5EIVA

Crystal structure of complex of osteoclast-associated immunoglobulin-like receptor (oscar) and a synthetic collagen consensus peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
181
Chain Sequence
b'HPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osteoclast-associated immunoglobulin-like receptor
publication title Structural basis for collagen recognition by the immune receptor OSCAR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 181
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eivA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eivA02
3BD4A 1AKJA 4UUJA 4MLSA 1J1PL 4F15B 4FQ1H 3O4LA 3SJVD 4HLJA 5FB8B 3BEWA 4I2XE 5HI4D 3O8XB 3VFGH 5KVFL 5E7FA 1MI5E 1MLBA 5MHSE 1U8KB 3QH3B 2JB5L 2IAMA 1AGFA 4LP5A 3WFEH 3MXWH 4Q9QH 3RWHA 1Q0YL 4XB7A 1IKFH 3O3DB 5FCSH 1U3JA 4PD4J 2FIKA 3AGVA 2Q76A 3I50L 2K7QA 1P9MA 2RR3A 4J8RB 4LNVA 1Z2KA 4TSBH 1NGPH 3IDJA 3O6FB 4K7PH 1H3UA 3W0WB 1E4XI 1C08B 3SKJL 4JHAH 3KG5A 3L3IA 1GL4B 1SJVA 5HYIA 3BKMH 3VH8B 4BM7A 1F6AA 4NO0D 2R29H 5E2JA 4U3HA 1UXSB 3D39A 5EZJB 3NCMA 3HUJA 2Z31A 4PJ7E 5DYOB 4YEFA 1MSPA 1PKQA 3FZUD 3IDMA 1N5AB 4WI2A 4R2GC 1MF2H 2CLVB 5LJYH 1A6PA 5ITFB 3MNWB 3RPKA 4F7PB 3NACH 4Z77A 1A2YA 4K71C 4Z5RA 2F54E 1TZIB 1XR8B 3EOAB 5KJRL 4X7DC 1DQJB 1P4IH 2DBJA 1A4KA 1FBIL 3BN9D 3LS5L 4HWUA 4DKDC 2APBA 5JW3L 4U1SA 1I8MA 5DGQA 5E2WL 2Q87A 4M1DH 5TPWH 3BXNA 4X6DE 4YWGL 2NY6B 1KXQE 5A3ID 4DAGH 4F9LC 3EFDL 3P9LB 5BRZD 2DMKA 1CGSL 3U4BH 4E41A 2HG5A 4G8GE 5GS3A 3AS1A 5CGTA 3OAZK 2WWMC 3MRRA 3IFPA 4ZDHB 3GO1L 1YUHA 3TBVB 3BYYA 1ZTXH 5HGAB 2I26N 3QA3A 4DN3H 3VXUB 4EN3C 3I6GB 1R3KA 3MJ7B 4QRRA 3WJJA 2WBKA 4X9HA 1RPQA 2R4RL 5DEZA 5IB4A 4X9IA 2BJML 3WDJA 2LE9A 3L1OH 4QXUL 1KSRA 4PJGF 3PWPA 1FNLA 4NKMB 1E4XH 3GIZL 1E27A 1LO5B 5FYLD 4U1MA 3TO4B 3WMSA 1NL0L 2OQJA 2VWEC 3WDHA 2I9TB 3AVEA 3QRFM 1AKJB 1HIMH 3MBEB 4EI6B 4UUJB 2YUWA 4IRSC 5DJDB 3O4LB 4NPYB 2H2SD 2ESVE 1ZANL 4UILL 3BEWB 4XCFL 3WD5H 3MX0A 3MLSL 3QIUA 2IAMB 4PLKD 1AGFB 3DARA 3RWHB 2ITDA 1G0XA 1O7VA 2G75B 4QKXB 5B8CA 3ZDZF 2A6DB 4WEBH 2DQGL 5C9JA 4JY4A 4TULH 3OKEB 3TP4A 3HR6A 5L2JA 3LMJH 3SBWA 3LHPH 3X12B 2IBBA 1UJ3C 2YD8A 2ZKHH 3KVQA 2LAGB 4CVWA 3IDGA 3F7VA 3L3IB 5C0DA 4DCQB 1WISA 1U93A 1HKLL 1ZSDA 3NIFF 3REWB 4RNRA 1XF1A 1FAIH 3MLWL 4ODSL 5F44A 4F2MA 4URTB 5DRNB 5E4EC 1XF3B 3EJYD 3H9HA 4YK4C 2P8PA 1OPGL 4RGND 4AM0B 3K3QA 1EGJH 1KT2A 1RK0A 3IDMB 4XP5L 2HLFD 4PJ5D 2RJMA 5H94A 2EZ0D 4Z77B 1A2YB 3FRUA 2VB5A 4ZXBD 3DRTA 1YEGL 2XPGA 4JPWH 3VDCA 2FH8A 2R0ZL 4OUOA 5F7FA 3MTRA 1A4KB 4U6VL 2NX5D 1QP1A 1RI8A 1RURH 2LFGA 4ZO6A 5GJSH 3UTSB 5I17A 4U1SB 4YXLH 5LAXA 1FCCA 3QYCA 4K8RC 2VL4A 4Y0GA 4LAJH 3CX5K 4PJIE 4WU5A 5DD1L 2BVUA 3HS0A 3O3EB 4P3WA 5EO0A 5EDXA 2HG5B 2HRLA 3CZFA 2W9EL 1YDPA 3VD7A 3CC5B 2VXSL 3WEXA 2D9CA 3MRRB 2VTFA 4DQOH 1IM9D 3IFPB 1AC6A 3WSQH 1XCTA 2RIKA 4LFHD 1L9NA 1OAXL 3QA3B 4DKAA 5DXWA 2E6QA 2WUCH 4K3DL 1T1XB 2WBJC 5IB4B 4X6CB 2FDBP 4JFFA 2HJLA 1I1AC 2X4PA 3CLFL 1RZJH 2HTKC 3T0BA 3G6JE 3T3PF 5C07D 5FYLE 2ZCKH 1E27B 3IJSA 3BE1L 5ILTH 4CBPA 4OLWL 1YEJH 1KLFA 1UVQA 4PJCE 5C6TL 4JQIH 4NKIL 5E2TH 4DKFH 1E0OB 1N8ZA 5D1XA 1DBBL 3SDAC 3ZYOA 2ZUYA 3BQUD 4M5YL 1BF8A 3SKNA 1JGUH 1KIRA 4P2QD 1RMFL 3EFFA 1VCAA 4K3JL 4LLUA 1LO0L 3WO4C 1ZK9A 3U7YH 1FVCB 3Q6FB 4GG8A 3B8SA 1RUMH 2RCSH 3F8UB 3U30C 3CIQA 4JFZH 5C08B 4Y5VC 5E00B 4JVPA 1KPUB 2F53A 4JY4B 5I1CH 4YHOH 1OOAA 2F8XC 4I5BA 1JHKL 4UTBL 2MCG1 1NBVL 4U1JA 5EU7C 3VG9B 1VHPA 1H9VA 5B21A 3VH8G 4NKOA 2PN5A 3SDXF 3IDGB 4L4TA 5C0DB 1U93B 2FR4A 1R5VA 1LGVA 2DTSA 3LQMA 4RNRB 5E56A 5L8LB 4TN9A 2DQHL 5K9KB 3E2HB 4FQCL 5DVMA 4AENA 1MCLA 3P73A 3CXDH 4RGNE 2P8PB 1R3IH 4PJ5E 5D7SH 3WUWA 5F1OB 4NQCA 3F6LA 5H94B 5KSUA 3FRUB 5IWLC 2W1NA 3ILPA 4HCRA 2YK1L 3QHFH 5DC9B 3DRTB 1IKNC 2R1XA 5E99L 1RK1A 4HK0A 4LDEB 5C0BA 5E8EA 4L4JA 1HSAA 4DGIL 4AY0A 4OLYH 4JFQA 4F58L 3VWKD 5DLMH 2QR0A 4LVHB 2NY7L 5KS9A 5LVEA 1TDQA 4GQ9H 5DVOA 1AP2A 4XVSH 1B4RA 3LEVH 4G9DA 2OP4H 3CZFB 3UZEA 1YDPB 3CFCH 1VFAB 2B0SL 2WUBH 2O5YL 3O2DH 3K80A 5I1JH 5LXGL 3LRSA 2PTTA 5CUSH 4OQTA 3VGBA 3FT3A 4M6NH 3R0MA 1YYMH 2HJLB 3STLA 3FFCA 2DMBA 4KI5F 3W11C 2H1PL 3LH2H 1NCDL 3H2WA 5F8QC 5HJ3A 4HLZG 1UWEL 1TQCC 1FRGH 4D0CA 4LMQE 1QFPA 2Q7YA 4OZIE 3ZE2F 1N5YH 1NUFA 3D3VB 1FC2D 3AS2A 2P5EB 1UVQB 1LE5A 1KBGL 1TJHH 4PJ9A 4IMLA 1I9RH 3B9KA 4YZFF 3KLSA 3MMEA 2DQCH 1ZLWK 1N8ZB 5D1XB 5IV2A 3ZTNL 2OLDA 3ZYZA 3O41A 4YDIH 3WIFA 3SKNB 4N9OB 3QI9D 4DVRH 4HFWA 2FIRT 2XQBH 1PLGH 1RIHH 4LLUB 1KN4H 5DD0H 5FGCE 3CU7A 4KJWD 2ZCHH 2CUMA 4P9HH 5J1TC 3QNZB 3NFSH 3JTSB 4BH7B 3EHBC 3GHBH 4W6XB 2MPAL 4U1JB 4WI7A 4NYLB 2EIZA 32C2A 4JFEB 4YHKH 1A3RL 2C9AA 5CLWA 3ZSSA 2DWEA 4NKOB 1GGBL 4O5LL 1VKXA 4U7SA 4WWKA 4U6XB 3TH4T 1NFDE 5I1DA 2VUOA 1R5VB 1J8HE 3K4DA 1A6AB 4NHUA 1U58B 5DMIL 1S5IH 4R0LA 4X7SH 1KTDA 1Z5LA 5E2VL 3NCFB 4AENB 1UCBH 4NRXB 3HAEH 3UMTA 1FV1B 1I7TA 3MRKB 4IOFD 3FO9A 1U3HA 3W39A 5JQ6L 1X7QA 2VJXA 5AZ2L 4LSRH 4AQOA 2ZUWA 1CIDA 5KSUB 4KMQA 4ZD3H 4HUWA 2VXTL 2R1XB 4HK0B 4OZFG 3P77A 4LOUD 1WVZA 5J1SC 1HSAB 5DFWH 1JNLH 1J05A 4JFQB 4ODXA 3D2UB 5I15H 4PJHE 2VE6B 