2PNDA

Structure or murine crig
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GHPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-set and immunoglobulin domain containing 4
publication title A novel inhibitor of the alternative pathway of complement reverses inflammation and bone destruction in experimental arthritis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pndA00
2HT2D 4MA8L 2X4OB 4AQ1B 2PXYD 1F6LL 3ETBF 4IMLA 2DDQH 4LNRA 3GRWH 4LCWD 3LRHA 1FDLH 1MFAL 4YXHL 1WWBX 2FJFB 4HIEA 4K7PX 3SDCA 4RDQF 2JB6A 3W5NA 5L2KB 1IQWH 3C9NB 2DBLH 3I3BA 4TVPH 4JDZB 1OVZA 1S9YA 3DX7B 2W9EH 3K3QA 3O45B 2BNRB 5HVWA 2PCPB 4ZFGH 3L95A 4JGUA 1UACH 4G7VH 2WBKA 1WITA 4LLDA 5EO1A 1QO3B 5KSVA 5EU7C 1P84K 1Q9LB 2W9DL 4MJ6A 3SPVB 2WUCH 5EWIL 4NUJB 3ZZ1A 2VQ1B 5CD3A 2A1WL 4Z7NE 1NBVL 3JVGC 1JE6A 3UAJD 1JPTH 2EIBA 4QXGL 3A6CL 4N1CA 4Q0XL 3BZ4B 4JN2A 2E6PA 4ODHL 4WUUA 4HK3N 1MLCB 2EKSA 5K9OA 4YDKL 2Q7YA 4UT9L 1KPRB 1A7OL 1U58A 2VJXA 4PLJC 1F2QA 1I7TA 3O41A 4NQEE 2NR6D 4M02A 1DCLA 3PWVA 2VDML 1AP2B 1PZ5B 2MCG1 3EJJX 3X14A 5GGSA 2BNQB 3B9KB 4EBQL 3RIAF 3BRFA 4OGXL 1BD2A 5FKPA 3B9VA 5BXFA 1CWVA 1JUFB 4J6RL 2CXKA 2D0GA 3ROOA 2BK8A 3B5GA 4FQHA 1Q9OB 2R4SH 5GIRA 2DQGH 4DW2L 2X4UB 3WLBA 3FTGA 5EU6E 3SO5A 5J13C 4XNYH 1A4JB 2JK5A 3QFJB 4PTUB 5DJ8A 2HJLB 4WFFD 1K2DA 4FQPA 4OF0A 3ECBA 2I60L 4NJAL 5MENA 4GMTH 4ONGH 3O8XC 3RZWA 1KYOK 1RK0B 2C3VA 3HG1E 4O2FB 3N1QC 5CMAA 5IVXF 1RZIB 4Q9QH 4MGXA 3MRCB 1KT2B 1ZLWH 5LGJA 3ALWA 5C6WH 4XBEL 4PJ7F 1AC6A 4FZEH 1NGQH 3RI5K 2LABA 3MJ8A 3VRLE 5T1LA 1GPOH 5D2LB 1WFTA 3BPCB 4QRPA 4IRZL 2XA8L 4CAGA 3L3DA 5IB4B 5F3HB 2X4RA 1TNMA 2EKJA 4PJDA 2L7JA 4PRIB 4XTRC 4NQEA 4G6JL 5IQ7L 5ITFB 4DFHA 2F74A 5IMKA 2JJSA 2X7LA 3TNMB 4KHXH 4F58H 1A7NH 1C5BL 2FJHB 3UZEA 2VC2H 3HE7C 2I26N 4RMVA 2EXWD 1D7FA 3NN8A 4WUUD 3BH9B 3GKWL 2QKIA 1CDHA 2XT1B 4Y5VC 3RUGE 5IBLD 3STLA 2G5RA 5EU6A 5T3ZD 5L7XL 4GW1A 3QXDB 4M6OH 1QNZH 2ZCLL 1KJ2L 3C6LA 4Y4KB 5FDYA 1EMTL 3TFKD 4PY8J 1ZT7B 3DRQB 3GBLA 5T1DL 2B4CH 3IU3B 5I2IB 3E2HB 3OXRB 5K9JH 3MUGA 4H25B 1BD2D 3HG1A 2E9WA 2ATPA 3O11B 1ZA3B 3KPLA 1U92B 5KVMC 5D8JH 5GJTL 2NY4B 3MBEA 1S7XA 1J05A 4OQ1A 5JQ6H 3WKMH 3L5WA 4S1QL 4PG2C 4DZ8A 4CMHC 5F71A 3BKML 1NSNH 5E0QA 1X5YA 5MEND 4JFDA 1ZGLP 4GG6B 1MY7A 3IRPX 4FHBD 4NM8H 5KSUB 1NUDA 5BS0B 1LEGA 5BQ7B 3RGHA 3FRPA 4GSDL 1KIRB 3KLAA 1V3MA 3HUJB 4F7PA 5E95B 3LEXA 1GIGH 1Q72H 3MA9L 4QRUB 5T1MA 3TJEH 4DFIA 3CZFA 4XCEB 3RUGA 4QRPD 4JRYE 1HH9A 1IARB 2HN7A 5L9DH 3CVHL 3ORJA 5D2NC 1FZOA 1HN1A 1ZTXL 5IESH 4RZCB 4WJ5A 3S36X 2NY5H 3X3GL 4XVJH 4FXKB 3T0DA 4QHLA 2C1PA 4RSVA 5E94B 3FAXA 2CKNA 4XPFH 3RX7A 5EDXA 1BBDH 4LSUH 3BE1L 4RIRB 3KPOB 2FX7H 5E8EA 1MHHB 4N0CC 3MUHL 2EDRA 1HHJA 3NIDE 4X8JB 3V95A 1U6AL 1GGIL 1NEZG 5GRUH 3C6LD 2QQQA 5DHYA 2P8LB 2IBBA 4LGSB 4P2CG 2HJKA 1QPPA 4U6HB 3TH2T 1QFWL 3L7EA 8FABB 2GITA 3FN0L 3QFDB 4JPVH 3MBED 3EYOA 2LV4A 5DMIH 3TP4A 2YS4A 3UZQA 4ZNEA 5HTSA 1HDMB 4IOIB 4F33A 3T8XB 2OXHA 3KPSD 5K9KA 4P4RA 3RZCA 4WW2A 4R6UA 1QFPA 3STBA 1DBKL 1TTGA 1KLGA 3KPNB 3D5OF 4OCYL 4JFDD 1U9KA 3TM6A 4P59H 4FQIH 4AENA 4P2OA 3DUSA 3MLTB 3LRGA 1R0AL 3BW9A 5D6CA 2BFVL 2EDHA 1E4XH 4NDMB 1KXTB 2WWKT 5F6HI 2A0LD 3EJYD 3E6HB 3VWKA 2IQ9H 1M71B 2EDNA 3VA6A 2BY1A 1HYSC 1J9CT 4N8VB 1U3JA 1Q1JH 5HHQA 3PQYD 5DVNA 3BEVB 1MNUH 1GC1H 3P0VH 4A2LA 4C57C 1I3RA 5C9KA 4PJCE 2FIKB 3SEPA 1V7NL 1Z9SA 3MCLL 4MS8C 4MD4A 3QG6B 1AKJD 1KIPA 1KTLB 2ADJB 1EEYA 4LDLB 4QOKA 5I1CL 2VO5A 1BGXL 3MRJB 4MX7B 4JG1H 1UJ3B 1J0YA 4BQ9A 4CVXB 4OT1L 3WJLC 3B2UD 4LSTL 3ABZA 3BKJH 1T21A 3ARDA 2X9YA 3NACH 5INCA 5DA0B 3UYPA 1U93B 1S5HA 5DGRA 3GM0A 4NNYA 2X4PA 3VXMD 4KFZC 2EE6A 3V6FA 4I2XE 2CKBB 5F7FA 3D3VE 3VWJD 3MRBA 2AS5M 5CLWA 1ZAGA 5JXAH 4KV5F 2E6QA 3RWJA 1WISA 2BSTA 4ZDHA 3RVXC 4MNHA 1V3LA 4KMLB 2B0SH 3BAEL 4JKKA 3U9UA 3U79A 2B4CC 5CEZH 1A1NB 2C4FT 4X6DB 3K4AA 4KUCD 2GJZA 3RZCD 5LCVH 2XY2A 5KVDH 1ZS8B 3G6DL 2WQRA 4FQXB 1P7QD 5IGXH 4X7FC 2VZ3A 4P2OD 4LSPH 3TBSA 3LKSB 4I0PA 3VGFA 3P3YA 4PJCA 2H6PB 4I3RL 5F7LB 2WQ8A 4LKCA 4Z18A 1I9RH 4EKXA 1KJVA 5A2JH 1ZLUK 1FH5L 4YZFF 4E0RB 3K81A 3QEUB 2P5EB 2OK0L 3DSFL 3EFDL 3O6FD 2FSEB 1Q8MA 2MQCA 2XWJA 4ZSOB 4I2XA 3BHBB 5IW6A 2OBGA 2GK0A 4F9LA 3D3VA 4OD3H 3IT8D 1MCJA 4PG9B 4XMLH 4B7LA 4AIZA 4DOHE 4QOKD 1MF2L 1QKZH 3NOIA 2CDGA 1NGZA 4MSWA 2ORBL 3DX9B 1RZ7H 2A6DA 1TIUA 3K2MC 3MA7B 4OUUA 2XG4A 3ARDD 4R8WH 3SO3C 4Y2DC 4UB0L 1A1OA 3PWLA 3CU7A 1FYTB 2R2BB 4Z78B 4WI4A 3CPLB 1H3GA 1JNLL 4M93C 3FQTB 4ZFFB 3L3JA 1U3YA 1WC7A 2X4NB 2BRRL 3HS0A 3OKOA 3BPOB 4M7LL 4MDJA 1W72A 4ELMB 1LDPH 1IAKA 4PLKC 4K7FB 4EN3D 4FQCH 3KNBB 5I1IH 4ZFOB 3LV3B 2AEIT 4S0TD 1MCKA 4YNYA 5BV7B 5IHZA 5HVGB 3TZVA 1BFOA 4ODWA 3LAFA 4Z7VF 3JTSB 2R0LH 5HYFA 5GGUA 1K4DA 4M7LT 5DFVC 4Y4FA 1MIEH 3K1KC 2NY6C 4KI5D 1BQHA 2F5BL 2EC8A 5HHVL 5F9OH 3KPTA 4I0PD 3PWPE 1NC2A 2Q8BL 4MXWH 4Y0GA 2A77H 5TE7H 4UT7L 1A3LH 5HJ3B 5BZWA 1H15B 1K4CA 5C0BB 1MUJA 4G3YL 4N8CH 3I3EA 3S96B 5ICYA 5IJKA 5ALCL 3VFPA 2WIIB 2YC1B 2NW3B 2VISA 3N06B 1Z3GL 3MOAL 4RMUA 1JTTA 2N7AA 5DEFB 4OZIF 2AEQH 4PGCA 3QI9C 3SY0B 1MAJA 2MPAL 2EC9U 