5EZOL

Crystal structure of pfcyrpa in complex with an invasion-inhibitory antibody fab.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
213
structure length
213
Chain Sequence
b'SIVMTQTPKFLLVSAGDRITITCKASQSVRNDVAWYQQKPGQSPKLLIYFASNRYTGVPDRFTGSGSGTDFTFTISTVQAEDLAVYFCQQGYTSPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PfCyRPA
publication title Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezoL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ezoL01
1NC2B 4WI6A 3SCMB 5JW4Q 2ENSA 1DQQA 2H26A 3OKLA 1RVFL 3PP3K 5FK9B 1A6UH 3TJEH 2VH5L 5FHBH 1DEEB 1F45A 3L5HA 4G8FB 5H2BB 4BH8B 2CO7B 2IH1B 3ARBA 3PABB 3VXPA 3VDBA 5LG1A 4RGNB 4KKNA 4JKMA 5GSRA 5GZOC 1QSFE 3V0WH 5DSCA 3P4NA 5K9JL 3CX5K 2D3VA 1A1NB 1BFTA 2E7LA 2I26N 3RY6C 4MNQD 4MD4B 1D5MB 1TJGL 3D6GA 1CE6B 1R3LA 8CGTA 3HR6A 2LU7A 3TO4C 4GBXC 4XPAL 4X6DA 1ED3A 4ODVH 5D5MF 5DI8A 5L88H 4FTVE 3QDJA 4XH2B 3L9RB 4POZD 1JYXA 4CNIB 4I5BA 3UZQA 1IILE 4M7JH 4MNHB 4R7NB 3LKQA 1NFDB 3MRPA 4GW4B 5F7EH 5IMLA 1RZFH 1BOYA 5HYJA 4QOKA 2X09A 4PJXA 3RL2B 4N8CH 2DIBA 1GGBL 1T66D 4L8BB 4U1MB 3VFWA 3D39B 4A6YL 2Y36L 3T04D 5F9WC 5D9SB 3RWIB 2F53A 1N6VA 1B90A 5DYOA 4XPTL 3EO9H 4HPOL 4OV6F 4LLDB 3BKJH 1LO5B 1CXHA 1DBKL 1EJOH 3HTLX 5T3ZL 4TVPE 4R4FL 2R0ZL 3VFNB 2Z91B 4UINH 1T2QH 4YHZH 3QEQD 3EJYD 3PNWA 1N6QH 1S7RB 1A9BA 1NDGA 3MRKB 2XA8H 3K74B 1ZVSA 4N8VA 3T3MF 4ZUTB 1K5NB 2ZUTA 1AH1A 1I7UA 2FEDD 1P4LA 3RRQA 1ZGLB 2BERA 4NRYB 3SDCA 2X40A 3SCMA 5KVMC 5C0AA 1IBGL 1BBDH 4R9HA 4KI5C 4P3DA 5HHXH 1SJEB 5I0DA 4FQJH 2D0FA 1Y6NR 3ZT7A 2FX8L 1RJYA 5IB4B 3LRGA 1DEEA 5H2BA 4BH8A 3BPCB 2EE6A 5GGQL 1PAMA 2EEAA 2YMXH 4Y8AA 1CLOL 4PJ8B 1AKJA 3MUY1 5IGXL 5EA0H 4U3XA 3VD5A 2HH0L 2CLRB 3O3DA 4RFEB 5DFWH 2CIKB 1A1NA 3VXOA 4MD4A 4TVSa 4FTVD 3TYGH 1D5MA 1HH6B 2EDDA 3EGSA 2XYCA 4IRSC 5BQ7B 1DQJB 2V7HB 4QYOA 1ACYL 1CE6A 1HNFA 1NCBL 4ONGH 1TNMA 5ISZB 3BYTA 1EHAA 1XGPB 4L4TB 5DVLA 5C2BH 5KSBF 5D96C 3L9RA 1ADQH 3JWDL 2SEBB 3RGVC 4CNIA 1ZTXH 4LMQE 3BN9C 3QUKB 5DJDA 4R7NA 2UZYB 3UTOA 4GW4A 1OTUC 3HNSH 3RL2A 2AQ2A 4P5TD 1MF2H 4U1MA 1IMHC 5IBUG 4Y19B 3K4ZA 4Y5XC 1ZT7A 3HAEB 3GB7B 5HGAB 2DQDH 1IGJA 3RY5A 3ULVH 4XB8A 4KRPD 2H41A 5D9SA 4LSUH 5ESQB 4YWGH 4HGWB 2FBJH 4LSQH 4JRYB 1LO5A 1SBSL 3FQXA 4N90E 1F8TH 3PGDB 3TFKC 1X5ZA 4F57H 1EHLL 3FQWB 3T4YB 2HRLA 3NFNB 5ERWB 5I1EH 5M95B 2YR3A 1UZ8B 4ZTPL 4R3SB 3O8XB 2EXYD 5C7XH 1HINL 4HKZB 3GSNH 3Q0HA 1CIDA 3ZDYE 1OP5H 4WU7A 2ERJB 2JIXB 4XC1H 3GJFB 2A74B 3ZE1F 4X7DC 4NRYA 3D85D 3PIQB 3FRUB 2AKRB 2V7NA 2HKHH 3LDBC 4PJDA 1OTTC 4KROC 3RZWA 1T4KB 1SJEA 3VXSE 1FYTA 3HZVB 3KDMA 4X98A 1UM6L 4QXUL 3SGEH 2BY1A 5SWSA 4BFIA 1CK0L 3BPCA 5E8DH 2P8LA 4KJPC 5AWNL 4M1DH 4ALAH 1GGIL 4QXGH 5DZLA 4Y5YA 2CLRA 3QCVH 1MCWM 1HKFA 2BNRB 1UXWA 1WBXB 1CXIA 4CMMA 5GGTH 2C26A 5ENWB 4JFFA 4TOYH 4JO2L 5AAWA 2NY5L 2GJ6E 3PWPA 4KQ3L 3WO3B 3QJFA 2FH6A 4HHAB 4H88H 5ISZA 4MXQC 4P46A 3BIKA 5DHYA 4KKLC 3AS2A 4WFHE 3GRWH 1AGDA 2SEBA 5IQ7H 5E03A 3MRMA 1J8HB 5F6HJ 5IW6A 5FV2A 3X12A 3QUKA 4JY4B 3V4VL 4X83A 4XWOD 4UI2A 3RTQB 2ZUQC 1T83C 3FT3A 3ARFC 1QR1B 3QIUC 4MQXC 4X7EC 4K7PX 3GB7A 3HA0A 3JV4B 4MAUL 4CRPA 4I77L 4N90D 5CJOH 5F7WC 1Z5LB 3G08B 3OKYA 3WXVL 5GGSY 3AS3A 4WTWA 5ESQA 3OWEA 4P2OD 4ZUUB 3VWKB 2VRAA 4JRYA 4YHPB 4M62H 4PPTA 5HHOA 4Y4HB 1P7KB 3BH9B 3PGDA 5CEXB 3LS4H 4YQXL 5ETUB 5FB8A 4HUNB 3X13B 5ERWA 3WYRA 1RUMH 1D9KC 3SKJL 2GT9A 4PJAB 4G9FB 3O8XA 5J7CC 1MH5B 1VFMA 2H3NB 1P84J 1PY9A 4KK5D 3GMPA 1I85A 5JOFB 1A9EB 1JF1B 1RUQH 4YXLH 3OPZH 3VXSD 2G5BB 3MRQB 4XP6L 4YGAB 2NCMA 3GJFA 4DOHB 1G9ML 1WK0A 5E7BA 4LQFH 3BD3A 4JFYB 1VPOH 3Q6FA 1P6AB 4OM1L 5E2UH 4O02H 1MCDA 4JG0L 5GS0L 1BX2A 4PRBA 2GITA 1D7FA 1JIBA 4YHIA 5I1KH 4GH7B 1X4ZA 1VSCA 1EX0A 1OP3K 4UIMA 2GJ6D 4ZS6D 3EJJX 2ZUSA 4UTBH 4LGSB 4OF7A 2HTKD 4LU5L 4WEMB 3PHQB 4UOW0 4BA8A 2EE2A 1AGEB 1WBXA 2BNRA 5ENWA 3PWNA 1GGUA 5KOVC 1NMAL 3RUGB 5TE7L 1G6VK 3VI4E 4RQQB 2A6DB 1RQ5A 4NYLB 2IC2A 1QFWI 4WIQA 1MCEA 2FYYB 4M6OL 4R26L 1IGML 1J8HA 1AR2A 4GG8B 1MJJB 1EPFA 4JY4A 4MXVF 4PJCF 2YD2A 3CK0L 1A7PL 3ZSTA 4RISH 3L3OB 1S7XA 4W81A 5EO1B 2AJYL 1QR1A 4PB0H 3FOMA 3GK8H 1V5JA 4ODXB 4ZD3L 3TN0B 4JY5L 5D7LA 2AV1B 5FO7B 5GRVK 3WIFB 4HT1H 4JQVA 4OAWB 3C5ZD 5F1NA 4OLYH 1I4FA 3VWKA 3MRCB 1WZMA 2AXFA 3FB5B 4ZAKD 1MCJA 3IGAB 3BH9A 5CEXA 4PYHA 2O5YH 1BMGA 1I7RB 3X13A 5F6IB 4XVJH 1IM9D 1HI6A 4GRWB 3MV9A 3IFLL 1DN0B 1S9KC 1JTPA 2YPLE 2BCKA 3I6GA 4PJ9C 5JOFA 2YK1H 2G60L 4LPVA 4LNVA 3BGFC 3QRGL 2G5BA 3MRQA 1MCSA 5IF0A 3RX8A 3VWJB 5DUPL 1HSAA 5DRXB 4OIAA 3AAZB 1U93B 1AO7E 4GRLC 3QUMH 1WIOA 3RWFB 1IQDB 3T65B 3TZVC 3SE3A 2IALA 5D1ZC 3OAZK 3OKMB 2EZ0C 1ORSB 1S8DA 1CVRA 3FO0L 5M7QA 1FGVL 1OP3H 2YD7A 1MIEL 1J5OL 1H3VA 4GAGH 5EPMB 3PHQA 2EH8L 1K8DA 4NZJA 1HK6A 4MCZA 3P9LB 1D5ZB 2NY1C 1QQDB 2J5LB 5MEPA 3VFRB 4K2UL 4ACPA 1FFNB 3ESVF 2A6DA 4FFVC 4BK4A 4HGKC 4NYLA 2R23B 5EN2B 2DQJL 5FUCE 1FL5A 4Q9RH 3P77B 3HHRB 5A3IC 2GHWB 1KXVC 1IC7L 1J18A 1E4KA 3OX8B 1IGYB 1RUAH 1BEYH 3WNOA 4GG8A 3G6JB 5K9KB 2QSVA 4LSRL 4JJ5B 1F42A 3GMOB 2R0KH 5JPMB 2P44B 5L8JB 3U46B 4KJYB 1KXQE 2F5AH 1D6VH 4KMLB 5EO1A 2AABL 4OQ1A 