4Y4KD 3FQTB 5FYKL 1ULVA 3CGTA 4PD4K 5EZLA 3D0VB 5K9JH 5EO1A 4G9DB 3VFVA 3SY0A 3SEPA 3MBXH 1PZ5B 2EDOA 3VMNA 1KENH 2APVA 4NKQB 4YHIA 4Z7WF 1QNZL 1JF6A 4LHQB 3P11H 1BVKA 4E0RB 1MEXH 3KYOA 1DE4A 5I6XC 1NBYA 4OV6F 2UY6A 4P46D 15C8H 3F65A 3IAGC 1LD9A 4X4ME 4M6OL 3LRSB 1UM5L 4OQTL 4PJDE 3QJHB 2PTTB 3T0ED 5BZWA 4U1NB 4CU7A 4QRQA 5ERWA 5D1QB 1XGQA 4N0FA 3FT3B 4HIEB 4ELMB 2YPLA 1MHPL 3L3KA 3TIEA 4DOHE 3RZCC 2D4FA 2HVKB 4KZDH 3B5TA 4A6YH 2ZSWA 1T89A 4KRNA 2QJDA 1OLZA 2Q7YB 5IR1B 4PV9B 3TO2A 3QRGH 2FH6A 1MCPL 2R1WA 4HF5H 1MPAL 3MMEB 5J8OA 4P2OA 5GJTH 4Z8FH 2ZCLL 5DTFB 3RPIB 4F15C 1ROWA 3G08A 1TNNA 5IV2B 2Q8BL 3RVWD 3PQYB 3O41B 1F3JA 2QSTA 4HFWB 4Z7UB 4I0PB 3MCKA 3O8XC 3RWFB 2XZQH 3MZGB 1RZKL 4JQXA 3NABL 2AJZA 5CEXB 1MFEL 2G5BA 1MQ8A 4P3DB 4UU9B 3SE8L 2AGJH 3DO7B 5FUCC 4HXAH 3EYUH 1FN4A 4QY8B 3SPVB 1T7VA 1VFOA 1F2QA 4GXVL 3RJDA 2YA0A 3BN3B 5KZCB 3ROOB 4P9MH 4M7KH 1G1YA 4M9OA 4BQ8A 4HUMB 4OZGB 3O6FC 4PJ8D 2EIZB 32C2B 3QUMH 5EG6C 4NO5A 1RU9L 1UKQA 4P99A 1FVDA 4IRJB 4HD9A 4I3SL 2DWEB 1EEYA 4D3CH 1VKXB 1A6WL 4OD2B 4WWKB 1D9KD 3QUXB 4TSAH 1Q94A 5I1DB 1U42A 4JZJA 2F5BH 5CD5D 1SJEB 4KQ4H 3B3IA 3ROLA 4NHUB 3GI9H 3UJTL 4DK3A 5DRZA 3NH7H 1JNHB 5T33H 2IG2L 5DO2D 1KTDB 4P5KB 3DECA 4X6BA 1S7WB 4Y89A 4MXQD 1I85A 3FO9B 1U3HB 3INUH 3ZSTA 5L9DL 5DJAB 3MCLL 1J1XH 4Y2DA 2H3NA 3ES6A 5T3ZD 2CKNA 5DI8B 4PTUA 4HUWB 4CVXA 2ADJB 1VPOL 3F58L 3VFPB 1J05B 2C3VA 2MFNA 2BP3A 2R23B 2Q86A 1MI5A 4K3EH 4NZUH 4ODXB 2DJSA 1FORL 4OTXL 2NY6C 2I07B 1BFVL 4G7YH 5EZLB 2IMMA 1KCSH 3BD5A 5ACZA 3RWJA 3VFVB 1FO0H 5F7HA 4LHUD 3SY0B 4QGTA 2Q7NA 4JO4L 1L7IL 3EW3B 5CZVL 3PF2A 2DM7A 2OI9B 3IT8D 1CFSB 5EU6D 2GI7A 4OKDA 1NBYB 2JTDA 5IB3B 4ZS6D 2NY2B 4BSWA 2NNAB 1CTOA 3T0EE 2Y07L 4YLQT 1CLYH 5MP6L 5BZWB 1A1NA 4I3GA 1NGXA 4HIJA 3MOBL 3QDHA 4HJJH 4QRQB 5IFHH 5JW5B 1I1YA 1XGQB 3DVGA 4N0FB 4U1LA 2FBJH 3TIEB 5HHVH 5FYJU 1CLZH 3RNQB 3B2UD 1R5WA 3KPSE 4PJ7A 4IS6A 4UQ2A 3VXPB 1JMZA 5I1KL 4I77L 3TO4C 3JVGA 5J11B 1DJSA 2WP3O 3E6HA 3TO2B 2IALA 1T1WB 2QHLA 1MHCA 1EHAA 2C1OB 2YMXH 2F54A 1J0YA 2XRAL 1Z6JT 2AXFB 1IGFH 2QEJA 3MBEC 4P3CH 2BSTA 4JEGB 3KXFD 4RRPG 1HH6A 2H26B 2UWEA 5DS8A 5EC2A 3BP6B 3MCKB 3QQNA 3MLTA 3V4PH 3SOBL 2AJZB 3CFDB 3WBDA 2XT1B 4PP1C 2G5BB 4X6DA 3U1SH 1MRFL 4ZAKD 5HGGS 5J06A 4Y5YA 5I1EH 3BGFB 1PY4A 2HT3C 4XH2B 2MQ3A 3RA7H 1LO4H 2ZJSL 3ZL4H 1ZGLB 3DOSA 4G8GA 2DS4A 4P59H 4EXKA 3X14A 4M03A 3HNTH 3DX7A 2KDGA 3B9VA 4KPHL 4YJZL 4GBXD 4LSSH 4PJFE 5HYFA 2IANE 3S37L 4H8WH 4GMTH 1EEYB 2AJYL 1Q94B 5LGKA 5F96H 5ANME 3V6ZA 3HLAA 5DR5H 1UA6H 1EO5A 2P5WD 5DZOA 1KFAL 5DRZB 2UZIL 2ZUUA 2M1KA 4N5UA 3ZDYE 1QHPA 3RTQD 3VFOA 3ARGA 5FYJD 3V5KB 3A6CL 4HIXL 2NZ9C 3RRQA 5FA4A 3QZWB 1GC1L 3E8UL 2JIXB 1MY7A 3P0VL 4U31A 5ESVA 5T3ZE 4JDTL 1S3KH 5TDNA 3SJVA 5D7IF 1INEL 4KVNH 3S96A 1M05A 2C3VB 5HYQB 1U8MA 5BXFA 4YBQC 3LPGA 5GS0D 2GFBA 4MJ5B 5ACZB 2R15A 4WUUD 2M2DA 4GSDH 1JPTL 3MUGB 4PRIB 1EDQA 4OLVH 1LEKA 1I1CA 4JFYA 5EU6E 5K59E 5KVMC 2R2HA 2VDNH 5F6IB 1HH9A 4GXUM 1JGLH 5DEFA 4PG2C 2HTLC 4XMPL 1GGCH 3O4OB 5GGVH 1IBGL 4BSWB 4I3RH 4NP4L 1D5XA 2D7NA 3BGAA 5JORA 4GW1A 3WJJC 1A1NB 2V6HA 4JJ5B 1T22B 1NGXB 4HIJB 3S36X 2ED8A 3RVXC 4U1LB 4NO0A 3BKYH 4AQ1B 1MUJA 1U8QB 4RISH 4OZHF 3U48A 1NSNL 4X9BA 3MROA 1RZ8A 4PJ7B 3ME0A 4R4NC 1EHLH 2XZAH 4ZUWA 2X09A 5CIPH 3GNML 4M3JA 4L5FH 3ORJA 2JJWA 1IEAA 3LY6A 1RZFL 3E6HB 1UWGL 2V2WA 1J0JA 4OIIH 1JHLL 1MHCB 5B3NA 1YJDH 3KXFE 5DC4B 4NKDA 4GRLD 4PRHD 2ZNXA 5IB5A 2UWEB 1VSCA 5DS8B 3VGHA 2XA3A 5EC2B 5DSCB 1EMTL 3MLRL 4NM4H 3ULUH 2C1PB 2D7TH 4X6DB 1OP3H 5BRZA 4PJIA 5D6CA 1IAOB 4ELKA 4LCCB 3WNKA 1VFBB 5CEZD 5GZND 5K93A 4LSQH 3H9ZA 4QYOA 5LKNA 3GSNL 1I8LC 4JG0L 5AZEH 4UIMA 4PJBF 1ZLUK 2FHFA 3DX7B 5C1MB 3LZFH 4OCRH 3VG9C 2VLLB 4F9PA 1KXVC 1Y0LA 3W81A 4QXGH 1UKSA 4KXZI 1VFUA 4UT9H 3FQRA 2ZG1A 3GK8L 3HLAB 3V6ZB 5BVPH 2P5WE 4CGTA 4X9GA 5E2UL 3G6JA 2Q3ZA 5FOBA 1UACL 3IFOB 3E2HC 1S9XA 5MERA 1BQLL 3H3PL 4J3SA 4XHJD 3QCVL 4JHWH 3QDJD 3EYQC 4TTDC 3DUHA 4WVRA 3BDYL 4PJCA 3KJ6H 5JA9A 5CJOH 4LGPB 3LN5A 4O9HH 4OSUL 5JZ7C 1EPFA 1TJIH 3SJVB 3LKPB 4Z7VE 3L3JB 1JPFA 3TZVD 4EIZC 2VAJA 3S3PA 4LVHC 3CK0L 5BXFB 2BVTA 1E4WL 1SEBA 2ZOKB 4HT1L 1WWAX 4KTEH 5F3HA 4CU6A 4TVPL 3HRZA 4NNXA 3EIFA 4GRMB 4ZUUA 5HVWA 1YNTB 4E5XA 1S7XB 1VACA 3KPNA 2BY3A 1FYTD 1NC4D 1MOEA 2IF7A 4PJXE 1DBKL 3HMXL 3N9GH 3O3BA 4AG4L 3HI1A 1LEIA 4LARL 3GMOA 2R4SL 5JR1H 4BK4A 5AUMB 4FG6D 1R24A 3UTOA 4D0DA 1D5XB 5JORB 4A2LA 1E6OH 3MYZA 4G8IA 5EORH 2YPKA 3QEQD 4ZOEA 1OGTA 4JKMA 4NO0B 3BH9A 1EJOL 3LD8B 3CPLA 5ECJE 5B22A 3MLXH 3IVKA 2W9DL 3B83A 4GT7A 3D25A 3A6BH 1RZ8B 1QFWM 3BGMA 3RVVC 5DHVA 1UZ8A 2D7OA 1A7PL 1KIPA 4ZTPH 4EZMA 4JRXB 3TYFA 4PJ5A 3PHSA 4UOW1 5ESQA 3OBAA 3WIIH 5J13B 4KK5C 5DVLA 3SDYH 3TT3H 4KK8C 4ZXBA 2EDDA 1Y6MR 5TJWK 4UV4H 5D1XC 1U9KA 3WKMH 5AG9A 5DQJA 4NKDB 3MR9B 1C1EL 5C7XH 1DBAL 4MDIA 1U41A 3P9WB 1JYVA 1AHWA 1U95A 3VGAB 2PKDA 4RX4D 3LEYL 4E42A 5CWSA 5BRZB 4PJIB 5D6CB 1B4JL 1ZV5A 1DBJH 4J3XA 3MRCB 3WDIA 4NQXA 1FGNH 1SY6H 1CFQA 1QYGL 4QYOB 2P8LB 4YEEA 2XKSA 4ZS7H 3RUGF 1M71A 4O2EA 1AXTL 1IM9A 1AGBA 4X83A 3L5XL 1RUKH 1AO7D 5ADPH 5C92A 