1MHCB 3O0RH 1GC1C 4QGTA 5CUSH 4XPTL 1RUML 3OKEA 5EORL 3P4OA 3VH8B 1OQOA 4QTIH 4YR6B 3VXSB 1E6OL 3ZKNC 1A6AA 3KGRA 5ESQA 4P9HH 2XKSA 4X5LA 1W0VA 1G9NH 4KJYA 3EYSH 1B4RA 1AGBA 1F2XK 3I9GH 3O2DA 3NFNB 1SEBB 1I9EA 2VAAA 1CXIA 3B6SB 4PD4J 2I07B 2AJUH 4O02L 1MCBA 1MVUA 4PYHA 4QTHA 5HY9A 1B0GB 3WIHL 1TETH 4P5MA 1A0QH 3PWPA 4OLUL 4K8RD 4NO0B 4D3CH 5LBSL 5GISH 3W5MA 3CJJA 2I5YH 4OZFG 3F58H 1B0RB 2I24N 4ONHA 4S1RL 5TJWK 1JGUH 2WBJA 3TZVD 3LQZA 2ZCKL 1OAQH 5MHSE 5HGAA 1ZVSB 5CEXA 1DQLL 1G7IB 4KGJA 5KOVC 4TUJB 2PYEA 4Y4FD 1HHIA 4FFYL 2Y36L 5I15L 4ORGA 4MHHG 2C1OA 3RHWK 5JXED 5D1XB 4K2UH 5C0CD 2GSIB 5JW5B 3MV9B 2L4OA 2D7PA 4PB9H 2IGFL 1FCGA 1WGOA 1CI5A 5DTFB 2V5RA 3SE9L 3AS3A 3H3PH 4QHUA 3HZKB 2NY0B 1FVCB 2YBRA 1CG9A 4OGYL 2AJXH 3MLRL 3V6OE 4LKXA 3NFSL 4MAYC 1BFTA 2HTLD 2VDPL 5DK2B 5EBLA 3JSSA 4PBWD 2ZSVA 3BQUB 1P4BL 2X05A 3DXAE 3GIVA 4K3EH 3UTPD 1XFPA 3WFHB 5IQ9A 2XPGB 1I1AA 2WINB 3T2OA 2HVKA 4BJLA 3OAUH 3FCTB 3QEQB 5BVPH 4GXVH 5EOCJ 1DFBH 3AM8C 4PJHE 2AV7A 2JJTC 5DO2C 5JOPE 2R1YB 1T1WA 1J86A 2DLFH 2ITDB 4HXBL 5GSRB 5DJCB 4K9EL 5DRNB 5IMLB 2WNGA 4TQEL 4AEFA 1CD1A 5CD5D 4NT6A 3BIKB 2X4TB 1CDGA 4IOFC 4CADA 1S9WA 2J6EH 3ARFA 4JM2F 1IKNC 4PJBB 2OZ4A 3I75B 4UOW0 5JZ7C 4PFEA 3INUH 1U8IB 1I3UA 3NGBC 4GQPH 4NCC2 2PYED 4CN6A 5EBMB 1QFWI 3VGBA 5C0RH 1YMHB 3BMWA 3NZ8A 3V6OA 4Q2ZB 4KUCF 4LVNB 3LKQA 4CMMA 3RGVB 1UKSA 3BWAA 3F12A 2VLKB 4R7DB 4Q97A 5A16B 3HLAB 1AXSA 4LLQB 1ZHKB 3DXAA 3MACL 2P44B 3QDMB 1NGYA 4J4PA 2MJWA 2YEZB 5MEPB 3O3BB 3OXSB 3H42H 3S97C 4UDTA 2A73A 3UTSA 1ERNA 1EO8H 1FPTL 1NGPH 3EYUH 25C8L 2Q8AH 2OTWA 2J4WH 4PJHA 1I7RB 4ENED 3GI8L 3SDYL 1ED3A 3BVNA 1KN4L 2MQ3A 4L9LA 4WCYH 1F3JA 4U31A 3OQ3B 2IQAA 5ID0A 1QRNE 3FB5A 2O61B 1FC1A 1JPFA 5FK9B 4NN7C 4NNXA 1IM3A 1KCSH 2BMKB 1I1AD 3TN0C 4U6XB 4L4VD 2WK2A 1E6JH 1XGUB 2OL3H 2QEJA 3RY6C 3IJHB 4RFNC 1JYVA 1G7QA 5EN2A 3REVB 4MDIB 3DETD 1D9KB 4UTAH 2IG2H 4BH8A 3N1FC 5GQBA 4NO2B 4P9HC 2Q6WB 4NJ9H 1G9NC 1HQRA 2EE9A 4I18C 1A14L 5T3ZL 5D1ZC 2Z8RA 1FORH 2YMXL 5IJVB 4HULB 4JO1H 4PRBB 4P46A 4TNWF 4O9HH 1Q9WA 2AW2A 3WSQL 3RWGB 3QUXA 1P4IH 2BOCA 2X44D 3VXUE 4K94L 3TIEB 5E8OB 1IGTA 3J7HA 4IIQC 3WXWH 5CIPA 4J1UB 3GSXB 4FTVD 1F4XL 4XC1L 1FO0L 3QDAA 3AFLA 1EHNA 4M1GL 2HT3D 4ODTH 1QRNA 3RVWC 3QAZC 4KI5F 2E7LC 3QUMH 4PJ7E 4J4PD 2MHAA 2E7BA 1OARH 2A9NL 4NKIL 3SDXB 3UTSD 1IC7H 4GS7C 3UPRB 5FA3A 3TO4C 5C6PB 4LCCA 4XP1H 5DZNA 4HJJL 5C6TL 4HHAB 3T08A 2BCKA 5JOPD 1NBQA 3LSOA 3WO4B 2AJ3B 5KZCD 5DD0L 3VFRB 3OX8A 2X6MA 4MA1B 1ZHBA 3UJTL 1EBPA 5F9AC 3VMOA 4DAGH 5I1HL 1KELH 1OSPH 4JZNA 4FS0A 3EDEA 5LVEA 3KYOB 1OF2A 1YEKH 4NQCD 3IKKA 3REWB 4C59B 3ZDXE 2OJEB 2F19H 5DFTA 3VXUA 1G7LB 3BISA 5ENWA 3W0WE 5IT2L 1AY1L 1A7PH 5JR1H 3EYFA 4XPAH 1ZEAL 3EDDA 5ECJE 1KNOA 2J7LA 4GKNA 2AV1B 3N85H 4X98B 4JQVC 4EQ2A 3QJFB 3FFDB 4Z95L 1ZLUH 4NQSA 3C08L 5FYKH 4BQ6A 4ZO9A 3H7LA 1KTDB 1ACZA 4R26H 4KK9D 1TVHA 2PW2B 1JVKA 4GKSB 3QUXD 3S37L 5LAXB 1XZ0B 3OR7A 4JZJA 2HG5B 2C7UA 5CJXA 3LB6D 3LZFL 1DLHA 4AH2B 4DKEL 5IHUL 1W0WA 3F5WB 4O5LL 1X9QA 1VGEH 2QQNH 5DR5H 2VOTA 5EPMA 4PRPD 5E70A 2H26A 2YXMA 5J7CC 1IL1B 4ZAKB 2PN5A 3IXAA 3O6KL 3VFNB 1GXEA 3D0VB 4GRWH 2FWOA 2CK2A 2C3WA 2VKXA 1DDHB 4H0GA 4TYUA 4WEMB 4HWEH 3S5LG 3VJ6B 4NQVB 5GGRY 1T80A 3TBYB 4XC3H 3GMLB 4X7TA 4MA8H 2B1HH 5DJ0B 3QXWA 3W0WA 1FRGL 1XGRA 4YXHH 3X17A 1A2YA 1U8MA 1MCSA 3A67L 4LCIH 3RWHB 2DB8A 2YPVL 1OHQA 4IS6A 2QSTA 5I8OH 4TOYL 1HWGB 3EO9L 1RZJH 4O4YH 5KW9L 3IAPA 3ARZA 5EZLB 2R23A 1QRKA 1OTTD 4OLWH 3HZYA 4F8QA 2E7CA 15C8L 3UTTA 1NPUA 4RBPK 5DEGA 3FO1A 1KFAL 4IMLB 5FV1L 3U4BH 3DO7A 4WV1B 3WNOA 4O2CB 2R29H 5T33L 3SDCB 4EOWH 4MVBD 4OIIL 3HNTL 4KZDL 1SJXA 1VADA 5IVOA 4WTZG 3TPKA 4ODHH 5KAQG 3BN3B 3L95B 2BVOB 1MCPL 3DTXB 3UDWC 1BBJB 5IFHL 5EO1B 4HWBA 3H9HB 1G0DA 2FD6H 3HR5B 5KJRL 5KSVB 3DMMA 4H0HB 4KROB 4OZGB 3DYPA 4KK6D 4BK4A 1IQDA 3WL9A 4P0DA 4R4BA 2ZPKH 5TQ0L 3VU2A 2A9ML 3I3DA 3HE6A 1DQJB 3CXDH 3IDXL 2ICWJ 4JN2B 4FN0A 4YAQB 3TA3B 4YGAB 3T0ED 5A2IH 5BO1L 3NCEB 4JLRB 1FZMB 3BP5B 3QUYB 1I8LC 4NZUL 4UDUA 4F7CA 5EO0B 3U82B 3W0WD 1I7TB 3NCYP 4QLRA 3U9PL 1N64L 1I1CA 3EOYG 3TPUA 5DJ6B 3OKDA 5GGSB 2X10A 4JFFE 3NA9H 1DBML 1Z2KA 3IXTA 3KHQA 3QUZB 3ROOB 4GW5B 1MIML 3QCUL 3L3GB 3BGMB 4GAGH 5GIRB 1EAPA 3CFBA 1P5UA 3EOAA 4LP4A 1NMAL 4OLVL 4P2QE 2Z8SA 5C08E 4HJ0C 1FFQA 3WYRA 2JK5B 3UTTD 3AXLA 4X83A 5DJ8B 1AIFA 5K93A 4Y4KC 1HHHA 1YPZE 1DQMH 3MNVB 2XWTA 3EDJA 5E8DH 1K2DB 5HDOA 3ZKSD 3OG4B 4E41E 3ECBB 4MNQD 1SJEB 5DRWA 2FZ3A 3E2HC 3SGKA 2C3VB 1WWAX 1X5IA 2CK0L 1CGTA 4B7IA 2NY4C 2CDEA 4Z7UA 3S88L 1VACA 1UT9A 1H3PH 1SY6A 3VD5A 3P9WB 3MJ8B 2FEDC 5T1LB 3GUTA 1IAIL 2DD8L 2IPTH 2XXCB 3AC0A 5L7XH 4OZHF 4XBGA 4M8VA 2X4RB 5F7EL 1A6WL 5GGTA 2XZAL 2NTFB 3EW3B 4Z5RA 3T1FA 1HHKA 1RV6X 1FZJB 5D71H 3WXVL 1SBBA 3JV4A 3QIUA 3NN8B 1PZUB 3QXUA 3H0TB 4YZFE 4FA8A 1L7TH 4P2QA 2VQTA 5C08A 1FBIL 5F9DC 4JCLA 1JF5A 3ARGA 4S1QH 1WBYA 2DLIA 4W70A 1LO2L 3MV7E 5I6XB 5KVEL 3AMLA 4JFXA 1QFOA 1P1ZA 2E27H 1YPZA 4M3JA 3VDAA 4E41A 1FGNL 1ES0A 3WS6C 1MRCL 2K7QA 1AJ7L 3V6BR 4MB3A 4FXGA 5C3LD 5GGQH 2ILLA 4QHKI 2YD6A 1R6VA 3MUGB 5ACZA 