5EIVA

Crystal structure of complex of osteoclast-associated immunoglobulin-like receptor (oscar) and a synthetic collagen consensus peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
181
Chain Sequence
HPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Osteoclast-associated immunoglobulin-like receptor
publication title Structural basis for collagen recognition by the immune receptor OSCAR.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 181
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eivA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eivA02
5D7JC 5CBEB 2CDFA 4UT7L 1BECA 4HEME 2J8UA 2V17H 5DJCB 4L4JA 4U1SB 5SX5H 1NBZB 1N8ZB 5DMKB 4Y2OA 1VFUA 4LMQI 1EVTC 3QXVA 4E41E 3CSPA 5JW4N 4OZFB 1A64A 3SE3C 1D9KC 4YWGH 1BMGA 1SEQL 4JHWH 5C6PB 5I1LB 2A6DA 1MJJA 1Q0YH 3GJFH 4EKXA 5CEYB 4UT9L 4RIRB 3BP6A 4IDJH 5IVOA 1YY8B 2XY1A 2BNRE 2QADB 4IOIA 1MHHB 5I15H 4HCRH 3UP1A 5EBLB 5DD5H 5C9JA 1WCQA 1KXVC 4KK6D 4PJ9B 5B4MD 4KK9D 2VL5B 5HGGS 1IEAA 4M00A 3U6RB 2NW3A 5KS9A 2Y5EA 3QJHA 5FOJA 3VD5A 1G7JA 3IJHA 2R15A 4IJ3C 4TRPL 4XP1H 4OTXL 1NCAL 4A6YL 1C12B 4I9WE 4IMLA 3S3JA 4M02A 5HHNA 1BX2B 1YEKL 5FGSA 3MUGB 5DR5L 1HI6A 3V5DB 3T2PA 4QOKD 1SJEA 4QOKA 3QDJB 1AKJA 3VFMA 1C5CH 1Q9KA 3FKUS 4MXQC 4YGVA 2HFGH 2R23B 4S1DC 2OL3B 5JIHA 3TH3T 3TPUA 2RHEA 3KYNA 2B8OT 3MBEA 3O8XC 4YHMH 5C6TH 3MROA 2EIDA 3JV5A 1ZTXH 4HBQA 4J3XA 4HLZG 3RX5A 1IRAY 1H3UA 1LVEA 2EC9U 5EOTA 5T5NF 3JWNC 4G8EA 1NL0H 1VFAA 4JY4B 4ODSH 1LO0H 1TVBB 1P7KB 3JWOL 2V9QA 15C8H 1DDHB 5M94B 2XWBB 4PJ8D 5CIPA 1MRDL 3O6MH 2Q86B 43CAB 2Z93B 3UDWC 2V5SA 3NCBB 3MCG1 5C0IB 1AHWA 4S1QL 2YEZB 4WFHE 5IOPA 3MOBL 4G6MH 4PJHA 1XF2A 4YX2H 4BSVB 2UZXB 5I6XC 5ID0B 4JQIL 2DQGL 3QEQB 1P4LB 2GFBA 5C1MB 3ULUE 4YFLF 3CJJA 4K3EL 2WBJC 4JCLA 2XXCB 3VWKB 3GI9H 4G8GB 5HJ3B 4Y1AB 4JDTH 3DHMA 1XGUB 1JUFB 1OHQA 1SYSB 1KTKE 3MOAL 1NFDF 1TJIH 1SY6H 3B43A 3NCEB 1OGAE 5FOBA 4PD4J 2CJUH 4JB9H 4NZUL 3IXTB 1DJSA 3GHBL 3LSOA 4HPOH 4IS6B 5SWSE 4CGTA 3LOWA 5DTFB 1A6VH 3QCUL 2RFXB 5TGBA 1BWMA 4NCC2 3W81A 2EKJA 4LCIH 3MA9H 3EDKA 4ERSL 3F65A 2NMSA 4KFZC 1HH6A 2VERN 1XGTA 3IDMB 3JBG7 1T4KB 4U1IB 3WO4C 1OAKL 4WEBH 3C5ZC 4QTIL 4M93B 1RZKH 3GHEH 2EXYC 5L0QC 1X5JA 3RWHA 4OCYH 2AJYL 1J1PH 3VXUE 2W0PA 3ECBB 3EYVB 3UCRA 3WYRA 4HMEA 3EOTH 4L8BA 5DRXB 4ZUVB 3BPOC 4M48L 3F5WB 4LLVA 3QI9C 1G6VK 4AYFA 3LPWA 5D7KD 3L3KB 1I9JL 1JZ2A 5F71A 3TBWA 1NLBH 3SBWC 1N6VA 3C60A 4PYGA 3GK8L 5LXGH 5T1DH 3AC0A 3HS0A 4NQVB 4XCCH 2BVOB 5C3TA 4RMUA 3P9WB 5I1EH 4N8VA 4G6KL 5ACLA 1P9MA 2B5IB 5L2JA 3W9EB 1FVCB 2CLZB 4XHQA 2ATPB 1U91A 1OQXA 1J10A 1QZ1A 1BAFH 3FOLB 2O5YL 2AABH 1GSMA 4G42A 1ZLSL 5ENWA 2X10A 2JCCA 1EFQA 4XMLL 1CCZA 3C8HA 1U3HB 4BK4A 4BQCA 3RBGA 4ODWB 3RTQB 1HINL 1I9RL 4CJ1A 3D18B 3EFFB 3U82B 4HEPG 4YBQD 5ICZA 2VLLB 1XCQA 3K7UA 1LK3L 2CXKA 2N1KA 4D0DA 3TNMB 4LSVL 4JKWA 4OZFG 2D0HA 3WJLC 3CVIL 5T1MA 1F4XL 3RVTC 5C0RH 3NZHL 2YKLH 1EGJA 5KVDH 1M7IB 1QKZL 3FRPA 4KI5D 4HF5H 4UDUB 1NCBL 2AEWA 3MNVA 1T1ZA 4WO4D 4HGWB 3TBVB 1MNUL 1HXMA 1YEJH 1FN4B 2VITB 4P5TC 2OTPA 2EC8A 3WLBA 1BF8A 1FLTX 4YJZL 1J8HB 1RUAH 1N7ML 1U58B 3FQUA 4AMKH 5DURB 1EEYA 3QUZD 3QUZA 5J6HB 2W07A 1LP9B 3HLAA 1JWUB 2ZOLA 2CDEB 2CUMA 5C09B 2GCYA 2NY0B 2IBZY 3OKOB 1ZK9A 4MNHB 1I85C 4ONGL 3NIFE 5DJYA 5HGAB 4LIQL 3O2DH 2V2WA 4IRJC 3KLHC 4XWGH 1YQ2A 1FYTE 1OP5H 4NNYA 3WN5C 2X9XA 3EFDH 1FNGA 2F53D 2F53A 1ZHBA 5GIRB 3BKYL 4HBCL 3U0PA 5GZOC 3X14B 25C8H 4GRLD 4GRLA 3WFBH 3BXNA 1WTLA 2CDFB 4BKLB 3NCJH 5IESL 2H32A 2J8UB 4NKIH 3W5NA 3MRMA 3QZWA 4TVPE 2WSKA 1E4XI 1G6RH 1MREL 3F7YB 1F4WH 2WWKT 3CC5A 3IFLH 4QRPD 4QRPA 1DUZA 3QPQD 2A6DB 5T3ZL 5DHVH 2J6EA 4OZHF 1IC7L 1MJJB 4ZUSA 3D6GA 1NDMA 2NTFA 1RVFL 4MJID 4WUUA 2D3VA 1LDSA 4IOIB 4XMKH 5E5UB 3UBXG 4FFZH 1HDMA 5C9JB 3CSBA 5I1KL 3QNXA 3MJ7A 1IEAB 4L8SA 5ITBL 1UKSA 4QGYA 4R2GC 3IDUA 1G7JB 4PJBB 3IJHB 1F5WA 5FAAA 3O9WD 1J0ZA 2P8MA 1AGEA 1XT5A 1AC6A 3BISA 5TF1L 4K71C 4IMLB 3CDYA 3S37L 2DDQL 4OCXH 4JHAH 1HI6B 4XAKD 4JN2A 3F12A 3KDMA 1SJEB 3D3VD 4QOKB 3D3VA 3KJ6H 3GMOA 5JHLH 3VFMB 3BZFA 1Q9KB 4YGVB 2APTA 2B0SL 5HYJD 1A9BB 5HYJA 4NQSA 3TPUB 2DTML 2C3VA 4RFEA 4D94A 4X6CF 1BEYL 4YFEA 3D2UD 3PWUA 2DICA 3D2UA 1KJ2A 1CFQB 2IQ9L 2CO6B 4LVOB 2UZYB 5DA4A 3NFNA 2F9BT 3FN0L 3MACH 4N9GB 3FHQA 4G8EB 2GTZA 4X4ZA 2ZCLL 3EOBA 5J1TC 2VSCA 4GSDH 1AIFA 3BFOA 1IGJB 4PJ8B 5CIPB 3KR3L 4FQ1H 5FHBL 1AHWB 4KROC 4K7PH 5H2BA 2OMBA 3T4AA 4N5EC 3MRJA 4PJHB 4TULH 1XF2B 5KTEH 5EOQH 2WK2A 2K1MA 2EC9T 4K2UH 4OF0A 4M1DH 1QRNE 3BZDA 5JW4R 2Z4QA 5K9OA 4J4PA 4TSBH 1OW0C 1AR1D 3ARFD 4XPGH 4E0RA 3ARFA 1I75A 2ITDB 3AY4C 4NQTA 1ETZA 3TV3L 2YK1H 2EH8H 3F7RA 5BS0D 1CG9A 5FOBB 3TBSA 2IF7A 3LIZL 3K0WA 5DJ0A 3BGFC 3LSOB 5C0EB 2FECI 5E99H 4CW1A 2XTJE 5TGBB 1BJ1H 4EOWH 4MS8C 4LDOB 1FLRL 3SEPA 1HH6B 2YUZA 1JK8A 4HFUL 5GS3A 2KZ1B 3S88L 5KSBE 3H42H 2HLFD 4C83A 2JJTA 4OZGE 5GPRA 1F90H 4GKZA 4YPJA 3CXDH 4Y5VC 5DD3L 3RWHB 3HPLA 1JI2A 2XQBH 1ZHKA 1YNTB 1IKNC 3GGWA 2HVKB 4ZNEA 3QXTA 4HIEA 2W9EL 1NCCH 4XZUA 5DQJB 1ZLUK 4JY5H 4S1RL 5TJWK 4GAJL 4LLVB 4M1CC 4LNRA 4YQXH 3TYFA 1J88A 3NFSH 4B50A 4M1GH 