4CADA 3RAJH 2IJ0C 4Z95L 1SM3H 4F7MA 4V2CB 4ONGL 5I76A 3SE9H 5IESL 1UB5A 2ZPKH 1J0KA 4KZEH 4QTIH 1Y0LB 5GGQL 1GIGL 3P4MA 5CEYA 1NAKL 3UAJC 4POZC 5DT1H 3GJFH 3HZYB 4MLIA 3IXAA 2QHRH 4MD5A 1NC2B 1XFPA 1NEUA 5FYLL 3MGAA 1HINL 3OB0H 4GAGH 5I2IA 5C07A 1S9KC 3C60D 5MERB 4ZOBA 3QDJE 5T3XH 3BIKA 4HLZH 4PY8J 3VJ6A 2GJJA 4DUWA 3TJHD 1B90A 4OZIA 3JZ7A 4QCIA 3WFHA 1WF5A 4JR9L 3DURB 3LN5B 4MCZA 4PJGB 4WCYL 2YUVA 1A6ZB 3BQUA 4N0UE 3OKKA 5ALCL 4LQ1A 3B2VL 1D5MB 1PG7L 2D0GA 2EE6A 2GAZA 4GAJL 2A9ML 1CXEA 5DD3L 4YFEA 5IW6B 4HX1A 2Z93B 3HRZB 5GSVA 5DK0A 5GISL 1BOYA 1LHZA 3DJ9A 4XAWH 5E5RB 2OR7A 4R97B 1CR9L 4ZUUB 3WN5A 1FYTE 4E5XB 1VACB 3U6RB 1J1OH 5H2BA 1ONQB 3T2NH 4FA8A 1LEIB 4WFGD 3GMOB 1KTKE 5ICYA 3UP1A 1CGTA 5C0ND 4NN7C 1R24B 4GMSH 3SN6N 1GGIL 2AXGB 1NFDA 5D1QC 2YPKB 1OGTB 3LV3B 2NW2B 3CVHA 2DKMA 5BQ7A 2PO6A 3BH9B 2CDEB 2W65B 3MREA 5KSAD 3CPLB 12E8H 3RHWF 4CW1A 3OKLA 3D9AL 4LSVH 3D25B 1BIIB 3FB5A 4UOW0 1OAYH 3BGMB 2A9NL 4R4FL 5DHVB 3UJJH 4JVUA 3OF6D 4QLRA 5DHYA 4LKXA 3TYFB 2HH0H 3JWOH 4L9LA 5DJXA 1B2WL 2FX7L 5CBAA 4ZXBB 3S7GA 3ILQD 3OZ9H 5F9OH 1AFVL 2NX5B 4OZFH 3V8CA 4I0PC 4FOMA 4MDIB 2Y4SA 4JQVC 4J3OC 3ARED 4PJHA 2ADFL 1AHWB 1AY1H 4GFTB 2JELH 2CLZA 4E42B 5CWSB 1MIEH 3DVFA 1RJYA 4LCIH 1Z3GH 4HC1A 4EOWH 2GYSA 4NQXB 2Y1VA 5JIHA 1G6RA 1CFQB 2QADB 3ARVA 4Q0XL 5T1KB 1OT1A 1XGPB 5T5FH 4O2EB 1P7HL 1IM9B 1AGBB 3FHQA 3RJQB 1EAJA 3RDTD 4X4MA 2W0FA 4F7MB 4PJDA 2DQTL 4IRJC 5KN5B 2HT4C 3B6SB 4WWKC 3QUXC 3VXRB 4DGVH 5A43C 2WMPA 1EEUA 5HGDA 3QQ9C 4FFZH 4FQHB 4UINH 4OF5A 3IKCA 3P4OA 5I2IB 1XGUA 5C07B 1IT9H 3FFDB 1TVBB 4OGXL 4ZMAT 3BIKB 1YPZE 2VNCA 5INDA 3VJ6B 1YECH 3C2AH 4OZIB 1U3HC 1BWMA 1GSMA 2R0LL 5IK3B 1N6QH 3KHQA 3HR5B 4OCSL 4M8QA 1BJ1J 4MAUL 2EIBA 3BKCH 4R6UA 3BESR 3BQUB 3U9PH 3M8OH 1WIOA 4YQXL 3GSWB 3QI9A 4MJ6B 4BUHA 4P2QB 3PWNB 4G5ZH 4PR5A 1N4XL 1Q1JH 3SGDH 2GAZB 4X5XB 3BPCB 1OWWA 2YA1A 4KAQL 2X1PA 1J8KA 5ETUB 4ONHA 1CF8H 2X7LB 5DK0B 1AJ7L 1U8JA 2CJUH 1G9MC 4GG6F 2K9UA 5TE4H 4LIQH 1I4FB 3X11A 1A6VL 2OI9C 4Q2ZA 1F00I 1OY3B 1T2XA 2PNDA 4ZFOA 3FT2A 4WFGE 1E4KC 1QFWH 5ICYB 2IADA 1CLOH 3DX8B 4I48B 2NY2C 3D5OF 2M26A 2Y5TA 4I0KA 1AGDA 4XVJL 3I3BA 2V7NB 1XF5B 3OQ3B 5JW4Q 1HHGA 2EDQA 3CVHL 1DEEA 4S1QH 5I16A 2WIMA 3CVHB 5BQ7B 4R8WL 3OHXA 1HILA 3GMRA 4UQ3B 4XNUH 5JO5A 5DC0A 2ZUXA 3S3SA 3MRLA 4CW1B 3OKLB 5TQ2H 3NFNA 4OQ1A 4KVCH 2VUYA 3LN9A 4RQQB 5FCUL 4J4PA 5DHYB 4LKXB 1TXKA 4M5ZH 5J11C 4JN1L 4L9LB 3K8KA 4XP6L 2MHAA 5CBAB 5IEKB 4QOKD 2F9BT 4NQEB 5GGSY 1T0MB 2B7DT 1KGCD 5HDQH 1JWMA 3VWKB 1GHFH 1G9NC 1W8NA 2LABA 4JHZA 4Y4KA 3V5DB 3OXSA 1QZ1A 1CXKA 3BDXA 5IEHB 2FBOJ 5JOFA 3K81A 1ZA6B 1G6RL 3BW9A 2VISA 2VZTA 4QGYA 2E9JA 3NIDF 2LU7A 4HKXB 1G6RB 3VXOA 4MNHB 4WY7L 5FKAA 4HZLA 2J8UE 1ZE3C 2P24A 1WT5C 4R26H 2F5AL 4WW2F 2W0FB 5JUEH 3T0EA 1A0QL 4OF0A 1DANT 4JREB 4AT6B 5HVHB 1CL7I 4OF7A 5ELIA 4J6RL 1I3RB 2XA8H 4P4RA 3WNOA 3FT4B 3UTZB 1XH3A 4KY1H 3HNSL 3KWWA 4MCYA 5EBWB 5JDSA 4G3YL 2NCMA 2OJEB 2A6IA 4DOHB 4JANA 3IKCB 5IJKA 3P4OB 3FHAA 5KVGH 1C5CH 1W0YT 4K9EC 2WWMD 3OAYK 4HMCA 5I66A 4X0KB 5HD8C 3QHZL 4HWEL 1SBSL 4NN5B 4I0CC 1CXHA 2ZUTA 4EUPH 2QL1A 4M8QB 5H37H 1BVZA 4OFIA 4R90L 4NBYB 3MRIB 1ADQH 3LS4H 3OR6A 4M48H 1UZ6E 3QI9B 2KL6A 4QHUA 1Q72H 2VDRL 5I1AB 4PR5B 4LDLB 4M61B 1DUZB 1LDPL 3DV6A 3X3GL 1U8JB 1ZHLA 3NAAH 4NO3B 4HPOL 2X1XR 4L3CB 1VGEH 4ZFOL 2VLKD 3O6LH 4Q2ZB 5FHAH 4ZFOB 5F6IC 3FT2B 2GT9A 2OYPA 1V3MA 3FMGH 4PJ8A 3O4OC 2IADB 4PJFA 2IANA 4RGOL 4IRSD 1CD1A 5DGRA 4W4OA 2Y5TB 4RZCA 1KCLA 5C2BL 4H1LB 1D9KA 4M7LT 3GSUB 1RD6A 2VDQH 1TJGL 4KQ3L 5DJ8A 1HHGB 3K2UL 1MHHA 4WFHD 5ANMA 3M17A 5AWNL 5JHLH 4F3FA 4RMTA 3KDMA 1T21B 1PZUB 1UB6A 2EH8H 3QNYB 4IIQB 4L8SA 5F9AC 5JO5B 5I8KH 4KKAD 1C16A 3NFNB 1IGCL 1A14L 5HHPB 5C0FB 2EKJA 4EVNB 3VFNA 3JVGC 4W68A 1P4BH 5ENWB 1BPVA 3FO2A 1OM3L 1A7QH 1T0NA 4PREB 2JCCE 3EO0A 3LKQA 1EBAA 3W82A 2YD7A 4WFFD 2P4AB 3FQWA 3O6ML 4WHTB 2EO9A 4TQEL 5I19L 1CZ8L 2B4CH 3HI6H 1TCMA 5ID0A 1U8IA 5H8DA 3MV9B 4M1GL 4LHUA 3GB7A 4LCCC 3BW9B 2VISB 5HHOD 3CFIC 3MFFA 4XPHL 2BVYA 4Z78A 5D8JH 5KOMC 4ZSOE 4RBPH 2ZUSA 2X4OA 4X98A 5EU6A 3ULVH 2VDOL 4NFBA 3BZFA 5EIIA 1MIML 3O2WH 4P46B 2P24B 5J56B 1RSFA 3TBSA 1G7IA 4M7LH 4NWUL 3MJGX 5C0GB 2BOCB 2PXYB 4HAFA 3VG0L 3K74B 3DMMD 1GPOH 4FQJH 4Z7WB 1W72B 3MRNA 1BGXL 4P4RB 4K8RD 2K7PA 3KWWB 4MCYB 4X8JB 2A6IB 1X9QA 3CSPA 5IT2L 3ZKXB 1OAQH 4Y4FB 5T1MA 4KK6C 2EYSB 1PSKH 2N1KA 4TSCL 1JPSL 1JV5A 1ZLVH 3DNKA 2K1MA 2VQ1B 2EE3A 1NCBL 3NCYP 1G7HA 3LOWA 4XPFH 4HULB 2C3WA 3KXFA 2ED9A 3OR6B 5DD5H 5B4MD 3CVIH 2WBJD 3B4NA 1I3VA 4PRAB 2X40A 4QHLB 4QHUB 3HNVL 5ISZD 4TNWK 1I1AD 4OIAA 3MXVH 1JI2A 2HTKD 1IQWH 1PQZA 3AM8A 3N1PC 1GGTA 4ZAKA 2X4QA 4YHLL 4LSTH 1S8DB 5JLZA 1JWSA 3DV6B 3MLYL 1AI1L 4F80A 1OTTD 1EFXD 4P2YA 5IVNA 4FXGA 4GBXA 3S36H 5BV7H 2VOTA 3SDAD 4FNLL 1CD1B 1L6ZA 3BHBA 5DJ8B 4WFHE 5KW9H 4NNPH 5ANMB 2VZ3A 1PBYA 3HG1D 2HFGH 1UB6B 5GGSA 5IROA 3OPZL 1V3LA 2P5WA 3BH8A 3LD8C 4UBDD 3V7AG 5JXAL 4HK3N 3ZHLA 4L8SB 5E5MA 3L3OA 1C16B 2VN7A 3RTQA 5JPNA 1Q0XH 2X1QA 3FZUC 2GTWB 4NDMB 4ODHH 3VFNB 4KDTC 4HEPG 5FAAA 3ARDA 4Z7NE 2ORBH 5T3ZL 1GH7A 2G60L 1WSST 