3HG1B 3BP6A 4GSDH 1C5CL 5E56A 2ATPB 3LOWA 3KPLB 4G9FD 1KCVH 4Y1AD 1J05B 2WANA 4XHJD 1UM6H 2QLVB 4OFKA 1V3JA 1RJLA 1IGJB 2E9BA 4WHTB 4DZ8B 4LVHB 3V52H 1YN6A 3LN5A 1NFKA 1T89C 1RZJC 3HI6L 3FRUA 3MO1B 3FT2A 4U1JB 5DJDB 5BV7H 2AJZA 1VEMA 1LEGB 5GS0L 2CJUL 2ADGA 5FO9A 4KGLA 2D2OA 1FVDB 4DGIL 1QBMH 5DJZA 3K8KA 3ZTJG 4K3GA 2Z93A 5KSBA 3AREA 4KTEL 3BE1H 2VUYA 3QCVL 3O6ML 2H2PC 3IF1A 5T1MB 1QBLL 3CZFB 3RUGB 3OJDB 2HN7B 4K8RL 2P43B 4NQDD 1GGIH 4L8SA 2J88L 5EBWA 1UWEH 2ICEB 1GGUA 2VMFA 4KJQD 5SWQA 3VFUB 4OFDA 4WJ5B 3HC3L 5HGHB 4QHLB 1Q38A 3I50L 3MRLB 3CXHK 3BUYA 1UZ8A 5D7LE 3MYZA 3QIUD 1I1FA 1T04A 3T2NL 5C9JB 1EFQA 5C08D 3F65A 1U8HA 1JGEA 3ARGD 1RUAL 3VCLB 4JY5L 5DA4A 4M7KL 1U3HB 4WFED 3JV6B 1QQDA 1DBKH 4GBXD 5GGVY 3Q5YA 4OQTH 4AY0A 2YD7A 4PJXF 3MTRA 2R0KH 5F8RC 2O26U 3C2AH 1SBSL 4C54A 1INQB 3MJGX 1QSZA 4HT1H 4WHYH 2HJKB 3L7EB 2GITB 1ZHNB 2X1XR 4XCYA 1F4YL 5D7SH 3O8XA 1QHPA 2XQBH 3GSNA 1JZ2A 3VI3F 4PP1C 2ESVA 4G43A 2P46B 4F33B 4Y5YC 3HPJB 3BEWA 3U7WL 3NIFF 4MXVE 2FCBA 5K9KB 4P4RB 4N5EC 4V1DA 4APQA 1K6QL 3GDBA 4JRYB 2DL2A 4X6FA 4JY6A 3A6BL 2A74B 1JF1A 2OM5A 3QO0A 5CP7B 3CFDB 4YX2H 1MCWW 3DUSB 4NN6B 2H32H 3BW9B 4Q9BA 5D6CB 4PJIF 4OFYA 3O2DL 2F8XC 5I1CH 1BGXH 3GI9H 2AJVL 3VWKB 5D7LA 2YA1A 4X5XA 1CGUA 4NZTL 3WS3A 4NN5B 4YO0A 2AJSH 5F89A 3BT2H 1BZ9A 3BO8A 2ZCHL 4FQXC 2ENSA 2R4RL 5IW3A 1LEIA 3D1MC 3G08B 4GMSL 4DKFH 3PHOB 4Y5VA 3IFLH 3WEXA 4Y2OA 1GHFH 2R2EA 1ZLSH 3NIGF 3P4LA 5DI8A 4YHYB 4ETQA 2GQHA 4PLJD 5IW1B 4TUKH 2EIZB 4M1DH 4MD4B 1KIPB 1EEYB 1F11B 5F9WB 2Y7QB 1F4AA 1GGYA 3UBXI 1HOCB 3VXRE 4NHUA 1X5FA 3HPLA 5IR1B 3CSBA 1S5HB 3WUWG 2DKMA 1CICB 3QXAA 4RAUB 3V6FB 1NLDH 4GT7A 4D8PB 3ULUF 4PG2A 3MRBB 1ZV5A 1HH6A 2VZOA 1A22B 3GMMA 2IFFL 2P8PB 5C0NC 4MWFB 1BZ7B 4JHAL 1CBVL 2AQ1A 4HMCA 3RWJB 4I3RH 4GXUN 1NEZA 3O8XD 5HYQA 5DQDL 2ESVD 3VMPA 1OAXL 4NZRH 3U0TA 1MFCL 1QSFE 3GRWA 2YXFA 1FH5H 1GGBH 5BCAA 1WFUA 1PBYA 2W65A 4V1DD 1BWMA 3FHAA 4FXLA 3CMGA 1WWCA 2NNAA 4GLRH 1IC4H 1RHFA 1TENA 4NC1E 2NXZB 9CGTA 1ZLVK 1A7QL 3CX2A 4QRRE 4TTGA 4X9GA 4PJCB 5HGBA 5D2NA 4XTRD 4F2MA 4FABL 4Z7WF 2NZ9C 3GEWB 4JO3H 1XF1A 2F53E 4ZOCA 3W9EA 5BV7C 1UKTA 3CH8A 1KJVB 1ZGLB 3U36A 2SEBA 1SYVB 1NBZA 3VFTA 1J1PL 3VXRA 3HE7D 4HW6A 4PJEF 1HNGA 1A7BA 2HWZH 1OAYL 4L1DA 5DHVH 3WD5L 5IB1B 2XWJB 3C8DA 5IW6B 2OZ4L 3PGCB 4JPIA 2GK0B 3D3VB 1Y6KR 1EXUA 2HFEB 1TZHB 4A6YA 4AIZB 1UH3A 4XWGH 4M7LH 1HEZB 2CDGB 5E4IA 1YEFH 5CJOH 3EGSA 3DVNB 4OF7A 3N1PC 1JK8A 1M7IA 4RBPH 1QSFA 3PWLB 2N7BA 4NFCA 3GHEL 3PHQB 1UZ6E 5TE6H 2AK4B 4UILL 1BLNB 2H41A 1WC7B 2PF6A 3HS0B 3OKOB 3QWOA 1W72B 4O51A 1R5IA 5L88L 2Q8BH 1CLCA 1IAKB 1NL0L 3DVGB 1KPVA 3QO1A 2F53A 3TIDA 1TVBA 3PG2A 1BFOB 2P5WD 5F7DA 5HVFB 4FQQB 2DL9A 1K4DB 1VKXB 3MUJA 4TVPD 4DVBB 3IGAA 1CDUA 5FIEA 1UM5H 4CU7A 3CDFA 4JFPB 3GBNL 5IFAL 1NC2B 1FC2D 3VRJA 3OWEA 5F9JA 2J2ZA 4HZLA 4DOHB 5EUOF 5C0IA 2YRZA 4M43L 3GIZL 2CIKA 3RAJL 1K4CB 2BVYA 4NUGL 1MUJB 2VIRA 5IFJA 5LQBL 3TT1L 3L3HA 5IBUG 3VXRD 3JTTB 1DQQA 1N3NB 3C2SA 4NM4L 3VFPB 1AGCA 4XP5L 5FHBL 4NWUH 1E4KC 3WJLA 2X4SA 4M7ZB 4N0CD 4P23B 4P9MH 5D1XC 3OHXB 4Z0XA 3CCHA 2EYSB 5IBTL 2DJUA 5GRWA 1CTNA 1IAII 1ND0B 3OKEB 2L0DA 3FKUS 3P4OB 2G60L 4LMQI 5JW4R 3W82A 2NY0C 1D6VH 5HDLA 1QSFD 4FQ1L 3N9GL 5D7JB 1W0VB 5AZEH 1AGBB 1KB9K 4EUPG 2FX8L 3FB8A 5EIIA 4YQXL 4QRTA 1F02I 4AEEA 3BQUC 4HFWB 4P2YA 5IP4A 4I4WA 3PWPB 5INDA 3DBXA 1MAMH 4QT5B 4WI9A 4HUVB 1NCBH 4FQJH 3BX7C 2F53D 5KVGL 2IWGA 4RX4D 3SE9H 2GT9B 2WBJB 1P84J 1D3CA 5HGAB 1H9VA 4B50A 1P69B 3K8LA 3ARVA 5E6ZA 2HJFB 4POZC 2N4IA 4KKCC 3K7UA 4KKNA 1HYSD 1S7RA 1BWWA 4R96B 1FZKA 3LEVL 4JJHA 2C1OB 5F93C 1I4FA 4BZ2L 3AS1A 1NFDA 5M7QA 4PJFE 4KQ4L 2UY6A 2FHCA 4MS8D 5C0EA 4NCDA 1A6UH 2V2TB 1UG9A 1BEYL 4CVWA 2YWZA 4I77H 1QEWA 1ZHLA 4JFEE 3SKUD 6FABL 5J06A 4LVNC 1J12A 5AD0A 3MJ9A 1K5NA 4Y2DA 4LKXB 3RGVC 1N0XH 3P9MA 4M7JL 4U1SA 4AIXA 2XV6B 4L8DB 3L9RA 2EO1A 2V7NA 1E27A 1GGTA 1DN0A 1I3GH 5JPNB 2XWBA 4IJ3B 1PG7L 5HYSA 3C8HA 3TBVB 4RISH 4M9PA 2Q20A 2QQLH 2BHZA 4QGYA 1OGTB 3ALPA 3FO9B 1KYOJ 3L7FA 3ISWA 2HVJA 4LRIC 1NJ9A 2BVPB 1T1WB 4WGWB 1KCRL 4EVNA 1CR9H 5KS9B 1F6FB 4QXWA 2CLVB 4J3WA 1NANI 5FO8A 4P2RB 3I2CL 5ID1A 1D5XA 2AKRB 2GUOA 1MEXL 2R69L 2CIIA 1X5KA 5F7UA 2VLRA 1FYHB 1OPGH 4YK4B 4AM0A 4CADB 4PJFA 3ARFB 5IB3A 3UPAA 2ZP0T 2VXSH 1J1OH 4PJ8B 3KWWA 1AGDA 4JFEA 4Q58C 1FPTH 4Z6AT 3WFBH 4P4KB 1NCAH 1NAKH 2VDQL 4OZFA 5AEAA 5LXGH 4Y19D 4L4TD 3SDYH 2P24A 2VZ1A 3LKQB 4F15B 4CMMB 3MXWL 3F12B 2XA3A 2KUTA 3FQNA 1XAUA 4J2XA 3QI9A 1AXSB 5MP6H 3DXAB 1EX0A 3IYLW 4LAQL 5EU3A 1RUPL 4OF3A 1NGYB 4JHWH 2QBWA 3QHFH 2A73B 4KKAC 5I71B 3RL1A 2FR4B 3NVQA 2OP4H 4W6XB 2PW1A 2DKUA 4FFZL 4Y2DD 4I1NB 4POYA 3OGCB 3BVNB 4HWZB 4UMGA 4HUNB 3RJDA 4L29A 2GTZB 1YJDH 2IQAB 2VH5H 5ID0B 4EDWH 1MJJA 1GJIA 1JPFB 3RDTA 5CS7A 4D94A 1IM3B 2YPLD 4MXQC 2YD9A 4OKVA 2BRQA 5BJTA 4PV9A 1VENA 4JRXE 1FNEB 4PLKD 5I74B 4WEBH 1YC7A 3IKCB 2W92A 2PKDA 3GZKA 5EN2B 3IDMA 4HPOL 3WO4C 3C8KA 5DYOB 3SE4A 1TJGH 5HYJA 4M6MH 2Y6SC 5JW4N 1YYLL 3QPQC 1KC5L 4MA1C 3MGAA 5JW4Q 2Y06L 5DFVD 3MRHA 1F4XH 3GMPB 2NY6D 1YQVH 3P9LA 3TV3H 4LBEA 2VLRD 