2PNDA

Structure or murine crig
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GHPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords V-set and immunoglobulin domain containing 4
publication title A novel inhibitor of the alternative pathway of complement reverses inflammation and bone destruction in experimental arthritis.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pndA00
3HG1B 3QCTL 4PRIB 2D7MA 5TF0A 3L3GA 4AIZB 1NC4D 4E42A 4I0PD 4KTYA 1EHLL 4L5FL 5DQJA 2G60H 1S7RA 1JYXA 3WSQL 5IBLD 5E4EB 3NH7H 2PETA 1P6AB 2CLVB 3ZLQC 4I3RH 1EXUB 3F7QA 5AZEH 5BO1L 4CW1B 1FLTX 1MFDL 4YHLH 3RP1A 2VAJA 4ZTPH 4R90L 3VD4A 4P0DA 2P8LB 2DQTH 1KN2H 1J0HA 1JRHH 2HVJB 4NQEA 1HOCB 4ZXBA 2UUDH 1H8NA 5C2BL 2BNRB 5JR1L 5FO7B 4Z5RA 3FN0H 4JFYA 4Y16D 2NY2D 5IJVA 1PG7H 1F45A 2BVEA 2EEBA 1CD1A 4X7TB 4HEME 4ODVH 5K9QI 2X1OA 1F4AA 2W9DL 4NHUA 4KDTA 5FF6B 1QO3B 1T83A 1Y18A 4LLUA 4PS4H 5CIPH 4ORGB 3PWVB 3IRPX 3HCVB 1S3KH 2VH5L 4OT1H 4P2QB 1FGNH 2E7LA 2V7NA 2IGFH 1OSPH 3EOBA 1ACYH 1VFAA 1CL7I 1WVZA 4X7DC 5TH2B 1G6RH 2DYPD 1MPAH 1VKXB 5I16B 3SDYH 3SPVB 4OIAA 2ATKB 1HHHA 3BMWA 2P7TB 1FE8H 4P4RB 5DQ9B 2WSKA 4D9LL 1HDMB 1X4YA 1S7SA 1NGWA 1DEEB 1ZEAH 4XC1L 1E4XL 2VDRH 4HGWA 3W0WA 4M43H 3QO1B 4RRPG 1H3PH 4NPYB 1EO8L 4LDEB 3TO2A 5KG9A 4I13B 5IB1A 1F90H 3QIBD 4P3CL 1KCUL 3KPRE 3U46B 1J05B 3VD7A 5EH1A 1EGJH 1ZXQA 1XMWA 3B5HA 2CRZA 1RZGB 4GMTH 3IS1X 1RVFL 5D7JC 1KYOK 2EIZA 2W91A 4Z7WF 2ILLA 2GAZB 2P5EA 1WF5A 4Z95H 5DJDA 1FNHA 4MXQC 1IILE 4TUJA 4UAOB 1OB1A 3C6LD 3LS5H 3D18A 2PW1A 3P11H 1ES0A 4MXVE 3WHE1 1G1CA 3GSWA 1YNKH 4OUOA 1MRFL 5JOPE 3BEWB 3S3SA 2XA8L 3BIKB 4OKDA 1MFBL 4KDTC 5KSBB 5CBAB 3S35L 2HTLC 1FPTL 1A22B 1CD8A 4GO6B 1JMXA 2ICES 3K8LA 2AEQL 4X6CF 2E7LC 3MA9H 1RI8A 1BLNB 1W2KT 2ORBL 3E0GA 3HFMH 1DBAH 1Z9SA 3KPSB 5IBUG 3S36X 3D87B 4NZRH 3X13B 1G9NH 1N8ZA 4O2EA 5E8PB 3P30L 1J1OL 2BC4B 4XBPB 4OLWL 2MJWA 3EFFA 2Z8SA 4TSCL 5HYJB 1LDPL 2H6PA 4PIRF 4HWNA 3AY4C 1A5FL 4APQD 2AXGB 3ULSB 2W0LA 3GSVA 3BGAA 3MLSH 1ZWIB 3O6ML 2Q3AA 1WICA 4YHIA 2ITDB 3QUZA 4NUGL 3NCMA 4IOIA 5C7XL 4HBCH 2CUIA 3TBYB 4DVRH 1QRND 2F5BH 2IH1B 2WV3A 3G5YA 3VGHA 1IKNA 4GUPA 2PF6A 4FQLH 3MCLH 1JWUB 1VHPA 4G8EA 3N1QC 4XNXL 3TFKC 2X4TA 3OX8B 3RL1B 1G7MA 2DQFB 4X80L 1NEZG 1MQKH 2KL6A 3FKUS 3QG6B 2O61B 2FCBA 3FO1B 3IJSB 5F89B 1U91A 4LPXA 2J4WH 1HE7A 2X4UA 3AXLB 4C56B 1MRCL 3VI3E 3NN8B 2XKNB 1WTLA 3JWOC 1PSKL 4JJ5A 1EBAA 1LO3H 2XY1A 4OIIH 1IKFL 3HI5H 1J9CT 2R23A 5MP6H 5ERWA 1KELH 3P4NB 1K5NA 4AEHH 5D96C 4K9EH 5FGSA 4WTZG 5CD3B 4KXZI 3QI9B 1W72B 3X3FL 2YPLB 1RIUL 4ZAKB 1J8HA 1WBXA 1INQA 2VJXA 3UTQB 1KBGH 3VGEA 4Z7NE 4OBRA 3WJLA 5GS0C 5FECA 1YY8A 3TJHD 1EK3A 4JG1L 3BQUC 1KC5L 4MS8C 1FRGH 3JTSB 4IS6B 5D7IA 5I76B 2YUVA 5DD3H 4YXLL 1B0RA 1C12B 2XOTA 3MJ7A 1PKQB 4NM4H 3ETBF 1EVUA 3HZVA 2B2XL 4NJAH 4FMFA 1FO0H 1FZMA 1IC5L 1FORL 2ZJSL 2JELH 1NMBL 1XGUB 4YZFE 3O6FC 2DBLH 3LCYA 3GB7A 2PYFA 2QBWA 3EDJA 4XXCA 3T2PA 3QUZC 1OAYH 5F7DB 1FGVH 1MIEH 5IGXH 2F54E 1TVHB 2V9RA 2UWEB 1NEUA 3DUHA 4YPGA 4LSQH 2Q1EA 3B9DA 4EN3C 1RJLB 5EOTA 3SDAA 4CU7A 3QIWC 3F7RA 4PJFE 1JPSL 3HI1B 4R4NC 3DO7A 4HJGB 2HP4A 3CLEL 3SDDB 5FGCE 4ZS7H 3HPJB 3ILPB 3GSNB 3OHXB 3VU2A 3QPXL 4V2CB 5E99L 1A6AA 3MNZB 2WUBL 1Z0NA 2H1PH 4ZOEA 1XH3B 2RGSA 2YPKA 1MH5B 3S3PA 3FQNA 1IM9D 4MXVF 4CKVX 4D0CA 1VFBB 2HRPH 3BZDA 4XPHH 4WY7L 4ZO9A 4P9HL 4JQXA 3PDDA 1KB5B 2I9LB 4ZPVB 2D03L 1DJSA 1I7ZB 4AL8L 3MBEC 3ZE0E 1RK1A 2W07A 3DTXB 4HUUA 2XICA 2KKQA 5INDB 5EC2A 5L8KB 2YC1A 4GAJL 5CZXC 4NNPL 5FCUL 4OV5B 4YEFA 1WC7B 4JO4L 4HX1A 4LSTL 3KPRD 3V0WL 2ADIA 2BSTA 1NQBA 4MDJA 5CJ5A 4QHKJ 2C3WA 2VWEC 1SMAA 2FSEB 4P46A 4Z7UE 5KVGH 2I07A 4M6AA 2JB5H 2QADB 4AEIL 2CJUH 3HLAA 1DFBH 1CZ8H 4AIZA 1GGTA 2DQJH 1JWSB 3LIZL 2X6MA 2BY3A 4TUOA 4UTAH 3PABB 1H5BB 4KFZC 5DR5L 4RMRA 4XXCC 2ZSVB 3NGBB 4NQDA 5JOPD 4Y2DD 4OD1H 3ALWA 1I85A 4F57H 3BZEA 4HD9A 4MA3B 4PJ9B 3VFMA 4BSVB 3Q48A 3ZYOA 2V2TA 5FDYA 4KDVA 2FECI 3SDAC 3MYJA 4K94L 1OGAB 4HPOH 1MAJA 2KZWA 3WLBB 3B43A 4NCDA 2X4SB 3HZMB 4R4FH 3RIAF 5FGRA 1MEXH 1RUAH 3MZTA 3V4VL 12E8L 4KJYB 3ZDXF 2NXYD 3VI3F 1F6AB 2F15A 3BPCB 3OXRA 5JZ7D 2BP3A 5E8NB 1MFNA 2NXZB 3G6DH 2HN7A 3RA7L 5BS0B 2F9BT 4M6NH 3I6KA 1NCBL 3EOTL 4GQ9L 3HCVA 4UV4H 2UY6A 3JXAA 5J13B 1Z5LA 3VXRE 3GSUB 3S36L 4Z7NF 3IDIB 4IRSD 2WP3T 4U7SA 4F7EB 3GJEA 4OGZA 4NOBA 2FO4A 1SEBB 1KLUB 1RIVL 1QPXA 2DMKA 4WGWB 2BZDA 2I60L 3SE8L 2XKUA 2GUOB 4P4RA 1E6OH 5F71A 1T3FA 1TLKA 3FQTB 2QV2A 2HFEB 3ME0A 4YQXL 4K8RH 1W8NA 2H3NA 4WW2F 5IFJB 4PD4K 4U3XA 4FG6D 4YZFF 3SQBA 3LRSB 4XBGB 1TFHA 5IOPB 5E4EC 4NCC2 1GOGA 4M93B 1OCWL 1FNEA 2OK0H 4M4RA 4XP6H 3CK0H 1I85C 2Y9RT 5E2UL 3U46A 4LU5L 5IB5A 2X05A 1C5CL 1HQRA 5E6ID 5C0BE 2A2QT 2F19L 4ZSOE 2A0LC 4ZOCA 3SBWA 4F8QA 1JGEA 4PJFF 1RZJC 3O4LB 3GBML 3EFDH 4H1LB 4UOJA 2EKJA 3C60B 4OKVB 1E4KC 3KLSA 3H7LA 4KKCD 1AD0B 2H32B 2IQAA 4HJJH 5BVJA 3FTGB 1IEAA 4NJ9L 3V5HA 3KYMB 3TVMA 2FWOA 5F96H 2IANE 2VLKB 2R4RL 4TPRH 4FQHB 1I7RA 1P1ZA 4HXAL 4M7LH 3BKYH 3C5SB 1OAQL 3SDXA 2CIKB 3QBTB 3W9DA 4I0KA 4RMTA 4MLIA 5A16B 2APTA 2F54D 3ZE0F 3QXAB 3BISA 1A1MA 