5KVEH 3EO0B 2VMFA 4WFFE 2BNUA 4I8DA 3P2TA 4Z7VA 4M43L 3BN9C 1C5BH 1R3JA 1A22B 2WWKT 4FTVE 4M7JH 3OXRB 4PGZA 4PTTB 3VGAC 2YBRA 5CP3H 1U8IB 2DQIH 4WUUA 4LHUB 4U3CA 2B1HH 4ZNEE 4XX1G 2DIJA 3HE7D 1A21A 1DFBH 4JM4H 3RVUC 3MRHA 4PJXA 4X98B 3P9MB 1OARH 1F13A 4FQQB 1L4IA 3BZFB 5EIIB 3GUTB 2DWDB 4MNGB 5E8NA 1LQSR 3BKJH 1V7NH 4LKCB 5I8OH 1OAKL 4N8VB 3CDFA 4DK6A 4N8CL 5LQBH 1CDHA 4X6EA 1T4KA 4ODUA 3I6LE 3QPXH 1Q38A 3G5VA 1F58L 3EDDA 1L0QA 5JW4M 4JGMA 2A73B 4GH7B 5SV3A 2V5MA 4ZFGL 3BPLB 4PG9A 1S7UA 2DIBA 4O00A 1JV5B 4X7TA 2VH5H 1WZKA 3MRGA 1W0VA 1EHNA 2P7TA 4GUPB 2VDKH 3I75A 5JOEA 1K3IA 3C08L 4MXVE 3K1DA 1ZT1A 3S34H 1WAAE 2A0LC 3VWJB 3KXFB 1QSED 4C4KO 4PRHA 4AEIH 2CGRL 2H2SC 1C5DA 3WO3B 1T2QH 4LLWB 4HWZA 1DQTA 5ITBH 4QHMA 4RFOH 4YBHA 1NAMH 1DR9A 1DBMH 3PJSA 1IAKB 4X4XA 1QO3B 4DGYL 3GMNB 5IHLB 1T1ZA 3HFMH 1E28B 1YN7A 3RY5A 3L95A 3I9GH 4HUVA 3FONA 43CAA 4PB9L 4R97C 2YSSB 3CXHK 4QRTA 5DK3A 5F9DC 4F37K 5D72L 3WXVL 1AXIB 5IM7B 3HI5H 4WI6A 4NWTL 5HHQA 1GGYA 4FXGB 1N6VA 4ENED 1JE6A 2EDFA 2R0WL 2V9QA 4GRWH 5FHBH 1X4XA 3BSZL 3G6AA 1OWRM 3BHBB 3H9YA 3BDBA 5F7DA 3HG1E 4YGAB 2NY4D 2F19H 3CDCA 5GGSB 2FX8L 4YXKL 4BFGA 4YIQA 1INDL 1YN6A 3FO0H 1AD0B 4HS6A 1QRND 2CPCA 3QDJA 5JPNB 5KSBF 3EHBD 3TPUA 4ETQA 3LRHA 5BJTB 5EU7E 1X44A 1WZ1H 3V5HA 4CN4A 4ZXBC 3JWDL 4U3XA 4N0UA 5EUOF 5C3TA 1KC5H 3IU3B 3WNNA 3ZKQD 5GS1B 1KB5A 3TZVA 3MJ9L 2ZUVA 2IH1A 1R3JB 2W07A 3WE6B 5I0DA 5GRYA 4K94L 3BZ4A 5GS0L 1JI1A 1AHWC 3NIGE 4PIRF 5TQ0L 2N4IA 4P5MB 4NQVA 1KCVL 1QLFA 4WUUB 3NFPB 1J0HA 2Z9TA 4Q97A 1OCWL 2IGFL 4ETYA 1WWWX 3W9EB 3ZE0F 5GRVK 1I3GH 1FE8H 2EH7H 1T6VN 2QADC 4ODVL 1FYTA 1N6UA 1NC4A 1NLBH 5D7IB 3KYNA 3ALPA 4PJXB 3VI4F 4PYHA 1QHOA 4Y19B 3RGVD 3ULUF 2H41A 4NCC1 5D6DC 1U8LB 3W9DA 2A1WL 3EOTH 3WS3A 4LRIC 4MD0A 4O51A 1O7SA 2I60L 3R1GH 1UT9A 4U1IA 3VDBA 2NLJA 2E7CA 3C6LB 4IOSD 1CLCA 1CS6A 3KPQA 4IMKA 5FO9A 3OGCA 4OUUA 1LILA 1IC5H 1YEEH 1KYOJ 1FIEA 3BWAA 2H6PA 3FCTB 4LQFH 4YXHL 4ODTL 1Q9WA 2E27H 1ERNA 4PG9B 4G6AD 1IE5A 4AEHH 5DJCB 4XP4L 1S7UB 5IB2A 3LEXA 3DXAB 4WIQA 1CVSC 1K3ZA 3SDCA 2UYLA 3L3GA 1P5UA 1QSEE 2J6EH 4OZHB 3TNMA 3BQUC 2Z35A 1FFQA 4GRLB 4PRHB 5FGSA 2UY7A 1CGVA 4OJFH 4WI3A 4XPTH 3NPSB 3TEUA 2DM2A 4QHMB 1WFOA 2E9WA 4OCWH 3RZCD 4DTGH 3QO0A 1CFTA 4XCNB 5CILH 4FABL 1F4AA 1Y18B 3ARFB 1S7QB 3TLRA 4LLMA 4I1NB 4HUVB 3IRZA 2VABB 4X7EC 4R3SA 2X9YA 1DQMH 1G7LA 2J2ZA 4EQ2A 5HHQB 1L6XA 3OKDA 5FUOL 2OR8A 4HV8A 3ZTJG 2XY1A 4X99A 2EDJA 4XRCA 4AEFA 5LCVL 5MEPA 3EO9L 4RFEB 4PJBB 4YIQB 3IRPX 4CMHB 1FNSL 1JGEA 4OM1L 1OD7A 3C60A 1ZHKB 1QRNE 1BOGA 5FXCH 2FX9L 4HS6B 1YPZA 5IJVB 1V7ML 4MVBC 3TPUB 4TUKH 3FB7A 3IJYB 3P3YA 1ZKAA 4TSBL 3WUWG 4CMMB 3GI8H 1IMHC 1FL5B 3C2SA 3O6FD 1LO2H 3LQZB 4L9LC 3ARUA 3PV6B 4XT1C 4HGMA 4S1SH 5F93C 3LQAL 3IF1A 4N0UB 1KB5L 1IC4L 1P84K 5IIEB 5SWQA 3BP4B 1IGYA 3VWKC 4H88H 3HE6A 1A7OH 2R29L 1LK2A 3AC0A 4KHXL 5CFHA 5C0CB 1X5AA 3STBA 4XPAL 4HS8L 2NTFA 3BPNB 2BMKA 3KPPA 4NQVB 1FZKA 4UT6L 5FO7B 3TBYA 2A77L 1X5ZA 4LPXA 5TE6H 1HCFX 3WHXB 1S7TA 1NC4B 1EGJA 1UCTA 1MF2L 3FN0H 1R0AH 3EO1B 5I18L 5IBTH 4N8VG 4PFEA 4XC3L 3SE3A 1BBDH 4YDKH 1FFRA 4DKEL 4NZJA 5DMKA 5ID1B 4MD0B 4O51B 1P4IL 3RL1A 1KJ2H 2BSSB 3MV11 4QO1A 3WIHH 1T03L 4JREC 4XNQB 3NCJH 5HVHC 2NLJB 4NZRH 5GHWL 3QEQB 3RVTD 2BFVL 1JPGA 3RI5F 3KPQB 2NY6D 2QSCH 4DAGL 3MACH 3NTCH 1YY8B 5MEOA 4P5TD 1JTTA 4D9QD 4NT6A 3BWAB 4EDWH 1E6JH 1LP9E 1QR1B 3RY6A 3OF6A 5HGHA 5I75B 4PJEF 4NGHH 5IB2B 2CMRL 5ICZA 1K5NB 1ZTXL 1BF2A 1BQUA 2NY5L 4NN5C 1OSZB 3L5JA 1D5BB 4M4PA 3VXUD 2Z4QA 2C7UA 3BD3A 2UYLB 2QBWA 3IKKA 4KI5C 3F62A 3WLBB 3TNMB 2Z35B 4KHTL 2EE2A 3QP3A 1QFHA 2VKWA 2NR6C 3QI9C 5IP4A 4QTHA 4H25B 5HDBF 1MLCA 1HHJA 3AREA 3L1OL 3ARSA 5DRWA 1CG9A 4JM2F 3U7WL 5EIVA 4KJWC 1RIUL 4PB0L 5F7YC 3MLZH 3X3FH 1CE1H 4LLYA 4ZTOH 2X41A 2CRMA 2FCBA 4NJ9H 3ZYJA 4G42A 3O0RL 2O5XL 3QXVA 1S5HB 4R3SB 4F57H 1VFMA 2DQUL 4G7VH 4BKLB 3FL7A 2J8UA 1G7LB 2UVFA 1AO7B 3PP4H 3LVEA 2DQEL 3MBED 4HV8B 1BZ7A 2HVJB 4N5EC 5HHXH 3NVQA 1DVFA 2EIEA 1ZLSH 1FC1A 4HW6A 3X13B 3S5LG 1J11A 1NCCH 2GKIA 3GMQB 5DJ6B 3RUGB 3C8HA 4MD4A 4PP1D 5MEPB 3G5ZA 5EZIL 1P53A 4IIQC 3TC9A 4YNYB 5FUCE 1XCQA 5E4IA 1OF2B 2AQ2A 3P30H 1N26A 1LO3H 1XF4A 3V0WH 3FB7B 2P43B 3IDYB 3IDXH 1UXWA 3LMJL 4TOYH 3WLWD 3U2SA 1K4CA 5J6HB 4G6MH 4TUOA 4LOUC 5BO1L 5SWQB 1KELH 2PTUA 1IGYB 1J1PH 1LK2B 4KDVA 5F7EL 3VFWA 3Q1SL 1UM4L 1J88A 2NTFB 4XXCA 3MRJA 3KPPB 3ZT6A 1ZT4B 5KVFH 3JXAA 2AK4B 5C09D 4MA1B 2JB5H 2XZCL 3ARPA 1EGJL 4H26A 1UJTA 2NZ9D 4HPYL 4XVUD 1Q0YH 4QT5A 4WWID 2X9XA 2XTJD 4CNIA 4P46C 3FB6B 3I50H 3BZDA 5DMKB 4YHPA 4HDIB 1KCUH 5T5NG 3IETB 2PXYC 2V2TB 2DTML 3UTSD 4YDLC 4YBQD 3P0GB 3SKJH 1FAKT 3VRIB 5KSAB 4Z7QF 4D9QE 2O61A 1C8PA 3ESVF 3WL9A 3TJEL 4NT6B 3ZKXC 2R39A 4Y4FC 3H42L 3S37X 2NTSP 2GQHA 3WSQL 3DWTA 5HTSA 3VXUE 1H8NA 4UNVA 5I8CA 4QOKA 4QNPF 2C7UB 5D7LD 4UTAL 3RWIA 1CGWA 2WUCL 3RVWC 2JCCA 4ZUSA 4MXWL 1T7YA 5DUML 1H3TA 3PIQA 1HHJB 3IAPA 3AREB 2CK0L 4QXWA 5KJRH 3H7BA 2C3GA 1FBIH 4R4ND 4R96A 5JW3H 4QXTA 5ILTL 5E2WH 1YEKL 1A7BA 2IPUK 4FZ8L 4PGDA 2ARJA 1F11A 4XB8A 4QRSB 4YWGH 1LEGB 4G42B 4ZSOA 3KPLA 2D03L 1A6UL 3EFDH 