3RKDC 4NWTH 4XGZB 5T1KA 4BFGA 2IAMB 2CRYA 2E9JA 2Z91B 3T2PA 4AMKH 1DBAL 1AR2A 1TCRB 3BIBX 5IVZA 4UV4H 4EXPX 1O0VA 1Q9WB 2X41A 5D7KE 4NKIH 4JRWA 5CJBA 1T3FA 3RWFA 3BH8B 3KVQA 1JGVH 3UP1A 1IGTB 4PRNB 2XIDA 1G6RA 5D5ME 2AJYH 3WIFB 2X1PA 2ZZUT 3GB7B 2V17H 5FUOL 5HGDB 2B1AL 4KDVA 4X0KB 5J1AB 2IH1B 1KACB 1QRNB 3QI9D 3UC0L 2DQCL 5D6DC 1BF2A 4R2GB 1JNHA 3IDUA 4ODVH 1OAUL 2OTUA 4JRXA 2BC4B 3FQRB 4ZXBB 4HLZG 3SQOH 3V6ZA 3VD3A 5B38A 2A83B 4JPWL 3FHQA 3S34H 3ZKND 1RZFL 2BCKB 1SY6L 4MAUL 4DCQB 4I9WD 2DN7A 1AY1H 3AM8A 2EH8H 1WCBB 1FFRA 2JJTA 4ZAKC 4K7PL 1EFXA 3OBAA 1KB5B 2RCSL 1C12A 4U1GB 1ZHBB 4P3DB 4XP9L 3BN9C 1IT9L 4Z95H 5FYJU 5C8JA 4JZNB 4XH2A 4LFHG 4D0DA 2M2DA 5HHOD 3MRPA 2VLJD 1OF2B 3H3KA 1WBZA 1JFQL 4M6NH 3S37H 4MQ7A 4CU6A 3LH2H 5ANME 5E8NB 2FO1A 1JPST 1T83C 3VXUB 1PYWA 3UTQB 4XNUH 5ENWB 4HIXL 4XVTH 1VCAA 1ZLVH 5GZNC 5HYJD 5IHUH 5D5MA 3VFWA 1SM3L 3CC5A 3B2VH 5CEZD 3RBGA 3X12A 4Z7OF 2AERT 3MGOB 3BSZH 4MMXC 2F54D 4NQSB 3EO0A 5B22A 2CLZA 3WN5B 4WNQA 3O6KH 2UWEF 1MCIA 1WZ1H 2A38A 3LKOA 3O2VL 4PJ7B 4JR9L 4TPRL 1OTSC 4Q74A 5HHME 1CLZH 3OR7B 2V2XA 4JZJB 4C56E 1IM9A 4U49A 2C7UB 1NCDL 2G2RB 2HMIC 4WV1C 5JIIA 4URTB 2A6KB 3IAQA 3SDCC 4YWGH 1AO7E 1FRGH 3AY4C 2W0PA 1I9IH 5EPMB 5C92A 2CO6B 4MAYD 1MJ7L 2H26B 3D87B 2YPVH 4MJID 3CH1B 1WZMA 3CLFL 3IXAB 1B9ZA 1DUYA 4TOYH 4NRXA 5JW4M 1AC0A 4XB8A 1R5VA 3IS0X 5A43C 5KW9H 3NCMA 3G5VA 2OJZH 2C3GA 5ANMA 4RGOL 3DARA 3F7VA 1BIIB 2FB4L 5TGBA 2DS4A 1UCBL 5AZ2L 5KANG 4P5KA 5DO2D 5AWNH 1H3WM 1XGRB 3K74B 5HHPA 1EFXD 5T33H 1A2YB 5CBAB 2C4FU 1WTGT 3KPRD 3FONA 3DURB 4P48A 5I8CA 5ESAA 4LLYA 3D85A 2EECA 3OSKA 4IS6B 3RL2A 1L4IA 1FL5A 1UQSA 3TA3C 4I18A 3C5JA 1YJDC 1XIWB 4M61A 3QQ4B 5EC2A 4PS4L 4W4OA 4PRHE 5D1ZA 2D31A 3UJJL 2R23B 4IOFD 4U1IB 1KV3A 1OGAE 4IMKA 3NFPB 4C56A 3U30C 5JZ7D 4OLEA 2ITCB 5DQJB 3Q5OA 4JFZH 3RA7H 5E9DA 3DO7B 4PGZA 5KJRH 1P7KA 2P8MA 3CUPB 1S3KH 3DGCR 4HH8A 1AD9A 1OT1A 1YNTB 4FFWC 5MERA 3QUZC 4EDXA 4IIQA 3KXFE 1UFUA 2VXQH 1EJOH 4NKOB 5FCSH 5IOPA 3MOBH 1CDYA 2VLME 4NO3A 4ZPVB 1UVQA 5JLZA 3NIFE 5EO9A 5HYIA 3VXPB 1YMMD 4CW1B 3W9DA 2E7LA 4JB9H 5IROA 4ZTPL 4LSDA 1OWWA 5FOBB 3GNMH 2KDGA 1B0WA 4WWKA 3S98A 3GSNL 1A4KB 4M1CC 4H1LG 4PB0L 2JTDA 3O3DB 3DMMB 4HG4J 1DVFA 3S4SB 1IQDB 4L8BA 3WL9B 4PJIE 2V9TA 3U0WL 4QXTA 1IKFH 3QUKA 2WZPD 5L2KE 3FMGL 5B39G 5JW3L 1DL7L 3HE6B 2DQTL 2J8UF 1QYGH 3FOLA 2N56A 3S7GA 4Y5XB 3UTZA 1NMAH 1PKOA 4PRHA 2FH8A 1FJ1B 3WHE0 2BNRE 3TN0D 4LK4A 4WFGE 3VGGA 5TDNA 3PXJA 3D6GA 3T65B 4LPYA 3VXOB 5DHXB 5TQ2H 1MFEL 2A6JB 3NIGE 3PWUA 3T3MF 1TZGL 2JJSC 5CEYA 1REIA 3MMEA 3S5LA 3O2WL 4OCSH 3QNYB 3MLXL 3QHZH 2GK2A 1HSAA 3D85D 1FLTX 1C1EL 1ONQB 4JFOA 4OF5A 4KMQA 1KCKA 1FV1A 3KXFA 1LD9B 3MLUH 3S88H 5I8EA 3THML 5D1ZD 4JQVA 4P99A 5J9PB 3NPSB 2ZOKA 1EA9C 1QACA 1FFOA 4Y16B 3V0VA 3BD3A 3T77A 5I6XC 3AXLB 4MJ5B 1AIFB 2I9TA 1HHHB 3U2SA 5E9DD 3D2UD 4HC1A 1ZA6A 3RWDB 2X4OA 5DS8B 4YBHA 3D9AH 2AGJH 5DRWB 3ULUE 1YEDB 2FZ3B 3G9AB 4XWOC 2J6EA 1WK0A 2FJFA 3S36L 3MODL 4LASH 4BKLA 1MJUL 1D6EA 1OTUC 1KULA 3J8F7 2DQUH 3QQ9C 1EEZB 2CDEB 5L2KA 1TTFA 3C9NA 4ORZC 4RA0C 4JDZA 3RVWD 5H37H 3DECA 4LVHC 1AGFB 2HKHL 3C6SA 3GUTB 3IFNL 2FO4B 4TSAH 1FBIH 3WNLA 4ZMAT 3O45A 5CJQH 2BNRA 3WDJA 4BFIA 1CK0H 1KJ3H 3TO4D 1RMFL 2DDQL 3GRWL 4RGNE 5DQ9A 1FDLL 2EDJA 1FIGL 1FL6B 1QLEH 1Q9LA 2D0FA 5ESVB 4JFFB 4N1HB 4Z7WE 5E2JA 3ZT5A 3MLSL 1IQWL 2DBLL 3SKNB 3VG9B 4TVPL 3MNZB 2OR7A 1TZIB 3GSRB 1A7RH 4R97B 4P2QB 4HUUA 4GO6B 3KJ4B 1GZPA 2W9EL 2R56L 4PJEE 5E8PB 4J3VA 4ZFGL 1UACL 1Q94A 4G7VL 4R0LB 3TVMB 4S10A 5DJXB 1YPZB 4E41B 1KPRA 3G6JE 3TYGH 4BELD 1CDJA 4L3ED 4PRIE 4FXGB 5FGCE 2WUCL 5GS0H 1AP2A 1RJCA 1PZ5A 3CFJB 4ZS6C 4X4YA 5ACZB 3H8NA 3B9KA 5ICZB 4BH7B 2OX5A 4NOBA 5E5RB 1JPTL 2X89D 4KTEH 4HKZA 1Q9OA 3WNPA 1U3HC 3O6MH 3MLWL 3F7RA 1W72H 3PDGA 4EJ1C 4RFOL 3GK8H 1OOAA 1YN6B 3LN5B 1A4JA 1A5FL 4PTUA 2HJLA 2J88H 1X5AA 3FT2B 3ZTNL 4LLVA 1EJ6A 3QULB 1HXMA 2AJZB 1HHGB 1RK0A 2DM2A 1JZ7A 4O2FA 1HKLL 3I50H 3KR3H 5L2KD 1AR1C 1RZIA 2Z93B 3AREB 2R4SL 4ONFH 2DQGL 2VR4A 4HDIB 1I1YA 1MRDH 4XNYL 4WFGD 5D2LA 4NP4L 3MV7B 4L8SB 3SGEI 4PGBB 4NN6C 5EBWB 4JM4L 5F3HA 5SWQB 1DE4B 3G6JA 1WIUA 1I8LA 4GMTL 1UWGH 2QR0B 4PRIA 1QLFB 5ITFA 3VWKC 4ZG1A 1ZT4B 4Q9QL 3BUYB 4X5WA 1F4YH 3IRZA 4NN5C 3TNMA 1I1FB 4Y88A 1T04B 3HUJE 1ORSA 2FJHA 5E1HB 4FZEL 3VXTA 4DVRH 2D7NA 3U7WH 4L5FH 1U8HB 2R1XA 1T20A 4M5ZH 2MCPL 4O58H 1KF9B 4LEXH 5DK0B 1QQDB 4YGVB 2EIEA 5I18L 3QXDA 1FNAA 2FGWL 4X6EB 4YHYC 4ZUUB 1YNKH 2DLEA 4EZMA 1NCUA 4Y4KA 3CX5K 2VN4A 3DRQA 2BNQD 5F9WC 4L8CB 1AI1H 5I2IA 3IU3A 1IAOA 3OXRA 4XCYB 1XF5B 1OB1B 4KHXL 2DM7A 1GAFH 4F58L 5DXWA 3O11A 5CZXC 2VC2L 2I9LA 4NZTH 1U92A 2P1YA 3M07A 1CICC 4APQB 2OQJA 3KYKL 1CD8A 3QFJD 4JY6B 1JF1B 4M6OL 1IE5A 2PTVA 1SMOA 1QNZL 3QO0B 5AYUH 2G9HB 2K1MA 5BS0A 4GW4B 2B4CL 3O4OB 4WIQA 3QEHA 3OL2A 5K9JL 1JWSB 1OD7A 3RIFF 2O5ZH 5CSBA 5D7LB 4HMDA 1KIRA 4DN3H 3WV0A 3WS3B 5D8JL 1QFUH 4XAKE 1T1ZB 1U8JB 1QOKA 1MI5E 3HUJA 4YO0B 4BSWA 5JQ6L 5FB8A 3BO8B 3FT3B 1UA6L 4QRUA 3WKML 4H20H 3JV0A 4XCEA 1ZWIA 2NXZC 5EG6C 1DQDH 1NSNL 2R2EB 4OZIB 1N59B 1AHWB 4PRID 