4LEXL 4ODXA 1RHHB 5ADPL 2AV1A 3WIFA 1F90L 4OAWA 3WS6A 4M4PA 3VFVB 5IB3B 4KUCF 4WWID 3FB8B 1JHKL 3X17A 3PHOB 4KK9C 1CFQB 3PGFL 4F9LC 1QFWL 4XNQB 5HI3C 3JTTB 5FUOL 1I7RA 4UAOB 3ULUE 1O5DT 5I19L 2WSKA 5I1AA 3T2NL 3M1BB 5I15H 4WO4B 4TRPL 1W72B 4OLWL 5DJZA 5I9QB 4KK6C 1AO7D 3IAPA 2WQ8A 1CD9B 1ZWIB 1X5YA 1Y0LB 2I25N 5DRXA 2V2WB 4DAGH 5DK0B 1CG9A 3AAZA 3V7MA 3VG0L 2MPAH 4NFCA 1BAFL 4KK8D 4P4KA 3TBTB 4JO1H 5K93A 3T77B 3O2DL 4P0DA 3OAZH 3OJ2C 3OKMA 4HZLA 2VDPH 1TVDA 5GGSB 5IESL 1ORSA 3GMRB 4O00A 3AS0A 1AC6A 2JB5H 4ZYKB 3NZ8B 4X6BB 3SPVB 1KB9J 4TSBL 3VGAC 3P9LA 5BMFH 1KGCE 3GSOA 2RBLA 3VFGH 1A6PA 2NZ9D 5CLTA 1ZT1B 4TPRL 1FFNA 1WWCA 1TZGH 4HX1B 4ORGB 1Y18A 3P77A 3LKOB 2LTQB 3EDKA 2Q1EA 1OARH 2VDOH 3GZKA 1J87A 1IGYA 3RDTC 5IG7A 2NXZD 5K9KA 4Z95H 4JJ5A 3QDGB 4WWKB 3QEGL 3OXSB 5KTEL 4NSKA 5JPMA 1DQML 5CKGA 1GJIA 1YY9C 1NH6A 3B2VH 3R06A 5IMMB 4F7PB 2VTFA 1FO0L 4Y8DC 1UT9A 2X9WA 2ZOKB 3TO2A 5DMGD 2ESVE 4WFEE 1YNLH 2R0WH 4K94L 1Z2KA 3EJZD 4UBDD 5IVXF 1P1ZB 1YA5A 3ULUD 2VDNH 3PHOA 3L5IA 5GS2D 5GSVA 4Y1AE 3P73B 3LQAC 2DN7A 1N64H 1KPRA 2QTEA 3CFJB 2BK8A 1QBAA 4U7KA 1U91B 2JJSC 4XVUD 4N9GB 3DO3A 3MPCA 3F7VB 1DEDA 2XY1A 1ZHNB 1W72A 2IQAB 4NJ9H 4F7EA 5A2IH 4ZXBD 5HJ3A 1QR4A 1N8ZB 5CLWA 5GGRY 1OPGH 3O2VH 2OL3H 4JM2A 4TUOA 3LRSB 4RNRB 4G8GA 5DK0A 1KENL 3OKNA 4U05A 4HUVB 1G6RH 4QWWC 2CKNA 3CVHH 1UWGL 4M00A 3O4LA 2YC1B 2FSEB 4X4ZA 5IFHH 3GMRA 1KGCD 1XGRA 4OIIH 2JKXA 3OKOA 1UGNA 3NCEB 2PXYB 2FHCA 4QHUA 2WZPD 4DVRH 4E41A 3NZ8A 3BEWB 2D4DA 4CADA 3SPVA 3V52H 4EI6A 2NY2C 1PKQB 2NPLX 3B83A 1RZ7L 1F4YH 2FZ3B 2MWCA 3G5XB 2VC2H 4W6WB 5DMIH 1AP2B 1P5VA 1WIUA 3PWVB 1KIQA 4ORGA 3H3PL 1UENA 2YS4A 3MXWL 2HP4A 2OBGA 2J88H 2A73B 2OP4H 2HRPL 15C8H 4OJFH 1KCSH 4LHUB 2ZZUT 1VGKA 3K0WA 3X14B 4G6FD 5DJYB 2ESVD 4WFED 1EZVX 4MNQB 1QFUH 4H8WC 5GGUB 1VEMA 1KNOA 3WUWB 1CYGA 1FZJB 3B6SA 3BVNB 2B7DT 3EOYG 4HKJB 1MFCL 1MCHA 3KPNA 1Q0XL 5H37G 3ZDXF 2B1HH 5C0IB 3HZKB 4R7DB 4WUUE 4WGVB 3SDDB 1J1PL 1U8HB 2BDNL 4PJ7F 2JK5B 1U8KA 4NHUB 4DZBB 1CE1H 3P73A 4RMTA 3CFJA 2XN9E 1F58H 1U91A 3AS1A 2H2PD 4LSSH 4XI5C 5E08H 3F7VA 1FVCA 1WAAA 2IAMC 1X7QB 2IQAA 5T1LD 3ZDZE 4P2RE 4J6RH 4GFTB 1KTLB 1N8ZA 3U0WH 1NGZA 1JPST 4HUWB 1UKSA 1JYNA 3CDGB 4RNRA 3IDXL 4Y4KC 4GS7B 4NWTH 4ZTOL 3B5GA 4XTRD 3ZKXC 3ZE2E 1D5IL 1WZ1L 1NCDL 5IW1B 3U4EB 3QI9A 3WIHL 2YC1A 5HD8D 1PJ9A 1QNZL 4GW5B 5IW3A 3E6FA 2OR9L 2OSLB 4GAJH 1VENA 3DUSB 4TNWF 4NQTA 2OJZL 4GMTH 1TZIB 3HE7B 1ZLSL 1PFCA 1S7SB 4HWBL 1PKQA 1DVFD 4F7CB 1F3DJ 4IOFD 3O2WL 2NY6C 4BZ2H 3G5XA 3MRFA 1GAFL 4J3WA 2OI9B 4L1DA 4D3CL 1QSFB 1MHCB 1WWBX 2XKNB 3EO0B 4TNWK 2VDRL 1U8PA 4ZFFB 2A73A 4HWUA 5ALCH 3H9SA 4EBQL 1Z0MA 4LP4A 4RMQA 3X14A 3C2AL 3MYZA 4MNQA 2X1XR 3O6MH 4M4RA 4FTVB 3TYFB 1IFHH 3DETD 1XIWC 3WUWA 1RD6A 1FZJA 3MXVH 4DK3A 1AHWA 4AMKL 3NFPB 2XN9D 4LLUB 3CSBA 3HZKA 4NQEA 2VDKL 5DC0A 1RZIB 1U8HA 2JK5A 4DZBA 4NHUA 4R90H 2HT3D 4X4YB 2BJMH 4BQCA 1U95A 2CKBB 2VISB 3EKCA 4P2RD 1T20B 1KJMA 3VGFA 5I8KH 2ICWB 1N59A 4P5TB 2BHZA 1OSPL 4MA7L 3ES6B 2PW2B 1X7QA 3WS3B 4R97B 3EFFA 3QP3A 5CEZL 2B4CH 3T1WA 4KRPB 1IAKB 5A43C 2JJTA 5EZOH 4MA8H 3TBYB 3QZWG 2G75B 4L4VE 4DGVL 4HUWA 5EZIL 3QWOB 5FYKH 5C0GA 3CDGA 4LGRB 1A1OB 3ZKQD 3EOAB 5J3HC 4OZGA 1DR9A 4NN5B 4X4MA 3I85A 4FRWA 4EOWL 3QEQA 2NTFB 5KG9A 2D7MA 4QTHA 1KF9B 4DKFH 4AG4L 3IJSB 4PV8B 2JELH 3F6IA 1PW3A 1HIML 2R2EA 3DI2B 2OSLA 5I1GH 3LEXB 5CSBA 1R5VB 1TZIA 3WJLA 2KDGA 3BZEA 2Q6WA 4F7CA 3D85B 1SY6L 3DO7B 2Z93A 5J11C 2YXFA 4P2QE 1XF4A 4OCRL 1IKNC 4OLVL 1IE5A 3LPGA 1HZHL 3TNNB 4HPYL 3VFOB 4X6DF 4BELD 2XKNA 1KC5H 2X10A 3EO0A 1MCNA 1FPTH 2XIDA 1EEYA 1PQZA 4ZFFA 1MSPA 4ODWB 2ZKHH 2W91A 5LBSH 2OTWB 1U8OB 1P4BH 4PGDB 4YLQT 5GGRB 5CILH 1VFBA 3NPZB 3RNQB 4Y7MA 5FHAL 3ARGC 4PJXF 4GLRH 1CDGA 5F9JB 2JJVA 1SEQH 1E6OL 4OD3L 1G7HB 3NIDF 3BGMA 2EO9A 1QO3A 3GSXA 3MA9L 5INDA 3HI6H 3VG9C 2EDYA 1KCVL 1RZIA 3ZT5A 4ENEC 1MQKH 2D7TL 1RIUH 4FG6D 4AEIH 2B1AH 5D1XD 3EYUH 1DBBL 1K8IA 1INEL 2CKBA 2VISA 1WCBB 4PJFA 4KV5F 1ITCA 2NY0D 2DL9A 3RZCD 1DBMH 4L4VD 1F4XH 3QQ4B 5B3JF 5JLZB 3WS3A 1L0XA 3TWCH 2F8VA 4G7YL 4NGHH 5CFHA 4ZODA 3KPSE 1DSFH 1X6NA 4QRTB 1IAKA 1NAML 5FECB 4P2OB 4UV4H 3TBYA 4K7PY 4GXVH 2CXKA 3I6KA 3QWOA 3LN5A 4N5UA 3ET9F 4OCYH 4MVBD 1XGUB 1RURL 4DKDC 1LO0L 2FJFB 5D93C 4LVNC 3LPWA 2XQBH 2BY3A 4QKXB 1MRDH 4ONOA 2NTFA 3GSRB 4Z8FH 1ZAGA 5JUEL 4LFHD 3P4OA 1S9YB 4DEPC 1YNKL 1NGPH 5KSAB 3AUVA 3V4PH 2VZUA 1CLCA 3LN4B 4JFDD 1IGFH 3ARBC 3OKEB 3WN5B 3VXSB 4WHYH 1VCAA 2UYLB 3DO7A 3GIZL 4JFOA 2VSDA 3RGHA 5JHDE 2E7LC 2DQFA 1J8KA 2AK1L 3TNNA 3G9AB 4PRIE 1TQBC 3QG7L 4MJ6A 2ZG2A 3IRPX 5TFSL 2X4RA 2I07A 4HQQL 2H45A 1T03L 2GJ6B 4PGDA 4I2XA 3RNQA 5ICXB 3D9AL 5JNYA 1Q0YH 1UB5A 4URTB 1IGIH 1BOGB 4M3KB 4F80A 1H3UA 1FG2A 1KOAA 4FABL 1KIPA 3HZYA 1I7ZA 1KB5A 1L9NA 1JRHI 4NRXB 1RZJL 1WIPA 3BKCL 3MMEA 4HJGB 4MHHG 4BFEA 2ADJB 3VXNB 1I3GL 1AXTL 2W0FB 4UU9A 4NN7C 3DIFA 1AQDB 2DS4A 5A2LH 4H1LB 1F4AA 5F7LB 1S7UA 4APQD 1BQHB 1UM4H 2R56L 3VFPA 4Y2DD 1YEDB 2VE6B 1A4JB 4HWBA 4P9MH 2CRMA 4R4NC 3KPSD 1WCBA 2B0SH 5JIHA 1G7LB 3QNXB 1W2KT 3M8OL 4HIIA 3VDCA 5FYJE 2DTML 4HBCH 4NM4L 