1T5XA 1CGSH 1MWAA 2R2BA 1DUYA 1CE6A 3RDTB 5D96B 1W0WA 4JG1L 2YD3A 4PY8I 1RUPH 4W4OC 4BZ1L 3GO1H 5F1NB 5TF1L 5J1AA 5CD5C 1NUNB 4MD4B 4F9LA 3DPBA 1O5DT 2DQJL 4XVTL 5A2IH 4L8SC 2R4RH 2AK1H 3GEWB 2BJMH 2VN4A 3MYJB 4QXUH 1RIVL 5C08D 3MA7A 4MXQC 3TBWA 3GIZH 4PLNC 5E5UB 2HJKA 1UXWB 5EU4A 4XI5C 4HS3A 5L6YL 2YXMA 3K46A 1F4XL 1NL0H 4DEPB 3GSRB 5SX5H 2QLVB 4NC0B 1BVLA 5TH2B 4JY6B 2P42B 3PDOA 4L29A 3VI3F 2D7MA 3GHEH 3VFWB 5IF0A 4GKNB 2YRPA 4UILH 4YDVA 3V8OA 3MRJB 3MPCA 5EOTB 2DB8A 4XCFH 1NDMA 4O02L 3MLSH 4PRNA 2D31A 5AEAA 3CH1A 3EYQD 4H26B 1I7ZA 1F3DH 1TTGA 2P45B 3NZHL 4PRPD 1CCZA 2VLKA 1R5IA 3MGTB 2XTJE 5CZXD 4HHAB 1U8PA 5L2KB 3EJZD 1ZVYA 4ZS6C 2DQGH 2BNQD 4NUJA 1JL8A 4IRSA 1T5WB 4QWWC 2VAAB 4YHPB 1EUTA 2PYEB 3UZQA 4KK9D 4BFIB 3UTSE 1BM3L 2F15A 2BVQA 4JFHD 4GG6B 5IG7A 3DVNA 2OM5A 5CMAA 4GQ9L 2DOCA 4WU7A 5GPRA 6FABL 1A5FL 1PJ9A 3C87A 4HUKB 4O58L 1HKLH 3WL9B 4U0QB 4G6KL 2P48B 2J8OA 5IVXF 3BPLC 1H0DB 2YRZA 2JK5A 3MLWH 4ODSH 1VEPA 1EVTC 3U0PB 1DANU 1OPGH 5D7LE 5I8CB 4QOKB 4LSPL 3NA9L 4XP5H 4W6WB 5GRJL 3RQ3A 3WS6C 4DFIA 3VWJC 5EU3A 3WFDL 2YD2A 5IHBA 2NPLX 4X6CE 1ZEAL 4ZUSB 4M6NL 3PIQB 4U2YA 1DQQB 4L8DB 2GJ6D 4KKCD 2C4FT 1YEGH 4JFOB 4FTVA 2AV7A 2R0ZH 3EZ8A 1FNEA 4U6VH 3T4AB 3MODL 4QXTB 1SMAA 4A6YA 4ZNEA 5IUSA 2ARJB 1LNUA 2EEDA 3RBGA 4ZSOB 3BVNA 3D3VD 2P5ED 5DD1H 1T5XB 1MWAL 1F2XK 4KK5D 2EYRB 2XWBB 4KK8D 5GGTL 3ZYIA 5E08L 2W9EH 4HFUL 4U6HA 4GO6B 5D2LF 1FL3A 3NN8A 2XQYG 1HHIA 3MRDA 3QNXA 4OI7A 1OAXH 3DMMA 1JZ6A 3GMMA 1KYOK 5IB1B 5J1AB 4Z0BH 3T77A 4B41A 4YDJB 4K3DH 4MB3A 4CVZA 5C08E 4Q9RL 2DMCA 3CLFH 2PW1A 3M1BA 3RKDC 4GXUN 1X5FA 4H0HB 3IB4A 2FSEB 2GTZB 5EBMA 5EU4B 1UEMA 3BE1H 4JFED 2PW2A 3LCYA 3UTPD 4OLWH 1WAAA 3UC0L 2WBJA 1CK0L 4JPVL 5C6TH 2NY0B 5GS1C 3H0TA 3UAJD 1WEJL 4B5EA 1I1AA 3FO1A 1DBBH 5J4MA 3BIBX 4L29B 4M5YH 2KZWA 4S1RL 1JZ8A 1RMFH 1H3WM 1T83A 2D0HA 1ZGLP 1K2DA 4K3JH 1NGYB 1NDMB 1LO0H 2DKUA 4HKBB 2D31B 4ONFL 3QWQB 2VLKB 1R5IB 5B3JE 1EFXA 2CXKA 1S7SA 2DJUA 1HDMA 2ATPB 3C8DA 3SDAA 3THMH 4RSVA 3KYAA 4U1KB 1HHHB 4WEMB 1ETZB 1JHKH 5EPMB 5HI3C 4UTBH 1NBVH 3QFDB 2HA1A 4MQXC 4JFHE 3C6LC 2UV3A 3D2UD 3D85B 3HG1A 5IG7B 3ULVF 3O9WD 2LU4A 4WU7B 2XXCB 3MC0A 3MOAL 3L9RA 1HXYA 3V4UL 5F3BB 4PGEA 1GJIA 1S9YA 1FO0A 4YGVB 4OF8A 1QSVA 5CGYC 4Y5VA 4KUCD 2HKFL 5D9SB 1MCIA 4N90E 4PLJC 2DQHH 4J2XA 2VC2L 5FDYA 1MEXL 4AK1A 3RHWK 1U8OA 1P6AB 1BJ1H 4FQCH 4ZOCA 1KCKA 3PNWB 4LEXL 2Q8AL 4IM8A 2GK2A 4AL8L 4M02A 4N1EA 4GRLC 3GSXA 3W2DL 1RJZA 5D1QD 3NPSC 4KJPC 3RIAF 1MFCL 2G2RA 2YK1H 5E6ZA 5E99H 4YHML 1IEHA 2X4RA 3ARBD 4F8TA 4DGIH 1WIUA 4F58H 3ARFC 4R4BA 5HHOB 3HE7A 1NMCB 4A6YB 1LNUB 3D3VE 5C6WH 3BVNB 2P5EE 1E4JA 1KPRA 1PG7X 3QRGL 4UNUA 4MAYB 1LK3L 4Z8FL 3QG6A 4FXLA 2L4OA 4U6HB 1KNOA 3VRLE 2B0SH 3QDGD 2O5YH 4HWBA 1I9IL 5LXGH 1HHIB 3QG7L 3QNXB 3PHQB 4I0PD 4K8RL 3CFKB 3DMMB 3OKMB 3GMMB 3SKMA 3GGWA 3ZZ1A 1MVFA 3RL2B 4FP8L 3T77B 5B39A 1V3JA 4CVZB 4FS0A 4CMHC 5INCB 1NLDL 4XHJC 3TN0B 1XGTA 3UDWA 2H1PH 5KZCD 4ZO8A 2PW1B 3M1BB 1XF2A 4P9ML 2KZ1B 3OL2A 2ZG2A 1NCDH 1UWEH 4U6YA 4JFEE 5EBMB 5EO9A 2AV1B 1F45A 1X4YA 1U8NA 4IRJD 4PP2A 3QUMB 1QSEA 3G5YA 5KVDL 1MHEB 1RFDL 1OB1A 1RULL 3LN4B 5IQ7L 4WNQA 3QUXD 5GRXG 1KBGH 2WBJB 4MA8L 3FKUS 5ISZB 3Q5YA 2OJZL 3FO1B 1WICA 2APTA 4OCNC 3ZTNH 1DP0A 3DROB 5D2NB 1UGNA 1GYAA 5EU5A 3BPNC 4L8BA 4JKWA 3V6FB 1K2DB 1KACB 4R7NA 1A1OA 1YNKL 3BRDA 3INUL 3ALXA 1UM6L 5E1AA 2V2XA 3HC4H 2W38A 1JTPA 4U1HA 1VERA 2AEPL 2DICA 4WO4D 4ZPTA 4EIGB 3UYRL 4HIIA 4JFDD 4NSKB 4YUEH 3DUSB 3F12A 4HH8A 2BC4A 1A3RH 2YEZA 3EYVA 3ZLQC 1MFAL 4O5LH 4JDZA 4HQQL 3BAEL 3HB3D 1KCSL 1BZQK 2N7AA 1HXYB 4PGEB 1FO0B 1QRNA 1XR9B 5FUZL 5GIRA 3F5WA 3QEHB 3IJHA 5H35B 5I75C 2ICES 1MJ7H 1MJ8L 1U8OB 3TCLB 5E2VH 3MLVL 4IDJL 4R9HA 1KCRL 5JQ6H 3DLQR 2EKSA 5DRXA 3EGSA 5HYEA 5EA0L 5I71B 3GSXB 1RJZB 3I6KB 4ELME 1QD0A 4ZPVB 1HOCB 5LWYL 4M3KB 5I1HL 3FQXA 1MCOH 2X4RB 2R56L 4R4BB 4AH2A 3HE7B 3CDGA 5FYKH 4YC2B 5CIPA 4EDXB 2DLFH 1KPRB 1OD9A 3RGVA 4LDOB 2ARJQ 2FLRT 2E5EA 5T1LA 1G1CA 4HKJA 1ZHNA 4P3CL 1QNZH 4HWBL 3PQYE 1PDKA 1AQDB 3E6FA 1AQKL 1F02I 1JUFA 3B43A 4Z7UE 5IFAL 3N1MC 2A6KA 3SKMB 1A7RL 5C0JB 4M6OH 4OQTH 1UM5H 5DQ9B 1HWHB 5AYUL 2VZSA 4MJ4A 4PV8A 1PEWA 2FATL 2FJGA 1KTLB 1OSPL 5I1EL 3LB6D 2FJFB 1LO4L 4OZ4B 1SEQL 2QQNL 2ENSA 1MHPH 4P59L 1LP9A 3MUJA 2JB6B 1SMOA 3TJHC 5F1IA 4DW2L 4WGWB 3IDYC 4OZGE 3L5IA 3SQOL 5JHDD 3RIFF 4BZ2L 4FQLL 1BJMA 4BA8A 1U8NB 3KLDA 4PP2B 2OMBA 4BSVB 1OB1B 4IHOB 4WNQB 2Y7QA 3S35L 4YO0A 1MCPH 1MPAH 4MZ2A 4OLXL 4D94A 3U46A 4KMTL 2B20A 2ZCLH 1EO7A 3IS1X 3RZCA 3N85L 2Q8BH 3HAEG 4WI8A 1PY9A 4L8BB 2H45A 2IPKB 1RZKH 4MA1C 4PYGA 1MFEH 1A1OB 3RWEA 4ALAL 5L88L 4FXKA 3SE8H 1A6TA 1P1ZB 3BMWA 2JIXD 3LKSA 3SE3C 1YMMD 4WUKL 5EZOL 1IGML 4GXVH 2JJVA 4ZPTB 2Z8WC 5IHUH 4HIIB 4KDWA 2IBGA 3M45A 1U8KA 3EYVB 1RU9H 1ZLUH 5K9QG 3K8MA 3STZA 2NY4B 1V3KA 3IFNL 3FQNB 5KSAC 4JDZB 3UCRA 1A6WH 1Q9KB 3F7QA 4I9WD 3TCXA 3ULSA 3O3DA 4EQ3A 1MAML 2FJHB 1WCBB 3UTTD 4Z7NF 3VE0B 1QRNB 5GIRB 3F5WB 1JNJA 4PRID 1N3NB 3VFUB 1SYVB 3UJTH 3AAZB 2IG2H 1MAJA 3O6FA 3DX6B 4BK5A 2VKXA 3EDFA 4JY5L 4YHYB 5DRXB 4LK4A 1DQDH 5L9DH 3ILQC 