5JYMA

Human p-cadherin ec12 with scfv tsp11 bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disruption of cell adhesion by an antibody targeting the cell-adhesive intermediate (X-dimer) of human P-cadherin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords Cadherin-3
total genus 51
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5jymA01
4NUMA 2OMWB 1NCGA 3LNDA 3K5SA 2OMVB 4ZMTA 4APXA 4ZMXA 1ZVNA 3Q2NA 3FF8A 3K6DA 3Q2VA 4ZMNA 1NCIA 3K5RA 2QVFB 4NQQA 1WUZA 4ZMQA 4NUPA 3LNGA 4XXWC 1L3WA 4AQEB 4ZMZA 4ZMWA 3FF7A 1NCHA 4ZMOA 1ZXKA 4QD2E 2WHVA 3UBFA 4AXWB 4AQ8C 3QRBA 4ZMLA 2WCPA 3LNIA 1EDHA 1OP4A 4ZT1A 1O6SB 3Q2WA 4ZMVA 2WBXA 1NCJA 2A4CA 2YQGA 2V37A 5JYMA 5KJ4A 4AQEA 4ZI8A 5CZRA 4ZMYA 3UBHA 4AQAB 4NUQA 1Q1PA 3LNFA 2WD0A 3K6IA 4AK1A 2A4EA 2X2UA 4APXB 3UBGA 3LNEA 2OMUB 5JYLA 3LNHA 2EE0A 2O72A 3PPEA 5CO1A 4ZMPA 2OMXB 2QVIA 3Q2LA 2OMZB 4AQ8A 4AQAA 4OY9A 1SUHA 3K6FA 5DZVA 4XXWA 2YSTA 4AXWA 4ZTEA 2OMYB 1WYJA 1FF5A 3MVSA 2OMTB
chains in the Genus database with same CATH superfamily
3ZDYF 5LJYH 4G9DB 4PW9A 1AACA 3N3EA 2FEDD 4LBAA 2X0UA 1BVZA 2BDNL 4ZNEA 2IH8A 1CFNB 4K3DH 4X98B 4GKZA 4LSVL 3MNWA 1Q9WB 1U2CA 2WQXA 1T4KA 1DL7L 1NPUA 4GG8B 3N91A 5KYXA 4C56B 4NC1C 4X50A 4HOXA 3L08A 3WE6B 1OAXL 4XO3A 3MMEB 4GUCA 3AT8A 1CDBA 4J3XA 1HCVA 3HR5B 1DVSA 1A25A 4TUOA 4ELKB 2KPNA 3FF8A 2F53E 4KX9A 1S5HA 5A16A 2YAFA 3JT0A 4P3CH 4MJ6B 3R8BB 1DDHA 1E5UI 1UZ8A 4M48L 1EHKB 5D6CB 4B60A 4DIXA 5EB9A 3RUGF 1G6RA 1YQ2A 2KLRA 1F56A 3BAJA 1HJCA 2HKFH 1KCRH 4Z5RA 2XQYK 2NXYB 2N7AA 3FUIA 3L4TA 2Z8RA 2NY5C 3PXLA 3IN2A 3NA4A 5J1AB 1EEZB 4XBPB 3BPOC 4FA8A 4ODTH 1XIWA 1ZS8A 3SKMB 2BSSB 1OT2A 2FUQA 4Y5YB 3VFPA 1WPCA 3MA7B 4XVSH 3S4SB 5BO1H 3KCPB 3VD2A 4WUUD 2PXYC 3BP7B 4OV5B 1OPGH 3QUML 5JIIA 4F1ZA 1KCUL 2FZ3B 4HD5A 1LK3H 4POZD 3PQYA 5D7JB 3QUGA 1IAIL 5GGRA 1NFDE 3K71B 3MJ7B 2N4IA 2PPCA 3SDYH 5D96B 1UM5L 3Q6FA 3VUAA 1UD3A 3U30B 3RTQA 1JHKH 1H15B 2BNQE 3AW5A 1IAOA 3KLAA 4PJ8A 5CJ8A 4ZTPH 3MJ9L 3P9LA 4BE5A 4JO1H 2QKIC 2FHFA 2MQ3A 3T0EC 3RL1B 2DJUA 3L1GA 3C6LA 5ESVA 1F90L 2QGCA 1FZOA 5AKVA 5T1KD 5HXMA 4ZUSA 2ATAA 3MNWB 4IRSC 2Y2TA 4I3RL 5L2JA 1PLGL 2IC2A 2X6CA 2JMRA 1S78D 4F15B 2IALA 4RISL 4L1DA 2AK4A 4E42B 2QJDA 4KKAC 2ZKMX 3QK0A 4JFOA 4GQZA 2FBJL 1CE6B 2C9AA 4EJ1C 2MNUA 1D2PA 4MXVE 3PYCA 2VDPB 4M3HA 3ZO9A 4TN9A 4U6YA 2BNQA 5ESAB 4OQ1A 4MAYB 4WWKA 2YD7A 5C8JB 2XY1A 3ILQC 5AYUL 4MZ3A 3MKKA 1G7JA 4DUVA 2O93L 1CD0A 2VO5A 5C0FA 5IFHH 3PHSA 3HAEB 5TE7H 3MLTA 3H4FA 3WTSA 1E5ZA 3WS3B 4ZFQA 1W91A 3TBVA 4Y4HD 1R3IH 3FQ4A 3K4DA 1WQVT 2XVGA 4IEFB 1T66C 4OZIF 3U7WL 1EJ8A 4Z7NB 1V3JA 3QJHB 2BY1A 3SYAA 5HHME 5DMGC 4U1IB 1YNKL 4MNQD 1HH6B 1XF3A 5D5MB 1WLHA 2RCSH 2OP4L 2ZZUT 5L6YH 2B4CL 2QR0A 3K2IA 3QS2A 8CGTA 2ZNWA 1J1XH 2GJ6E 4NOFA 4DKAA 5IESH 4LE8A 5ANME 2DYSB 4UQCA 1KTDB 4URKA 4FFYL 4L3ED 4XCCH 4BFKA 1EEYA 2D03L 1SM3H 4IKKA 4OIBA 2FYVA 3PPSA 3LYRA 1QWHA 3L1OL 4L5FE 1HHHB 4TLUA 2VUOA 3EYOA 3WY1A 2FNWA 2OLDA 3DX1A 2HFTA 4I0PA 4XP5H 3ERXA 1Q9LB 2YD9A 4NN5B 1IGFL 1FNSL 2JCCB 2Z8WC 2VDLH 3OKKB 4MNGA 4MVBC 5ISZA 4IRSA 5KJ4A 2ZX6A 4N0YL 4XVJL 1SEQL 3QUYC 3SKNA 3EXJA 2HLFD 1U8LA 1CF1A 1Q90A 1NA8A 5D2LE 2BS9A 2IFFL 5FO7A 3E9UA 4UDUB 3FCGA 4NIYE 3FUNA 4KTYA 4FQXA 5SWZD 1XMWA 3CH1B 4W9HC 5I6MA 3B43A 1BIHA 3G6AB 4M7ZB 2GB2A 1E8XA 2HT3C 3VU2A 3QI9D 3PQYD 4TSBL 5E2JA 2OMUB 4MMXA 5ALBH 3MLZH 3ZLQC 2NMSA 2XWEA 4FNQA 1RVFH 1BA9A 3RZCA 4DKDC 4JVUA 2EXWD 2IALB 1LK2B 3TBWB 4RAVA 3H9YA 3SE9H 4TSAL 2GTZA 3WJLA 2PWHA 3ZTJG 1NMBL 2GSIA 1FE8H 1A4AA 1AO7A 1WCQA 2JKRM 3E3QC 4U1HB 5DRNA 4X5PA 2WZ6A 2XX1A 4HAKA 4WO0A 3F83A 4XC1L 9CGTA 1OAKL 1BXVA 4QAWA 5DJZB 1HCZA 3ARPA 3BGMA 4TOYL 5EBMB 1HH6A 4CDGC 1RPKA 5HHQA 5I30H 4PJDA 5EN2B 3MJGX 1G7JB 3LNDA 1ZTXE 3H7BA 3QIBC 5FM4A 2WIIB 4JUTA 1RK0B 2R2BA 2B1HL 2DIAA 2N7BA 4JJ5A 5TDOA 4APXA 1NC2A 3Q9QA 2GTWA 4H44C 2WNXA 1FSKC 3GHEL 3QUZB 2PWGA 1M53A 4ERSL 1UCBH 3EOAA 4PBXA 2VXSH 2I5YH 4J3OH 3SQRA 5BOJA 4Y16D 3HR6A 3SKJL 2IGTA 2DDQL 4YHPB 2N01B 4F33B 3VJ6A 3HHRB 4HH9A 2CH8A 5AVTB 4LSRL 2HVKA 2VERN 2XTJB 3GMOB 3S3PA 3MLUL 3UJJL 1XGQA 2NY1B 3PREA 3JT2A 4MQTB 3RE0A 5L88L 1MVFA 5D71H 4H1LG 1KPRA 1TJHH 3QUYA 3ARBA 4LKXA 2DMHA 4YDKH 1EEYB 1M4KA 2OSLA 2W5PA 5DMKA 3NFNB 2F0CA 3K81A 3HZVB 2Y0SA 5FLUA 5I23A 2EXSA 1DZBA 3UP6A 1K6QH 4QOKE 2ISDA 4XMXA 3X13A 2VMCA 1DJZA 4Z7OF 5GXBB 1EBPA 4X9GA 5D1ZA 4ETQA 3ECBB 3HNVH 1TYRA 4NO5A 4U3CA 3MN8A 3EH4B 3EO0A 3L3OC 2ORBL 3AS3A 1NGPH 2AQRA 1MIEL 3H9HA 3OKDB 5GGVH 3BAEH 1ONQB 4JKNA 4J3OD 4FCAA 4HKXB 3K1DA 2ZX5A 4S0TD 3G7TA 5ANHA 4RMQA 2AV7B 3SD5A 4Q9RL 4XB7A 2VZTA 2IBGA 5B1AB 1JFHA 3C60B 3ESUF 3N9GH 3UTTA 1FDLH 3M17B 5T1JA 4P2YA 3RGVD 2R0ZH 2FAUA 4QKXB 4NYLB 1KIQA 5LGJB 5EF2A 3FS9A 3QPXL 4BFOA 5JPMA 3SOTA 3AZUA 2J6EL 3L4XA 4YO0B 3UC0L 1NC2B 2CUAA 3U4AA 4D0DB 3HC2A 5FYLD 1NLBH 4P5SA 5KAQF 4J28A 4K0OA 4KX7A 1EX0A 1BWWA 1HHGA 1U21A 1W6LA 2NPLX 3D7PA 3O6FA 3Q3GB 4JCWA 4RGND 1V5JA 1MW1A 3ZE1F 2VC2B 1A3RH 2W95A 4K94C 4R2GB 2EDHA 4KJPC 4P0DA 5JW3L 2GBTA 1R19A 4IBTA 4ZNCD 1GGUA 3QXWA 2PYEE 3UYRH 3COOA 1CN4A 1XL4A 2GK0B 