3QQ4A 1A14H 3WLBB 3U7AA 1WWWX 4K3DL 3T0EE 1FAIL 4N0UA 4IOIB 5HDBE 1L7IL 3C5ZB 4EQ2A 1GZPB 4WI9A 5I73B 4XPHH 5EWIL 4I4WB 1I1RA 4Z77B 4XBGA 5DUMH 4P9HH 1R3KB 4OUUA 4PJDF 5ILTH 4U1IB 4XPGH 43CAB 5TPWH 4Y4FB 2VR4A 3SDCC 5E99L 3VI3F 3SCMC 5LXGL 1IM9B 1CQKA 4U1HA 3R8QA 5F6HI 3DX9B 1IJ9A 1A7QL 3GSRA 1EAPB 5A16A 2XRAH 1S9YA 2GK0B 5KAQG 3P30L 1G7MA 3LB6C 2CDGA 3LN4A 3TPUB 5JHDD 1RK0B 5HYFA 4QNPE 1BZ9B 5LKNA 2R2BA 2BRRH 1YY8A 1FLRL 2EDFA 2GTZA 5F1SA 1QFWM 4MLIA 5BOZG 4S1DC 4ZFZB 1H3TA 3GMQB 4NOFA 1P7QA 1TZHB 3SGKA 4FFZL 4GKNB 2VZOA 1N7ML 3T0DA 5HYSB 1JGEA 2CIIA 1K2DA 3L7FA 3TT3L 1HKLH 5D70L 3V5HA 3CUPB 1F2QA 4F58H 1U8JB 4ZPVB 2W9DH 1IAOB 4KQ4L 3RPIB 1V7MH 3MLUH 3U7YH 1XH3B 4WRLA 4WFFE 1S9WA 2WP3T 1DLFL 2AEQH 1OTSC 4LQ1A 3GHEL 4FQQB 5F7DB 1O7VA 3AXLA 5FUZL 4WV1B 1FNAA 2VXQL 3QXAB 1BQHA 2X1PA 5FYJD 3QO0B 2K9UA 1GC1L 2VE6A 1BBJA 3LHPH 5TQ2H 2AV7B 4QRRE 4KHTL 3O3EB 3MRNB 4KZDH 3QHZH 5D7IA 3QNXA 4XVSL 2CLZB 1NKRA 3E3QC 3NCJL 1R5WB 2GK2A 3QBTB 1H3XA 2Q86A 1NLDL 2D9QB 1WZLA 2L4OA 4UT9H 4M48L 1IKFL 1LO3L 3OZ9L 2MOVA 1MJUH 3F58L 3C5ZA 4X7FC 1GZPA 1JRHL 3HUJE 5T1KA 1QFHA 4Z77A 3CXHJ 1R3KA 4ZAKA 3NPSB 4N0YH 2VSCA 4XCFL 5JHLL 2X4PB 4ODSL 1N0LA 4CVWA 1RIVL 4ZNEA 3OKDB 4RGOL 3MYJB 4D8PB 4I3RL 4GUPB 1JV5B 2CDEA 3DGGB 5TQ0H 4F2MB 4NZRH 3KR3L 4HLZH 4L9LB 2JCCE 4LARH 1AO7B 1RPQA 4WCYL 1RK0A 1L7TL 5ALBL 2IFGA 1R3IH 4KWUA 3C60D 1XF5B 1Q9WA 4U1SA 1RFDL 2EYTB 4Y5YC 3BSZH 2QJDA 4HUXB 1OD7A 3CC5A 5J1AB 3Q48A 5HDOA 4YHNB 2DDQL 1HOCB 2X4NA 2ARJB 3GMQA 3NIGE 2N4IA 5CZXD 4DN4H 1TZHA 1IC5H 3FONB 3I84A 2IPUG 4GKNA 4P46C 4LCUB 3BRFA 5HYSA 5C0EB 1WBYA 3DVGA 3GO1L 1OT1A 1OAZL 4MJ5B 1T5WB 1OCWL 3L5JA 5D72L 4E42B 1BVZA 3QEHB 4ZPVA 2Q8BL 1IAOA 4FQ2L 4FQ1H 3RPIA 2AEIT 2CLVA 3LD8B 4U6TA 1KYOJ 1T1ZA 3VE0B 3QXDB 1FNLA 3SGDH 1JPTH 4QRRD 3W39B 1G7JA 3BPNB 1KJ3L 4WV1A 5DR5L 3LQZB 1EFXD 5BZDB 4NJAL 2NXZB 3QO0A 4HCRH 2VUOA 4GKZB 4TYUA 5C86A 4C59B 2E9WA 2AV7A 3GM8A 2YRLA 3HFML 3HAEH 1CXEA 1I9RL 1I1AA 2P1YA 2ILLA 3JTSB 3H7LA 5E24E 1CFTB 1TVBA 4HAFA 3O8XC 4J3UA 1LDPL 1ZLVK 5JW4M 5EIVA 4N0CD 1ZT4B 3DX6A 1I85C 4J12A 3L95B 4HH9B 5FKAA 5JO5A 3BDYH 3CU7A 4X6FB 4JFPB 4LCIL 1DZBA 1T0NB 3TF7C 5D71H 2X4PA 2A1WH 5JA8B 4IHOA 1HEZA 5EORL 5HI5D 4U1GB 2HMID 3DGGA 4PY8J 2C3XA 3GJFH 1NCAL 2CRYA 4F2MA 1IEHA 3L1OL 1NGYA 4ZXBB 5BRZE 4UDTB 4YZFE 4WDIB 1AO7A 2GI7A 1A2YA 3GSQA 1LMKA 2GJZB 4PJIF 3EYVA 4FHBD 5CINL 3L3JB 2IPKB 5HBBA 3ZE0E 4JFZL 2EYTA 2CQVA 4WTZG 2AERT 3K4AA 3QNZB 3AMLA 3QRFM 4J3TA 4WJ5B 1E4JA 1X44A 2ZPKH 4WENB 4ZG1A 4WI7A 3WHXA 4M5YH 4YHNA 4OKDA 5E9DE 1HOCA 4DW2H 3GSUB 2EDBA 1W0WB 2EKSB 3MSPA 12E8H 3QG6A 5IM7A 1JNLH 4PRPA 2NY4C 2DJSA 5EZJB 3QJHB 1MELA 2P8PA 4C58B 2VXVH 3UZEA 4O9HH 4MJ5A 1T5WA 4E42A 4EIZC 4XPFH 4L1HA 1KTRL 3E2HC 3MLRH 3TJHC 5GRUH 1OAUL 2NZIA 2QQQA 3MLTB 3MRLA 3QXDA 5EBGA 4PTUA 1LO4L 3O9WC 3RVUD 4MJ2A 4JQVC 5F1IB 2OR7A 3LQZA 3SE8L 2P5EA 3QZWA 5FO9B 3C09B 4GKZA 3FZUD 2P8MB 5KBNC 5DD0L 2AJ3A 1YEIH 5ITBH 3VWKC 3LEYH 4G8EB 1XF1A 2OR8A 3BD4A 4G6FB 2ESVB 3QDHA 2Z35A 3LS5L 3KYAA 4Q9BA 4JZJA 3UTQA 3V8OA 3B9KD 3JTSA 4U1JB 4XNMA 4PRHD 4FFWD 4M7KH 1I9EA 1SJHA 4UUJB 1CFTA 3VXRA 1HNGA 1EZVY 1ZHBB 3BPLB 4K71B 4UT7L 1EBAA 4JDTL 3IF1B 2Z4QB 1YEGH 1CGVA 4HH9A 3JWDC 5KVFH 2MCPL 1A1MA 1BQLH 4OF8A 1T0NA 4S2SA 3MCLH 4FP8L 5BRZD 5DRZA 2W0KA 5JOPE 2VABB 4UT6H 4OGXH 3CIQA 1QYGL 1T7XA 2NNAB 3CZFB 4YHOL 4YXKH 5T1LB 4UDTA 4WDIA 2GJZA 3O6FA 3MLSH 5GJSL 2VDQL 2GY7B 5E9DD 1FIGL 1M7DB 1OP9A 1NCNA 3QNZA 3RKDC 4L4JA 2VWEC 4PV9A 3S35H 4EI5D 2YUXA 2DQGL 1AGBB 5LGHL 4QTIH 4OT1H 4JANB 5E8PB 1M71A 3QQ9D 1A7NL 4U1KB 4LHJB 2QQLL 1W0WA 4NKMB 5IBTL 4OCXH 5L2JB 4U1NA 4FQCL 1ULVA 3T0XA 5DT1L 5B22A 1NUFA 1PEZA 1F4WL 1D5BA 2WUBL 5EZJA 3QJHA 1E4KC 2Y23A 4E9LA 1Z9LA 1MFAH 1CDIA 1DVFB 2DLFH 1C12A 3TJEL 3DYMA 3TA3B 5ADOH 2BNQA 2CPCA 5F93C 5FHBL 5J12C 4ZFGH 2K1MA 3EW3B 3CD4A 3AU1B 2R1XB 3JSSA 1KELH 3MQIA 3V0WL 3WS6C 2QSCH 3TCXA 1CD8A 2A9MH 3VXTA 4BSVB 4K8RD 4N5EC 2P8MA 4Z7UE 1YMME 4WEBH 4QY8B 2PTTB 2X9XA 4GSDH 1G9EA 4WUUB 3CXDH 1I1YA 1SM3H 4G6KH 2HG5B 4U1JA 4G9DB 1ZHLA 4ODVL 3DHJA 4OQTH 5L88L 3MBXH 2YD9A 4LCCA 3LMJH 4UUJA 2DWDA 2A0LC 2XN9B 2JJWA 4M6NH 3FB6A 4G43A 4JFHE 4M7JL 3IF1A 5F9OH 5C0RH 3WO4C 1PG7H 4J3SA 4KJWD 1G7IA 4JM2F 5JOPD 3KPOB 2RHEA 1ND0B 4ZUSB 4JCLA 5F7EL 1RZFL 3QDMD 1DE4B 4POUB 4N8CL 5DZOA 4KDTA 4P2RB 5D2LF 4Y89A 1RIHH 5FF6B 2VMFA 1JGUL 3HRPA 3IDMB 3EDEA 4P4KC 3SKOB 4HD9A 3CZFA 5SWQA 3EDDA 4OLEA 2PKDA 3EO9L 3BKJL 2Q8AH 1KEML 3RVTC 4HXAH 1CICD 2DLGA 5EOQH 1EJOL 3RWHA 1AR1D 2OQJB 1C08A 43C9B 5L0QC 2GTWB 1T2QL 4UINL 5MERA 4YHZL 1U3ZA 4CAGA 5IB2B 1N6QL 3V6FB 5AAMA 1TCRB 4JANA 5E8PA 4X80L 2J5LC 4L9DA 4Q0XH 3IAGC 1QEWA 4U1KA 2XA8L 4PYGA 2C7UA 3INUH 4YDJB 2YPKA 3E8UH 4I0PB 4RAUA 4NBYB 4JHZA 3U4BH 1HYRC 3FT4B 4XBEH 3BT2H 3FMGH 4QRSA 1W8OA 3CH1B 1JWMA 4HJ0C 1DVFA 5HHXL 3VJ6B 1C5CH 3S88H 2VDMH 1FSKB 3RVXD 3WNLA 1CT8A 3DMMD 4M43H 4XP4H 4DUVA 4J4PC 1VFUA 1YPZE 3C8DA 2KQMA 4JKPH 5KSUB 1I9IH 2R1WB 2VR9A 4LKCA 3S36H 2YMXL 3AROA 1DN2A 2F5BH 2X4UB 5BOPA 1YMMD 5GS0C 5EA0L 3BHBB 2DB8A 1IAII 3ZYZA 4F8QA 4BSVA 1JYVA 1YUHA 