2Y72A 3VH8A 5KSBB 2XICA 5KAQG 3BKYL 8FABB 3Q2CA 3R4DA 3AREC 3ZT5A 2YZ8A 4GKSA 1MCCA 5EZJA 1VPOH 3FQXB 4XBEL 3F58H 3R06A 5CGMA 1AR1C 1RZJC 5DYOA 5F9JA 4EBQL 2MKLC 4AH2B 5E94B 6CGTA 1FORH 4OTXH 5EUOB 2J12B 3IXTA 5CIPB 1U2CA 2CLVA 5ITFA 3MNWA 1OW0A 3RGVB 3CNKA 1I9EA 4JO4H 1L7IH 1XR8A 3RDTC 3RWCB 3EOAA 5D96C 4QRUA 5F89A 3O3UN 4OLZL 1QTYT 3C6SB 4X9FA 2A6KB 1GZQB 2Y07H 1F4YL 5MP6H 4ZOAA 3P9LA 4DUVA 4PV8B 4P5TA 2FJGB 3MOBH 2HMID 3QIBD 1LP9B 2WAHA 1BAFL 4ZDHA 5F1IB 5AZEL 3R8BB 5HGAA 2AJVL 1UEYA 5DFVC 3VXUA 5HYJD 3MJ7A 5I1KH 5C8JB 4I77H 1C7TA 4DEPC 4DZBB 3FB8B 4GRWE 2Y7QB 2XRAH 3RX5A 1NGQH 3U46B 3EYFB 5JQHC 4NKMA 2HWZL 3ZHKA 3OAUL 4K3HA 2Z0BA 1MH5A 3SOBH 3TO4A 2VITB 2FZ3A 1TQBB 3HPJA 3QWRD 1MRFH 4PS4L 4NOFA 4FXKB 1JK8A 4NO2B 1HYRC 1A6TB 2ZJSH 1MQKL 2DI7A 3MBEA 4EI6A 3LKSB 5C0EA 1FFPB 1H3VA 3WNLA 5DJDA 4NPYA 4I18A 4OGAD 5F8RC 3BT2L 4KPHH 3U4AA 4KJYB 1HXMB 2ZSVB 3S37H 3STZB 2R2EB 2AJYH 2Z8RA 4I9WE 1MREL 3AXLB 2H9GA 1G7QA 1O0VA 3ULSB 2G75A 4N9GB 1MAKA 2A6DA 4XNMB 4PRIE 5HGBB 4KKLC 1KFAH 1QEWB 3OKEA 2UZIH 3OR7B 3VW3L 3X12A 1MFDL 3A6CH 4HIXH 1KXTB 1GC1H 4DCQA 3E8UH 5T1DL 1WV7T 4BUGA 3P0VH 4M1CC 3REWA 4JDTH 5A2FA 4GKSB 2D4DA 4R7DB 5D7JB 5DRNA 1XF3A 1INEH 3H9SD 3R06B 4M00A 5E6ID 3AMLA 5F9JB 2C3HA 4OF3A 2XN9D 4L8CA 4KI1A 4AM0A 1NGZB 2FEDC 2QKIA 5D71L 5HHNA 1NCWL 4JRXD 3IXTB 1WQVT 1PX4A 4D9RD 3L5WA 1HQ4B 1K9TA 1T04B 1JPTH 2X1WL 1K6QH 4Y8DC 4QRUB 5F89B 4OAWB 3UPRA 4BQ9A 2UWEE 1EO8L 5C7XL 4MX7B 4XMPH 1QSFD 3UTSA 1NH6A 1IBGH 5CZKA 4NCC2 4OZFA 4BQCA 4C54A 4NP4H 1XZ0A 4P5TB 1TLKA 3O3EA 1TIUA 3T4YB 2CQVA 4I13B 5CJ8A 3RVUD 3CC5A 4P9HC 4BSJA 1NSNH 4PG2A 4LBEB 2V17L 3T0WA 5HYJE 2X44D 4XXDA 3GNMH 5D7LA 4K2UL 3SE9L 1RZFH 2F74A 4XAKD 1UWGH 4QTIL 1T1XA 3IU4L 5EN2B 1JHLH 2NY0C 4X6CA 5D5MF 4CDHA 4JKPL 4PJEB 3DVIA 1NC2D 3GJFB 5D7KD 3SGJC 3ZDXF 4LVNB 5GRUL 3LRGA 3MLRH 5L8KB 3N0PB 4L1HA 4U7MA 5E9DB 1B6DA 1MH5B 2FZ3B 1G7PB 3HPJB 3DSFL 1JK8B 1I9JL 4QEGA 2VR4A 3P4LA 3H3KA 4Z6AT 1WFTA 5C0EB 3K2MC 2A0LD 1I7UB 3GSNH 3SJVE 4KJQC 3UPCA 2ZNWA 4I18B 25C8L 3TVMD 4ZFFB 1CU4L 3KYMA 5E70A 1FVCA 3Q6FA 2J88L 2GEEA 3CAFA 2H9GB 1G7QB 4X80L 1F97A 2E6JA 4KKAC 2APFA 2JJTC 3GK8H 5C08A 5E00A 1I8LA 1KPUA 4MNQB 5E2UH 1J1OL 1UACH 3BO8B 2ILLA 1M6OB 3H3PH 1UWXK 2GY5A 4XP9L 3HZKA 3VXMB 1IAIL 4HUXA 1SYSA 3BDYH 4H20L 5CSBA 3QFJD 3VXQB 2CDGB 1JZ3A 3L7FB 3JSSA 3P40A 2Z92A 4OSUH 2XWJA 3ZHDA 5K9KA 1Q9OB 1QSZA 2I24N 1WFUA 2XN9E 5C09B 5IW1A 4L8CB 3CK0H 1NMCC 3KR3L 2QKIB 3RKPA 4JRXE 4PRPA 1E4WH 2DQFB 4HT1H 5HHNB 4TVPH 5CCKL 1U3ZA 2XTJB 2IQ9L 4W4NA 1DL7L 4MAYC 4XNZB 3L5WB 3UX9B 1FSKB 2GIYA 3WJLC 3D18B 1UH3A 3UPRB 1DBKH 3HMXH 1OP9A 5F9OL 2GW5A 1B0RB 4LARH 4AG4H 3UO1L 2R4SH 4NRYB 3DMMC 3G5XA 3MJ8B 1OP3K 4OZFB 3O6KH 1J10A 2JELL 1XZ0B 5BRZE 2YWZA 2X89D 1NEZB 1Z3GL 5DZLA 1QA9B 1U6AL 1EJOH 3TN0C 2QADD 1EUUA 5T1KD 1VFAA 3T3MF 2ICWJ 1JJUA 1XAUA 1AE6L 1QFOA 4Y2OA 4PJAF 4XXDB 1A7PH 1LMKA 5D7LB 4X6FA 4XAKE 1IGIL 2F74B 1QKZL 4PGJA 5B4MC 3TPKA 3VXRD 5TGBB 4NQDD 4FN0A 5FM5O 2OCFD 5D7KE 2XFXB 1TCRA 1S7RA 2FD6L 3CCHA 5D2NC 4PRBB 1C1EH 1DBAH 1T83C 3O2VL 2SEBA 3PHOB 4GAFB 3D3VA 3LEYH 4A2MA 2P5EA 1OTTC 4LASL 2D0FA 1B4JH 4KGLA 1A1MB 4MB5A 3DRQB 3U0WH 2R9HC 4PJGE 3T8XB 2EXYC 2NY3C 1QYGH 3NCCB 2HYMA 4ZYKB 3QT2A 1AXTH 1IM3B 1NFKA 3L5XH 4G5ZL 4Z95H 4HK3J 3PDDA 4RRPA 4ONGH 4BH8B 1F6LL 3KYMB 2BHUA 4PGCA 5IESH 3GMLA 3QXAB 4UBDC 1F42A 3F7RA 3T08A 5JXEC 1TPXB 1CGUA 1GIGH 3QNZA 1NAKH 2P1YA 4YFDB 3JTSA 4CAGA 1EHXA 4UAOB 4BH7A 5FYLH 4JO3L 1HINH 4NQSA 1QLEL 1UQSA 4NYLA 4JFEA 1JZ7A 3HZKB 4EI5B 2AEWA 3OAYH 4U6XA 4HUXB 3AUVA 1IC7L 1SYSB 2YD6A 4ZUTA 3HUJF 5I71C 1GGUA 4JR9H 1FJ1A 2JJUA 5L0QB 4HSQA 4S1QL 3WYRA 2Z92B 5IMKB 3GBNL 1A6AA 5ALCH 5B38B 2XWJB 1U58A 3B2VH 5JW4N 4KKBD 2Y9RT 4NRXA 7CGTA 3DIFB 5IGXL 1U91A 2WP3T 4GAJH 3RWGB 3SGKC 5IW1B 1FV1A 2A9MH 3HE7C 3MRKA 4MVBD 5DD3H 4PRPB 4F7EB 4YC2C 5ADOL 3RU8L 5IHZA 1SJHB 3NIFE 4MJ2A 5GISH 3CZJA 2BNQB 1CR9H 1F8TL 4UDUA 4NQED 2XNAA 1FGVH 2C4FU 2NX5E 3VFMA 3BIAX 3D2UA 3G5XB 2VE6A 5E7BA 3FQTA 1NJ9B 2MSPA 2JJSC 2BERA 3UJIL 3D0VA 1FFNB 2DD8L 1GGIH 4ZFZA 3KYKL 1PZ5A 4MA3A 3Q5OA 1FZMA 2HJFB 2IPTL 3PGCB 3UDWC 3RI5K 5D1ZB 2FRGP 1T20A 4E0RA 3KLAB 3D9AH 1JN6B 4K55A 4E41D 5DMYA 4R4FH 1FNFA 1JNNL 3QJHA 4X6FB 2CIKA 3CUPB 3MV8B 4AIXA 4M8VA 4U1NA 1OTUC 3VXRE 5D1QA 4H8WC 1B2WH 2FX7H 4HIEA 4ELMA 5IVXB 2GJ6B 1LVEA 1MJUL 1CXIA 1U3YA 3QUYB 5E8PA 2O93L 2IFGA 2HVKA 5KANI 3ARBA 1TCRB 1S7RB 1SJXA 3CCHB 5C07E 1AFVH 1NGWB 1C5CL 1N7ML 1PD6A 3QDAA 1MFBH 2ADFH 3T0DA 2SEBB 3IGAA 5IR1A 4PV9A 4UZGA 5IMOB 1D6EB 3MRFB 3C9NB 4LU5L 3L6FA 4V1DB 5DJYB 4KI5D 3K4ZA 5DTFA 3RPIA 4EUPB 4Q0XH 4ENEC 4RMUA 3T3PE 3PQYA 3QDGA 4LF3B 4LLAA 4P2QE 2NR6D 4Z7UA 4I0PA 3RWFA 4JQVA 4F7CB 3QSKB 3VA6A 5CEXA 2VDML 2BHZA 3ZE1F 1QACA 2DQTH 2NY4C 4P3DA 1P7QB 4PGCB 4UU9A 3GMLB 4JKLA 2IQAA 4NIKB 3DO7A 2BOBA 3NAAL 5EIQA 4QY8A 3SPVA 3V52L 5F97E 1LE9A 1MCBA 3GKWL 3ROOA 4ERSL 1S7VB 2ICWB 4NQSB 1ZAGA 1UQSB 4OZGA 4UT7L 2GSGB 4OGXH 3HN3A 4N5ED 4IRJA 2BX5A 4JFPA 4RWYL 5FEBA 4OGYL 4YHYC 4OD2A 2QQKL 1FG2A 3QUXA 5HYSG 2R0LH 4FQ2L 4ZUTB 4OCSH 1FJ1B 4RMQA 4MAUH 3DV4B 