2W38A 4NM8L 5F97E 3Q5TA 4LARH 4RZCA 3WS6A 1HE7A 4FXKA 2MOVA 1WBXB 5IVNA 1CLYH 3N1GC 1EGJA 3HZVA 5FYLE 1OAXH 2OLDA 3KPOA 3TBWB 1GIGL 1Q72L 3TJEL 4PV8A 3S3JA 1MHHA 1CIUA 4HJ0D 3ZKXB 4X8JA 4F9LC 4JVPA 4H8WH 4EI5A 5I30H 5L9DL 2OI9B 4HPYL 4Y4KD 2RFXB 2P8LA 2IALB 3O9WA 3PGDA 4XVJL 3WO3B 1NEZB 1KENH 1SQ2N 4U6HA 4XPFL 2BSED 2ZG2A 4HIIA 2XZQH 1CIDA 4LSUL 3QFDA 5GS0C 1IGFH 2NY4D 2VWEE 3PDDA 2FX7L 4CVUA 3AUVA 1J1PH 3HB3C 3QDGB 1MI5A 5C2UB 2VL4A 4CDGC 3T8XA 1S7UA 2FEDD 3SKJH 4HV8A 4BM7A 2NNAB 5GRUL 5FYKD 3WD5H 3KPNA 1KBGH 2OZ4H 2ARJQ 3MRDB 5BS0D 2QL1A 3MLTA 2HLAA 4F2MB 5EU5B 3LMJH 3QA3B 4NDMA 5DC9B 3CFEA 3O4LE 4JPVL 4F9PC 3U36B 5DMIL 4J3SA 1NBZB 5TH2B 2C4XA 1M71A 4N8VA 2YUWA 1AD0B 2BVTA 1WVZA 1UKQA 2ARJA 3BEVA 4P59L 4FQIL 5DURB 3SHSA 4E9LA 3LIZH 1TPXB 4QCIA 3VFGH 3Q1SH 4A6YB 5CZKA 5DGQA 3EFFB 1P4LB 3MJ6A 5DC0A 1E4XL 1RHHA 4PGDB 3ZT7A 4U2ZA 1J87A 3V5DB 1UJ3A 1M7IB 1IGCH 3FQUA 4UU9B 1NDMB 1KN2H 3QYCA 4M7ZC 1S5IH 4P23C 5I1EH 1Q1JL 3H6JA 1MNUL 1GC1L 2PR4H 3ARWA 3QPXH 2CKBA 2GTWB 2BVEA 1G84A 5C09E 3SKOB 4QRRB 3TC9A 3WUWA 5J89A 1BOGB 1KPVB 1PG7W 2GW5A 3TIDB 4JG1L 1U42A 1P5VA 3CSYB 5D7JC 1XR8B 3O4LA 4JM2B 5LQBH 2QSQA 1CL7I 4H0IA 4X6DA 3BKJL 2RHEA 5F7DB 4YDJA 3NACL 1ZS8A 1T2XA 2V2WA 5DEZA 1HZHL 5A2FA 3IGAB 4PJGE 4RRPG 4F7TA 2RR3A 5EZIH 1LHZA 5IBTH 4UNUA 5JXAL 5D96B 5F9JB 1HYRC 5C0IB 2H6PA 1RJYB 5ALBH 3FO0H 4UOJA 1P7QB 2WBJC 5C0AB 3RU8L 2ZJSH 3PP4H 2ZUTA 1J18A 2DMBA 5CEZL 1C08A 5I76B 2WP3O 2E6JA 2JB5H 2XI9A 5LCVL 5KVDL 3QEUA 2P5EA 3QJHA 3DYOA 4P3WA 3O3EB 5IGXL 2FSEA 4YQXH 3HKFA 5HDBE 4FFVC 4ZSOA 4LSPL 4GH7B 1YY8B 3BESR 1LDSA 3P77B 1I3VA 3CIQA 1G6RL 1M6OB 1I9RL 5C0BE 4ZNCD 3DX9A 4F7EA 3MA7A 1JZ5A 5FYJE 4RAHA 1KB5H 1T03H 5M95B 1LK3L 4PP1D 3JWOH 1N6VA 1FYTA 4Z78A 3G6AB 1HI6A 2O5XH 5EIIB 4N5ED 1F8TH 1T7XA 4PJGA 2PNDA 5I1GH 3QIWA 3FQTA 4IJ3C 4OD3L 4I4WB 3E1F1 5E1AB 4XMLL 4H8WC 1QKZL 1PX3A 4K7FA 3IB4A 3VXSE 3KNBA 4XVSL 1RZ7L 4ZFOA 3LV3A 1I8MB 4R8WL 1S7QA 4JO4L 2GYSA 4HF5H 4ZUVB 3JTSA 1MCLA 1S7RB 3GSWB 3TH3T 1FZKB 4OGZA 3MLYH 4FQXD 1QG3A 5I1DA 4NSKB 5GHWH 1W2KT 1Q0XH 4YK4C 4S0SD 3PWJA 3ALXA 3IU4L 1TQCB 3MSPA 2IJ0C 4OCWH 4PBVC 4YHIA 3ARFC 3VXQA 2VL5B 1TMCB 1LDPL 5JHLH 3VDBA 1A3RH 1IILE 2UWEE 5I1IL 1C8PA 3ZDZE 4XNXL 4PJ8C 1H15A 2OMNA 5C0BA 1HNFA 4P4KC 2P5ED 4PRDB 1P53A 3S96A 4U6VH 3V6OC 4X7CC 5CFHA 2R0LL 2YC1A 2NW3A 1K5NB 4OLYH 1MIEL 2X70B 5GS3A 1DZBA 4U1SB 3K80A 1F97A 5DEFA 3D39E 5F9OL 2V7NB 1E27B 3RQ3A 3O6LL 3VGDA 4X7SH 3UO1H 2YWYA 3I2CH 2XWBB 4MXWL 1NDGB 2A77L 5TE7L 5C0ND 5K59F 3LHPL 5BZDA 3H9SE 5I71C 3VH8A 4YR6A 5C0JB 4N8CL 3VXSA 3TWCH 1JTOA 1U2CA 1Z9LA 4OQTA 4Q6YA 4X7EC 5E4EB 3LKRA 1NJ9B 1N5YH 1FYTD 1IC1A 1UC6A 2YKLH 3GMNB 3SGDH 4GAJL 1SEBA 1CXKA 1CU4L 2CLRB 2AEQL 3B6SA 5I1KL 2I07A 1T5WA 2W07A 3JXAA 2VDRH 3T4AB 3MXWH 1YA5A 5ID1B 2GUOB 3O0RL 5IB5B 3ULVE 1T2JA 5CUSL 4OTXH 5I74C 3AAZB 4QTIL 5IB3B 2NZ9D 5HI4C 3TT3H 3ZE1F 4GKZB 4H88H 2WAHA 3P73A 2H9GB 5MEQA 1W8OA 1AGDB 4JFEB 1ZVSA 4P9HL 1G7IA 1G9NL 4OZFB 2XNAA 3EYSL 4TUJA 3I9GL 4W68A 4YXKH 1F3DH 3GMOA 1O7VA 2P24B 4L3AA 2AJUL 3OR6B 2APXA 3OPZH 4MA3A 3FQNB 5D1XA 3E6FA 1TETL 4P46C 5D7IE 1JHKH 3BI9X 4D3CL 4HWBH 2IADA 5GISL 4UV7L 1B2WH 3F58L 3HRPA 4U6YA 4LSQH 5C0BD 4GG6F 5CWSB 4OGAC 1JGUL 1OAQL 1DBJL 4I13B 2QHRH 3HZKA 4HS6B 1FVCA 5IG7B 12E8H 4Z77A 4L29B 3ZDYE 3ULSB 2Y06H 3IJYB 5DK2A 1MJJB 4GKOA 3RDTB 4AEIH 4H26B 4R2GC 4E42A 4OKVB 3BQUA 5CJ5A 4PB9L 4ZXBC 4GRWF 3SE8H 3H3PL 1MRFH 4GUPA 2WINA 3DI3B 4KH2A 3MRMB 1EVTC 2F5AL 3FCTA 4PTTB 4WHYG 3C8KB 3EHBC 4RDQG 1F5WA 5E00B 5IK3A 5IEKB 1MCQA 2AJXL 4N8PA 3JWOC 2ITDA 5HPOA 5GSRA 5DJCA 5DRNA 5T1KB 5IMLA 1AE6H 2DQCH 4NO0D 5D7IA 4NBXB 4YC2B 3BIKA 2D03H 4QHKJ 3EJZC 5J3HC 4HEME 5HI5C 4OM1H 5F88B 2X9WA 3S8WA 4ODSH 4PJBA 4UIMB 3RWFB 3OAUL 5BVPL 4HKJB 3I75A 3SN6N 4JPWH 1JRHH 1DFBL 5DD6B 1YECH 1G6RB 4HJGB 1RZFH 4MAUH 4W81A 4LSVH 2XKUA 2GJ6E 2DLFL 2Y1VA 4JGJA 4D9RD 4Q2ZA 5D1XD 1NEUA 3EZ8A 1JPSH 4OF6A 4K7PH 3MV9D 3VI4F 1DUZA 1GOGA 4R7DA 4UZGA 4HFUL 4XP9H 5A16A 4NKDB 3HLAA 5GGTH 1JNHB 4LLQA 1ZHKA 2B39A 4JZJC 4KY1L 2J6EL 4JRXB 3QDMA 5CJXC 5CP3A 1U8QB 4NIKB 3V6ZB 4PGJA 2YEZA 2HH0H 5B38B 5MEPA 3OXSA 1JFQH 2NY1B 4WU5A 1FNGB 2NY0D 4PGEA 1XGQB 5E6YA 1PDKA 3WHXB 1FFPA 5C0RL 3V8CA 1UB5A 4YDVB 2NY7H 1I7RA 4PIRF 4P5TA 1INEL 1SJVA 5GJSH 3MYJB 3BQUD 4R4FL 2MWCA 3PJSB 5FK9A 5C8JB 1D5BB 4D0DB 2LU4A 4FP8H 1JYXA 2BMKA 4NRZA 4TPRH 4U6XA 1U95A 5D70H 3H42L 1OQXA 3QEQD 4HK3J 1CGXA 1EO8L 1E4XI 2GKIA 1NGPL 3EYUL 1NKRA 1XGPB 2Q8AL 1X4ZA 4AT6B 5D5MB 3REVA 4MDIA 4POZD 1D9KA 1IEAB 3HCVA 4KKCD 4N0YH 4WCYL 4NO2A 4KJWC 2DLHA 2CLZB 4WNQB 1KCSL 3CLFH 4ZUTB 4PRBA 3ARRA 3AGVA 2DM3A 1E28A 2YD4A 1J11A 1E6JL 1IM9B 2BJMH 3RWGA 1FNSL 3QSKB 3HI1A 4LQ1A 4OZHB 1VERA 5E8OA 3RHWF 1VA9A 4UTAL 4X4XB 3S35H 2IG2L 1OP3K 3GSXA 2JLLA 1LVEA 2YZ1A 4NJ9L 3HMXA 3RGVD 4V2CB 4D9QD 4WY7H 2VLKD 2DTMH 1KSRA 1FORL 1RJZB 4LLAA 1DUYB 4JO1L 3F7QA 1T1YB 3QDMD 4FTVB 3HTLX 4O9HL 3UJJH 1F4WL 3SDXA 5D1QB 1P4IL 3UPRA 4X9FA 5ANMB 3JZ7A 3DMMC 3F7VB 4XMPH 1U0QA 1WEJH 4HHAA 4YLQT 3OGOE 1CXEA 1C5DA 4LPVA 4NYLA 5HHPB 5GRYA 4KXZH 2AJ3A 3L5XH 