1U9KA 5LXVA 1PS3A 1V55B 3TO2A 1YYLH 2P80A 5TDOB 3D2UB 4N1CA 1F3JB 4HOMA 2NNFA 1DSFL 2HX7A 3DVNB 5KS9E 1UJ3C 2XFXB 4L9LA 4NQDE 2JJTC 4F7TA 2E7DA 2H32H 1T21B 3MCG1 4DGVH 1MFBH 4GIAA 1QD0A 4AGLA 1EUTA 1R6VA 4FI7A 4GAFB 4F3FA 2X4UB 1JPGA 2QFPA 3JWDL 4JFUA 5F70A 5I74B 2OV0A 1JGVH 3NCBB 4NP4L 3Q5YA 3MYJB 1KB5L 25C8L 2FDBP 4OZ4B 1X9RA 3WLBB 2WSPA 1IFHH 3MGOB 3BSHA 3T0VA 2BM3A 1CMOA 2XSKA 4YSQA 1AGCA 3DETD 1AI1H 2I85A 3HG3A 4DN3L 1T1XB 3O3DB 4L3EB 3TVMA 3VFMA 3QS3A 4ZMOA 1G7QA 1HSAA 2AJUH 4OLYH 5DRZB 4RGMC 4X99A 2FEEI 3HN5A 4W1TA 5GGVY 4JY5H 3QJFB 1S78C 5L4FA 1A8ZA 5LGYA 4AYFB 3NA9L 4FNLL 2X2HA 2DEYX 2B5IC 3G6JA 2F5AL 8FABB 2NY7H 3LY6A 1EDHA 5DGQA 5DS1A 4BQ8A 3R19A 3UTTB 2A6IA 1MCPL 1ZDQA 2AS5M 3C5ZA 4HUUB 4N9GA 1KCVH 3TCTA 4U7SA 1J1OL 4GI8A 3QW9A 1XVSA 4DVBA 1PZ3A 2NYYD 4MJIA 3BP5A 5HGBA 2GTWB 4F5CA 2ZD0A 4KDVA 4AQ1C 1NLDL 2F1BA 5J89A 3B8SA 3RPIB 1KGYE 3GI8H 2GI7A 4QXGH 1BFOA 4PJGE 2W94A 4J5VA 1YDPA 2H2PC 1DLHA 4G43B 4QXUL 3WE6A 3EOYG 3DTDA 4AWJC 4K73A 4U2ZA 4PJ7B 3OMIB 3JVGC 5IHZA 1N68A 5F0PB 5IB1A 3CLFH 2ZUUA 1ZPLA 5GGSA 5KEZA 2FO8A 4NKDB 4KTDH 2GK0A 1THCA 5E5RB 3FFCB 2CDGB 2E47A 2XPZA 1R24B 3DUUB 4H4NA 1SDAB 4RSYA 5DMIL 5GRWA 2XU9A 5JXEC 1E5YA 4UMGA 5FGCE 4WWID 5I0VA 2HLEB 2F54A 2NUPA 3DECA 3UMNA 1AKJB 1IC1A 1ETA1 3BZEA 3AAZB 4NI3A 1BD2B 4NB7A 1HI6A 1F1GA 4P2QA 3HG1B 1NQBA 3QQDA 4OT1H 3EYUL 3RWHB 2NNCA 1RKRA 3RZCC 4A2FA 1BQKA 3T8XA 4FZ8H 1BQHA 4JAMA 3GTVA 4HPYL 5JA8B 2XDHA 2WW8A 4PJ8D 1I3GL 4PJAE 2IH1A 3RB7A 1UXLA 1ADQA 4ODWB 5TGBB 4Z78A 5I1HH 2PW1B 2OMYA 3NCJL 4NQSB 5G4NA 5HI5D 3BE1L 4OCXL 2QBWA 1P84K 2BHYA 1HOCA 5GS0H 3DK0A 5ERWA 1OWWA 2JKTM 1CBVH 1RLWA 1AH1A 3L4UA 3ZDZB 1ACCA 1I9JL 1ONQA 2F8IA 2JVUA 1CTOA 2N0KA 5DVPA 4UTBA 3EO9H 3QCVL 3VCLB 3F7VB 3NCCB 2WCGA 3SPVB 1M1XB 2FIKA 1BVNP 4GLRI 4FQIL 3ULSA 2X3BA 4GAYB 1AG6A 4JRFA 1OT4A 5D2LA 2EVJA 4B95C 4U1LA 3AXLB 4KHTL 2P8LA 5L7XH 2LFEA 1P5VB 2ZKHL 5F2FA 3U0WL 1SOSA 2FT6A 4HPOL 1BD2D 4WI5A 3CC5A 1VRSA 3ZIMA 1AOHA 1JGEA 3ZO0A 4MHHI 4K4KA 3V6OE 2YGVA 1W8NA 1J7VR 2CIIA 4FEIA 5KVEL 1KGXA 4ESKA 3T1WA 3LHAA 4YUEH 5HYQB 3OSKA 5AOLA 4LLWB 4OI7A 2ED8A 4HZ1A 1EHNA 3BH9B 1E2WA 2EVFA 1G9NH 4XMVA 3A67H 3EOTH 1A7NH 4NZFA 5MEND 3UTSA 4PUBL 4GMTL 1QA9B 3HJ0A 2QKIA 3T0EA 4LP4A 5BRZB 3QJUB 2YBRA 2P28B 3HW7A 3ENEA 5I8KL 4L4JA 5CN2A 4Q0XH 1P5UB 1SZNA 3MLRL 4PWGA 4MNQA 1HX0A 2QV4A 4YR6A 1UEMA 4B41A 2VDOB 4A7UA 2RR3A 3BAKA 3LQZB 4MD4A 4LCCC 5EO9B 4AEEA 1MIML 4HS8L 3QRLA 1UCTA 1MWAA 3QQDB 3RWHA 3S88L 2AAAA 4WI8A 1R1CA 3A24A 3UFIA 4P9HH 5ITBL 2ENPA 3IJ8A 3JVFC 3ZBMA 3S96A 2WLLB 2O72A 3NTCL 4G70B 3WFEH 1NMAL 3JV0A 1N6QL 2I07A 4JDTH 2ZUYA 2IDCA 2VSMB 4GP8B 5C3IA 4ZO7A 2BVUA 4PGDA 3BZFA 2LTQC 3GUFA 5IW6B 3OWRA 3E38A 2R2CA 3F7RA 3QAQA 2JKIS 1PYWA 2XFGB 4YMPA 4MD0B 5FYJL 4APQA 4JMXA 4EI6A 2NY6D 3MOAL 3IT8D 3FH5A 2RFXA 2CJSA 3LZRA 1GW6A 4RNRB 4GUQA 4G9FB 3QP3A 5IQOA 1B90A 3PXJA 4LAQL 4NDMB 2W9LA 4UIMA 4EN2A 4DESA 4OZGB 1IBGL 3UERA 1R3LB 2UXFA 1AAJA 2XTJE 1CFBA 1GSKA 2HFGL 4W4OC 3T08A 2IF7A 4X9YA 1KXHA 5K33A 3BP5B 1QW9A 1UENA 4O2EB 2AC0A 3FQWA 3EYQC 3CFKA 2Z91A 3PIQA 3H2WA 5D7LD 2WKOF 1E4XL 5HDWA 1OALA 1MCFA 5F1SA 5GS2D 3QIUC 2WSDA 1F58H 4PEEA 4EOWL 3S36H 3FSZA 3IMTA 3SKNB 5KTEL 4GAYA 4QOKB 5EIVA 1R9FA 5I74C 1XAKA 3VI3A 5INCB 1Q1JH 2D4FA 4NKOB 5TH2B 2NY3D 4JDEB 1G43A 1QA9A 2EIJB 2FEEL 4PS4L 1T0NB 3GXTA 3DO7A 2XRAH 1AGBA 3UTPE 3ZMRA 4FFVC 4AUUA 2E7LC 1ZLEA 2K9FB 2VDOH 3K74B 4KVCL 3V5HB 2F54B 4PU2A 1F3RB 1U6AH 1IT9L 3OM3B 5K1VA 4XGZB 4TLSA 3DTXA 1AZZC 1WZAA 3BPCA 3HC0B 2PP7A 5DVOA 1CIDA 1AGDA 1H3XA 3KYOB 3ULVH 1VESA 3VQLA 2ADJB 4ZX3A 1GHFH 1FLRL 1KPUB 5FGSA 5F7HA 1JZJA 2FJUB 2QQQA 2EQDA 2WBXA 4LVNB 2IWKA 4AUYA 4NZUH 2K4AA 3SDXA 5BVPH 4Z18A 1U36A 4N3UA 3DV4A 1JGUH 2VISA 4OF5A 5EBMA 2B08A 2BY2A 2X42A 3VDCA 4K8RH 3TJPA 3V6ZB 2CQVA 2QDVA 3GXNA 3CQPA 2DL2A 4WRLA 5IGXL 3ILEA 3P3SA 1DYZA 2ZCLL 1T0MA 3I6LD 3QZMA 3KBHE 5EZJA 4YHZH 3PAVA 4C59B 2Y7QB 3TYGH 5DQ9A 4LCWE 5FAAA 2VYRE 3L3KA 2RMNA 1QO3A 2X1WL 3QARA 1H8LA 2BPBA 2Z7YA 3NBNA 3V4VA 3QDME 1NIFA 3Q2LA 5IV2A 3V7MA 1MFAH 1IM9B 1TZIB 1U42A 2VR9A 1N26A 3UO1H 1KTJA 2HKHH 3VWKB 3QDGD 5J12B 4HKJB 4HJJL 2BHZA 3SPJA 3VXMA 3BSZL 5E1QA 4CNIB 4NCC2 3MRMB 4BCZA 2DQDL 2X7LB 1DQKA 1M7IB 4NLAA 5I0ZA 1HINH 5KVEE 1ZJBA 4H5SA 5F7YC 1I8KA 2EO1A 2J4WL 3EOBA 2OXGA 3QQ4B 1FZMA 2Z31D 4I85A 2IOIA 4LLDA 3G5VA 3NZSA 4QF1B 4TYUA 4UDTA 4XWGH 5IMLA 5F1IB 5KAQG 4GG6A 1UD5A 3UTSB 5GGTL 4WV1C 4KK9D 1BJ1H 4DZBB 4K2UH 2C8NA 1BHGA 2FQGA 3SZKC 1SQMA 2BCMA 4J2QA 3ZMNA 4KFMA 5J6GB 3QEGH 1JTPA 1GZQB 2FSEB 4KI5E 5IMKB 4LIQH 4FXKC 3CMOH 2BRRL 4I13B 1QVOB 4LF3A 4JRYD 4GG8A 1RZJH 5D4IA 2EDJA 5A1AA 1PTZA 3K5RA 3ZDXF 4Q14A 4M5ZL 4HF5L 3DBXA 4WUKL 2KYIA 4NQEA 3VXME 4GYBA 1OEZW 1BYOA 1D6EB 5T1MA 3VSVA 4Q6KA 4YLCA 4JJOA 5ACMA 3EUUA 1C12B 3CX5J 2LR4A 2HUEA 4FQLL 4JREB 4WFGD 4UM9A 4XMZA 4ZMWA 3EFDH 1ZA6B 2XKSA 3FPYA 1C1EL 4MAYA 3RY5A 4D0BA 1R0AL 1E2ZA 3LX9A 1CLYH 3EGSA 4FTVA 3VG0H 4IKLA 3CLEH 1TPXC 4XWOC 1U2HA 4JFQA 4P9ML 3N44F 4HUVA 1WJ3A 1MI5E 3NCYP 1X4ZA 4CRPA 1KCSL 2CBTA 2HT2D 5E51A 4Z1PA 5GRZA 2UWEE 