4OZFH 5LQBL 2AXFA 3T3PE 5FFLA 3FHAA 3VXSB 5EC1B 1N6VA 5FK9B 3GMPA 4FQQB 3JWDL 1CLZH 3P4OB 2YA2A 5ACZA 4Z0XB 4HZAA 3WS6A 3MCG1 5HYJA 3OJDA 2CGRH 2DD8L 1JN6A 1HHIA 3GGWA 4JFOA 3T4YB 1L9MA 3QFJA 4Z7UF 2VUYA 3ULSA 4YX2L 1GGBL 4X4ZA 2ITDA 1BVKA 3O6KL 4AENB 1MELA 3U0WL 1BVLA 2Z93B 2AABH 5D6CA 5EA0L 5IR1B 2RFXA 4OLXL 3FT2A 3OBAA 1KCRL 5DRNB 3TT1L 3RL1A 2DQFA 4JG0H 1KXQE 3C5ZB 5T5NG 5ACLA 5C6TL 2XKSA 3NABH 3QCUH 1FG2A 3JV6A 1SHMA 1P4IH 4FABH 2CIIB 3OJVC 4FQ1H 1RUML 5FM4A 4E9LA 3DROA 2BSED 3AXLA 1PLGH 2NTFA 3IDNA 4QXUH 4TNWF 4UAOC 4C56A 4X4YB 1FYHB 1U8KB 1NMCB 4U1KA 1OHQA 3FQUA 1E6JH 3EW3B 4WWID 3X14B 5IBTH 1CICA 1QFPA 5I17B 5JORB 3GJFK 2ESVE 2NYYC 5JIKA 3TBSB 2W9EH 1W72A 2WWMD 4JDVB 1BJ1H 4OCXL 4OCNC 3C2AL 1NLDH 5TPWH 4RX4A 3QPQD 2D7TH 4X9BA 2W9LA 4H88L 4K23L 1YECH 3DETD 4QHMA 1S7VB 1MCQA 3HC4L 1U42A 5GGSB 1BREA 1WWCA 3K4DA 1LHZA 2EYSB 5C09B 4G9FB 4BZ1L 2H2SC 1MCCA 3CFJA 4RAUA 3V6ZB 1TQCB 5GS3A 3AMKA 5I0ZA 3MRCB 1DZBA 3DRTA 5J12B 1PKQA 3GIZH 2DL9A 5F7YC 1Q0YH 3WS6C 2IBBA 2EDTA 1I3VA 1OM3L 5AYUH 4GRMA 5HHXH 1XEDA 4K3JH 5CCKL 1QEWA 1XIWA 2B4CC 1NC4B 4LAJH 1F2XK 3V4PH 5HYQA 2W1NA 5F7DA 3RAJL 4E0RB 1YYMH 2F5AL 3QQ3B 4OF6A 4NP4H 1G84A 1RJLA 8FABB 4FQPA 1U8IA 4QY8B 2VSCA 3OZ9H 5IQ9B 5GQBA 4MD5B 5LBSL 5FXCH 1RZIA 4UB0H 3VXRD 2XYCA 2FX7L 5C9JB 1ZHLA 2MQ0A 3QCVL 2NY2B 4MNGB 2YN3A 3TNNA 2JJUA 3A6CL 5EOCJ 5D2LA 4QOKA 4DKDC 4UQ2B 2ICWB 1MH5A 4PY8J 4TSBH 3PL6B 3MLWL 5EUKA 1IBGL 3TJEL 5I1KL 5D1ZD 1CICC 4I9WE 2YEZB 4FOMA 4ZPVA 4XVJH 5L2KE 4XWGH 3QI9C 4LRIC 2BSSB 3CPLB 4ZAKC 1XGYH 1Y6KR 5FYJL 4ZUTB 5HDOA 2YHGA 5C2UB 2O26U 4XPBL 1QNZH 4OFYD 3L3DB 4OZFG 2DYPB 1WC7A 2AKRB 5DEFB 3P0GB 4YDKH 3RY5A 1B0GA 4BH7A 1ZLSH 3T3PF 4WTWA 4L8SB 1CQKA 1Q0XL 5C0BD 1GZPA 5IEKB 1DVFA 5KANG 1T89A 2Y72A 3QUXD 4U3CA 2DL2A 3HPLA 1JYVA 3C8KA 1RUPL 3PABA 3VFUB 5C0ND 4XZUA 1TQBB 3HZYA 2DF3A 2Z9TA 1WIOA 4GW5B 2IAND 5F9AC 1JV5A 1QTYT 3DUUB 1YEDB 3QIBB 1IAIL 5DGQA 1ZA3B 1U93B 2WBWB 5FUCE 4J3UA 4HH8A 4MA3A 4YPJA 3T77A 4BSVA 5E56A 3UPRB 4DN3L 3ARGB 2P46B 3IKCA 3L7EB 4XHJC 1AXTL 3ALXA 3WLBA 3TV3H 3SDDC 1WLHA 4N0YH 3R06A 3RZWA 4Y4KB 3F7YB 1KTDB 3C6LB 1UACH 1KEMH 3IKKA 4N68A 1CGTA 4HWBA 1TMCB 3VCLA 5KSUB 1A3RH 1OGTA 5MENA 5JPNB 5DMGC 4UNVA 4EBQL 5BQ7B 2GSGA 2N4IA 5ITBL 3ARED 4GKSB 2JE8A 2XFXA 3PIQB 1VCAA 2HFGL 3BT2H 5EU5A 5LCVL 3HNSH 2I26N 3PWNB 2EXYD 2J88H 1KN4H 2B1AL 4PV8B 4KUZH 3HNTL 2ARJB 1PAMA 1VGEH 2VTFA 3DX9A 3RWJB 5FYLH 4HUXB 4KJQC 5I15H 4F7EA 2AV1B 3T2NH 3VWKD 2BHUA 2EXWD 4MCYA 5I1LA 4YDIL 5DVNA 3L3IB 4KU1A 5MEQA 5DRWA 1VEMA 2W0PA 5HHOE 3IDYB 3FQTA 2HFEA 2QADC 3SE9H 4APQB 4P4KD 1WWWX 5F6HJ 4XAWL 1P2CB 1S7QB 3VRIB 1AXSA 1I1AA 3IFOB 1YEHL 1H5BC 2VDPH 4IRJA 1N6UA 2X4OA 4M48L 5CJQL 2H41A 4OIBA 2EDRA 1QRNB 3NGBC 4LCCB 4QWWC 2ESVD 3WFHB 4OBSA 3UYRL 4OFIA 4JRXE 4ETQB 3GMOB 4PJ9C 3BDXA 3WIHH 4QXGH 2VZVA 4TSAL 2GY7B 2CQVA 1VACB 2WBJD 1Z2KA 3QHFL 2H32A 2R2EB 3CFDB 2ZKHH 3FTGA 4ISVA 4UT7H 2CO7B 3S9DB 3RI5K 5TFSH 3KYMA 3MXVH 1P7KB 2IFGA 1F3DH 2GTWB 1ZAGA 2HT2C 4DTGL 5D6DA 5J4MA 2NXZC 4W6YB 3T0BA 2P8PB 4B5EA 3BH8B 4ERSH 4ETYA 2R1WA 3MRHA 4KHXL 2YPVH 5A16A 5J13C 4F8TA 3V7AE 3CMGA 3QXAA 3MRBB 3FZUC 3KWWA 3IFPA 4RMVA 4KK6C 5FK9A 3QEUA 4HUNB 3PWUB 4HMDA 5KN5B 3P4OA 4Z0XA 3FFCE 3FO0L 3BDYL 3MRKB 1BBDL 2FGWH 3GSQB 5I18H 2A74B 1BFOA 1NKOA 4QGYA 1AD9A 2WUCL 3FRUA 4QHUB 3W81A 4S1RL 3LN5B 1FNFA 2VE6A 1OOAA 3FFDB 4XTRC 1PJ9A 1B6DA 3G08B 4DUWA 3LKQA 1L7IL 1FZJA 4M93C 3WUWA 5INCB 4S0TD 3WN5A 4I9WD 5HHNA 6CGTA 5L2KD 5I66B 5E5UB 32C2A 5DRNA 1GGYA 2NTSP 1LE5B 1NAKL 3C5ZA 4D0DA 1ZGLA 1RUKL 3HE7D 3IAPA 5ECJE 4Z76A 1V8HA 3DV4A 4G42A 1IJ9A 1FP5A 1EEZA 2XZZA 3C60C 5D1XA 3ZL4L 1JI1A 4MA8L 4RISL 1DQML 2C3VB 4X4YA 1MIMH 2VL5B 3EJJX 4D3CH 1IM9B 3MRRA 1MWAH 1RAMA 1FCCA 4MMXC 1X9QA 1IMHC 4KJPD 1NPUA 3C6SB 4XWOC 3QEGL 1MJJA 2J1KA 3H9YA 5L9DH 1VB9A 1WIPA 2QEJA 1U8PA 2JIXA 3DVGB 43CAB 3D1MC 1YDPB 3HE6D 5GS2D 4QF1B 1N5YL 1AQDB 5AWNL 4OF7A 5FDWB 2QQKL 1SVCP 1MCKA 5DC9B 3D2UD 1U95B 4XP1H 1JWMB 3IDJA 3LQAL 2YRLA 4K3EH 3SCMA 4M4PA 1T5XB 2X4PA 2CDGA 1MI5E 3D3VE 4PRAB 2XN9E 5TDNB 5HBBA 4PRHA 5CINL 3V52L 4Y2DB 3UZEA 4PGDB 1UADC 7FABL 1NLBL 5C6WH 3TBWA 4NWTL 1XF4A 3L3OB 5IROC 5K9JL 4LRNL 4P3DA 3GK8L 1RZ8A 1BBJB 2N1KA 2RJMA 3C5ZC 4PP1C 4W70A 4A6YH 2GK2A 3N85H 3QDJE 5MERA 4X9HA 4H8WH 4YHKH 1UKSA 2XIDA 1CYGA 3B3IB 2XV6B 1MQ8A 4GXVL 4H26A 1NMCC 2NXYB 3FHQA 2V9QA 5HHOD 3PL6A 5TQ0L 1IGJA 1EEYA 5GSRB 3TN0A 3UJTL 4CAGA 2HTKC 3R0MA 3D5OF 3RTQD 4MB5A 2DQHH 2ZCLH 4N8VA 4JZOB 3O3UN 4O02L 1NGPL 4E41A 2Q76B 1L7TL 4GW1A 1BQLL 4CUCA 1RJYB 4ZUSB 2AKRA 2IPTH 4IRSB 2BXYA 3GUTB 4TVPL 2Z91B 4JRXD 4XPFH 2OJZL 3U2SA 2WWKO 1TQCC 2JCCE 4LOUD 1MHPL 3V6OE 4O2FB 5J12C 1DBBL 2M1KA 1OTUC 2HFFB 4KY1L 1BMGA 1HILA 5ANMA 3GMNA 4I0CC 5K9KA 4LF3A 4V1DE 4ELKB 3OKNB 4JPVL 4QLRA 5IBLC 2CLRB 2KH2B 2D7PA 4P5MB 3EOAB 3H0TB 1YEDA 3WFEH 3DRQB 3T8XA 4U33A 5E1AB 4PRPE 1ZA3A 4OLEA 5IFHH 1DE4A 1QLFA 5ICZA 3LMJL 5HHQA 3TZVA 3UPRA 5E6IB 4ONGH 2W0FA 3ARGA 3HZKB 1NMAH 2X1QA 3L7EA 1J88A 4UQ3A 1OP3K 4HIIB 3B2UD 3EGSB 4UDTB 3WEXB 1O0VA 3DMMD 5ADOL 1K6QH 1F4XH 4Y4KA 