1K8DA 3HE6C 5ESAB 4AJ0A 4LLYB 1SEQH 4ODTL 1A3QA 2VRAA 2Y4SA 1LO4H 5C0GA 5FECA 4Y5XC 2DQEL 2D31B 1OARL 2JIXA 4KQ3L 1QHOA 5HHMB 3CLEH 3OZ9H 4C56B 1HQ4B 3REWA 3ZE0F 3LQAH 4YHKH 1G7LA 3GSNH 2DJSA 2CR3A 1QD0A 3FT4B 4PB0H 1P7KB 1AO7B 5F7YC 1HCFX 2AV1A 4X98A 1VEPA 3NPSC 5IOPB 3QJFA 4PY7B 3FFDA 4DAGL 1KELL 1OSPL 3F62A 5JLZB 1KTDA 5D6DA 5CINL 4R90H 3LCYA 3W9DB 2VXTH 2CO7B 1LP9F 4GKSA 4WI6A 1J0HA 1YEKL 5LAXA 4AQOA 4G8EB 1XZ0A 2G5BB 4ELMF 2F19L 2E7MA 4WWKB 4KKAD 3FQWA 2HG5A 2VDOL 4U7SA 3SGKC 3VRIB 1SHMA 4AH2A 3F5WA 1DVFB 1TZGH 3IDNB 4Z0BH 1A7PL 1M7DA 5CILL 5DDHB 3QQ3A 5JR1L 4QXTB 1V7MH 3WKNA 4ZAKA 4MXQD 3MX0A 4R26L 3UTZB 4PRHB 5JO5B 3JUYA 4NQVA 1FE8H 1KGCD 2ZG3A 3PDOA 4EEEA 1NAMA 1OGAB 1RUKL 3TBYA 2YN5A 3GMLA 2XTJE 3ZHLA 3VG0H 3PWUB 4XNZB 2JJWA 3S5LB 1VGEL 4PJXB 1LMKA 4U1HB 2QQNL 3VW3H 2BXZA 1HSAB 2PTUA 3GO1H 4J3XA 2Y6SD 5DR5L 5DRZA 3QPQD 3MODH 3VG9C 3KXFB 2VXVH 4IRJB 4R97C 4K71B 3RKDD 3IJSB 3GKZA 1DJSA 3MRQB 4POUB 4HWEL 3ZLQC 4XCFH 2IANE 4R0LC 3V0VB 3T77B 3MNWB 3TVMC 4K3DH 4XC3L 5GRVK 3DUUA 4QEGA 4XPGH 1P6AB 5EA0L 3CDGB 4CKVX 3RTQB 2B1HL 2G75A 4KMTH 1RMFH 2ADFH 1NQBA 5IMOB 1IJ9A 1DP0A 4WV1A 3GSUA 4TSBH 1FIGH 1IFHH 3L3OA 4O2CA 5MEOB 4BKLB 3BRGC 1D6EB 4PJIB 4LCIL 2B8OT 5HDQH 3MLSH 3AY4A 3V4PH 5T5FH 5ILTH 4OCMC 5I8OL 5DUBB 1T0NA 3QWRD 3RX8A 5E2VH 1UEYA 1RZJL 3C6SB 4O4YL 4JY4B 4OLWL 2R56H 3ZSTA 3WLWC 2ZUWA 4BFIB 1MREH 3HC0A 2BVOA 2WLYA 4XAWH 3DTXA 1BBJA 4UAOB 4YDLB 3U4BL 3H9HA 5DQ9B 3HR5A 5J6GB 2R29L 4OZGA 4EOWL 4KKLC 3AREC 1RIUL 5JIHA 2VTFA 1KB9J 5T5NG 4ZAKD 1N5AA 1DQJA 3CSPA 3MREB 4V2BA 3BN9D 4N0UE 3MOQA 4HUUB 1GZPB 4YAQA 3T0XA 3PV7A 3TA3A 4A6YH 3MLWH 2IANA 4L8SC 4LLWB 5B39A 1Q94B 4RFOH 1CGVA 4XPBL 2XQYG 4JLRA 1FZMA 3BP5A 1A5FH 3QUYA 1CXLA 1MWAB 4Y8AA 2FHFA 5EO0A 2FD6L 3ZTNH 3T0EB 5H35B 4BFEA 4P3CH 5GZND 2ED8A 4WFHE 1E4WH 5DJ6A 4PJ5E 4X4YB 4NRYA 2D9CA 4TULH 1MVFA 3WHE1 2ZPKL 5F96H 1HKLH 4CN1A 1FVEB 5I16B 3CXDL 3QUZA 2GFBA 4HKZB 4GW5A 3L3GA 3B9AA 3BGMA 3LN9A 5DD1H 1RK1A 4LHUD 5ADOL 2BP3A 3DV4B 3FOMA 4LHUG 1OTSD 3QEGH 1WAAE 3BXNA 4NP4H 4YFDB 3MNVA 2DQJH 1WSST 1HWHB 4JM4H 4LLVB 3S35X 1HXMB 2HMID 4RGNB 4PRAB 1SJEA 1I8IB 4JKWA 3UZVB 3SDCD 3LQAC 2JCCF 1S7SB 3NA9L 2FBJH 4LCUB 4Z7WB 3M17B 1PKQE 2AI0H 3CVIH 2CKBL 2CPCA 4GAGL 5ETUB 3SOBH 4APQC 2FBOJ 3BOVA 4UQ3B 4HK0A 5F1IA 1I1YB 2GJJA 2MCPH 4LL9A 4PJEB 2ATKB 2VZUA 2XZCL 1EBAA 5I18H 1DQML 2VB5A 5E8DL 2FGWH 4JCMA 3G6JB 3O4OC 2NTFA 4FMFA 4U1LB 4WVRA 1Z6JT 2VABB 2XRAH 4M4RA 4PJ9B 5FGCB 1QA9A 3L6FA 3MLVH 4N9GB 1FZJA 4X5WB 4WUKH 1IMHC 1H3PL 1ORSB 3AU1A 3VXTB 3TA3D 2F15A 2R1XB 1T20B 5EC1B 4NOFA 3UPCA 3H0TA 2COQA 3HR6A 2IPTL 5IF0B 2IEPA 4LSSH 3KYKH 3MRGB 4DK3A 3QUYD 1AHWC 3GJEA 3MLZL 1I7UB 5JDSB 1WAAA 1VFAA 4Q9RH 4KKBC 3IDJB 5HHXH 3L3IB 4QHMB 1KEMH 1IAOB 5D71L 3ES6B 1F90L 5F1NB 1RZ8B 3BIAX 4FFWD 3UJIH 3QUZD 4C58B 2I9LB 3TYFA 3SE3A 4LF3A 1L7TL 3ZKXC 1XCQA 3C5ZB 4HX1B 3LEYH 1UA6H 2OQJB 1IGJA 3CNKA 2OI9C 4WHTA 4ZQKA 32C2A 3RVUC 2J8HA 1XMWA 3UMTA 3EOBA 2E27L 3BJLA 2Z8WC 1M4KA 4K3HA 5DMJB 1BVLB 3MO1A 1G7MA 1RURH 1MCRA 4U1JA 2FEEI 4ODXB 4KHTH 4M1CD 5DJDA 4YHOH 5GGQL 43C9B 3ET9F 3QEHB 4HQQL 2CMRH 4OD1H 2HKFL 4LSRL 1MCDA 1FVDA 4QRSA 1LO0L 5BRZE 1JWUB 1KCVL 3GBMH 5FUCE 4BSWB 5T1LD 1UM6L 5FB8B 4X4ME 4LIQE 1BPVA 3OJDA 3V52L 1ZWIB 1GCFA 4PD4K 4G7YH 4ZFOL 3HFMH 4HPYH 2ICEA 4NQED 2CUIA 5BV7L 3LQMA 3VFUA 1YUHB 5E2UL 5HGHA 1QBML 3MJ9H 1NUGA 3MRLA 5KN5A 1JV5B 3HZVB 2UYLA 3G5YA 4QF1B 5JORA 4PV8B 3DV6A 5C9JA 1RVFH 1YY9C 5EU6D 3VCLA 5EOQH 1N6UA 4BZYA 5JOFA 1U3HA 4BUHA 3JV6A 4EI5B 4KJPC 4NQTA 5FDWA 1UWEL 2UY7A 4BK5A 1X44A 3O9WB 3DROB 5FYJL 1INQA 3PGDB 2Z35B 4XWOD 3HG1D 4HXAH 3V8OA 1ZHNA 4HIIB 2O5YH 3EZJB 1OTUD 3EOTH 1ZT1B 3QQ9D 5BRZA 4WI5A 1MI5B 3IS1X 3HPJA 3UBXG 5ISZE 2GY7B 1S7UB 4X4MA 3T0BA 2DWEB 4HV8B 4HIJB 4KUZH 2Q1EA 1OP3H 4JRYA 4NC1C 1R3LA 2A74A 4OQTL 2RIKA 4YEEA 2R0KL 3IDIA 5CP7A 3C2AL 3CFDA 1X5GA 4HT1L 4PJAF 5D9SB 2HLAB 3O3AB 3VMNA 1CZ8H 5KVFH 3FRPG 4OZFH 1BJ1J 1FNLA 3CFEB 4JM2C 5D7SL 3SKMB 2XQBL 4WI7A 1D5IL 3MQIA 1OCWH 3VE0A 4BQBA 2R2HA 2NXYB 4KVNH 1NUFA 3G08A 3K2UH 2W60A 1DEEB 2ARJB 3PHOA 5D96C 1JGDA 1CE1H 4GRLA 4QCIB 5DZOA 4XI5C 4YX2L 3RNKB 4ZYKA 4ALAH 2EXYC 35C8L 5IW1A 2EIZA 1RHHB 5TF1H 2ADIB 1F11A 3GI9L 4ZS6D 1FFNB 2Y7QA 3FQUB 4KDTC 1NMCB 4JREB 2VR5A 5EB9A 2E8YA 1HOCA 3GMRA 1I7ZB 2AJSL 3BT2L 5ISZA 5T5NF 5IR1A 1U3HD 4XP4H 4DKFL 1XH3A 1HZHH 3IFLL 4GRMB 1GZQB 1CICA 1GHFL 4J12A 4RAUA 1ZLSL 1H8SA 4D8PA 5BMFH 5DC4B 4YHML 4TUKL 2P8PA 4M1DL 3WUWB 4MWFA 1BZ7A 2IPKA 5TDPB 4R7NB 3RU8H 1P9MC 1S9VB 3GGWB 3O4LB 5FGBA 5JUEL 1AR1D 2HRPL 4YDJB 2W0FB 3MV8B 2V2WB 3ULVL 4JRYD 1CGWA 1NLDL 3QB7C 2AK4E 4F7TB 2WLZA 5FM4A 5TDOA 1WFOA 3QDJE 5KTEL 4N90E 5F6IB 1G6RH 4Z7QE 1XGTA 1B6UA 4MYWB 5K33A 4S2SA 3HC4H 3VWKD 1C08B 4J3UA 4NZRL 2EE2A 1ZGLA 1GGBL 2LFGA 3ARTA 1SYVA 4JFYA 2KL6A 1FAKT 1LK3H 3QJHB 1CDCA 4FOMA 4RMRA 3P4NB 4HUXA 5IB1A 1IC4L 1TQCC 3PGCA 1YYMH 5FA4B 1J1XH 1KTRL 3SQBA 5C09B 2HFEA 1TZHA 2DJ4A 2C3XA 3MRKA 1HEZA 4JO3L 1SMAA 1J88A 3DVNA 4FG6C 4XVSH 4JZOB 4F7EB 1K3ZA 1U8KB 5CZXD 5FCUH 4JO4H 2VN7A 1FGVH 2ICWB 4HKBB 2HWZL 