4J1UB 4U1NB 1CFSA 2VTFA 4OKDA 2OK0L 1AGDA 1UZ6E 4XPHH 1ZLWH 3BD5A 3BIAX 1CL7I 1FYHB 4CVWA 1EUTA 1A47A 1QG3A 3HS0B 1U8HA 1KPRA 3QUKA 4D0BA 4XNUL 3HC0A 2HJKA 2X1XR 1L9NA 4N8VB 4F3FA 4J7RA 3V6OA 5L2JB 4MDJA 3EO9L 3G5VB 1BQHA 1FAKT 2NYYC 1OCWH 4LPTA 3GIZH 5TFSH 4G42B 5ENWB 1DVFC 1ROWA 2JCCB 2X5PA 1T1WA 2V17L 5EIVA 3IRZA 3KPNA 1UCBH 2ADIA 4QRTA 4QRRE 1JJUA 1BGXH 1RD6A 3BQUC 1XCQB 1HWGB 2X4QB 4YWGL 1JGUH 4JHWL 4GXUN 1BJ8A 2ICWI 4D0DB 5D2NC 4NFDA 3B6SB 1Q0YL 2Y7QA 5T1MB 1UCTA 1T89C 1I3RA 2PO6C 2BFVH 2UVFA 5DJ2A 3FTGA 4IDJL 5D71H 3EBAA 2FRGP 5I15L 3MNVB 4HCRL 1T1ZB 1ZKAA 2VWEE 3GMNA 4JGJA 1KYOK 1HXMB 4WO4B 5DD5L 4Z7VA 2W60B 1RQ5A 1N0LA 4GS7B 3SCMD 4H5SA 4LARH 4XB8A 3SCMA 3WLBB 3K1DA 3X3FH 3VFTB 4LHQB 1QHOA 3S35H 1XGQA 1EEYB 3ESVF 3QUZB 3OR6B 5FB8A 2VDNH 1FL6B 3HLAB 4XP1L 2UYLA 2GCYB 2WBKA 3DWTA 5D1QD 5D1QA 4LLWA 5GSRA 3MRQA 4QGTA 3BIKA 5DJYB 1HCVA 2H3NB 2V2WB 3VFSA 1T66D 1UA6H 3S36X 5FYLH 2ZZUT 1C5CL 1EV2E 2HFGL 1FNGB 1OAXH 4OD2A 2F53B 3MNWA 1FE8H 1ZHBB 4NRXA 3U4EA 3FMGH 3HTLX 1IL1A 3U0PB 4YHML 3SDDC 5C6TL 5JLZA 4HUVA 2O5XH 1ZTXL 5E6ID 4M7KH 4Z7UE 3OKNA 4GRLB 5D7LE 5E2UH 3BXNB 2N56A 3RVWC 1CR9H 5ESAB 2BK8A 3X13A 2H32B 5ANME 4WVRA 3ZDYE 1GZPA 1NL0L 3MRMB 4KRNA 3QZWB 4ODSL 5M95B 5DC0A 1LO0L 4ZNCD 3GBNH 15C8L 1EERB 5ADOH 1WBZA 3O6ML 2MKLC 3CC5B 4PRHE 4QRPB 3TN0C 1DUZB 2VOTA 4OLVH 4WJ5A 1VCAA 3RWFA 3KAAA 3N1PC 5EZJA 2CRYA 5A40E 1ZXQA 4G6ML 4WENB 3MCLH 2X7LA 4YX2L 3RGVD 1NDMB 3RGVA 2NTFB 4KQ4H 3BRFA 4MJIB 1BFTA 4EI5D 2V6HA 4EI5A 2YA0A 2OTWA 3FQTB 4ZSOA 3IAGC 2YUXA 3QNXB 2Z35B 4L8SB 1CWVA 3GI9L 4JDTL 4RMQA 3O9WB 3WO3B 1TJIL 1SY6L 2P8MB 1AGEB 3CFKA 4U1HA 2CJUL 1Q8MA 4JB9L 3RWIA 1DBKH 5DJXA 2PTVA 4CVXA 4HPOL 4JN2B 3F12B 3KDMB 4DZBA 3BPLB 3D3VB 1A6VL 4CKVX 3BZFB 2B2XH 4Q6IA 4BH8B 4XVUD 4KXZH 4LCIL 3PHOA 5HYJB 4NQSB 3MA9L 1AH1A 1AGBA 4RFEB 4LFHG 1I1AA 3D2UB 1KJ2B 4WEBL 4YHYC 3C6LD 1RZKL 3C6LA 3NFNB 2DYPD 2DYPA 3GHEL 4Q58C 4OCYL 3SJVD 3SJVA 1J1PL 3RL2A 2IJ0C 4L9DA 5KSUA 2GTZB 4K9EC 4NO2A 3LY6A 4WEMB 4HGMA 3EOBB 3IDYB 1KJMA 2P44B 1CLYH 3U9PH 3EOTL 4PY7A 1AIFB 1MCDA 4PJFE 4PJIB 4U0RC 1PY9A 5IIEA 3QDGA 5TDNA 2FJHB 1IJ9A 1Y18A 1UH4A 5H2BB 3T4AB 4H20H 3MRJB 1OD9A 5DC4B 1FZMA 3HNSH 1NLBL 1WITA 4W70A 3C2SA 5I1DA 5LXGL 4OI8A 5T1DL 3HB3D 1KN4H 2HG5B 3GMRA 3BIBX 1KC5H 4XCCL 4M8VA 5I1EL 3GMPA 3IS0X 5JZ7D 1WWBX 2Z4QB 1S3KH 4LQFH 4JFDD 5K9OB 1BAFL 4CU8A 4E0RB 3ARFB 3P0VH 2AABL 2BVPB 1K2DA 1V3LA 4UNTA 5KN5A 4QHUA 3BAEH 4ZMAT 1MCSA 4I4WA 2L7UA 5BS0B 1CG9B 2I26N 1EEUA 4GH7B 3KWWA 5DJ0B 2ZUXA 1FJ1A 4Z7WA 5HHXH 1QFHA 3WBDA 3PDGA 2I25N 1CGTA 4CW1B 3V95A 1G0XA 2ZG1A 2HTLD 3NOIA 5BRZA 3SDCC 1JK8B 3VFWA 3WSQH 1X5GA 4Y19D 5C0RL 2YKLL 4C83B 5KVDL 4UU9A 5I9QB 4GKZB 1DBAH 5TF0A 4HF5L 4WFFE 2FGWH 4U3HA 2BVYA 4R0LA 5EC2A 5EB9A 1YEJL 3HPLB 4EEEA 4DUVA 1ZHKB 5BVJA 1TZIA 4HUXA 1FORH 1RUAL 3GGWB 4RCAA 4AMKL 3HZYB 4HIEB 4DGVH 2LQRA 4XZUB 5C08E 1UB5B 4X7FC 3V7AG 2J8OA 4MA3A 5HYEA 4LNRB 4ZOAA 3TYFB 2EE6A 3CPLA 1C7SA 5LWYH 1DLHA 1CFSB 4XCFH 3CMGA 1AGDB 1TPXC 3O2DL 5GGUA 2YD8A 4XWGL 4MB3A 3EFDL 2P45B 1KPRB 2YXMA 3QUKB 4JO1H 3HC0B 4OQTA 4WW2F 2HJKB 4D0BB 1U8JA 5F7FA 4F3FB 1C8PA 4F7MA 5BW7A 3ARYA 3L95B 1Y6NR 4OCSH 3AS0A 4WFGD 4DVBA 2JTDA 25C8L 3T77A 1X5YA 4KTYA 1BQHB 3QWOA 3WFBL 4HLZH 1AR2A 4ZFOL 4P9HH 2PXYD 2PXYA 4FXKA 3NCJL 5ALCH 4NKIL 3SGDH 1T1WB 3D87B 4PD4K 1YN7A 4FTVD 4NGHH 4QRSA 4FTVA 3KPNB 5DA0B 1S7UA 3UTQA 2ADIB 5FDWA 3EGSA 1G6RL 1F4WL 5KANG 2BY0A 3IFLL 4JZOA 1GOFA 1V7MH 3HNTH 1E6JH 2Y7QB 5K33A 2PN5A 1I3RB 1XR8A 4NBZB 4NN5B 5DJ2B 3FTGB 1XR9B 1KGCE 4RRPA 4M5ZH 5IW1A 4O2FB 4XMKL 3GMNB 4Z7VB 5DDHA 2I60H 4FFZL 4BZ2H 4XXCA 2PYEE 4HKJA 5IP4A 4H5SB 3SCMB 3MRHA 1F4AA 3DI2B 1XGQB 1RMFH 5FB8B 4O51A 1J87A 4Z0BH 2H9GA 1P5VA 3U7YH 3IXAA 2UYLB 2Z8RA 4OF6A 3RQ3A 5D1QB 4NBYB 4ZUWA 1T3FA 3MRQB 4OCXL 2VLKD 2VLKA 3BIKB 4CN1A 4JHAL 1KCSH 3VFSB 3AMKA 2APBA 4XNYH 3KJ6L 5JHLL 5AYUH 4NRXB 2QTEA 3LQMA 1IL1B 5JLZB 3ARED 4HUVB 5IJVB 1MHEA 4XX1G 2HVJA 4TUOA 5E6IB 5ACMA 5EZOH 3TZVD 1CZ8L 1UZ8A 3KGRA 3TZVA 4JHBA 3V52H 3X13B 3MACL 4JFOA 4NN6B 5IJKA 1G9MC 1GZPB 4LRIA 4G3YH 4XT1C 3ARBA 2C4XA 3G6JA 4GSDL 4JREB 2HT4D 1GJIA 4YO0A 4WDIB 4PJGB 4J2XA 1WBZB 2PTTA 1QSVA 5FO7A 2AK4E 4JKMA 5GS1B 4FQ1L 4WJ5B 4K7PL 5JMRA 1MFEH 1YEIH 4PRDA 3G08A 4TULL 2X7LB 5KTEL 3RGVB 5B8CC 4FZ8H 4UQ3A 1YNKH 5EOQL 1F42A 1ACYH 3CXHK 3FZUC 4EI5B 4K2UL 5F6IC 1I7TA 4M1DL 2OTWB 4ZSOB 4X7SH 3NTCH 3EOYG 2R2EB 4CN6A 4JRWA 1MF2H 3QUXC 1SQ2N 4XP9H 4EJ1C 4ZYKB 4H0GA 2GK0A 4TSBL 4HG4J 1V8HA 4XPGL 3S7GA 3MLYH 1T5WA 1QFUH 2YK1L 2VABA 2EH8L 4HW6A 3CFKB 3HR6A 3EDJA 5CBAA 1FL5A 3RWIB 4KMTH 4PP2B 2M2DA 5DJXB 4CVXB 1IARB 3O45A 3RHWK 3QIBC 1HEZA 4DZBB 2BMKA 4RGMB 3FB7A 5E99L 4AEHH 4V1DD 4V1DA 3MLPA 3DXAD 4Q6IB 3DXAA 4EOWL 3PHOB 4KKAC 3VXRD 3VXRA 1S9KC 3TBTA 3K4DA 3H42L 3ALPA 4OZFH 1NPUA 3MYZA 2MNUA 4P2OD 1CVSC 4UTAH 1F90L 2AJ3B 3HMWH 3C6LB 2DYPB 3CXDL 4M3JA 3TA3C 3SJVB 1VDGA 3RL2B 4OV5B 3BP7A 5HI3C 5KSUB 2XQBL 5HY9B 1KCRH 4NO2B 1B4RA 1KJMB 4X7EC 4N0FA 1NCCL 4YHZH 5KOMC 4JPKH 4P2YA 3V4VH 4JY5L 5IIEB 5DVOA 3EZJB 3DYMA 3QO0B 1Y18B 3UMTA 4YQXL 1EH9A 2HT3C 