5JYMA

Human p-cadherin ec12 with scfv tsp11 bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Disruption of cell adhesion by an antibody targeting the cell-adhesive intermediate (X-dimer) of human P-cadherin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 51
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5jymA01
3Q2VA 1FF5A 3UBGA 4APXA 1NCGA 2OMYB 3FF7A 2OMWB 5JYMA 4ZMXA 5CZRA 3PPEA 5DZVA 4ZMZA 4ZMWA 2YQGA 3K6DA 1OP4A 3LNHA 3FF8A 2O72A 4ZMTA 1SUHA 4AK1A 3K6IA 4AQ8A 3LNEA 4XXWC 2WCPA 2OMVB 3Q2NA 4AQEB 4ZMQA 4NUPA 4AQAB 3K5SA 1WUZA 4NUQA 1WYJA 2A4EA 2OMUB 3K6FA 3Q2LA 4AXWB 5CO1A 4APXB 1ZVNA 2YSTA 5JYLA 4ZMNA 2QVIA 2WD0A 1O6SB 3K5RA 2WHVA 1L3WA 2A4CA 2EE0A 2QVFB 3LNGA 3UBFA 3Q2WA 1NCIA 4AQ8C 3LNFA 1ZXKA 4ZI8A 1NCJA 3QRBA 2OMZB 5KJ4A 4ZMVA 2OMTB 3LNDA 4QD2E 4AXWA 4ZMPA 2V37A 4ZMOA 1Q1PA 1NCHA 3MVSA 4OY9A 4AQEA 3UBHA 2WBXA 4XXWA 4AQAA 4ZMLA 3LNIA 4NUMA 4ZT1A 2X2UA 2OMXB 1EDHA 4ZMYA 4ZTEA 4NQQA
chains in the Genus database with same CATH superfamily
5DEJA 1NGPL 2PYFA 1A6UL 5I1DB 4X8JA 4ZFFA 1WTLA 3U6RB 2P52A 3B2MA 3D9AL 4POZD 1J0JA 1E4JA 4X6CF 2B5IC 4Q0XH 2JCCB 4GUPB 2IDUA 2HXAA 2AEWA 5GZNC 4GKNB 3PQYE 4XNMA 4GLRI 3VGDA 3ZDZB 3NOIA 1FLRL 4NQTA 5D2NC 4JFZL 3ZZLA 1LEKB 3GZQA 4N2BA 3BVNB 5E9AA 4NN6C 4F7TA 1BZ9B 2VL5A 4TPRL 3P9MB 4N3TA 1O7SA 3NK4A 5HDQL 3KZ8A 4N22A 3A67H 3QH3A 4L8BA 5CMAB 3T6VA 2C3VB 5B38A 3LIUA 2EUZA 1KTBA 4YPGA 4Z3IA 3HB3D 4QTIH 3MRRA 3CX5J 1QI4A 1EFXB 5EUKB 2VDQH 3SE9L 4HMDA 5A2AA 3BSZH 1NUFA 4KDTC 4UOW1 2X88A 3ZK0A 3PFUA 1A5FH 3QFJB 4H8QA 3V6ZB 2ZWZA 1RULH 2QGEA 3DPBA 1VZHA 5EBLA 2P44B 1P1ZB 1EXUA 3HI5L 3K6FA 1A0QL 4Y5VC 4KTEH 43CAB 4N6QA 5FYJE 5I5RA 3OB0H 2N0KA 1XIWA 1QACA 1ZAGA 4P4RA 3WENA 5KBLA 1DQIA 2I60H 4DPAX 2EVIA 2Q1EA 4QF1A 5FDYA 1Y6NR 1MRFH 5I1DA 2EUVA 2WLNA 3GKWH 3SBWC 1SPDA 1YZZA 2DIJA 1RUQL 5E6IA 4JLRB 4PI0A 4F93B 2CG9X 4XODA 4DGUA 5BJTB 5C9JA 3E6HB 1EMTL 4NB7A 4GUPA 2YQ3A 3GBDA 2AMUA 1AY1H 4XB7A 5BO1H 3MZTA 5J3HD 1JPTL 1XGZA 2ALWA 2L7UA 1XCTA 2Y7QA 1CLZH 2C7FA 4N2LA 4ODSL 5E2TH 1LEKA 3HNSH 5ICYA 3N3EA 2WC7A 5IHUL 2E6QA 1EVUA 5E2VH 5IVXE 1J1PH 3RPKA 4OKVB 1D5BB 3RU8L 4Y4KC 5FYJU 2VDMB 2GSMB 4ELME 3VI3E 4WW1A 5CMAA 3LH8A 2C3VA 5D1XC 5I76A 4DZBB 3M7FB 1S7RB 2Q3ZA 1IVLA 4H8WH 1O75A 5JQ6H 1M05A 1EFXA 4NRZB 5EUKA 3GTTA 3B6SB 4XTRD 1OAKH 2MSPA 3IETB 3IXTB 5E5LA 3QFJA 3FUEA 3CFJB 4Q9RL 3V6ZA 3KXFB 1JWSB 3ZDYF 5AVRB 4UQBA 4U1GC 4PN6A 5I9QC 2ZUQC 5C0AE 1ASQA 5CFAA 3EYQC 2IH3B 43CAA 5H4YA 5BRZA 1HZHL 5TQ2H 4IRSB 1ZXQA 1HNFA 3RY6C 2PXYB 4JCLA 3NJXA 1WTGT 3CXDL 4NUGL 4XMXA 3KLKA 3VQMA 3P3SA 5EG6C 3JBG7 4OZIB 2BIIA 3K2MC 2P5EB 3I75B 3VFGH 1A7BA 1NC4A 3LEYH 3WDHA 1FFQA 3U1QA 3ABKB 4KITB 2AI0L 1RZ8A 4OFPA 4X6BA 1YA5A 2EXTA 1TZ8A 2VUOA 2YLKA 3BDYH 1LO5B 5E1GA 4JRYA 4H1LB 4PJ5D 2V5MA 1DJSA 4JN2B 1QUNB 1OQXA 1T6VN 3PF2A 4ZO8A 5C0CE 3KLAB 4OLYL 2BW4A 3D39D 1OK0A 2WBJB 3VG0H 3PABA 4PRDB 5AW2B 5EN2B 4I18A 2UZIH 5LCVH 1VFAB 3QIWA 3B6SA 3GSXB 3T0EC 3IXTA 4ORZC 5F7MC 5FO7A 2IIJA 1E4WL 3L7EA 3QIBB 1G9ML 3KXFA 3D25A 3PRZA 4NQCD 2X6UA 5EOCH 1OL0A 1FPTH 2GG1A 2YAEA 3JV4B 3O81A 3QDGE 5A40E 1Q72L 5IFAL 2CBOA 2VLJD 3QWOB 1A3ZA 1ZA6A 1J8KA 4P23C 1P84J 3VXSE 1A6TB 2QVIA 4IRSA 1KBGH 2PXYA 1HDMA 1A7OH 1DQKA 4ZDHA 4CSTA 1RY7B 1TXKA 5A6LA 3BGMB 4M62L 2QSQA 2NT1A 2VXQA 3VXTA 1S8DB 1HEZA 1QSZA 4H0LC 1V10A 4KZDH 2MOGA 1PU0A 2E9JA 3TCXA 1W91A 2BINA 4KGJA 1GXEA 5FB8A 2P5EA 1BFTA 