2PNDA

Structure or murine crig
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GHPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel inhibitor of the alternative pathway of complement reverses inflammation and bone destruction in experimental arthritis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords V-set and immunoglobulin domain containing 4
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pndA00
2NLJB 4J8RA 2W60A 1NCDL 4EIGB 5F44A 3SDAB 12E8H 3X11B 4W4OC 3SDDB 4WFFD 2ZCLH 4JB9H 4TVPL 1DQDH 5K9KB 4TSBH 1I9JL 3V8OA 4KROD 1XF3B 2HN7A 5L0QB 3O9WA 3RWFB 1TQCC 2JJVA 1L0QA 3CC5A 3WS3B 3IKCA 4LPXA 3RL2A 5MEOA 3I02B 1OM3H 1RIUH 4MJ6B 1IGFL 3IDYC 4NBYB 1HIMH 4G7VL 3TT3H 1PD6A 5E6IA 3PDGA 4J3SA 2OI9C 3RHWK 3DI2B 5BCAA 3F5WB 1VFMA 1OAKL 4KHXH 1MFEH 4QRTB 3AAZA 2A6IB 4A6YH 1A14H 3G6JE 1KOAA 2QQQA 5E5MB 3BDYL 4KDTA 4HCRA 1NLBH 3NFSL 3KPRA 4HJ0C 4ZDHB 3U7YL 4F7MA 1VEMA 1YJDC 3A67H 3ZE0E 4KAQL 5BZDA 2V5YA 4UTAH 2NY3C 2BNQA 1WC7A 4GUPB 1C5DB 2YRZA 2OR9L 1WZMA 3KYNB 5EU7C 3BMWA 2W9EL 1C5CH 1CGUA 4CJ1A 4MMZC 1EO7A 3BJ91 3ROOA 2ZSVA 2YC1B 1WTGT 5HD8D 2EC9U 5AZ2L 4AQOA 4X6CA 4X5WA 5KS9E 3L3KB 1Y18B 2KZWA 4LLYA 3BVNA 4YZFF 4R97B 3UC0L 1P4BL 1Z5LB 3D18B 4LSRH 4Z7VF 3QULA 2DQTH 4RNRA 5D7LB 2YN5A 1TETL 3PWJB 1LEGA 4AG4H 5D2NE 5JXAH 5IFJB 3GBML 2EC8A 1UWXH 3HC0A 4X8XA 2DLEA 5MHSE 4LASL 5I1LA 3V5KB 5C9JB 4PJ5E 1H0DB 1JBJA 2FX7H 4H0HB 1ZA6B 2CH8A 3TPUB 5HHNA 5C71A 4R6UA 1I1AD 2DWEB 1TJIL 2Q7YA 3EDFA 3MV8E 4K8RD 5FOBB 3TJHC 5AD0B 2AGJL 2IG2L 3HG1B 5D8JL 4NQCE 1QFOA 1A4JB 1B0WA 5JR1H 3IETA 2QSQA 5IJKA 1RZ8A 4CU8A 3KLHC 2OL3B 1SVZA 1KJ3H 2PR4L 1YEIH 5ESAA 5IB5A 4K71C 3H3PH 1WWWX 3FN3A 3ESVF 5ITBH 4JZOB 4DK3A 4PRHD 4JFZL 2VDRH 2NR6C 3SO3C 5EUOE 5EULV 1CBVL 3CUPA 1F3RB 4HWNA 1EK3A 1HWHB 4O58H 1HH9A 3WKNA 4X9BA 4HWBA 3SGKC 3HZMA 5GS3A 3VXRD 2DLIA 4G8FA 5DURD 1CT8A 5J9PA 5ISZE 1PKQB 2DKMA 3AU1A 3DLQR 1K6QH 1NCWL 4OFPA 4P2QE 1TVHB 4JDTL 5CEZD 4LLQB 5HY9A 4L4TB 1L6XA 1LO0L 1NGQL 2CRIA 3WKML 1AP2B 3KXFA 4Y4FC 4TTDD 4TRPH 1UJTA 4ZODA 4M1CD 3GMPB 1FZMB 4PGZA 1FZKB 1AE6H 1YYLH 5DJCB 2H8PA 2IADB 5DHVA 3B8SA 1NKRA 4OLVL 3VI4E 4UTAL 2BNRB 5D96C 2BNQE 4KK9C 2LU7A 4TN9A 3IAPA 4PJ8C 2GFBB 3AM8A 4XWOC 3VXRB 1I1AC 3PWVB 4X6DB 2E8ZA 3VGGA 4MXVE 4OFYD 3LS4H 1WGOA 5TQ2H 4D8PA 3L3GB 4R9HA 3ARBB 4N1EA 4X6EB 3O6LL 4X98B 3STZB 4D9QD 3KYOB 4K3DH 1HHGB 3UYOD 3MSPA 2XWTA 4LVOC 2A77H 1YJDH 4GRWB 3DURA 3M1BA 4JO4H 3HAEH 3FZUD 3CVHL 2VDPL 1KLGA 3QJFA 2B2XL 2WP3O 1G7PA 4P49A 3EAKA 5KSUA 4HHAA 3TNNB 1OQOA 2GEEA 3BQUA 4DW2H 3MOAL 1T1YA 4I0CC 4IIQC 4LRNL 3WN5A 1UXWB 2HN7B 5EB9A 3QUZA 4TOYH 1JF5A 3TBVA 3L95A 3LV3A 3RY5A 4MJ6A 3H3BC 2MCPL 4PJ5A 5I8KL 4Q9QL 1A4JA 1KV3A 4FQ2H 5HHVL 4DKEH 5DMKA 3K1DA 4HFWB 1GC1L 4EVNA 4TSCL 4BFEA 2GJZA 1H3VA 4ODHH 1I8IB 5H37G 1I7TB 5GGUB 3MV8A 4OLWH 5IBTL 4G7YL 5A3ID 5H94B 3L5JA 1U3JA 3VXUE 1FSKB 2N1KA 4DCQB 2P1YA 3RVWD 4E41B 3IFLL 5CZVL 4PJDF 4PRDB 4X99A 1GIGH 5C0BD 4KK6D 4YHKL 5FYJD 3HI6L 4OIBA 1VESA 1MHHA 3MXWL 5EIQA 4D0DB 2Y1VA 4NZRL 4OM1H 2YRLA 4KQ3H 3KNBA 3HUJB 1IM9B 5E4IA 3VWJA 3LKOA 2QHLA 3DSFH 5HYSB 1MH5A 4Y2DB 4N9GA 1ZT4A 3VE0A 5IWLA 4ETQB 3I75A 3P4OB 3DHJA 2IGFL 2XQBH 5B3JE 3O4OC 5I1AB 4U3XA 1HXYA 2WM0A 5B22A 1GSMA 5ISZA 1GZPA 2OZ4A 1KCUL 2A38A 1S5IL 3GRWA 5GSRA 1BGXL 4HZLA 3MNWA 2LTQB 2UZXB 3Q5TA 2ZG1A 3LKOB 3AMKA 1JNLL 5D71H 5DJ2A 1ACYL 3MA7B 1MEXH 1B4JL 3QUKB 4NNYB 3IDMA 4PJEF 2DMKA 4NUJA 3WS6A 1R3IL 1CFSA 4XB8A 3V5DA 1JYWA 1RHFA 3IKKA 2RAMA 1T80A 3E8UL 4GW1B 4M93B 4JRXD 5D9SB 3JWOH 3FQUA 3ZT6A 3PQYE 1S7WA 3RZCC 2A9NL 4M48H 5FO8A 3O3DA 3MRMA 4KRPC 1V3KA 4ZTPH 4QHLA 3QUXD 2AERT 2ENYA 5I30L 4QT5B 5SX4H 3B5GA 3EGSB 4ODHL 4Z8FL 1WBYA 3KJ6H 3VMPA 5I1HH 4PLJD 5TDOB 5IW1A 5J57B 3O41B 3DTXA 2ITDA 5C6TL 4WEBH 5F7NC 5E6ID 2VLLA 4FQIL 4JDZB 1E4KC 3GGWB 1CXHA 4LLAA 4K7PY 4BZYA 3GNMH 3W5MA 1L4IA 5K93A 4YNYA 1DBBL 5T3ZD 1CLOL 1RJLB 4G6JH 3ZDZE 5GRZA 2PCPB 1MI5D 4CAGA 1ZTXH 3MLUL 3NAAL 3FONB 4Q6IA 4AEEA 3SEPA 3NIDE 4QRRD 4FTVD 5EZOL 3MV7B 3MMEA 3WO4B 2LFGA 5D7IF 2X1PA 2Q86B 5I19L 4AH2A 4PRIE 3ZKSD 4ZUSA 5EO0A 3DRQB 3RKDC 2QQKH 2P44B 4CN6A 2J6EA 2FO4A 2AJUH 4LLUA 1S9YB 5IFAL 1KFAH 3TBYB 2OX5A 2JK5A 1X5HA 5GISL 3R06A 1BOGB 1AXTL 3GMOA 5IK3A 2FZ3B 3NCEB 1U8NA 4YPJA 2NW3A 3MRFA 5EC2A 1NGPH 1UG9A 4R2GD 2F5AH 5HYIA 4U05A 3SDYH 3BWAA 4NRYA 3QIBA 3DHMA 3BP4B 1OAQL 2CR6A 5DFWH 1FE8H 5K59F 3HNTL 4BQ9A 1UWGL 4MDJA 5IOPA 5CGYD 4CMHB 3HZYB 3IVKA 4K2UH 5DQDL 4F57L 2F54A 2EECA 1AI1L 3EKCA 3QDGD 4L3AA 3TVMA 5HVFB 5C0AB 1CDHA 1CFQA 2NLJA 1EGJL 4AQ1B 4CMMA 3WNMA 1NFDF 3MRQA 1C12A 2V9QA 3HTLX 2ZWLT 1U8OB 3BP4A 5MEND 5HYJB 2Y5TA 4HW6A 4DVBB 2X4OB 3FO9A 1PKOA 3DV4B 4XWGH 5LGKA 4IIQB 4WWKD 4NUGL 1DVFA 4JGJA 4F37F 3QUZB 4HJGB 1LO5A 4EXKA 4WNQB 1NFDB 1CQKA 3WLWD 1QRND 2DF3A 5SV4A 4LF3A 3ZKMD 1AFVL 2H45A 1LWRA 2YR3A 5HGAA 4FXGA 4P57B 2FSEB 4JHAH 4O2EB 3RVXD 4I4WA 4YIQA 3RVUC 1KTDA 3DMMC 1WBYB 3FB8B 4XMPL 3FL7A 3V6FB 4OV6F 1DN0A 1FAKT 4P5MB 3TIDB 1IARB 2VOTA 3OB0H 1FNEB 1KB5H 4JZJC 2NY5L 3U46A 5IG7B 3HE6D 4XP1L 1TZIB 3X3GL 2FGZA 4WTXA 3VXSD 3QWOB 5J0BA 