1VACA 3NFSL 5D6CA 5K93A 4BH7A 1H5BC 4M1GL 3DJ9A 4XPAH 3MNZA 4Y5XB 3KXFD 2X6MA 3KXFA 2A73A 4KRMB 4X6EA 1FZMB 4QF1A 4XPHL 1R3IH 4TNVK 5F9JA 3GMRB 3P4LA 2IGFH 5CGYC 2DI8A 1AFVH 1OD7A 3FHAA 2FBJH 1TCMA 4DEPC 3GMPB 3DTXA 3O8XD 3BH8A 3O8XA 4K8RH 4ALAH 4GKSA 2OL3H 2H26A 4JFDB 1OP3K 1OCWL 4Z7OE 1E0OB 4ODHH 3GIZL 5TFSL 2F74A 4LEOA 1K2DB 5KN5B 4ZTPH 4QHUB 2Z8SA 4I4WB 1AO7E 2ZG2A 4Q6YA 2F19H 1UCBL 3KWWB 5ESVA 5E00A 1FJ1B 4Z7WB 1NUNB 1NFDA 1F4YH 4KAQH 4DCQA 1BGXL 3CCHB 4OGYH 1OAYH 4MJ6A 3TEUA 1C16A 3LRHA 1JGUL 3ZE2F 3UDWA 4CDHA 3HI5H 3VFWB 4PUBH 4Y19B 2BFVL 1BQLH 3OHXA 1LK2A 4UU9B 5ICYA 1QLEH 5D71L 2DQTH 3QDME 3W0WE 4R0LB 1WBYA 1IQWH 5BVJB 4LARL 1TZIB 3JWOC 4HUXB 2WBJD 2WBJA 3X3FL 3A6BH 3S35L 4H1LB 5IF0A 2VDNL 3WFHA 4HWBA 4PGBA 4MA3B 1VENA 3CPLB 3S4SA 1DLHB 1KNOA 3TCLB 3HE7D 2VMFA 2ICWJ 1KB9J 1ZOXA 3HE7A 5GS0H 4PJXF 4I18A 4XBEH 1UA6L 4U31A 5C0FA 5GGUB 2BCKA 5FYLL 4Y4HD 4Y4HA 1OAXL 4URTB 4X4YA 1FE8L 3A67H 3FMGL 1U8JB 1FL3B 1INQA 4FFWC 4NUJA 1KPVA 2O5XL 3HMXH 4DVBB 1LGVA 3T77B 3QWOB 1BZ7A 4M7KL 5E2UL 5EIQA 3C5ZD 5GGVY 3C5ZA 4GXUM 1CR9L 1MWAA 2PXYB 4FXKB 2FEEI 1EVUA 4UV4H 1YN7B 4QRSB 4FTVB 3RIFF 1EPFA 1S7UB 4UT6H 3UTQB 5FDWB 3WCYA 3GBNL 2ICES 3EGSB 5ADOL 1FSKC 5IQ9A 3SE4A 2VIRA 1AXTH 3QI9D 3QI9A 3OKYA 4OFDA 1NKRA 4OLVL 5L9DH 2VDPH 1FG9C 3MCLL 3L5WB 1XR8B 1YJDH 1T2QH 5E4EC 4KQ4L 3QG7H 3LS5H 3U36A 4TVSa 4OGAC 1T6VN 4OF8A 5DDHB 4JLRA 4LCWD 4LCWA 4HKJB 3WUWB 6FABH 5C09E 3MRHB 2A38A 3MV9E 1YPZF 4XWOD 4TSAH 5ALBH 4GBXD 4O51B 3TO4C 4GBXA 1DN0A 3IXAB 4YDIH 5EULV 2OJZH 4ZUWB 1T3FB 5IB2B 1DBKL 5DLMH 1TIUA 2VLKB 1YYLH 5A3IC 1NGYB 3VMPA 5TDPA 1P6FA 2B2XL 3QUYC 2IAMC 2GITB 3TM6A 5B3JF 2NXYC 2J8UE 2F54E 4F33A 4CDGC 3DVNA 1JGDA 3AREB 3WJLA 5JOEA 3P4OB 3RVTD 1MHEB 4TUOB 3AVEA 4P2RD 3U79A 1UZ8B 5SX4H 3TZVB 1A4KA 2JE8A 3H3KA 2UY6A 2A83A 3VWJC 5FUCE 4XRCA 3QT2A 4P5TD 4P5TA 3U9PL 1CLYL 3G6JB 5F7WC 1IGMH 4Z95H 3ZE0E 2JIXA 2ZCKH 2PTTB 5FO7B 1O5DT 3VG9B 2EZ0C 3KPRA 2FCBA 2AV1A 4PRDB 2YZ1A 1M7DA 4H20L 3MBXH 4NPYB 2GHWB 3HNSL 1I85A 4X80H 4NHCH 2P4AB 4UQ3B 5C0AE 4IRJD 4IRJA 4PJBE 5DI8B 1KN4L 5D7SH 1ONQB 1KC5L 2VUOA 2NY4D 1I7TB 2RR3A 5I1HH 2FHCA 3RWGA 5TQ0H 1U8NA 4RMRA 5JXED 4Q74A 1YY9C 4AENB 1N64H 3FAXA 1WICA 1S3KL 1JYNA 4LQFL 2GK0B 1OLZA 1NQBA 3P0VL 1T5WB 1N4XH 2FATH 1WIPA 4LQ1A 4MVBC 3BAEL 4P5MA 4N9OB 5CBAB 1FL5B 1CU4H 3VD7A 1C1EH 4CMHC 4OBSA 2YC1A 4KH2A 5D2LA 4I3RH 3O45B 3LKNB 1NBQA 2BMKB 3QNZB 3FB7B 1IM9A 1IGYB 4V1DB 3AB0B 3CZFA 3DXAB 1RIUH 3VMOA 5E2TH 3VXRB 4M61B 3AGVA 1MEXH 3MC0A 3WSQL 2XOTA 4KRPC 4P2OB 5IK3A 2ARWA 4NT6A 3T3PF 1DBAL 1JGVH 2FGWL 3BP7B 1FORL 5AWNH 4N0FB 4DGVL 4G80A 1RZ7H 4IJ3B 1HHJA 4MQTB 3U0TA 1BJ1J 2VH5H 1VACB 5D6CB 4BH7B 1LHZA 4QXTA 5LWYL 3MRGB 3E3QE 3MNZB 4XCFL 5DUMH 4NQDD 4NQDA 3KXFB 4X6EB 3UJJH 4QF1B 4KMLB 3H8NA 5GGTA 4NO5A 3EYSH 3PGFH 5LGJB 4AIXA 4JO1L 5DXWA 5JOPD 4HS3A 4JRXD 4JRXA 4JM4H 4JM2C 3DTXB 3BH8B 3O8XB 4OCSL 3FFDA 2RQ8A 2WQRA 5CSZA 3G6AB 1MH5A 1NGWA 4P9HL 2F74B 4LEOB 4G7YH 4Z9KB 5ALCL 1S7VA 3T4YA 1GGTA 2ARJQ 4MZ2A 1INEH 1FGVH 4BFBD 3MMEA 3GSWA 4NGHL 1KLGA 7CGTA 4Z18A 5F93C 5ESVB 3PQYD 5E00B 3PQYA 4R9HA 4ZTOH 1B0GA 1NFDB 4YIQA 4IOFC 2EDYA 1UENA 3WFZA 4MJ6B 3C87A 2E7MA 1Z0MA 2X70A 2D7NA 3S6CA 1V7ML 5H37G 1OM3H 3HNTL 5CIPH 1E6JL 4N5ED 5F9OH 3PWVB 4P3DB 4LASH 3OHXB 3RVXD 2X42A 3MJ8A 4M5ZL 2R4RH 3KHQA 2I60L 1WBYB 4BZ2L 4PJ5D 1I7RB 4PJ5A 4HZAA 1U3YA 4JJHA 3RNQA 4L3EE 5HYSB 1A7NH 2DQFA 3QFDA 2WBJB 2IMNA 5EFIA 2EDBA 5JW3H 3S5LG 1RMFL 3CDCA 5IF0B 3WFHB 1BVKB 3Q5TA 4PGBB 4TNWK 1V5JA 3AY4A 4Z0BL 4RFNC 1IAMA 3U7YL 3QAZC 1RUPH 1MI5D 3S4SB 1MI5A 3V0VB 1KNOB 3CZJA 3E6HA 4JEGB 3HE7B 3SKNA 3WDHA 4L3CB 3QEHA 1KCSL 4I18B 5F44A 5C0FB 5CILH 4XNYL 2BCKB 4PJCA 5AYUL 4Y4HB 4F9LA 4MS8D 5L7XH 4ZOEA 2Q7YA 4NQCD 4NQCA 3SE8H 5FECA 1INQB 4Y4KC 2XPGB 1KPVB 3BEVA 4QCIA 4WWKD 4WWKA 1ZVSB 1H15B 1BZ7B 2DLHA 5EZOL 5BVPH 3C5ZB 5EPMA 3JV6A 2PR4H 2UVEA 2NY6D 4WNQA 1MWAB 5DUBA 5F9WC 4Y5VA 3V52L 2EDHA 4MA1B 3IKKA 4G3YL 1IKNA 1J1OH 3SHSA 1QPPA 5F88A 1WF5A 5IQ9B 3MFFA 3MUZ1 1I8KA 2VIRB 3OB0H 4NQEE 4G9DA 3QI9B 4AEIH 1TFHA 3VD9A 5EU5A 1LO5B 1MFEL 1YEIL 4NQXB 3HE6C 3KS0H 1BFVH 4FP8H 3V7AE 3PP3H 5B22A 4FZ8L 3U36B 1YNKL 5BOZG 3T04D 1ACYL 4O4YH 3GBLA 1QA9A 4QYOA 4GAGH 2VZVA 4N0UA 1NCDH 3VRLF 4YPGB 4JLRB 1LDPH 1AGCA 4X7SL 1UKQA 3NTCL 4LCWB 2H2SD 3MLUH 1MF2L 4KTDH 1E6OH 4XP9L 3FO1A 3VI3E 3T0EE 4UINH 3MLYL 4GBXB 1KOAA 1IC5H 1QFUL 3T2QA 1FZJA 1DN0B 1DVFD 4QNPF 1DVFA 4QXUH 1WVZA 3MRKA 1KLFA 3GSNB 4KMTL 3LHPH 3NIGE 1SM3H 2DLIA 1MPAH 1PZ5A 1MUJB 5TDPB 4AEHL 4NFCA 5K9JH 4JN1H 3BQUD 3U83A 4LDLB 3BQUA 4WTXA 1NUGA 4ZS7H 1MRFH 3GFUA 5EA0H 1T21B 3HUJA 2YPKA 4F33B 5D2NA 2EDKA 1MCHA 4ZS6C 1T89A 2ESVE 4UTAL 1K5NA 2DIBA 4K7FA 5KW9H 4P2RB 3HMWL 4JFHE 2DLGA 2DL9A 1T7YA 5H94A 2A83B 1L6ZA 3IU4H 5AUMA 1KCRL 4XRCB 2ORBH 4P5TB 5TE7H 3H3PH 3NAAH 2HJLB 3B5GA 4YHZL 4JPKL 4LSQH 3V4VL 4MJIE 5DZLA 2VXUH 4X7TA 1JWMB 3KYKH 2E8YA 1XF3A 4XPAL 2AV1B 2NY3C 4HK0A 4DFIA 3RI5F 1M7DB 3L9RA 2AERT 5IBLC 2ADFH 4F7EB 1R3IL 4IRJB 4IIQC 1HK6A 4WU7A 2NY4B 1TVDA 2IGFL 4PJEF 3RWGB 4NZRH 1AFVL 1OSPH 1J5OH 1X3DA 1QSEE 4HUWB 