4X6CE 5SWZE 2CRMA 1CFSB 1HI6B 1CICD 3PHQA 1RPQA 4PJGB 3QIWB 1JZ4A 2AK4A 1AGEA 4OI8A 1ZE3C 1BLNA 3IU4H 3QDJA 4XWGL 5CAYB 4E5XB 1YEFL 5CJOL 3DVGA 5C0DB 1T6VN 4XNXH 3R1GH 4BSJA 1S7QB 5ERWB 2R8SH 4ERSH 4F9PA 2UZXB 2YD5A 4IRSB 4HWUA 4G8GE 3A6OA 4FQQA 1VKXA 1FCCA 4OJFH 3U83A 5TE6L 4MCYA 3W2DH 4YIQB 2PO6A 5I1DB 1CD9B 4DVBA 1PLGH 4QY8B 2NXZD 1FAIH 1RIHH 5H37G 4CU8A 3S3SA 3O6LH 3PWJB 2BVQA 2P5WB 3I6GB 4JFPA 1S7VB 4YHIB 3VXQB 5KG9B 1T2QL 3LHPH 3CAFA 3BJ91 4JN1H 4RRPA 4QNPE 4XZUB 3B9DA 4JQIH 1CQKA 3JTTA 1N3NA 2E7HA 2FGZA 2VDLH 4ZUWB 3DHMA 4Z7NF 3KAAA 3OAZK 4X6CA 4P23A 2ED7A 4GAJH 3T2QA 5IBUB 1CU4H 3OHXA 5I1KH 3D3VD 1UM5L 4F80A 2H1PL 2EYSA 1ZGLM 3ZE2E 1JNNH 2HFTA 4KVCH 4LAJH 4DGVL 3DGGB 1CFVH 1ND0A 3KLDA 5BZDB 1U3ZA 4OFPA 1A6PA 4PJDF 4Q9CA 1BFVH 1LK2B 5FM5M 1JNJA 3LKRB 4LEOA 5J6HA 5GS0D 1MCEA 5D7JA 4NWUL 3TBTA 5C70A 3FQXB 3HB3D 5DLMH 4G8GA 2QTEA 4P9ML 1CLOH 2AK4D 3RDTC 1T5WB 5GXBB 4RWYL 4F37K 4WEUD 3PXHA 4HFWA 3SDDA 4EUPB 3DO3A 4QT5A 2Q76A 4UV7H 4HUVA 2UWEB 3C60A 4CJ0A 2GT9A 1D6VL 1ZMYA 3P73B 4HBCH 3QIBA 4WDIA 5MEQB 4HS3B 3SE4C 1N0LA 4BZ1L 1DBJH 1VPOH 2Y9RT 5AZEL 2XNAB 2HJFA 3HNSH 3Q6FA 4ZO6A 3GMOB 4R96A 4TTDC 5KS9E 1BQHG 2OSLB 4MA3B 3VRLF 3D39B 4P2RE 3E6FB 1NC2D 4YC2C 4MCZA 4HZAA 1KXQE 4X8XA 1MAML 2IADB 1J8HE 4JDVB 1NCBL 4FQJL 4U6YB 3VFVA 3H9SB 4S11A 4F3FA 4MZ3A 3K1DA 2V2TA 1LP9E 4Q6IB 2F5AH 4NKMB 3HZMB 2NY3B 5H94A 3MZTA 4P23D 4Z77B 5LWYH 1KJ2A 4L8DA 3RUGF 1I1RA 4E42B 1A64A 1PAMA 2WIMA 5JPNA 3TBVA 1S8DA 2V5MA 3SDAA 2CQVA 1A6UL 1OT2A 2NY1C 1INDL 4GUPB 1SJHA 4FNLH 4I77L 1OGTA 2IBZX 5D7JD 5LGKA 3FO9A 4U1NB 2Y23A 5IK3B 2BVPA 4JPKL 3U46B 4Y8DC 1N0XL 4Y4HB 5KS9A 3BP4B 2CLVA 2WV3A 4ETYA 1B4JH 3G04B 4YHLH 1XGYL 1I3GL 4P2RA 3PWPD 1U36A 3OKYA 2AKRA 2UZIH 3B43A 5D7IB 4HC1H 4HFUH 4L4JA 4RISL 2YPKB 1J8HA 2QQLL 3SGJA 4KY1H 5J56B 4AG4H 1S7WA 2WBJD 1KG0B 5GGRB 2ZKHH 2BZDA 4PJ8A 4ZOAA 1RZGB 4P4KA 1B90A 1CR9L 1MQ8A 4G6KL 1INEH 4P57A 4YUEH 2EO9A 4WW2F 5IHBA 1UJTA 4FFVD 4R4FH 1DUZB 2AK1H 1OPGL 5FOJA 1ACYL 4L4TB 1CGYA 1MCHA 5B8CA 1RUQH 1U91B 2VXSL 2DQHH 1J1OL 4DJMA 4WU5B 4PGEB 2FR4A 4JFHE 1FFPB 3WFBL 1ITBB 1EH9A 1NCAL 1NAKL 1UB5B 5J1TC 5LXGL 4KRPB 4P5TB 1WV7T 3OGCA 4HWZA 5E6IA 2GTZA 4XNMA 3DVFA 3SCMB 1CFQA 3V0AC 1P6FA 3FFCE 3U4EA 2DLGA 2Q86A 3SO3B 5DJ2B 2FL5A 4DWHA 5MP6L 1PX4A 1VFBB 4DUWA 4YPGA 4M5YH 4JHWL 3NA4A 5D1QC 4UNVA 5IIEB 3ULUH 4NRZB 1U95B 1FNEA 1XF2B 1BAFL 3QHFL 3PV6B 4QYOB 5MHSD 5E03A 3IKCA 5JHDE 1FNSH 2OP4L 1YN7A 2HTKC 4OV5B 1OD9A 3WFDL 1T6WA 3HCVB 1LE9B 5GRXG 5DYOA 4NKQB 3PIQB 2GJ6B 1GH7A 1YJDL 4UINH 2VH5L 4P2RD 4EDWL 3GMPA 1CE6B 5LGHH 4W4OC 4XGZA 5I17B 5HYEA 2IAMA 2Z91A 2FYYA 5L2JB 5EOCH 4IMKC 3P30L 4OI7A 3ARFD 4L9DA 1TCRA 3RBSA 2FATH 1E28B 3D69A 4WEBL 1NCTA 1F4WH 3I6LE 4PJ8D 3HI1B 2K7PA 3BH8A 1AQKH 1VFUA 4WW1B 2XN9E 3WUZA 4P4KD 4PRNA 4LPCA 4AEHH 5SV4A 1TJGL 1NCWH 4M6ML 3WIFA 3I6KB 5A3IC 1CT8A 3GB7A 1QSVA 5HGDA 3TV3L 1YQVL 2JCCE 3DIFA 1AXTH 4NWTL 1YEEH 4X0KA 2IH1A 3IFPB 5J1AA 4KWUA 5IVXE 3FFCA 1CD0A 1HILA 2DQEH 3DXAD 3KPMB 4ZOEA 5DUMH 4AMKL 1BMGA 5EOTB 1T1XB 5IROC 3EO1B 1CVSC 4KQ3H 4UV4L 5TE4H 1F4HA 4WWKC 3WFEL 2BC4A 3FQRA 4PJCF 3U1SL 4ZXBA 5HSFA 2A83A 4QHNB 1JGVL 1WIPA 1G7HB 3GFUA 1DVFC 2OCFD 1IGIH 2X09A 2AJYL 3MBXL 4DCQA 1C5DB 1QVOB 4NYLB 1P7HL 3V7AE 2V17L 1UB6B 1TDQA 1K8DB 3X11A 1WCBA 1KB5A 3PGFL 5C0GB 5FECB 2YK1H 3D25B 4P3DA 3RKPA 5CZVL 5T3XE 4GLRI 3S9DB 4ODVL 2JIXB 1YEGH 5CINH 2DWDB 3SQOL 4YBQC 5HI4D 1EV2E 3S34L 3K46A 1IGMH 5E8NA 1Y18A 2Z31A 2VDOH 3UTQA 5DF0A 1MFBH 4WI8A 1GL4B 5FO7B 2EH8L 5CILH 1EVUA 3QP3A 4K71C 4D0CA 2EDOA 1HCVA 3CSGA 3MGOA 1TNNA 5IVXA 2P7TB 3GSQA 4P46D 3T4YB 4OM0H 5E2WL 3WN5A 4DN4L 4PJ7A 4CBPA 1WZKA 2BSSB 2M26A 5I8KH 4M6NL 3RTQC 3FZUC 1RUKH 3LH2L 4AK1A 2OR8A 3SJVE 1EEQA 4OGAD 3FQWB 4MB5A 4XNUL 4I3GA 2G2RA 4XVTL 3STZB 4JVWA 3B2VL 2A6KA 1M7DB 2ARWA 3QQ3B 1ZANH 4HSQA 5J12B 2LVEA 3EYVA 3BSZL 1QRND 3GMQB 1X5ZA 2CSPA 3V7MA 3ZTJH 2BNUB 3QZWG 4LHJB 4R2GD 3CH1A 1WZ1L 3ARBA 4ZXBD 1CLZL 3PDOB 1NAMB 3QH3A 3EIFA 4K3JH 5E99H 4YDLC 5EFIB 5EA0H 4BQ8A 1BIIA 4FQ2H 1EGJH 1UYWH 4RQQB 1UEMA 4YWGL 3EHBD 1YDPB 3TJHC 1NBYB 2DQIL 1YQ2A 2X1WL 1I9IL 5DRZB 2JF1A 1UENA 5CBAA 3DURA 4KRMB 4ZOBA 1XIWA 3QQ4A 3EJZD 5J3HD 4MZ2A 5HI5D 3VFOB 5E5MA 4U1IA 4Z8FH 3DUUB 1VFOA 2OJZL 3VXUD 3NFPA 5I1JH 2FHBA 3SJVA 3ULUC 2G75B 2ITCA 5DQJA 3AS2A 5C07B 5IWLA 5AWNL 3B9KC 3GSUB 3CUPA 4NZDA 4UT6L 3L3OB 1D5MB 2ENYA 2VSCA 4QO1A 1KIUA 2X40A 1YNTA 5FUZH 4DZBA 1RIUH 4AYFA 5GRJL 1NMBH 5CGMA 2BOBB 4RAVB 4NKOA 4WTWA 1T0NB 3LRSA 1JI2A 2DYPB 4ZPVA 5AG9A 1XF3A 3VXPA 1IZJA 4CW1A 3OAZH 3LN4A 3HC0B 4TUOB 1MCCA 4XPBH 5F7KC 2VLLB 5FOBA 4DK6A 1EHLH 4RGNC 4JFZL 3RA7L 3P11H 2XTJB 1A6ZB 5BW7A 1A4KA 3O3DA 5FYLH 1S3KL 3S4SA 4OV6F 2VXQL 1T7WA 2WP3T 1N5AB 4H1LB 1EJOL 3LVEA 4NBYB 3MOBL 3KJ6L 3QR2A 4Y5XA 2IANB 1SYSB 5ADOH 4JB9L 1FJ1A 5B39B 2B2XH 3GNML 2BY3A 3T65A 3VFSB 4XXCC 2P42B 3VXOA 3GJFB 1U2HA 2A6JA 4PJ9C 1FL3B 4JEGB 2V7HB 1UXSB 1MCOL 3QNYA 1IBGL 4NRYB 4WI3A 1IKFL 3RPKA 2H8PB 3ZHDA 4HIHB 3NTCH 1ONQA 3WJJA 4LVEA 1LD9A 1QYGL 4KJWD 2GFBB 2GAZB 2CKBH 2JJUA 2LTQB 1MPAH 3F6LA 1HIML 