2NT1A 1K9TA 4N2BA 1QYGL 1YEEH 3ZR6A 4XCEA 5KYYB 4JDZB 2VXVL 4FKEA 4PTTB 1E90A 1TITA 2H0JA 2Z7UA 2SODB 3C6LB 4JKPH 5C3TA 1YPZB 3O8XC 2H26B 2Q7YB 5CWSA 2R9HD 1P4LB 1UJ3A 1WWCA 4FLHA 1A7OH 2JJTA 5DMYA 1BEYH 4LIQE 4PV9B 4PY7B 1ZGLP 3L1FA 1B0IA 1F3JA 1WITA 3ULVD 2DQFA 3TCXA 1WS8A 3TVMD 3SE4C 35C8L 4JE4B 3NPSB 1BZDA 3IXTA 3O3BB 4D9RE 2ZX9A 1B4RA 2OXHA 2ESVA 3HZKB 1MI5D 2R51A 4F3FB 1K5WA 4PJIE 1ZLVH 5DRXA 1UZ6E 5GS1B 1OY3B 1TYJA 1ZV9A 2MMXA 3L9BA 3VTAA 3X12B 4HOWA 5MEQA 2A9AA 2GAZA 2WOBA 5C9KA 5INDA 3QDAA 2VR5A 3ULUH 4GAJL 3MRFA 4DHLA 3RIFK 5K39B 3IFNL 4AX3A 3CFCL 3VFWB 2BIMA 3D18A 5ANMA 5GSRB 1Z9SA 3MRKA 2A99A 4JDVA 4E9LA 4Z76A 4YHIA 3GHBL 3OHXB 5E8OA 1IIIA 3BO8B 4PD4K 5KBPA 1BM7A 1KIRA 2J1YA 3CCHA 2ATPB 1T2JA 4LVOB 5E2UL 4HWUA 1AKPA 5LWYL 3O6KH 5CBEA 1V7NH 5KSAB 5F88B 4PSPA 4TVPD 3KYNB 5DWUH 4NKIH 2O5ZL 4JRXD 3T3PE 1OARL 1E4KC 1P9MC 1RJCA 2EDTA 3ETBF 4QYOA 5EEVA 2A74A 2B3IA 3ZRSA 2I32A 2Z6FA 4JM4L 1HWHB 3U1QA 2ALAA 4XOAA 5JW4M 3VXNA 3S8GB 2WXMA 4LLUB 5AZUA 3RPKA 4U1GC 4P46B 3BMWA 3ZT6A 1OOAA 3EHBD 1V54B 2W07B 1W2KT 1PZBA 1KJ2L 1JVLA 2CUIA 1U58B 3APMA 3IGAA 6TAAA 2UUDH 3BP4B 1JNHB 3GMMB 4ZFGL 4H1LH 1J5OH 1E4WL 4MAUH 2IPKA 3SEPA 1MJUL 4FFWD 4KHXL 4TMPA 3WV0A 1QNIA 2O5YL 4D9QD 3L9RA 3FT9A 3UAAA 5F0LB 1Y0LA 3CZJA 5FLVA 3P3RA 2CBOA 4FL4B 1KV3A 5E00A 3SQBB 3SBWC 3FQXB 3GSVB 1TVBB 3CU7A 2RHEA 1JZ5A 4HS6B 5HI4C 3FCUB 1V7MH 1N4XH 1UOVA 4PG2A 2V37A 3GEFA 3IB4A 4NFBA 5TDNA 4FQXB 3ZU8A 1YEDA 4KXBA 5E08L 5T1LB 1IGCL 4E5XB 5DUML 2BP8B 1QFWI 5HDLA 2XCMC 3VXRE 2LLLA 1EPFA 4JZOB 2MPAL 4JFTA 4O02B 3LHPH 3HS0C 5I0YA 5I1AB 5E8EA 5A6LA 2CGRH 3GWJA 4S0SD 1PAZA 5CINH 4AGOA 2IH9A 1YEFL 4XBGB 2EP6A 4LKCA 4KVPA 3MLWL 4N8VG 4AGQA 3ZJAA 1QFWL 5JA9A 2H9GB 3CCHB 1MNNA 4HQQH 2IADA 4F7MB 4A66A 4HWZA 2AJVH 1SUHA 5I16A 3N43F 2CO3A 4QRRE 1TPXB 4OBRA 5IHLB 1PCSA 2SEBB 4UIKH 1NMCC 4N5EC 3AFLA 3O2DL 5D1QD 5TE6L 2G2NA 3MGTA 4J23A 3ARSA 4X6FA 1LK2A 3V5DB 2IDSA 4JFXA 4IK7A 1R5VB 1GKEA 2BVQB 3HC4H 5FO2A 1IBHA 4GRMA 5DZLA 3ZYIA 3W2DL 5HYQA 2CLRB 3SIKA 4JNXA 3BLKA 3LDBB 3D85B 1AHWC 2P45B 5D4QA 3MODL 5EZPA 1JN6B 4ICXA 1MUJA 4NNYA 1S7XA 3HN8A 4GW1B 4GQ9L 4Z0BL 4PRHD 1SHXA 1I75A 4XVSL 4BD4A 1Q8MA 5B38B 7FABH 3O4LD 3KJ4B 3X1BA 1KOAA 3CSFA 4YIQA 1MHCB 2V17H 4P2QE 1SXNA 4ABUA 1KPRB 3E6HA 5JW4Q 2DJSA 3R1GH 2WMPA 4GH7B 4U0RC 1SN5A 3ARGB 1T1ZB 3IJEB 2DTMH 2E8ZA 5IHHA 4JM0A 5I8OL 4UB0L 3RZCD 2VR3A 5AFAA 3DSFL 3H42L 3JV4A 5HPMB 4I48B 5AG8A 2Z9TA 2VAJA 2R9HC 5FHAH 4ZO8A 3CFDA 4Y1SA 5FYJU 2F68X 2YAOA 4LRIA 5GJSL 2BNRB 4N8CH 4AQ8C 2E0PA 1G9ML 3JZYA 1VEOA 4GPVA 1B9ZA 3S35H 4UM8A 1BQSA 3PE9A 4LPTA 4WEBH 1PDKA 4WW1A 5GS0D 3ULVF 4BGDA 4QRFA 1LWJA 3KVQA 5BMFH 1CQYA 2XT1B 3FQXA 4TVSa 2GC7C 2P24B 1RUAH 3H9HB 4PJFA 1A7QL 2YUXA 2PO6B 3QCUH 4PJXE 3O4OC 1X5LA 5FCUH 5I76A 4GKSA 2BOLA 5E8NB 3PF2A 4FXKA 4QHKI 4DP1X 2MKWA 4NDMA 4I8DA 4E5XA 4DFHA 4MA3B 3S97C 5EBLB 3EGXA 3IDIB 1D5XA 4PR5B 4ZW3A 4ZUVA 2BOBA 3MRIB 1KEGH 4QRAA 1G84A 1Q9KA 3IN0A 3LEXA 5B3NA 2NTFB 3QXUA 4JRYB 5JOEA 3RWCA 2Y7LA 2MCPL 4LSUH 1OAQH 4F8NA 4LLUA 3GMPA 2I27N 4JPWH 4P5TA 4K94H 4WNJA 2JWYA 1HSBB 4OCRH 3IFOB 2FQDA 4ODVH 1ZHBA 4PP2A 4XHQA 1F4WH 4HXAH 2A2QT 1XGRB 3A6CL 3OF6A 3VJ6B 2OK0L 3K6FA 3F6JA 3I6SA 3U7WH 2X4OB 1KIQB 4ODBD 1U33A 2ZKXA 4HSQA 1G7LB 5T5FL 3RNQA 1J5IA 3LEYL 5KSBB 3B4NA 3FFDB 2ZCKH 4HIPA 1JZ2A 4TNWK 2F15A 1FAIH 5AKSA 4Y5XA 1RJZB 4EE2A 4HAFA 2VXUL 3U7YL 4DJMA 1JV5B 2VQ1B 5F3HB 1JPTH 1LYQA 4JN1L 1RMFL 3GIVA 4PPTA 4XMLH 5D1XA 5J6HB 3EUDA 3I84A 1F6AA 4WV1B 5J6SA 4ACPA 3PAZA 3IEAA 3L3JA 3LZPA 4FGMA 4IBSA 1S7WB 4UCFA 4XOCA 5D5MF 3WXVH 4YN3A 1AQKL 3B56A 3PRZA 2HX8A 4M7ZC 5FWRA 3HHSA 5J13B 2J1ZA 1T7XA 1M2OA 3E8VA 4JN2B 5KSBE 1MFNA 1XF2B 4QUOA 3VGBA 3NSJA 1I9RL 2JXMA 1BG1A 3NEOA 2UZYB 2IANA 2WXFA 4DFIA 4P99A 1S5HB 2XKNA 1K4DB 2WJ5A 1QRND 2VW4A 3H2QA 5SWQA 5AG9A 5EORH 5ID0B 4FABL 1MCWM 5EUKB 2IQAB 3BHBB 3DX3A 5HI4D 5T33H 2IAMD 3QNZA 1MJ7H 1YNLL 4ONGL 2GBUA 4RFEA 1P7QB 1QHOA 5C0GA 3BQUD 4M43H 1PNDA 4PCKA 3Q05A 2ENQA 4UM8B 4F80A 3KLDA 5AVQB 4MCNA 3V7AG 5F9OL 4L3CB 2J6EA 3ZT7A 3IDNB 2D3NA 2AEWA 4DKEL 3WS3A 4RWYL 3QGVA 1ASOA 4AVHA 5IR1B 4JFFA 4U1NB 5SWZB 4PV8B 3HZ3A 3HNTL 4WY7H 5TPWH 3T65A 3LPFA 5CLYA 1BWMA 5IVXB 3QYNA 2PYFB 1IC4L 3O9WA 4S1QH 3UAFA 1CS6A 4L8DA 1PJ9A 4WJ5A 1JK9A 4KZ0A 4N0UB 3CPLA 3REVA 4XC1H 4O5LL 4R7DB 4FAAB 3O2WH 2EJ1A 3KM2A 4F24A 3VRLE 3QISA 4HISA 3JVGA 4ZXBD 3ARGC 4TVPL 5C0NC 2IOOA 3FQTB 1D5BA 1LL1A 3GSRB 2ED7A 1AR1C 2NYKA 4AQ1B 1HILA 1Q94B 1CI5A 1OSEA 2B1HH 4N2IA 4QT5A 3V4UL 3P4NB 5F21B 4RX4A 2A1WL 5EEUA 4Z7WE 1JYXA 1UACH 2G60L 1I1YA 1B0GB 4XRCB 5DA0B 2AXGA 5A2FA 5C92A 2X10A 1TEGA 3TX4A 5MEPB 3LPGA 1B0RB 2G0LA 4Y7MA 3QUXB 1ML0A 5EA0H 3SQOH 1K4CA 2ZWYA 4OZHA 3SKJH 3HLAB 1E67A 5C0RH 2NXZB 3HI6L 3KJ4C 3W0WE 1I1FA 3HZMB 4G8AC 1X5JA 1ZHKB 3VB9A 3VYOA 2JXMB 1XO8A 3KYAA 1RU9H 4YHKL 3VRIA 4WGVB 3MV7B 3ZYJA 3ULVE 2C7UA 3F04A 3PWUB 3T8MA 2FX8H 3SPCA 1IL1A 1QFOA 1FLTX 1U3YA 1J11A 2BNQB 3MLXH 4PJXF 1X9QA 2APFA 1DLFL 1A6WL 2KDYA 3B9DA 4KAQH 4MMXB 3WTWA 1TTCA 1EAQA 3DX9A 3BH4A 1ACYH 4MJIB 5HJ3B 5DHYB 5AW4B 