3I75A 2E5EA 4Y1SA 3FKUS 1QSFD 4DOHE 2QL1A 4P5TA 1NCDL 3WJMA 2F5BL 3FQXB 1TJGH 3OKOB 3IN0A 1J8HD 2FHBA 5D1ZC 2F8XC 2JJSA 4RFOH 3FU8A 4I77H 4U1HB 1FGVL 1VPOH 1H8LA 5GRJL 1GTNA 2DWDB 1H8NA 4Z7OF 2ZUYA 1E8YA 4RETB 4QHNB 4J3OF 4PJEE 1QUNA 2C1PB 4K71B 1UUSA 1D3CA 1DTUA 1ETJA 2DI7A 2DIEA 4F7PB 2JV6A 4X99B 3TVMB 1RZ7L 3FQTB 3CZSA 4YSTA 3VD5A 1CDCA 1LEGB 2WBJA 5E8DL 4L8DB 5A16A 4X7SL 4PRDA 3FAXA 4R3SB 4WTQA 4QOKA 1YEIL 4WO4B 4BYHA 1T66C 5BS0E 3GSXA 5DGQA 1IGJB 4QRPB 2AEIT 1V27A 5F7LB 3MLUH 2Z92B 1OM3H 4DN3H 4TUOA 1ZTXL 3B5HA 3JV4A 4HH9A 1DFBL 4QRTB 3QWOA 3TCLA 1JPSH 3QWRD 3KPOB 1X6NA 1WWAX 3UH8A 1TPXB 5CZVL 1EXGA 3FK3A 5F7KC 5EU3A 1ZCRA 3B2PA 4OCSL 1K4DA 2QHRL 4YXKH 3THMH 2WWKO 4ZTPH 2W8CA 3P3YA 5GRXG 1NFIA 3BGMA 1RUPH 2F5AL 2GAZB 3QJFB 4XOBA 3LZFH 4WI0B 4GRLB 1KLGB 2WXFA 4I89A 2BJMH 3FH8A 4FNPA 1G6RL 1BJ1J 1ACYL 2CKBA 1QD0A 2CIKA 2PKDA 2XQYA 4NCDA 3SBPA 3O8XB 3VYOA 5AW6B 2V9UA 3H53A 3WV0A 2VNCA 4ZMQA 3FQXA 5JOEA 5DD1H 3W0WB 1OAZH 1YG9A 4KOCA 3K5SA 3KLHC 5GRZA 4DW2H 3L7FB 4MQTB 4WI7A 1RUKL 1WP6A 2DYPB 4B5EA 2ZKYA 4JKWA 4M9PA 5ILTH 2B77A 4OT1L 1CD0A 3P73A 3Q8EA 5GS0D 4QCIA 4CDGC 5IGXH 3TVMA 5EBWB 3ARRA 3QJSB 2J88L 1UXMA 1RU9H 3Q5YA 4GAYB 4L8DA 5D7IB 2APVA 1GZQA 2A6KA 4PGZA 4R3SA 5CLYA 1KIUA 2KMWA 4YDLB 5D1XE 4Z7NE 1XZWA 4KV5E 3WMSA 3V2AR 1FN4B 3GLDA 4U6YB 3EO1A 2Z92A 1Q0EA 3B2UC 3X11B 4LEXH 2DW5A 3EZ8A 4CVZB 3EGSA 2X5PA 2ZIDA 5EC2B 5EU6B 5L4MA 1E4KC 3KPOA 3O6FC 1X5KA 4RMRA 3CVDA 3FT0A 1UA7A 3CN1A 4LPUA 2EVHA 4H0GA 1AHWB 5L2KA 5CJ5A 4Q2ZB 4WI0A 1NDMA 3ZHDA 4GRLA 5HVGB 5E6UB 4DGYH 3UTOA 1ZHNB 5FLVA 3SZ6A 2AAVA 5ALBH 1JG9A 2P8PB 3LCYA 3WLWD 1N26A 1BECA 4M3JA 4POUB 4RBPH 4BSJA 1JHKL 2L7JA 3C09B 4XX5A 4ES9A 1CDUA 4P2OB 3RB7A 3DO3A 3Q5OA 2MKLC 1E3XA 4XBGB 3L7FA 4K2UL 1YNLL 3WEAA 4JFFE 5JUEL 2IH9A 5T3ZD 4WTXA 4L2LA 3H9SB 2ZYIA 3I3DA 5F89B 1FNFA 1H5BB 5JOFA 3AWFA 3N43B 3SGJC 3OX8A 1RAMA 4P2QA 4PJCA 4GAYA 3ELAT 1MCEA 3KPNB 5D7IA 1XT5A 3TJEH 2DJ4A 4KI5E 1RZFH 1NH6A 2XZCL 3OXRA 1MCWM 3NIFB 1ZLUK 4WU7A 1N2RA 5CD3B 3HMXA 4HZAA 2W60A 5DZVA 3L08A 3CDGB 4CVZA 3HHSB 2FJFB 4F58H 1MLBB 2WNWA 3T0EE 1EA9C 4GP8B 1FV1A 2Y9RT 3IMTA 4I48B 1ZK5A 1P6AB 2X4QB 2YWZA 3AXLB 4R90L 3HEIB 3NBNA 2WWKT 1C5DB 4GUOA 4BSVA 1AHWA 2CH8A 4Q2ZA 2AMGA 2IPUK 2KPNA 3T65B 2CO4A 1YJDL 2Y22A 2OZ4L 3ZRFC 3BKMH 3GNMH 4EIBA 4HHWA 1F97A 5ADPH 2P8PA 1OXYA 1GHFL 3CPLB 3BVTA 3OAUL 4X5LA 1JWUA 1ZLWK 4I3SL 4GQ9H 1MCJA 2AZAA 1CF8L 4P2OA 4L29B 2P24B 4TLUA 3CLEL 1YMMA 1NCUA 4V1DD 1R19A 1B88A 4YGVB 4AITA 4I9WE 4B50A 2A74C 1S2EA 3H9SA 4N8PA 2NUTB 4NM8L 1S9XB 3LY6A 4JDEA 2BP8B 4UV7H 5AOJA 3B9EA 5CEYB 4C58B 4UF7C 3HOGA 1O6VA 3SQOL 5B7MA 1A3QA 2QKIC 1KBPA 1SZNA 2CWRA 2PO6C 2VDMH 4G6AC 4X7FC 3UZVB 5I18L 1H19A 5DEGB 5EIQA 1HX0A 1KGCE 2NY2B 4TNEA 4PTTB 4HSCX 2EP6A 4Y5YA 3N85H 4BQ8A 2ZX9A 1SLXA 3MV7D 1WD9A 4K3EH 2IC2A 2YMTA 3WIHL 3CDGA 1DHKA 3MRPB 3AB0B 3HHSA 3JWDH 1UACL 4JO4L 4MJIE 3C6SA 2FL5B 3I2CH 2CD0A 4I48A 2WXOA 1LK3H 5ISZB 2X4QA 2W88A 4JDTL 3AXLA 1KBKA 1BDYA 4KC3B 1C5DA 3BJLA 3FSOA 1JD7A 2UX7A 1CDYA 3V52H 1BGXH 3BP6B 4O2FA 3T65A 5T1LB 4EDWL 3B5GA 3EJSA 3CCHA 3H2WA 1AI1L 5D2LE 3ZR6A 4MYPA 4NZRH 3KPSE 3EJYD 4QXGL 1D5RA 3SO3B 1JGDB 2VXQH 1IJ9A 2WM0A 3KL0A 2Y5QA 2XIIA 3ZL4L 2F08A 3B9AA 2B4CC 2JXMA 4AUJA 3A6OA 3LRSB 3N41F 5IQ7L 1OF2B 3V4VL 5IZ7A 2IANB 3M7OA 4BFOA 3KWTA 2ZX7A 2XWTB 1TTCA 3L95A 2X9WA 1JFQL 4O9HL 3LN5B 4ONHA 3WNOA 3BAXA 4RRPG 1RUAL 2E75C 