4IIQB 3LH2H 2IFFH 2EDLA 2A6JB 4HIXH 4DJMA 2PTTA 1HSBB 4E0RA 3RX7A 1RY7B 3V6OA 5A40E 3EOBA 1UC6A 2VUYA 4ONGL 5C09E 1WAAF 2HG5A 4V1DA 5JR1H 5C2BL 5IVNA 5BZWB 1R5IA 5DD6B 3IKKA 4KTEH 4W68A 1ZTXL 2XN9A 1NAKH 25C8H 3O41A 4X5LA 2V2XB 5F96H 4C54A 4KRNA 5I9QC 4LAQH 2ADFH 1RMFH 1U92A 3HNSL 3IDUA 3EHBC 5D1XB 5IMOB 5KJRH 1QSED 2QBWA 4YR6B 1MF2L 4P2RA 4JM2C 4U49A 2HVJB 5DEGB 2FWOB 2NY0B 1W72H 3KJ6H 2X2YA 3VA6A 2DQDL 1KLGA 1U9KA 3RZCB 1DUZB 3UC0H 4L4VB 2NXYC 5IOPB 4Q7DA 3SKOA 4LSUL 3DJ9A 3MJ7B 4YWGL 2BY0A 3DVFA 1EHNA 2FBJL 4LSQL 4OF3A 4D2NA 3LEVH 4LLMB 1MFDH 2DM3A 2HLAA 3BZFB 4JB9L 2HLFD 5K9OB 3OGCB 1F8TL 3MRGB 3IDIB 1XGTA 3H42H 1T3FB 5JZ7C 1SEBB 4JPWL 3PDGA 3HMWH 1MRFH 1MI5E 1JGVH 2UUDH 2YUWA 5C7XL 1LWRA 4WI3A 4X8JB 3NAAH 4U4BA 3GSNL 5LWYH 3ARRA 1HWGB 1UJTA 3CFKB 1UWEH 4GAYA 1FFOA 5GZNC 2FB4H 4MCYA 4S1RH 5ID1B 2LTQC 4IMLA 1M7IA 3V6BR 1C5BH 1FC1A 4MAYD 2EYRB 2VKWA 2HKHL 4F33B 5B8CA 2DI8A 3ARUA 3VJ6A 2AK4E 4EUPB 1UEMA 2UVEA 3H0TB 4P49A 3Q5TA 4JN1L 3L7EB 1W0VB 3SQBA 1K3ZA 5KSUA 5E8DL 4MJIE 2R1WA 4UNUA 5TDPB 1DP0A 2X4UA 4AK1A 4UIKH 3X3GH 3BHBA 3QCVL 1JZ3A 3BE1H 5C09D 3OMZA 2W92A 5GGTL 4TOYL 1LK2B 5IK3A 4ODUB 1MWAB 2Z8RA 4QRQA 3CGTA 1BZ7B 3FHQA 2HWZH 5ICZB 4H88L 5HY9A 1L0QA 1MREH 4M3JA 1WCQA 3JVGA 5DD6A 3GRWL 4WNQA 4WU5B 5IJKA 4HC1H 1EGJL 2P24B 1NANH 4KKBC 2V2XA 1EXUA 5AUMB 3NA4A 3B9AA 1A7BA 2WWKO 4APQB 5DD1H 1F02I 4Y2DB 3BQUD 5ICYA 1TJHH 5CHNB 4AEFA 4ZUVA 1IAIL 4YR6A 1EFQA 4OZGF 3I75B 1VADB 3KPSB 2HVJA 5ITFB 3S37H 1HHIB 2VN7A 3RZCA 5CJOL 3U36B 1CFSB 4Q9CA 2AAVA 5B38G 2D0HA 5E00B 5D7JD 3QI9C 1AJ7H 3IDYB 1XF3B 2IH3B 1TQCB 4M62L 2M8XA 1U42A 5DMJB 3BO8B 2ARWA 3BZFA 1MI5D 2VAJA 3LS4L 2R4RH 1LE5B 2DYPD 3NVQA 4LKXB 3A67H 3IDIA 3KYMA 4XCNB 1RUML 1MJ7H 1YYLH 2BNUB 3IFPA 3MA7B 5FOJA 2I9TB 4K3EH 1UJ3B 2X7LB 3UBXG 3NA9H 1RUQL 4Q58C 4YXLL 3MODH 2AK4D 5E1AA 5C0DA 4JN2B 4K07A 2RFXB 4JFDA 5JHDB 3RQ3A 3EYFB 1VPOL 2EYRA 3P0VH 4MJID 4PRIB 3MJ6A 4FXKB 1UA6H 1NGXB 3S4SG 4HMDA 5EBWB 4O02L 3JBG7 4EUPA 2ZCKH 3B8YA 1W0VA 3L7EA 1CDBA 2F74A 2V5TA 3MREA 3NCFB 5I1KL 3U30C 3FO9B 3OR6A 1X5AA 2Y6SC 1AHWC 4UTBL 3PWJA 5HSFA 5JQHC 2PYFB 2C4FT 3BUYB 4POZC 2DJ4A 2C3HA 3S3SA 1QVOB 4PJFF 2EDEA 4MS8D 3RWCB 4YPJA 1A64A 5IEKB 3ZL4H 4NHCH 5ICZA 4JO4H 3SO5A 3CDFA 4Q9QH 3O45A 3ARYA 4MSWB 4OF6A 1T66C 3IJHB 3MRBB 2DKMA 5F44A 2C3VB 5BS0E 2P24A 3ME0A 2C4XA 3MCKA 2JLLA 2VLKD 2WWKT 1BFVH 2ZSWB 2WBJB 5DK2B 3G6AB 2VZSA 1FO0B 2JJTC 4RISL 4WTZA 1P9MA 5K59F 4Y2DA 1KTDA 4LLAA 2GY5A 1CD1A 1U6AH 2VQUA 1KBGH 1R3HA 4PB0L 3T0EB 4CMHC 3GMLB 3GK8L 4MWFA 4HWZA 1M7XA 5ITFA 4YBHA 1HHIA 3HZMB 4GS7C 4HT1L 3U36A 4NT6A 5MEQB 3MRHB 5E00A 4OLYL 2OJEB 3EJYC 1XF3A 5KVDH 4NQSB 1LNUB 2IH3A 4PJGB 4UTAH 3ILPB 1IGTA 4F15B 4K94C 1FFQA 2HT4D 2HVKB 3FOLA 2VQ1B 2O5YL 4LKXA 5DQJB 3WJLC 3KXFA 5I66B 2J12B 2NY3D 2ED9A 1CGWA 3HR5B 4CKVX 3C5JA 1UJ3A 2X7LA 3BISA 3FFCA 4LF3B 5GRXG 2YK1L 2OI9C 3UJTH 1ADQA 1FE8H 2VXSH 4JREB 3QPQC 2ITDB 4AEHL 3MFGB 2EIZB 5JHDA 5LGJB 3HC3H 2VITB 2A38A 2D2OA 3C60B 1J0HA 3QUML 4DTGH 1NGXA 2VDLL 2H8PB 5EBWA 1FZMA 4D9LH 4OLXH 3PG2A 4U7MA 4Z5RA 3W81A 2E27H 2B5IB 3V8CA 4ZQKB 1U3HA 3UJIH 5E6ID 1RHFA 3FO9A 1AGCB 1VACB 2PTUA 2ZCLH 4GO6B 1MCQA 2BZDA 3TGXA 3Q3GB 4YBQD 5TF1L 5EU6E 1DFBH 1WF5A 4IDJH 1QVOA 4XCEA 4M9OA 1YJDC 4MA1B 4YDVA 4Z7NE 2D7QA 2ENYA 2FATH 5BS0D 5J1SC 3RWCA 5IEKA 4Z7VE 1T5XB 2A77H 1UXSB 3IVKA 1KN2H 3HKFA 1QKZL 3BP4B 4HDIB 4UNTA 2WINB 3MRBA 1GRWA 4UNVA 2FL5B 1BEYL 4QRRB 3SO3B 4R97C 1X5GA 1T0MB 4AJ0A 5D4QA 2CKBH 2ZSWA 4YGVA 1EFXB 3G6AA 4X9FA 2R0KL 4YK4B 4NDMA 1D6VL 3MX0A 4NZUH 4ZO7A 4QHLB 3ZDYF 4LBEA 1AI1L 1IM3B 5EU3B 3FAWA 5FM8A 3HUJB 1I7TA 4DN3H 1IEAB 4Z78A 4U6HA 3D0LB 4WVRA 5GRVL 4NN5C 1R3JA 4PGBB 4X7CC 5MEQA 1UZ6E 4D9QE 2OJEA 5DTFA 4PJBB 2EDOA 1LNUA 3TIDB 3MV7E 4PJGA 3L3DA 5L2KE 1DBAH 3ILPA 3QPXH 1T6WA 1M4KA 3ALXA 3EBAA 2HVKA 5J13C 2VQ1A 1E27B 3MBED 4OCWH 1BVKB 5DQJA 3TVMD 3ROOB 5I66A 2DBLH 2C5DC 5DJAB 3UMTA 1IL1B 5DJ8B 3I6LD 3QXUA 4JFEE 4C4KO 3GRWA 1EV2E 2HFEB 5KZCB 1BPVA 2KH2B 1UG9A 3HG1E 3MLWH 4HKBB 4QT5B 4NCDA 3HS0A 4DAGL 3C60A 3SBWA 4MQ7B 4X0KB 4YDIH 4NQXB 5I71C 2O93L 5FCUH 3K1KC 2A83B 5IB1A 4DZ8A 1TDQA 3BWAB 2NLJB 4P3WA 5CMAB 3KAAA 3IDJB 4I1NB 5EU6D 2VDPL 4ZQKA 3OQ3B 1XT5A 4RMUA 3WNMA 1NJ9B 3FTGB 1REIA 4I9WD 1VACA 3SDAA 4R4BA 4EIGB 4FQHB 1UCTA 4KRLB 2J8HA 5BMFL 4HWEH 4MZ2A 4KRMB 2EXWD 1KB5H 3VFGL 5D7IF 2OM5A 4I3SL 1S9VB 4YFLF 3TBWB 1A47A 1TZGL 1T04A 4XWOC 5D1QA 1U8IA 3MROB 3UTZA 3KPPA 1OARL 2VDOL 4JY6B 3BP4A 4JFXB 2WINA 4HFUH 1XEDA 3B2UD 4QRRA 1CLYH 4KI5E 1FQ9C 3L3IA 3JWNC 1T0MA 3W2DH 4Z95L 5GZOD 3FO2B 2E6PA 1BF2A 2YUZA 1ONQA 1OAQH 1B0GA 3B2VL 5I76B 2VLJE 4D9QD 4LVOB 1IARB 3DSFL 1SJVA 3MV7D 3MR9B 2FLRT 1IEAA 2ED8A 1X4YA 3B9KB 1YNLL 4GBXD 2R0WL 4PGBA 1K85A 4PRHB 2VIRA 3S5LG 3DUUB 5T33H 1HHJB 3VFUB 3RU8H 4LVEA 4PJBA 2VDNL 5JIPA 1E28A 1DL7H 4M7LT 5AZ2L 3ARQA 3QUYB 1N64L 3LKPA 4ZO8A 1L9MA 5GS1B 1U3JA 2AJVH 4X5WB 32C2B 3ROOA 1JZ6A 4YUEH 2BHUA 5BRZB 4F3FA 5MENA 3AM8A 1OSZA 3OTTA 3LQAL 1JPGB 4MD5B 2F58H 4NJ9L 1OLLA 1LO2H 5DJAA 4C4KT 3DVNA 2RJMA 4BFGA 4Z76A 1OPGL 2WIIA 4LL9A 3SGKC 2OL3L 