4N0CC 4N26A 4GRLC 1BMGA 2P5PA 1INQB 4KTEL 1AHWA 5KW9H 4BQCA 4AW4A 2GHZA 2ITCA 4YZFF 5IR1A 3HNVL 3H6AA 4BK8A 3I6KB 4U3XA 4NWUL 2DQGH 4KUZH 3NJMA 5G55A 2NUTB 3NN8A 1D7DA 5E2TL 3KPRA 5DJ0A 4PM1A 2WHVA 1XGRA 3FCSB 4WI0B 1HDMA 2IG2H 4NM4H 5FFGA 1CFVL 1HHKA 3AU1B 1P0SE 3T4YA 3WFBL 5BS0B 3Q44A 4L8SB 1F1DA 1XCWA 2XN2A 4Y19A 4KO5A 3K0WA 5DUBA 4P05A 4UTBL 3GMNA 3II1A 4GS7C 5D1ZD 3GBMH 1VDGA 4Y9GA 4I9WD 4P5MA 1AFVH 2DIEA 4P5TD 3FJTA 3UJTL 4OB5L 3MLSH 4AM0A 2VTFA 4Y9CA 2E75C 2AF2A 5EHFA 5DJCA 3U6RB 1L7IH 1E9PA 5CEXA 3QZLA 4ZZFA 5GRVL 4QGTA 5K59E 3IDYB 4PLKD 5D7JD 4XP9H 2A6JA 2L4OA 4EDXA 5BS0E 3ARDA 3VXPB 4R6UA 4XO9A 3UTTD 2YD0A 4F2EA 4OTXL 5HHOD 3B5TA 5ADPL 1O9VA 3VE0B 3BPCB 5GGQL 3RA7L 3ZTJH 2OMVA 3WEBA 3FSVA 1CB4A 2NW3B 3O8XD 2ICES 3NVQA 4UV7H 1K5NA 1L0YA 2FD6L 1CDIA 2ZUSA 4RMVA 2R4RL 4OQTA 3L7EA 5AVSB 3FOLA 3OKYA 4HC1L 3NCMA 3ARFD 1DUYA 1BM3L 2Z31C 3S3BB 5AVUB 1EJOL 1JGDB 3EJUA 1JGVL 3H9SE 3DX9B 1TJIH 4XR8C 4PYGA 5HYSA 1IFHL 4GRLA 4JHBA 5E99H 4JKMA 2I7OA 4G8EB 4OLWL 3HFFA 5KYWB 1UD4A 1QLFA 5F1OB 3NJHA 1MCWW 1T1WB 2ZJSL 1SXCA 1RZ8A 4M9PA 1TQUA 1QW8A 2F19L 4XVTH 3CNKA 1YPZE 2XWZA 4FNLH 3F7YA 3QT2A 1NDTA 3PJLA 5KBNC 2BRQA 4Q2ZA 1NH6A 3CSTA 3OLIA 2AEQL 2OTPA 3VI4F 4A2DA 5EUOF 5T3ZD 1F6LL 5C0CB 3TT1H 4I5BA 1UFUA 4LO9A 1S7QB 3PWPA 5TE4H 4FLOA 4PWEA 1NDMB 3OZKA 4X0KB 3SOBH 1UM6L 1QHQA 4TPRH 1B0WA 4OCSH 5CCKH 1MZZA 3QIUB 4Y1AD 3QQ4A 1I8AA 1UD8A 5LXGL 3E80A 3LN4B 3VWKD 2WWMC 3ZHNA 5KVFL 4ZXBC 1BAGA 2PXYD 4BEIA 5FM5M 1A6UL 3QUKA 2DQCH 3L5WA 1KYOJ 2P7TB 4KY2A 3BKJL 1HNFA 3PV7A 3NCXA 1IBZA 1BD2E 4A7VA 4Z7WF 3AMLA 1XF4B 1TKWA 1B2WH 2P5ED 4WFHD 1E2VA 1TYEB 3LZFL 4KNUA 5IK3B 1A1NA 3VACA 1AE6L 1X6LA 4LZKA 5FFOA 3RWFB 5FS5A 1YEJH 4ATTA 4M1CC 1UB6B 3OXSA 2A6KB 1OTUC 2QKSA 3W5NA 1T22A 2QSCL 5DJCB 4L9DA 5D7SH 4X9IA 3RGHA 4JFZL 3W38A 3GZKA 4PGBA 3CVHA 4X6EB 4XPTL 2Y4SA 3O6MH 3SDDC 1J0YA 1NEZA 3W39A 3FN0L 2EECA 3EO0B 3BH8B 4H88H 3V6ZA 2YS4A 5D5MA 2Q8AH 4NCC1 1J88A 4Q74A 1BX2B 1MJJB 3DURB 4KI5D 3L9EA 3T0XA 4G7VH 4H25B 5EU4A 2FJGA 1NBVH 3MREB 4RLDA 2YKKA 4UDTB 4XO4A 2F61A 5EIIG 1DQJA 4N0CD 1PVHA 3EO9L 5FKAA 2NY1D 4IMLA 5T5FA 3RQ3A 3QEHA 3L5IA 4NJAL 3LPOA 2XXMB 4CVZA 2XN9A 5I0XA 3TWCH 3NIFB 4GRLB 4WWKB 3U0WH 3OKKA 4LXFA 2Q7YA 2XV3A 5LUMA 1NAML 1OB1B 1G7MB 3O8XA 3MV8D 4ZSOB 3V7AE 3ZDWA 3T1FA 1QNZL 2Y06H 2VLRE 2O6CA 1M42A 3U46B 4XP4H 3G5VB 2JFCA 3IPEA 3BUBA 3C6LD 3EJJX 3FO2A 3QEUA 3OGOE 5FO7B 3CZLA 4LCCB 4MCZB 4JG0L 2UY7A 3K6DA 1DDTA 2E9BA 4BSWB 4F2ME 1FNHA 2QVMA 4Q2ZB 5C08A 2C3GA 1KIUB 5IB2B 3CFJA 2PETA 1X6NA 1FRGH 4Y2LA 3KDMB 3HC3H 3IDIA 4JFDB 3FU7B 3LKPB 1DJIA 2R23B 4FFWC 3ZQWA 5HYIA 4U6XB 3AB0C 5D8JL 1AANA 2UXVA 1Z6JT 2PF6A 2KL6A 3KE0A 4HDIA 4K71B 2YFNA 3ESNA 2CCVA 4UV4H 3IYLW 3F01A 3RWCB 1LO3H 1MRDH 4P23C 3RDTC 1SXBA 4JQIH 3HE7D 4Y4KC 3RX9A 1M1SA 5C0JA 5AD0B 3P30L 2PCYA 4BFBD 1ZV2A 1QG3A 5IHUL 4FQHA 3QZWB 2F2HA 1DVUA 1I7RB 3O6FC 3V6OC 3WJLC 1GYAA 2JF1A 1CQKA 1LP9B 3LRHA 3DTUB 2YEVB 3V4PA 5KYUB 3MLYH 1OCCB 2BX5A 4NQCD 1FC1A 1T3FA 4UNVA 1B4LA 1V3KA 2EINB 3QDJA 2Y69B 1E4KA 1R3KA 1AC0A 2JNZA 5J3HD 4JFQB 1S3KH 3UAJD 3GLZA 4NO2A 2FIKB 3DVGA 4PJ8C 1Q1PA 3OLGA 4XBMA 3TNNB 3V4LA 1MRFH 2YPKB 5HHOA 3LKRB 4D3CH 2XQYA 4BHUA 4H26B 4PJHB 2BNQD 4XCEB 2X3AA 3K8KA 4GAGH 5D72L 4PTTA 4HIHB 5JOPD 3K2KA 3I50H 5I19H 5B1JC 3BQVA 3O41A 4Q89A 5C0CE 4ANKA 3W9DA 5MENE 5BZWA 1IAKB 2VR4A 5HGDB 1ZWIA 5AAMA 4P2OD 1DHKA 5IJCC 2BVTA 4KXAA 4XNUL 3VFRA 5GS0C 2HJKB 3E6FB 2CAKA 3PG2A 2VLKA 1NGXA 1AP2B 1CDUA 1LMIA 4JO4L 1OGTA 4PJ9D 4QXVA 3WTUA 3BH9A 2VIRB 4ZPVA 4ELMB 1JG9A 1BYNA 2TAAA 3A4DA 4Y8DC 1K85A 3KLLA 5E6YA 4NPKA 4HWBL 3Q9PA 4TLTA 3P4LA 4RFOH 3KGSA 3S36L 5SWQB 3FB6B 2Z7ZA 4CVUA 4JPKH 4GSXA 4E9SA 3ELQA 4V33A 1K72A 1NIEA 2Y72A 1NPNA 4IJ3C 4PS4H 3MBXL 4NKMA 1IVLA 2VDKB 5DK0B 3ISYA 2IV8A 3EG9B 4I9XA 3QXTA 3QDHA 2EVHA 1PZ5B 3IDYC 5KANG 2JJUA 2UYLA 4JUSA 2YA2A 1JFQL 1U8MB 2A6KA 3TIEB 2NW2B 1FHGA 4JFHE 4Y16C 2NY3B 2L7UA 5FW6A 1NUNB 4LCCA 4NAMA 5D1ZC 3FCTB 4S1SH 3RVXC 1ET7A 4JKKA 4Y8AA 5JUEH 2GJ6A 2XVKA 3IE9A 4JRXE 3CFBB 1WDAA 3QNYB 1OGAE 2IPKB 3U1SH 2P47B 3EYFB 3UTZA 3RU8L 5IB2A 3SBQA 4BZ2L 1DQLL 1FVDB 1CDHA 1OE2A 2ZSWA 2ZOOA 3FO0L 2R2HB 4JW3A 5GRJH 3ZSTA 1PU0A 4PH8A 2K70A 4NZUL 2ESVD 5I1IL 5HPOA 3REWA 3WN5B 5ID1B 2V0AA 5I1JL 4PJIA 2R8SH 5CGYD 4YDJB 1O6SA 1S7VB 2J2ZA 4B9YA 1TEYA 2DM3A 3IU4L 4NFCA 3LKRA 5CD3A 3NK4A 4MSWB 4EAEA 3MRNB 4G1EB 5C08E 3QULA 3O45A 2B1AH 3IETA 3KPOB 3L7FB 2XWDA 1CGYA 1BQLL 2FRGP 1B0GA 3IMSA 1RIUH 2CIIB 4XNXH 1AZRA 5EO1A 3V4PB 2VDMH 1HYRC 3DJRA 5DQJB 3SE3A 4G2AA 1T4KB 3HZYA 4F58L 1G9HA 4B9GA 3M8OL 3FTZA 4JRXA 4KMTH 1IM3B 1RSFA 3V95A 5ECJE 2MRYA 3GSVA 2AK4E 3L3IA 5FW8A 4FJZA 3ZKXB 5L9DH 1KN4L 2YGPA 3UAEA 4Z7VF 5BV7C 1H3TA 3W82A 1UG9A 3QUZC 4L9LC 1Y7VA 1S7UB 4MKTA 3FUEA 4C4KT 5IJKA 3CAFA 3PAYA 4YHLL 4M7KL 2AJSL 3B9KA 3FU7A 3LKPA 4K2UL 3Q8EA 4HIIB 1J0ZA 4CSTA 2VZ1A 1PDKB 1IGFH 1XWVA 3TS8A 4HJSA 5CJXA 4PJEE 3BVNA 4NC0B 2ZXGA 3WFCH 4OBSA 4WI7A 1BYPA 1TTFA 2AJZA 1RZJL 2C9RA 3FFOA 3O6FB 4H0HB 1TLKA 2KI6A 1SEQH 3F84A 3QJVB 3AQYA 4MJ6A 3T5WA 1NCAH 2AJ3A 3HAEG 