1N6QH 1KTDA 3ARUA 4MNHA 5F7NC 2NY2C 5DK2A 1KG0A 1S9XB 3B8YA 3I6GA 3FFCD 3UBXA 3TC9A 1JMZA 3MOBH 1NCCL 1BPVA 3PL6C 5JPNA 5D70H 4HS3B 3OXSB 4AJ0A 5BQ7A 3FO2B 4V2BA 3ROOA 5J06A 5HI4D 4ELMF 3PIQA 4LP4A 5DK0A 5H2BB 5CP3A 1SYSA 2QSCL 1FG9C 3PWNA 4URTB 4OM1L 4XCFL 4Z18A 1M7IA 2F54B 3KR3L 2ARJA 4BUHA 3RWJA 2RAMA 1EEUA 1DL7L 3BDBA 5E4IA 1AHWB 5GZND 3CZJA 4XCNA 1FL5B 3V0VA 4BUGA 4L8SC 5DHVB 1U2CA 5T1DL 1XCTB 3GHEL 4WWKD 1JHTB 4NBYB 4JZJB 1FZKB 2VC2H 4FRWA 4PJFB 1K8DA 2VLRE 2CMRH 1CE1L 4BFIB 5FGCB 4I2XE 4M5YL 1DUZA 5AZ2L 2ED9A 3VFOA 1CF8L 1P2CA 1S7QA 4DGIL 2BFVH 1ADQL 4KMQA 3WNKA 5DRXB 1TQBC 2G5BA 1TETH 5EFIB 4ZFOL 1P7HL 1AGCB 3FT4A 1JNHB 4FQCL 1CT8B 3QIBC 2IJ0C 4N9OB 1NSNH 2R0WL 2WIMA 3B9AA 4J12A 4NQXB 3WFHA 2DIAA 1A7RL 1BOGB 2J8UE 2SEBB 3MFGB 4AH2B 4Y5XA 1N7MH 2F74B 5JXAL 2GFBB 3A6OA 1NAMH 3ARGC 5CS7A 3S96B 1J1XH 5EUOF 1EJOL 4HKJA 5BZDB 3X12A 2A6JB 4Y4KC 3C6LC 5FA4B 2OP4H 5DJ0B 5HDQH 4NHCH 5EZOH 1FZOB 4OD2A 4C57C 4OCSH 2R0KH 2GTWA 4Z7UB 4WJ5B 1TZGL 4XVTH 4DQOL 1IFHL 3BAEL 3K2UH 4JRYE 3N9GH 5IFAL 4YHZL 4OAWA 3BH8A 1SY6L 2CRMA 3EYQD 5IB2B 1OP5K 4AG4H 1MI5D 3D3VD 5ILTH 2XN9D 2YSSA 3QT2A 4PRBA 1R0AL 4G8FB 5LWYL 3OPZH 4Y1AB 5JR1H 3TH2T 4U1HA 2GY5A 5KN5A 1YQVL 1W0YT 1I3UA 3O8XD 3MQIA 4FXGB 4EJ1C 2JCCF 1YMMA 4WU7A 3IDYC 4NNXA 4KI5E 4EZMA 2BHZA 1UWEL 2NY3D 3LKPB 4N1EA 1I8MB 3QDJD 1R3HA 5GHWL 4LHJB 3VFNA 4APQC 3I50H 3OKOB 3S7GA 4QHUA 3G5XB 3MX0A 4OLVL 5IP4A 3MV7A 4J3OC 4GBXD 2IBGA 3EYUL 4YUEL 3QH3A 1IC7H 4U1JA 4Z0BL 4LCCC 4O9HL 1QR4A 1CFVL 4FXLA 2HLFD 1CE6B 5I66A 1KPRB 5BMFH 1PD6A 2G75B 1E4WL 1CU4H 3NMEA 3KDMA 2FIRT 5T1KA 3VXRB 1ZOXA 2LTQB 3W11D 5E0QA 1I9EA 2DQGL 5H94A 1I1FA 1F42A 1VGKA 5GS1A 1MCEA 4ZFZA 1RU9H 2X4QA 2MFNA 4ZDHB 3RWCB 3UTPE 4XBEH 4JZNB 3STBA 5DRZB 4UT6L 2VXQH 3RJQB 4DFHA 4L1DA 4OCWL 5EPMA 3FMGL 5D1ZB 4V1DD 4X9GA 4TOYL 3OG4B 2XWBB 4LSSL 3PHOB 4MX7B 4X8XA 1UM6H 4PRPD 3HC0B 1HQ4A 3TJHC 1JTTA 43CAA 1QA9A 4PTUB 4NDMB 1YDPA 2HVKB 1A7NL 3BSZL 1GHFH 4QF1A 5F3HB 1HHKB 1FC2D 3RUGE 1AQDA 5IESL 5I0DA 4ZSOB 4WFHE 4HUMB 2ED8A 4Y8AA 3WUWG 2A6DA 1MRFH 1ZGLM 4GXUN 3QUXB 1LDSA 4Y5YB 5C9KA 4YXHL 2XRAL 1NGZA 5DFWH 1FPTH 2FEEI 4N0FB 4IMLB 4OFVA 2DLFL 1JZ3A 2AEQH 1VSCA 2C1OB 1F6LL 1JPTH 3SKMB 1QZ1A 1OAUL 2CK0L 2IANB 3VI4E 2FZ3B 3X11A 4PJGE 1LE9B 3WXVH 1A21A 4F58H 1HSAB 4PJEE 3ESVF 5L6YH 5FM5O 3O6LL 1QBLH 1WZLA 4PJAB 2IQ9L 4LBEB 1J1OH 2OZ4H 3PHQA 3CVHL 4P9HC 1YN7B 1R5WA 2J8UF 3P73A 4EIZC 3WBDA 1KTLB 4M9OA 2VITB 3LV3B 4FQIL 1S5HB 1ZT1B 4XH2A 5DMYA 3TO4D 5JTWA 3NA9L 4OGXL 3O6MH 3MUY1 1JNLL 3B3IA 1CXEA 2DMCA 2FJFA 5F9DC 4OZHE 1RZKL 2VLRD 4GKOA 4HT1H 4RFOH 4O4YL 4PJHE 3MXWL 1CS6A 5F70A 1LEIB 5IF0B 4HJ0D 4RWYL 5DDHA 1T4KB 5E2VH 3OAUL 1A7OH 2JKXA 1WV7T 1T1WA 4L9LA 2AJXL 2BCKA 3RIAK 5LVEA 3U0TB 5E00A 4P5TD 4U6YA 4ZNEE 5F1IB 1LMKA 3VWKB 2P24B 1TJIL 4XNQB 2FIKB 1PSKH 3NFSH 1UQSB 1PY4A 5EOCL 3UTTA 5E5MA 3VE0B 4O2FA 1IGFL 4BFBD 5IJKA 5GRUL 5C0CE 4WFFE 2AEWA 1IM3B 4MQSB 4LPCA 1G7PB 2HT4D 4P4KB 2DKMA 1VEOA 3CXHJ 4KV5E 5HGBB 3OF6A 4JN1L 3QDGE 4ELKA 4Q6IB 1EPFA 4OCMC 2BERA 5CD5D 1BJ8A 1KXVC 2A77L 3Q5OA 4JFFA 4HUVA 4JRYD 1OW0C 4Y2DC 5F8QC 2ESVB 1A64A 5ISZE 4S1SL 1MCOL 2EH8L 2V2WA 4YXLH 5E6IA 2Z4QB 2KUTA 5TE4H 3KYKL 4XNZB 1TJGL 2C1PA 4R3SB 3QZWB 2CKBH 4N8VG 2WBJB 1DQLL 1N64L 2DN7A 2IFFL 1JZ2A 2AEPL 5DTFB 5JHLL 3LSOB 2RQ8A 2PTVA 1AIFB 3VG0H 2QLVB 1N5AB 1EA9C 4HCRH 4OLYH 2NXYC 4ODHL 1HXMA 4KI5D 5JZ7C 1FV1B 4L3EE 1U0QA 3PWPE 4JFDE 1AH1A 4ODXA 4CNIB 3DARA 1RY7B 2DLIA 1XCQA 4BQ8A 1JPSH 4NRXA 3HAEA 4K7PH 5MI0B 4PJCF 1KTKE 1BQSA 2E6JA 2PW2B 8CGTA 5I73B 3QPXH 2CDFA 4IRSC 4K07A 1FQ9C 5FHAL 4C4KO 5A43C 1YEKH 3RVVC 1IAOB 4YBQD 4W4OA 3OTTA 4UDUA 1PG7W 1HEZB 3BH9B 4ONHA 3RUGF 2UUDK 3JWOH 4BFIA 3OAYH 1ACZA 1NCDH 3IS0X 2UZIL 1LNUB 2VRAA 2AAVA 4GG6E 6FABH 4KPHL 2D03H 1S7WA 5DSCB 4Y4FA 3UTPD 2B39A 4MJIE 3AU1B 4Q0XH 5DRXA 2E3VA 4FG6C 2A1WH 4Y5VA 3STLB 1AGCA 5FOBB 1QSFB 2LE9A 2C3XA 1CDIA 1BJ1J 4LASH 5FCUH 3VI4F 1CDCA 2HJKB 4PJGF 5CEZE 3V0WH 4NQXA 1NBZB 5L2KB 5GS0H 3MLVH 1BOGA 4JFEA 4MNQE 3UBXG 4PJEF 1F5WA 1EHAA 3P4MA 5I1IL 4P57B 4U2YA 5E6IC 4XPGH 1A6UH 5SWSE 1RUQH 1A7BA 1AY1L 5FKAA 2DWDB 3UC0L 3RL2A 1JZ5A 5D71L 1JZ7A 4NIKB 5DS8A 3TWCL 1N4XH 4MJ5B 4KKCC 5FA4A 2XWTB 4TQEH 4WFHD 1FZOA 3U9PH 2RCSH 2VDNL 4XC3L 1FFPB 4OZHF 4XCEA 3HN3A 3QXTA 1Z3GH 1BAFH 4L8BA 5E2WL 1U8JA 3JWNC 4PGCA 3SY0A 3HRPA 1H3TA 1HZHL 3LKRA 1AR2A 3K81A 1D9KD 1I4FA 4K94H 5SX4H 4MB4A 1H0DA 4TNWK 3GO1H 4HGKC 1TITA 1JZ4A 3ZSSA 4Y1AA 1I7UA 4Q6YA 1T2QH 1UZ8B 2P43B 4U6VL 1AHWC 4DUXA 4HC1A 1UVQA 5IB3A 3LAFA 2AJVH 4JKLA 4NRZA 3HE6B 5HHPA 4NKIH 5D7SL 3IU3B 4LHUD 4WIQA 4YGVA 4JZJC 1TNNA 4MSWA 2HJLB 3SGKC 3LKPA 4LSVH 4YDVA 3DX8B 1CFTB 1U8OA 3S5LB 1NCBH 4KV5F 3Q6GL 5JIHA 3ULVH 1S78D 5I6XB 3C87A 1MFEH 1Q9LA 3EO1A 1UJ3A 1XAUA 3MJ9L 1YJDH 2R29H 4RGNE 4XNUL 3MV01 5EBGA 3SDCD 4R8WH 2O5YH 3WD5L 4F37F 3BKML 1FVDB 1U8HA 4NN7B 2N56A 1JFQH 2Q7YB 2BVTA 2K1MA 3H9SE 4AIXA 1BM3L 4J1UA 5CKGA 4MHHI 2FYYB 3EBAA 1IE5A 1LK2A 5GRXG 5CZKA 5EU3A 5DRZA 3LEXB 3FQXB 5HHOB 5C0CD 4WFFD 2A6KA 5FYKE 4X6BA 3RTQB 4MAYD 4WI7A 5TDPA 3QDGD 3QUYB 1MCWM 