1PDKA 3CLEH 5B4MC 3GGWB 4LSPH 4PJEF 5E9DB 4MQ7A 4X0KA 1G6RL 4D0BA 3SDYH 3STLB 3CVHL 3BWAA 5FGCE 1B3JA 4EI5B 4L3EE 5A2KH 3GSVB 3IDJA 1JI2A 2YRPA 5IFHL 3DX8B 3QCUH 4YHMH 1Z0NA 1YEKH 4OIIL 1NJ9A 5F8RC 5I1JH 2Y25A 4HF5H 3HE6A 4X9GA 4OB5H 4DVRL 1ES0A 1N26A 5C1MB 1MUJB 4JZOA 2ICCA 2J6EH 3STBA 3UO1H 3KG5A 1J05B 1F4YL 4HS3A 3LKSB 2VC2L 4PY8I 5DMIL 4XNZB 4KI5D 3TBWA 2V5YA 4P59H 4OZHA 1VDGA 3TCLB 5JORB 1QD0A 4K9EC 4MB4A 4OI8A 1AE6H 2J88L 3T3ME 3MRRB 4ELMA 2OP4L 2VLJD 15C8L 1TFHA 1JCKA 4QCIB 1ZV5A 4NKDB 4OJFL 1KCSL 4YNYA 5HI4D 5GRJH 1KJ2B 3C5ZC 4K9EH 5B21A 3PWLB 5I8EB 2YXMA 1QFUL 1JF6A 3IRZA 4IRSD 4PJ8D 4MD0B 4ZAKC 3MO1B 4X6CA 1T7ZA 2B1HL 3B9KA 3F5WB 4WGWB 4PRHA 2B20A 1KSRA 3P9MA 3MACL 3RGVD 1CE1L 5B3NA 3QYCA 3BN9D 1CFVL 4RIRB 1H15B 3SGJA 2K3TA 3KYNA 1F58L 3VFTB 3VXUE 4LSSL 4FZEH 1ZLUK 32C2A 4KU1A 1RZ8B 1B6DA 5JDSB 1IQWH 1KTKE 2EO1A 2P47B 4P57A 2BSSB 4NBXB 4PRNA 3P3YA 4NO5B 3OR7B 3MFFB 3V7AG 4X6EB 4U6YB 5KSBE 4J6RL 3SY0B 1IZKA 4HG4K 2YOCA 3U0WL 4XCYB 4L3ED 1CICB 4W70A 2NMSA 4I18B 1CTOA 1GL4B 5AYQA 4XXDB 1IGCH 4QF1A 4NWTL 3TFKD 3VMNA 4KAQH 5CD3A 1QG3A 4P2CG 4JHWL 8FABB 1XR9A 3Q2CA 3DX8A 3ECBB 5FDYA 3MUGB 4ZFOL 1TITA 3WNKA 4OM0H 5L9DH 4MDJA 4GAJL 4N1EA 4AM0A 3QUZC 4GMTL 1MUJA 1DLHB 1F6FB 1J05A 4WV1C 4KVCH 5IWLA 3LKSA 1FNGB 2AVGA 1VEOA 4KROD 5AG9A 1Q9OB 2E9BA 2BP3A 3DMMB 3TCLA 5HPMA 3K2UH 1I1AC 3RX5A 3QO1A 1VFAB 4XNUH 3MRRA 5B38A 5IJVA 3FN9A 3JV6A 3MRDB 5ALCL 1CF8H 1YMMB 1HQRB 5KVEH 2EDWA 3ZE1E 5IV2A 3VGBA 5C6WH 3LKRB 1KJ2A 5M94B 2V2TB 2Z31D 5DFVC 2Z9TA 1ZA6A 3O6ML 1IFHL 1D6EB 5DD3H 4NQUA 5IFJA 3K46A 1VHPA 1JHLH 3MO1A 5H8DA 5F89B 1VGEH 3JWOC 3F5WA 4PRAB 2GIYA 1JNHB 4MXQD 3DTXA 3UBXA 3VXUD 2VKXA 5FEBA 1GCFA 4LRIA 3O0RH 4KKLD 3OL2A 1CTNA 4L8SB 4EN3D 3REVB 4R90L 2BJML 4MLSA 2ICES 3ARTA 4NQCA 1LGVA 4FQLH 3HB3C 2XWBB 3QDMA 5I8KL 1QSEB 4NO5A 3QFDB 3QIUD 4U6YA 4GKSB 1B4RA 2B4CL 1XZ0A 5JW4N 1H8OA 5IHLB 3RTQD 3N1PC 5EZOL 4WUKH 5CZVH 1WZKA 5JXEC 5F7UA 3ZZ1A 1CICA 5FYKL 3DRTB 4I18A 4ETYA 2XT1B 5CP3A 2YBRA 3TIEA 3LY6A 8FABA 3KVQA 1D9KD 1Q94A 3PWUB 4DKFL 2DQHH 4RFNC 3ECBA 1IAIM 4IRJD 4AY0A 5GHWH 1RZKH 4K7PH 4Y4HD 5I1GL 3HPJA 1T21B 3OGOE 3L3HB 1DLHA 3U6RA 1YPZB 4OFPA 2C3GA 3BPNC 1BJ8A 4MAYB 4G9FD 1U8MB 1HHKB 2X4TB 4OBRA 2GFBA 2NTSP 3MC0A 1RV6X 3D25B 3PDDA 2HTLD 2AEPH 4UILH 4XRCB 4X9BA 1NDMA 4UOJA 2I5YH 3DMMA 1U8LA 2YZ1A 3D2UD 4X4XA 1HYSC 4CUCA 1FPTL 4JZJC 2PUQT 2ZKHL 5LBSL 1P4BL 3LZFH 3SDXA 4O2EB 5CILL 1OGAA 3LKRA 4U7SA 3C6LB 1CL7H 5C09B 3EJZC 3FAXA 4P2YA 4OFKA 1BWWA 1VESA 2DI7A 2Q76B 3EYQD 4PG9A 5H94A 1MLCB 3M17A 1FGNH 1D6EA 1G6RA 2XTLA 3MLVH 1CQYA 1SEQL 3KNBA 4PFEA 4O51A 3CVHA 4C57C 5H35B 3CSYA 3J8F7 3HI6L 3ULUH 4HULB 1CZ8L 3MUJA 1A7OH 3VGDA 1TPXC 5GS2H 1MQKL 4DGIH 1KT2A 4MNGE 1RIUL 4AEIL 2B1AL 3EYUL 4U6XB 5FKPA 1GGCH 4OV5B 3O6FC 5C8JA 3BQUB 1NCUA 3CFDB 3A6OA 1QSEA 4XPTH 1DBML 4HPOH 2CUIA 1GC1C 3GI9L 4R8WH 1F4XL 5CBEA 3QFDA 1VB9A 4GKSA 3TWCL 5LVEA 4NGHL 4M1CC 5EU5A 4ODHL 1DSFL 2BVQB 3FN3A 4HLZG 4UV4L 5D7JB 4MXVE 4GXVL 4PJCE 5E4EC 4HIHA 2JE8A 4RFOH 3F8UB 2VERN 2Z92B 4OCYL 1DQLH 1N3NA 1MI5B 3OJDB 4H26A 3TN0D 5CP7B 4FQXD 2DYPB 4TSCH 1FV1A 2XQBL 1X5XA 1MRDL 5JPNB 3DNKA 3BI9X 4GW1A 3PWUA 4Z8FL 1U36A 2BY2A 4JPVH 1BREA 1FORH 3O4OC 4HUUB 5C9JB 1NGPL 3HRZA 2MKLC 4PJ9D 1T21A 4NUJB 2AK4B 1YEEH 5JMRA 3L6FB 5C9KA 4EVNB 1X5IA 4MJIB 4MMXC 4QRUB 1OF2B 1HHKA 3BKML 4YHLH 1UM5H 3D25A 4DUXA 4GRLD 5J6GB 3VXME 5D1ZD 3VWJD 2GJJA 1MFBH 3BJLA 5TF0A 5KAQF 4MA3A 3TBVA 1ZHKB 2WBKA 4NN6B 4LCCC 1I1FA 1E4WH 1ACYH 1Q0YL 4PP1C 1IGIL 1OAXL 4K71C 3BH8A 3RWGB 5JW4R 1MLCA 1TMCB 3HAEG 4M5ZH 2NY1D 4BH7A 2P48B 5H35A 1BLNA 3BXNB 4Z7WA 4OKVB 4FFVD 2H2PC 4KDTC 5F3BB 2R2HA 5IBLC 4XP9H 3RL1B 1YMHA 1UM4L 2DOCA 2PN5A 4KTDH 2VLKB 2NX5E 3L3KB 4ODBD 4P9ML 4U6XA 5J9PA 1B0RB 3DX7A 2MQCA 4B0MM 3D5OF 3RA7L 1HQ4B 3ULSA 5DJ6B 5DMKB 3C08L 3DV6B 1PZ5B 3QNYA 4HBCL 4M7LH 4OFDA 4RGMB 1A14L 4H0IA 4KMQA 1S9XA 4XPHL 1KN4L 5D7JA 1R0AH 3JXAA 2DLTA 4CVZA 2Y07H 4KK9D 1MAKA 5DUML 2MCG1 1GZQA 1C5DA 4JR9H 4P9HL 5ILTL 1N4XH 3OJDA 1MI5A 2FIRT 5HI3D 4XPGL 1WISA 5TPWL 1J0IA 1LP9A 2DYPA 1FVDA 3KHQA 3V95A 2NY3B 1UKQA 5BVPL 2PO6A 2XWJA 5KSVB 5FDWA 2XRAL 1CD0A 5C9JA 2V17H 3GBMH 1AQKL 4FMFA 1F6AB 4NUJA 5HTSA 4W4NA 1MHHB 3I50L 2BRRL 1QBLL 1N5AA 4EVNA 2G9HB 4XNXH 4MJIA 3SGDI 3PV7A 4RZCA 4TSAH 1FL6B 1G7PB 1SQ2N 3ARED 4U0RB 2Y7QA 3V6OC 1KEGH 4DGYL 5LQBL 3CX2A 2WANA 1NMCB 2E9JA 5E6IB 3DPBA 3ETBF 3OB0H 3G5ZA 4DCQB 3RJDA 5F88B 5FGSA 1HKLL 4PLOB 4P5MA 3F12B 1LE9B 3H3BC 4IMKC 4F58L 3G5VA 4HIEB 2IQ9H 1D5XB 4GKOA 2PCPA 2P5WE 1V7ML 2HT3C 3MLUL 3U7YL 2J4WH 4WW2B 2VAAA 3C8KB 3AGVA 5BS0B 3V0AC 1MOEA 4Q2ZA 1VEPA 1ZVYA 3G5YA 5CGYC 2AEQL 2NX5D 5F3BA 2Y5TB 3HNTH 4OZFB 3S7GA 3C87A 4JEGB 3RL1A 5I1DB 4NWUH 4HS6B 3RDTD 5CWSA 3FO1B 2VLKA 3L3KA 4WW1B 3LHPL 5TQ2L 1B0RA 5DJCA 2EIEA 3BWUC 4Y88A 3ZYJA 3D1MC 1INQA 4ZSOA 1HQ4A 1NL0H 2UV3A 1YY9D 3PF2A 4ONHB 1PZ5A 1YDPB 3WDHA 2IPUK 3W5MA 1UFUA 1UQSB 4KMTH 4UT9L 5HYQA 4YIQA 1MJUL 1XAUA 1A6VH 4WWKD 4I13B 4D0DB 4PGCA 1J88A 3K8MA 4KUCD 4XAKD 2AJXH 4OFYD 4N0YL 4S0SD 3NH7L 3N85H 4NZDA 4F9PC 5DDHB 2W65B 3MBEB 3TVMB 