2VERA 3T04D 1LP9E 4GSQA 1G1KA 3S37H 1YEWA 1EERB 1TLMA 1PKQE 2BSEA 2ZXBA 1GMEA 1KB5B 2DQIL 3QH3B 3ME0B 3WJJC 2JI1A 4MJHA 4NNPH 4ABVA 1VFUA 1DJWA 3LQAL 4FQLH 4XH2B 4L1BA 2VAAA 3KPNB 4RNRA 5DZAA 3ETSA 3LSOA 3DOSA 1TZGL 4PJEB 2QHRH 3LV3B 4HHWA 4KC3B 3ARDD 5EIIA 1SMAA 3KPQA 1VAHA 4HS6A 1JRHI 1CLCA 1HSBA 2GBVA 2OMTA 1IGTB 5C7ZA 4I87A 2GITB 4I0PC 4Q58C 1LE9A 2NQCA 3KLSA 2Z1PA 3EJZC 3UBXI 1QUPA 4OCWH 3I9GH 3MBWA 3NZHL 3SBRA 2VW7A 3SBWA 4M7LL 5K69A 4YVUA 4JX0A 2Z34A 4NBXB 4YWGH 5A2KH 1H3PH 3MO1B 4WW1B 4Z7VB 4PJIB 3C9NB 3ZE1E 4H0IA 1SYSB 4WWKC 4TQEL 1S9XA 5MHSE 3IK2A 1XZ0A 4K7FA 2WNGA 4IM8A 3GI9L 4TLKA 1UQSB 4QTHA 3GM8A 1R34A 5BXFB 1UCBL 1TIUA 2NYYC 4R96B 1Y07A 2EIKB 4YXHL 2VLJD 2GQHA 1CGTA 1WBZA 2MJWA 3OX8B 4M29A 4XC3L 3LOWA 4B9KC 1AGCB 1FNAA 3H4HA 1NBZB 2X6UA 4IK6A 3ZK0A 4JK0D 3T77B 3MV9A 4FERA 4GLRH 4P06A 3T0WA 3P0GB 5FR3A 3G5XB 1I8IB 4NSKA 5FYLH 3L3IB 1OTTD 2WD0A 2AITA 1TMCB 2DV6A 1T89A 3E8UL 4GAJH 1CD1B 3O4LA 2VE6A 1MG2C 3MRBB 3K7UA 1T1WA 1KTLB 5F6HJ 5AQ0A 3B2PA 2A0LC 5E9DE 3N1QC 4XPGL 2Q9OA 1P4UA 4LGPB 4ELMF 1RP8A 2P8LB 1CC3A 2BZDA 3D0VA 3TEXA 5KOMC 3JTTA 3W37A 3IJSB 4PCTA 3JWOC 2OFQA 2J1KA 1XR8B 4HBQA 1G5GA 2B59B 2X89A 3IKKA 5B7FA 2Q0ZX 5GRUL 1UUNA 2QLYA 5CM1A 4NRXA 1U3HA 2QQNL 2CHNA 2Z4TA 3KPQB 1AO7B 5DRNB 2KC0A 1THAA 4NZTL 2ZSVA 3VXUA 2VN4A 4PJBF 4AENB 3O0RL 4EI6B 3UDWA 2NY6B 5GGVL 3G5WA 1OW0A 2RBLA 2XWBA 1ZTXL 3WIHL 1QASA 3FQNA 4JG1L 2H26A 3DGGA 3LH2L 3DRQB 4MNGB 1J5OL 3ZE2E 1KJ2B 1S7RA 3RVTD 1IGYB 2H2SD 3FTXA 2UXTA 4ODHL 5DLML 2DLIA 2FBRA 1TETH 2VDPL 5T3XD 3QFJD 1L0PA 4ATWA 4NXKA 2BY3A 5A3IC 2FX7H 5F1IA 3BUIA 4LVOC 4TTDC 5BV7B 4GG6B 5I1KL 5I5IA 3FRUB 3TIDB 3MNVA 3OZ9H 3CC1A 4YK4C 2BXZA 1NIBA 4OF6A 1IVTA 5KSVB 4JRYE 1JDDA 3CSGA 4IKJA 4NQVA 4WTZG 3GTTA 3A23A 3SB3A 3U4BL 3W56A 2DICA 1ZEAL 4KDTC 1P7QA 1TF4A 2YSSA 1G7IA 1U91A 3BPLC 4HJIA 3MLPA 3TVMC 2VO8A 5DU7A 4E0RB 5DUMH 2GY7B 2HH0L 3WKNA 2KZWA 1YN6B 4TVPE 1XZ0B 4K7FB 2YRBA 1TQSA 1QKZH 1KGIA 1QBML 2MPAH 1F4YH 1ICTA 2FX9H 2D31B 4P2RD 4R5TA 4QJ3B 1OAZH 5EOTB 3U36B 2ZP9A 1GXEA 1MLBB 3O2VL 5D6DA 1QFUL 2VXTH 1I3RB 3L3DA 5FC9A 5DHXB 3RWEA 2PCFB 3HRPA 2NZ9C 4LARH 4DERA 3BVXA 5T3ZH 1B9KA 1TVHA 2YD5A 2ODHA 5GIRA 3RZCB 4FQQA 3ZHFA 4UT9H 25C8H 5FECB 4F7CA 3S3DB 2UV3A 5AALA 2KLTA 3UIYA 1AGFB 1RP9A 1KNOA 3B9KD 5FA3A 4KQ0A 1Z9PA 2YD3A 1CDGA 4PJ5D 1WFTA 2A4EA 2AQTA 4JDZA 3NN8B 1QBLL 3UH8A 3O81A 3FUFA 3SODB 4JFDE 2K3TA 3IDXL 4X8CA 3SDCA 3X1NA 4PJXA 4L8CA 2C3VB 1WD8A 2VSKB 3CG8A 4A7GF 1AGBB 3DPBA 4A6YH 2F9BT 3CJJA 1KJ3H 4LT7A 1ITCA 4X42A 1AQDA 5D7IF 3NIDB 4YDIL 5CCJA 2PP8A 2VQ4A 4NN7C 2YUVA 1HHJB 3RG1C 1BOYA 3OGCB 2CRIA 4HWBA 1G6VK 3OPZH 4JFFD 3V6BR 1DEEA 5BS0D 4P5MB 3PWUA 1AD9B 4X2UA 2H0FA 4QEGA 2FGWH 2Z64C 1S8DA 2YK1L 1CFSA 1NCGA 5I8OH 3GMRA 4HUXA 4QXUH 2DKUA 2WKOA 4MYWB 4DK6A 4LOUD 3IXAB 3H6JA 4RBPK 3UL4A 1MNUH 2JKNA 1XIWD 3BP7A 3EDKA 2EDLA 3U0TB 3CH8A 2R0LH 4G6MH 2HT4C 2XZCH 4MB5A 5DJXB 4C58B 1C7SA 4AKOA 5KVGH 1MY7A 3FUDA 5CFHA 1WWAX 4HXBL 2AI0L 1JRHL 1GOFA 2IIJA 3INUH 1RZKC 3UACA 3UTSD 1NFKA 3INOA 2EXYC 3RAJL 3RX7A 1NKRA 2AZAA 3OC8A 2CJUH 4WFEE 1A7QH 5CBEB 5T1DL 3FOLB 1CT8B 4N90E 3X3GH 3LMJL 3D34A 4H1LA 5HJDA 4DGYL 2APTA 4ONHB 3H3KA 1VGEH 2AGJH 2WXRA 3BVTA 4ELME 1I3GH 3PWNB 1NDGB 4OZFB 4QD2E 4O2CA 5LBSL 3NG5A 4YXLL 2X2IA 3NACL 4YHNB 4E41E 1LO2H 4NQTA 1G9MC 3QHZL 3NSXA 4PREA 3NP4A 3B2VH 2ZXQA 5F1NB 4H8PA 4ONOA 3BX7C 4CGUB 2JKSA 5I1GL 1A3LH 1DCLA 2KHAA 3QNXB 5I6KA 1DANU 4P23D 1ZVSA 3RDTD 3ZT5A 3TPUA 2HG5B 4N6RA 4ODVL 3VYNA 4B5EA 2CUMA 4KDWA 2FQEA 3VW3H 1JUFA 2I7SA 1ZHKA 1AGFA 2C5DC 5HDQH 1ECYA 4ILDA 4L9LB 1U8HB 4PVNA 4POUB 4Y16A 2PCXA 1YDPB 5AOIA 2PPEA 4AV0A 2P5WB 3G6JE 2LLGA 3GMLA 3ZKXC 4JZNA 3QUMB 4K9EH 1IE5A 2EDOA 4HK0B 2XBTA 1MF2L 4Z7QB 3OV6A 3X13B 5E2VH 4FMKA 4PJAA 2C3VA 1YUHB 3D25A 4HG4K 3U25A 3EDDA 5JQ6H 1WAAF 5F9DC 5I66A 3MGAA 1FL3A 5DRWA 2EE9A 4HD9A 1E42A 4I4WA 2WB1A 2V8MA 3D07A 4N2OA 4YGAB 1I3UA 1AQKH 5J3HC 2XBDA 4B7LA 3RWFA 3QJFA 1BAWA 2V9RA 1TZAA 3F7LA 4NAJA 1JZ4A 4AYFA 2CMRH 4ANXA 3GS4A 4UT7L 1FZJA 4P2QB 1ZGLA 4RZCA 2E56A 2ARJQ 3CZFB 2W65B 4JFWA 2R0KL 3L7EB 2D2CC 1CXLA 4RMBA 5GISL 3GYRA 1T2QH 4AEIL 1DUYB 3HFML 5CU5A 4KK5D 5CCHE 4NYLA 3IGUA 2J57A 3S8WA 5C6TL 3DROA 2FUTA 1J48A 3FW6A 1F00I 4MA8H 4WHYG 2X1PA 1ZGLM 4AH2A 2BP0A 1K8IA 2FHBA 3O11B 2QPFA 4GXUM 3MOBL 4YLQT 5GQBA 1IARB 2G9HA 1SEBA 5B3JF 2XKUA 4X7TB 5A2LH 4PN6A 4L8SC 5EU4B 1YJDL 1TENA 3QQ3A 3SE6A 2EUWA 3GKWH 4X4YB 4NP9A 2YOAA 3K2UL 1CWVA 3MU3A 4AM0B 1SJHB 3PP3H 3QA3B 4UZGA 1DP0A 1MFEL 4HCIA 1ZANH 3VRLF 3FFCA 3QPQD 2JI3A 2TSBA 3TO2B 2EDWA 1FCGA 3ARZA 4LAQH 4ODUA 4IOIA 4FN0A 1KY6A 3F5WB 1U3HC 3FUKA 1F4AA 4FFZA 2TRYA 4NAQA 4S1QL 1WSST 4OLXH 4GNKB 5CP3A 1ROWA 3NRQA 4O5LH 2J8UB 4GUPA 5EBWB 4AXWB 1BQ5A 1L6ZA 3MA9H 4G59C 3QIWD 1CGVA 1DLHB 4G43A 3T9WA 1NWOA 2C1PA 2CD0A 1F11B 1IV8A 2WQ8A 1JF1A 2YGQA 1YN7A 1U3NA 1SYVB 2Y25A 2H2PD 4M1DH 5D7IA 4KI5F 5A6IA 4KPHH 3ZDYE 3UGXA 1VIWA 4QY8B 3GQFA 5KYYA 3LB6D 3BT2H 5DO8A 1TKWB 3V0AC 1YEKH 4JY6A 3VFSB 2E5EA 2AABL 3ZY7A 1X7TA 5FO9B 3FB8A 3NSFA 1E8WA 3BXNB 3DYMA 5BCAA 1LEIA 