3O8XD 4I2XE 4LPWA 3X13B 4ZUTA 4EI5B 1T0NB 5CJQL 3U6RB 3EDKA 1X5LA 4UDUA 1LEKB 4ERSH 3OAUL 3ULUD 1NAKH 4AMKL 1U58B 1N5YH 1BLNA 5C7XH 1D5MA 6CGTA 4GMTH 1A5FH 1DBBH 3V0WH 2ZCKH 1CLOH 3ARVA 3FT4B 1FZJA 4F7EB 1Y18A 4G8GB 3QXDA 3NZ8B 2MQCA 3BOVA 4J3VA 4TNWK 3WN5C 1N5AA 4K07A 5A3IC 4YBHA 5GGSA 1DBKH 4F7TA 2VYRE 5LQBL 1IGYB 1N3NB 3C8KB 4NGHH 5I66B 2Q3ZA 4V1DD 3LIZH 3DVGA 4ZXBD 2XIDA 5HI4D 4ZPVA 5DS8B 5IQ9A 1FCGA 4M7JL 1F6FB 1S8DB 5JXEC 3G9VA 4BZ1L 1CGTA 4UT9L 4YDJA 5E1HB 4ZFFA 1KCVH 4S0SD 4PJ7E 4LVEA 3W39B 4DFHA 3LEYH 4MJIA 1LHZA 1O5DT 3HMWH 2PNDA 5IB1B 1KJ2B 5CMAB 1CBVH 5C08E 4LL9A 2YD6A 2AV7B 2VH5L 2O93L 4JHAL 4HXAH 4QTIH 3FOLA 1P84J 1IGTA 5KS9F 1T1XA 3OAZK 2QQLL 4K2UL 4Y5YB 1U8OA 2HLAB 3RGVC 3BXNA 3FFCD 3P9MA 1AGCB 4GH7B 4H5SB 2NTFA 2W0FB 3MCLH 4ELKA 1T0MB 1KB9J 1T21B 1MHEB 3DMMA 4J12A 3ZL4H 1Y6MR 3P9WB 4S1QH 1YJDL 1BVLB 4B7LA 4PG2A 5TDNB 1KBGL 4YDVA 1RQ5A 3QO0B 4JB9L 3P11L 4TSBL 1LO2H 3SKOB 4OLEA 3GBNH 1F2QA 4HIEA 5KVGH 1ULVA 1P6FA 3O4LD 4LRNH 1DN0B 4KY1H 4MJ5A 5C8JA 4W4OA 5EOCJ 2ICES 1I8KA 2P5WB 2VDPH 3MRJA 5DXWA 3WFHB 5HDBE 1RZ7L 4X6FB 1U3HA 5FUZH 4CVXB 1E28A 5F9JB 4NQCD 4FG6C 4XMLH 2G75A 3JV5A 4HS3B 1EEQA 3QRGL 3DO3A 1NEZG 2BNRD 1AGEA 3S37X 4DN4L 3S34L 2VXQL 1BOGA 1Q1JL 2E7CA 3GMOB 3S5LG 4CN1A 2NXYC 5FO7A 4UOW1 1KN4L 1FDLH 1R24B 4C56D 5E5MA 3T3ME 1ZGLB 4FQ2L 5HHVH 2QR0A 3P4LA 1S7TB 4PP1C 4WU5A 1M7IB 2DIJA 4JY4B 1TCRB 3MGAA 4AT6B 4WFED 5EOTB 1OAKH 2BFVL 4KHXL 4CVXA 3GK8H 5C3LD 1C5CL 5I76B 4LNRB 2B8OT 1B3JA 2EE3A 1KB9K 4XPTH 1CZ8L 2H3NA 1OTUD 1XR8A 4LLMB 5BRZA 4G6AC 4NN5C 1KPVB 3O2WH 2JCCE 3D3VE 1A7BA 3UTTA 5JDJA 2J8UF 2VIRA 3WFDL 1H3PL 3VWKB 1SEBA 1MUJA 1MCWW 4NN6B 4R7DB 3VMOA 5FB8B 1JGDA 5CZKA 1QZ1A 3TVMC 2CIIB 4HH9A 5I9QB 4CU6A 2YRPA 3LKSA 2Z8SA 3MRLA 4UTBH 3LKQB 4E5XA 1JZ8A 5TE4H 4LCCA 1NJ9A 1LP9E 3MBED 1A2YB 2UVEA 1CE6A 3ARFD 5CMAA 5B8CC 2GK0B 4KGJA 3IDGB 4K23L 2E6QA 1KCVL 4EOWH 2J6EL 3HLAA 2NYYD 4PJ7A 3JWOC 5C86A 3TCXA 1CGSH 1MUJB 1YEGL 3HG1D 1NBVL 4RGNC 5HSFA 1JV5A 2GAZB 1E0OB 4P3CH 3TCLB 1LP9B 4ZAKB 4WI3A 2J8OA 5CIPA 2E9JA 3UTSD 2BVYA 2XQBL 5EO9B 5AD0A 3KHQA 4JFEA 4JDVB 3O3AB 1MVUB 4WWID 1CGXA 5BXFA 1O0VA 3HLAB 3BP7B 2QSTA 2GT9B 5KN5B 5EN2A 4GRWH 4TVPD 3NA4A 1A9EA 1DANU 2EDBA 4Y5XC 1KBGH 3TBWB 5E9DB 3UROR 1CFNB 1UB5A 4M1DH 4IRSC 1KENH 4NZUL 3QWRA 3UTQA 3QYCA 4OKVB 4RGMC 1AGBB 4F7CB 4F7MB 2EICA 3PF2A 1BQLH 1KELH 3O3AA 1N26A 5TH2A 3OX8B 4XC3L 2CDEB 2ENSA 1FO0B 4O4YL 3KPNB 2X70A 1JRHI 3BP7A 5F9WC 5KOMC 3R1GH 5ALCL 2XT1B 1JZ3A 4QGYA 4NO5A 3GSNB 4WO4B 3O2WL 4FS0A 4RBPH 3ROLA 4JAMB 3H7BA 2R4RL 5ID0A 1ZEAL 5IQ9B 3ET9F 5FYKD 1CE1H 1B90A 2GJ6D 1PSKL 4K7PL 3ZDXF 1R3LA 5E4EB 1DUYA 1ZGLP 5DGQA 3BX7C 4ORGB 2EKJA 3DO7A 3PP4H 5DK3A 1X44A 5AZEL 1EXUB 4MDIB 2ZUUA 4LSTL 5CBAB 4NWTH 4N0CD 3VXMA 2JK5B 1YY9C 5C09E 4PIRF 1HCVA 5JHLL 5L9DL 3AS2A 1G7HA 4Z7QE 3DBXA 2C3GA 4CVZB 3NA9L 5JNYB 5CD5D 3V5KA 5C9JA 4ZSOA 1RV6X 3PXJA 3CDGA 3LEVL 4E9LA 4HXBL 5F3BB 2UWEE 3ZE2E 4B0MM 4Q6YA 4UUJA 1FIGH 2P5EA 4BFIB 5C09B 3LB6C 4K9EL 4G8GD 3KPSE 4R4ND 5I8OH 4K3GA 2DM3A 1XZ0A 3HAEB 2FLBT 2YEZB 2BY0A 4OCYL 4JFOA 5KTEH 2ZUQC 2Z31B 2E7BA 2R2HA 3DUUA 1ZHLB 5EC1B 4CVZA 3O2DL 3QDJE 3IRPX 5B39G 5J6HB 3TO4D 1FLTX 1J0KA 1FV1B 3AS3A 2O5ZL 3GSOA 4BQBA 2AQ2A 3I6GB 3EYOB 5L0QC 1YNTB 3H2WA 2NY6C 1JGEB 1JHLL 3CFKA 2OBGA 3M45A 2ID5A 3NFPB 1LEIB 3IF1B 3IXTB 3WMSA 4LBEB 1IC4H 2PW1B 3UJJL 3QZWA 5DTFB 2P47B 4J3UA 5ADOL 3I9GL 5E7BA 4UOJA 1NEZB 2YD1A 5FM5O 3P4NB 4PJDB 5E9DD 4TUOB 1HYSC 4G8FB 4Z77A 3W0WA 3DGGA 1RUAL 2ADJA 4YHNB 4XCYA 5DR5H 5LJYH 3CC5B 4GRWF 3GMLA 1M7IA 4PBWD 1F4YL 3RL1A 2PYFB 3P3YA 4N0UB 3VH8B 1HDMB 1AXSA 4P9HC 3X13A 5D72L 2BVPB 1ZWIA 4PJFA 3F65A 4X4MA 5FUCC 4UU9B 1AQDA 4XVTL 1R3JA 1AGFB 4XPBH 5GQBA 4RQQA 4J4PD 5FDWA 1BQLL 1KIRB 1M6OB 1QYGH 2MPAH 1K3IA 5BOZG 3IU4H 3O3UN 4QWWC 4U6HA 4L8BB 1YC8A 3ALWA 4HWUA 1JZ4A 4P2QD 1CS6A 3BPLB 1F90L 3W2DH 4CKVX 3PHQA 5LXGH 1QFUL 4BZ2H 1FFPA 2G5RA 2DLGA 1OT1A 4A2MA 4M6OH 4WVRA 4ELMF 5IGXL 3D0VB 3FFCA 4OIAA 4GG6F 4KAQH 3OB8A 4P4KD 1U8PB 3L3JA 1CU4L 5JW5B 4IJ3B 3QDGB 4I5BA 5D7JA 3K4DA 4ZOBA 4UNVA 3V9FA 4L9LC 2EIZB 4FFZL 3EOTH 4NO2A 3CX2A 4JPKL 5C0ND 5C07E 4FZ8H 1NGYA 1MEXL 4PJDE 1NL0L 2ARJQ 3WS6C 3PHQB 2DLFL 3MLSL 3SKJL 3GFUA 1EIBA 5HDOA 3MR9A 5D6DA 5EIIB 3QWOA 2XFXB 1MVUA 4Z8FH 4HWBL 1JZ2A 3MA9H 4OB5L 1TITA 5F1IB 4W6XB 5MEPA 5E94B 2WQ8A 3EYUL 1A6AA 3S35L 5BV7H 2CLVB 4JQVC 1DP0A 1AXIB 2ITDB 1IGCL 1IGML 5JXAL 2VQ1B 4HIIB 2KUTA 4P2CG 1MAJA 3GSXA 5HPMA 5JW4Q 3RWGA 3I02A 3VG9B 2UZIL 2XA8L 4MQTB 3QDJA 1IT9L 4I48B 3RDTC 3S4SB 4ODSL 4KQ4H 4UBDC 5DD3L 2HG5A 2ZJSH 4GKNA 2FBJL 5HPOA 1FNGB 4M3KB 3KPLA 4TULL 2IPUK 5GRVK 1U8JB 4X0KB 5HYSA 1FSKC 1VCAA 4FFZH 3RPIB 3NCMA 4YK4C 1KCRL 1MJ8L 4P23C 4PJXF 1U8KA 2M1KA 4OBSA 3OKKA 4ALAL 4ODBD 4FRWA 4HF5L 2OXGA 4OGZA 2CXGA 2CK0L 4X6FA 2QSVA 5J3HC 1HINL 4X98A 3GSUA 5DJXA 4J3TA 3LAFA 3VG9C 2CGRH 3U9PH 5FYJE 1U8MA 1EEZA 3EFFB 3MNVA 2VAJA 1IBGL 3MFFA 1NAMB 4M6NL 3MJ9L 5CEZL 5F1OB 2I9LA 1BZ9B 3X3FH 2YSSA 1X7QB 3C6LA 4WIQA 3HI5L 4X5WB 3EZ8A 4QXTA 5ENWA 1U93B 4PJFE 3VFUA 3S36L 4XNQB 4AM0A 4HK0B 3HI1B 