5J6GA 1SJEA 4YQXH 2VO5A 1NMAL 1JNHA 5I8KL 4P5KA 1N4XH 1U91B 1S7WA 2CDFA 5TE7L 1J5OL 2R8SH 1CL7L 3HCVB 3SDXE 4KAQH 5MEQB 1MRCL 5DJAA 5EBGA 5IHZB 4NUGL 4HCRL 3OKOB 3FOMB 2QQLL 1AJ7H 3RGVC 3TYGL 2KPNA 3VCLB 5DI8A 1YEFL 4NQEE 1A6VH 4UDUB 4WO4A 2ADJA 1QBLL 2XNAB 4U2ZA 1RHHA 1YEIL 1YJDC 3VFPA 3VFMB 3QBTB 2R23A 3V6BR 1NEZG 3C5SB 3O9WB 1GAFH 1KLUB 2I07A 4XVJH 1IVLA 4ZFZB 3MV9D 4JJHA 3ULUC 3LDBB 2CKBH 3KPMA 4MA3B 2X70A 4DVBB 1FZMB 5CP3A 5HPMA 1BJ8A 5CJ5A 2VZOA 3K8LA 4R8WH 1D5ZB 4G6AC 1CFSA 1T20B 1UADC 1E4KA 3UTQA 3VGEA 3O3AB 5IB3A 1YEHL 2NMSA 1ITBB 4BQBA 2NNAA 4NN7B 5FCUH 1OHQA 3CMOH 2CIKB 4JN1H 1DDHA 3OV6A 2W92A 3HC0B 2PXYD 5JW5A 5LGHH 1GPOL 3S4SB 4XP6H 5FM8A 3RNQA 3QQ3B 5E8PB 3Q3GB 5BOPA 1KEMH 3QAZB 3ARBB 3VXPA 5L7XH 5FA3B 4Y4FD 1KF9B 1NCAL 4RMVA 1FG9C 3IGAB 1TQBC 2X4UB 3PDGA 1T1WA 1CDJA 2C1OA 4P2CG 3L6FB 4KI5E 1N2RA 2AXFA 4WY7H 4Y8AA 5CKGA 5AYQA 3QDGB 2E7BA 2H26A 2F58L 5GSRB 3BP6A 1AXSA 1FNHA 3I02A 3MUHL 3CFDA 3QO1A 3ZE2E 5EBLA 1A0QH 1P4LA 4YZFE 4KROB 5FYKU 2EXWC 5CLTA 2IQAB 4XH2A 1ZGLA 1UC6A 2BOBB 3P0YH 5HBBA 3HNSH 1LE9B 4G3YH 5DUBB 2A6JB 5DDHA 1WT5A 5JHDA 4NQTA 1IL1A 1JGDA 3ARTA 1NQBA 2HT2D 4JFPB 5BV7B 2M8XA 3QHZH 1F4WL 1FG2B 4HWEH 5B38G 4YBLB 2GUOA 5KTEL 1KJVA 1RY7B 4LVOB 4GKOA 2FNBA 5J6GB 2N7BA 3A67L 4EXPX 2YZ1A 1FIGL 5D7JC 1G7MB 2VDRH 4LNRB 1BBJB 2EDBA 3V5KA 2CDFB 4WHYG 1II4E 4Q74A 4BYHA 4O4YL 3QZWA 1MCHA 5CJXC 1LDPH 2XWTA 1OW0C 4XI5D 4LCUB 1G0DA 2MWCA 3FAWA 2JIXA 5TDPA 3JUZA 4HPOH 1P7KA 4WO4B 4J1UB 5C70A 5KS9F 3DX9B 1OGAB 1RHHB 4JFDB 5HYQA 2OMNA 3RVTC 1V8HA 4RGOH 3FAXA 1X4ZA 3MNVA 4MJ5A 3MV9E 4FFYL 3Q6GH 1G9ML 2DQIL 4KV5F 1TJGH 4KQ3H 1H15A 4P5TC 3KPMB 2X70B 5AWNH 5HPMB 1DFBL 3MUGA 4NFDA 1YQVL 1MELA 4PRIA 5KOVC 5FYKD 5J89A 3UTQB 5AD0A 3HC3L 4Z76B 1HQRB 1IGCH 1M7DA 1A14H 3AS0A 1EK3A 4WI5A 2ZP0T 4QWWD 4D8PB 2GK0B 1JPST 1R6VA 3OMZA 1PX3A 1DDHB 3O11B 4C56D 4JJ5A 1T22A 4Z7WE 1OM3H 1JZ2A 5I74B 1ZWIA 2WZPD 2XV6B 1U8QA 3PL6D 1R3LA 1TZGL 3JV6B 4BFBD 4LVNC 5EUKA 5FK9A 3QDMD 3O6MH 3PGDB 4TQEH 1QBAA 5I19H 4YE4L 1CZ8H 4EUPG 1TENA 4M1GH 5H37G 3V0AC 4MSWA 1BFTA 4XPHH 1N2RB 3FTGB 4JCLA 3PWUA 1CBVH 1OAUL 3VWJD 2WIIB 5A1AA 2D9QB 5HSFA 1G9NL 2VDOH 4I18C 1KTRL 3I3EA 4PJ9D 4ZQKA 5DSCA 1MIMH 3A6OA 4QRPD 1AXSB 3I02B 5I8EA 3MRBB 1HSBB 3QO1B 5EBLB 2C1PA 3EDKA 1DN2A 1K8IA 2XKUA 3PG2A 1P4LB 1NAMB 4NWUH 1IAOA 1QRKA 4U1GB 4LCCA 3VG0H 1VFBA 3QIBA 1BGXH 1M7IB 4U7KA 4Z7OF 1A9BA 4AIOA 4ACPA 2XI9A 3WXWL 1A3QA 5IT2H 2X4SB 4GS7B 5DDHB 4G8FB 1HI6B 5JHDB 1IL1B 4XWGL 3OJDB 5HYJA 1JGDB 1S78D 5IVZA 3QB7C 3WLWC 3H3BC 1RZGA 1BLNA 5SWSD 4FFVD 4TSCH 1JPSH 2VLLA 2QTEA 4GRWB 3PWJB 2GUOB 3JTTB 4IOIA 4NHCL 1KJVB 1NCBH 2FHCA 2F19L 2AEQL 2BRRL 4K9EL 1DSFL 3TA3B 3IFOA 3LIZL 3HNVH 3GBML 4S10A 4MDJA 2HFTA 5BW7C 1FLRH 2OZ4A 4XVUC 3RKDD 3DTXB 4JPKL 2WBWB 2VXVL 4YHLH 2VXUL 2XTJC 1ZT7A 2XWTB 3VU2A 1S9VB 4XNZC 5TDPB 3MLYH 1YMMB 1FSKC 1QUNA 3JWOC 1AI1H 1P7KB 1TETL 4G8EA 1KC5L 1CDYA 3TV3H 3EAKA 4NRZA 3LKPA 5IKCA 5GS2D 4Q6IB 3L3JA 1BFOA 3CFJA 2UUDH 2OSLA 1SQ2N 2OX5A 2ZOKA 5I30L 1MCRA 3MNVB 4FMKA 2DDQL 1X6NA 1BX2A 1H15B 3UTTB 4CUCA 4RBPK 4GRMA 2EE9A 4U6TA 2EH7L 3TF7C 1YNTA 3OPZH 1S7XA 4M7ZB 4WGVB 5JOPD 5JXAH 5T5NF 3IDNA 5FGBA 1T6WA 4Y19D 3G6DH 3BRFA 5AD0B 2CXGA 4B50A 4MNGE 1M7DB 2GCYA 5AUMA 3T0XA 4MS8D 2HAZA 3CX5J 3S4SG 1FH5H 5HI3D 3SDDD 4C56E 4MQXD 5K33A 3C6LD 1QVOA 3BP5A 4XP1L 2G60H 2Q3AA 1Q9LB 1ZWIB 4NJAL 5DUPL 5DJ2B 3QCUL 3UZVB 2AJSL 1GOGA 1R3LB 4NBXB 1YEEL 2C26A 3QDME 5E6IA 5EUKB 5FK9B 5CGYD 2XN9A 4PBVC 2FECI 4K07A 4AEHL 4KDTA 4JRXA 4PLJD 3GFUA 1A3LL 3DXAD 4MSWB 1AGCB 1H3PL 4V2BA 5DJZA 4C58B 3PWUB 3MR9A 4ZQKB 4KJPD 1U0QA 5I8EB 1JGVL 1XEDA 3BYTA 4OCWL 3BMVA 4JZOA 4DTGL 3MLUL 1K8IB 2OK0L 1IGTA 2DN7A 3DUUB 3ARFD 3MRCA 1TPXC 3QIBB 4N8CH 2EO1A 2P8LA 4YHZL 1WFNA 5EWIL 4UAOC 1A9BB 4Y1AD 1F58H 1KEGL 2VDPL 3CJJA 1WUNT 4ZFGH 2CO7B 5HYJB 3MRMB 1ACZA 5IVZB 4I4WB 5SWSE 4N1CA 3TBTA 3VD9A 4D9LH 1RZGB 1BLNB 1D6VL 4EI5C 1YMHB 2VZVA 9CGTA 5DK2B 3C08H 4IOIB 5L0QC 3HZYA 5SX4H 3IFLL 3REVB 1KB9J 1NC2A 3MV7D 2CGRH 4LAQL 4G9FD 1NCTA 4D2NA 4MDJB 2OZ4L 5FYJE 2DQDL 2E9IA 3TNNB 3DHJA 3ZKMD 4DGYH 1U2HA 5F6HJ 1ZT7B 1ORQA 5CZXC 1NUDA 1RVFL 3DURA 4JO1L 3EJZC 2VIRA 1A64A 2I27N 4PJGA 2MKWA 1A6ZA 1OP5K 4PB9H 1QBML 3O45A 4G8EB 1D5MA 5IKCB 4NRZB 5D72H 5CHNB 5C6PB 3TVMA 4KK9C 3GZKA 4NWTH 5BOZG 1BFOB 3CFJB 2C5DC 2NXYB 2R0WH 2OSLB 5C0CD 5IW6A 2Z93A 3BSZH 4WUUE 1BX2B 5JIPA 5C71A 1RV6X 1MI5D 3EBAA 4OB5L 5D7IE 5JOPE 2FX8H 5SWZB 5D1ZC 1CD8A 4YXKH 2LV4A 3U6RA 1FFOB 1KPVA 3IDNB 4Y19E 4RA3A 1ONQA 4LRNL 5E95B 3K7UA 1RUAL 4LVEA 3ZT7A 2GCYB 3TT1L 1AIFB 4TTGA 3T0AA 2C3XA 2AXGA 5F7KC 4ORZC 2AI0L 4HZAA 1KJ2B 4PJ7F 2AJUL 2V7HA 1QVOB 3BP5B 3GSVB 1K4DB 3LV3A 2NW2A 4KKCC 2W65A 2CDEA 3JWDH 2KH2B 3QUYC 2DLIA 3PGFL 3H9SB 2R0KL 1EZVX 2DL9A 3QEGH 5E6IB 1BIIA 3MJ9H 2XN9B 4HH9A 1PW3A 4K94H 5GS0H 4GKZA 5CBEB 5TQ0H 3DXAE 3SHSA 2VXQL 1OCWH 2IGFH 2NW3A 2Y25A 1B0GA 4OZHE 5DJZB 1KN2L 4ODVH 3V4VL 2ADIA 4PRHE 4X6DF 5CSZB 1WWBX 2NX5A 2AXJA 1QSFB 1CFVL 2CRZA 4M62L 2VLJD 4JZOB 2I60H 3L7EA 1IGTB 4UIKL 5CEZE 4H0GA 1KJMB 4OM0L 2FGZA 3PABB 4D0BA 5FKPB 5T1KA 3JBG7 