3MRLA 4NJAL 3MNZB 4M7KL 4GNKB 2NQDA 1AYOA 1FRGL 1OWWA 2J1XA 2QMKA 4OZFB 2BHYA 5B39G 4DP5X 1CTNA 3SOBH 4XCFL 5IQ9B 3C8DA 1DYZA 3BCDA 3B4NA 4JZJC 5DEGA 3U0PB 1GJUA 1S5HA 1MJ7L 2X42A 4DQOH 2ITCA 4AQ1B 1ZGLA 5TK4A 2WUBL 3V5HB 1H3TA 2LLNA 2Z31D 1JTPA 2WKOF 4OI7A 1KCUH 4O4YL 3UTPE 3OQRA 5E1AB 5DEFB 1IO4C 3HB3B 4U2YA 4KWUA 5ISZA 3EYUH 4Q0XL 1XXFC 1IJNA 4JMXA 4QMEA 4KJQC 3QT2A 4Z7IA 2X9XA 5F3BB 1JN6A 5JPNA 3MROB 4D9RE 5C71A 2CR3A 4X5PA 2AK4A 5AW4B 1KB9J 4PJGE 2XZAH 1LE9B 4GEJA 1U4FA 4HUUB 5K93A 4L8SA 3KD4A 4ZPVA 3KWUA 4F9LA 3TPUB 2C3WA 3FHQA 3A67L 3ILQD 1CPUA 2DLTA 3T4AA 3UIYA 4R4BB 4HPHA 1T7YA 2CKBH 2XNAB 2NDGA 1BD2E 1ZS2A 3U36A 4CC1A 4LEEA 4U1KB 1NSNH 4QTIL 4JJHA 1SDYA 3O3UN 5FUZH 2VDQL 3N2JA 4HK0B 2WIIB 2WLMA 1DVFC 4GMSH 3N44F 2XXGA 5LG1A 2DQCL 5A7BA 4IEFA 1SOQA 4UT9A 1HXMA 5IUCA 1RULL 4FF9A 1BQRA 1EHLL 4OZFA 1WHOA 2Y5TB 2IPUG 3FCTA 1OT1A 5IQ9A 3HE7A 3U0PA 1YLBB 4MNQA 5FV1L 4KTEL 5JTWA 1ZXKA 2MNUA 5CSBA 3V5HA 2DLFH 4ZAKC 2AAAA 3CVCA 1MVUB 4F2EA 3D2TA 3SDAA 2I60L 3H8NA 3ABGA 3BP4A 2MPAH 1LK2B 1MRFL 3APCA 5D1QC 3EYVA 5DEFA 4ZS7H 3GKWL 5HPMB 5KYNA 2WK2A 3LH9A 5K39A 2VUKA 1Z66A 4LKCB 4Y19E 2JVUA 1V55B 2CDGB 3NP3A 4X7TB 1KCLA 1AY1L 3VTMA 4FEMA 5BO1L 3E0GA 3E1F1 4BJLA 5KSUB 5KSBB 2EO1A 5E2TL 2RR3A 3O41B 3HNSL 4NQXB 3E2HB 1WS8A 4JG0H 1HHKB 3P2BA 5E2VL 3ZRSA 3OAWA 2DLGA 4OCYH 5HDRA 4FD0A 3TPUA 1AIFA 2O6CA 4KZ0A 4GOSA 3TV8A 3QXWA 4R4BA 3VMOA 3S36X 5I74C 4L0ZA 1KCWA 5J9PB 3FXIC 2D2OA 4ZO7A 1EUTA 1NIDA 2AQQA 4KKRA 4H26B 1DVTA 3SDCA 2J8HA 2HLFC 1F5WA 3VMNA 5JQ6L 5E8PB 2F1EA 1OAKL 1YPZF 4ZMZA 5IVNA 3IVKB 2WP3O 2GC4C 1S9YA 4JE4B 3VXOB 4W9FC 3UCQA 1U8LB 1VCAA 2ZXEB 1X3DA 1TT6A 5KSAB 4GSXA 5JOPD 5TQ2L 3D4CA 4PJ5B 3QYMA 3MV8E 5JXEC 3VFWB 1MVUA 4R5VA 5C0GB 3V6FA 4P5RA 3SB3A 3GFUA 4JDVB 1KBBA 1LK2A 2APWA 1AMYA 2XWEA 3MLXH 5BQ7B 3HMXH 3OZKA 3VFMB 2BVPB 1OCZB 2E9WA 5DHXB 3EOYG 1G7IA 4X7TA 3LEYL 4JPVH 3AMKA 4YBQC 4PV8A 3AWGA 5IT2L 5IVXA 1K3ZA 2I26N 5I8OH 1AC0A 3O41A 1OY3B 5E8EB 4AGQA 3HNTH 3N6YA 2JKSA 5DJ8A 5HI4D 1XGPB 4PRPD 4DCQA 5K9JH 2VN7A 4H8UA 3V9CA 5C0JB 3U9WA 3L4WA 4NQDB 5AUMA 1KPVB 1D7DA 1F4WH 3WI9A 2V7HA 1XAUA 4ZFQA 3VD3A 5J9PA 3VWJA 3GXFA 4XMPH 3VG0L 4LSTH 3QJTB 4K8RH 4H26A 3UEZA 2Z64C 5E8PA 5LCVL 4YOKA 3BDXA 1KPRB 1QSFB 4WHCA 5A2BA 3IVKA 5EOCL 3JT2A 1TZGL 3DX6A 2DLEA 2WNKA 1J8HB 3U2JA 5IMLA 2ZOUA 2DLHA 4JHUA 3U46B 5PCYA 5C8JB 4FNSA 5KSAA 1RK0B 3WJLC 1PPIA 2V37A 4L9LC 4LVEA 1MJ8L 3VFWA 5AVZB 3ABMB 3CIQA 4M4PA 4Z7VF 2JWYA 3TNMB 3WY2A 1S7UA 2BNQB 2KLTA 2P8LA 1FCGA 4KZDL 4FERA 5IWLC 5DZLA 1GKOA 3VFMA 2FYYA 5C6WH 4PG2C 3UIZA 1QUPA 4JM2C 3HRZA 4JM2F 5B1JA 3GJFK 3IGAA 1IGFH 1T22A 1ASPA 2OMXB 1A1NA 3DX3A 4KKNA 1XH3B 1GYVA 1TJGL 4LDOB 2E7CA 3JTSB 4I77L 4RFOL 2FHFA 4YX2H 1VPOL 1FZKA 3NSYA 4DUXA 4LCCB 1IBHA 4FQHB 2NR6C 1A6AB 1FE8H 3V4PB 4FXKB 3VSVA 3W9EB 1UFGA 2D7QA 4KK6C 4AKQA 4YMPA 4U33A 3WN5B 1CLOL 3ZTJH 2H2PC 4G7SB 3DX8B 3L48A 1OAUL 4KJWD 5CGYC 3P02A 4P2AA 4B96A 3ZSTA 2Q3XA 3V0IA 4KH2A 3LRHA 1I7RB 1IKNC 2R8SH 4JFVA 2F7IA 2VDOH 2LLLA 3FC8A 3MUJA 3VXQB 1AZNA 1ONQB 3DA0A 3JQOB 2WP3T 4PAZA 5E9DB 3IS1X 3P54A 4A7GF 1JGIA 4OFKA 3N9GH 2VE6B 4YLBA 1MCKA 3EBIA 4UIMA 4DN3L 3A4FA 3O4LD 3K46A 4ERSH 1YQVH 3O6KH 2DWSA 3FFCD 1JPSL 5FAAA 3RWDB 4C83B 4X7EC 3U46A 4LVOC 2WCPA 2WQSA 1NBQA 3C9NA 2FB4H 1FWXA 1IAOB 4YXKL 5EEXA 3THML 4ZTPL 1SXCA 2ADFH 2CRIA 2ZUXA 3ARUA 4ZJ9A 1RUPL 2BNQA 1NANI 3U9PL 4OGAC 1X5GA 4JCWA 3V5KA 4UM9A 