1Q0XL 3S34H 3NN8A 2AXJA 3VFNB 2EYSA 1P7KB 3CLEL 1LO4L 3ULSA 4ELKB 1RVFH 2DIBA 1U8MB 1OSPH 3LH2H 2PF6A 3SDDC 3LZFH 4P2RB 5HHXH 5E03A 4WTZG 1DSFL 2PTUA 4KUCD 4FQCL 5A2LH 2XTJC 2Z31A 2F54B 1CL7H 5J7CC 4KDVA 2ARJB 1OAXH 4D3CL 1BJ8A 5IJVB 3D85A 5HHME 2W60B 4KZEL 43CAB 3JV6A 3TBSB 4OB5H 2VDML 4LSPL 4JFFA 2MCG1 4OLXH 5DC4B 1HYSD 1T89A 4WY7L 2N4IA 5DZOA 1U2CA 1EGJA 4YUEH 5HJ3A 4PGBA 2DQGL 2EZ0C 3QDMB 2KQNA 4HQQH 1ETZA 1MCLA 5FCUL 5HHPA 4CVWA 3BT2L 3TNMB 2WBKA 4K23H 1CLYL 3BYYA 4F3FB 2BSTB 1XT5A 3VFWA 4Y5YC 3S96B 1WFNA 1AGEB 2PYED 4PJHA 1EHAA 1GPOL 5T1LD 4XPGH 2BCKA 3JTTA 2EH7H 1WWBX 3BHBB 5EBMA 3L3HA 5I1GH 1T1YB 4JO1H 2JJSC 3WFDH 4Z0BH 1KYOJ 1IGJB 4ZUVB 3MREB 1G1CA 3KLAA 4JFEB 1VADA 3B9KA 3DRQA 1EBAA 2YHGA 1X5JA 3JVGC 3QCTL 2WINA 2DI9A 3U0PA 1X3DA 1URLA 1WSST 3ZE1F 4QNPE 4JO2L 4QNPF 3ZE1E 2UZIH 4RQQB 4OCLC 1ZE3C 4HG4K 3N9GL 2D03H 4Y19A 3DECA 5CBEA 5IV2A 3N85L 4HUXB 3WFBL 4GRMB 1VHPA 1FRGH 5E2WL 1J1PL 1LNUB 1QLEL 2VLRA 3BVNB 1JGDB 1RZKC 5K33A 4AMKH 1N5YL 1JYVA 1LE5A 3RJDA 4RFNC 4FQXC 3R1GL 5F9AC 1OAZH 3JWDC 2H8PB 5TDPB 3SDYL 1I9RL 2BVTA 3MFFB 2FEDC 3LH2L 3O3BA 4C4KT 35C8H 3MJ6A 5IJKC 3U4EB 5EU6E 3C08L 5GGQL 4KVCH 4ETQA 3RI5F 2CKBA 3QEHB 4NRZA 2OP4L 4IRJB 3ZKND 1T6WA 2JIXA 1RMFL 5EU6D 1FC2D 2FECI 4ZFFB 3OQ3B 5ILTL 4BM7A 4K71B 1QBMH 4QOKD 4EDWH 4OUUA 3JUZA 3GSVA 4M7JH 1IKFL 4I3SL 4QGTA 4P9HL 1C1EL 4QXUL 1MFCH 2D03L 5GS0H 3LSOA 5JIIA 5KSBA 1IQDA 1MWAB 4MNQB 4XXCA 4MD5A 3THMH 5C92A 1WWCA 3BQUB 5DLML 4KJYA 3GSRA 4QO1A 5D2NA 2EKSB 1NUGA 2O5YH 4O9HL 5TF1L 4XXDA 3NPZB 5DJAB 4HIIA 3I84A 5D4QA 4I0KA 4JKLA 4KJWD 1ETZB 3RP1A 1CICB 2DBLL 3NFNA 4WHCA 2YBRA 1JJUA 2J7LA 4NSKA 4HXBH 3T4YA 3VRJB 1GC1C 5GIRA 4LGSB 4Z0XB 1CG9A 3VXRE 4QHNA 3SKOA 2VC2L 3BQUC 2EDLA 3BPCB 4TYUA 4DGIH 4N5UA 4N0RA 1AHWC 2FZ3A 1NSNH 5DURB 5D2NB 3D48R 3G6AA 3RWFA 3LKRA 4GBXD 5DYOB 1F4HA 1Z3GH 1KTLB 4M43H 3L1OL 4LKCA 1NPUA 3LDBC 4DTGL 1J10A 5AG8A 5J13B 3CH8A 2WWKT 2YXMA 1AH1A 1A5FL 4PRPD 4MDIA 4IRJD 3ESUF 3ARDA 4G9FA 5DT1L 1X5IA 1A8JH 3G9AB 3FONA 2PO6C 4Q6IB 2Q8BH 3WIHA 4CVUA 3TVMB 4EI6A 5D1XA 4YC2C 3MROA 2HT4D 3P0VL 5T3ZH 3D69B 2VR9A 5DDHA 4KHTH 1X5XA 4YZFE 2B1HH 1MCNA 4DZ8A 2R1XA 3DV4A 3WL9A 2OYPA 3B5TA 4QRSA 4ZD3H 4QCIB 4NHCL 4Y19E 5EWIH 1KPRA 5GHWH 4GKZB 5IMOB 2J88L 5I6XB 4HPYL 4G9DA 2EIDA 3OKLA 3TJEL 5BJTA 1DBAL 3QUYC 1AGFA 1D5BB 5BW7C 3SGEH 3RTQC 4NQSB 3TO4B 1CFTA 1Q72L 1ZHNA 2UZYB 3UTPD 3I9GH 4FQHB 2K3TA 1UWXK 3GSNH 5GRUH 1ITCA 4HG4J 1RPQA 2AEPH 2HH0H 4IOIB 2OM5A 4JN2A 5IHLB 1LK3H 2CD0A 4JO4L 4I3RL 5IGXH 4MQ7B 3U4BL 2IALA 5ICYB 1ITBB 2OR7A 3BP5A 2Q7NA 3PNWB 4MJ4A 4NM4H 1J8HA 4Y2DD 4OCSH 1XF2B 4DGIL 1CXEA 1JV5B 2GHWB 2EIZA 4NO2B 5LWYL 4E0RA 1X5YA 5D8JH 3DXAE 3H3KA 3OKEB 4RGOH 3CFBB 5F7DB 2HJFB 2EEAA 2Q7YB 2FHBA 3HS0B 4XPFH 1VGEL 1F2XK 2JB6B 5HYQA 2X9XA 1Q8MA 2VDLH 4RA0C 2VLJB 4MJ2A 1QBBA 3L1OH 1VADB 4MB3A 3BFOA 2MQ3A 1IRAY 1EA9C 3MRRB 4KI5D 1CG9B 4Z7WF 3EOTL 5I16A 4TTGA 4QHMB 1DN2A 4LHQB 4KH2A 2VDRL 4TNWF 3K8LA 5FDWB 2AEPL 1ZLUK 1OAQH 3ARFA 3MBEA 5CBEB 3BW9B 2AXGB 2FIRT 2X2YA 4LOUD 3O4LE 5AYQA 4LLDA 3H9SB 4M6AA 1XGYL 1Y6KR 1YNKH 2XTJD 2LTQC 3AREA 1OTTD 1WZ1L 2LU4A 1B9ZA 4MXQC 2NY6B 1BAFL 4PJIE 4V1DE 4I1NB 4C83A 4P4RB 3MACH 1HHJA 4OGYH 3RTQD 4LCCC 5FO9A 1V7NH 4ODVH 2FYYA 1YY9D 2IBZY 3F7QA 1GRWA 2C7UB 5CJOH 5D7JB 3PL6A 2HLAA 1YZZA 4U6XA 5GGVH 1FIEA 3O8XB 1ND0B 5L2KB 4LEOA 2D0GA 5E8DH 4YGVB 3E6FB 3QQ9D 3OXSA 3QDGE 4M7LL 2VXVH 5HI3C 4R26H 4WI9A 5DD0L 1CFVL 2DAVA 3ZHLA 4DUVA 4LSVL 2I60H 2NY0D 2XY1A 3BUYA 4B53A 4XVJH 3VXOA 4IRJC 3BDXA 3GI8L 3P73A 1KB5L 2Y72A 1A7PH 2YD9A 4FNLL 3SE8H 1D9KC 3PWVA 4OTXH 4X6DA 4HK0A 4KJQD 1ONQA 5DRNB 5MENA 1PQZB 4D9LL 1BWMA 4U2ZA 3O8XC 5L8JB 4KTEH 3MJ8B 4HPOH 3OJDA 3CFCL 1WEJL 4IRZH 4TUKH 5HGHB 3BPCA 1FQ9C 1UZ8B 5C0AD 4OQ1A 4QRQA 3RPKA 4FQIH 3PGCB 2XKNA 1NH6A 3PQYA 1PZ5B 4JHWH 1OPGH 4M62H 2VL5A 4JG0L 5B21A 5HY9B 3IDXH 4PRBB 1V7ML 1TCRA 5HHMB 3BT2H 2VMFA 1S9KC 4KZEH 1I1CA 4YDKH 1JWSB 1AP2A 1WUNT 4QRRB 5F7MC 1UXSA 3QZWB 5IR1B 4EI5A 1I8LC 4FFYL 5EZOH 4XPGL 2H9GB 1U91B 4Y4HC 4P4KB 4NO5B 4NN7C 2I25N 3QDHA 2FWOA 5FKAB 2OK0H 4OM1L 1QR1A 2A74B 3QIUD 4R0LA 2I9TA 2VO5A 5KAQG 4LSQH 4JPWL 3S7GA 1KN2L 4TNVK 1EO8L 5KVGL 5LVEA 1KPUA 4R4FL 1MNUL 3CIQA 4HPOL 2X89A 1BD2D 5E08H 1AXTH 4TNVF 2W59A 5B38G 3MV7E 4LIQH 3UC0H 3IDIA 5CINH 3UJTL 1AJ7L 2VL4A 5F9OH 2GI7A 5BMFH 3O6KH 4PRIA 3U0TA 2A1WH 4QWWD 2OTUA 3K2UL 5D5MA 1KLFA 1OD7A 1DTUA 5E1AA 4G43A 2FLRT 4PJEE 5IBUG 3GI8H 4MNHA 4P5TA 3D87B 3UEZA 4JEGB 1TTUA 1FYTB 3ARZA 1JNJA 1OD9A 2W1NA 5AAWA 3N1PC 5CP3H 4MA7H 3F7VB 3L3IA 4F33B 2ORBH 1A4KA 2Y6SC 3M8OH 3CX5K 5I1CH 3GJFH 3TH4T 4WV1B 3IFNL 3QB7C 4HGWB 4ZFOL 2XZZA 3EYSL 4GXVL 3FFCB 5ICYA 4LOUC 3O3EA 2ZCHL 5I1LB 3CFCH 2IQAA 3QDGA 2D0HA 3F7RA 5I8EA 4O2FA 1HN1A 1BQHB 3SDXB 4MXVF 3TBWA 3ILQD 4KDTC 4M5ZL 2AI0H 4NN7B 3VH8G 1KIQB 2VXUL 4WWKA 4WUUB 5CZXC 5IM7B 1G7JB 4DN4H 4P2QA 2P24A 2I26N 1QQDA 3NACH 4TSAL 2GK0A 4X6DE 5CP7A 2HFGL 4JGMA 1D7FA 3MGOB 4NQDE 5EZIL 3U6RA 2AK1L 4ZXBB 1YPZF 4NNXB 3T8XA 2BC4B 2A83A 5IKCA 5ALBL 5F21B 4JAMA 2FB4H 3O9WC 1IC4L 1B0GA 3UJJH 1UVQA 1BWWA 4NWUL 