1LO5B 1RK1B 5J9PA 3FOMB 3QG7L 1MCWM 2K3TA 1MCNA 3H2WA 4Y16A 5JNYA 4J7RA 2P4AB 2VZSA 4MJ5A 4LQFL 1VGKA 2NLJB 3BDYH 2XZCH 3BXNB 3L5HA 5TQ2L 4X6BA 5DRXA 3RWDA 5DS8A 1YEDA 5C0FB 3E8UH 4OCSL 3HAEG 3QHZL 4KV5E 4U7MA 2XFXB 3U7YH 3MLUL 4A2MA 2BY2A 4H5SA 2PXYA 1EEZA 2VE6B 3C5ZC 3OKLB 3EDKA 4DGYL 4HK0B 4N0UB 5F1IB 4M4PA 3BKCH 1AGFA 2W1NA 5KSAB 2FO4A 2Y5TB 2R2CA 1C16A 3MLZH 3R06B 3HRZB 3D9AL 3DMMD 2AGJL 4CL7A 4ZPTB 3U0PB 3R4DA 5F7MC 3LS4L 5C86A 1FL6A 4LASL 1QA9B 3L6FB 2R1WB 3OJMB 4PJ5B 5ESVA 5KBNC 4JFFA 2DQUL 1MFDH 2ZG1A 1F90H 1J7VR 5E2TH 3HE6D 3TO4B 1TLKA 3AU1B 2J5LB 3SKNA 2DIAA 3MNZA 3R0MA 1TZIA 3GSRA 2Q87A 3JWDH 4D9LL 4TSAL 5FKAB 1JP5A 2EYRB 5CJQL 5E8PA 3TNNB 2DQDL 3GJEB 1CK0L 4R0LA 1KJ3L 1VFAB 3VFMA 3TVMA 2C3HA 1TFHA 5DJXA 1CS6A 1URLA 5DT1H 1QLEL 5I1AB 2RJMA 4O2EB 3HMWH 2WBWB 1A6VH 4R3SB 4HQQH 3CFJA 5FFLA 3FN9A 2HKFH 4LSRH 4PJHF 5ICZA 1CGSL 4BH7A 1PKQB 2EEBA 3TYFB 1LEKB 1LO0H 3DX8B 1PJ9A 1A7RL 4LF3B 4BSVB 1XCQB 3I02B 4Y16D 4EI5C 2V5TA 2ED9A 1OL0A 4ZQKB 32C2B 4UQ2A 3EOBB 3WE6A 1KTKE 3O9WC 1G9MC 1OAKL 5CBEA 3TYGL 4WUUE 1G7MB 4ODUA 5L8JB 2EDYA 2IMNA 1I85C 3MFFA 1O7SA 3F7YB 3QULA 5SX5K 5T3ZE 1HHGA 3HNVH 2VITB 5E2UH 1LO3H 4QRSB 4LGRB 4DUXA 1ZXQA 4OUOA 1CDIA 4RMQA 4R9HA 3BDXA 4Z7VE 1W72L 1BD2E 4HDIA 3GK8L 2ZUYA 2EDKA 3MV7A 4D2NA 4PGBA 4DEPB 3RIFK 4C4KT 1DE4A 1G1YA 3OKMA 2QR0A 5FYJH 2EICA 4L3CB 1QLFA 4JFFD 5C2BH 5CKAA 4M03A 3KR3L 4XCNA 5C7XH 3FN3A 1ZT4A 5KN5B 3NCJH 5MENE 2UYLB 3G5YB 3OV6A 5JORB 4ONFL 4P2QD 3DV6B 4RGMB 2NXYC 4NO5A 3VD9A 1Q0YH 1MRDL 3NH7H 5JOFB 5DK0A 4ESKA 3TVMD 4YGVA 2KKQA 4E41D 5FDWB 4OZIE 4X6EA 2QSCL 2XY1A 1V3KA 3UXFA 1KIQA 4ZUUA 3KYAA 1UWGL 1I9JH 4QRPE 2DM4A 4L8CA 1UJ3C 1NMCC 4JREC 2FJGA 1V8HA 4PJDE 1XF5A 1OB1A 2VWEC 1D5IH 2VUOA 4PREA 5IB2B 2D3VA 3ZKMC 5BRZB 3ZHKA 2KBGA 4DVRL 3W11C 3GJFK 4L5FL 2OL3B 4M5ZL 3OF6A 4G5ZH 4O58L 4G9DB 4LEXL 4EUPH 4Z7VA 3WIIL 5FF6B 1R3LB 5DWUH 3WLWD 5M94B 1TQBB 1YNKL 3IDIB 3TLRA 3QCTH 3DRTB 1FO0A 2G9HA 35C8H 1AI1L 4GW4A 4GQ9L 4G6MH 3KPPB 3ZYJA 2EDWA 1JWSA 1HINH 3BPLB 1GAFL 4KRLB 4KKLD 3ARED 5CGYC 5IKCB 3IETA 4MNGE 1T1ZA 1U8JA 3QDGE 1OWRM 5E7FA 1K8IB 3VE0B 2R2HB 3FT3A 2X1OA 4OLXH 2WUBH 5B3JF 4OBRA 2W60B 3MV7D 1IEHA 3TO2B 2YD1A 4X4ZA 5F6IC 1JGDB 4GRLB 4OZIA 4RNRB 1N59A 1AHWA 5AYUL 4ZYKB 3KPSE 5DK3A 4YHMH 4LVOB 1XR9B 1WTLA 2CRZA 4LPUA 2O5ZL 4JFDE 1WCQA 1WBXA 3QUMB 3P0YL 2RAMA 4JO2H 4DN3L 3H7BA 5JUEH 1QFUL 4ACPA 3GMRB 2GSGB 2HRPH 2EH7L 5MI0B 5ISZB 3N1MC 3TBWA 4H20L 3ULVH 1JTPA 4F57H 1XH3B 1DQDL 1R5WB 4NC0B 1F3RB 3JWDC 1QR1B 4JQXC 3ZYIA 4TSCL 5ACMA 1MQKH 2RFXA 4DTGH 1WQVT 2AEPH 1X5JA 5KTEH 2IALA 2IPKB 4LARL 1KCUH 3PQYE 3ZDXF 2PUQT 1R3IL 1J10A 4U1KB 1A8JH 2W0LA 4ZS7H 4M62L 1CLYL 1U41A 3OF6D 4OFVA 4M48H 1R3KA 4MNGA 4G6FB 3QDGA 4XBPA 4APQD 4ZO7A 2V9RA 3QIWC 4H8WL 5I30L 2Z92B 2ZNWA 1U8OB 5TDOB 3BPOC 1JGLH 3UBXA 5I73B 3MRDA 4OAWB 5BVJA 4OFYD 2W0KA 3KPSA 4XNQB 2VZVA 5F8QC 1XGTB 2XXMB 3TF7C 2D9QB 1KENL 4OIBA 4N9OB 3V5KA 5EU5A 3QA3A 4S2SB 4XVUC 5A2LH 3VXME 5GS2H 2XZQL 5D7LD 2LVCA 1IGFL 2CXGA 2E9IA 4IRSC 4JFYB 2R0WH 1NC4B 5TH2A 2BERA 1N6QH 4KAQL 1R3HB 4MD0B 3SKJL 4LLUA 5LG1A 1AD0A 2FECL 3CDYA 1WZLA 4HUXB 4ZNEE 1KBGL 2WW8A 5CP3H 3ZL4H 1GGCH 3QRGH 4MQXC 4B0MM 4KTDL 4KKBD 3DX6A 3EFFA 1P4LA 3LMJL 3MRKB 1UM4H 3PQYA 2M8XA 5C0AE 4PGDA 3V4UH 4GRWB 4I0KA 3V5DA 1HSBA 1V05A 4YHNA 2F58H 1JN6B 4UU9A 1NDMA 1WT5C 3CMOH 1AKJA 4FQLH 2NY2B 1ULVA 2HLFD 2KQMA 4NHCH 5D72L 3RVUD 3ZMRA 1AGEB 2GTWA 3LIZL 3VFGL 1DSFH 3Q1SL 3SKOA 3QDJB 1F42A 4QRRA 1JYWA 1T2QH 1BOGA 3VXMA 4F7MB 1IGCL 2APVA 3CSYA 2A6IB 1XR8A 4JM2A 3VWJA 5AAMA 1KN2L 3QDGD 1S5IL 3ELAT 4YDIH 5I1EL 4QOKE 4MCYB 2PO6B 2PR4L 3D18B 3WNKA 3QPXL 3EYQC 5AAWA 2H1PH 2BVQB 4LCYB 4KPHH 2JJVA 1GSMA 4DGVH 3BPNB 1RJYA 1P7QA 1HXYB 4G8IB 5C0AA 1DBBH 3CFIC 3HMXH 1KEGH 1XT5A 2AABH 3B9EA 5I76A 4XMKL 4KDTA 4Z7UF 3VXNA 4X6CB 5SWZB 1YY9D 4LMQE 2XOTA 3O3EA 4Q7DA 5DURD 3RVVC 5EZIL 4NNPH 4RWYH 4KJPD 3X13B 3L1OH 4YHZH 1YY8A 1A9BA 1N8ZB 4ZTOL 3P77A 4S1SH 5IM7B 1BF8A 3QHTC 5ALBL 3FO0L 4KI5E 3O6FA 2ZJSL 3PP4L 3Q3GA 4Q6IC 4HLZH 1M6OA 1KLUB 2NY3C 4LEOB 5J6HB 2JB5L 1UXWB 1P9MA 4BZ1H 3TBTB 4G8GB 2CR6A 4KRNA 3G6AA 4U0RB 3ULVC 3SDDB 1A6TB 1BVKA 4QRRD 4Y5YB 5E1AA 4W4NA 5F7NC 2Q76B 1A1MA 1YPZF 2HP4A 1RY7B 3C60B 5BOZG 2WSKA 4JM2D 3QIBB 4WDIB 1I8MA 1KB5L 1T03L 1R3JA 3JWOL 4OZ4B 4Y4HC 1LNUB 3Q6FB 3C09B 4ZUVA 2W91A 3GSWA 4EN3A 2O5XL 3G5XA 3OJVC 1F8TL 2UUDK 3PL6B 4IOSD 5I1GL 5DVOA 5F7WC 4NSKA 1KPUA 2OS7A 4MCZB 1DEDA 3P4MB 3ROLB 1G0XA 4XI5D 1CFNB 3VFVB 3FB7B 2EXYD 5TFSH 2VL5A 5C0AD 4XHQA 1F58H 4F3FB 2AXHA 2LAAA 2VSDA 3OMZA 3CK0H 3RWIB 1INDH 1OM3H 5DVKA 4J3TA 4YBLB 2VR9A 4NPYB 4PRDA 4HF5L 5H94B 4XX1G 4JPKH 5KSBF 3MLYL 4KK8C 2MTPA 1KJ2B 2X70A 1YEJL 2LAGB 2OXGA 3L5JA 1Z0NA 5GHWL 5E08H 4OCXH 4ZD3L 2YUVA 3W39B 1Q0XL 1NAMH 2FX9H 1XGYH 1LE5A 5HPMB 4OCWL 1NDGA 4PUBH 5JHLL 1S8DB 3SDAB 1A3RL 4GG8A 2DF3A 5C0CE 1SJHB 3QNXA 5C0JA 5JA9A 3WNMA 1NCCH 3EUUA 1VSCA 4KRPC 4U6VL 1BVZA 3NZHH 4P5TC 1VFMA 4ZUSB 1ZK9A 7CGTA 2E3VA 4OLYL 4RMTA 5C1MB 5SX5H 3SCMC 5T3XL 3GMNA 5E5UB 4G6KH 4HG4K 2CLRA 2NY5C 3LPWA 4GJTB 5IEHA 4X7SL