1XGPA 2E7HA 2E9BA 4Y1AE 1F3DJ 3EUUA 5D6DA 2OL3H 3SKOB 4YXHH 4ODTH 4LRIA 1N0XL 4Q7DA 3VFSA 5FV2A 4XP4H 3TBTB 5KN5A 3T2QA 2P8MA 3B6SA 1P2CB 1MRDL 3VXRA 2YRLA 4X7FC 5GXBB 2BY1A 4NZDA 5LBSL 4LSDA 4CN6A 5IFJB 2DF3A 4G6JL 3RIFK 3WKNA 5I1IL 4FQHA 4PJBE 3FRPG 4P4KD 2R69H 4G9FE 2EEBA 3FFDA 1VA9A 3SQBA 1I8IA 1TVBA 2A38A 4ODBD 3P30L 3OJVC 4S0SD 5C3LD 1CICD 5IK3A 2CK2A 4FABH 2FL5B 1KV3A 4TVSa 4CJ1A 4PBWD 3HR5A 1ORQB 5D5MB 3ARGD 2VIRB 3O45B 4L4VD 3GSWA 3WCYA 4MJ6A 2PCPA 4P2QA 3PWNA 4LLQA 2Y5EA 1WBXA 3TVMB 4Q6YA 5FUOH 4X5XA 2CRIA 2XKNB 3BPCA 2IEPA 3O9WC 5C0CE 1OTSC 5ETUA 1NFIB 4WJ5A 1DZBA 2ESVD 3CLEL 4E9LA 4JRYD 1X5LA 2X7LA 2B4CC 3LDBC 1UYWL 2AK4D 2EDYA 4HEME 5FIEA 5LCVH 4NC1C 1I4FA 1CFNA 3EO9H 4GOSA 3OG6B 1FNSH 1KPVB 2HFFB 4HUNB 4OM1H 3UBXB 4Y16B 4TVPD 5DQDL 3DX8A 1DTUA 4I48A 3ULVC 2FX9H 1DQLL 2EDWA 1V7MH 2V7NA 1KCUL 1XF5A 2FB4L 3QFJB 3QEQE 1XMWA 2V7HB 3MRPA 2QQQA 3LQAH 1KB5H 1IC4H 2ATKA 2OTWA 4UQ3A 3QAZC 5EB9A 3ARBC 2BNRB 4P49A 4EEEA 4RQQA 4HH9B 3VGFA 2PR4L 2VL5B 4KHXH 1FL6B 3SDXA 2W59A 4GKZB 4XPAH 4HS8H 3SGDI 2HN7B 3S35X 2R1YA 4UT6H 1NKOA 2NW3B 4AYFA 1TTFA 5IEKA 2A77H 1B0GB 3ABZA 4WV1C 3RFZC 3MRQB 4NQEA 2ADIB 1T0MA 1OQOA 4PJIF 5I18H 1BQHB 3VWKA 4KU1A 4XC3H 4IJ3B 3V5DA 4DKEH 2VLJE 1QFWI 5IEHA 1T03H 1AR1D 3L7EB 4KROC 4TPRL 3PP3H 1PG7W 1ZA6A 1Z9SA 3BUYB 5GHWH 5GRZA 5B39G 2BFVH 3M07A 1CI5A 2IFFL 2G5RA 3TIDA 4HKXA 2AJXL 4D0BB 4MNHA 2BSRB 4P57B 5I73B 3D87B 1AO7E 4FQXD 4FZEL 2PF6A 3RWDB 2LAAA 3GRWH 5HDLA 3OSKA 4DJMA 3VFSB 4UV7L 1RUPL 5BV7C 2CMRH 4Q9CA 2FHBA 2OTUA 2P8MB 4AT6A 3G6JF 4YBLC 2NY5H 1I3RA 1VGKB 3RUGE 3FT4A 5F9WB 3UTZA 4LVOC 1JBJA 4NQDB 5EBWA 2OJEA 4LSUL 4O2CA 4KHTH 4PJCF 2AK1L 1I8IB 4PJAB 2X4NA 4HJ0D 3U0TA 1BEYL 1ORSB 5DA0B 4X0KA 3U7WH 4PB0H 1RIUH 5IOPB 4AMKL 3HPLA 3U36B 5DFVD 1T7WA 4IBLT 2A83B 3MRIA 3KAAA 3O0RH 4L4VE 2O5XH 1JMXA 1A9EB 2DQUH 4WO4C 2PCPB 4Z0XA 2YD9A 4LLQB 2WINB 2XOTA 4N0YL 1KJ3L 4YX2L 5SV4A 5I1AA 1BIHA 1WBXB 3BEVA 2DQEH 4M61A 1DUZA 3GHEL 3HB3C 4JRYE 4WJ5B 2AK4E 4MA7L 2BXYA 1MLBB 4NO3A 4GJTB 4L3CA 4RGMB 1A47A 1CFNB 5EZIH 4TVPE 1H5BA 5L2KD 3KPRD 5AG8A 3ARQA 2W91A 2FIKB 2Q76B 4XC1L 1XGYL 4H1LA 2Q1EA 3GSUA 2PYED 2X42A 4LGRB 5CJBA 3NMEA 3IDJB 5I74C 2J5LB 1T21A 3MRPB 4G6FB 4KUZL 1I3UA 2GITA 2OTWB 2ATKB 3QNYA 4IIQA 4KRPD 5BO1H 1EERB 1QBBA 2FO4A 3CU1A 1F6AB 5HHPA 4UDTA 5C0FA 5F7EH 1ND0A 4EVNA 3Q1SH 4KKLD 3SDXB 1UM4H 3D39B 4WHYH 1JF1A 5ENWA 3HUJB 2Z31B 5FDWA 3NCEB 2R1YB 1YYLL 4C4KT 1PKQB 2XZCH 2YS4A 4NM8L 2ZZUT 5DWUL 3TGXA 4CJ0A 4HPYH 2UVEA 2W9LA 1HEZA 3QCTL 4PREA 2A74A 4Z5RB 7FABH 2ICWI 5A2KH 4WHTA 4M1CD 1H3XA 3KJ4B 3QULA 3VA2C 4HC1L 3MV9A 3MFGB 4U1GC 3LB6C 2DTMH 3H7LA 1I8MB 2FEDD 5E8OA 3TIDB 4JGJA 3BXNB 1DLHA 1X5YA 1CXLA 4GS7C 3TJEH 5A2JH 4E41B 1NMBL 4P46A 2F8OA 3H42H 4TYUA 3GBLA 1ITCA 5DA4A 3X17A 2OTUB 5C0GA 1YUHB 2BOCA 2PXYA 4WRLA 4Z7WA 1W72A 1WK0A 4UMGA 4Z0BL 1R3KB 4QRRB 4UTAH 2ARWA 4X8JA 4O2CB 4OZIF 4RIRA 1IZKA 5DHXB 3TA3C 2AQ1A 3U4EA 4MXWH 5DUMH 3DGCR 1JFQL 4DN4L 3C8KA 4Y4FA 3UYOD 2X4NB 2EYSA 3KPOA 2CK0H 3U0TB 5I1GL 2B1AL 3PWPB 2VQ1A 5FF6A 2IBZX 2EDHA 3MGOA 2OR9L 3HPLB 1YEKH 4FZ8H 4U1MB 3TFKD 2OQJB 2D03H 5MI0B 1A6UH 1FVEA 2RAMA 1DLFL 4QHLA 4PRAA 4Q6IC 2NY0D 4TNWF 4Z0XB 1HYSD 5CSGA 3BEVB 1CWVA 4JG1H 3VD5A 4BZ1H 4KH2A 1S8DA 5TF1H 3UBXG 4JO2L 3QIUB 3NCBB 3FJTA 4M7ZC 5DEGA 2ITDB 2VR5A 2DQJH 4XVTH 5JMOC 5L2KE 3KPRE 1NFDF 1H5BB 1MY5A 5ACLA 5B8CB 3THML 1RIVH 5C9JB 5C0AD 3SO3B 4KJQD 4NZTL 2PYEE 1KB9K 5L2JB 2BVEA 5EOCL 4GG6E 5L6YH 2YN5A 3D85D 3D1MC 1F4XH 43C9A 1KG0A 2BDNL 3PWLA 4C59B 2GITB 5GZOC 3F7VB 2NY1B 1WTGT 1T0PB 1ZSDB 4IRZL 2FO4B 4UDTB 4KWUA 2GTWA 2PO6D 1ND0B 1J8HD 4NDMA 4F2MB 1JHTA 3G04A 1JF1B 3QUZD 5FDWB 4OBSA 5KAQF 2VQTA 3H9HB 4O02H 4QOKE 1BQHG 1KT2B 1RK0B 2VLRD 3A0OA 3NZHH 4MMZC 4PJHF 1RZ7L 4XNYL 1HEZB 5GQBA 4MYWB 1KGCE 2A74B 4KTDL 3OXRA 3QULB 4PTTA 2FYYA 2XPGB 1T7XA 3QR2A 4OGZA 3VD4A 4J3UA 4W6YB 3PE9A 1BM3H 2HMIC 5I17B 3QIBC 5LAXB 5E8OB 3WFCL 1DLHB 1HZHL 4K7PY 4PJDF 2RGSA 1A5FH 6FABH 5GRVL 5JPMA 4WU5B 1L7TL 3P9MA 4O58H 3SGEI 4UNTA 4MAYD 3HS0B 4FQQA 5EO0B 4HBCL 4FFWD 2DLEA 4XMLL 4G6KH 3GUTA 2DWDA 4MNGA 2FGWL 2VDLL 4LKCA 1Z0MA 5LG1A 3WEXB 4N8VA 1WITA 4C56A 1XCTB 1W72L 2H2PC 4XTRC 3NIDE 4YDLB 2F8VA 4OIBA 3CSBA 4RAHA 4LSPH 3NA9H 5GRJH 4TRPL 3PL6A 3WFDH 4OT1L 1JZ4A 4RIRB 1QFUL 1ZEAH 3U4EB 3QDMA 2A73A 3C8KB 4JFFB 3TN0D 3T0VA 2X4PB 3KPOB 2WK2A 4OD3L 3WUZA 1EIBA 1JRHL 4KMLB 5FF6B 1ED3A 4GUPA 1F90L 2VZUA 3MGOB 3IJSB 4L9DA 3MODH 2YKLL 5SX5K 4AEEA 3WS6A 3VWJA 1FVEB 1MWAH 4LLWA 4JVWA 3BP7A 4OGAC 4QRPA 35C8L 5GGTH 5E08H 4HFUH 4XNXH 2NXYC 1IAKA 1QG3A 2AEIT 1QO3A 4MGXA 1KIRB 3GMNA 1A7NH 5CJQL 1E28A 3EFFB 3KS0H 2EDEA 1ES0A 2YSSA 1CQKA 1IFHL 2VLKE 4F37F 4GG8B 2XXMB 5DEGB 4KGJA 5FGBC 5IM7A 2I5YL 3HC4L 4DFHA 2R9HD 4FHBD 2EXYD 4Q9RH 2NY3D 5C0AE 2AVGA 5SWSA 5DMGD 2F53B 2RFXA 2DI9A 3P4NA 2ICCA 4I5BB 2VRAA 4YUEL 2MCPL 3PXJA 1G6VK 3SGEH 43C9B 1KG0B 3PWLB 3S5LA 2DLGA 3UROR 2YD5A 3UC0H 1CK0H 5JXED 4JPVH 4L4TB 3AY4C 4OF6A 1AD0A 4XHQA 1WEJH 5E6IC 2FR4B 1TFHA 2MQ0A 4OCXL 1NANI 3V6OA 1G9EA 5BJTA 1JHTB 4S1RH 3KLHD 4Y5XA 3G04B 1MJ7L 4BJLA 3P73B