4GG6A 1WZLA 3SDAC 3M8OL 1CLCA 5AWNL 4RMTA 1UB6B 1MREH 2IAMD 3KJ4C 5J8OA 5BZDB 1E28B 5F9JA 1JWMA 4R4BB 5SX5K 4R4NC 3V4PH 3RZWA 2BSRB 1JPFB 5J6GB 2DQJH 3EDJA 1RIVH 3NH7H 3P4MA 1P7HL 3I3DA 2GCYA 3QEGH 4EUPA 5I73C 3SGKA 1DUZA 1I9EA 4OZIA 3QFJB 5IT2H 2KBGA 3I3EA 1T22A 3D39A 4S1DC 4ZSOB 1MY5A 3Q0HA 2Z35B 4JKMA 5EOCH 1GGUA 4WFHD 1AY1L 3TYFB 4M9OA 5DEFB 5I76A 4NO0D 1B2WH 5A16B 2GJ6B 4MWFB 4TPRH 3P4MB 4KV5E 2RBLA 2OTPA 5HYJE 2RFXB 5BRZD 4N0YL 2BK8A 1BZ9A 4EI6B 5D1XB 1SM3H 4O5LL 5I1KH 5HHOB 1MCOH 5J6HA 1AJ7H 1SEBB 4GRLC 3VW3L 3T3PE 1HQ4B 3SO5A 1U9KA 2A6JB 4WHTB 3U82B 1NLDH 1NBYB 2B4CC 5IW6B 3IKCB 3RL2B 2VDKH 1T0MA 4QHUB 4PJXB 4MCYB 2A6DB 3SKNA 1VSCA 3KVQA 1D6VH 4LSPH 4YDVB 4OLXL 5IT2L 1RD6A 4KUCF 3ILPA 5DJ6B 1SJEA 4MA7L 3QISA 1AQKL 3RVTD 4HIEB 3Q1SH 2FL5B 3IRZA 4JLRB 4M02A 4WW2C 1ED3B 3PWNA 3UO1L 2Y07L 1MCRA 1IMHC 1MY7A 5ETUB 2DQHL 4L1HA 5DJ8B 2R39A 2X7LB 5K9QG 3GM8A 4M61A 4HT1L 5HPMB 2P5WA 1XZ0B 4L4TD 4RSVA 4HV8B 1WBXB 4OT1L 1IC1A 2XQYK 4KK8D 4N0YH 5DGRA 3NCCB 1UWEH 3OB0K 1EO5A 2QKIA 1QTYT 2FSEA 4O2EA 3VXNA 2YPLD 4U1SA 3QCUL 3KPSB 3H9ZA 3QUMA 3KYKL 4XC1H 3VJ6A 3FHQA 3G04B 5EU5A 4V2BA 4IS6B 1S9VA 1T83C 3UDWC 1B0GB 5F6IB 1TJGH 4M7ZB 2I9TB 1BGXH 3RY6C 5HYQB 3BGMA 4QTHB 4KJQC 1FL5B 1HQRA 4MS8C 4NNPH 3V52H 2APXA 3OAUH 1MLBA 2WUCL 3O6FB 2YUXA 2O5ZH 1UJ3C 3MLRL 3IDIB 4KUZH 4U1SB 2H2SD 3O45A 3EHBD 4QHMA 2CRMA 4GRLD 4U0RB 2HVJA 4P46B 3W0WB 2YPLB 3P2TA 4WFHE 5E2TL 3S36X 2BNRA 1S9VB 3BW9A 1U92A 3BH9A 2D9CA 5SWSB 5I2IA 5F1KC 1YMMA 2DYPB 2P7TB 3V6OC 1U95A 5FGSA 4JN2B 5CAYB 4HJGA 4MWFA 5L2KD 3LVEA 5F3HA 2VKXA 4WW1B 2YWZA 1OGAA 4PJFB 4UINL 4EBQH 1LK2A 3V5HA 1XGYH 4WV1A 3VXMB 1FFOB 1P53A 4UZGA 1F4YH 2EXYC 4FXLA 1OARL 4WJ5B 1S9XB 1D5XB 5KSAD 2I07A 1PYWB 5CS7A 3VGAB 2HKHL 3RIAK 1ZS8B 4KVNH 2QHRH 4ZFZB 2Q1EA 3CFBA 1ZHKA 2JJTA 3RFZC 3RNQA 3LN4B 3D3VA 3OAZH 3I50H 4AIXA 3CD4A 3SKNB 4XVUC 3VD5A 4PJ5B 2P42B 1XCTA 4WY7H 2EYTA 4P5KA 2OTWA 1MI5A 4M7KL 3TZVD 1NUDA 3HZVB 1NC4B 1XH3A 2ARWA 4R7NA 3VXTB 2FL5A 5HBBA 3D2UA 4PJGE 3IGAA 1G9NH 3ZTNH 1I1FB 2BC4A 1ZS8A 3I6GA 3KLHD 1G7LA 5GS0L 4WI7A 5DFVD 3NFPA 1YN6B 4CNIB 2DMCA 5EORH 3B6SA 5IFAH 4QOKE 3BP6A 4QXWA 4KKNA 4P2OB 1LQSR 3QQNA 1J1XH 3HR6A 3IU4L 2H32A 3QIUA 3F58L 2QQKL 3VXQA 43C9B 3VJ6B 3BE1L 3MLYH 4GG8A 1FO0L 1B4RA 3AS1A 5GPRA 4Z7NE 4QEGA 4JFXA 4RGNE 2XWBA 1ORQA 4MJID 2A2QT 1KYOK 3QNYA 4EXPX 1Q1JH 1S7UB 3WV0A 3NN8B 2Y6SD 2G75B 4FN0A 4P2OA 5IR1A 1ZV5A 4MJIB 1HHGA 1VFBA 3KPLB 3VXQB 43C9A 2WMPA 1WICA 5DJ2B 3AU1B 3QAZC 4LCUB 4ZUUB 4L8SC 2DICA 1G7HB 2WUCH 4FFVC 3FOMB 1Z6JT 4J4PA 4BH8A 4HC1H 4E42B 4LLWB 3FO0H 3JXAA 1JPTL 1CK0L 3T2NL 5JQHC 4M5YH 1OAZL 3SDCA 2J88H 3ZE0F 2VWEE 2AXFB 1TNNA 1D5IL 1K3ZA 3BEWA 4PGBB 1NBYA 5J3HD 5D9SA 2CO7B 1FZMA 3MZTA 3CXDL 5IFJA 2CIKA 2J5LC 4RAUA 1HILB 3MRMB 1A1MA 5C1MB 1YMME 4OZFH 1G0DA 3EHBC 3BRFA 3TF7C 5BVJB 5F7LB 4LPVA 5BO1L 1I75A 1EEUA 2W9DH 5FYLH 3VWJD 4Y4HD 1IFHH 5EBMB 1T7XA 4M7ZC 4IOIA 3O41A 1FVDB 4MD4A 1JGEA 2CPCA 4IHOB 2EYSB 2P5ED 2ICWJ 1ZLSH 3RI5K 4BH7A 1INDH 2Z4QA 4EEEA 2Y06H 2WNGA 3KPPB 2KL6A 1IGIL 5GGRB 1AKJD 3P0GB 4XGZA 4MA8H 1XF5A 2ED7A 3KPSA 1GGCH 3SOBL 1NDMA 1XGQB 4MQXD 1G7QB 4KK8C 3V6FA 1EDQA 1QSZA 3QJHA 1H3UA 3HAEG 5LBSL 3WJJA 3PE9A 1UZ6E 2BX5A 4YQXH 4JREB 5DUBA 4POUB 4XNYL 5H35A 4BH7B 3FB7B 4WWKB 5T5FH 1CTNA 1I8MA 1MCJA 4PJGA 1RSFA 1XR9A 3GKWL 4YHML 2VABA 2MNUA 5CLTA 2DKUA 3MRRA 3PWLA 4JQXC 2BOCB 3BGFC 1DBMH 1VPOH 5T3ZE 5FCUH 3T8XB 4GXUN 3ZO0A 3C5ZC 4F58H 4M8VA 4J1UA 5E2VH 5E9DA 4YXHH 3DXAD 3CU7A 4JRYA 4ODUB 4YHIB 2B5IB 4DGVL 3T3PF 5JPMA 1YMMB 2DYPA 3FB7A 3D18A 3LKSB 4LHUD 4NYLA 3ZKNC 2VSDA 1GVIA 2CRYA 5DD5L 3PWLB 4NHUA 5JOFA 4P3WA 3U30C 1S7WB 4HXAL 2X4UB 4LU5L 2WBJA 1G9MC 2QQLH 3WCYA 2VQUA 15C8H 4YUEL 3FQTB 3T65B 1TZGH 5FKPB 5IUSA 1PZUB 3QG7H 1AY1H 4Y4FD 1W2KT 4X4ME 2VLRB 2VSCA 1M1SA 3JWNC 1TTGA 1T7VA 2Y5TB 4YHMH 1A7OL 1GZPB 4JZNB 2VAAB 4TVPE 2MHAA 5EDXA 3HR5B 5TFSH 5LG1A 3EYFB 4PJ8B 2VRAA 4ZNEA 1XF4B 4L4TE 4HLZG 5J13C 3HNVL 1QQDB 3VD3A 1XGPB 3FRPA 4FTVB 4F58L 4DQOH 1CF8L 3VI4F 1D5IH 3V4PL 1FYTE 3SE4A 5C0JB 5GGTA 2NY7H 1IE5A 3VXTA 4JFFB 2AJYL 3TM6A 5FGRA 3VA2C 3WFZA 3FFCE 5D6CA 4XP5L 3C9NB 3LMJL 5LGHH 3OGCA 4YHOH 1TLKA 3PL6D 4JY6B 4HMEA 1AD9A 3GJEB 4PJBA 4D0BA 1MAKA 3H42H 3DROB 1Z9SA 4ZUTB 3CLFH 2PXYA 3T1FB 1UENA 3KPOA 5L88H 5FA4A 1WFUA 4PJ9C 3WNOA 3TO4C 4GSDL 1BBJA 1RAMA 4XAWL 4WGVB 1I4FA 5D2LB 5E2VL 3TWCH 3VDAA 5BRZE 1RHHA 4PGCA 3I6KB 3MLWL 5CHNB 5GS2H 3W9EA 2IH3B 4M8QA 4Z7VE 2H2PC 1X5GA 4HS3A 5GIRB 5CEXB 1RK0B 2R2BB 4JG0H 5C6PB 2NY1B 4U1MA 4D0CA 1FZKA 5DJCA 4DKDC 4N90D 1YA5A 5EZJA 1T3FA 5JDSA 2JJUA 4EIZC 2YKLL 4PUBL 5CD5C 1EO8H 2BXZA 3OKNA 1C7TA 4KU1A 5D2LA 2P46B 5DS8A 4HKBA 4IMKA 4L4JA 1AIFB 2R0KH 4YDJB 2GSIA 2X4QB 3WJLC 3S3PA 1A0QH 1CYGA 5TDPA 1TJGL 2XG5A 5DMJB 5K9JL 2Z8VC 2ILLA 3GRWH 1YEGH 5J11B 5IHZA 4DK6A 1OF2A 4MCYA 1D6EA 4N8PA 5D7SH 4GKSB 3D69A 1ZAGA 3VFGH 2HWZH 4BFGA 4NKIL 4YHLL 3V5DB 3X17A 2ZUYA 3VFVB 1FVDA 2NZIA 1ZTXL 3NAAH 2Z91B 1CL7L 3QIUC 5IW3A 4YHYB 1FFPB 3RAJL 1ADQL 3O0RL 5F7HA 1DEDA 3ULUC 3IDGA 3L5IA 4PTTA 5I16B 1BEYL 2XKSA 4CMMB 3NCFB 