3LZFL 2XICA 5E4OA 3NEOA 2E6JA 2QQNH 5HVWA 4X6CA 4HJJH 2VL4A 3L2MA 2BJML 3OVUB 3P3RA 3Q9PA 5GZNA 3REVB 5D1QE 4K07A 2CGRH 4XR8C 5A3IC 5F7AA 5D2NA 1XH3A 2BHFA 5DD1L 1OAZL 1F1AA 1XHHA 4FTVB 4N2HA 4ZSOB 4A2HA 3WTWA 1TQCB 2R9HC 1AQMA 3H4FA 4FQHA 4LCCA 1A6AA 1OSEA 3CHPA 4UIKH 5JYLA 1OZUA 2Z93A 4NO5A 4G8EB 2IGFH 5EZIL 3STLA 4PJ8D 1T0NB 5IGXL 3LSOA 1S7QB 1XIWD 3DX8A 2MH4A 3VB8A 4G9FB 1RU9L 1J0IA 4MZ3A 1TQBC 2A9DA 2CK2A 2VDLL 2CA3A 4KDTA 3GSQA 5CIPB 4QRAA 5LVEA 1ONQA 1TEFA 1XTLA 2G3MA 2VOTA 4IOIA 5E9DA 5EZOH 1CGSH 3VDCA 3ZDYB 3FUFA 5MENE 2VE6A 3BH8A 4OLUH 4LEXL 1Y18B 3SO5A 4Y5VA 2V2WB 3O0RH 4KRPD 4UUJA 1DQQB 1A3RH 3HG1B 4DO5A 3AREB 2GKIA 2VLLA 3M6DA 4UT9H 4HEME 4OZFH 5DRXB 3CHOA 3SGDH 2QSVA 1IAOA 1PZ5B 1PW3A 3L1FA 3SBWA 1DLFH 1T7ZA 2I9LB 2QQKH 4DGYL 4QHLA 4OCLC 1UM4L 4GP4B 5IROD 5ALBL 5CN3A 2OMZA 3WIIH 3LKSB 3EH4B 3OLIA 3MUGB 4K94L 3VYPA 5EF2A 3CVBA 1QHQA 3TZVB 4JAMB 1ZRUA 4U7SA 2H6OA 2Y69B 4FTVA 4ZSOA 3G6JF 3MUUA 2Q76A 4FGMA 1BVOA 1A66A 4Y4KA 3ULUF 1UWXK 3DV4B 4MJ5A 5C3LD 5ADOL 5D1XA 3BEWA 1T0NA 4IHOA 3KMDA 1IAII 3LPGA 3WLBA 2D0HA 4UNVA 1IX2A 3CFKB 4FYTA 2C9XA 4G9FA 3U4KA 1NAKH 2ODHA 4FI8A 3TJEL 1RZFL 3AITA 4J7RA 5ID1A 3DTUB 1KB9K 3N40F 2R0WH 1BFOA 2NNFA 4Q6YA 3DX2A 4XXWC 1NC4D 4DPBX 3ZE0E 1DSWA 3DNKA 1NGQL 3RIFF 5KVEL 1FIEA 3V0FA 1N6QH 4HEPA 3PAUA 5FYJH 1JTOA 1DQQA 1MVYA 3HG1A 3KVPA 4LASH 3AREA 5FUOH 5ENWB 4PJHB 4BSWA 1IBGH 5DRXA 3RY6A 5CEZH 1AR2A 2VXTH 1R4XA 2W80C 4G80A 4JFYB 1L9TA 4JRYD 4JX0A 4FRWA 4R4NC 4D7PA 2AXFB 1IL1B 2WNXA 3IDMA 3ZZSA 4JKPH 4KKAC 3PGFH 1HYSC 3MGAA 4JGJA 4DP1X 1KPUA 1AG0A 3ZU8A 1QWUA 2AABH 2Z1PA 1QO3B 2I9LA 2V2XA 1U3NA 3BKML 3MNWB 5DJCB 2UX6A 1NUDA 2V3EA 4PJAF 5ADPL 2IADB 3D85B 5LBGA 2VB5A 3QIWD 3MOQA 2E4TA 1U8KB 2C9AA 2MOQA 2CR6A 2PYED 3O9WB 4TSBH 2WTOA 4FNQA 3MUGA 5LAXA 4GQ9L 3VSTA 4K73A 3NJIA 4KFZC 2R7EB 2WD0A 4Z7OB 1XXDC 3NAAL 3V0AC 3L4TA 3DTXA 3ATEA 3FB6B 3DV4A 2PABA 1CL7H 5E03A 4XMTA 5E08H 1PAMA 1MCQA 4JG1H 4UV7L 1MH5B 3ETBF 2G5RA 1NEZB 3WO4C 2LOEA 4Z1PA 3JVFC 4J2QA 3GZOA 3SYCA 4LKXA 3QUYC 5B38G 3T0EA 1B2YA 3N85L 2B08A 4FJ6A 4P5SA 4NX0A 3MYJB 1ZS8B 5HGBB 4ANKA 3GSRB 3MCLH 4JFSA 4K3EL 4O02B 2WZPD 2BS9A 3KPTA 4MNGE 3QR0A 5F1NB 3B43A 3JWDL 1ORQA 2QTEA 4GG8A 4P23A 4XP4L 4HKZB 4OFYA 1R3HA 1EIBA 3QDAA 3UZEC 4MZRA 3Q43A 1UD8A 5EMYA 5AB1A 1CBJA 2CLVB 3UJIH 2XI9A 3RFZC 3V52L 3WCYA 1BGXL 1OPOA 3LPWA 4XGZB 1YY9C 4HXAH 3M17A 4NZRL 1QO3A 4PRID 1T6WA 3TFBA 4J1UA 5HYEA 4JRWA 3D3VB 3TBBA 2CU9A 4QOKD 3ZBMA 1G7HA 1KIRA 1KT2A 1U21A 2VN4A 1Z6JT 2ILLA 3GUTA 5D1ZA 1SYVB 4I0KA 1G9HA 1WBZA 3ECVA 4W4OC 3S5LA 4AT6A 4D0CB 3RL2B 2VC2L 4RISH 3KL5A 1JXDA 4UU9B 4CA4A 1FVDA 1VGKB 2JSFA 1YNKH 3PWPE 5FXCH 3T8VA 4JQXC 1AR1D 1JGEB 2ZX5A 3FB6A 4Z23A 4Y1AB 4NEHB 4AJYV 5F7HA 2R56H 4LRNH 1X7TA 4L4VB 4IBSA 4NIYE 4Z3GA 1MH5A 4FC3E 3BUTA 1NEZA 3B8YA 1Z9OA 3QNFA 4G8AC 5EZJB 3SOBL 1AO7B 4YO0B 4UNIA 4DQOL 2UXVA 4YHOH 3FTWA 5ESVB 1E9PB 5K1NA 4IBZA 4KNUA 4XO4A 3WJJC 2CM6A 3T04D 3UAEA 1KCUL 3GSRA 3MMEB 4YQXH 3U7WH 2HAZA 1F3JB 4U6TA 1AAJA 3QWQB 3DURB 1XSJA 5F1NA 1ES0B 3IFLH 1IM3D 5C92A 2I9TA 4EPSA 2EH7H 3HAEA 2X6CA 2BS8A 3L6FB 1C8QA 3EYUL 3L5WB 4S1DC 1MHPH 5AZ2H 1NOFA 1QG3A 1THCA 4LCWE 2JB6B 3T2LA 4EOWH 2ERJC 4F8NA 5DRZB 2H32B 2C4FT 2XZAL 1NQBA 4EO5A 4RMSA 1FZJB 1IC0A 4Y2LA 3HI6H 5IOPA 1SJHB 3OL2A 5GSRB 3P0YH 2K9FB 4X4XA 4L8CB 8FABB 3OD3A 3ALXA 3R19A 2CKBL 3GIVB 3T08A 5LQBH 1INQB 4D0CA 3T6XA 3LMJH 3WFHB 