3IB4A 2WWMC 5KSVB 2BVQB 3VGGA 4KRPD 3QPQC 4R4BB 1UXSA 1ZA6A 3DETC 1DDHA 1CDYA 5IVZA 5ISZD 2E8ZA 4PTUA 5HDBE 2H26B 1GIGH 4JRXB 1PQZB 3ILQD 4GAGH 2PTTA 2EDJA 3NIDE 3L5IA 2YR3A 4J3WA 2G60L 3S4SB 2APVA 1MCFA 4Y5YA 1TZIB 1T1YB 3NH7L 4RMSA 3BZFB 4NQEE 3TCLA 3RZCD 5DC0A 4I3RL 1CG9A 4GG6F 5AZEL 1DQDH 3SE4C 4IMLA 2FR4B 5DJYB 1OF2A 2XPGB 4YHLL 2R39A 3RWHA 2R1YB 1WBZB 3L5JA 1LE9A 4ZTPL 4L3ED 3HHRB 2DQTL 4LLQB 3PWPD 4G6KH 1W0WB 4JFDD 5E5RB 2WQRA 1KN2L 1JRHL 3R8QA 4PJAA 1U8QA 2PCPB 2NX5A 5CEXB 4G43A 3ZE2E 2Q7NA 1G7IA 3FN0L 3LV3A 1AKJA 1S5HA 2Q8AH 1XGRB 3QO0B 1KGCE 2LTQC 1PG7L 1TZHA 2ZG1A 2APWA 4HLZH 4FTVA 1UCBH 3DMMB 4ODVL 4QTIH 2VOTA 2BMKB 1CD9B 4F7TB 3LKNB 4YDLC 3FFCB 3I85A 1IAMA 5I8OH 4HEPG 4PS4L 5C92A 1OSZA 1J0JA 1KPVB 4ZUWA 3GJFA 2AQ2A 1S3KL 1P9MA 2DIJA 1FDLH 1FGNL 1LEIA 1OSPL 5D1ZC 1ACYL 2ADFH 5F9JA 5TE7H 4MJID 4QXTA 4YHOH 1G6RL 3U7WH 2ZUVA 4ACPA 4NO5B 1CFBA 1EBPA 1MPAL 3TBTB 3LQZB 3W0WE 4QTHA 4ZFOB 2ZUTA 3SDYL 5H35B 2DB8A 2CDEB 1NH6A 5F1IA 5CEZD 4LPVA 3HUJA 3U4BH 1WCQA 4MNQD 2XZQH 1RZJH 1FE8L 2Z8RA 4XNQA 2PO6D 1CFQB 3D85B 4WWKB 1ZEAL 3WKNA 2VQTA 3OKMA 5SWSD 3VE0A 2VDRL 4RAVB 4M43L 5IW6B 1H3PL 3QUMB 3QUXC 3UPCA 4Y5YC 1A9EB 4WI6A 1T1XB 3U9UB 3V6FB 1F90L 4BZYA 5C0NC 1GGUA 3ARXA 2F8VA 5JMRA 1RHHA 1T21B 3VJ6A 2H9GB 2GTZA 2P5EE 1JF6A 4X7EC 5HY9A 2Q87A 1MHHB 1EGJL 2XWJA 1A2YB 3M17B 3MUGA 5E7FA 2EYTA 1PZ5B 1YN6A 2IEPA 4GMTL 4PB0H 2Z4QA 4LLDA 2BX5A 3VFSA 2Y06L 5L2JA 4Z95L 1ZVHA 5KSAD 5J6HB 2VR5A 1RFDH 3P11L 1JTOA 4RNRA 3QULA 1FL3A 5DTFA 3IXAA 3T1FB 5ENWA 4DGYH 2FRGP 5IG7B 4EVNB 4DJMA 1MF2H 1DN0B 4CADB 4HC1H 5DD6A 1P4BH 2OQJB 2DLGA 4JM2D 3MA9L 4KVNH 1QPPA 4G7YH 3QEHB 1MI5B 3UJIL 3HFML 5LBSH 3D3VB 1DBAL 1MCPL 2EXYC 4NZRL 3W82A 3WCYA 4X6FB 1G9NL 5EU4A 1LP9A 3SJVA 3LRHA 2J5LB 4RGND 1K2DA 1G7QA 2A9MH 1EAJA 3VWKC 1GSMA 4FFVD 5HDBF 1AR1D 2JJSA 3IF1B 3O8XB 2JB6B 1B4RA 2J8HA 1CIDA 4GRWF 1B9ZA 3TNMA 3DX6A 4CBPA 1R3LB 1DBJH 3KPQB 3H9SD 3MLSL 3NIDF 4WV1A 2NY3B 3PGDB 2CKNA 3QDJB 4HBCL 4P4KC 3ZYIA 1T22A 4X5XA 4LEOA 5DSCA 4DVRL 2XZCH 4B7IA 2F5BL 3E8UH 2DJSA 4Q6IC 2QQLH 3OQ3B 4FQLL 4GMSH 4XPBH 4JGUA 3MCLL 1QSFA 1MNUH 5FYKD 3RGVB 2OM5A 2HWZH 5D5MA 1MQKL 1ZS8B 1SVZA 2EECA 4P59H 2DJUA 1CGUA 2VISA 4M1DL 4NKOB 3ZE2F 1I7TB 1XF2B 2YUZA 4XNZC 4HLZG 5E95B 1QSZA 1ONQA 1J8HE 2GYSA 3NIFE 4XCYB 1LO3L 4OIIL 1OQXA 2WBJC 2ZOKB 3HI5L 1KELL 2JCCB 2B4CH 1A6TB 4AEHL 1NFIA 4DK3A 4K9EL 1FFPA 3P77B 1NGQH 4HKBA 4QXWA 3VD5A 2GW5A 5D7IE 2BK8A 1KBGL 3D69B 4NQED 4ZXBD 4V1DB 3LH2H 4LKXA 4PGBB 1FC1A 3SOBH 3MRGB 4DN3H 1X6NA 5I8KH 2AEIT 1FRGL 2BJMH 5KW9H 2EDXA 2AERT 5MI0C 4PRPB 4U0RB 3ARDA 5I8CA 5I73C 1L4IA 4NM4L 4PTTA 4IIQA 1XGQB 4NJAL 3F7PC 3O3DA 1FO0L 1FLRH 3CVHB 1BIIB 2VLLA 2JELL 3VH8G 1A6ZB 1KGCD 1QFUH 2DBLL 4XPAH 3BD3A 3DHMA 4U4BA 1U36A 3KPPA 1FGVL 3UZVB 1MIEL 3S5LA 1JF1B 4KK9D 1ZHKA 3GMRA 1OD7A 1WCBB 3CXHK 3OKDA 4H20H 4LSQL 3O3EB 3IXTB 4LLWA 2IADB 4YAQA 3U0PB 4FQ2H 3F7VA 4OSUH 4Z78A 4QYOB 4M6MH 4NRYB 2WP3O 5IB4A 1A3LH 2X7LB 3GSOB 4EDWH 3W0WD 2Q7YA 3CMOH 5HJ3B 4AEEA 2H1PL 2YKLH 4S11A 3TO4B 1UXWB 2C4XA 1BZ7A 4UU9B 3LEXA 2OL3L 3MLXH 3E6HB 4UTBH 1ZVSA 3FQXA 2COQA 4XPHL 2VLRB 5BZWA 2IG2H 4I2XB 2DJ4A 3EYSH 3PWJA 3ES6A 1F02I 3ZKND 4PV9A 5DT1H 4PJXA 4I77H 4ENED 3LQAC 2YD9A 3QUYA 4FQJH 4KJPC 2YN5A 1AFVH 3BP5B 2BVQA 2P5ED 2Y25A 3RQ3A 4EUPH 3GMQA 2QSQA 4TSAH 4P5TB 4QO1A 4NSKB 4ZPTA 2WZPD 5HGHB 2DDQH 4JY6A 5FUCC 2J8UB 5GRZA 5KVGL 5CHNB 1H15A 1PQZA 3EYVB 4NQDE 4IIQC 3HE6C 2JB5L 4Q2ZB 2CJUL 4LCUB 5FHBH 1DFBL 1CZ8L 5EIIB 2BRRH 2D0HA 2DQJL 3CX5J 2VKXA 5DVOA 4UTAL 5HD8D 2D7QA 3CUPA 5C86A 2ZCKH 4WW1A 4LNRB 5FO9A 1FH5H 4OD1L 3OGCB 2XPGA 2NY4D 4KHXH 5EBLA 1DTUA 1MCBA 4F57L 3KPMB 2W38A 4K7FB 5I6XC 3DVNB 4F9PA 2G2RA 3IJHB 3H3KA 4MGXA 1NBVH 2PCPA 3ARBA 4NBZB 4HWEH 1QRKA 5CEXA 4U1IB 4D8PB 3M1BB 4JFPB 4UOW0 1P53A 4R4FL 4NN7C 1O7VA 5F9OH 2JJTA 1RUAL 5IK3A 2ZP0T 3QUZD 4YFDB 3BP7B 3IRZA 3NIFF 4X99B 3GM8A 1X7QB 4XAKE 3LKNA 4KZDH 5JO5B 1NDMA 1OLLA 2LAAA 1RPQA 3S88H 3G6DL 2GSIA 2A73B 3CFIC 4MA1B 2YD6A 1R24A 2DQCH 1KPVA 2FJGA 3DECA 3TEUA 4PUBH 4K8RD 4M6NL 3MCKB 3BKCH 1NUGA 4IDLA 4PLKD 4UV4L 3ZZ1A 3RTQC 3T3ME 1LEGB 4UIKL 1ADQA 5ICXA 5DMKB 3KHQA 4IDJH 1BF8A 4PG9B 1FFOB 3QUYC 1V7ML 2DI8A 5C8JB 4BSWB 3LEYH 1NL0H 2IALA 3QNYB 4FQXA 4O5LH 4ZFOA 5H35A 1T7YA 4W4NA 4M03A 4BQCA 4FN0A 1E6OL 1ZT4B 3CVIH 2GQHA 4OB5H 3D85A 4Q9CA 1A1NA 4YO0B 4LOUC 4ONFL 4WO4B 3TBVA 1J8HD 2GITB 3CFKA 4G6JH 1AO7A 3B9VA 1WWAX 2OK0L 1YNLH 1LO5A 3M07A 5GISH 2H9GA 4M62H 4OZ4B 3CK0L 4XP6L 1I9JH 3TT3H 2MPAH 4YXKL 1PZ5A 3IDGB 1ZSDA 1HXYA 1IEBB 1OL0A 3WFBH 3MREB 1F58H 2B1HH 1KSRA 1SY6A 3EFDL 3N1PC 1UWXH 4RQQB 2GEEA 3SDXE 1P7QB 4HJJL 3B2UC 2ERJB 4J2XA 3DMMC 2FGZA 5F96L 4TPRL 5IW1B 3AS3A 4XB8A 3T1FA 5GGRY 5CZVH 5GRWA 5BV7H 3BKYL 4EVNA 5HYSA 5CINH 4R0LA 3SDAD 2X4RA 1NLBH 1LO4H 3J7HA 2OQJA 3HS0A 1HI6B 1B4JH 2YMXH 5C0AA 1I1YB 4HS6A 5HI4C 5HYJE 4PGEB 5JMOC 4PRDB 4QRRA 3QFJE 5K9JH 2V2XB 4LRNH 1D6EA 4EUPG 4PJGB 5KVDH 4PJEB 4OQ1A 5GZNC 4OUUA 2YS4A 4PJBA 1HHJA 2CGRL 1PVHA 1JUFB 1X3DA 4H1LH 4WWKC 4F3FA 3G6AA 2KDGA 3O4OB 4Z77B 1ED3A 4OZGA 1EFXD 3UJTH 