2P7TA 5EBMA 5HHNB 5B39B 3V9FA 4YH6A 5B8CC 2FBOJ 5KSVA 1FSKC 2XICA 5TQ0L 5IVXE 4NZRL 5CZKA 3F7YA 1Q9LB 4PLKC 3W0WE 5TH2B 4LARL 1F6AA 5LJYH 1BD2E 4JG0H 1Z3GH 4M6MH 1R3IL 1MHHA 2CDFA 2Z8SA 3P40A 5DS8A 2F54E 5DQDH 3BSZL 3IFNH 5SX4H 3ARXA 3WBDA 3HNVH 2HT2C 4R0LB 3NGBC 5HVFB 2AGJH 4HW6A 4J3OC 4ZOCA 1FL6A 4X5XB 4LU5H 1YEJH 4DN4L 5EU6B 1IC5L 2XFXB 1I8LA 1EUUA 4UZGA 3I02B 3T1FB 1VFOA 5E6IA 5TE7H 2VLLB 3JVGC 2Q20A 3HPLA 2ZG1A 5IJKC 4Z7VB 3IFOB 4XMLH 1LE9A 4M6OH 2BOBB 4FQ1L 3QUXD 2ADIB 5E8EB 4WW2A 2AJUH 3O3AA 4FG6C 4LP5A 3WFCH 4OGYH 1X4XA 3IB4A 1WBZB 1JPTL 3WL9A 1J9CT 2NY0C 3U0PA 4JRXE 2ICEB 2OTUB 4HCRL 5E1HB 3GIVB 1LEIB 2GSGB 1JYWA 4WW1A 3KPRE 3KLAB 1MCPH 5CIPB 3VXQB 3QIWA 5K9QG 1A22B 3QFJE 1YDPA 4FXGB 2NW3B 2VJXA 4LDLB 3MV7B 5L2KB 4MVBC 4P5KA 5EULV 4ZPTB 4LHUD 3BP5B 3TO4B 2QQKH 4GBXB 3N06B 2LFGA 4U33A 5DHVB 4M7ZB 4D0DA 3NABH 2OTPA 3BDYL 1RJLB 3MJ8B 3IAQA 4KPHH 5DFTA 2HJKA 3FT2A 5BV7B 3MV8D 2G60H 2E3VA 5D71L 3U2SA 5C6TH 4JFEB 2A1WL 3TVMA 2FIKB 4WTXA 5HHNA 4KZEH 1BD2D 4P23A 3SDDD 4XI5D 1QZ1A 3ZDXE 4NIKB 1H5BC 5KVGH 3ULVF 1G9NC 2F54D 2IAMD 4HUKB 1CDHA 3QA3A 5TH2A 4M9PA 4PJ7E 3VCLB 5T5FH 3EAKA 2FR4B 3SE4A 2YA1A 2YD1A 3OG4B 4LASH 2VL5A 1G9NH 1CXLA 4EUPH 3FRPG 5EU7C 5FYKE 4P48A 3MNWA 2ZOLA 4A2MA 1RZGB 2BOCA 3MNVB 4WI5A 2ZPKL 4Y4KD 5E6YA 4YDKH 1MIEH 4M5YL 2IGFL 3X3FH 4X5XA 3T2QA 1MPAH 4DW2L 4TTGA 3RI5F 1FBIH 2M26A 3Q1SH 5EOTB 12E8L 1JNLL 3RWEB 3I02A 3MJGX 1CLZH 4HG4J 1WSST 4JHAH 1F4HA 1MWAH 2VXVL 1AC0A 4O9HL 3IFOA 4UOW1 4EXPX 2H32B 2A6IA 4PJHA 4KI1A 3UZVB 3B3IA 4XPFL 3P0YH 2E6QA 3OV6A 1OGTA 2PW1B 3C6SA 4UB0L 4Z9KB 5SX5H 2NY6D 3RI5K 1P9MC 2UWEA 1OP5K 4LSRH 1H8NA 3V0VA 3KPRD 3HI1B 4OTXH 5BW7A 3WIIL 3BFOA 3HE7D 4XPBH 1PKOA 1W0YT 2OTUA 5K9QI 2VLJB 1NC2A 4PJGF 4OZ4B 2XOTA 3QFJD 3FN0L 4QO1A 1LEIA 2WIMA 1YEIL 4L3CB 5ITBL 3U4AA 3P2TA 5FK9A 4UDUB 2OZ4A 4O2FB 1QSFD 4WEUD 1X5KA 4MDIB 4G8FA 2DQEH 1X5LA 1PGRB 2FO4B 1T7YA 2IH1A 3PABA 2IEPA 1T1XB 4AENB 3QHFH 4IRSB 3MV11 3DYOA 4M7KL 3BYYA 1INDH 5FUOH 1NPUA 3BP5A 4DK6A 1MEXH 3IU3B 5DO2D 1UJ3C 3VRIB 1YEGL 5D96B 2ZCHH 3LV3B 4P4RB 3RGVB 5KVFL 1RJLA 1T1YB 4M8QB 3MJ8A 1XF2B 1BQLL 3ABZA 3T2OA 3MCLL 2C1OB 4H5SB 3L5WB 4XH2A 2MQ0A 4OGXL 2Q7YB 4LEOB 5EO0B 1H0DB 4Y5XB 4YXKL 4MNHA 3ARDD 2DQTL 1BIHA 3VCLA 4QHMB 1ZGLP 1NFDA 1BAFH 3ULVC 1U3HC 2XQYK 3MLSL 4G80B 2FR4A 4YJZL 3NBNA 3O3BB 5D2NE 1A5FH 4F37F 5FGCB 4L3EB 2YA0A 4NOBA 4L8BA 4TUKL 3D39A 5DHXB 2IMNA 4U31A 1YN6B 3S35L 1JZ4A 3B4NA 4QTIL 4TVPD 4OT1L 5J3HD 3RWIA 1A3LL 1EK3A 1T89A 4LLDA 4ZO9A 3BIBX 4M61B 3RWEA 5GRZA 4F37K 3R8BB 4BQ6A 3CFEB 5ABDE 4XXCA 5C2UB 3VFNA 3TT1L 3BDXA 2W60B 4HEME 2Z91A 2H32A 5ACZB 1MFAL 2DLFL 6FABL 1T80A 4MB5A 1S7RA 2C4FU 4NNXB 5ADOL 3LDBB 5EUOB 4ZFGL 3MRKA 4KROB 1QP1A 3D69B 3CDYA 4ZUTA 1K5NA 4PBVC 1JZ2A 1KELL 2IANE 2XNAB 4FQIL 1ZGLA 1BM3H 4PJBF 1R24B 2QSCL 5FYJH 1FO0H 3OHXB 2A9ML 3H6JA 3T2PA 4WEBL 4UDUA 2Z31B 4O2FA 4GSDL 5IB4A 2IBGA 4MDIA 3ARGD 3ZO0A 4J8RB 4FNLL 4L5FH 3CXDL 1SM3L 4G6KL 4LPYA 4MXWH 4X6DE 3GMNB 4PJ8A 4OQTL 1HCVA 3LOWA 3MBXL 4NP4H 3LMJL 2OMBA 1O7SA 3D0VB 4JO3H 4QHKJ 4M6NL 3LVEA 3MV01 4RFEA 3VXUB 2CIKA 2DTSA 5TGBB 3VRIA 4S0TD 4NM8H 5F9OL 4EEEA 1PG7L 5C0RL 2UZIL 1URLA 2CUMA 3LV3A 4EN3B 4ENED 1HH6A 2CK0L 5ELIA 4WHTB 2A6KB 4JZNB 5HYJE 4QOKE 4PJXE 5I30H 5BQ7A 1DQJA 2V7HA 2EDRA 4WHCA 5KSBB 3HCVB 2W9LA 4AL8L 5L7XL 4H5SA 2J8UF 1CGYA 4IRZH 1MFNA 2ZUQB 3C60C 1XGPA 4L4TA 3SBWC 3NIDE 5DLMH 2F53E 1EJ6A 5EO0A 3UEZA 4JKWA 3QIUB 1YZZA 4LGPB 3VMOA 3MOBH 2Q8AL 4LVHC 4G42B 4HXAL 2EH7H 5EOQL 3LSOB 4G80A 1UWGH 4HCRA 5CZXC 3SDAC 1KIUA 1P5UA 5HGHB 5D6CB 4Y19A 3HAEA 5HGAA 4OZHF 5TE6H 5B3JE 3WKNA 4Q0XL 4JGUA 1KXTB 4ERSL 1D9KB 2APFA 4HGWA 3INUL 4ELMF 3E8UL 4IRJB 1RZ7H 4LHUG 4M61A 3MUHL 2DKSA 5D1QC 2FD6H 3U4BL 4NPYB 3CFEA 4XBEL 3BT2L 3FMGL 3FQWA 3DBXB 3OAUH 2VZVA 3ARBD 3NMEA 2X4SB 5C0AE 3T4YA 5I6XC 5IT2L 3NFNA 3FQTB 3WUWG 3ZHKA 5E8NB 1C5CL 1UZ8A 2IAND 2VDML 1KJVB 4R3SA 3S88L 4XP4L 4LSVH 3BIAX 5IB5B 5EUOA 1NANI 4X6CF 5KSAD 1I9IL 1LEKB 4HKZA 3S36L 3D2UB 5E94B 3T09A 3WLWC 4U3HA 2H9GB 2JIXA 2XNAA 2A74A 1U58B 3R1GH 2MMXA 3PIQA 3FRUA 2AKRA 3OHXA 5I8CB 3LH2L 2IFFL 4O5LL 3UTPE 1B88A 1MFCH 1T4KA 4HIXL 5I17B 2Z31A 3HZVA 1RU9H 1UACH 1MAMH 4X9HA 4J8RA 2MJWA 2X1OA 1QLEL 1H3GA 3B43A 1NCWH 5JR1L 4FZ8H 2UVFA 4QOKD 1J1OH 2HFGH 3H7BB 4KTEL 3DURB 1JPFB 5CUSH 1NAKL 25C8L 4WI4A 5DJ0B 4JDZB 5TGBA 1U41A 5F96L 1EEZB 4EN3A 1VKXB 4LAQL 2ADFL 2A6KA 4JZNA 4WFHD 4F7TB 1RMFL 5L6YH 1JUFB 3HCVA 2M2DA 4R4ND 4HHAA 1CDCA 1II4E 4DKEH 1F3JB 1W72L 3WFEH 1U8NB 3UC0L 1V05A 1AIFB 3STZB 3LEVL 3RTQA 3LSOA 2ARJQ 1MFDL 5DD5H 1KCRH 3E3QE 3HE6C 1YEHH 5DEFB 3TBSB 1BFSA 5HGHA 3RVWC 3DGCR 1JP5A 2O26U 3JV4A 2AXGB 4OFIA 2OR9H 4FQXB 3H42L 1Z5LA 3G08A 3GKZA 1QBBA 3BZ4B 3SDCD 3HMWL 1MRFL 2C1PB 4Q6IC 3K1DA 5C0AD 3NAAL 4ZUUA 3BGAA 1KPUB 5LWYL 1UWEL 2ZG3A 2FB4L 4IRJA 4PB9H 3O3UN 4YHPA 5E2VH 4S1RL 1IEBB 2XZZA 4HK3N 4PJ9B 4Y4HA 1C5BL 1P7KA 3AMKA 5EG6C 4Y4FD 3BGFB 4PJDE 2X4SA 5ETUA 1ZEAL 2AQ3A 1AKJD 3RVUC 3FQTA 5ACMA 5E8NA 3AB0C 4PJAA 1FYTE 1KJVA 4GAFB 1T1WB 4G9FA 3CFBB 3VI3E 4X7TB 1MH5A 5IB5A 2H3NA 5SWSE 2I27N 