5BOPA 2FBJL 3K80A 5SX5K 5F89A 5J57B 3SDDD 4K8RL 3SDDA 4ALAL 5E94A 4AG4H 1TJGH 2OL3L 4TQEH 3BGAA 4LAQH 3FJTA 4XAKE 1BD2E 3ZT6A 5D7IA 4ODHL 3RVWD 2ATKA 1AD9A 3O4LD 3O4LA 4ZTPL 4MQSB 3ZDXE 4HXAH 4P5MB 4RGNC 2CGRH 2GT9A 1AQKH 3ZMRA 2Z8VC 3GJFK 3QIWC 2F19L 2RIKA 2YC1B 5D2LB 2QEJA 2H32H 1T0MA 1F4YL 4WCYH 4UAOC 4KAQL 3O4OC 4JFYA 4OGYL 1OAYL 5MENE 4ONFH 2ZNWA 1ND0A 3P9LA 3TN0D 3TN0A 5DD6A 3HI5L 1CTNA 4PUBL 3KPQA 4UQ2A 5IK3B 1NAMA 1BQLL 3QQ9D 5GZND 1QLEL 5FYJD 2J6EH 2DQTL 4PJIE 3ARUA 4ELMF 4XNZB 2YRPA 4OZIA 1W0WB 5DGRA 1IQWL 3UAJD 4RBPH 2Z31D 2Z31A 1UH3A 5KBNC 4POZD 3U30C 1JP5A 3PUCA 2ZP0T 3HRZA 4BFGA 3A6BL 3GMLA 4NZDA 2Q7NA 1HHJB 1J0HA 3KPMA 4WUKH 1M7XA 3PGCA 4X4XA 3LRGA 3ZT7A 4Q9QH 4NQDB 5GS0L 4PLOB 4L1HA 5FV1L 4NO5B 4XBEL 1CGXA 4IHOA 1OB1A 4R7NA 4HS3B 1X4ZA 1K4CA 2VDQH 3A67L 3G04A 1S7TA 3CFIC 1OLLA 4JRXB 5BS0E 2CKBA 3HI1A 1XGYH 3HMXL 4EIZC 1FFOA 4HG4K 5CSZB 1CDCA 2DLFH 1NGWB 3I75A 2EKSB 2AAVA 3IDNA 3L3OA 1X4XA 3T4YB 2LAGB 2X1QA 4UV4L 3GSWB 1A0QH 1KLGB 3F7QA 4UT6L 4FXLA 3PQYB 1LEKA 2D7PA 3D39E 3ARDC 2V9RA 3KPSD 2Z91B 3KPSA 4YIQB 2ILLA 1AXTL 2MMXA 2X70B 1TVHB 1U41A 5L9DL 2VDPL 5JA8B 3I6GA 1MCEA 5GGRA 1YJDL 3FT4A 1T2QL 1RZKC 5EOCH 3QG7L 3MJ8B 1A6ZA 3LS5L 2GKIA 2VLJA 4FQHA 2C3GA 4B5EA 3WHE0 3GNMH 1TXKA 4KJWC 1LMKA 5J3HC 2YBRA 4PJ5B 6FABL 3RNQB 4AZ8A 3QFDB 2DQFB 4F2MA 3GMQA 4FMFA 2R2BB 4NSKA 2WP3T 4TSAL 2HYMA 5ALBL 5IMMA 2DMBA 4X6DA 4CBPA 2C1OA 4YDIL 1MI5B 3PHSA 3GO1H 2OJZL 1HQRB 3ULUC 1URLA 3E6HB 1G9NH 2E9WA 1EBPA 5DLML 2PF6A 3SKNB 1YYLL 3QEHB 1D5IH 1WQVT 2FIKA 1SMAA 4X5WB 3B9VA 5EBMA 1JWSB 5D6DC 1B2WH 3LPFA 1OAUH 1QEWA 2Q7YB 1JMZA 3ISWA 4PG2C 4NQCB 3ZKMC 5FECB 3SDCD 3SDCA 2NNAA 2E7LC 3BEVB 1WAAE 4WWKB 1ADQA 1KXTB 3CH1B 4MNGA 5BV7H 5EPMB 3JV6B 1I3VA 4WNQB 2NY6B 3QA3A 5MHSE 4ZDHA 1S9YA 4U3CA 1UEYA 1UWEH 5A43C 1S9VA 1IGML 2YZ8A 1I8KB 4Z95L 5GGQH 1QFOA 4JZJC 4RWHA 2ZCKL 5CGTA 4ZPVA 3GIVA 4G9DB 5I8CB 3OQ3B 1QPXA 4KHXH 2DLEA 3CH8A 2IADA 5EU5B 1TLKA 4JKPH 1JZ6A 2VR5A 1W8NA 3MBXL 4X4ME 4D9RD 4MQ7A 4X80L 4NHCL 1GGBH 1M6OA 4TSCH 1QA9B 4QYOB 4N0UB 5D7SL 5I1HL 1A8JH 9CGTA 4P0DA 5TQ0L 3ARGC 4WV1C 1EJ6A 1N64L 5IFHH 3FO1B 3WDJA 3GM8A 4P2QE 1YMMD 2VO5A 2CPCA 2ZUWA 5IHZA 1N4XL 2FATL 2L0DA 3U2SB 1FZJB 1DVFB 5HYQA 2P49B 2Q87A 1CU4L 3MRKB 1KB9K 1C1EL 1R5IA 1VB9A 3BUTA 4I3RL 4XP5H 1Z2KA 5KVEH 4X99A 4LLUA 1PZ5B 4Y88A 4JHZA 4YXHH 3BQUB 1RIUL 4OLWH 4NKMA 5E2TL 5F7YC 2QHRH 1OWRM 4P3WA 2YPKB 1MEXL 5D2NB 1HKFA 5KS9F 2GTWA 1WT5C 2ED7A 1JGVL 1S8DA 4C4KT 4PJGE 3QJFA 5D93C 5H94B 1A22B 5DMGC 2A9NH 4XTRD 3IS1X 5AUMB 3UXFA 2ZPKH 5AWNL 1YC7A 4NO0D 2UUDH 4NO0A 3DX6A 1EHNA 2YWYA 1F02I 4LLAA 1OP5K 1RZ7L 2AGJH 4JKLA 4X7TB 1N59A 2VH5L 4KKCC 5HVHB 1XF3B 4XMPH 5DUML 3L9RB 3UJJL 2Z92A 5DHYA 3EYSL 3PGFL 4WU7B 3P4MB 4NFBA 4X83A 3C09C 4JM4L 3HC3H 5F89B 2C7UA 3SDDB 2EDQA 5E94B 5F7NC 2OSLA 4NRYB 2V5TA 3I6LD 5D7IB 1IGCH 1J0YA 4IEFB 4FG6C 3O4LB 4G7YL 1INEL 3SDXF 1FGVL 2GT9B 4PJHF 4U05A 1KACB 3L3GB 2NXZC 1S7SA 4ZTOL 1T0MB 4M7LT 4JFYB 4UB0H 4AK1A 5HDBE 3DV6A 1ND0B 3P9LB 4HKXA 4XPTH 3TN0B 4RMTA 5DD6B 1CF8H 2XYCA 1OM3L 4HUMB 3KPQB 5F9OL 3ABZA 3PWPD 3PWPA 4UQ2B 4OCMC 3W2DH 1NAMB 4LASL 3VG0H 2XACC 3CSYA 5B8CA 2HLAA 2R4RL 3FZUD 4LKXA 2BERA 5IG7A 3WV0A 1CDJA 2Z31B 5F97E 2EYRA 3H3BC 5JW3L 1A7NL 5I2IA 3VGHA 3QUXD 3QUXA 4RX4D 2E9JA 1WC7A 3GMLB 4RX4A 3KHOA 1NFKA 1YNLH 1XGPA 1WFTA 1FNEA 3KPPA 4YDLB 2YWZA 1A3QA 2VQTA 4G6AC 3AS3A 1A6PA 5SWQA 1RUPL 1I8IA 1UEMA 4X4XB 4GJTB 3MCKA 4EUPG 3DUHA 4NC2B 4F15C 4QHNA 3QIBD 3QIBA 5CILL 4J23A 4JFDE 2Q20A 4IHOB 2YD1A 2H2PC 4LCCA 1OB1B 1OP9A 5L7XL 5FGCE 3WDIA 1K4CB 2IPUK 4H8WH 5IR1A 1S7TB 3SE8L 1B6UA 1JRHI 1JFQH 3F7VA 2CKBB 3HI1B 5KJRH 2EXWC 1FFOB 3I9GH 5BVPL 2WWMC 3GUTA 1IAII 1WIUA 2X4SA 4F8QA 1D7FA 2EDFA 2PR4L 2Y23A 2XWJB 3FB8A 5IMLA 3IDNB 4XVTH 3L3OB 1B9ZA 4H25A 3TA3A 3NPSC 1U42A 5HI3D 1KG0A 5J0BA 2DJ4A 5MERB 1TITA 1J1OL 2R29H 4Y19E 5HHQA 1MCOH 1HHHA 3KPSB 1F45A 1XAUA 2D4DA 4U0RB 3H6JA 4P46C 2FB4H 2YHGA 2IAND 1T6WA 2IANA 4FOMA 2ZCHH 4AEIL 1EJOH 2HT3D 4NN7C 1ZE3C 3C5SA 3U7WH 1GPOH 1H5BA 3I6GB 5IW6A 4FP8L 1BFVL 3DSNA 5GGRB 4HPYH 2CUIA 1LE9A 1CFVH 5HYFA 4FQHB 1G7LB 1YUHA 3MQIA 4O4YL 1TNNA 4GAGL 5F6HJ 1NCDL 4IBLT 1O7SA 2F5AH 1LDPL 3MUJA 5C7XH 1QACA 2YBRB 3OSKA 4L4VD 1U95A 3MLUL 4L4VA 4XCEA 4F2MB 3GMQB 4KTDL 5AG9A 5K9QG 1E6OL 1JHTA 4OGXH 1D5BA 4NSKB 3VXNB 4P3CH 1ORSB 5GRZA 2GJ6D 4UNVA 4GRWB 2GJ6A 1G1CA 1XH3A 4UINL 12E8H 4XHJC 5IMMB 1TENA 1IC5L 3LPGA 2C1OB 4WI9A 4A6YA 4PBWD 4QXUL 1CYGA 4OJFH 1BP3B 1MY5A 1XF5A 1LEIA 3LHPL 4OGZA 1SM3L 4HQQH 1TQCC 4KI5F 3ZDZF 1MPAL 2EYTA 5HHME 5K9JL 5EBMB 4JN1L 1CDUA 3PWLA 5F3BA 1QEWB 4ZS7L 1MRFL 5EA0L 4ZQKA 3SDCB 4PS4H 3UJIH 3O6KH 2BNQE 3OKDA 5KW9L 4MNGB 3MRBA 3QA3B 5FYKD 3IU4L 2VAJA 2XTJC 2MQCA 3O0RH 4PJ7A 3UPCA 1S9YB 4MSWA 1QP1A 2BSED 4NZTH 2ORBL 5TE7L 3H3PL 5IQ7L 5DWUH 1N6UA 1S9VB 3RGHA 3NAAL 4LSQL 4X7DC 2HH0H 1JTTA 4ZPVB 4KUZH 1U3ZA 3GIVB 2VXUL 5JPNA 3SO3B 2H8PA 3KYKL 5GQBA 1HN1A 1EZVY 4H1LH 2IADB 4OIIH 2HJFA 4MQ7B 2ADJA 4Z7NF 5J11C 1TPXB 2ADFL 3PF2A 1M6OB 4PLJD 1RZFH 2J8HA 4LHUD 3UEZA 4LHUA 4NZRL 1OSPL 1J5OL 1VGEH 4FFWD 2UWEA 4EI6A 