3DGCR 5FM8A 3RWEB 2V9TA 5CJXC 1E4XI 4LPYA 4YNYA 5DVLA 2AABL 4KJWD 4UILH 1G7LB 4YHMH 4KKLD 4N90E 3OJ2C 4RGOH 4QT5B 4PJHB 3RGVA 3OAZK 1MOEA 1VADB 3L5WB 4C56E 4MZ2A 4JO2H 4JG0L 3QB7C 3OSKA 1JK8B 3O2DA 3I3EA 4P46D 1J0KA 3NABL 3QCUL 1GXEA 3SE3C 1P4IL 3C5JA 4FABL 3ARZA 2OXHA 1LWRA 4FQ1L 5IBUB 1PLGL 4QXUL 3GDBA 1RIHH 4XCYA 1I8IB 3WNPA 2Y1VA 4ODBD 3U7YH 15C8H 1T7XA 3BXNA 2XTLA 4MLSA 4NQDD 1BX2B 3ZTNH 5KTEH 1C08B 4J4PA 5DYOA 1YC7A 1JGLH 5IV2B 2W9EL 5C0CB 1PW3A 2NY1D 3BD4A 1F3RB 4R0LC 1AGFA 3WL9A 4OI8A 1NLDL 5TPWL 1HH6B 1PKQE 2D7TL 4V1DA 5CAYB 5B39B 3QDGB 3T3MF 4UI2A 3EYQC 4MD0B 2VLJB 5FB8B 5B8CB 4ZD3H 3QHTC 4YEEA 4KRPB 3VW3H 5GIRA 4Y8DC 2LQRA 5FEBA 5F7KC 3MUZ1 2YRPA 3PUCA 2J5LC 3C2SA 5ISZB 3GIZL 2EDEA 3R0NA 4TNVF 2A83B 1XGQA 3QDMA 1Q0YL 5HGAB 3QP3A 2DMBA 5J9PB 5HPMB 5AYUL 5I2IB 3CVHA 3O8XC 2YBRA 5F88B 5HHXL 4K3JL 2FH6A 1UB5A 5LGKA 4C83A 3V4PL 2ADJB 4GT7A 3ECBA 4X6CA 3UTOA 4M61A 1KACB 1FVEB 2NY3C 1YYML 1JPGA 3RZCB 1DBKH 4XAKD 1MAKA 4YR6A 1WCBA 2P42B 1EMTH 3O3EA 4NP4L 3BPLB 5DUPH 4L3EB 3OZ9L 3RGVC 5DUMH 3PWPB 4IRZH 5D2LE 1GZQB 4QOKE 1S5IH 3LEVH 3VDCA 4UB0L 2VZ3A 2HJFB 3ZDZE 2GJ6B 4TYUA 3EHBD 3GSOA 1G6RB 4B41A 1CE1H 2L7UA 1QOKA 1HHGB 3NAAL 3MMEB 3W11C 4S2SB 3SDXF 1Q9WA 2WNGA 5DD1H 1A7QH 3R4DA 4C54A 3AROA 3OWEA 1YUHB 3V6OC 5JLZB 3G5VA 3KPOA 3F12B 3MLZH 4XVJL 4XWGL 4Z7OF 2W59A 3L3KA 5HYEA 4GG6B 4I48A 4S10A 5EO1B 1QNZL 3G9VA 2Z35A 4O58H 1OAXH 1VENA 5IIEB 1NDGB 4YHPB 5C0IA 4YDKL 1ZLSL 3RJDA 3BP6B 1AQKH 4NO2B 1WQVT 4U0RC 3TESA 3TVMD 1H3WM 1TCMA 2AJ3B 4H1LG 3EYVA 2PO6B 2O5ZH 1QR1B 5FKPA 1T0NB 2CK2A 5SWSB 4F9LC 1WIUA 4PJDE 3ALPA 5IFAH 4OLUH 4HV8B 4XNYH 1SY6H 1FIGH 4P9MH 3DO3A 2Y5TA 2OTWA 4YWGH 2ZWLT 4ZO8A 1YPZA 3H3PH 3CDFA 5T3XE 3DVNA 4N9GA 3UDWC 1XR9B 1UB6B 3IJHA 2EKSB 1U6AH 2PN5A 1Y0LB 2VDOH 5HYJD 5IT2H 1GCFA 3QFJD 4MXWH 5MENE 1NCUA 1VPOH 4D8PA 4RMQA 4N0YL 4J3TA 1YA5A 4NO3A 4POZD 5ESAA 5DD0H 5KSAB 2ICCA 1UACL 3G04B 1KEML 3KPLA 5KS9B 3TO4C 1V3KA 5JNYB 1SYVB 2UYLA 4OLVH 2M8XA 1A3RL 3LKSB 3REWB 3QQNA 3V79C 4ZUVB 4BH8A 1CLOH 1P5VA 4KTDL 1X44A 5BOPA 3KLAA 3SGJA 3UTZA 4F7PA 1UM5H 2XACC 3FN9A 1EVTC 4OTXH 3BT2L 3HNSL 5ID0B 1EIBA 2J88L 3QUKA 1KN4L 3BW9B 4JM2B 4KUZL 1VGEL 2QHRH 3EO9H 4N90D 1OAKH 3KPTA 5FYLL 1FFOA 2G5RA 5I15L 4NQVB 3MRFA 3T2NL 5C8JA 2B0SL 1G7JA 3PXJA 1RURH 2DQGH 4C56D 1Z0MA 2X4NB 4P5TC 1MCIA 4RGNB 1JNNL 1I9IH 1ZT4A 3ULUE 2VAAB 1U3HD 2GK0B 4MA7H 1SEQH 1WEJH 4UT6H 1CICD 1JVKA 3CDGA 4WO4A 3SE9L 3H9SB 2R56H 1P6FA 2PR4H 3WHXB 1D5XA 2VDPL 1I8LA 3O2DH 3O3BB 2HT4C 4RX4D 3UPAA 3MRJB 5J6GA 2YWYA 4M7ZB 5CD5C 1MY7A 4LIQE 1T20B 2YK1H 5F72S 3ARYA 3WIHL 3IDGA 2EDNA 4QXGL 3BSZH 2V7HA 3HR5B 3L3GB 3ZDZF 1XIWD 4RQQA 4E42B 5FV2A 5I1AB 5DQJB 1P7QA 3OMZA 2ZKHL 3ZT6A 4UT7L 3RVTD 1F97A 1Q38A 3MXVL 1U8MA 3D48R 5CILH 4X9IA 1MFCL 3T65B 4MJ4A 1FO0B 3MRLA 4MA1C 4ERSL 4KI5C 3MRPA 3MSPA 4TUKL 2W65A 5C0DA 4RRPA 2YPVL 3RFZC 3L95A 1OP9A 4X9FA 5EU6A 4ZXBB 4PRDA 2CO6B 3H2WA 3FONA 1M05B 4Z5RB 1JZ8A 5IJVB 5C3TA 3MZGB 5DJ6B 3ROLA 1CD1B 4QOKD 2NPLX 3CFEA 4NHUB 2FGWL 2NY6D 5KAQF 5I18L 1RZKH 1Y18B 3BESR 5C0GB 5F7FA 4LLUB 2YD7A 4WO4C 1MUJA 5DWUH 3CX5K 1I8LC 4TVSa 5DJCA 2V7NB 3EOBB 1VFAB 1A7PH 5GSVA 2NCMA 1XGPA 2AQ3A 4KJQD 1R3JB 4H0IA 1QLEH 2AJXH 5D7LA 4NN6B 3L3JA 4QT5A 2EIEA 3V0AC 1HHHB 3GSXB 2OCFD 4XGZB 3OKEA 5EZIH 1DVFD 1S7SB 1NGWB 5D1QA 5HYSG 3WFZA 5EOCH 1MVUB 3P40A 4WW2A 4HGWB 1IC4H 3W0WB 4K55A 2PUQT 3AB0B 1NCTA 1NCNA 1MIML 1G9ML 4DKFH 1OP5H 1EO5A 1URLA 5D4QA 2ERJC 4GS7B 3TO2B 5KG9B 4D3CL 5J57B 1MWAL 3PP3K 1M6OA 1QVOA 1ZHNA 1KUMA 4NC0B 2BNUA 4X0KA 4RIRA 4ZUUA 3QAZB 4L29A 4UMGA 2ENSA 4OGYH 5EN2B 4HPYH 5L9DL 2EH8H 2EIZB 4MD0A 2VLJA 2Z31A 1DQJA 3MJ6A 2RB8A 2P5EB 1S9YA 2XNAA 1Z6JT 4TUJB 1UCTA 5T3XD 1WTGT 1OB1B 3T09A 3D18B 2PW1B 4Z7VB 1ES0B 1FN4A 2VIRA 3BGMA 4RFEB 4EIGB 1DLHA 3OR7A 3GSWB 3DYOA 4WI3A 4M3JA 1NEZA 2NY5C 5MEND 4PRHE 3ULUF 1HCFX 3TGXA 5F88A 4XP1L 1HKLH 4S0SD 4K3EL 5HHME 3O4OC 1RHFA 4XVSH 2I24N 2C4FT 1FVEA 5DZNA 3W5MA 1PBYA 3Q6FA 3LS4H 2A6IB 3F58H 5IWLA 2NY4B 5IVOA 3KPNA 2AS5M 5CIPA 1S78C 4WTZA 3MBXH 4OI7A 3FAWA 2AJYH 3EFFB 4PREA 4MD4A 1Q9KB 4A6YL 3N85L 2GJ6A 1S7TA 1G6RA 2VXTH 2VZTA 4H8WL 4YHKL 1A6VH 1I1AD 3GSVB 1XZ0A 1HHGA 2BVOA 3GI8H 4MQTB 3QUZB 4IRJD 4XTRD 4IOIB 4NC2B 2NZIA 3VGAB 3ULUD 4E41E 5E08H 3G5YB 1TIUA 2P1YA 4GUPB 2IMMA 5JLZA 3F12A 2DQHL 4G8EB 2X4TB 1G7MB 2EDQA 1I3RA 1I1CA 5EO1A 4FMKA 4MWFA 3P9LA 3TIEA 2IPTL 1NDGA 5B8CC 1U91B 2VZSA 5ANME 3JSSA 3UC0H 4KRPC 4XPFL 2X4UB 4YFLI 5DEGA 4JJ5B 2ARWA 1EGJA 1HNGA 3TWCH 4HW6A 2R23B 1QR1A 4DKEH 5ERWB 1K5NB 3ILQC 5JIIA 3IDXH 5KBNC 1J8HB 1WBXB 5CGMA 4IBLT 1INQB 4R9HA 5BJTA 5K33A 3ZMRA 4U1LA 3RZCC 3WFEL 3HMXH 1YY8B 2Q8BH 2CXKA 3NFNA 5L7XH 4KK5D 3BKJH 4UT9L 3FQWA 4J3VA 3MLUL 4LCIL 3BPLC 1BZQK 5D7IB 3RWIB 1B0RB 1XR9A 4ONGL 1UB6A 3MJ7B 3C08H 1NMAL 3FB7A 3HZVB 1C8PA 1FZMB 3GSRA 2V5SA 1F4XL 4M1GH 3MRNA 1N6QL 2W60A 4CN1A 2P5WB 5KS9A 5JNYA 1SYVA 3MOBL 5D70L 4NZTH 4FFYH 4ZUVA 3BPOB 4YPGB 5EOTB 4LCWA 1CFNB 2HMID 5ID0A 1T66D 3F62A 4LLVA 5AAMA 2D2OA 3C5ZD 4XVUD 3DO7B 4XMKH 4UUJA 1MCJA 1YEEL 1A6AB 5D1XD 1BZ9A 1JF5A 4HXBH 