4UV7L 3LS4L 5TQ2L 4PJHB 3MYJA 1BREA 3ECBA 1K4DB 2AJUL 3RDTD 3HKFA 4LDOB 4B50A 1ZA6A 1DBKL 1KFAL 3UX9B 4X7TB 1FCCA 1FGVL 4U31A 3QHFL 1NGYB 3D25B 4ZO9A 4NZTH 5KANG 1S7QB 2MKWA 3CSYB 5FECB 3BEVA 1JMXA 4DOHB 3QUZD 3E6HB 3MLWH 4AL8L 4PREA 4N0UA 3VH8A 4GAGL 3DROA 2LABA 5BXFB 5EA0L 5IFHL 5FGCE 3VU2A 3M17B 3EZJB 4YIQB 1N8ZB 5BZWA 1FJ1B 2Y7QB 2HVJB 2NY4C 4P46A 1SEQH 2XA8H 4DN3H 1XF2A 1FLRH 2FWOB 1IAIM 4HUXA 2WIIB 4AG4L 1NQBA 4WW2B 1F4AA 4JRYB 4KKLC 1KTLA 3VRIA 5HHQA 1FBIL 4Y1AD 1S3KH 3G5ZA 1P7QD 3ZYIA 1GYAA 2GUOA 1K4CB 1HH9B 5IVNA 1G6RB 2R2BA 2BNUA 4RGOL 3SCMD 2A6KA 3KGRA 2P5EE 3SDCD 3BD3A 1JF1B 1EPFA 3CCHB 1JFQL 2HJKA 3KYAA 4XRCB 3UTZB 4OF6A 4L4VB 1I7RA 4NPYA 4PJ9A 4DFIA 4NWTL 4P99A 1AFVH 1RURH 2X4SA 1HE7A 4NKQB 4NUJB 4I3RH 2FJHA 3FT3B 3MV9B 4BUGA 5IB3A 1MFDH 1T4KA 2HFEA 4YEFA 5ANMB 1EVUA 4YDLC 3SDXE 3B2VL 1TJHL 1WAAA 3M07A 1P9MA 3SQBA 4J4PC 2VLRE 3HMXA 1KEML 1MRCL 2OTWB 1EEYA 3TO4A 1BEYH 4OD1L 2XOTA 3CDGB 4XPFL 2FX9H 3S88L 3OGOE 1JI1A 2VLKB 2V7HA 3B83A 4NC0B 1J5OL 2DL2A 1EHNA 5D6CB 5EU6B 5I30H 4JFDB 3QI9B 4EN3B 3W0WE 3C60A 4P2RA 1UJ3A 4JY6A 3SQOL 2IALB 4HEME 2CMRH 1T7ZA 2AKRA 2E8YA 5DC9B 5JW4N 4AL8H 4L5FL 4Z0XA 3DUUB 4JFYB 4JR9H 5HI5C 3DX8A 3TYGL 5ECJE 1E4XH 1YNKL 2D7QA 3AGVA 1MCBA 3QUXA 1CFVH 5KG9A 2V7HB 5D2NC 3FQNA 4LDLB 4ODXB 3EOYG 3EFDH 3G6AB 1RULH 4B7IA 4R90L 4EN3A 5B3JF 2NY6D 1MHEA 1Q9WA 3DMMB 4PPTA 3DYMA 4JRXB 1EVTC 4UQ2B 2DQEL 1S3KL 1A9BA 3OX8A 1F45A 2GK2A 4M3JA 4HFWA 4LARL 3QUXC 1CICC 3BESR 3O4LB 2AEQH 3DNKA 2L4OA 4Z7VB 3FO1B 1MREL 5CD3B 3S37H 3EYQD 5B3NA 2X4NA 5ICXB 5IROA 5DVLA 4WW2A 4CBPA 5EA0H 5IFHH 1CLZH 3ZDYE 4JANA 4F7EA 4RIRB 3BGMB 5D7LD 3QIBB 4XC1L 3KDMB 3LKNB 1SY6L 4L5FH 3QCVH 2D31A 4MVBC 2CSPA 3QPQC 4X5XA 2BNUB 3K2MC 1MCIA 5IMMB 1GGTA 2GTWB 5M95B 1EHLL 1UWGH 4RMQA 1NFKA 1G7MB 3V52L 1BFSA 2F8VA 4HUNB 1QACA 5HI4C 4LCIL 4U1GB 2C7UA 4MNGE 1XGUA 3P4OA 2GJJA 4TPRL 4KUZL 1U3HD 1H15B 1IM9D 1LNUA 2VDOL 1HOCA 1Q94B 3RUGF 2D4DA 2V2XA 4NFBA 4DVRH 3QIBD 1UACH 2JCCB 2NW2B 3MA9L 5ID1B 1W0WA 2BVQB 5E8EA 3DSNA 5IVOA 5EO9A 2A6DA 3X12A 3V95A 5C2BL 2DL9A 3I2CH 2P24B 2VLMD 5IEHA 1FFOA 3P77A 3RIFF 5L2JB 3U0WH 2YMXH 3WJJC 3MA7A 2C4XA 1ORSA 4JR9L 2VDKL 4S1SL 1A1NB 4M00A 4XVSH 3HRPA 4Z7OF 3HE7C 4ZFZA 3VG0H 3GMMA 3TPUA 4KK6C 2CIIA 4HH9B 4I13B 5DJ8A 5F7DA 4Y2OA 3BO8A 5F88A 5DUBB 3B9KD 1F6AA 3DUSB 2W07A 3C87A 4GXUM 1K2DA 3SE4C 2YPKB 1MWAL 4I77H 2VDQL 4A2LA 2ADIB 3VGBA 3IFPA 4OUOA 2BOCA 3C5SB 1MHCA 1YPZE 1JHTA 5CJ5A 4I2XB 3MZGB 4P2RE 1DCLA 1H3TA 4UV4H 1J8HD 4Y2DA 4PRPB 5HDQH 3RVVC 4YR6A 1I8KB 1RIUL 3T77A 2WWMC 3JWDH 4GAFB 3UTPE 3C6SB 3OAYK 2NY7L 3UYRH 2C9AA 3EDDA 4M6NH 2RR3A 2RCSH 5A40E 1WC7B 5A16A 4XMKL 3RZCB 5IIEB 4LFHG 1KCKA 3KYNA 3SHSA 1D5ZB 5F9DC 4MZ3A 5I1IH 4HD9A 1I7ZA 4LSDA 3EYQC 1J0YA 1NFDE 2ORBL 1C7SA 1N59A 3ZDXE 2BXYA 1ORQB 5I1JL 1CICD 5DHXB 4PRAA 2HT2C 3ARED 2VDQH 4R4BA 1MAML 5IW6A 4YEEA 3TN0A 4XP5H 2X70B 1CLZL 2JB5L 2E6PA 4LKXB 2XN9B 4Z5RA 4YC2B 4HWEL 4ZO7A 4KKAC 4WO4A 3L9RB 1X7QA 4V1DA 5DHVH 3SE9H 3K3QA 2AI0L 1I7UA 4DKEL 4UINH 2DQIL 2AXFA 4XVSL 4H5SA 4M7LT 5DJAA 2IPKB 4C54A 1TETH 3ULSB 1PQZA 4PUBH 2I5YL 1UADC 5CBAA 3BPOB 1DLHA 5MEQB 4NZUH 1AO7B 1ZT1B 2C3VB 3HCVA 1BVKB 4QHNB 2F9BT 4LNVA 1FPTH 5AYUH 3HI6H 5E8NB 1UACL 4XNMA 3I50L 2PCPA 5EUOA 3GI9L 5KVEL 5E94A 1QRNA 4K3EL 1RU9H 3NABH 4O4YH 2GAZA 5D72H 2R23A 1BF2A 2FBOJ 3HN3A 1I1YA 4JQIH 1IKNA 4M7KH 1ZGLM 5GISH 3QDJB 3JWDL 2Z93B 2XZQL 4HWEH 2FR4A 2IGFH 5EBLA 3MJ9A 1QP1A 4OGXL 3DIFA 4CGTA 5MENE 2GT9A 2J4WL 4HZAA 1J8HB 4CW1A 3PP4L 3R06B 5IK3B 1NDMB 1XGQA 1MIML 1NCBH 5D70L 4DUXA 3NIDF 3MJ7B 3TJHD 1ADQH 1CFNA 5ETUA 3GSQA 1JNLH 1REIA 1EJOH 1S7QA 3SDCC 1PX4A 3UAJD 2P7TA 3O6MH 4UV7H 3OKMB 3PHSA 4LVOB 3UYPA 1RJYB 3AFLA 3EOBA 2FO1A 1XGRA 2FDBP 2DQCL 1QR4A 5CSBA 4ZOCA 3PWJA 1XEDA 4N8CH 1JE6A 4KZDL 3OPZH 4KKLD 5ICZB 1G7MA 1OHQA 4GOSA 1RMFH 2IFFL 4LLDB 3WIHL 2R0ZL 3MACL 2NY4D 3MRPA 4OZFG 5C0FB 4HX1A 1RK1A 3HI1A 5IROC 2VKWA 4B41A 4IM8A 4OM0L 1EXUA 3KYOA 5SWQB 4YHPA 2HFFB 2BVQA 1NFDA 5I17A 1TPXC 1IGYA 4HGWA 5DLMH 5HGAB 2YC1A 2BRQA 1MIEH 4G6KL 1QA9A 4X8JA 1BZ7B 4H1LA 4WUKL 4P2RD 4G6JL 3DV6B 4JPIB 4WI4A 4R8WL 2DQFA 4XZUA 3CK0H 1G7IB 3UPAA 5T3XD 4JZOA 3U83A 4K3DL 1DLFH 2HFEB 4GW1A 1RUAH 5J1SC 3A6OA 3G5YB 2J8UB 4LHJB 3LV3B 5DRZA 4K94H 4KPHL 3B2UC 2XACC 4POYA 4HWZA 1NMAH 1LMKA 3OG4B 4MHHI 3BUYB 3WYRA 1EEYB 4J6RL 3MV8D 4PB0L 5MP6H 4Q9RH 3MGTA 4H1LB 1JCKA 5IW1B 2SEBA 4ONHB 3P9MB 2R23B 4DQOL 1Y6NR 3IU3B 2YPVH 5DRNA 2OLDA 4G9FE 5T1KB 3NACL 4TSAH 5C0BA 2PTTB 3VXSB 1BIIB 1INEL 1NSNL 2Z8RA 3C09B 1YUHB 2GKIA 3CMOL 4KI1A 3LN9A 5IHBA 1TCMA 2AV1B 1MQKH 3DMMD 3BYTA 1LILA 2PTVA 4M62L 3ALPA 3CMGA 1YEKL 4NFDA 5H2BB 1E4XL 2IADA 4OCMC 1CR9H 4URTB 3REVB 3RVXC 4NJ9H 2WLYA 4RGND 3QDME 4U0QB 5TQ0H 4EUPB 4W6YB 2CKBL 4JQXA 1YMHB 1BFVL 2JCCF 5DMGD 3FQNB 2R69L 1MRCH 2BY2A 1N6UA 4YAQB 1FH5L 4QRRE 3MODH 3RWHB 1BIIA 4LSUH 2R0ZH 4NQDA 4HPYH 4U6XB 3JVGA 3WFHA 3BI9X 2VZVA 5IB3B 4D3CH 4UDTA 4XNUL 4D8PB 2AV1A 3L3GA 2BZDA 5ABDE 4U7SA 3TFKD 4PJCB 2NXZB 3E6FA 3OXSB 1ZWIB 4HZLB 2C26A 4OM0H 3TVMD 5D1QB 1CWVA 4NBXB 3ZYZA 4GG8B 2CUIA 