4AG4L 1G7HA 1TJGL 4TQEL 3WNOA 1YMMB 4LAQL 3O41A 5IHZB 1X5FA 4HXAL 5HYQB 3DETC 2CGRL 1HYSD 4K3GA 4I5BB 1AQKL 1R5IB 3S3SA 5KZCD 1DSFH 2X89A 4WCYL 3UJTH 1A1MA 1RUKH 4MAUH 4LLUB 4HKZA 4YXLH 1P4BH 4ONFL 3JV0A 3I85A 4U1KB 2Z9TA 4S0TD 3CNKA 1HYRC 5H37H 5JHDE 2ZSVA 4MXVE 2GTWB 1MAMH 3HC4H 5TDOA 1YMHA 1U0QA 2DQJH 2J6EL 3L6FA 1S8DB 3QJFB 2AXHA 3L3IA 3SE9H 5J4MA 5EO9A 4YHLH 1GC1H 4NO0B 4Q7DA 3DX6B 2PKDA 2AKRA 5D70H 1GIGH 4CU6A 3TO4D 3TO4A 1N59B 5TPWH 2HTKD 3PV7A 1VERA 4WUKL 4GUPB 4PGDA 1T2JA 2VWEC 4Q9QL 2XKSA 2R9HC 3L7FA 2Z92B 5DQ9A 5A3ID 5DHYB 3F58H 1AP2A 2HN7A 5IVNA 4JFQA 5TH2A 3QUYD 3QUYA 2VDQL 4KZEH 5I8EB 1VPOH 2C7UB 3QFJE 1XGYL 5DVMA 1A14H 4JFED 5HHOD 4JFEA 2QJDA 5C0CD 5DD1H 2DLFL 4HAFA 4KDTC 2K7QA 5CD5C 4FHBD 2ERJC 3S8WA 4S0SD 4U1JA 3WEXA 1A0QL 4J8RA 2DQHH 1S7SB 1I7UA 5LAXA 3HAEA 1G7QB 1PKQA 2LTQC 3DV6B 5E9DE 4WI3A 4HKXB 2X41A 4NHUA 1JI1A 3TFKC 3PWPB 1U8OB 2KUTA 3M07A 5EOCL 3CSYB 3O3BB 2HLAB 4UV7H 4LKXB 3GNML 3MO1A 5DFWH 2P8PA 1LO3H 2YPLD 2E6QA 2YPLA 3ZTJH 2EYRB 5I2IB 3QUXB 3WNNA 1IAIM 3KNBA 3RZCD 1XGPB 1CXIA 3KPPB 3QEGH 5SWQB 3IRPX 1N0XH 1I8IB 3CU1A 3GO1L 5MP6H 5T5FH 1G9NL 1L9MA 1CXEA 3MCKB 4PRAB 5HXMA 3LKSA 1D5IL 2PCPA 3QIBB 4LCCB 3QUMH 1B2WL 1OAUL 4DGIH 2R4SH 5IR1B 4P4KC 1ITCA 1KCKA 3F7VB 2QSTA 3QXUA 1AD0A 4AH2A 3B2VH 5BV7L 4OFKA 5ACZA 3GUTB 3P77A 3FB8B 5IMLB 3CFBA 4P23D 4G8IA 4H25B 4G9FE 5L2KA 3O3EA 1KG0B 2VXTH 1U8KA 1UWEL 4GG6A 1P4IH 1MJ8H 5HHQB 1HHHB 3ARZA 4OD3H 1Z9MA 4D0CA 1QR4A 4UIKH 4MYWB 5GGQL 1RJLA 5J13B 2J4WH 1BZ9A 3I02A 3U48A 2EIEA 2IANB 2A6IB 4KHXL 3H2WA 4OLXH 4NKQB 3T2OA 3C5SB 1H5BB 4JKPL 5J6GB 3WFDH 4MD5B 3U9UA 2FJFA 5J12C 4JZNA 1LE9B 2AXFB 1GGBL 1YUHB 4TSCL 2XN9E 3NCYS 1FNHA 5CSBA 3STLA 4XCEB 4L4VB 4DK3A 4JM2D 4DEPB 1FGNH 1JHTB 4JM2A 5AZ2H 1D5BB 5IVXA 5IFHL 5ID1B 2GJ6B 4EDXA 1XH3B 1DANT 3RL1A 2BRQA 3P3YA 1UM5H 2FZ3A 4L9LC 2MQ0A 2EEDA 3L5IA 4XBGA 1KULA 4A6YB 3H7BA 4F8TA 3NH7H 3QULA 4BK5A 4OLEA 1XF5B 3H9SE 1LEIB 3KS0J 1H8OA 4JGUA 1JNLH 4XP5L 5KVEL 5HI4D 2EYTB 4GW4A 1EFXD 4IOFD 1EFXA 5I1GH 4R4ND 4Z7VF 3PWLB 4YXHL 5BJTB 1U8LA 4OLWL 3UTZB 2QHRL 1RV6X 5HSFA 3ARSA 5IM7A 4ZQKB 5T1LA 1EAJA 1ZWIB 1X4YA 2ZUUA 3PXHA 3EJYC 4U3XA 1E4WH 1T5XA 2WBWB 3OKDB 4P9HC 2B4CC 3DBXA 2A9NL 5C0BA 3A6CH 3THMH 2FJGA 4MSWB 4QRUA 2KKQA 3U4AA 2V2TA 3ULVF 1WZ1H 2ZPKL 5MEQB 2VL4A 3PHQA 1ZEAH 5ELIA 4MJ2A 2AGJL 5JPNB 1ZA3A 1J05A 2H8PB 3DPBA 1DTUA 4KKLC 3C9NA 1QHPA 3QDAA 4XMPL 4LCWE 3RIAK 4HWBH 5ITFA 2D7MA 4F9PC 3FAWA 3RIAF 5DFVC 4Y5YA 4UZGA 2JLLA 2FDBP 1PFCA 1IMHC 4LHUB 4I3SH 4RMSA 4LLDA 1K3IA 4R90H 3LZFH 5DO2C 3HC3L 7FABH 3NGBB 3PIQB 3TPKA 4Y4KD 4Y4KA 2UWEB 4YBLC 4NNPH 4EI6B 3LKQA 3ZKND 3HRPA 3O6FC 3MRRA 1J1XH 3O41B 1IGCL 3DARA 5FM5M 2FGZA 3QQ4B 1YPZB 4WWID 2XKNB 2CQVA 1TNMA 4G8FB 5KZCB 1JZ8A 3ZKQD 2VN7A 1A1MB 1UXSA 3LMJH 3N9GH 1FSKB 4HKZB 4L1DA 3W11D 4P2RE 4UB0L 2A77H 3FQRA 3MODH 4XPTL 4FFVC 5AYQA 3IFNH 1JNHB 1CF8L 1BVLA 2ZSVB 5TDOB 4NKOA 3W2DL 1JPSH 3HE6A 1YMHB 3KYMB 3VG0L 3V8CA 3N85H 1DQLH 2DJUA 1UJ3A 4OCRH 3L3IB 4ZFZA 3C2AH 5EO9B 1RK0A 1FFPB 4FQCH 2IBGA 2ZUQB 3LCYA 2R1YB 2LE9A 4GLRH 2AKRB 1YNLL 5BZDB 3MPCA 3OGCA 3TO4B 2COQA 4OZHE 1K85A 4PGDB 1WZMA 3TC9A 4DTGH 4L8CA 4KU1A 2P5WD 2Z0BA 3L7FB 2P5WA 5DQ9B 3UZEA 3VXME 1RAMA 2Q8AH 2YD9A 4FABH 3D85D 3D85A 3GSNH 1AP2B 2HN7B 1IAKA 2EDOA 4RSVA 4JFQB 5TH2B 3QUYB 4H8WL 4I8DA 5AEAA 2YA2A 2A6JA 3WE6B 4YHNA 2HWZH 1JFQL 4X9HA 2GYSA 5KJRL 4ZS6D 4JFEB 5HHOB 3I9GL 1JTOA 5C0CB 3ARVA 4PJEA 1B88A 2NZ9C 3WIFA 3D25A 5SWZD 5SWZA 4XVTL 3R8BB 3O6LH 4U1JB 1A4JA 5ETUB 3MV01 4J8RB 4X0KB 5F9AC 2R29L 1MCOL 1I7UB 5ICXA 5I66A 3VXSD 5LAXB 3HAEB 1PKQB 1F3DJ 2FB4L 4OF3A 1QRKA 2ZCHL 4ZFFA 3PL6D 4X6CE 3PL6A 1EJOL 1Q94B 4PGCA 1MCKA 1UC6A 4NHUB 3U7WL 1GPOL 4MCYA 3GJFA 5F7MC 4HPYL 5F21B 3DOSA 4WI5A 3LDBC 5IBLD 4LP4A 1CFVL 5F1NA 1K8DB 4HCRA 3MO1B 4IIQA 5CP7A 2P8PB 2F5AL 5AD0B 5C7XL 2QADC 2XQYG 3MRDA 2YPLB 4NUGH 2OI9B 1J0KA 2MFNA 4QT5A 3BE1H 1J11A 5A1AA 4OGXL 2NW2A 4PJ9C 4UNUA 4P3CL 4Z7WF 3KNBB 3RZCB 4DWHA 12E8L 2F15A 3VFVB 3IETB 4OUOA 3RX8A 4OJFL 5JOPE 3QIWD 3QIWA 3EDDA 3VU2A 2R56H 5C92A 3LKSB 4HQQL 4YEEA 3O3AA 3S37X 3WJJC 1DBMH 3GSQA 1CFNB 3TNNA 4ETQA 4DGYH 2VISA 4K8RC 3D5OF 1CGSH 4PS4L 4ODUB 3OJMB 3UJIL 4HJJH 3O6KL 5C0JA 4AH2B 1R24A 2WZPD 4U6VH 3MGOA 3P77B 4E41D 1U2HA 4E41A 4P23B 4LSTH 3O0RL 3O3EB 2WUBH 4NZTL 4GG6B 2HKFH 1PG7W 5DWUL 2HH0L 4KUZL 5JIIA 1PZUB 1BZ9B 2OZ4H 3I02B 3OZ9H 5GRXG 4L3AA 2BNRD 2BNRA 5D5ME 5BXFA 4IRZH 3VXOA 2FO4A 5EWIH 8FABA 4OIIL 3U9UB 2FJFB 4UUJB 4JZNB 1QFPA 4JKKA 2PW1A 3FB6A 5JDSA 1RZFL 4ENEC 5B39A 1ITBB 5INCA 1FCGA 1NGXB 3STLB 4HHAA 1MI5E 4HX1A 4MJ4A 1VGEL 1MHCA 4JM2B 5IVXB 5F7DB 2CDGA 4LP5A 3CVHA 3L3JA 2ENYA 5J56B 5E24E 4EDXB 5EIIA 1FO0A 5IUSA 3VWKC 2FZ3B 5EUOF 4XBGB 5I0ZA 3H7BB 3I3EA 2R0ZH 3QULB 1ZLVK 2A0LC 5GS0C 1L4IA 3UTSE 3GSVA 4BJLA 1OF2A 2OLDA 1DSFL 2Y6SC 4PPTA 4BUHA 3UJTL 1RUKL 2DI7A 3ARDD 4MAUL 4O9HH 3ARDA 3IB4A 4QXGH 1FV1A 4GW4B 2VR4A 4YXLL 1EFXB 1BOYA 1P4BL 4FMKA 1HHKA 1U8LB 4OM1H 5IM7B 5GGRY 2X1WL 1MAML 3HC4L 2DQJL 4ODVH 4NZJA 3DBXB 1JPFA 4FRWA 3SE9L 4NDMA 3TWCH 4FQXD 3RKDC 4M93C 3UTPD 1XFPA 1MCCA 