4JB9H 2YPKB 4KRNA 2VC2L 1S7UB 2VAAA 2HTKD 3RIFF 2CMRL 4D0CB 2MCPH 2PO6C 3U83A 4U1SB 4X6EA 3EYOA 3P9MB 1W0VA 2BFVL 4LNVA 1EFXB 2ED7A 4BSJA 1M71B 4TTGA 3WHXA 4JCLA 1ZANL 2UVFA 3O3BA 4K2UH 1TETL 4HUUB 3VFRA 5T1MB 2KBGA 2HAZA 4KH2A 5EC2B 5ADPH 2YXFA 3M45A 4NQSA 5GGTH 4HX1B 4JHAH 1NSNL 2JIXD 1GRWA 2ADIB 3BO8A 3VDBA 2BSTB 2K7QA 4YE4H 1N7ML 2XQYG 4MAUH 4MDJB 5DO2D 1QQDA 3O45B 1JZ6A 4P46B 1NAML 4NZJA 1OTUD 1J1XL 2IBZY 2I07B 2NY0B 4POUB 3HR5A 3HLAB 1TTFA 5JW4Q 5J1AA 4A2LA 3RWDA 4TUOB 4ZQKA 4LARH 5I1AA 5K9OA 3SCMD 1CBVH 2FBOJ 5KSAC 2APXA 4BYHA 2OP4L 1VESA 3VXPA 4HZLA 5HDQL 4NHCL 5EZOL 4OCSL 2R0KL 4LHQB 4NQDB 4XVTL 3QRGH 3T65A 1LO0H 4PRHD 5TE6H 5GJTL 3K2UL 4WUUA 4F80A 3N9GL 1FO0A 1WISA 3BZEB 5HHMD 4U6HA 3DWTA 2NY1B 3MLTA 3VFMB 4UV7H 5JQHC 3OGOE 1ODAA 5F44A 4AG4L 3ESUF 2V2TB 5ILTL 5AD0A 3MYJB 1MHCA 4KROD 2AK4B 4JM2C 3WE6B 1YMME 1FVCA 1EO7A 1M05A 3GMLA 3OPZL 4K7PX 2FDBP 4BKLB 3BVNA 1F4WH 5DJ6A 3PG2A 5GGQH 3B4NA 5A2LH 4RGNC 3MV7E 1NFKA 3NCYS 1TNMA 3OXRB 4HIEA 3PL6D 3TN0D 4FFVC 4CL7A 2GCYA 1AR1C 5C0GA 4JR9L 3WDHA 5T5FH 2HN7B 2WW8A 3I50L 3PV6A 2CLZA 3I6KB 3N1GC 1DP0A 1Z5LB 2VYRE 4E41D 4QHLA 2OJEA 1IC7L 1R3JA 3ZKXB 2LV4A 2OL3A 3GJEB 1B0WA 4HHAA 2FO4B 4M7ZC 3MV11 5KOMC 5I19H 5BMFL 1VFUA 5EBMA 1CU4L 3STZA 3GSXA 4XGZA 4R6UA 4KMLB 1VFMA 3IFNH 1T3FB 1A0QH 1F8TH 1MCWW 1R6VA 1MVUA 1SJHB 3LOWA 4M5ZL 2H3NB 1RU9L 3C8HA 4XBEL 1MLBA 1IGIH 1KLGB 2O5XH 2VXQL 1P5UA 4I3GA 1FNEB 3C8DA 4P48A 4ZYKB 4C58B 3OAYK 5IB5B 4OFKA 2ATPA 3QXDA 2JK5A 3TZVD 1HQRB 2R9HD 4BM7A 3L5XL 3ZKSD 3ARGD 5EWIH 2WQ8A 4J6RH 5EN2A 3INUH 4YK4B 2VB5A 5I8EA 1JGEB 4ZXBC 3VXMA 4LSPH 1GGIH 1UM6L 3I02A 2Y06H 4PJ8A 4Y4KD 2IQAB 2Z0BA 4Z7VA 1GHFL 4RFEA 5BVJB 1IEAB 3V5HB 2DRUA 3TVMB 2FWOB 1I7RB 1P1ZB 2YA1A 1T83C 2DM2A 3O9WA 3SDXB 3U1SH 4G6MH 3DURA 3W9DB 5DMIH 2MHAA 2DICA 1L6ZA 2QTEA 1FBIH 3IDMA 3FB8A 3BRDA 1JPTL 5J1SC 1HSBA 1A1MB 2A6IA 3WXVL 3UJIH 4KK9C 1DANT 3EDEA 3BRGC 3VXUA 2AXFB 4F58L 1MCPH 5L6YL 4GW4A 1QBLL 3GMPB 4NN6C 5F3BA 1RULH 4UINH 1U3YA 2OZ4L 1O5DT 2MTPA 5ITFA 5SWZA 2AJZA 5ACZB 5JPMA 1Q9KA 3OJDB 1NC2D 5HYIA 5B38G 1JN6B 1HHIB 3GGWB 4JFOB 3QFJB 2FATH 1AJ7H 1AGEB 1DUYA 4HKXB 4U7KA 3SKOB 1AP2A 4X4MA 5E8OA 1BVKB 3AB0C 3PP4H 3NTCH 3AM8A 1BVLB 4CU8A 1F4HA 4HT1L 1UZ6E 4GS7C 4RFOL 5D6CB 4LKCA 2E7CA 3RY4A 1WFTA 4PRNB 2CSPA 2RFXB 3FT2B 1KFAH 5E2VL 1A7OL 3QAZC 4JREB 3UTTE 4GKNB 3ZKNC 5DVKA 1FG2B 3JV6B 4ENEC 1IZJA 4K3HA 4M1DH 4O00A 3L7FA 3CD4A 3DROB 1DQTA 1R5IA 2NTFB 3IDNB 4FFZH 2V17H 5E9DA 3NFSL 5M94B 3S34H 4U1KB 3FQUB 4OF5A 1WZKA 4GG8A 2FBJH 1U3HB 1BD2B 2C3GA 2BOCA 1R3IH 4JFFE 4Q74A 1UA6H 1CICB 2KZ1B 1N26A 3MOQA 5MHSE 1HWGB 2CR3A 4LVHC 2LFGA 1J1PH 5HD8C 3MOAH 2IWGA 2QHLA 1CD0A 3LPFA 2MKLC 4L4JA 4QHMB 1D5MA 5IHUH 4HMEA 2D9QB 4EKXA 2NY4C 1UH2A 1CL7H 3WIFB 3CFJB 4RAUB 3RWIA 5B4MD 5IVXB 3K7UA 3VWJA 5D9SA 1J5OH 2BVPA 3DRTB 5TE4L 2C26A 1ZMYA 3DVIA 1YMMD 3ZHKA 2CKBL 4WI5A 4PG2A 4GRMB 3PGFH 3JTTA 3THMH 1QEWB 4OZFA 1XIWB 5ESQA 3I9GH 3B9KA 5HYQB 5E24E 2P5WA 3RKDD 4HKZB 3T0EE 4F33A 3MV7D 3VG0L 3RDTB 3AM8C 4HCRL 4OLYL 5EO0B 3VGAC 4JKWA 2YA0A 1U92A 3DI3B 1IKNC 4RFNB 1IGTB 4NZUH 5CSZB 2ZUSA 5GGUA 4BK5A 5I75B 1U8IB 1HH9B 1CFNA 4K8RC 4PLKC 5FO8A 2BNQA 5T1KD 1RZIB 4K7PL 4N0RA 1ZHLB 2J6EH 4PLJD 3CSYB 3PGCB 3ELAT 3RGHA 4WHTA 1YEKL 3TNNB 5D2LB 1T1ZB 4QOKB 5ETUA 4KDWA 1S7UA 5EUKB 3JWOL 2VDKH 4LLAA 4HWZA 2ICEA 2NY6B 2OL3H 1NCDL 4U1SA 3P9MA 1BFVH 6FABL 35C8H 1EFXA 4NO0A 1H3UA 4JFEE 1M71A 3WIIH 1FNLA 4Q0XL 2X9XA 2A1WL 1JCKA 4I5BB 1KB9J 5T1MA 5K93A 3BIAX 1CVRA 3BUYA 1FYTA 3V2AR 3WJLC 3O2VH 4LASL 1MWAB 1B0GB 3MFFA 4BH7B 2AK1H 3MLVL 5GS0L 4L1HA 4FZEH 1GZPB 2VQ1A 4XPGL 4HFWA 5JOFA 1A6UL 3JV4A 3O45A 4M7JH 1RUQL 3MRQA 2X1PA 1DVFB 1BGXL 3NPZB 3T04D 1QFWI 5IQ7H 2FD6H 3HPLB 3CH8A 3C8KB 4QHKI 4NFBA 1N4XL 1B88A 4XZUB 4P23B 4QEGA 3DIFA 3FT3A 1N59A 1WZMA 3HZYB 3LN4A 3VXNA 3VXOA 4TQEL 1D5BB 3EZ8A 3U9PL 2RCSL 1O7SA 1JV5B 4WI2A 4LMQI 4Y89A 3VA6A 1UZ6F 4Y1AE 1Z3GL 1BAFL 3BPOC 1RZFH 4MDIB 3T77B 1G9EA 4PJDB 4X7CC 3OR6A 1KOAA 4XP9L 4F7CB 5A3IC 2AK4A 4KMTH 3IKCB 3WE6A 2MMXA 2WINA 3GO1L 3I3DA 1T2QL 1U8NA 4U0QB 4BFEA 4BKLA 3R06B 1D5ZA 2AJVL 3D0LA 4NKIL 1Z9OA 3EO0B 4DN4H 4L8DB 3MNVA 4U7MA 3QSKB 2EC8A 1HIMH 3VCLB 4OZIA 1OGTB 3FOMA 4K3DH 5MENB 2IAMA 2K9UA 4LSVL 4ELMA 2GSGB 4JQXC 5K9QG 3HC3H 2XFXB 1AC6A 5EU5B 1YYLH 1KJ2H 5FYJE 4UIKH 4KXZH 2Z8VC 3ULVL 4KJWC 2AGJH 3DX9B 5L8LB 3ISWA 1MFEL 4KKLC 4WUKH 3T1WA 1KJMA 3BWAB 1V7MH 1YJDL 2R29L 4TNVK 4R8WL 3UYOD 2O5YL 4MCYB 1IVLA 3RVVD 5I1LB 5T3ZH 5HHVH 4NT6A 3UTTD 5MEQB 5DRWB 1JFQL 2C7UA 4P46C 1RK0A 5JXEA 4ODUA 2NY0C 5ALBL 5T1LA 2NW2A 1SJHA 4ONFH 1AXSB 1I1AB 1MAMH 3OF6D 4GSDH 4IRJB 1KLGA 1RQ5A 1LK3H 3I75A 4HH9A 2X4OB 2OMNA 4KKNA 4JFFD 3MRDB 4ZYKA 1Z9MA 3WYRA 2H45A 2FB4H 2ICWJ 3UJJH 1XF1A 5MHSD 5HDLA 4QGTA 3ZSTA 4YXKH 5EU7C 5BRZA 2NY1C 2A38A 1I1RA 1I3GH 5I1DA 1S9VA 1FNGA 1K4DB 5TQ2H 3IU4H 3VRLE 3DXAA 3ZO0A 1ZLUK 2WMPA 5DA4A 2E7BA 3ARSA 3GRWH 4XP4H 5DI8A 1II4E 4JE4B 1CLYH 1OD9A 4L4TA 1GIGL 2BVUA 3PHSA 3TH3T 4GAGL 4DZBA 2DS4A 3QQ4A 4ISVB 2EDLA 2MNUA 5CGTA 1BQHA 3QZWG 3KLHD 1R3KA 2H8PB 2AV7A 1BFSA 