1WC7B 3UYOD 4GRLB 1A9EA 1JF1A 1QBML 5F70A 3UTPD 3D2UA 4MJ4A 4S1DD 3TZVB 4G6AC 2H9GA 3MRIB 5D1ZB 4UIKL 3X3GL 4QGYA 2DBJA 3BE1L 4JFYA 4QXTB 4YDLC 4JFFE 5HDLA 1RULH 2AXJA 3KJ4C 5I17A 2YN3A 4TNVF 3AC0A 1PEWA 3PWPE 2I9LB 3GMMB 4I0KA 3SGJC 2HWZL 2X1WL 4YO0B 1TETH 2NY1B 4XWGH 1MREL 2J7LA 5I1IH 1B4JH 3S35X 4MNGB 3B9DA 4NC1E 3BEVB 3DURA 4HC1L 1OTSD 1AGEA 5DJ0A 4JDZA 3W11D 4TNVK 5SV3A 5C71A 1EEZA 4PREB 3RUGA 1A3RH 4LIQL 1TJHL 3DXAE 1JUFA 5C3LD 4RQQA 1WUNT 4RWYH 1BJ1H 3QQNA 1F3JA 3S37L 2IADB 4LNRB 2FYYA 1AIFA 4G8IB 3STZA 2XG4A 1S5IH 1AJ7L 1MJJA 4EDWL 2E5EA 5HHOE 3BW9B 3L3OA 3NFSL 3QQ9C 3VH8B 4C55A 2R4RL 5ESAB 4AG4H 2OK0H 5T5NG 2BMKB 1MY5A 3TN0A 3NTCH 1MJ7L 1YYLL 3U9UB 3QWQB 5FO7A 4FQXA 1GGTA 2RGSA 2DLIA 4K3EL 5IWLC 5E2WH 2X9YA 4OQTA 4XNZC 3FB7B 1KPUA 4HXBH 1FJ1B 3MODL 1FYTD 3MRCA 3SDXF 5CGMA 2BVYA 3FB5A 1IEBA 1EO7A 3IGAA 2YPLD 5SWSD 3LIZH 3QIBC 5CJQH 5AEAA 3VXMB 1UA6L 2IG2H 4W6YB 3BP7B 1DN0A 3NCYS 3UYRL 2ZCKL 4K8RC 1QFPA 2AS5M 4HK3J 4Z7QF 3VW3H 3S34H 2MSPA 5FHAH 5KW9H 3AREB 1QSVA 2HJFB 3PWPD 3VRLE 3VWJA 1NLBL 1KJ2H 1AY1H 4JAMB 3U0TB 3BOVA 4K8RH 1FYHB 2DM4A 1NC4D 4KC3B 4P46D 2QADC 4PLJC 4LRIC 5T3ZE 5EB9A 1U93A 5A1AA 3RWFA 1IQDA 4CW1B 4S10A 3T65A 1KLUB 3S96B 3MA9H 1I9JL 1KCVH 3GMMA 3VGAB 1LD9B 3UPRB 2J2ZA 3ZL4L 4NHCL 4JO4L 4YO0A 4Q9QL 2IJ0C 3TP4A 1MIMH 3BEVA 4M93C 2NX5B 3DXAD 5EPMA 2Q3ZA 4OZIE 2JF1A 1OB1B 1RJZB 2R0LL 1LILA 1U3YA 1BFVL 4PREA 3RDTB 3WJJA 1D5ZA 1QQDA 3VFRA 3FRPA 3WXWH 1U6AL 1KBGL 5HGDB 1CICC 1S7VB 4JVUA 5EN2A 2R23A 4I18C 5D7LE 1AR1C 1UCBH 5HHOD 1KG0B 4MYWB 5DUBB 3WSQH 3OX8A 3C8HA 4LRNL 3RP1A 5I1CL 2MTPA 3MRJB 5GGVL 4G8IA 2WLZA 2KBGA 3G6JA 1J0KA 3S36X 5LGKA 3CXHK 4PR5B 4LOUD 4UTAL 3BW9A 4LSTH 5FO8B 3GMOA 3QB7C 1GSMA 3WMSA 3U46A 4KJYA 5CP3H 2APXA 5AD0B 5ESAA 3R0MA 4OSUH 1WTGT 1RHHA 3MV9E 3U9UA 1MCCA 2VNCA 4ELKB 4GG6E 1W8NA 3VFVA 3B5TA 5HHQB 5IB3A 1IT9H 4YX2H 4OLZH 1EBPA 2IBBA 3FB8A 2NYYD 3I3EA 3UJTL 3RVXC 1CFQA 3DMMC 1FJ1A 1FE8L 2VXSL 4D0CB 4XNQA 1Z6JT 5TDOB 3JTTA 3HC3L 3QG7H 4PG2C 4AT6B 4OGAD 4DTGL 4HMEA 4D9LL 3M1BA 3PJSB 4WO4A 2R1YB 2E27L 5GRWA 5T3ZD 4Z7WF 2FH8A 4IJ3C 5C0FB 3UTSE 2QQNH 2N7BA 3UJIL 5CBAB 3AREA 3SE9H 1ZWIA 1YYMH 2ZCLL 1BQHG 1Y0LA 5J6HB 4MX7B 3HLAB 4JJHA 1WT5A 2CO6B 3U0TA 4PJIE 4FABH 2VWEE 4CJ0A 2X70B 2P5WB 2V2WA 1HILB 1DFBL 2NY4D 4IDJL 4QHNB 5E5RB 3TBTA 3S96A 1KYOK 2FATL 3F7PC 4RX4D 3T77A 1LD9A 5TDNB 1FVEB 3QUXB 3C5SB 5GGSA 5IR1B 2A77L 1SVCP 4BKLB 2QEJA 1YJDL 1CS6A 4ZYKA 1NCCH 4LPWA 1FC2D 4X6BA 2YD6A 3O9WD 1RJZA 1KPVB 5D7LD 2CKBL 2F8OA 1JWUB 1GIGH 3GSWB 3ZTNH 1ZT1A 4NZUL 4GT7A 1EUTA 1LP9F 4HX1A 4V2BA 5I16B 1NGQH 3LKOA 2HLFC 3BZDA 2X5PA 4F8TA 4DN3L 1H8SA 1KG0A 5HVWA 3MRJA 5J1TC 1KIRB 4HZAA 3SEPA 4YHKH 2Y9RT 3QDGA 5ANME 4WWKA 3QPXL 3OXSA 3LKNB 2CUHA 4NKOB 5IMMA 4F7PA 5AD0A 3BPOB 4OCWL 3SKNB 5IVXB 3GUTB 3ILQD 4OFYA 4XGZB 3P30H 4Y1AD 2DBLL 2ZOKA 2P43B 4DQOH 3EO1B 3MV8B 4ELKA 3W0WB 4BUGA 2DRUA 5GQBA 3UAJC 1BD2B 1P1ZA 5ESVB 5HYSG 2F54B 3H2WA 2IAMB 4HC1A 3MLWL 5TDOA 4N9GA 3UTSD 3UPAA 5EU4B 4AT6A 4YDIL 5IHZB 4L8CB 4RBPH 4FFZH 3RKDD 3PJSA 1ZHNA 2R1YA 4HKXB 4XP1H 5C0BE 4ZFOB 4Y4KB 3IXTB 1QOKA 3S3PA 5FYLL 2RCSH 4GMSH 4H20H 3LQMA 5CBAA 3S37X 4YFLI 3WDIA 1CCZA 2XPGB 3HLAA 4GOSA 4KVNL 5JA9A 2HFFB 2X70A 3LRSA 4Y5VC 4HWEL 4HUVA 4QHNA 1S7WB 1KB5L 2BSRB 1CGSH 3GHEH 1TENA 1T7VA 3QUXA 2FSEA 4JRXB 5FA4B 2NY6B 3TLRA 4BKLA 4E5XB 1G1YA 2XWTB 2PXYA 3TM6A 3RBSA 4CGTA 3KPRB 4M1GL 4RA3A 2XZQH 3BEWA 3KWWB 1CLYL 1FZKB 3LAFA 3W2DL 4OFVA 1J1XH 5C6PB 1KPVA 4NQDE 4OD1H 3OAYH 1JHTB 3ZKND 2FZ3A 3QFJB 4K3JH 4PS4H 3TA3D 5INCB 4G6MH 1FL3B 1OAQL 4Q74A 1Y6MR 2BX5A 5D7JC 2I24N 1AP2A 4OCLC 3PWVA 1LO3H 3SQOH 1CXKA 3EIFA 1JRHH 2FJHB 2VZ1A 3TV3H 1JWSB 5T33L 3RU8L 4LHUA 3FQUB 2PO6C 4KUZH 5I75C 5DJYA 3LKNA 4LLVB 4WUUD 5JW5B 5DVNA 1UH2A 2LVCA 4NKOA 3PDOB 5GGUA 3RNKB 3IS1X 4NQVB 3SKNA 4PD4J 2RAMA 5C92A 3BVNA 4HKJA 3CLFH 1BVLB 1NKOA 4KGJA 3MV8A 4PJ7B 5C0IA 4QGTA 4R7DA 5DVKA 2F58L 3SDDA 4QXWA 1RFDH 2IBZX 1AFVH 3MLZH 4U6VL 1V8HA 2V6HA 3ARDB 5ECJE 5C0BD 2B4CC 4FQPA 3CLEL 1ROWA 2E7BA 1UVQB 4NFBA 3DVIA 1P53A 4G8GE 5E0QA 2DDQH 2R15A 5EU4A 2DWEB 5D2LE 2PR4H 3SDYL 3IS0X 4WW2F 3O4LE 2VZTA 3IXTA 3QCUL 4YHML 1YEKL 1KTLA 1EVUA 3ARZA 3C9NB 2ATPB 1QUNA 5DA4A 4E41E 4OB5L 1DTUA 5IMKB 2HFFA 1M6OB 3FFDB 2YEZB 4XZUB 1S7WA 2K7QA 1ZA3B 2BSRA 4ETQB 2V5MA 3SJVE 3U4EA 5IW1A 3KPMB 4HJ0D 4P59L 1KJ3H 2R9HD 4NQDD 4GW5A 4XBPB 2E7CA 4I0PD 1A6TB 4J4PD 4CBPA 3I3DA 4E5XA 5FYJU 1AE6L 1NEZB 4NO3B 3DUSA 3NN8B 3KWWA 1X6LA 3E6HB 5GRYA 1I9RH 2X4QB 3HE7A 5GS0D 1S7SA 5GRJL 5LAXB 4NNYB 1JGDB 3A6BH 4K9EL 3QFJA 3QULB 2NY7H 5MHSE 1JGLH 3WCYA 1IAMA 4JPKH 2X41A 3R0NA 4X99B 3HMXH 5MI0C 1QSFA 4NO2B 1MHCA 3ARGB 1LDPH 2D31B 1J0JA 1ZANH 2FEEI 2H6PB 4LCIH 4UQ2B 2NY3C 5E5MB 2BVOB 1FH5H 4YC2C 2MQ3A 5JW5A 4FTVA 3TYFA 1ZLWK 4FZEL 4NQVA 4LIQE 5E56A 3BKYH 3EHBD 1IQWL 1WAAE 3NFPA 4J7RA 4LLUA 4G8GD 1EDQA 1WLHA 5D2NB 2NXYD 4TQEH 2EYSB 4X4YA 1PX4A 1M05B 3O4LD 3ARDA 3SN6N 3FKUS 2F8XC 1I8KB 1T20A 3DRQB 1WFOA 4PJHF 1IGCL 2ICWA 3PXHA 1FLTX 4P5TA 1BJ1J 5CJ5A 1NMBH 1YC7A 3ES6A 4KAQL 4E41D 2G2RB 2PW2A 2F9BT 2UWEF 4OD2B 