1U8IA 4OJFL 1X6NA 3U4EA 3VXOB 5IP4A 5DUPL 1JP5A 1V3MA 1MHPL 3H6JA 1P4IH 5E24E 4G6KH 1WT5A 2ZOKB 1KCUH 3ARBD 2MSPA 4PY8J 5TGBA 2F8XC 1YEFL 5BW7A 1YMMD 2R29H 2IH1B 3LQZB 2D31B 1BOYA 4TTDC 1TMCB 3A0OA 2P8MA 5F93C 3ZSTA 1RIHL 3QQ4B 1UKQA 5F72S 5FGBA 4JFYA 3HPJA 2R0LH 4MCZA 4D9QE 4WENB 5FF6B 1T7YA 5DRWA 1JI2A 4NN5B 1WBZA 1A6VH 4PRHE 5HYJA 1H5BA 1RZIA 5LCVH 3T2OA 3GHEL 1G9EA 1IAII 3D6GA 1OQXA 3BAEH 5D7SL 5ID1A 1ACYH 4ONFH 3RX7A 2AABH 4WGWB 3SJVE 1AHWB 4IBLT 4WUKH 2P48B 4Q74A 3P77B 3HPLA 2EH8H 1R3HA 3UPRA 4JRWA 2EDOA 4L8SA 3KPQB 2F5BH 5DRWB 1HEZA 1NEZA 4YE4H 1AKJB 1S9WB 1TTFA 4H0GA 1TZHB 2R0WL 1JGLH 5I1EH 5DF0A 1SJXA 1F11B 3CSYA 4HKZB 1JNNH 1TVBB 4PB0H 1MELA 1CIDA 5HDBF 1DQTA 3EJZD 4X80H 1FL5A 1HQRB 3P9LB 2YK1H 4PLJC 2X9WA 4F9PA 1D3CA 3QHFH 3RJQB 3K0WA 1RK0A 4PJAE 5I1HL 4PJAF 4WI2A 4HC1L 1GCFA 5C0BE 1OAYH 1SYSA 5GRXG 1PKQA 1ZLSL 1A3LL 2P5WE 2V2WB 5SX5H 1DL7L 2YPLA 1FBIH 4NT6B 4GLRH 4XVTH 4NC1C 3U36B 5IF0B 3K81A 4I77L 1YEKH 1A7RL 4PJAB 3DGCR 3BSZH 2F54E 3KJ6L 3I85A 3GO1H 3KLAB 3GJFB 1GGCL 4UDTB 1U95B 1VFOA 2VDMH 1UH3A 4DKAA 3QULB 2XRAL 2XTJB 4QCIA 2VISB 3KPTA 4F33A 3C8HA 4D2NA 4X7EC 3X12B 1LO0H 2VTFA 2OMBA 5JW3H 5EPMA 3IJYB 4FABL 1U8LA 4HUWB 3WJLA 3MUY1 4LLWA 4NQEA 1B6UA 1YYLL 1A0QL 2B7DT 3DTXB 1DVFD 4UV4L 2VUYA 1P7KA 2DWEA 2GJ6A 3L5WA 2BNRE 3H0TB 2NX5B 2DJUA 4JPKH 2D4FA 2XYCA 4JO1L 4Y19D 3VW3H 5E99H 5EPMB 1BECA 5FDYA 1MSPA 2R29L 2V5SA 5TE7H 4FOMA 1P9MC 5BVJA 2EE6A 4BK4A 5MEPB 5KSUB 4HHAB 4IRJA 3TNNA 3V0VB 1TJHH 3MV11 4I2XA 5ACLA 3RUGE 1R5VA 5I1IL 4LVNB 1UVQB 2R8SL 3KAAA 3BKJH 3TO2B 4QHUA 1AI1H 2B4CL 7CGTA 1Q0YL 1W72H 3K4ZA 3RWGB 1EGJH 3E6HA 1QSEA 3IAGC 4Y4KA 1KEGH 4GKNB 4DKFL 2VXSH 3MCG1 5DD6B 4KROC 2ADFL 2FIKA 5C0JA 4ODSH 1UYWL 3GIZL 4GO6B 1MRDL 1RUPH 3D39D 3X11A 3S3JA 5GJTH 5JR1L 4YFLI 4OCRL 5ESVB 2AK4A 5I18L 4OF0A 2OQJB 1CVSC 4WEMB 2FECL 4ODWA 2ESVB 3VCLB 2BRRH 5D7IE 4OBRA 4XP1H 4JDZA 4NC1E 2ZPKH 4G7YH 5FUOL 1SJVA 4KI5F 1W0YT 1AD9B 3GJEA 4PJBB 4YNYB 3EFDL 4C83B 3HUJA 3FZUC 3DVFA 2X4RA 3KLSA 5DA0B 4ZFOA 4GLRI 4K9EH 3ARFC 2YK1L 2HJKB 3MBEC 4XRCA 2E7HA 4YHZL 5DJZB 4QXUH 2OQJA 2QR0B 4U6VH 3LKRB 1WAAF 2DS4A 4PJAA 3RA7L 3U4BH 4XH2A 1S8DA 4PJ5D 3I6KA 3C5JB 3K2UH 4WDIB 1A3LH 2XKUA 5J1TC 1PLGL 2PYFA 4XWOD 4PJ8D 4JHZA 1NGQH 2HMID 1FNAA 3LEXB 2C1OA 1T5XA 1MJ7L 1G9ML 2W65B 1UCBH 4G8IA 4Z18A 1YQVL 3INUL 4ELME 3IDUA 5CGTA 4XCCL 2DBLH 5E95B 3OKOB 1XCQB 1DQJA 4J8RB 4TVSa 1ZLVK 3MRFB 1ZVSB 1DQQA 4WI5A 5EC2B 5GJSL 1V3LA 3EYSH 4GXVH 1NKOA 4Y7MA 1FORH 5FHAH 5HI5D 1F4WH 4D94A 1C16A 2GSGA 4OD3L 4IHOA 1OOAA 3BEVB 1LEGB 1WBXA 3VFMA 5C2UB 4JREC 1UJ3B 5TDNA 3MRHA 4A6YB 4HQQL 4KK5D 3L3JB 4GKSA 1FL3A 2R1YA 1D5XA 3TBTB 4HCRH 4PS4L 3HFMH 1A02N 5KSAC 4FG6D 3TT3L 4YXKH 1IL1B 4JQVA 5AAMA 3HG1E 1MF2H 3O6FC 5HHNB 5CIPB 5AZ2H 5CEZE 2XV6B 4FZEL 1FAIH 1HYRC 2W91A 3KPRB 3GMQA 3F6IA 1VFAB 4I9WE 2EDJA 4NO3B 2APBA 4WNQA 1J05B 2ZPKL 4BQCA 3PIQB 4D0DA 4H26B 3BH8A 1DEEB 2PXYB 2WINB 3PABA 1INQB 1JUFA 5DVKA 4NHCH 3G5XA 4HFUH 5T1LA 2AK4B 3KPSD 4OCXH 5EFIB 1R24A 3CU1A 3HZKB 3Q2CA 5IF0A 4ZPVB 1QR1B 2VR5A 2PTTA 4UI2A 4QRUB 3FQRB 3RZCD 3B6SB 1HHKA 4O51A 3UTTE 3CK0L 3GRWL 1EH9A 2F53B 2VNCA 1WIUA 1S7RA 5DJ0A 4D0CB 4MS8D 5E8PB 1FVEA 5D2LF 1U8JA 4HK3N 4XX1E 1RFDH 4HGKC 3IJYA 4YDIL 1LO3H 1MJUL 1OGTA 1WK0A 3HB3D 3S9DB 2WANA 3TH2T 4YGAB 5KVFH 4XZUB 4DZ8B 4Q2ZA 3QNYB 1NGXA 5TQ0L 5FAAA 4ORGA 3LQAL 4OGAD 5DJXB 1KCLA 4HS8H 5E9DE 3C60B 2RJMA 2DD8L 1JZ6A 4LCWD 4JRYE 3EFFA 3MNVB 1FRGL 3QIWC 3E2HC 4LCUA 2C4FT 1A6TB 2CDFA 5HHOD 2CJUL 1ROWA 2V9RA 3VI3E 4S2SB 1F42A 2X4SB 3Q5OA 5D71L 1A6AB 4JFEE 1MCDA 4PGDA 3W9DB 2GFBA 2X05A 4UT7L 1Q9OB 1EZVX 1PZ5A 5CWSB 1YEHL 4QF1B 3FT3A 1FDLL 3QDMD 4U7MA 1F8TL 4ELMA 4EUPG 2IPTL 3V8CA 1JFQH 4O2CA 3AXLB 2PKDA 4XP4H 1F6AB 4NO0B 4JFED 25C8L 5JPNB 3GGWA 2B20A 4I48A 3B9EA 4XAKD 1YN7A 4D0BB 1RU9L 3NABL 4GT7A 1P69B 4QXGH 3TC9A 1W0VA 2R1YB 4OF8A 2Z31D 4GAYA 1MCKA 2AQ1A 1X9QA 3B2VH 5LAXB 3L6FA 4U1JA 3GUTB 3Q3GB 4OGYL 2XN9E 5IMLA 3O9WB 1RZJL 4OFVA 3RWDA 4ODWB 2X1WL 4J3XA 5DUPH 1WCBB 4HIJA 4U1LA 5E00B 5F89B 2PN5A 1HXMB 2BJMH 5ACZA 1FNLA 2DBJA 4ZUSB 2FX8H 4OCWH 3K8MA 2VJXA 3F7PC 4MXWH 1IM3A 3W81A 4OLYL 3M17A 2APFA 4X5LA 5DEZA 1V3JA 3WKMH 4PJGF 3UCRA 4JCMA 3CX5J 1EFXA 2H32H 3O6ML 4Z7NF 3DUHA 4EQ2A 5FA3A 3HE7B 5HHQB 1TVBA 4L3EA 1CDJA 2WQRA 4W81A 1IEBA 4OLVH 4NOBA 5D7KE 2EYRA 4H25A 4PJGB 2ZCHH 3DYPA 4RMRA 1OGAD 1M7DB 4L9LA 4RZCB 3TN0B 2DRUA 2FATL 2ZCKL 2YZ1A 4LCCB 2IFFH 1R3JB 3BMVA 3WLBA 1N3NA 4RAUB 3J8F7 1P4LA 5AUMA 2V5RA 5CCKH 1MH5B 5T3XH 1C08A 5CGYC 2IMNA 5KSAB 1A7RH 4UB0H 4PJ9D 4Z95L 3RY6A 4Z7WB 1JIBA 4Q2ZB 1U8QA 4EI5D 4OIIH 5EIVA 3UDWA 3S4SG 1DFBH 4ZTOL 1F58H 4C55A 3NGBC 3PL6C 4YXLH 3PV6B 1X5AA 2HH0L 4F2MB 2ERJC 5D2LE 4I18C 2FB4L 3MBXH 3CZFB 3MO1A 1ZHBA 4PTTB 2C4FU 4JJ5A 1IT9H 1KACB 3UTTB 1KCSH 3ILPB 3KLDA 3QUKA 4RISH 4D9RD 1OT2A 4QOKA 4PY7A 4IRSA 3C09C 1C5BH 2CO6B 1FIGL 5DK2A 4O02H 4PJBF 1E27B 4Z7WA 2BHYA 2R2EB 2R4SL 4M93C 5D1XC 2N7BA 2RIKA 1MCHA 1OWWA 1PG7H 1ZHKB 1A7QL 3QDJD 3CVIH 3LKQA 4ZAKD 2JB6A 1A4KB 5JHLH 5MEOB 3C2AH 1ZXQA 4KXZI 2VABB 4HF5H 4ZS6D 3WDIA 5JXEA 