4F9PC 1MUJB 5ID0A 1NSNL 3HHMA 3QO0B 3BEVA 2CO6B 1IFHH 4P5MA 2B2XH 5F44A 4BQBA 1VZGA 4PVLA 1CURA 5AYQA 4GMSL 5EIIB 4L4VA 2J55A 2BNRB 5I8KH 3ILPA 1AKJB 4LQ1A 4RMUA 5L2KD 5EZJA 1XZ0B 4AIXA 1WD8A 3QCUH 4YO0A 1BVNT 4BFRA 4P06A 3GKZA 3UG3A 3QI9D 1E9PA 5ANHA 4F7CB 1L7TH 2DLFL 5B3JF 5IBLD 3D07A 5I1HH 1MCIA 4UNTA 3BZFB 2W0PA 1F3JA 3R4DA 5G55A 2MPAL 3NZHH 4NAQA 1ES0A 2BH0A 4OJEH 4ZS7L 2B15A 3O6FA 5C09E 2GHWB 3WFCH 3MGTA 5BV7C 3TX4A 5EUOE 3HS9A 1K5NB 1JZ2A 4OR1A 4ZFGH 3U83A 4D7BA 4JFDD 4RFNC 3VRLE 3ZY7A 3UP1A 4WFFD 3GMPB 4Z7UF 5FGCE 1CXFA 3QS3A 2EE3A 1F13A 4IGBC 2JB6A 5CWSB 5HVHC 4P2QD 4JG0L 1BD2A 2H4EA 4AE1A 5KN5B 4OJAA 5I6PA 3QUXD 4OCYL 1GC1C 1SJHA 3QQ9C 2VJ8A 3K6DA 2FEDD 4NQSA 5T33H 1IEBB 3BKJL 2DL9A 1UEMA 5D7LE 3L4ZA 2ESVD 3BLKA 1T7VA 2CO6A 1ZT7B 4CKQA 2CUIA 2YPKA 4DO6A 1WIUA 3IJHB 4GH7B 2OMVB 3SGJA 3SD2A 3BGFC 4HJUA 4V11A 4XMZA 5DA4A 2EDDA 3UTQB 1AKJA 5F96H 2BRQA 2YPLA 2R59A 2F6AA 1XZ0A 4BDVA 1JPST 5KYUB 5DSCB 2YUVA 1MQ8A 1Q0XH 1WUNT 7CGTA 2K8QA 4YHNB 3BISA 3LYRA 4WTZA 4Q97A 4PMFA 2JJVA 3BZFA 3CZUB 3T6QC 2EXYC 2OMUB 2XZZA 3JV6B 1BVZA 3WU1A 3MLXL 4TLTA 5CJXC 3FB8B 1YMMD 3HC4H 4C8XA 3MRMA 4JPVL 4UB0H 3GMPA 4XNDA 4OVUA 4ZMNA 4IOFC 2QBWA 5ABDE 3R18A 1SQ2N 3QQDB 4LLUB 5I8OL 5IV2A 5K9QG 2VSMB 5IK3B 1EAPB 4NFDA 2E9BA 3TJHC 3S34H 3DDGA 4K3GA 1UH4A 1KN2H 3S5YA 2NY1C 5K9JL 1M1SA 1DQDH 2HFGH 3N41B 3WFBL 1FNAA 3JWNH 3F5WB 4K7PL 3CZKA 5SWSD 5JW3H 1F4WL 5KJ4A 1KLFB 2XQYG 5DJAB 1PY0A 5I1LB 4XMPL 1HN1A 2X6MA 1PY9A 2LV4A 3BAYA 5I1AB 4M5SA 1FLTX 1JZIA 3QUHA 1AFVH 2A9NH 5FYLE 2QKIA 2PO6A 3BLPX 5EU7E 3PS6A 3ZKXB 4MCZA 4JY5H 4TUJA 2JKIS 3KBFA 4N0YH 1U8OA 4JREC 5BW7C 2XG5B 5DC0A 1CFQA 1A65A 2MMXA 4TQIA 1JZ7A 5L7XH 2HRLA 1UD4A 4PJIF 1I7TA 4M4RA 3RFRA 1DJWA 2XQBL 3TO4D 1IGFL 1DJYA 3K6NA 4GSQA 3O4LB 2NTFB 4AC2A 3QQDA 2ICWB 3FFCB 1EAPA 4YX2L 5J1TC 1LDSA 5DDHB 4TSAH 1FE8L 2X0WA 4FA8A 3DTDA 1FORH 4FCHA 1X5ZA 3H7LA 4PU2A 2MQCA 4IU3B 3PY9A 4HALA 1XR8B 2CHZA 4GB9A 4V33A 5L4JA 1KLFA 3C60D 5DJAA 5HJBA 4D9LH 2J57A 5DJZB 4HLZH 3WIAA 2R8SL 4JFXB 4U0RC 1ANUA 3KYOA 2EC9T 4BUQA 1UB5B 3TFKC 2VDOL 3DX7A 2WAHA 2R2EA 3N44B 5FO9B 2V9TA 3T3PF 1Z0NA 2M1KA 1THAA 3H42H 3OTTA 4J3OH 2MHAA 3N9GL 5AZUA 3CTTA 2Z4TA 1DVXA 4NUQA 4C56B 5AOZA 4XPBH 4MSWB 4QJ5B 4NI3A 4ERSL 5LKNA 1YQVL 2PWHA 2VQ4A 3O6KL 4JZJA 4PGCA 4CNIB 5FF6A 3L1EA 2W81C 2AK4D 3KS0J 5DMGC 4K0OA 3ZZ1A 4FG0A 1KXTB 4PJ8B 4HUXA 3RHWK 4X5WA 2ADFL 3GBLA 2D7NA 5HHOD 4YDJB 1BHGA 3C6LC 3GSOB 2QQNL 4HJJL 1HSAA 5EBMB 2AGJH 4EUPA 2GJZB 4MA1B 3I3BA 2F1BA 2A4CA 2A99A 2G9HA 4MDRA 3GS0A 3HAEH 5LLIC 5EC1A 4CDHA 4YSPA 2NTFA 2PW2A 3U0TB 2ZWSA 2H3NA 4KKBD 4U3SA 5HYSB 3L3HA 4XNZB 4UIKL 4FLQA 2Z8RA 2OTUB 3QC6X 4MNHB 4X4ME 1UXSB 3ARGB 3G5XB 2IGFL 2RACA 4E9WA 4EIUA 1Z9MA 4FX5A 1MSPA 1XR8A 1RHFA 2VABB 1LO2H 2AHIA 5DJZA 1T3FA 2OSLB 3MLTB 1F86A 5F6IB 3PQYD 1QX1A 1BMWA 1H6TA 3ARDD 3SE3C 1DVFA 1YPZB 4L3FA 1ID5I 3UEQA 1R1CA 5EZOL 4JRXB 1CGSL 1SYSB 3N50A 1JTTA 3FRPA 4OLUL 3WE1A 2QADC 4DZ8A 3O0RL 4MRCA 3OR6A 5C0IB 4OSUH 4LLWA 1OHQA 1OHZA 1N70A 1EK3A 2DRUA 3LKNB 1A3RL 1WA2X 2X4PB 4B95C 4ECNA 4C55A 4W9HC 4ZAKA 1X5JA 4C4KO 2XHNA 4S10A 5PAZA 3UDWC 2KDYA 3RVTD 1KXTA 3DUHA 4EXPX 2AQ2A 1W9XA 4Z76B 2FECL 1DLFL 2PP8A 4JFPB 1DQJA 3O6ML 3UYRH 3TP4A 2BOBB 4YHYC 2DAVA 5GQBA 4HS6B 3WIIL 5IJKC 2GIMA 4X9IA 3VD7A 5FYJD 1AGBB 2WMPB 1L9OA 5DJ6B 5FHAH 4B9JA 1I53A 3QB7C 4QRSA 5KVMC 1N7MH 4PWGA 2F53E 2OTUA 5CXPA 3ARGA 2BWQA 