2FJGB 4YHLL 4QRUB 1IC1A 2V2TB 4F57H 1JHKH 4XGZB 1AI1H 1GC1L 3PHQB 4WFHD 5D70L 1GIGL 3P30H 1ZA3B 1J05B 5TPWL 4DFHA 5IWLC 4RFNB 1DQMH 3ZSTA 1DE4A 3C9NB 1KCLA 4JQVC 1Y0LA 3JUYA 1YJDC 5ITFB 3ULUD 2M1KA 3EJZD 4UTBH 3E2HB 4RAUA 1JPTH 2K3TA 5ABDE 4Y5YB 1RK1B 4DOHB 3F58L 3SO5A 5IEKA 2P5EE 3QR2A 1DEDA 5D6DA 2NR6C 2YD7A 4KZEL 4PG2A 5FK9B 2A74A 1VPOL 3GSOA 4Y4KB 2AQ1A 1OGAD 2D4FA 1A14L 1OGAA 3G6JF 5JDJA 3CMOH 2B5IC 5DD1L 3UZQA 3D1MC 1CD1B 3MJGX 2BVEA 2W38A 1CFBA 5FA3B 5SWSD 5SWSA 4DKDC 3Q0HA 3MXVH 5F9WB 4FQ2H 3BDXA 3VXTA 1GGUA 2DQHL 3DUUA 1YEGH 4QHMA 1HNGA 3DVFA 3VGGA 1UXSB 1FPTH 4JZJA 5C2BH 4W81A 4NC0B 2C1PA 3FQRB 4HJ0C 2ICWA 1BVLB 4U1GC 4WI6A 1SJHA 2F5BH 3VXUD 3VXUA 4Z8FH 4NKOB 4OLYH 1MLBA 4WTZG 1HILB 1QLRB 1UJ3B 4UV7L 5I16A 3VFNA 4ZFZB 4M7ZB 3PDOB 1LO3L 1FZKA 5AZEH 1A02N 1RK0B 2IFFH 1N3NB 1EX0A 1KIRA 4WV1A 2YD6A 4AY0A 1EHXA 3OGCB 3QEGL 5GRUH 4BQ6A 3CDFA 5FGRA 1X5KA 1N0XL 1CVRA 1CICC 3SQOH 5MP6L 1DL7H 1KENH 5T5FL 2VZ1A 1AKJD 2P5WB 5JW5A 4OFIA 3O2DA 1B4JH 3MR9B 4PREB 3U4BH 2NY1D 5JOFA 3D85B 3VH8A 3MBED 4EDWH 1B90A 1FNFA 3T0AA 4JRYE 3QUML 1S7QA 5FGBC 2R4SL 4DGIL 4MDIA 4YHNB 1IGIH 2AV7A 3H0TA 4L29B 4W6YB 1UB6A 1WT5A 2DWDA 3B2VL 4PJEB 4KKBC 4ZFOA 1XF1A 1FIGH 1MLCB 3D25B 5SWZB 1JZ5A 4K7PY 5DMGD 1JNJA 2E6JA 5FHAH 2L7JA 5GRJH 4WIQA 2VXQL 4GQPH 4OFVA 4KDVA 2VXTL 2MWCA 3AS1A 5DC9B 1P4IL 1MJ8L 1MOEA 1E4KC 4LEXH 4OD3L 5ICXB 4UIKL 5I66B 2BNUA 2Q3AA 3K81A 3VXSB 3SDXA 2J4WL 2JJSA 4PV9A 1QO3A 5DS8A 3UTOA 4ZFFB 3PL6B 4OLXL 4PGCB 4KKCD 5DHVA 1KCUH 4MCYB 3U1SH 1CE6A 3WFDL 1HSBB 5IB1A 1ZV5A 2E3VA 5FUCC 3ALWA 4OBRA 1LO4H 5IMOA 4IIQB 2H41A 5L6YH 5IB5A 5CJ5A 2XZAH 4QT5B 5M7QA 1FGNL 4DN3H 1YECH 2IH1A 2NW2B 5AZ2L 5B4MC 1A6TA 4ELMB 4C56E 2XA3A 2IBBA 3TIDA 1EHLH 1J0JA 3TYGH 1UM5L 2CUHA 4BZYA 3SKOB 3LB6D 3NBNA 1FYTD 3NH7L 1FYTA 1T20A 1NCTA 3QIWB 4PTUA 1JNLL 1UXWA 3MGAA 3O3AB 1AC0A 3BN3B 5I1GL 3GSQB 3UC0H 5IEHB 1VEOA 3TNNB 4ETQB 3RDTC 3TBYA 2VISB 2ICCA 2RCSH 4ZO6A 3LH2H 5HVFB 1FG2A 1E4WL 1XIWD 2I27N 1XIWA 3IFOA 5C0JB 4TVPD 3WNPA 4NWTH 3VE0A 3MGOB 4Z6AT 2ZG3A 1G0DA 1I1YA 2V5MA 2OYPA 4E41B 1NAMH 3A6CL 5IBUG 3THML 5FYJH 3VFOA 1CFTA 3EW3B 1WZ1L 1BFSA 3U30B 1CGVA 2DIJA 3B2UD 2R39A 4PG9A 3EUUA 1ZEAL 3E6FA 3ES6B 1JZ7A 2Q6WA 2DM3A 3BI9X 3NA9H 2BNRB 5BXFB 4PJ8C 3ELAT 3K8LA 3C60D 2WIMA 3VXOB 4HWBL 2FO4B 3NMEA 4YLQT 8FABB 4XVSH 5EBWA 3UPRA 4APQC 2PW1B 3BOVA 3FB6B 4MJ5A 5JDSB 5B39B 4MCZA 5INCB 2H2PD 4I3SL 4R90L 4HHAB 3LZFL 5C9KA 4HX1B 5TE4H 7FABL 4F37K 3E3QC 4GT7A 4NNPL 3CVHB 3L3JB 1REIA 5EIIB 5F7EH 1FO0B 1J1XL 5J1AA 1IEHA 4FQIH 4RMVA 1RU9H 3DECA 3CK0H 3X3GH 2VAAA 3GSVB 3ILQC 4PJDF 4OI9A 4PGZA 3N9GL 3LMJL 4BYHA 3ARDB 3EJJX 1FV1B 3BT2H 3O2WH 2A77L 1UWXK 4K9EH 4P46A 1HHKB 4MLSA 3SDAC 2BSSA 3MODL 5GGSY 3BWUC 4HWNA 3IFNL 2H6PA 1MFAH 1LILA 4O00A 3CXHJ 1JPSL 1W0VA 3A0OA 3B4NA 3N85L 1DQLL 2XZCH 4OCRL 1JPFB 3MV7D 2CRIA 3MV7A 3VDCA 3C2AL 4FQXB 1E28A 2I24N 3MV11 1OQOA 4LVHB 4FQCL 4QTHA 3S98A 3VFUA 3V8OA 2DD8H 3EKCA 4ODXA 5I74B 2YSSA 4M8QA 1FFQA 4NM8H 3AS2A 2G75A 4N0YH 3QPXH 2EH7H 1DE4B 3JWDH 4JG1H 4N1CA 4LVNB 5B3NA 4DTGL 1Y0LB 2UZIH 1UQSB 3KPOA 4HMDA 4JR9H 3B9AA 1Z5LB 4PP1D 4D8PA 2FR4A 4RAUB 5JW4Q 2Q8AL 3OAUH 4FABL 1D5MA 1YMME 4X6FA 3GSNL 5IEKB 1R5WB 2CK0H 1KB5H 5IFAH 2HWZL 4MLIA 1MHPH 1OGAB 4CVZA 3GMMA 1P9MC 4M9PA 1OPGH 1T7VA 1HQ4A 3REVA 4LBEA 3WIHA 5SWSB 3O6LL 2XTJD 5I73B 4PRNA 2G2RA 4C57C 2GEEA 3DUUB 3PP3K 1WBXA 1BOGA 1QTYT 1MCPH 5KSVA 3ZZ1A 1QBLH 5I76A 4JZJB 2JB5H 4OZGA 2C1PB 1QFWH 3BP6B 4ZG1A 2ICWB 4YBQC 2DM4A 4N90E 4NBXB 4WUUD 3K4ZA 1T80A 3VXUB 4Y8DC 3S3PA 3CLFH 4MMXC 5FKPA 4LOUD 1T83A 3MUHL 3BVNA 5I16B 3MGTA 3VFNB 2NW3B 5KS9B 1X6NA 1FZKB 3QHFH 4LPXA 3QJHB 4NUGL 4V2BA 3FQXA 3BE1L 2O93L 1KIRB 4WO4C 3CX5K 5BQ7A 4X9IA 2VQ1A 5D2LF 1KIPA 4GFTB 5CMAA 1DCLA 2YRLA 5HHNB 3QUZC 5K9KA 1OTUD 3DETD 1IEBA 3AM8C 4GW1A 1AKJB 3P73A 5JW5B 3SPVA 3RNKA 1EO7A 2R56L 2FEDD 3QSKB 1U2CA 2NY1B 3V79C 5JOFB 4UDTA 3VH8B 1S78D 3KYNB 3MBEB 4IMKA 5EG6C 3T0EC 3MROB 1S7QB 1DBML 4P4RA 5C3LD 4RFOH 4MDIB 4DGYL 5LQBH 2AQ3A 3H0TB 2AV7B 1CGSL 1CZ8H 3R0MA 1G7IA 1BBDH 2R0KH 1QSZA 5GS2H 4HJJL 1UB6B 4M62H 5EOTB 2DWDB 5LJYH 1Z9LA 4ZFOB 4U6VL 1VFAB 5JUEH 5FCUH 3OWEA 5D93B 4QRRD 4HXBH 4QRRA 4LSTL 2VR9A 1F6AA 2AJZA 2WUBL 1KFAH 1UYWH 1FP5A 1R3JA 2HKFL 2KPNA 3HPJA 5IB4A 3R1GH 4W6XB 3SDXB 2D31A 2M26A 5IOPB 1VGKA 2OZ4L 1QO3B 3OZ9L 1EO5A 4PV9B 4XH2A 4ZO9A 5DS8B 3HG1E 4KTEH 4XI5D 5DHVB 3MJ6A 2PW2A 4PRIE 2PETA 3FO9A 3MRIA 4IRZL 4YH6A 3T0XA 1BQSA 1GRWA 3BKCH 4XCYA 3VI3F 5IB1B 5EWIL 2R9HD 2RBLA 2FLRT 1R3LA 3PWJA 2GFBB 4JVPA 3ZT5A 1PEWA 4K7PX 2R2HA 3RBSA 2EECA 4P99A 5DFTA 5KVGH 5IB5B 3FQWA 4J4PD 4JANA 2YPVH 2Y9RT 2IH1B 1A6TB 3DUSA 1KEMH 3TIDB 3WLWD 2X4NA 4KDTA 1KLUA 3EO1A 5CD5D 3PGDA 5L8LB 1KT2A 2R0ZL 1FYTB 3OBAA 1T20B 3O9WC 2BHYA 2BY1A 4NQUA 1UXWB 1D5ZA 2XZZA 4O9HL 1HE7A 4QXGL 4U2ZA 2DQIH 5B38A 4PJAF 1XGTB 3BYYA 1X5ZA 4Z7UA 1TZGH 5D7LA 5D7LD 3BPLC 5I17A 4OM1L 4O2CA 4RBPK 3TBYB 4OF5A 1CD8A 1YDPA 2QQNH 5ANMA 4NM4H 5C07E 4LSDA 3TFKD 1FG2B 1XIWB 3IFOB 1U6AH 5CJQH 4ODVL 3VE0B 1XGRA 1I1YB 3L7EA 3TWCL 1CN4A 1F2XK 4L8BB 3VFOB 1BIIA 1CFTB 