4TQEL 1H9VA 5ESQB 2X09A 4AK1A 1N6QH 2V2TB 3Q6GL 2AVGA 5LGHL 4PP2B 5JW3L 4JRXE 2SEBB 1RZKH 4ONHA 4UIKL 2R8SH 4XNZB 1R5VB 5C8JB 2EIBA 1IAKA 1T20B 4XXDB 1KXTB 4UMGA 4LSSH 3SCMB 1BQHG 4NC2B 2DM7A 2DKSA 2YBRB 5D1ZC 1KIPB 1BJ1J 5K59E 4HDIA 1U42A 2G5BA 4WHDA 5HHMD 3EJYC 4ENEC 4Y1AB 5CEYB 2HT2D 4GUPA 5ITBL 2XZCL 2YPVL 1XGTA 3AB0C 1W72B 5GSVB 3HZMB 4JRYD 5FOJA 5DA4A 5GRVL 1Z9OA 4W4NA 5FUZL 4ZS6C 4OFKA 3FB6A 4OLUH 1MFBL 4NKDA 1MCCA 3VD7A 1ZGLA 4YX2H 1KJMA 3ARDD 4U1NA 1WV7T 2R9HC 4JVPA 1AGBA 4AH2B 4N0FB 2EYRB 4H25B 3WFCH 1H3GA 3OZ9H 1NAMH 1B4JH 4Y1AA 3NMEA 5CEYA 5INDB 3DRTA 4LLVB 1CDCA 1L7TH 4YHPB 2P49B 3CFEA 2E7LA 3EIFA 2WWMD 4Y4FA 4LQFL 4AEHH 1JRHL 5C07A 1F4XL 4L3EE 1B0RB 1GAFH 3E8UH 2CKNA 3DX7B 3NIGF 3QIWB 5HD8C 3ZKQD 5KJRH 1BQUA 2JKXA 3D0LA 3LHPH 4MQXC 1QA9B 2EKSA 2L7JA 3QG6B 1P84K 4AM0B 5A1AA 2X7LA 3MUZ1 2QQNH 3LEXA 5DQDH 4K3JH 4JM2D 1ZVHA 1QSEB 5IB2A 1RJZB 3V6ZA 1IC7L 3O11B 3LEYL 3T0AA 2G2RA 4UTBL 3DIFB 1NC4A 1FG9C 1OSZA 2EO9A 2IANA 4NKOA 5FV1L 2HA1A 3G04A 3MGTB 3U7WL 4XNYH 3QUXB 3SDXA 1RIHH 2A73B 2VUOA 1A1OA 3CFDA 4R3SB 4YHZH 4WHTA 5E4EC 1A7NL 5JLZB 3BKCL 4HUVB 3VCLA 4J6RH 1KG0B 5H8DA 5EZLB 2F5BL 3IS0X 1GAFL 5HI3D 4PG2C 3VFWB 1F4WL 1LDPH 3SE8L 4AEFA 3NPSC 4HCRL 2AXHA 5T5FL 2V17H 4XNXL 4TOYL 1QFUH 1VENA 2M8XA 2JJWA 1ED3A 1UCBL 1IEAA 4PY8I 1ACZA 4YWGL 3DJ9A 4GQ9L 4P5MA 1PEWA 3BKYH 3UTQB 2YA2A 3IDYB 4K7FB 2XY2A 4XH2B 4YX2L 4OZHE 1SM3L 3V4UH 4L3EB 4OFDA 1GOFA 1A22B 4HV8A 4GAJH 1AIFA 3FB5B 2G5BB 3QPQD 4QHKJ 2BHZA 5KS9B 1KPRB 5C09D 5IIEA 1DEEA 2X5PA 3GMPA 5CJXC 3SDXF 1LK2B 3V5HB 1NANI 3U7WH 1N8ZA 4LCWE 1T2QL 1QBML 5FK9B 3KR3L 1DQJB 4HWBH 1ZHNB 1D6VL 3JSSA 5F9OL 5DD3H 1PYWA 3E0GA 3CXHK 4IOFD 1YNLL 1Q38A 4GS7B 2DQFB 4R0LC 1FYTA 4XI5D 2BVOA 1NCBL 5D70H 1DVFB 5MHSD 1RJYA 4KC3B 1G6RA 2QADB 1AR2A 2X89D 3KWWA 3QA3B 2QL1A 5TE6H 2EDKA 2RFXA 3LIZL 2UWEB 5EUKB 4OV5B 4NUGH 1HNFA 2E27H 3OBAA 3NZHL 4LAQH 3QEUA 4JFFD 3RDTA 3SJVB 4WO4D 3PNWA 1GL4B 3T4AB 3V4UL 1KB5A 4MD0B 4W68A 4ZS7H 1ZA3A 5SWSA 1OVZA 3BPNC 5DFTA 1VB9A 1HQ4A 1KTRL 5B4MD 3UTSB 3U9UA 1EV2E 2GIYA 4NRXA 1ZK9A 3WHE0 3HB3C 4MNGA 4NKMB 4XTRC 1OP3K 2ADGA 4JFOB 4Z9KB 3PWUB 3WHXB 4XP6L 5GGRA 4OV5A 6FABL 4P46D 2CDFB 4YBQD 1CDIA 2H32B 3QIUB 5C0DB 2X6MA 2X41A 1T1XB 2VXTH 1KB5B 2A77L 4MD0A 3S3SA 1IBGH 3DWTA 1SBBA 1J0ZA 2CQVA 2AJ3B 1BP3B 1O7SA 3UAJC 2EXYD 1P2CA 2XWJB 5E6YA 3C9NA 2KDGA 3CAFA 4GSDH 4BUHA 3KHOA 2LVCA 4LBEA 5EUOF 5DQJB 2BP3A 3SN6N 5GZOC 1U36A 1CK0H 3T2NH 3TEUA 2D3VA 4GS7C 4M5YL 4KKBD 1JPFA 5J6GA 4F15C 2OL3A 4YH6A 1QLFB 1Q0YH 1W72L 3AAZB 4ZUWB 3EO1A 5INCA 3BIAX 4NT6A 4LSRL 4RAHA 1IAOA 4GW4A 5KSBF 1EAPA 2HTLD 2DI8A 3D9AL 5CHNA 1YUHA 3OG6B 5IBLD 4NGHL 1YC7A 2YWYA 4ZO6A 1YPZA 3TV3H 1VACB 4LLUB 3VMNA 1WWAX 4DAGH 4Q0XH 3N9GH 4R96A 5DEGA 4HSQA 1LK3L 3BZFB 1PW3A 1FZOB 5DMGC 5K9JH 4APQB 3OKKB 3UBXG 3P73B 1CVRA 2VWEC 4HX1B 1RK1B 4NQCB 2NZ9C 3BXNB 3KPMB 3IJHA 3F7YB 4TUKL 2YD3A 4NO0A 3T0WA 2CLZA 2AJVL 5I71B 3C6LC 1CD1A 2PR4H 2VDOH 4KWUA 3SE9L 5JW4M 1R3HB 1ZOXA 3UPRB 5J1AB 3AMLA 2BDNL 3FMGL 4ZG1A 3VWKC 4QHLB 1KT2B 6FABH 1WFOA 4Z7UF 1H0DA 3A6BL 3VWKA 4KTDL 4BKLB 3QQ3A 5IMLB 4CJ0A 3IXAB 5T1DH 2FH6A 4MNQE 4RDQG 1FO0H 4YFDB 3K74B 3L3IB 3S35X 1PG7X 1T1ZA 5EZLA 3QP3A 3QFJD 3WHXA 4WEBL 1DJSA 4P57A 3RGHA 2JLLA 4YXKL 1E4WL 5F1IA 4JFZH 1F58L 3F5WA 3MCKB 1NCCL 2WUBL 4DZBA 2YS4A 3PDOA 2WAHA 3BZDA 2UYLA 4OZ4B 1A7QH 5EBWB 1H5BB 2PO6B 4Q6IC 5I8CB 2ZG2A 4JY5L 4RIRA 5FGCB 2O5XH 5I1AA 2A1WL 4LKCB 5T1KD 3CGTA 5C0GB 3ES6A 1DQMH 2VC2H 4Z7UA 5DMKB 3QG7L 3EO0B 3WDHA 3H7LA 1T0PB 3WXWH 4YXLL 4Y4HA 3O45B 1SMAA 4RRPA 3VDCA 1MHPH 1CCZA 3MV8B 4MA3B 4OZHB 5EH1A 2A0LD 5T1LB 2PYEB 3G08B 4MMXC 5J56B 1CQYA 3GDBA 1F97A 3FQTA 5DJZA 5EO1A 3BKMH 1SY6A 2H26B 3WXVH 3ULVC 3A6CH 4NQDB 5H35B 2FRGP 1KELL 4D9RE 4X4XB 4KMQA 4I0PB 2NY2B 1S7UA 1NAKL 4NQDD 3BRGC 1MCPH 1JTPA 2G60H 1E4WH 3CVIL 4E5XB 2H2PD 1QFHA 3PV6A 5DUMH 2IAMC 2NX5A 2LVEA 2F5AL 4XPAL 5GS1B 5IB4B 2FX9L 1VA9A 4R96B 1XGPA 5DEGB 3S88H 3SDAD 4UAOB 3FO2A 4KMLB 4S1RH 3RBSA 3O6LH 5LCVL 5E6ZA 4YHYC 4WFEE 3GSRB 5EU3B 4N0FA 4KTDH 5HYEA 3V0AC 1RZKL 2AJZB 4UIKH 1K5NB 3MRIA 4UQ3A 3UBXA 4PRAB 3ARBA 4X6EA 3STZA 3QEQB 4H8WH 3DUSA 2HRPL 4IDJL 5D7JC 4PBXA 1NBVH 4BZ1H 2XTLA 4LF3B 3BIBX 1FG2A 3W2DL 1JPSH 4F9LA 3L9RA 3R4DA 1FNHA 3CFIC 3ARGC 2XRAH 2Q20A 1MHCB 2XICA 4F7PB 2IPTH 1T04B 4PP2A 3EUUA 1QG3A 4PJFF 2A83B 3P30H 3TT1L 5I8KH 4BFIA 3SGEI 4DGYH 4Q9QH 1QSFB 5HTSA 1BF8A 3G6JF 4KPHH 2A6JA 3IU3A 1RUKL 1J0IA 1UB5B 4MB4A 2QQNL 2ESVA 2W0FA 3QFDA 3OMZA 4FABH 3QEQA 3EYFA 4QXGL 3FQUB 4RFNB 5H37H 1PSKH 4K7PH 4AIZB 5E8OB 5MERA 1W72A 2Z9TA 5EWIL 1S9YA 1MWAA 4MNQA 4JFQB 1KGCE 5E2JA 5J9PB 4LQFH 2XA3A 3VFRB 1JRHH 3WEXB 3GUTA 2VL5B 1A1OB 3CFDB 3NTCH 5I8CA 5ID0B 2F58H 4KFZC 1QUNA 2WV3A 3L7EB 3CFJB 4MXWL 3BKML 2J4WH 2GYSA 5K9QI 3UZVB 2AAVA 1U3YA 1XR9B 4GMSL 3MRBA 4NSKB 1BQSA 1RUML 4XAKE 5B39B 4HKJA 4NDMB 5L7XL 2ZSWA 4C57C 1RJLA 2G60L 2HWZL 4WW2F 4ONOA 4JFQA 3SKMB 3FQXB 5IHZB 3MRNB 1NLDL 3MJ7A 1D9KB 1FZOA 3G5VB 4NPYB 4OZGF 3O2DA 1FP5A 3S97C 4GRLA 1J12A 4WTZA 1MRDH 1RUPL 3MTRA 4YDIH 4AZ8A 4L9LB 4RZCA 5GSRB 