4U4IA 2WVUA 3TN0C 1T1ZA 3F7PC 1HXKA 3EXJA 1G7JA 1IBYA 3I6LE 1LHZA 1NAKL 3ESNA 3EO0A 1R3JB 2HJFA 5KAQG 5I0YA 3VXUA 2H9GA 2R0WL 2VIRB 2WCGA 5HI3C 1W72A 4DUWA 1SYSA 1COBA 3LDBC 3ABZA 1GYAA 1FGNH 4KKLD 4X6FB 1PZUB 5SWZE 1GL4B 3BZ4B 1MREH 5C0IA 3EH5B 1N6QL 3QP3A 5FYJL 1BZOA 5FUOL 4I4WB 3SCMD 5D70H 1UOVA 4G8GB 2NY3C 1IBGL 3HC2A 4RDBA 1OLZA 3QO1B 2EAEA 3PL6C 4ONFH 4Z7VB 5HJ3B 5CEZL 4LAJH 1KYOJ 4A66A 4JKPL 3PGFL 2X40A 3ULVC 5IKCA 4KQ0A 1AOHA 2AABL 2ADJB 5ACLA 3VWJD 1ILSA 2ZZUT 5J13C 5M7QA 5CCHE 4DKTA 4H20H 1U8IA 2NLJA 5C0AD 2VSKB 3GHEH 4TNWK 4TSBL 1MW2A 2WMPA 4WO0A 2LABA 4HJGA 5DJ6A 3LPFA 2NZ9C 3SDXE 1OIOA 3ILDA 4ZX6A 1CDGA 5KBMA 2NMSA 2CBQA 2P9RA 3SSGA 1A4BA 2B14A 5E6ZA 5E08L 2IV9A 4JG1L 3UBXI 4YIQB 2MIZA 3NIGE 2YC1A 3HFMH 2J6EA 1TCRB 2Y6TE 5KSVB 6TAAA 1EV2E 1CXEA 1EEZB 4OW6A 1MWOA 3GS7A 4XVSH 4IOSA 4OD2A 3MCLL 1DUYA 3D34A 4Y4FB 2OTWA 3BWAB 3DETC 3OR7B 5B3SB 4OJFH 1MHEB 4AEIH 5C0CD 1W15A 2X09A 4UT6A 2LW3A 3MPCA 4C4KT 1FZOA 4L9LA 4G8GA 5FKAA 1BF8A 4OZFG 2OMYB 1S5IH 2OZNA 5HJ3A 1HL8A 1WFTA 4Z7VA 5EO9B 3UJIL 1ZJBA 4MYWB 1GJWA 5CCJA 2X4NA 3WIFB 1HTYA 4OI8A 4XCYA 4AX3A 1PCXA 3U6XS 4IKJA 2QDVA 4HXAL 4U3XA 4MMYB 1CTMA 2DIAA 1S46A 3RTLA 1DE4B 1AZUA 1CIUA 4JM2A 1E9QB 2AJVH 3QDGD 5J5EA 1H3WM 2LFGA 4R84A 3UTTA 3OF6D 1G5GA 1SXSA 2YJQA 3VXSD 4MCNA 1VZIA 3K71B 2GJ6E 3AM8C 4FLSA 4RISL 4IS6A 2NR6A 3V6OC 4GW1B 2BSBA 1YNKL 3FB7B 4WUUA 4JPSA 4YL4A 2CK0H 5AAPA 2NNAB 3VM7A 1XCQB 2R56L 4LRNL 4Q56A 1CFNA 4TSCH 4M1CC 4N87A 3CGTA 2QR0A 4HMCA 1IKNA 4OIFA 2GB2A 3DX9B 4MNGA 4JHZA 3OXSB 1BMZA 4UM9D 4QYOB 4N20A 2I27N 2V8MA 1T1XB 4BCZA 3L54A 4PG9B 5D7JB 3P4NB 5GZND 4GSUA 3U7WL 4YQXL 2VQUA 4Y4FA 4QNPE 1O7VA 2CZNA 3BWAA 3OR7A 2AEPH 5EORH 3IFLL 1MHEA 3X3GH 3ZXAC 1PS3A 3Q7JA 3TA3C 4Z95H 2EH7L 1JZ8A 1SJXA 5ITBH 1T83C 2OMYA 5FW7A 2G4GA 3KPPB 3MRFB 3GMOB 3WIFA 3AAZA 4TL4A 5BS0D 1EZVY 1MHPL 3LS5H 4P3DB 4UQ2B 3IJEA 1KGUA 3IM1A 5AZ2L 3KLLA 4XZUB 4MMYA 1JD9A 1QR4A 3IPBA 3MNDA 1YUHA 2A6JB 2WBWB 1E9QA 1E7UA 3DBXB 5HPOA 3QI9B 1YN6B 1ZWIB 4YAQA 3ZMEA 3UAAA 1Q4NX 1NCHA 3P0YL 1I8UA 2MNWA 3CC5B 1IM9A 4EUPH 3BPCB 4J5VA 2K0RA 1Y07A 3QJOA 2BY2A 5LQBL 4WWID 1I3VA 3LMJL 3VVVA 4GW1A 2FO1A 1G7LA 1IFHL 3V7AE 1PZAA 1XCQA 4W9JC 1L4IA 3A0OA 3LKRA 3UYPA 3ECBA 5I8KL 3ZPDA 3B8SA 4HG4J 2H26A 3B7UX 3BPNB 1OCWL 3DX9A 3T6ZA 1OGAE 3QCUL 3GGWB 4HU8A 3ZE1F 3ETTA 3ILEA 1HIMH 1T1XA 4AV0A 1B9ZA 1FQ9C 1KXHA 4P4KD 4PG9A 1L7TL 1RP9A 5D7JA 1BMGA 4LVNC 5I1HL 4BGDA 3ZE2F 3VU2A 3DO4A 2VQ1B 5AD0B 4ZMXA 3NZHL 3JYBA 5GZOA 2ZP9A 2G2RB 3L9YA 3N55A 3WFCL 2ESVB 1ORSB 2ICWI 3ARPA 4OF5A 4HFWB 1X9QA 4QHUB 1N9PA 3BT0A 4PYHA 4ICWA 4X7CC 2O72A 4ZFGL 1D5IH 3K6OA 2FEEL 2IVFC 5D1XD 3QR1A 2D31A 5CSZA 3RWGB 4P3DA 4UQ2A 5JHLA 1DP0A 2A6JA 3E80A 4U1LB 4NKQB 3ULVE 1ZWIA 1MG2C 3KYMA 4Z8FH 4HKBA 25C8H 4ZFOL 4JM0A 3CC5A 2OKMA 2GI7A 3RWFB 5T33L 3FU6A 3G6JA 2FYVA 5FYKH 3IKCB 5GGSB 2WW8A 1NLBL 3K6SB 2WQAA 1ZLSH 4C4BA 2IAAC 2ATKB 4WJ5B 1QPKA 3IJYB 4M93C 4MBRA 4N8CH 3ZHNA 5JZ7C 4FS0A 5DJYB 5KG9B 4AXWB 3WO4B 4P2RE 5F96L 2XKSA 4QT5B 4JFEE 2R0LH 1CLVA 2NCEA 4QWWC 2B9AA 5C09A 3RWEB 2XV3A 4YE4H 5JXAH 5DQDH 4CILA 4B5ZA 3KR3H 5ECGA 3LXUX 4GRWF 4JFFD 5H2BA 5C7XH 2VQ1A 4RGNE 4G8IB 1W72H 3CXHJ 3LEXA 4X8XA 5FA3A 3MI6A 1ORSA 1CFMA 4ONGH 1JNHA 3RFZB 1TZIA 2Q7YA 1O7DC 3HUJF 1JK8A 4KI5D 2W0FB 2HT3D 4LT7A 4U7KA 4UB0L 3VMPA 3FJTA 3RWGA 2D3NA 2IG2H 1K8IB 4PJAA 4QJ3B 1I9JL 3S34L 4CSPA 2B39A 1HAUA 4AK2A 5C0RL 1M7DA 