3SKMA 4PRHD 4PRHA 4X5LA 4F57L 3ZE1F 1JHKL 1AI1L 4PG9B 3E6FB 3IDYC 3P30L 4PJCF 3ZE2E 5DD0H 2Q6WB 2X4OA 4ZPTA 5LGKA 3VRIA 1DQML 4KUCD 3TBWB 3C60B 1NEZA 4YC2C 2X1PA 3BEWA 4UTBL 1YEHH 1JPTL 2JK5A 5EBWB 3UPRB 4F15B 4MJ5B 1FVDA 4MCZB 4L4TE 3QCTH 5FYLE 3DNKA 1U91B 1NEUA 4P4KD 4P4KA 4H26A 3PP4H 4Z7QF 3FFCE 4PRPE 3FB5A 3CMOL 3RPKA 5SV3A 4MHHG 4YK4B 5J1AB 5DGQA 4M6NH 3MXVL 3K8KA 1AR1C 4FQ2L 3ARFC 1G9NC 4HIXH 5DRZA 4EZMA 1FNLA 5ISZD 1ZGLM 5ISZA 3RUGE 1Q0XH 2WWKO 3UO1H 4PJXE 4CVUA 5ICZB 1YEGL 2L4OA 5CWSA 1FPTL 1BVZA 5C2BL 5DYOA 1A7BA 2BSSB 4B41A 1O7VA 5FYKE 4NN7B 3RKPA 1FIEA 1KV3A 1U93A 2D7QA 3QRFM 2F5BL 4Z8FL 1Y6MR 4OLYL 5BV7C 5I1IH 1KPUA 2JB6A 1EAPA 2HLFC 3WUZA 3NIDF 3MV7B 4PJFA 3MTRA 5I9QC 5FKAA 3FQUB 3CFCH 1E28B 3JVGC 5AZEL 2DQDH 1CQKA 2IFFL 4ZD3H 2X9YA 3VFUB 2ZOLB 4ODXB 2YSSB 1U3JA 1GOGA 4L9LA 5GRUL 2G75B 3ULVD 4I0PC 1H0DA 3S35X 2IFGA 3SQOL 3HUJF 1DL7L 1KENL 3KPOB 4NNYB 3IFPA 4D8PB 2W9LA 3KYAA 1EO8H 1OT1A 1B4JL 4P5KA 3U4BL 3VGAB 3VGEA 4EDWL 4X6FB 2VKWA 3DIFA 2O61A 3QDHA 1RZ8A 4WI2A 1IGIL 1I4FA 1YPZE 3VGFA 4I77H 3SN6N 2IBZX 4CVZB 1G7PA 3GMMB 2XXMB 4YDVA 1ZMYA 4MWFA 1FIGL 1NAKH 1HQ4B 3REVB 1T04A 2FLBT 3EIFA 5FHAL 5GRJL 4C54A 2XTJB 4JFFE 1Q9OA 4PRNB 2G2RB 1WBXB 4LEXL 1FCCA 4LK4A 5FYKH 5KSVB 5I76B 3ORJA 3RP1A 4W4OA 1D6VH 4OZGB 4ZUSB 5CZXD 5B3JE 5DJZA 2BJMH 1S7XA 1I3GH 4PY8J 5CUSH 3X12A 1GGCH 4ELKA 4KKLD 1KCUL 2V7NA 3K3QA 3U1SL 5T3XE 4WUUB 1AJ7H 4F9PA 5C86A 3MLSH 5J11B 1HDMB 1LO4L 5D7IF 3AROA 3MJ7B 5L8KB 3Q2CA 3BVNB 3MGTB 5IW3A 5IFJA 5C08D 1Q9LA 5C08A 3EOAA 5L6YL 3T08A 2XZAL 5EU6D 5EU6A 3MREA 2AQ2A 5J06A 4DN3L 1YECL 5BQ7B 1Z9OA 1KIPB 5CMAB 1EHLL 3BGMA 2XIDA 3TYGL 5KAQG 1IVLA 1Q9WA 5K9KB 4K23H 1IEBB 4EN3D 2H45A 3LQAH 4EN3A 4GW1B 4X98A 3P73B 3GMOB 3H9HA 3SPVB 1P6AB 3RNKB 5D1QC 2QV2A 5HHOE 4UDTB 3FO2A 2C3VB 5C0CE 3O3DA 4Y16C 1R0AH 2FSEA 1MQ8A 1ERNA 4OZIF 1I1AD 4P4RB 3SGEH 3PWUB 3UC0L 5DHXB 5FUOH 2RCSL 4KK8D 3LH2L 2BSRA 2UUDK 1TDQA 3D0LA 4I2XE 3WNKA 1ACZA 4NWTL 4LMQE 1JE6A 3D48R 5DZNA 1HWHB 5E6IC 1NAML 4QRRB 5HVGB 1F6AB 5FYJL 1R3JB 1MIEH 3QDGD 3MJ9A 4DK6A 1YEFH 5IB4B 5T3XH 1II4E 3BP5A 4DZ8A 3I3DA 4XH2B 4YAQB 4FQQA 1KGCD 3NA9L 4HIHA 4NKDA 2PW2B 5F70A 3FO9B 3MRIB 1DUYA 3P11H 2HRPH 5GS1C 1WIOA 4XCYB 4LPWA 2PYEA 2GSGA 5LCVH 4LGSB 3PWJB 4XVSL 2R2HB 3IKCA 4R4BA 1ZANH 4Z76A 2VB5A 5FO8A 3FQWB 3GSRA 3HZKA 2OP4H 5TE4L 4N8VG 1YQVH 1Z9SA 1ETZB 1T7XA 4N0RA 4PGJA 5DEFA 3I3BA 3EZ8A 5F7EL 4POYA 2X4NB 2NZ9D 4FQIL 3TBSB 1KLUB 4HFWA 1T22A 1KT2B 3UTTE 3FCTA 1RU9L 3CK0L 4GXVH 3X3GL 5CBEA 1CS6A 4UI2A 4IM8A 3MV8E 1JN6A 4GW5A 4LSSH 5BRZD 3BT2L 3O2WL 3IF1A 1RZJC 3DX9A 4P48A 5B38B 5HBBA 4K9EL 1B0WA 1N8ZA 1IILE 4H8WC 1ZVHA 5D7LB 5I17B 3WXWH 4O2CB 4MA7H 1ZSDA 1PX3A 4FN0A 4UOW1 1MFAL 4OZFA 1T0NA 1YDPB 4XVUC 5ANMB 1JGEA 1UG9A 1JL8A 1MCFA 4GRWF 2LVEA 2EE3A 2XZCL 1L7IH 5F3HA 4X6DF 3VDAA 1XGRB 1VEPA 4BZ1H 3L7EB 4RIRA 2EO9A 2O26U 5CLWA 2AK4D 1BIIB 2AK4A 3SKMB 4PRHB 5EBLA 2NX5E 1R3HA 3OG4B 2DD8L 4HJGA 2FIRT 35C8H 3G5YA 4NM8L 2X4OB 4ZPTB 4K3HA 3LRSA 3P9MA 3VRIB 4AIZA 4N0YL 3QPXL 3VFGH 3DRTA 2EH7L 3JWDL 1L7TH 4JG1L 2P43B 1NEZB 5ILTH 5J89A 1XF4A 1MAKA 2UZIL 2HMID 4JR9L 3BEWB 3PE9A 1QUNA 4LNVA 1U8HB 4JCMA 1PQZA 2HKHH 4Y5XC 3OAUL 1FVDB 5JR1H 3N1GC 5I0DA 2CK0L 1NMAH 4MDJB 1KB5L 3OPZH 3WJJA 4OLUH 4NNXA 1QNZH 4JO2H 3HB3C 5IFAL 4P4KB 4YHPA 3OMZA 4H26B 1HCFX 1MHPL 2C3WA 1MY7A 5HDBF 3FB5B 2W91A 1OPGL 3P0YH 3QG6A 1HKLH 5EU3A 2DQCH 4QRTB 1CLCA 4XNMA 5ISZB 2VE6A 1ORQA 4A2MA 3QZWG 3DHJA 5EO0A 5HPOA 5EU7E 5EUOA 2NLJA 1MCPL 1QBLL 4O2EA 3DURA 5CWSB 5DYOB 2JB5L 1AY1H 4U4BA 5I71B 1QFWL 5HD8C 1SMOA 4TTDC 1U93B 43CAA 4IRSC 4CN4A 4J3WA 3CLFL 1CTOA 3S34H 3TJEH 1KPUB 2JB6B 3WS6C 3ARTA 4PJFB 1VSCA 3UBXA 5FKAB 5E2JA 1H9VA 4GG8A 3QHFL 1H3TA 5DQDH 5GRVK 2QQQA 1G84A 2OTUA 3RY5A 2P1YA 5MI0B 1J18A 4LLWB 5GSRB 4L9LB 5E8PA 1H0DB 3NFPA 4P9MH 3RWDA 4U1MA 2A0LD 1GAFH 2IWGA 4NOBA 3IFPB 5J7CC 1S9XA 1NANI 4P5KB 2Y6SD 4OD2B 3VXPA 3MNWB 3U4EB 1GGIH 3VRLE 3W82A 3IXTA 4OZ4A 3DIFB 4XPBH 1JYWA 2O61B 4IS6A 4GMTH 4FQPA 2EEAA 2CIIA 2J1KA 4RFOL 5LQBL 3OKNB 1I4FB 4KV5F 2R0KL 1BBDL 2E7HA 1ZT4A 3F62A 1AO7D 1BWWA 4M62L 1AO7A 2DF3A 4WGWB 1A1NA 5GXBB 4YDVB 4MWFB 3BJLA 4HULB 5JUEL 5FCUL 3ARBD 1ZT1A 1T04B 4HXBL 3RKDD 3NCCB 1KFAL 1UYWL 1Q9OB 4HD9A 3QNYA 4NO3A 3RWFB 3R1GL 3FN9A 2B20A 3OXRA 2Y72A 1YC8A 5EZJB 1I8LC 4OM0H 5J9PA 5DJZB 4KTEL 1S7XB 3QDMD 4LL9A 3QDMA 3W0WD 3W0WA 4TTGA 4NCDA 2V7NB 2W92A 5CEZD 4WHCA 4JQVA 3BKCL 3DRQA 1SBSH 4ESKA 5ECJE 3B83A 5KVGL 5IFJB 5C08B 3EOAB 2NR6D 5EU6B 3MREB 1GC1C 2YPVL 3BRDA 1KELH 5D7JD 3QDJE 5D7JA 1KEML 1MQKH 3BGMB 4U1HB 4U33A 3GKWH 4EN3B 1CLZH 4OLZH 2ZUYA 1W72A 3V6BR 4KXZI 3RHWF 4U0QB 1D9KD 3SE3A 1D9KA 5IKCA 2PUQT 3FO2B 1NCWH 2DQIL 3O3DB 3Q5YA 1AGBB 4M9OA 4ZAKC 2FSEB 3V6FA 1TZGL 1I1AB 4HJ0D 1QYGH 2RB8A 3EFFA 4FQLH 1XMWA 5E95B 2QQNL 2BSRB 4NM4L 3D0LB 4HC1A 4XAWH 1U6AL 3AREC 4GAFB 5CJQL 3TNMA 1GXEA 5F7KC 3VXSE 4I0KA 1OAZH 2OR8A 3ARRA 3TZVC 3ULSA 4ZO7A 4PY7B 5K59F 4K55A 2YA1A 1CDBA 5ERWA 3TBVA 3QDGB 5TDNB 4X6BA 2B1HH 5IV2A 3SGKC 1FN4A 1PEZA 4GMSH 3QEQE 4S10A 1DZBA 3BP5B 5DD0L 1U8QA 3UYPA 4FQQB 4I13B 5DJ8A 