3RNQA 2E5EA 3MJ8A 4XRCA 4RAHA 5C0FB 4PJAE 2NX5E 4P2RA 1DQDL 3W2DH 2R1WB 3T0ED 3MRHB 4OJFL 4KGJA 3BGFC 2EDKA 3MLYH 5IKCB 2HYMA 4FTVE 4G6KL 3KWWB 3MGAA 3ZKXC 3IFPB 3QEUB 1S8DA 1X5JA 2FH8A 3KJ4B 4YFLF 4U6XA 5JW5A 4OCRH 1I8KA 1DBMH 3FO9A 1KCKA 1G7HA 2Q8AL 2P45B 2IPKA 3N0PB 4UBDC 5JXEC 1AGEA 1BFOB 1UCBL 2EE3A 3EHBC 4HKXA 4QTIL 1AD9B 3SKOA 3FRUB 4Y4FD 3KYOA 1QFWH 5C1MB 2VE6B 5I8OL 1MCDA 3CCHA 3LKQB 4G3YH 3SKJL 1FZJB 5B3NA 5TGBA 5J0BA 3WUWB 5C0RH 3ARFA 3QEQA 1FDLL 3WN5B 3HUJE 5HHNB 4PRNA 2F8OA 1NGXA 4JFED 2ADFL 32C2B 4ODSH 5TE7L 4YHOL 5HGDA 2QJDA 4Y2OA 3U7WL 4GKNA 4D0DB 3SBWC 1ZGLB 4LCYA 1CGXA 4YK4C 4Z76B 3RX8A 1OAZH 3DV4B 1EFQA 4G42B 3C09B 3U4BL 3OB8A 4QRTB 5GRVK 1EEZB 2XZQL 1RZJL 5AYQA 3E3QE 3GBNH 5D1XB 3IFLH 4U6TA 4OCYH 4BQ9A 2UV3A 3WIHA 4XT1C 3TVMC 1U3HA 1BD2A 4ZFFA 2C4FU 3MRRB 3VFPA 1Z9LA 1G0DA 4BQBA 5FM5M 1KIPB 1L6XA 1UWGH 1MJJB 4LGRB 4QRUA 4LDOB 4H5SA 3EOYG 4LSRH 1U8PB 4Y1AD 2JIXB 4JQVA 1INEH 1V5JA 3WIFA 4P2OA 4YH6A 4PB0L 5IVXA 1A4JA 3OJMB 3U4EB 5EO9A 3RHWF 4EI5A 5ICYA 5IUSA 1CIUA 1RFDL 3DSNA 4FXKA 2C9AA 3IDJB 3Q0HA 1PEWA 4DVBA 3SCMB 4POZC 3S37H 2X4PB 1A1OA 4HKZA 2CDGB 4QRQA 3QNZB 4DGYL 3RDTA 5EO0A 2WWKT 1MF2L 3QUMH 4PRHB 1LP9E 3SJVE 3UO1H 2Z8WC 2VQUA 4HC1L 1P4BL 4KKAD 1WT5A 3GM0A 1IGTA 5CSZA 5HHMB 3TBWB 1NCWH 1TXKA 4KVNL 1HH9A 4G7YL 1XF4B 2AVGA 1M7DA 1LEKA 3WFDH 4P3DB 4JREC 5FYJD 2PKDA 1RZ8B 4KROB 4PBWD 3EJZD 1A9BA 3G6JA 1SJXA 3CSYA 3PGCA 5MERB 2A9ML 1FL6A 3IVKA 3NAAH 3KYAA 4LPTA 3PDOA 2RBLA 1T1ZA 4JANB 4H26B 5B3JE 1DBJL 1IGJB 1EEYB 3TN0B 1QSFE 1U3HC 5ALCH 1T7ZA 5FOJA 1ETZA 5D5ME 1IGYA 3CLFH 4N8VB 3FQRA 1PY9A 2XZCL 4MVBD 4MB3A 3E8UL 4PJAF 4I5BA 1WZ1H 1UYWL 2QQLL 2BY0A 4GMSL 4E41B 3S8WA 4GW1B 1MNUL 2KQMA 5GZOD 1MWAA 2HWZL 1K8IB 4F7MA 4NM8L 3U2SB 2AJSH 1RZ7H 3QFDA 1WBYA 4P59L 4KAQH 3ZE1E 1V3MA 4JFHE 5J11B 5GGVH 1AGBA 4BK4A 1HILB 5ANMB 3GMNB 1XIWC 1KIRA 3DI2B 4Y7MA 2BDNH 5K9KB 4P23A 4LF3B 1L0XA 3UXFA 2P48B 2B4CL 1D5BA 2FX8H 1CXIA 3RVTC 1NGQL 4UNUA 3RDTC 4L4VB 2EDBA 2QKIA 2ZZUT 4KQ4L 3TP4A 3T8XB 3ARRA 4RFNC 1DE4B 3D9AH 3WNNA 4L8CA 1QLFB 2NX5D 3NZ8B 5ICZB 5HHQB 4MDIA 4PJDA 3LH2L 3HUJF 4ZO7A 3TZVB 3V9FA 5I75C 4PGZA 3SOBL 2W0FB 1QHOA 4QNPE 4F7CA 5I8KL 5MEPB 1AKJD 1TDQA 3RY6A 4NBXB 4UQ3B 2BJML 1NANI 5KW9L 4FTVD 3BHBA 1I9RH 1H3XA 4MNHB 2PTUA 5DK2B 2Y5EA 1KG0B 3D0VA 3AAZA 3I6GB 4HQQH 3EO0A 3V7AG 5LJYH 3UBXB 1FLRL 2M26A 4L8DA 3RVWC 2X5PA 1QFUL 3D25A 4XPAL 3O41A 3U36A 3NACH 1Q1JL 5I1GH 3MROA 4JVUA 3OAZH 4A6YA 2NY6C 1UWXK 4IEFB 4WDIA 4KTDH 3ROOB 3V4UH 2BY2A 3VFWB 3HA0A 3CDCA 1N2RA 3K74B 5DK0B 1SYSB 4CU6A 1KXTB 4H20L 4PJCA 5DHYB 2FNBA 4TRPH 1M7IB 1B2WH 3BWAA 1GYAA 4FQ2L 1P4LA 1SJVA 4OSUL 2B0SH 3X17A 5I30H 4XCNB 2XA3A 4M6ML 3V0VB 1XF5A 4TVPE 1A3LL 1JNNH 1K8DB 4EDWL 3IETB 5E7BA 1NC2B 1EX0A 4KK8D 3MLRH 1DUZB 3CMOL 1DVFC 1U8LA 2R2HA 2YKLL 3VFOB 1T89C 5EOQH 5IHLB 1BECA 2H2PD 3NIGE 4PJXE 1CTNA 4P23C 3PQYA 3MLXL 2G5BB 4UTBL 3TIDA 4NNYB 5DJZB 5J89A 3FT4B 3R1GH 5F6HI 3UAJD 2IG2L 1TVDA 3MRDA 5IEHA 3BIBX 1P69B 5JDSB 2IBZX 3EYSL 2EDOA 4M8VA 4BA8A 4HIHA 5DT1L 1BQUA 4I77L 2EYRA 1MHEB 4Y5XB 4FQJL 5I1JH 1AFVL 2GT9B 4O51A 1K4DA 1A6PA 1MFAL 2Y4SA 4HKJB 3VXTA 2D4FA 2EEDA 2DDQL 3X12B 5EZLB 1PZUB 4CVXA 3GSNL 4OI9A 3BWUC 5FHBL 3SGDI 2X10A 4LMQE 4OD2B 2BRRL 5ELIA 5JUEH 1B90A 2H8PA 3BEVB 4GLRI 1MFCH 5B3JF 2ZCKL 5E6YA 1A02N 5C0FA 4OAWB 4WEBH 5C0EB 3VFVB 3E6FA 5D5MF 4TUKH 3TA3B 3B5TA 1FH5L 1D7FA 1U3ZA 3TM6A 1KB5L 2YSSB 1S7XA 4PRBB 4PPTA 5IKCA 3SJVD 1NCAH 1KB9K 2HKFH 4DGVH 4PJIA 2PYEE 4U1HB 5F21B 4HWEL 1NBVL 1AGDA 1RJZA 3QQ9D 5AUMB 3DPBA 1KT2B 2VR9A 5IHZA 3T0DA 2NR6D 3JV0A 3AUVA 1YMMB 2NNAA 4FZ8H 4WU7B 4NNXB 5F9OL 3ZE1F 2VABB 4F15B 3O11A 4ZMAT 2C3HA 1R3HB 3VFNB 1YEFH 1I1AC 4KZDL 1VEPA 5IMMA 3S88L 3MV7B 4IRJC 2ZUXA 4NFDA 2ZCHH 4JRWA 3R8BB 3ULUC 1QSFD 2DQCL 3HMWH 4PUBL 3QH3B 1T7VA 4U1JB 1ZHBA 1GOFA 3BKCL 4HDIA 3E1F1 3T4AA 1JHLH 2YUWA 1BQHG 4IDJL 3KDMB 1B3JA 1QKZH 2MQ3A 2IH3A 1OARH 5T1KB 2F53A 3FB5A 4MJ6A 3LEYL 1NL0L 4O5LL 4QNPF 3FOLA 5H94B 1A4KA 1I1FB 1KENH 4QRTA 2ZOLA 2WLYA 1C5DB 1VGKB 5GS1B 4ZFZB 2DM3A 2X4QB 3CVIL 4OB5L 1HKFA 3WHE0 1AO7E 1G9MH 2X9YA 1X5FA 3ZDYE 3GI9H 4JFHD 1UFUA 2ZUQB 1JE6A 1GC1C 4JY5H 4K3GA 4RDQF 1NAMA 4PB9H 5EPMB 5F1NA 3WV0A 5JHDA 5D6DC 4G6JL 1KJ3H 4J3XA 1KIPA 5IMKA 1EHXA 2AQ1A 1DANU 4JAMA 4JHZA 1YNLL 4Q97A 5GISL 4M62L 4PJ5A 3TT3L 1I9JL 3MGTA 2L0DA 2MPAL 5A2KH 1YEJH 1HQ4B 3CFCH 4KK5C 2V5YA 3MA7A 3ARDD 1QA9B 2L4OA 3D6GA 3WFBL 3KJ4C 1F58L 2B1HL 3FN3A 3U4EA 2FL5A 5IM7A 1T6WA 4BZ2H 4G80A 3L6FA 4PLOB 2A6DB 3U4AA 5JOEA 5I1EH 4EXKA 2KPNA 3VGBA 3O3AA 5GGRB 1VFOA 3RU8H 1NGZB 4Z6AT 5C0AE 3LPWA 1CR9H 1J11A 2Y7QA 4QRRE 5CZVL 3QNZA 5BV7L 3NIGF 4PJXF 3BMVA 3X11B 3V5KA 5CSBA 1JGUH 4KKBD 5DMJB 1LO4L 4DCQA 1B4JL 3FAXA 2YMXL 3WN5C 4EQ2A 4R96A 1MJUH 1TVBA 5CKAA 4PJBE 4M7LT 3PHQB 5LGHL 1R5WB 3P73B 2HMIC 5DK3A 1T66C 1J87A 2OTUA 4XVUC 4OZGE 4JFZH 4GRLA 4XH2B 2X70B 5KVDL 1DQQA 2DQDH 2OR7A 4O2CA 3C09C 1FAIH 5D1XC 4TVPD 3Q1SH 4JANA 2FJFB 2OSLA 1KCVH 1KIQA 1DEDA 1KIUA 3SGDH 4HGMA 4KTEH 4HMCA 4UILL 4YHML 5DDHB 1E28A 4JFXA 3MR9A 4OCLC 3QUYD 1T1WB 4RGOL 4JPKL 