D5BB 4NN7B 2Y06L 3FN9A 5ITBL 5EBLA 4ZD3L 4PRNB 2W60B 3TBWA 5MP6L 1E4WL 2HYMA 1ZSDA 3OKLA 3ARBD 1EEZB 5E8DH 3U0TB 1N59B 1FVEB 1NCUA 1ZT1B 3H3PH 4F57H 5HDBE 3S96A 2ZSWA 1SJHB 4C57C 1L9NA 2WLZA 1INEH 3I50H 1JZ6A 3QDJE 5HTSA 1GC1L 1KPRA 5ALCL 1ACYH 2VXSL 1ZVSB 2YK1L 4NRZA 1Z9OA 5HDQL 3SDDC 1BREA 1FAIL 4KJYA 4MNGB 4HMEA 1AH1A 2VLJB 4X6CB 4PUBL 2BZDA 4IRJA 1HH6B 2PW1B 2R2EA 4G7VL 4LEXL 2DMBA 4MA7H 1F5WA 3I6LE 3MODL 2A74A 1A3RL 1J0KA 3BKML 3S3JA 3D0VA 5FF6A 2OK0H 1A6UH 3G6JB 4CNIA 1QTYT 4HIEA 5CGTA 5KSAA 3UXFA 1WISA 2FX9H 3K2UL 2HLAA 4M5ZH 4YHZH 1MHCB 1OWRM 3O8XC 4V2BA 3O6ML 1NBYB 1K5NA 4L5FL 1OP3H 3OGCA 4JPIA 5AZ2L 1QYGL 43C9A 1B6UA 3I85A 1TJIH 3WYRA 1DBML 3H9SD 5IT2L 4CUCA 5EFIA 3VJ6B 4DVRH 4ZTPL 5FUCE 3QXDB 4Z77B 1HHKB 3QXVA 2L4OA 2X4SB 5EUKB 2HFGH 4EQ2A 1GZPA 3IJYB 1AO7B 1KELL 4PP2A 5EOTB 5D6CB 2FJHA 5FGSA 4Z0XB 1S7WB 4JQXA 4HMCA 3VFTB 3S37L 2APBA 3C5ZC 4O51B 4XBPA 2FR4B 4LCUA 2IALB 4YR6B 3CLFH 4WU7A 4KUCF 4KKBC 1LO3H 3ILPB 3O3EB 1DSFH 4H8WC 3UO1H 2WIIA 3D3VA 3SGDI 1A3LH 1KTDA 4KHTH 5F7NC 4OZIE 2DWDA 4NQVA 3C60A 2QV2A 5FYJH 4D2NA 3TO2A 1MFCH 3IDJB 3TZVD 1N26A 2Q6WA 1Q9OA 2CGRL 3VFUA 4I0PC 3RPKA 4GQ9H 1N0LA 5EA0L 2E7HA 3P4MA 3OG6B 5C0DB 3SCMC 4I8DA 4QNPF 3W0WE 4L1HA 2IBBA 5EULV 4N90E 3SDXF 3G5ZA 5E94B 2VXTL 3ROLA 3QH3A 5SWQB 3DXAB 1J10A 4MD0B 1ZGLB 3FQNA 4RRPA 5KBNC 1UG9A 3ARYA 1QR1A 1YMHA 3O0RL 3GSNB 5CILL 3X12B 2AJZB 1NGXB 2DQIL 4KQ3H 4LDOB 3S3PA 5LJYH 2BOBA 3FB6B 4N0CD 3WUZA 4LPUA 2W9LA 1CI5A 2X2YA 5C0BE 4ZSOE 3I02A 1I85C 2DM3A 2R1YA 4RGNE 2X6MA 1X6LA 4I48B 5C0IB 3HNVH 2PETA 4UU9B 1AD9A 2Y9RT 5D7IB 1SYSA 3MJ6A 3BT2H 2MWCA 4HUXB 3VXNB 3GJFB 3O6KH 1HI6A 5K9KA 4GAGH 1QEWB 2FL5A 3DWTA 3O45B 2A77H 4IRJD 4KUZL 3WS6C 4H20L 1NBVL 4QRSA 3QIWD 2F9BT 1U8IA 2ZWLT 3JWOH 5EOCH 1NGPL 3EO1A 3R8QA 1HKLH 5IMKA 2DYPA 3BAEH 3G9VA 2XQYK 1XF3B 4ZPTB 1OF2B 5KSAD 4QLRA 1ZGLP 1IT9L 1Q9LA 3NZ8B 1YEFL 3P2TA 5A3IC 5CD5D 3B5HA 3RUGF 4Q0XL 3B3IB 4ZNEE 3MX0A 3UEZA 32C2B 4R4ND 4F3FB 4HMDA 5HYQA 4RAUA 4JVUA 5FA4A 4NJ9H 1NC4A 1QQDB 2Z31C 1F2XK 1U8MA 5FEBA 2NZ9C 3FO0L 5DJ8B 3EOAB 2DRUA 1BIIA 3QFJA 2NY2D 3EZJB 2HT4D 3MA9L 5IB4B 4R4FL 5JPMA 5KSBE 2O93L 3C5JB 1A2YB 3PWJA 3V5KB 1D5BA 3KYNB 3OAUH 4XNUL 1N3NA 2Z35B 4GUPB 5D8JH 1BAFH 4JGJA 4PRNA 5EZOH 1EEZA 1IILE 3D3VD 3CX2A 1N59A 3L95B 1NMAH 1UM5H 1Y6NR 1ZT1A 3F58H 3C60D 3P77B 3ARGB 1S7VA 1EO7A 1MPAL 4OFYA 1L7TL 4QF1B 4M6NL 1I1YA 2DQUH 1UZ8B 5TE6L 3N1GC 3MC0A 3V5HA 1ZVSA 3GSQB 3CFJA 4MNGA 4P57B 2DBLL 2VLJA 4X6CA