5HDBE 1OOWA 2AQSA 1WCBA 2CWRA 4LHJB 3VD4A 2OM5A 1MG3C 2VDOL 2WWNA 2QT6A 2WQSA 1G9EA 3PLYA 2KUTA 2NY4D 1OSPH 1RU9L 3BHBA 4YHKH 4UQAA 4J4PC 1SGKA 2YPLB 2VRAA 5CO1A 1NAKL 3GDBA 3NCYS 5E4OA 2CM6A 2F8OA 2DQEH 1AD0B 1MI5A 1ZE3H 1JAEA 4A38A 3BWUF 3IDNA 3BH8A 2PTTA 3PABB 2NQDA 4JRYA 4PTUA 3TWYA 4AT6B 1ACZA 1WV7T 1PFCA 4MD0A 4Z7QF 2PPDA 1M56B 3DV6B 4OJFH 4PRBB 3QFJA 3D87B 4LESA 4PWJA 2UWEF 3MCLL 4XMPL 1I7ZA 3KPLA 3QR2A 1YYMH 2BIHA 4LRIC 3D51A 1NFDF 2ZCZA 5B4MD 4FQJH 3BKMH 2XA8H 4L5FH 1HHIA 1RIVL 4LRNH 4Z7UF 4GO9A 3FO2B 4GIOA 2AEPL 3WY2A 3C5JA 3NSYA 1JK9B 4HU2A 3ESVF 3QUMH 4GEJA 1MW2A 3F62A 2VXQA 2IOMA 1TNMA 2H32B 2IPUG 1CFNA 1MFDL 4PP1C 5K1NA 5HGDA 1F8TL 1CCZA 4N8UA 4PVMA 3RDJA 3BDYH 5KYNA 4YR6B 5CF3A 1Q94A 3DDFA 3Q13A 1A3QA 1LILA 1NSNH 3U79A 4F9LA 1KZYA 4ANUA 3MUZ1 1NBZA 3SHSA 3UMTA 1Q72L 4Q9QL 5F7FA 3TJHC 5E7FA 4U4IA 3TT3H 4P2RA 5EWIL 2OSXA 3AU0A 4NJ9L 4OM0H 1MHEA 1WUZA 5DVKA 1W72H 2EACA 4LKCB 2QKIB 3T0EB 3TF4A 2K6YA 3DO7B 2ZAIA 2X5PA 1F90H 4JM2D 1NM9A 4QHMA 4OVVA 2QPSA 1DJGA 3CIAA 4N5UA 5E4AA 2OQJA 4BBWA 5SWSA 3VXRD 3X17A 2AXFB 4ZO9A 5IVXE 2IQ9L 3BT0A 4QTIL 1EFXA 3SGEI 2PR4H 3UZEC 1F2XK 2F1EA 1QRKA 4OD1L 2FO1A 3IGLA 5CR1A 2BIOA 4GUPB 4Z9KB 2N3JA 2DKSA 3EKCA 3LQAC 1IGMH 2FEJA 3IRZA 4APQB 2BVEA 1G6RH 3KGRA 1EAPA 2D0GA 4GRWF 4QRPE 3WL9B 4CADB 2FBJH 1FBIL 1S6NA 3P2DA 4Z7UA 4L0YA 3BUPA 2B59A 2XA3A 3GGWB 1OHQA 1YEHH 3CMOL 3RWJA 4XNMA 4OVUA 2AKRA 5H94A 3NGBB 5AZ2L 5DJYB 2Z0BA 1BFSA 4MAZA 2X87A 5DD6B 3QXAB 2I07B 4W9KC 1LGVA 2X2YA 1W72B 5C0IA 1QPKA 1L5GB 4WUKH 2IWEA 4FFZL 3TJEL 3GUTA 3UBHA 3S98A 5CUSL 2FWSA 4TNFA 4Y4FC 3L9RB 5F6IC 1UUSA 3DHMA 5B7MA 1WCBB 4YNYA 2WLJA 3QUYD 3FO1B 3K71A 1JNNH 4WO4B 3REWB 1F41A 3T65B 4OJYA 5KVMC 1Q4NX 1NCWL 5IOPA 5LAPA 2J5LB 3DKHA 1OM3L 2WLYA 1AXTL 4B0MB 4OZIE 4M4RA 3P0VH 5TD4A 4QRRD 4WDIB 5LGHH 4MCZA 4Y4HB 3FTUA 3LKNA 1OHZA 4PJHA 3TTYA 2WLIB 2ZG3A 5EUOE 1ZLVK 1T0NA 3WELA 2IDQA 3JV4B 3MTRA 3ES6A 4DP6X 1OSYA 1E6JH 3LKSA 3DO4A 5ABAA 2PWFA 1FH5L 1KBGH 4MQ7B 5GGTA 1DBAL 2ZAGA 4PWKA 5E0QA 4DKFL 4DCQA 1BDYA 2YSTA 4FFYH 2J8UA 2Y5QA 4JZOA 3FU3A 3LQZA 4MD4B 5EBWA 4AXWA 1QI5A 1PSKL 4MJIE 1VEPA 2UYLB 1DO6A 4B7IA 1RURH 2DIBA 2NR6A 3CSPA 3OLEA 3L5JA 2NY2C 3SOBL 3IVKA 1LLAA 2AJYL 5JHAA 4UYQA 1DEDA 2DMBA 3EIFA 5I5JA 1KGWA 1ED3B 4WI4A 1U41A 2WN2A 2YJQA 1ZHLB 3HS0A 3DV4B 1A6AB 3C08L 3FFCD 1N5YL 2NY0D 1GZQA 2FSEA 4LSQH 4OJCA 4OZGF 3C8KB 3K72B 4X5WB 1OVZA 3K6SB 3P77B 1TVHB 4F7PA 3D39B 3FQRB 2E9JA 2YWZA 2NCMA 5ITFA 3O9WC 4G71B 3L3OA 4UBDD 3LEXB 3M7OA 1Q9OA 4QXTB 5MENB 4QJ4B 3DJ9A 4WNQB 2N59A 3WHE1 4ZG1A 5C97A 3OAUH 5M95B 2R7EB 4JFFE 3T3MB 2CLRA 1PZUB 1FJ1A 1EXUB 2J8UF 1CF8L 3QIWA 5IFJA 3ULAB 3S4SA 4N2FA 1NUDA 4Y9EA 4U1IA 2E27H 1ZK9A 5CKGA 5DHYA 3C5SB 4GQQA 3DX8B 3ARXA 1EVUA 2DPKA 5KS9A 2HLAA 4BQBA 5K5YA 2ZT9C 1IEHA 2Q8BL 3RVUC 3HI5H 5DT1H 2QMKA 5A2CA 1MSPA 2OXGB 4LHUB 4MJ5A 1P1ZA 4Z7QE 3IMBA 2BFVL 3L3KB 2WCSA 2IANE 1RSYA 2GIXA 1TJGL 5AYTA 5LBSA 4I48A 1KELH 4J3VA 5HGGS 1VB9A 4TL5A 2D7TL 5EC1B 3PWPB 1JD7A 5DUBB 2XWJA 3GHEH 2CLVA 1U93B 5AWNL 2QPEB 1IAIM 2R1YB 1WA0X 2V3DA 3EYQD 4KHXH 2ADGA 4TQIA 5SV3A 3K6NA 3TIEA 3VTTA 1C9SA 2ARWA 3PUCA 1PG7L 1BVLA 3Q5TA 5A2JH 5BO0D 1PLCA 3SY0B 4LLQA 1KJMB 1QNZH 3ABZA 4U1SA 1J9QA 3QDMA 5FUOH 5TFSL 4AL8H 1L6XA 1RLBA 3LKOA 4OQTH 2YMXL 4RIRB 3UJJH 2VISB 3EF7A 1V7ML 5I5MA 3C8KA 5D4JA 1SLWA 1XF3B 2EIBA 5E1HB 4DCQB 4EMZA 1J8HA 1IKFL 4NPYB 1BBJB 1KZQA 3CHXA 1A1NB 4R97B 4AIXA 4ZTEA 1X5AA 2W9DH 3VFGL 1C5CH 2DYPB 2BSRA 1M7DB 4I18B 3D1MC 5LG1A 3PWNA 4NO0A 2VJ0A 4YDNA 4Y5XB 5IF0B 1X5ZA 4NBYB 4JGNA 2AJZB 2AXWA 2WV3A 5D8JH 3SDDB 2OA9A 1T89C 5D2NE 5CNHA 2NZ1A 2CGRL 2CNYA 1EXUA 3OJMB 1CFTB 2GSMB 3OKNA 3ZE1B 4XZUA 4A2EA 4JANA 2P1YA 4X7FC 3WLWC 4JM2A 2VT0A 3QJZA 4Z7OE 1GYCA 3P30H 2KT6A 3QDGE 4JR9H 4L8DB 2ORBH 2X4OA 4RSVA 1N10A 3B83A 3KVDD 3U1PA 1RK0A 2HTLC 3L3OB 2MCAA 3KZ8A 3BAEL 4NN6B 3LEVL 1PG7W 2Y6SD 5JMRA 3BD4A 1N59A 5IJVA 1IQDB 3RURA 5KWYC 4M4RB 1U8HA 1LNUA 2UZXA 4E2OA 3LCYA 3P3YA 3O2DA 1L3WA 2D4DA 2O6FA 4LDEB 3MNDA 2LABA 4KKAD 4XCFH 3LS5L 3VI4B 4AQEB 2NY5L 5I24A 1QRNA 1RUKH 3UDWC 4OGAD 2LV4A 1HQ4A 1S7UA 4YFLI 3FXIC 4J8RB 4ALAL 5M7QA 3B1TA 3WN6A 3AACA 4M6MH 3BZDA 1SHSA 3L3JB 1QP1A 5F6IB 4X83A 1NCBL 1E5AA 2WCPA 4OZFH 2YD8A 1S7TA 5I5RA 1OP4A 3FUHA 2V9UA 4HJ1A 4XT1C 4X4MA 2V7NB 3I9AA 4OU3A 4J6RH 2WIMA 2V17L 3O4LB 3CHPA 1IM9D 3HLKA 3NQKA 2Y7SA 2BIPA 5BXFA 5EFIB 1XXDC 1XF4A 2VC2L 1I8MA 4KVNH 3EF4A 1TZOA 1LD9A 1MFBL 4ELDA 4APXB 5A7BA 1V3LA 3HNSL 2MHAB 2OCJA 4FG6C 4XBPA 4NHCL 2IAMA 5GJSH 1A21A 2P42B 3MCYA 4K3JH 1A4BA 3EBGA 5KANI 5T3XE 4N0RA 2B2XH 1MREH 2I24N 4U1NA 5SWZA 2CKBL 3BWAA 4OFDA 2K45A 1I82A 2IGLA 5BMFL 3BKYH 4AENA 3X3FH 1G94A 5JTWA 1CYWA 3QCUL 2BJMH 2W9EL 3L1EA 3ZKQD 2JKLA 1UADC 4HMCA 2CCLA 4KZDL 1FCCA 2P5EB 1PD0A 3I6GA 1AZVA 4BWWA 1JYVA 4XN4A 1PQZB 5AAWC 4HJEA 2E4FA 4G6KL 1G0XA 2D3VA 1IQDA 3KPSD 1RPUA 4TNVF 4U2YA 1JHLL 4F9PA 2D9CA 1SVZA 2GUOB 2OXHB 3PWLA 1GIGH 2YD1A 4XPAL 1J1OH 1AGDB 1AZNA 3QZPA 3HZVA 3HUJB 4MNHB 2C34A 5EH1A 5LNDA 5DR5H 1QPPA 1Q0XL 3I3BA 4KXCA 3D39D 3CX5K 4CVXA 4J1UA 3VXRA 