1F11B 1KN2L 3NJVA 4JFUA 2XKNA 3RNKB 3T0ED 1KCVL 1DQDL 2HFGL 2IBZY 2NY0B 4B41A 2VTFA 1W0WB 4KAQH 4PV9A 2WVTA 5JW3L 2IWKA 2H0FA 1X5LA 3RIAF 5L6YH 1XR9B 4QR7A 1GYCA 1URIA 2ZXWB 2ICWJ 1D5ZB 2R27A 1I1AB 2R2HA 1AGEA 2GITA 4EKJA 4M29A 2HMIC 1BA9A 3G9AB 4QY8B 3TO4B 5AZEH 2JE8A 3V6OE 2DBLH 2A9NL 1B4RA 5C0BE 3U1SL 4QT5A 4BRVA 2AKRA 5KJRL 3QUYA 4JY5L 4Z0XB 4APQC 3DO7A 4N0YL 4K5OA 2CJSA 2C9UA 2J6EH 3GUFA 3SOTA 2RQEA 1XL6A 2NX5E 5IJDC 4I9WD 4E42A 1T2JA 4S0HA 3C60B 1K9TA 2EVJA 3UZEA 5L7XL 1C5BH 3BUYA 1S9VA 2FSEB 3RZCC 1JNNH 4AYFB 3RFZA 3B9DA 1NEPA 2C9QA 1XX9C 3NG5A 1SEQL 2W0FA 3OKNB 4JO5A 1KGCD 4UT6H 3KPRE 3ZKQD 2RBLA 5AL0A 2NCMA 4GQRA 4KKQA 2D9CA 4TSAL 3CSBA 1T66D 4BZ2A 1I7ZB 4WFGE 3RNKA 4MJID 4M56A 4J3VA 1FORL 4ACTA 4G5AA 1WF5A 3MN8A 1AKPA 2LTQB 1E27A 4I0PB 2P8MB 2VXVH 4W6XB 3WAJA 4L5FH 4YDVA 4PM1A 5HHOB 5LWYL 1JI2A 1XR9A 2ED9A 4D9LL 1ML0A 1NWOA 3FQ2A 4FG2A 3SEPA 2DI8A 1I1AA 3IKKA 5DO8A 4LBEA 5A6IA 1KV7A 2DH2A 2ZF9A 1XGUA 3KPSD 3H42L 1CICD 3DVGB 4XPBL 3BGAA 1QBAA 4Y4HD 3EFOB 3CFDB 1MRDH 4KQ3H 3MRNA 4KUCD 3DRTB 4OI9A 2K9UA 3VXNA 1LP9F 5FGSA 3MODH 4NP9A 4OZ4B 4PW3A 5E00B 2YJLA 4OZHE 4F57H 1NCJA 1YUKB 2I5YH 3VFUB 4GAJH 2GY5A 5BZDA 1YY8B 1BBJA 1U8MB 3TEWA 1UH3A 2V6HA 3PQYB 4LF3A 1G1CA 1X7SA 2BVTA 2AGJL 4RIRB 3ARDB 3T8XA 4E68A 2KS0A 4AYFA 4PB9H 1CR9H 4HEPG 5DMKB 2UYLB 4Z7UB 4GJTB 4B0MM 1PZSA 1SJEA 4PGDA 3FYIB 3DC0A 4MMZC 1EO8H 4WFHE 2YWYA 2AEQL 1IZKA 1WICA 3BFWA 4UBDC 3QWNA 3LPPA 2AK1H 6FABH 3KYKH 1QBLH 3QDJA 3UTPD 3DARA 2H8PB 4Y2OA 1P0SE 4M6OH 1CK0H 3QUMB 4BHUI 3B2UD 3JWNG 4I0PA 2P8MA 4WK2B 3RRQA 3ZDWA 1BXUA 4F9PA 1LO2L 3OZ9H 1M6OB 2J4WH 1N0LB 5LJYH 3AG2B 1N64H 5CCGE 4D9RD 3QQ4B 2YXFA 1EH9A 3ML9A 3O6FD 4N9GA 3OKYA 5E56A 2I85A 2FX8H 3ELQA 5F2FA 1AXSB 4B9KC 5F7DA 2NY5C 3OKKB 3EF4A 3LRMA 4JFHE 3DVGA 2PW1B 4XVJH 4EZMA 4OSUL 3ESOA 3CFDA 1TJHH 4G42A 3OPUA 5GS2H 3ZDXF 1BD2D 3BSGA 3QDHA 2ZUUA 1X7QA 1XF2B 2YQ2A 1T4KB 1JERA 1HXYB 1U8MA 3I6GA 5GSVB 4F5CE 1DR9A 2Z91B 2EDOA 3UYRL 2F54A 4TVSa 3V0VB 3VQ1C 2HFFB 1YEEH 1DL7H 3MU3A 4X4MA 4KHXL 5HGDA 4RMQA 2VR9A 3C2SA 4IGBA 4XWOC 2DD8H 3I9GH 2G5BA 1WGVA 2DQ6A 4PSPA 2JI3A 3NCJH 2N7AA 4ELMB 4ODUB 2HTLC 1O7DE 2E6PA 1N7ML 3SCMB 4D8OA 1WFUA 1BQ5A 5JHLH 3O4OC 3MYZA 2G5UA 3CLFH 4FLRA 3JTTA 3QUMA 1F6FB 2CQVA 5JHAA 2BMKA 4Y19D 4GI8A 3F01A 3VG9C 1M6OA 1N0LA 2EKJA 3V8CA 4JY4B 2X3CA 4HLZG 3QQ4A 5H37A 2P43B 3BC9A 5C0FB 1E3FA 3NCBB 1TR7A 4GT0A 4XRCA 3S5LG 1I1YA 4KHTH 3HS0B 2E7HA 3ULUH 1DJZA 2FJGB 5DFVD 4J3OG 1FGNL 3LNGA 1CXKA 1F4HA 3EOBA 4AQ8C 4JL1A 1MREL 3FTVA 4R97B 4N8UA 1OD9A 4MS8C 3X1NA 5JPMC 5D70L 1NEZG 2FWOB 5I2IA 2OL3B 2C26A 1I8IA 1A4JA 3O0LA 3V5DB 1OSZA 3GXUB 3T4YA 5KJ7E 1SOKA 2ZF8A 4YL9A 4EAEA 3G6AA 4RNRB 1IQWH 1XF2A 1T4KA 4PRBA 5CJXA 1DVZA 1HL4A 3FUMA 3PHOA 4PJIB 5GSVA 5IHZA 1FZMB 1G7PA 1QTYT 1OSPH 4QAMB 4LHUD 3TO2A 2HKHH 3NPZB 1YEDA 2HFFA 5E4IA 3GHEL 5T5NF 1H6EA 1T0MB 1JDCA 3HAEG 4YBHA 5F9DC 4JUSA 1ZHBB 3D87B 3MV8D 2G75B 4OGQC 1P5UC 2LU3A 3SKOB 5C0CB 2FX9H 4ZNEE 1N5YH 3MC0A 2ZP8A 3REWB 1CFTB 2Q0ZX 4R0LC 3IRZA 3CZFA 1UZGA 4IJ3B 1ZTMA 3B9VA 3NGBB 2WSKA 2N01B 3HFML 3D52A 1PFCA 1R24A 4KX7A 1HKLH 4ZO9A 3T3PB 3V0WH 4HKXA 3OWEA 5B1CA 1OE3A 4A39A 2DH3A 1SMAA 2F74B 4X9GA 3UAFA 3AGVA 4AEIL 5IOKA 4KVCH 4ODXB 1KXVC 1QWHA 4B6ZA 3DUUA 3LNEA 5BW7A 4LIQE 1S5IL 1GVIA 5H4ZA 2EEDA 5F7NC 5F0JB 5FO8B 2Y4SA 5J57B 1DLHB 3FT3B 1HQRB 1FSKB 1QFOA 1VEPA 1JV5A 4PJIA 5DFAA 1XF5B 3SDXA 2AJVL 