5JO5B 1BFOA 3S98A 3WXVL 4H20H 1J1PH 4QHKI 4BSVB 3FQXA 4X7CC 1P6AB 2RGSA 1HZHL 3AB0B 5HDLA 3O11A 1NMBH 3D85B 2VIRB 3STBA 3TA3C 4XBPA 3HA0A 4NRZB 4XNXH 5EUOB 3BZEB 2YMXL 1H15A 5D1QD 3VFSA 1I9RH 2NX5E 2VZUA 4JZJB 2JJSA 2P45B 4H88L 4K8RL 1UXWA 2VXVL 3TIDA 5HJ3B 2V5TA 4LASH 5DHYA 5DD1H 2B1AH 5DMIL 3OR7A 4RMSA 1A2YA 1D5BA 1C5BL 4KGLA 2AKRB 4O02L 1CTOA 3CLEH 1KC5L 4EVNB 4OF7A 4BK5A 3EYVA 4H8WL 4PJ7B 5FYKE 3T04D 3QUYA 4EJ1C 4X9HA 1Q9LB 4BJLA 3VWJC 1JWUA 4PBVC 1SMOA 2HLFD 4FQ1L 5CFHA 2ADJB 1U58A 2XKNB 5JA8B 4WHYG 4G42A 3C8DA 2AXGA 1NMAL 4MLSA 4ODXA 1ZLWH 1G84A 2NY0C 4RFEB 3REWA 2B0SH 3QFDB 1A14L 1FZJB 3G5YA 4WCYH 3WNLA 1KLUB 3PGFH 4M03A 3P40A 1AGDB 4JO3L 1HZHH 3H3PL 3QIBC 1KJVA 3QUML 2R0WH 5FM5M 3C5SA 4I4WB 1RZFH 5DK0A 5FYLE 2BJML 3ROOB 5CSZB 4XBEL 1YYMH 3UTZA 1M6OA 1FE8L 3MV7A 1EBPA 1IAKB 1T20A 1OWRM 2OL3H 4EBQL 3VFPA 1K8DA 3RX5A 4PGCB 1L9MA 1OTSD 3ETBF 1JHKH 3Q6GH 4IRZL 5BQ7B 3TN0D 1OAYL 1P4BH 4MVBD 3T08A 1YQVH 3INUH 3MLZH 2P8PA 1XFPA 3GZKA 2F19L 4RX4D 4ZFGH 5IHUL 1NMCC 2Z31C 2H3NB 4LSSL 5F96H 4Y16C 1WIOA 2J8HA 5DSCA 2AJXL 2HKFL 3ARGB 4ZUWA 3PP3K 4OI8A 1U8LB 3QEUB 1G6RL 3OKNB 2AV7A 4KRLB 2PW2A 3O0RH 5DDHB 3WDJA 1AE6L 2CMRL 4J23A 4QRUA 1ZT7A 3PGFL 1Q9OA 3TV3L 1QFPA 1PKQE 1XIWB 3GMRB 2OJEB 4J7RA 3IDXL 4RAVB 1V7MH 5F8QC 1W0WB 4PJ8A 5FOBA 1FGVH 3OKLB 1IAIL 4F2MA 3MLPA 1TQCB 2YD5A 5DHVB 5EIIA 2FYYB 3S6CA 3VXPA 5JOEA 4JJ5B 1NL0H 3J7HA 4FP8L 1KC5H 2Q76B 3N0PB 4NCC2 5E0QA 4RWYH 4JZJA 4FTVE 1F3JA 3Q3GA 1HIML 2BY3A 4EZMA 1UZ6F 4TRPL 4MA1B 1T4KB 4DN3L 1NC2B 1FLRL 2R0LL 3W39A 4I0PC 3D9AH 3RNKB 1CGSL 5IB1A 3RY4A 2BSSB 2R4SH 3VRJA 4GG6E 4A6YA 4JKKA 1P1ZB 3UTSE 1UKSA 3KYMA 3ZYJA 2IANB 3PXHA 5KZCB 4MAYD 3PWNB 4JM2B 1S7VB 5IKCB 2ITCB 2ED9A 4PRNB 2IAMA 2YD7A 3WSQL 1YEEL 1BD2B 3N1QC 3TNMA 1WCQA 2Y9RT 1HH6B 1QO3A 4L4VE 1JHKL 3KDMA 3LKNA 4HDIB 3V0WL 3C2SA 3IJSB 1MJUH 4MQSB 1XF5B 5I18H 2EO1A 5IMMA 1XMWA 4ZQKB 1AKJA 2CK0H 4Z77B 5IBUB 3JTTB 1TIUA 2MQ0A 4JKPL 4JM2A 4PRIB 5EU5B 3U0TB 3ARFB 3MBEB 3QJHB 2HKFH 1QSEE 4H0IA 4FMFA 3MRCA 2BMKA 3QUMH 5JHDB 3SO3B 4LPUA 1E4XI 1LGVA 3D5OF 3QI9D 2MCPH 4OD2A 3BDBA 2IH1A 4PJHF 1IM3B 2HP4A 2QHRL 4WFGD 5FYLL 1BFOB 3U0PB 1RZJH 2IBZX 4UT6H 3MUGA 1D6EB 2X4NB 3CXHJ 4DUWA 3VE0B 4QOKB 4O00A 1QLEH 1K9TA 1I7UB 5HHXL 5A2IH 4Z78A 3FAXA 3WFEL 1PX3A 2BSED 4JCLA 4RAVA 5GGRY 3RGVA 2HYMA 1CE1L 3QUZC 4ZMAT 3MJGX 1M05B 3KPRD 1R5WA 1J1OL 4F9PC 4G8GE 2FJFA 2XPGA 4ZD3L 3D2UD 5AZEH 3T0BA 3GEWB 5JOPD 3SDDA 1JVKA 3HMXH 4LARH 5H94A 2NYYC 2A9NH 2ZUSA 1F3JB 2VQTA 4RFOH 1QNZL 2HRPH 2P5WD 3REWB 1MJJB 2XZAL 5DMYA 3S37L 4MHHG 3HR5A 9CGTA 4L8CA 4O5LH 1KLUA 1PVHA 4LPYA 5IMKB 3C5ZD 2GTZA 2HVKA 2BSSA 5GRWA 4FTVA 1NCNA 4X6DF 1K6QL 1R5IA 1ZHBB 3TIEB 1XGTB 3VFGL 2BVEA 3WNPA 3AM8C 1IM9A 3VWJB 1RY7B 3HZVA 5HGHA 1IC5H 2Z0BA 5C3TA 2B39A 4N68A 1FAIL 3T0DA 3P0YL 5E5RB 5I8EB 2DQDL 3DETC 4KJYB 4PV8B 3W11D 5GS0C 5C70A 2NXZD 3RX8A 3B9AA 2P8LB 1C8PA 3VFPB 3ZSSA 2Y25A 1SEQL 3HRZA 4J2XA 5IVXE 1N59B 2VXQH 1OP5H 1R3LB 1EUTA 5DQJA 4ONGH 5D96B 4JM4H 4OKDA 2IC2A 1MFAL 3U79A 3LKPB 2W0KA 1Z2KA 4AY0A 4IDJH 4AIOA 4JFDE 1JL8A 3DX9B 3WSQH 4LVHB 3STLB 5B38A 1UA6L 2CDGB 2HTKD 4L4VA 1YEFH 3MRCB 2FBJH 1OGTB 3TESA 5K9OB 2I24N 1F3DJ 3T0ED 2QSCH 3GNML 5IWLC 4L3ED 3HE7D 4JZNA 3HC4L 3RZCA 2MWCA 3LD8C 1U6AL 1F00I 3CDYA 1EEZB 5EBGA 4PRHA 4LP4A 2KZ1B 3SKMA 5T1MA 4H1LG 2LV4A 3OKYA 1V8HA 3HC3H 3MV9E 1QHOA 1PLGH 1C08B 3AROA 5KSAA 3G5VA 4JM2C 3FKUS 3LPGA 3SJVA 4KHTL 5CIPH 1RZJC 5CINL 3UJTH 4NIKB 1JYXA 3ZE2F 5TDOA 1DUYB 1DVFC 1MI5E 3TP4A 3WNKA 2D0FA 2DWDB 5ERWB 3NPSB 1OLLA 5D5MF 2P8MB 3DYOA 4MAUH 3QXAA 1NJ9B 4BSVA 3S36H 2DIAA 5SWZD 3OKOA 1J8KA 1P1ZA 1J9CT 1MFDL 4V1DB 3IFLH 2HJLA 4M6OL 2WWKO 1IC5L 3DGGB 3PGCA 5ESAB 1S7VA 1QSED 4IS6A 3RWIB 1RZIB 2ZP0T 1I85A 3P0VH 4IIQA 2UVFA 2X10A 1AHWA 2X44D 3RIAF 2B1HL 1QO3B 1A9BB 3WIHH 3CSGA 4JDTH 1TXKA 1XGRB 3ARXA 3V7AE 4L8SB 5E2UH 3S96A 3SKJH 5GZND 3K46A 1CXLA 1J87A 1MAMH 1QLFA 4UIMB 4N5EC 1CGVA 4FXKA 4E0RB 4HLZH 2NXYB 3BN3B 2OZ4H 5CJ8A 3SQOH 3CFKB 4L8BA 4RX4A 5JLZA 1I3RB 4GW5B 5DRXA 1GPOH 1GHFL 1Z5LA 4WDIA 5EOTA 3IXTA 4LGRB 4EN3D 3TPKA 4JFDD 1F4XH 5I1DA 3QFJE 4PJCA 5IOPB 3V79C 3KNBB 3QXTA 4OLZH 2NPLX 4GBXB 1VKXA 3VRLE 3MLYL 2B1AL 5DMIH 2FGWH 4WCYL 1VEOA 2GJ6E 4XPHL 4XCEB 3DOSA 3VXUD 2GITB 2CUHA 2ZUQB 3QCTH 5JA9A 5JZ7C 4OCSL 5IVXF 4ZNCD 3MLZL 5DEFA 4XNQA 3G5ZB 5DVOA 1OB1A 3LRSB 4PR5B 3X3FL 4N8VB 1C5DA 3MV9D 5E2UL 4P9MH 3OWEA 4ISVB 3LEVH 4UU9A 4Y89A 3FFDA 2ERJB 2R1WB 1R5WB 3RUGA 4DW2L 5C07B 3ARGA 3VFTA 1G6RH 3MOBH 1HKLL 4FQXA 2AEWA 4BQ8A 5C07D 1IGFH 5JNYA 5D93B 1XH3B 2PW2B 5FKPA 3LRHA 1RZFL 4PGEB 2C1PA 4OCYH 5F96L 3QH3B 1G7LB 1SJHA 3ARBC 4S1RL 4XHJC 2XG4A 3C08H 4EDXA 2EIEA 5FECA 1YN6A 1F6LL 5ADOH 2HFFA 3AC0A 1P5UA 1T1ZB 4U1IB 2AK4E 4U33A 3S4SA 4LSVH 1QLRB 4E41E 1XF1A 5D7IA 5C0IB 4DGYL 2A9MH 2F19H 1D9KD 1S9XA 1BVZA 1H8NA 1MFNA 4DVRL 1MCWM 4DZBB 2D7PA 1FYHB 2EDFA 3MX0A 1DR9A 1UQSA 1YNTA 1OL0A 3QWQB 4CDHA 3HUJE 3B3IA 1CD0A 3T3MF 3ZTJH 5BS0A 4FQLH 2ICEA 3VDBA 2E7LC 3TO2A 2V6HA 3K7UA 4XCNB 2XWBB 2MTPA 3C6SA 3NZ8A 1T03L 2WUBH 5BV7C 1QPXA 3MOBL 3ARPA 4Z7WE 4GKOA