1J9SA 1NLDH 3QI9B 4GIPD 4OF8A 1GCFA 2AV1A 2ATKA 5IW1B 1RHFA 1R46A 3QR1A 2GT9A 1RZFH 2VJXA 3OHMB 5AVWB 2YKLL 3T77A 5SX4I 1SY6L 4Q8BA 4NQEE 4U0QB 4U1JB 4XBGA 2XVBA 3CXHJ 1OGSA 4FJYA 1CE6A 1BIIB 2GVYA 4FQ1L 2QV2A 4PJHF 5KSVA 1E8ZA 1CLOH 3HUJE 2E3VA 4MKMA 2ZCHH 3MGOA 4G8GA 4UWQB 3IDGA 5CU9A 5J5EA 4LPUA 1A14L 4PJEF 2EYSB 5DI8B 4HWNA 4JZJB 5H4YA 4D94A 1MCLA 3JWNC 4EUPH 4K9JA 4RA3A 4DAGL 3TNMA 3VI3E 5AD0A 3AC0A 1NCJA 4FZ8L 5J9PA 3MROB 2YN3A 4FXTA 4XN5A 5ESQB 3C09C 3T2NL 5B21A 2HFEB 1MKFA 4BUHA 4EKJA 1HQRA 3JQOB 5E23A 1H8OA 4GBXB 4NNYB 4FX5A 5C0AD 3WNPA 3I02B 2SEBA 3HA0A 4KKQA 4CMMA 4M56A 1EVTC 5GGRB 3C8DA 4P59H 3T8VA 4CN6A 1CYXA 4YZFE 1W15A 5E95B 1LO4H 5ISZE 1YNLH 4ONGH 4UAHA 5L0QB 3MRGB 4TULH 2DQIH 3QORA 2AK1H 3A0OA 3N85L 1TFHA 3QO1B 1HHGB 1HHJA 1X7QA 3QUXC 4OLUL 3BWAB 4H26A 2GFBB 4G1EA 2WZ5A 4KHTH 5D4HA 2ENJA 2WLHA 5HPMA 4MLIA 5HD8D 4G1MA 3N42B 2G3NA 3O3AB 5FGBC 5BUGA 4PD4J 5IW3A 4YHYC 2MH4A 4QRTB 3MKGA 43C9B 3IPFA 1LXMA 5D55A 3VFRB 3N5AA 1EBAA 3WO3B 1ZCRA 1AXSB 1FP5A 1INDH 2EIMB 1C12A 2GT9B 4JPIB 4M8UA 5DFVD 1KCWA 3KCWA 4AMKH 2VM3A 5EOCJ 3V6OA 3OJVC 4HX1A 4HULB 1G9NL 4GO6B 3EGSB 4FTVB 5EU5B 5A43C 3ABMB 3F85A 1GGIH 4RGNE 2KZKA 4M1GL 3PWLB 2H1PH 4Z3IA 5C6WH 5I28A 1URIA 2CDEB 2X9XA 4JFPA 4AZ8A 4LHQB 3D08A 3GXUB 3QXAA 3DHPA 2J8OA 1R47A 4NUGH 1F3DJ 1E6OL 3Q8BA 3D25B 4C4UA 3IXAA 5GZND 1UACL 2G60H 5BRZD 3U82B 4HCGA 3W39B 3U9UA 3HG1E 4NZ8A 5HGBB 2A73A 4L8BA 5AB2A 4RAVB 3TBVB 3KDPB 1CGSL 5BQ7A 1XBRA 1UVQB 3TBYB 4P2CG 2ZX7A 5JDJA 2F58H 1VFOA 4D8PA 4YPJA 2WGNB 2H1LM 1XD1A 1M1XA 5EZIL 4JLRA 2VLJB 4K7PX 3LRSB 5HHMD 4DW2H 1N6QH 1X5IA 4Y5XC 2FR4A 3CVHH 1QBAA 2BIIA 3LN9A 1Z2KA 3QCTL 4LU5H 3UBFA 3MCKB 3CHOA 4BFJA 1XEDA 1P5UC 2JV6A 3BD3A 4AH2B 4WHCA 3LXCA 1Z0MA 2VDNB 1D5IL 2W38A 5CILL 3P40A 4P8QA 2A38A 5FUCC 2JKJA 1OZUA 3FT3A 5IIEB 2HUHA 4WWOA 3RWIA 1DQIA 3HG1A 1KN2H 4KTEH 2LHAA 4P9HC 5EF1A 2CU9A 3L5HA 5FGRA 2QQNH 2EC9T 4FNTA 4FI6A 4KMQA 3RBSA 4KUZL 3FTSA 5LG6A 2YLKA 3IDMA 5I66B 4QDGA 2EUXA 3TH3T 3UJIL 2ZUQC 2J72A 3KYMA 1JZ6A 2HTKC 2R23A 1KXTA 1JHKL 5IB5B 4FXGA 4MNGE 2FH6A 4Z0XA 2JIXD 3D3VB 3CWGA 3DO3A 1FFOA 1IAII 4IOFC 2YAPA 1VFAB 2XRAL 3WY3A 1HKLL 4K3GA 3QUMA 2FX7L 5AB1A 3UC2A 1BP3B 1UWGL 5GHWH 5D2LB 1P6FA 3PDDA 3MSPA 4TVUA 3L9YA 2WLLA 3MX0B 3Q06A 2ZOUA 4KY1L 2VZSA 4P23A 3RDTA 3RB5A 1HAWA 1BREA 1OGAA 3ZXAC 5A3ID 4OKVA 1IMHC 5GRYA 3II3A 3IAQA 5ERWB 4DPCX 1ZVHA 3O11A 4EDWL 3FK3A 4S10A 2COQA 2TRHA 2WXQA 4ONFL 5KN5A 1PLGH 3V4VL 4Y0GA 2BC4A 2XG4A 2DD8H 3L4YA 1PPIA 2ESVE 2APXA 5KJRH 2J5WA 3FU9A 3B2UC 4RETB 4GBXC 3N1GC 3ULSB 4HIXH 4AVJA 3OB0H 4G11A 3ETBJ 4YFEA 3KR3L 5FOBA 1QBMH 1BQHG 1XGYH 5HHOB 3AABA 3ATBA 4N0UA 4P4KC 1OAZL 4JJ5B 5MP6H 4NBZB 4QHUB 2JB5L 3QIBA 3NH7H 4BRJA 1KXVA 2BP8A 4NO3A 1R3IL 4D8PB 4Y4KD 3BKCL 5KYXB 3AQDA 1EWHA 4ZUUB 3M1BB 4N28A 1AXIB 1H3GA 1XF5A 3G5YA 4QNPE 3IJYA 3NJVA 1BVLB 2FATL 4JZNB 1JZDC 1WISA 4O58L 3QWRD 1YNKH 2H3KA 3X1EA 1Y18B 1N6UA 2HPOA 1SPDA 2VLLB 5D9SA 4KROD 3AXIA 2C4FT 2B4CH 4PVBA 1E9OB 3FSWA 3HRZC 4WU5A 5CXPA 1G1OA 4O2FB 1J05A 2RCSL 3PP4H 5C0EA 4QO1B 4JFDA 3ZQ9A 4G7YL 2UZYA 5FHBL 3ALPA 4OAWA 2CKBB 4FXGB 3FAWA 3KBFA 5EU5A 5L4JA 4IU2A 2EE6A 4FP8L 4Y9BA 1MWAB 1YMMB 5GGTH 3N1MC 3VTMA 1BXUA 4YBQD 5ADOH 4XP5L 5H35B 4BSVA 4LBEB 2Y36L 3QEGL 3SDDA 4ANWA 5HD8C 4FTDA 4Y2DB 1BLIA 3VFPB 3ZHDA 3BLBA 4PLNC 6PAZA 3I2CL 2BRRH 4ODXA 2C4FU 3CFBA 3V52L 3ARDB 3TC9A 1K8IB 4AZUA 2VLME 1SFDA 2PW2B 3CFTA 1B3JA 1FYTE 1MCSA 4CMHB 3FO9B 3MV7E 4JFFB 1E28A 3US9A 3ZTNL 4ZFOB 1ADWA 3TZVD 5JORA 4GSDH 1MHCA 1OT1A 4NQCE 2H0EA 5FB8B 5DQ9B 2HJLB 2R0LL 4AQAA 1DQMH 1LWRA 1U92A 3NJGA 1EMTH 3MRQA 4EBQL 4GG6E 2H1XA 4Y5VB 2J71A 2FH8A 4N2EA 4CBPA 1XHHA 3FSOA 2V2XB 4LLYA 4LNRA 3VXSD 1ZMYA 2QQKL 4MCMA 3R0NA 5T3XL 1OGAB 4YC2B 3TH2T 1VPOH 1AJ7L 4XE5B 1TSRA 4L8SA 4F7CB 2EC8A 5ALBL 1U8PB 4PBVC 3X3GL 2FO4A 4IMKA 5ALCH 2C1OA 1UXWA 3KLHD 1LDSA 3JUYA 1AIFB 2CA4A 3QI9C 4LSPH 5DEZA 3RVXD 1U8OA 2C3WA 2Q8AL 3O9WD 2G5RA 2CO6B 2CIKB 2Q20A 4UBDC 4AV4A 5IB1B 1SDYA 3NACH 4D9LL 4RH4A 5HDBB 3OKOA 1FG2B 3ZL2A 3FHQA 1A64A 4P5KB 5TK2A 5JMOC 2WLKA 2Y23A 1WBYA 1OO2A 2ZUQB 3FB6A 5E8NA 4PRIB 3RVVD 5C0AB 4WI2A 4QRPD 4XMKL 5SWSB 1L4IA 3VFSA 3V5HA 1AQDB 5D7LA 1OP9A 1S9VB 1RCYA 5BUPA 4UOQA 2IH3A 2A9MH 4TUJA 5C9JA 3SDXE 2H0PA 1EGJL 2EEDA 1UT9A 4GT0A 4ZUTA 1B4JL 2DBLH 1NAMH 1XEUA 3DUSA 4BUGA 1T1YA 3RIKA 5E24E 1OTSD 2HYMA 3LRMA 2XIIA 2XV0A 3DXAB 2P26A 2IDTA 1D7BA 3EYFA 4XPFL 1V10A 4U6VL 4OKVB 4JG0H 3FT2B 2WO3B 2A77L 3B2MA 3NABL 4M7JH 4P4KA 3D39A 3MLUH 4BFIB 5I6XB 2G75A 4FJ6A 3QORD 4U1GB 4ZD3L 4DGIL 4Q6IA 3X11A 1JK8A 3GHBH 1CXHA 3I75B 2VMFA 2Y7QA 4IJ3B 4Z7IA 4UT6A 4AQOA 3L3DB 4L3EE 5DJYA 4LCUA 2GUYA 5E2UH 5L0QC 4G5ZH 3FCSA 3ALWA 3US0A 2CMRL 4MMYA 1UOLA 3RIAF 4LNRB 4CAGA 4IRJC 5AL0A 4E36A 1BMWA 2O5ZH 1LO3L 1MRDL 5C71A 4RVBA 2BH0A 2HMIC 1DJXA 2IFGA 3ZL1A 1MIEH 4M62L 1UASA 2JQMA 4NO3B 2UWEB 3BAYA 1H3VA 1KWGA 3FTWA 1UA6L 1TU2B 4JHUA 4JQVC 2M26A 4LASH 4P2RB 1LM8V 4UDUA 2XWTA 2F5BH 4LLYB 2O5YH 3I6LE 3FOMB 1CDJA 1U4FA 4HIEB 2PPAA 3ARBC 4L29A 4ORGB 3T0BA 3WHXB 4DO6A 2X1XR 3AS2A 1KB5A 2ZOLA 