4U1MA 4L9LB 2BCKB 5HI5D 1C16A 5E00B 5F7WC 1JPFB 3A67H 4U6YB 5DFVC 4JO2L 1WWBX 1K8IA 3QIUA 3W9EB 5CLTA 2BVYA 4LGSB 4PP2A 3UTTB 5E5MB 1T0PB 5DO2C 3QJHB 4J23A 1IRAY 4QRPA 4G7VH 1RIHL 2GHWB 1Q94B 4FFWD 2NY5H 3U7YL 15C8L 3SCMC 3ZTNL 5KTEL 5J8OA 4CMHB 3KJ6H 5LXGL 4C4KT 1JGLL 4U31A 2JF1A 3GMMA 4L4VA 4JFFB 3DV6A 4U1GB 3W39A 3UTSB 4HUVB 1XR8A 4UT9H 2P8MA 3MLUH 3ARBD 3NZ8A 4LCIH 4DAGH 3Q3GA 2V2WB 3QDME 3RVUD 5IVNA 4ZD3L 5LAXA 4JO1H 5E94A 3VMOA 5MEPA 2C1PB 3B8SA 3DGGB 3VW3L 4KGLA 4KROC 4X6CE 2BOBB 2PYED 1OT2A 1J7VR 3NPSB 1E27B 4X7SH 3EYFB 2OZ4A 4M6OH 5ESVA 1F11A 3HR6A 1HXMB 3ZDYF 3AGVA 3NCJH 3W5NA 3TN0C 1K4CB 4IOFD 1U9KA 5TF1H 2LVEA 4ODXB 2HLAA 3QYCA 4OLZH 3VFWA 1DBKL 1UT9A 1FNAA 2P49B 2X42A 3T0EB 1XCQB 5CUSH 5DHYA 1EMTL 4NRXB 4FQXD 2W0KA 5DUPL 3HAEB 3S98A 4DKAA 3WKMH 5DUML 1MCHA 4IRZL 2CDFB 4H0GA 1IQWH 1YEEH 1S5IL 3LEVL 3QIUC 3D85D 1IGCH 1G0XA 1IAKA 4G5ZH 3PP3H 2HG5A 4IHOA 4RZCB 4UDUB 3F5WA 1E0OB 2ITCA 4ONHB 3IETA 3I6LE 4AM0A 4EI6A 4JHWH 1NC2A 4CVZB 5J11C 1SM3H 2EH7H 1R5VA 5D2NB 5DD1L 1A7QL 5FUZH 1A14H 1S7WB 1D5IH 5D7JA 1AO7D 4Y4FB 3T2OA 1ZANH 2WAHA 5BCAA 5DJ8A 1ORSA 4X4XA 4Y5VB 4NNYA 1JGDA 5DJZA 3DBXB 3PJSA 3MLZL 1HINH 4HFUH 1I75A 1KF9B 5JDSA 3VH8B 3CXDH 1OT1A 4JFEB 2ZPKH 1EZVY 3P4MB 2DI7A 3CC5A 1MHEA 4O58L 3TZVC 1OAXL 5CGYD 2R9HC 2GT9A 4PJBF 1XGTB 5FKAB 3D39A 1AQKL 3RL2B 5EBWA 4OZGF 4LLMA 5DLMH 4N8PA 5DS8B 4OM0H 5CEYA 5EZLA 1DSFH 2O5ZL 3OKLA 5C0JA 5TDOB 3FCTB 4DEPB 2BSRA 4M1CD 3BEVA 1LO2L 1YPZE 3ARPA 3K2MC 5GJTH 4XCEB 2CKBA 4OLUL 4L8BB 3ZKQD 1U8JB 5C0AD 4PGCB 4NWUH 1ZVYA 4XNYL 3SY0B 5C0EA 3VFVA 2YRZA 3TA3A 3LKRB 4WNQA 3AY4A 1FIGL 4QRRD 4P9ML 1I4FB 5C07A 4YWGL 1H0DB 3H3PL 5CMAA 4HCRA 4N5UA 4N0UA 1I7UB 4CMMA 1U6AL 1UVQB 5IB3B 2VDOL 4NRZB 4NUJA 5AUMA 5HHPB 5IT2L 3AS0A 4LDLB 1T5WA 4MXWL 1VPOL 1KT2A 4YGVB 4MSWB 3EJYD 2J7LA 3VFGH 5DD0L 4GH7B 1PYWA 2VABA 5CEZH 4NKDA 4PY7B 4YDVB 4JR9H 5SWQA 3FJTA 1U8OB 3X3GH 3DX7B 4LHUG 1CLOL 1UM5L 3RGVD 4X8JB 1Q9LB 3EO1B 4OTXL 1CDJA 1UJ3B 3BYTA 2D0GA 2VL4A 4LEXH 43C9A 5L0QB 2YD4A 2QHRL 3EO9L 1OAKL 1QLRA 2XQBH 3K80A 1U8HB 3P0VH 3QR2A 3QG7H 4Y5XC 4MQ7A 2XTJE 3U6RA 1NBYA 1X5YA 5DJ2B 1RURL 4XXDA 4J1UB 1Y6NR 1ROWA 4XP5H 2FJHB 2Q3ZA 4ALAH 2D3VA 1C5DA 4M5ZH 1I9IL 4YDLB 2LVCA 1LK2B 1SEQL 4MA7L 2D4DA 5EU3B 1WEJL 2XQYK 3BQUA 3ZT5A 4J4PD 1RV6X 1DN2A 3EAKA 2A6KB 2R56L 1NFDA 1EAPA 1CN4A 1MCSA 2PR4L 4X6BB 3O2DL 5TDPB 4X6DA 3H9ZA 4PBXA 3Q2CA 4HG4J 4FS0A 2DI9A 3L5XH 3TA3C 5GGVY 3F8UB 3O6FA 4N1CA 4NYLA 2WANA 4P2YA 1FJ1B 1UXSB 1ZA6B 2YK1L 1DDHB 5IVZB 5B39G 5JQ6H 3CGTA 3QDMD 3CH1A 5B4MC 2PTTB 4AEFA 4EN3A 4F2MA 1LGVA 4G8GA 1T7WA 4PJ7A 1CFSA 4F15C 3QIWA 3H42H 5GGRA 5D8JL 2Z92A 3TCLB 5ID1A 2NLJA 1F3JA 5CILL 1CG9B 5EU6E 3B6SB 2LAGB 5SX5K 5FGBA 1OF2B 3RKDC 4QCIB 5IMOA 4HIJA 5E2JA 3RWHB 4HK0A 3ZDXE 3MV8A 1XF3A 3QWOA 5CWSA 1U8QB 2NX5B 4G43B 4KZEH 1ZV5A 3MACH 2PNDA 3T0VA 1LD9A 1G7IB 4U1NA 2R4SH 5FYKH 1AKJB 1C5BH 3MBEA 2MWCA 3A6BH 1TZHB 2X70A 4FTVB 5F7EH 3TYGH 4PLJC 3DHJA 4Q7DA 2ZUYA 5GS1C 4Y4HB 1CDUA 5D72H 1V7NH 2DM4A 5DFTA 1BWWA 3I6LD 5D7LE 1OSZB 5C08E 1ZK9A 2ZUQC 4ZUWB 3GJFB 5DWUL 4Q9RH 1YPZF 4GRWH 2Q6WB 1A7PL 5F9JB 4QXTB 4GKZA 4NGHH 4P3WA 4WGVB 3HRZB 1QLEL 3QJFA 5E03A 1CWVA 1TPXB 3NCBB 4QTHB 1JPFA 3HKFA 4HIXH 4JY4A 1YY9D 3HUJB 1QSEA 3W9EA 1KPUB 3MNWA 5EIQA 5EZIL 3I84A 3S6CA 3KYNA 3OKMB 4R7NA 5KJRL 5F7HA 3QJHA 1IC4L 5DUBA 5CJ8A 3U82B 3DYMA 4K94C 4EUPB 3BD5A 1KNOA 4DKFL 2YD5A 2X41A 4Y19B 4WHCA 4KI5F 1Q94A 4HF5H 2V5MA 4Z7QE 2HKHH 2GJZA 3VFTA 5DHXB 4ODWA 1RHHB 2VLJE 5FGBC 3VJ6B 5GRYA 5IMLA 2GTZB 3NVQA 5E8EA 4NQCB 3CJJA 1MREH 5HY9B 3UTSA 4YDJA 4WRLA 2XWJB 3MUGB 4MCZA 2E27H 2EYTB 1YN6B 3MUHL 2O93L 4JVWA 4OGYL 4HPYL 4QRSA 4BELD 1JHKL 4LLDB 3VFSB 4CJ0A 5L2JB 2I5YH 1OPGH 3DGGA 1KJVB 2R2BB 5GXBB 4Y0GA 2BOBA 4JM4L 3RWGA 3ULVC 4RNRB 5I1HH 3QULB 1E27A 3MO1A 4JDTH 5FA3A 1FL3B 3EYFA 1YJDC 2CXGA 2X1XR 3IXAB 3V5DA 5DQDH 5ENWB 3E2HB 1HKLL 3AS2A 2DIBA 4XVSL 5HPOA 5A2FA 1K4CA 2G9HB 5KANI 4NKMA 5DD6B 1GGCH 4R7DB 1T03H 5JW3H 3LS4L 3HG1A 2RHEA 3F58L 3K4ZA 3T0EA 4PRIA 2GJ6E 5DXWA 5J6GB 4L9LC 4XMLH 3VRJB 3UYPA 2DQUH 4X5LA 5EU4B 1LP9B 3SJVB 2EE9A 3MBXL 1CXLA 4FP8H 1J10A 4LSUH 1K2DB 4YBHA 1G7QB 2CLVA 2AJYL 3DSFH 4AK1A 1EXUA 4Q9BA 4CW1A 1UEYA 4I1NB 4RZCA 4WO4D 2XTJD 3TNMB 3WUZA 3DX6B 1X4XA 2VXTL 5IJKC 1A6VL 4CVZA 3GI8L 4WV1B 2P8LA 3GIVB 2XT1B 9CGTA 3EDFA 5D2NA 2HVJA 1T22B 4X5XB 1HOCA 4LEOB 4XCCH 5E08L 2BNRA 4CMHC 1E4KA 5FO7A 3DBXA 3L1OH 3VH8A 4U1GC 5FYKU 1IARB 4X7TA 3SQOL 5D5MB 4HS8H 3LHPH 4XHQA 5FF6A 3PV7A 1QO3A 1XGTA 2VISB 3Q5YA 1BGXH 4ORGA 3PWVA 1P7QD 3PNWB 1ONQB 1CXKA 4P2QA 5I1CH 1BJMA 1UENA 3NPSC 4JKMA 4JO3H 4DKEL 5TH2A 1QSVA 5TDOA 1NFIB 3FCTA 3JWDC 3VMNA 3IDXL 4HKBB 3KLHC 1VKXA 5I16A 1NGYB 3SPVA 2DLTA 2ATKA 4OGAD 1UG9A 4PJHF 2PXYD 2ZNXA 2P7TA 1MJ7H 4M7KH 5DQ9A 5EU6D 4P99A 4LKXB 1HDMA 1YEIH 3HMXL 1DEEA 2Q8BL 5CJOH 2F58H 3T0EC 5F6IB 2X89A 3BKJL 4XP9H 4CGTA 5L7XL 5BV7B 3QO1A 5DZLA 4NPYA 5KS9E 1KTRL 3ARDB 3C08L 2OS7A 5I8CB 4PTTB 4IIQB 4CJ1A 2DTMH 3O3DB 2VLLB 4W4OC 2EC9U 1Q8MA 3HI6H 1MRDL 4M1GL 1J05A 1WUNT 4PY7A 4LCWE 4ORZC 1WJ3A 2XXCB 2Y6SD