4HIHB 1INDH 4NKDB 1DUYB 1CE1H 3VG9C 1CICD 5I1DB 1CICA 1AXSA 3K2UH 2EDNA 4G8GE 4W4NA 4Y1AE 4CAGA 2GSGB 1YEHL 5C09A 5IHUH 1NGQH 4MXQD 4S1DD 4ELME 4QLRA 4TNVF 3MV9D 3MV9A 4Z76B 3GSXA 3QCTL 5HGAA 5FO8B 1WWWX 4WHTA 1FC1A 3HZKB 1M71A 5FGBA 2VLME 3F8UB 4HAGA 4EBQH 1ULVA 3LD8C 4AT6A 3VI4F 3WIIH 3PP4L 3RVVC 4J3TA 5DEFB 1BQHG 4KKBD 2W9DH 5DJAA 4HFWB 1T22B 4M6NL 5EZIH 3T0DA 1DEEA 3FCTB 4HIXL 3UO1L 1Q0XL 1LNUA 4BKLA 4R4FH 4LCYA 2F54D 2F54A 1E4KA 1JN6B 4GW5B 5BRZB 1IQDA 3IF1B 3DX9B 4HKBA 1VFOA 1C5BH 1PDKA 1E4XH 4WY7H 1ZSDB 1MCIA 3F7YA 3AB0C 2X4TA 4FQJH 1T0NB 3MRLA 1A7PH 5EU4A 1JGEB 5I1IL 5EC2B 3LDBB 5F3HB 4P2OC 2A1WH 3V4UH 3CFCL 4Y7MA 4LU5H 2DQDL 2BC4A 2AK4B 2V5RA 4ZD3L 5JO5A 5DT1H 1R3HB 3SQBA 1WFUA 4HJGB 4M43H 3G5YB 4X8XA 3DX8A 1UACH 2LAAA 3LRSB 3P9MB 4AIZB 5C0AD 4YDJA 3DRTB 2A9MH 5C0AA 4PJBA 3C8KA 2QBWA 4HV8A 1XF4B 1QOKA 5E56A 2AI0H 4P57A 4JG0H 1EO8L 1PQZB 2NQCA 2BRRH 1VADA 3E1F1 2CK2A 4F7MB 1EEQA 3GB7A 5F1OB 4NNXB 4MX7A 4PJ7F 1EA9C 1DBBH 3RDTD 5E8NA 4YHPB 3RDTA 3MZGB 5JQHC 2CXGA 2BHUA 4I77L 1A9BA 3SGDI 2EXYD 3BN9C 1ZGLP 1NAKL 3QG6B 5EU3B 1CFQA 1WK0A 3HKFA 4XNMB 2MCG1 2VE6B 1ORQB 4G6JH 5EO0B 5EUOB 2NLJB 4E5XA 4N9GA 5FYKL 4JZOB 4O2EB 3DURB 5F9DC 2DQEH 2OBGA 1D6VL 2UY7A 1H3VA 4ODTH 2BJML 3T65A 1I3GL 5CUSL 2ZKHH 1J8HE 1GGCL 1IGJA 4PJDA 3NN8A 5E4IA 4PJ8A 3SBWA 3UTPE 4F80A 5IW1B 1AJ7L 2UWEF 3T2NH 1LP9E 3MLSL 1OAQH 3B5HA 4APQD 4APQA 2JJWA 4KKNA 2D03H 4RQQA 3UBXB 4GG8B 2MCPH 5CFHA 5E7FA 2M8XA 1U8MA 2AEIT 3BX7C 2H9GB 2OTUB 2QQKH 2VDOH 4AQ1B 4KQ3H 5IMKA 5E8PB 5HYIA 3U46A 2AW2A 3CVHH 2X1OA 3NFPB 4K23L 3RWDB 4U1MB 1FO0H 2ITDA 3LQAL 2FX8H 4G5ZH 5E1AA 1S9XB 3ILQD 3RJDA 3NPZB 5I8KH 4KJQC 3VXPB 3HE7C 2X09A 4OZ4B 1R0AL 1EIBA 4JPWH 4I18C 2JJVA 5C0EA 3SDAD 2HVJB 2CIIB 3SDAA 5FUOL 3Q5OA 4Q9RH 4LFHD 4Y4HC 1PBYA 1ZT4B 1TJHH 3L1OH 4R3SA 4E42A 1AO7B 2E7BA 4OCLC 3VGBA 4JFOB 1A1NB 1LO2H 1BHGA 3CLEH 1ZT1B 3ARBB 4HUNB 4N0CC 4TUJA 4YO0B 2JIXD 1MIEL 3IDGA 3QNYB 4HUUA 1P5UA 2HFFA 4MA1C 4NO3B 3KPRD 1YEFL 1B6DA 3TESA 1YNTA 5T3XL 2FNBA 3OXRB 4MNQD 4MNQA 3VCLA 2HVKA 3G08B 5J9PB 2I07A 5GSVA 3QDMB 3SE4C 3W0WB 5DQJA 5KS9E 3P11L 2R0WH 2HRPL 5IROC 2WNGA 3HNVH 5CS7A 3BP4A 3KLHD 5D96B 3DRQB 4Z0XA 5LCVL 3WN5A 4L3ED 3GRWA 4J1UA 4L3EA 4U1NA 5I8OH 2FH8A 3ULUH 1ZANL 3L3HA 2RGSA 5GZOD 4NJAH 4POUB 2OP4L 2BY3A 1CL7H 1YQVL 2XA8H 4QOKE 4BA8A 5D7JB 2VC2H 2VABB 3WMSA 5D8JL 5BMFH 4KVNH 4XWOC 4GKNA 2BOCA 1X5LA 3G5VA 4GBXC 1HEZB 4GXVL 1RY7B 1IM9D 1W72B 2IMMA 2WAHA 1D9KB 2YRZA 5IKCB 4LSSL 1PGRB 3H9YA 3TBTB 1FAIH 3OR7A 5LGHH 3V6FB 5E8DH 1KIUA 3WXWL 2CR6A 4MA7L 4XCNA 4I48A 4PB9L 4U1GB 4K07A 2X4QA 1A9EA 1CBVH 4N5UA 1L7IL 3B6SA 4UIMA 3SDXE 4BZ1L 4OCWH 1RULH 1NBVH 4PJHE 4PLKC 3ULSB 2C4FU 4NQED 4NQEA 4R2GD 1CQYA 3HZVA 3HA0A 5ERWB 1AQDA 4WO4A 4X6BB 5IV2B 2W60A 2DQUH 4FNLH 4H1LG 4R7DA 2FX9H 35C8L 4BSJA 1U8QB 2K9UA 3VFTA 2A73B 5DJ8B 3VFGL 1L7TL 2Y25A 2EICA 3OR6A 5I1CH 5ILTL 1CICB 1AXSB 1FL6A 5DSCA 3M1BA 3AM8A 5F9JB 2GAZA 2N4IA 4QY8A 2HKHL 3REWA 3TT1H 2DMKA 2WUCH 2VDMH 5JR1L 1JCKA 3KLDA 3MV9B 3I6KA 4XBPA 5I75C 3GSXB 3JTSA 1NMAL 3T0ED 3T0EA 3OPZL 2H3NA 4OLUL 2P48B 1QNZL 4GKSB 4WHTB 1JTPA 1M71B 4JO2L 2H26B 1FNSH 4GG6F 2NY4C 4AT6B 1NUFA 4LSUH 5JXEC 2IPTH 4K94H 1UT9A 3P0YL 2KQMA 1HKLL 2EDJA 4XNQA 5DJAB 4YR6A 1DQJA 4OF7A 1DEEB 4KZDH 2DQCL 4GRMA 4DCQB 1LNUB 2OS7A 5ESAA 4LCYB 1C16B 2F54B 3L3DA 4M6MH 3BUYA 4KROD 1IQDB 4XC3H 2ESVD 4HKBB 2ESVA 1C08A 2GI7A 1AY1L 3MFGB 2IALA 4JFHD 4QRQA 1LK2B 3AAZA 5ICYB 5I6XB 2X4TB 3MRLB 4JM2F 4KVCH 4UILH 5EU4B 5IVXF 4PJAA 3UBXI 3S34L 3TJEL 5HTSA 4RRPG 1ED3A 2J88H 5D7KE 3I2CH 3KPTA 4MJIA 2BC4B 5DQDL 4F58H 3WUWG 1U8PA 2X2YA 4R6UA 5JO5B 1OW0A 4XNZC 2J12B 1HSAA 3FQTA 4WU5A 2G9HA 4TNWF 2CH8A 2Z35A 2R1XA 1I1CA 2QSCH 3DX8B 3OJ2C 4YDJB 5C0AB 1SJXA 3C8KB 4P9ML 4HV8B 3ZO0A 1GAFL 3O9WA 3STBA 4DJMA 1WUNT 4P57B 5DEZA 1QSED 1QSEA 4X4YB 1GGIL 4RMWA 1VADB 5I1AA 5D4QA 2JCCE 4XPBL 1HZHH 5E5MA 1F8TH 1PYWA 4NUJB 3WO4B 1BD2D 3GB7B 1BD2A 4GMTL 4MX7B 5DRNA 5E8NB 3RDTB 2BX5A 4U2YA 2BY2A 5F6HI 1F4HA 5HDQH 4BH8A 4N1HB 5L0QB 5A16A 3HI6H 2V9TA 2ED8A 1OY3B 1DQTA 4KPHH 2ZJSH 2FD6H 2DL2A 5MEND 5MENA 2AXGA 4TVPH 1V7NH 4Q97A 2WQ8A 3BPOB 3PNWA 4RAVA 3SGJC 4QKXB 4WHYH 4KI5E 3ZDZE 2X4UA 4E5XB 5D72H 4M1CD 2IEPA 5HHPA 1YEEH 3RFZC 1Z6JT 4OM0L 3T65B 3MV7E 2BSTA 4PJIA 4PJDB 3NN8B 2QLVB 4DN4H 3VA6A 3OL2A 1SBSL 1UM6H 1WEJH 3MLWH 2FJHA 2Y06H 3ROOA 1OT2A 1DLFH 3ZTJG 4APQB 2YXFA 3JZ7A 4JO3H 5HPMA 4RQQB 1H3GA 3RVXC 3B9KC 1PKOA 1F13A 2HG5A 2NYYD 1R6VA 1U8MB 3OG6B 1KELL 4Y89A 5JQ6H 1WGOA 4KY1H 1DQDH 1MQKL 3IAQA 1DBJH 3V5KA 4AL8H 2F53E 4QWWC 5IMKB 3U46B 3UYOD 4HK3N 3GKWL 2A2QT 4Z7NE 1CLZL 2Y07H 4OLZL 2BVPA 3DX7A 2IC2A 5E1AB 5BS0A 4H0HB 4X9FA 1G7MA 1NCWL 4EXKA 3DVNB 1JGDB 4Y8AA 4BUGA 3ZKSD 2PO6D 3SDAB 2PO6A 1R5VA 2GK2A 4M5YH 5SX4I 1QYGL 4FQLL 1A4KB 4F9LC 1MCNA 2OCFD 4R3SB 2Y36H 2KL6A 4E42B 3QH3A 4EVNA 1EGJH 4XAWL 1GOHA 1KJ3H 4QRPE 5D5MF 4WWKC 4YZFF 3D39D 3D39A 1OAZL 2OX5A 4MD0A 1Z0NA 5IQ7H 3JVGA 4TUJB 1U36A 2NY6C 2JIXB 4PV8A 3IDGB 5LVEA 4HUUB 4WUUE 1MIMH 2B1HL 4GOSA 2HFFB 4ETYA 3DROA 3KPRB 1KF9B 5T5NG 4GMSL 3T3MF 4MNQB 3VCLB