3GSNL 1AQMA 5LHDA 2ERJB 4MA1B 2X4SB 3ZZQA 2MNWA 1MOEA 1NICA 1J0HA 3I50L 1UB5A 3R4DA 4ANVA 5I19L 3MRFB 2QADC 4NWTL 3KWVA 3P3TA 2W0PA 2IPTH 3NJJA 1EJFA 5JW3H 1Z5LA 2PP9A 1PBYA 4B97A 1JERA 3QUKB 2PYED 3D85D 5DD6A 1D6EA 5T1MB 1KYAA 1GC1C 2XICA 3W5MA 4H8WC 2VMEA 1PZCA 1HT6A 2UVFA 4OZIB 4M1DL 3BN9D 4GBXA 2K8MA 3D9AH 3FONB 3MBWB 3UTPD 5JOFB 2VXQL 5EEWA 1SJXA 1C5DA 2GABA 4NQUA 1AVAA 2ZUXA 1UB6A 1DBBL 5I8CB 3IKCA 5LCVH 1FVEA 7PCYA 5DVNA 4DGVL 3PWVB 1ACXA 4AG4H 2V2XA 2C9XA 4PGBB 4QT5B 3JWDH 5DA4A 3L5XH 2AMUA 1QSEE 4UQEA 1YUKB 4TRPL 4UIKL 4XZUB 1L7TH 4DH2A 5ETUA 3GO1H 3HMXH 4DN3H 3D0LA 3EJYC 5EZOH 3AUWB 3KL0A 1A1OB 1AXSA 3VD9A 1UJ3B 5HVWA 1OGPA 2FE0A 3W2DH 1WG3A 2ZICA 2IAND 5F1NA 2OZ4A 3VA6A 3IMVA 4XP6H 4PGJA 4PGZA 3D18B 1NL0H 3HE6B 2NY7L 4JQVA 4PJFF 5ANMB 5GSRA 3TNNA 3TP4A 2YPKA 4GXVH 3H55A 4QMEA 5INCA 4RAHA 2GTQA 3SCMB 3CVIL 4MJ2A 4BQ6A 4QTHB 2BSED 2UVEA 2P7TA 4GQ9H 1RZGA 1I1AD 2WVVB 4Z0BH 4Y2DC 3TO4D 1CD8A 2XN9B 4ORGA 4PS3A 3VGDA 2X53A 1DQTA 3US1A 4YXKL 2H5UA 1T20A 3DRTA 1U8KA 5CP7A 3X14B 4IRZL 5DJDB 3VXSA 1NFDA 2DTML 3E1F1 1OCWL 1MHPH 2CJTA 2OL3H 5EIQA 3UYOD 4CSSA 5HJBA 3TOPA 2P5WA 4P49A 5ICUA 2W0KA 2XPYA 2VH5L 2VZOA 4KJPD 3S3JA 4CSZA 5EOQH 2EZ0D 3TXAA 4JFED 4J3BA 1A7RL 3M1CA 1BOGB 3LVTA 3HG2A 3WNKA 5HHXL 1KTLA 3WD5L 3KPRB 1I3RA 5L9DL 5DJ0B 4HWZB 3DX6B 4YSSA 5F9AC 4LGRB 1DN2A 2FZ3A 1N9PA 2X12A 2XI9A 3VXUE 3IJSA 2PWEA 3FU6A 4Y1AB 2P43B 3TO4B 1XV8A 4W9JC 1D7CA 4NC1E 1N59B 3MZGB 2E74C 1WZMA 4ZYKB 4RMTA 2BVYA 4JVPA 4WO4C 5I18H 3IMWA 1UWEL 4KKNA 1JBJA 2IGFH 4S2SA 1GJUA 4QRPB 4OT1L 4MQSB 5DDHA 3V4VB 1MXDA 3RWGB 3BGAA 3C6SA 3S7GA 5AZ2H 1WFNA 1P6WA 3TN0D 1XCQB 1IAKA 2WQRA 1TQWA 1A6ZA 1KCBA 3ARTA 2BVOA 3DSNB 3FMGL 2F8XC 3MRMA 3P69A 3S37L 4K3EH 2UZPA 3OG6B 4MXWH 4CC1A 4HPHA 5JHDD 4KXZI 3SYOA 1INEL 3BPNC 2K6WA 2BIQA 4FQIH 3UPRB 3P11L 1CICD 2HKAA 1T21A 4JGMA 5F72S 3ZKNC 3GS7A 3VVWA 3HMWL 3WOVA 4XNYL 3C8HA 4DTGH 2CR0A 1VSCA 2DQJH 3O6LL 1RUPL 5AZEL 3NCWA 5KVDH 4RFNB 3EDFA 5T1LA 4HCRL 1WO2A 3U83A 4OM1H 3KDMA 3N06B 4HUXB 1LHZA 3TPKA 1T20B 5CP7B 1BQUA 1KFAH 2CO1A 4FTVE 4XHJD 5BOPA 3ECQA 2AXHA 3LZNA 4YUEL 3HS9A 4I77H 2AP2A 4K5OA 4MDIA 5JPNA 3CFQA 3KLHC 4MD5A 1J0JA 1Q0YH 4FXGC 1YN6A 3FKUS 5HHOE 4F9LC 1IEAA 1YLBB 1GY1A 4A37A 5K9QG 5KYWA 1CXKA 1H3PL 3QPKA 4PB9H 4QWWD 4P4RA 2WXOA 4GKSB 1AY1H 4Y5YA 1DVYA 3K6IA 2AQ3A 2KZBA 1ADQL 3DMMD 2ETWA 3RJOA 4BINA 4NZRH 1EHXA 4M6NL 2YXFA 3EGDB 2OQJB 1RJYA 4R4FL 5FOBB 3BW9A 4KRMB 2MWCA 4LLAA 4ZOBA 5D5ME 2WAHA 3LNHA 5J56B 5F3FA 4MA1C 4V2BA 4PJXB 1NUFA 5C0ND 4L8CB 3WFDH 1H5BB 4W81A 5I8KH 4XNQB 1NEUA 1E4XI 2KERA 3BVNB 3RZWA 1KC5H 2WN3A 3NGBC 4UNUA 2V7HB 4LPCA 1CVRA 5DZVA 4HC1A 4YHNA 1L3NA 2EKSB 1XTMA 4HS8H 4H8VA 1FO0H 3B3BA 2YGNA 3V0HA 2YJLA 3WFEL 2F7OA 4FRWA 3HB3D 3D85A 3HPJB 4X0NA 1GAFL 3RL1A 1OD9A 3WKMH 2BXYA 3BFQG 3SO5A 4NOBA 5F8QC 2B20A 2K1MA 4IRJB 3RNKB 4PLJD 3O4LE 3U9PL 1MAMH 1DZ0A 1NCCH 1JUFB 4FYQA 2VABB 2NY6C 1O7DE 1JWSB 2WUBL 1KCRL 1S4IA 3QORC 1JZFA 2P8MB 4JFEA 4P46D 3VMNA 3GPEA 1R3HB 5DD5L 3TBTA 2CKBA 4E41B 2HT3D 2Q8BH 1BW8A 1JPSH 3DJSA 3OGCA 5B8CB 5DT1L 4P5RA 1JZ8A 3TBSA 1FGVH 3GMQA 4FXKB 2IEPA 3OKLB 2BFVH 4XX1G 4WV1A 1DE4B 2DLFH 3FT1A 1FYTB 4QHNA 1JIBA 1F18A 3WDHA 4F8PA 3VSUA 5FA4B 3BESR 5BO1L 1KLUA 3QVAA 5KSUB 4P4KD 4Z95L 4DEUA 3V4UH 5DD1H 1OAYL 3OAZH 2NY2B 2JSFA 3WIHH 4HUNB 3DI3B 1Z3GH 5JZ7C 1MLCA 4I1NB 1U95B 1CK0H 5C07D 4ZJ9A 5HYJD 5EU6D 4JL2A 3FB5A 3P4MA 3ZDZE 2WLZA 3OHXA 5E8OB 4ZFOA 4PREB 2A6DA 5JORB 3ASOB 3IBOA 1BQRA 1AZUA 2WYIA 4MA7H 5EA0L 3SQOL 3UTZB 3CZFA 4DPRA 3GB7A 4KV5E 5CEZD 1Q1JL 5IQ9A 3V5KB 4J3OG 1U3HD 1I1AC 3UBXB 1MJ8L 1BFVL 3KYNA 5A7EA 2VR8A 3TO4C 43CAB 3RFRA 3RP1A 1WC7A 3H9SA 4B6ZA 2QPDB 3P73B 1G1CA 2NTFA 2NXYD 2E7MA 3LN5A 4PS8A 1A02N 12E8L 4WNQA 1FYTD 4UQBA 3EOAB 3ZVVA 4MCYB 2WZ0A 1ZA3B 1BXXA 2XN9D 2VNCA 4PRDB 2BHFA 5JIDA 2CE6A 5FF6B 1ZHBB 4PJ6A 1CR9H 2W92A 1CUOA 3HUJA 1XT5A 4I18C 3C09B 4U3HA 4MXQC 2UXGA 2XC8A 4YL4A 3RKPA 1KB9K 3IJHA 4HETA 2DYPD 5FFLA 5K9QI 1J9RA 2NX5D 3ARFC 1QLRA 1IC7H 1XGQB 4M5TA 4Y9FA 4UANA 3TCLB 3CU1A 4IMKC 2AFNA 5T3ZL 1KENL 5EIIB 1G0DA 4JFEB 4NM8L 1IJNA 3IXTB 4LQ1A 2ZCLH 1MRCH 3D12B 2K7PA 1R5IB 5EV7A 1WYJA 4WFFD 3SKOA 3BC9A 1FFNA 4LGSB 2HRGA 1NC2D 3RGBA 3H3PH 5FYKE 5H2BA 2E6JA 1MQ8A 1PY0A 3FBKA 3D50A 1ZT7A 3RGVA 4OD3L 4ZTPL 2YEQA 3DUSB 4J3UA 4K5NA 4W9CC 4BFGA 4E9RA 2HVKB 3D69B 1VF5C 3LZLA 2HPTA 4L05A 2XTJC 2ARJA 5K39A 3VDBA 4X6DE 3FYEB 5K59F 2OP4H 1BBDL 4IDJL 3Q43A 1EH9A 1WF5A 3GBNH 1JHTB 4TQHA 2WZPA 4OB5H 2DQ6A 1NCBH 2Z8VC 3Q2VA 1WA1X 3HE6D 3QRGL 3QUHA 1U4EA 1L7IL 1CYGA 5AVVB 3D2UD 2F18A 4L37B 4M7LT 3SCMD 1JXKA 1FA4A 1QR1B 4X8GA 5I6LA 4ISVA 3VSQA 2OJ1A 5IT2H 3X2QB 5C0GB 4K71C 4UT6H 3VWKC 1RERA 2FEDC 1MCEA 4JHWL 4P23B 3RDTB 3WKPA 3C87A 2N0MA 3RA7H 3MACH 4H0LC 2ZXWB 1CTMA 5CEZE 4KNTA 5E8PB 5KBKA 2PO6D 3B8YA 1SXZA 2QQLL 2V8LA 3M45A 4YBHA 2D7OA 1MNUL 1I7ZB 3KPLB 5C07E 1JZHA 4PRDA 3CQQA 3P4NA 3GMMA 3RPBA 3LNIA 3TEWA 4JM2B 3FN9A 1SDDA 3EFDL 1JP5A 2OR9L 2VMJA 1JRHH 1L9OA 1G0YR 3INUL 3BKYL 1HHKB 3T4YB 1CLYL 4QY8A 3VG0L 4ZQKB 3D8MA 3V0WL 3MLZL 5AVYB 3Q8CA