1FNFA 4RAHA 5JZ7D 4WW2C 1CL7I 5EC2B 2ATPA 2EKJA 2G75A 4BZ1H 2H26B 5L9DL 3QAZC 3SJVD 5IIEB 3TPKA 2LU3A 5GZND 5IMKA 4BSJA 4DEPB 1M6OA 2XXCB 1A1OA 3OKKB 4XZUA 2YEZA 5HVHB 3EOAA 1TTFA 3ARBB 1PY4A 3VXPB 5IKCB 2Q87A 2CRZA 1OW0A 3NACH 5GSRB 5T1DH 1ZVHA 3SHSA 1BQUA 2HKFH 2I60H 2IANB 4ESKA 2HAZA 5DSCB 4OZFH 4B41A 3QIWC 3IJSA 4PV8A 2Y06H 3K2UL 4P2QD 1DDHB 1NEZA 4XNUL 4AIXA 5MHSD 2Y4SA 3ESUF 3H9SE 1CF8L 3LEXA 3E6HA 5KVEL 1R5VA 2ZUYA 3JV5A 5DF0A 3LS5H 5LAXA 3D85A 1R3LB 3F7QA 4NNYA 4CN4A 4X6DB 3VD4A 1ED3B 2DD8H 2VXUL 3HC4H 5DI8B 3DI3B 3NIFF 2CR3A 4Z7OF 5DD3L 3VFOA 1U2CA 4JG1L 1JHLL 4OCSH 3ZMRA 1VGEL 5E2JA 4ODWA 4NQEE 5IMLB 2OTWA 1U8OA 3CCHB 2H6PA 4QOKB 4PJXB 5GGRA 3O0RL 4P23C 1NFDF 5DVMA 3V79C 3VFWB 2BVOA 2FGWH 4NN7B 4KKBD 4Z0XB 3JWOL 2BVTA 5F9JA 4FQLL 2F53B 1ZLWH 3SE4C 5FM5M 3ZYOA 5DYOB 1V3LA 1G7HA 5CD5C 3DLQR 3WV0A 2K7PA 3HC0B 5GJSH 4AZ8A 5AYUL 4HSQA 1HHHB 5D2NA 9CGTA 4WUKL 5CZVL 1UWXH 3QI9D 1JTOA 3PNWB 1OWWA 2DQGH 3PXJA 2FEEL 1A9BB 1JJUA 4HMCA 1A7NH 4OZGE 4X4ME 3E0GA 4N8VB 2XG5A 2OCFD 5BCAA 5JLZA 3QEQE 3G9VA 4QHKI 3V4UH 1I7UB 4P9HC 1P4LB 4KXZH 2DQHL 3SDCB 4QRTA 2XTJC 1XGYH 4XCCH 5GHWL 5FECA 1RZKL 5C0AB 4P2OA 4K7PL 5EC2A 4P3DB 5IIEA 1FG9C 1CR9H 1RJYB 5BW7C 5A2JH 1XGUA 3OKKA 5IVOA 2FJFA 3I9GH 5IKCA 3B2UC 5F1KC 4AH2B 5JQ6H 1AKJB 1XMWA 3OB8A 4X7SL 3H9SD 2CSPA 5AZEH 5FV1L 2AEPL 4UILL 2IANA 3PL6D 2I5YL 4DUWA 3O3DB 1H3PH 3QWRD 5KSAA 3H3KA 2DI9A 3VXOB 1DDHA 3EGSB 4R2GD 3OKEA 4RGNC 1OL0A 3VXSA 3WN5A 3LZFL 5CEYB 4PRID 2AI0H 4QYOB 2Y6SD 2PETA 5CIPH 1CU4H 1NSNL 3K4DA 2UYLA 2OZ4H 5F7KC 5T3XH 1CL7L 4NQED 3UPCA 1FGNL 4TTDC 5HGGS 3MLVL 4M7ZC 2LABA 1Q72H 1P4IH 2BVUA 1Q1JH 1SJXA 5DJDB 5BV7C 2DQCH 5MP6H 1SMOA 4LDEB 5LCVH 3CCHA 2GJ6A 3ULUL 1A7OL 1ETZB 5DHVH 5ICXA 4DGIL 5IFAH 4MHHI 4I48B 1BOGA 1ZT7B 4FXLA 5BV7H 4Z0XA 5DC9B 2EDNA 1IGJB 4B53A 2J6EA 1JGUH 5FOBB 1GGCL 3J7HA 1SMAA 4PJFE 5HPOA 2XZAH 4NRXA 2D7NA 4HJGA 4Z18A 2ADJA 2DLHA 3DV4B 3VXNA 4R8WL 1KEMH 2W0FA 3HC0A 1AQDA 2DICA 3FQXB 1A6WH 1Q38A 4H1LA 1HHHA 3PV6B 1XGQB 4ZS7H 3T4AB 1DBJH 2WBJD 3MZGB 1YEDA 1T89C 1A4JA 4RFOL 3T0ED 4LLWB 1G7LA 1DQLL 4X80H 5K59E 3L3GB 4XXCC 5ID0B 4TSCL 1WEJL 4WU7B 5EUOF 3WLBA 4PLNC 4IOIA 2H1PL 2YKLH 3N0PB 4JPVL 2V7NB 1FORL 4PJDB 1CGXA 2OS7A 4KGLA 4I4WA 3RVVD 1FYTB 2H32H 3PP3H 3KDMB 4X98B 1YEEL 3QPQD 4ODTH 2YPLB 4KJQD 4U1IA 5SWSB 4BFIB 4DWHA 43CAA 1OAKH 4Y4FA 3MOAH 4AH2A 2P8LB 3ORJA 5HI4C 4YHLL 1IM9A 1N5YH 1UM5L 1JPSH 3DX9A 4Y5YB 4DFIA 5FGRA 2ZJSH 3GJFK 4NCC1 1EAPA 4I3GA 1UXWB 2GK0A 3WFDL 1KFAH 4CMMB 4JFFB 1MFBL 4KFZC 1LK3H 3TPUA 3CZJA 5FYLE 3KYKH 1MCKA 3K81A 4PJ8C 5CEYA 3PWPB 1BZ9A 4I2XE 1E4WL 3QJFB 2FLBT 5EC1B 1NC4B 4P46B 3BIKB 3GKWL 5DHYB 1OHQA 3O6KH 3F6LA 4M5ZL 1AGDB 1EEUA 4WY7H 4ZFZA 3MRMB 5IW6B 4NZTH 3X12B 3BESR 2ZWLT 2V9RA 3U1SL 1F00I 4OLUH 3TH2T 1JNNH 4GQPH 4XP9L 1ETZA 1KLFA 4H0HB 4WFFD 3DXAB 3FT3B 3BAEH 3JZ7A 2IPTH 4HK0B 4I48A 3CUPA 4KTDL 1U8JA 3V5KB 5FOBA 1S78C 4HJJH 4P3CH 1XH3A 2A9NH 2FX7H 3ZSSA 1BF8A 3DV4A 4OBSA 4M7LL 2O5XH 4JDVB 4M02A 5HHOB 4N0UE 4JB9H 4FQQA 4LFHG 5F7DA 3PV6A 1XGQA 1EMTH 3T4AA 3DYPA 1FIEA 1PLGL 3QXAA 5HDQL 5SX4I 5FB8B 2CMRL 4BM7A 2Y5EA 1R0AL 2GT9B 5JIKA 2Y07L 3T3PF 3O3EA 4JPWH 4JR9L 1K6QL 3MRNA 1N4XL 4LLWA 1N0XH 5IHUL 4EUPG 1FCCA 2CLZA 3GMPB 3L3GA 3GBNH 4PJAF 5ID0A 4GXUN 1R5WA 4BUHA 2Y1VA 3MJ9H 1ZXQA 2ORBH 2WNGA 3N50A 4YXHH 3Q6FB 2V17L 5I18H 5D6DA 3GBML 4POYA 3M07A 2ERJC 1BX2B 4JN1H 4PRBB 2VZ3A 4A6YB 3NZHL 1MFEH 2WK2A 2YPLA 2GITB 1FNSH 4YHIB 3G04B 4TULH 4XNXL 5FYLD 4UIMB 3OKDA 2R2CA 3MYJA 4TSAL 4D8PA 3P4MB 4GUPA 1JV5A 2Z31C 5KZCD 4JFQB 1ERNA 3EFDH 5CEZE 1KEGL 4L9LA 3PWNB 4N9OB 3WHE0 2CRIA 4K3HA 1XF5A 5EC1A 2OMNA 1NC4A 4HS8H 3RUGF 4HUXA 4LDOB 1CN4A 2NY4B 2IQ9L 5J1AA 4EN3C 3THMH 2J4WL 1EGJH 2ARJA 2D7OA 4OZIB 3P0GB 3FONA 3E2HB 3HNTL 4LCUA 1T22B 1S7TB 2Z0BA 3QCTH 4G6JH 1S7XB 4NWUL 1IAIH 5C0EA 3DXAA 5BJTB 5J56B 3FOMB 4HK0A 3O9WB 4PGEB 3QSKB 5D7LB 4K23L 3V5KA 3QEHA 3Q5YA 5I2IB 3GI8H 5D7IE 3RTQC 4QRPE 5F1NB 1NL0L 3WE6B 5EUKB 2AJZB 5FFLA 3VE0A 1I4FB 1NBVH 2HA1A 1QLRB 4JDVA 2EDQA 5TJWK 2AXFB 4KMTL 3W39A 4NBZB 3T08A 1GYAA 2H2SD 1A6VL 1F3DH 1AGFB 3H9YA 5BZDA 4XHJC 1HI6B 4O2CB 2O61B 3MV9B 4B5EA 4JQXA 4IRJC 2MHAB 4GG6B 2BCKB 2AJXL 1MRCL 3I6GB 3Q5OA 4GRWF 4Y4HC 3N85L 1C16B 4ZNEE 5IF0B 3R4DA 4Y1AB 4FFYH 1HSAB 2CK2A 1F5WA 1OY3B 1JFQH 4YE4H 2HTLC 1GPOH 1ZT4A 3QUYD 4NKIH 3O11B 3L95A 3N1QC 1C1EH 3KLHC 3AY4A 1Z3GL 2IALB 4M6ML 4X6FA 4A6YA 4JFPA 1M1SA 1P7QD 1K4DB 5CEZD 3G04A 5DQDL 5B4MD 1S8DB 3IFNL 1V3KA 3HNVL 3UTSB 2XZCH 2AGJL 3P4MA 2PYEE 2DIJA 2KZ1B 3LCYA 4PJIB 3SE3C 1K8DB 4JFQA 1YEJL 3EYQC 4ZXBA 4MCZB 1A7RH 5GXBB 3G6DH 5L8LB 1DQTA 5MEPB 3L3JA 4J2XA 2IPKA 1IC4H 1CXFA 3VA2C 1OAYH 4XMLL 4PJEE 1FL5B 4WJ5A 4N0FB 1MVUB 3NOIA 3RWJB 2W1NA 4Y16D 2AJUL 1JBJA 4RX4A 3VDAA 4OZIA 3WFCL 3GSUA 4OGYL 4N68A 2EKSA 4DFHA 3DOSA 5J06A 1EAJA 1BIIB 1T22A 5J12B 1S7TA 3KLDA 4QRPD 3G6JF 4RSVA 5BJTA 5E8OB 5JIIA 4XT1C 3O9WA 2E8YA 4PGEA 1MCPL 5I2IA 1A6UL 4M8VA 5EFIB 3WE6A 5T1KD 3MLTA 2AJZA 5EUKA 1FRGH 1QLRA 2DQUH 2FHFA 4GJTB 5ANMB 3TN0C 1A21A 4FQXC 5F1IA 2QQKL 1MJ8H 1AGFA 5FO9A 1NFKA 1HN1A