4HSQA 4O58H 4PLKC 2BP0A 1KCBA 1YEGH 2OCJA 3H9HA 4BFGA 3RWCB 2VDRB 2V33A 3MACH 4JKKA 5DT1H 1QNIA 2WWMC 2JIXD 3D8MA 2IJ0C 1N68A 3MFFB 4PJEB 4MD0B 3SQRA 3CXHK 3X1BA 3REWA 2VO8A 4PGBA 4XN5A 4J6RH 2CK0L 2CLZB 4NQEB 3AMLA 4TSCL 4AOFA 5BS0B 2K3HA 4BZ2H 1Q9KB 3QUKA 2B4CL 3B3IA 4X83A 1U8QB 3QGVA 5DUPH 2HVKB 3NIDE 5GGUB 4EN2A 5LNEA 4IIQB 1ACXA 3A4DA 2MQ0A 3EOAB 3RX8A 2AEPL 1B0RA 3MDJA 3X3GL 1QYGL 1MN4A 4Z95L 1HWGB 4XAKE 4DPCX 3HZKA 5ITBL 4WEUD 2XVGA 3V9FA 2ARJQ 2UZXB 4IMLB 5EF1A 1YDPB 1MFEH 3F8UB 3NA9H 2CAKA 3SY0A 5C2BH 3C6LA 3L3DB 3LS5L 4L3EA 4HWZB 5EU5B 3PDOB 3PNWB 3MLSH 4WTZG 3B7RL 1ODUA 4KY1H 4FCAA 3KM2A 2E4FA 3BW9B 4WKZB 4IRZL 4W6WB 5B1AB 4Z77B 4LSVH 5EEYA 3LV3A 2PTVA 5TF1H 4FQ1H 4XP9H 1B4LA 3ULSA 3LS4H 4NWUL 3SPVB 4UOZA 4PGJA 4FDWA 2ZICA 3OG4B 2CLZA 1KIQA 4GG6F 3D33A 4NQEA 4NZTH 1RJCA 2OX5A 4MA3A 1JVOA 2DB8A 1Z9LA 3WAKA 2BP3A 3BESR 2VN6A 4HJ0D 4DK3A 4K5NA 5D1QD 1G6VK 5EIVA 1QLRB 1AP2A 4YC2B 2DJUA 2HVKA 4X6DE 1HIML 1OOWA 3QNXA 4LHJB 5GGUA 2WQRA 3S35H 2K6WA 4IIQA 3ETBJ 3FBKA 3NDYE 1CMOA 1OP5H 2AXHA 4K15A 3O6LH 5T1MB 4PGEA 4YDMA 4DIXA 3Q2NA 4K3JH 4DKDC 3GHBH 4TVPE 4CJ1A 2DM7A 1BVLB 2JI1A 2WO2B 3UDWA 2X4TA 2UZXA 3M1CA 4QGYA 4IMLA 2RHEA 3NRPA 5GXBB 1RIHH 3FSWA 1WUZA 1D5IL 1YDPA 2XN9B 2FQGA 2X3AA 5IEKB 5EU5A 5F6HI 5E1IA 4ZMAT 3JZYA 5MEND 1FNEA 2PPEA 2O93L 4NPJA 2EDKA 2HLFD 2JKRM 1MDAA 3NJNA 2O5ZH 5E2UH 4A7VA 3TBSB 3NYKA 5BV7H 3LVTA 3DK2A 4HZLB 4Z8FL 3M8OH 3MBEC 25C8L 2GFBA 4OLVH 1T1YA 4DFIA 2P48B 3SJVE 1FYTE 3L3JA 3UMTA 5FYKL 2HN7A 3AADB 4Y1TA 1B3IA 2JTDA 1OGAA 3FO9B 3TN0A 4KXZH 2CHXA 2VAJA 2IDQA 3KYNB 4BZ1L 5JXED 4HS8H 2OXHB 4N8CL 4LLDB 2IQAB 3SKJH 5HGHA 1GC1H 1BZDA 2EE9A 3GDBA 4FYQA 5DC9B 1PZ2A 2FECI 3VWKD 5GGSY 3P4OB 4TOYL 5FCSH 1QLRA 5AYTA 2R0LL 3QUMH 1IBFA 2OFQA 3V10A 2OCCB 1Z9PA 3HZMA 3G5ZA 3K1KC 3KNBA 5H94B 3DWTA 4YE4L 5JXAL 1N10A 4N9OB 5DQDL 4MQSB 1ZTXE 5H37H 1I3GH 4AMKH 3KR3L 4F37F 1H9VA 3VRIB 2CRZA 3MFGB 5C7XL 1BSIA 3L1GA 1SLUA 1W72L 3P69A 1PSKH 1J11A 4P48A 4IM8A 2N56A 3PL6A 2YD2A 4ONOA 4ONGL 2R0ZH 3CV5A 3APMA 1J88A 2VDPL 4LVHB 3PPSA 1RZIA 2BNUB 3HC3H 4KXCA 3U0WL 2CO7A 3VGAC 3IDIA 1YEWA 3ZGIA 1KZYA 2ZSWB 5FX3A 1DN2A 5LNGA 4MXVE 4OH2A 3PG2A 3TBSA 3MV9E 4MXQD 4AY0A 1B0WA 5FKPB 2HX8A 1UKSA 1HI6B 3ARBC 4KAQL 1RJLB 4IOSD 4R96B 3SE4C 3TBVA 4U3HA 1Y0LB 3X1EA 5IG7A 3GLAA 4DESA 5KZCD 1S3KH 3HZVA 2OXHA 3F7QA 4RVBA 5H35B 4IW4C 5AZEL 1EAOA 2DBLL 3EFFB 3MR9A 1GZHC 3US1A 4HW6A 2OR9H 4BIKA 3FU3A 1EHAA 1N5AB 4Y88A 3H2QA 2YUWA 3IAPA 5AVQB 2ZP0T 3PAYA 1O0VA 4L9DA 1HWHB 1M1XB 3KDMA 3RQ3A 4EIGB 2R4RH 4MJIB 3WTXA 1TO4A 4KJYA 3SGEI 3QISA 3GSUB 3ECQA 3D2UD 5DZJA 1XH1A 1F2QA 2FE0A 5C08A 3T3MF 3BD3A 1AE6H 4J4PA 4XBMA 3KW8A 2KT6A 1C5BL 3RY4A 5IB3B 5HJDA 4HVBA 1JNNL 5D2LB 4AYBA 3EJJX 1KSRA 2VT0A 3EDFA 2H2PD 3KPSB 4UT6L 3RWJA 2A73B 5CGYD 1CICB 4YFEA 6PAZA 3DJTA 5AOKA 3FQUA 5I8EA 3C87A 4U6XB 5KVFE 3G5VB 3KBPA 2ZPKH 2ZSWA 5J6GA 4YSUA 3TESA 7FABH 1YAZA 3VXRE 4XNXH 5FKPA 4R96A 5KYYB 4ILDA 3RNQB 3AM8A 4LEOB 4MVBC 1F8TH 4L5FL 3E38A 3V6OA 1Y0LA 1E2ZA 5JNYA 1LEIA 2ZUTA 4P0DA 4XN7A 3UACA 1BLNB 1QRNE 2BFVH 3NJKA 3MRCB 4OJCA 2XX1A 1AMXA 3EFFA 2QZ5A 3VFNB 1AIZA 1HH6A 3FCSB 4NM4H 4IKIA 4OGAD 3ARVA 2BPBA 4ZPTB 3ZE1B 1N5AA 1NBZB 3OAZK 5DQJB 3CN2A 1MRDL 4KQ3L 1HHIB 3DIFB 3DXAA 2E46A 3TYFB 1CD9B 1NGXA 5DHYB 3MODL 4KY2A 2WBXA 4LVNB 2CO3A 3ZE2B 4GKOA 1S9KC 4FHJA 3RIKA 3PWPD 5BUPA 3GK8H 1NBYB 4G7VH 4F57L 3GSUA 4XNQB 2I5YL 4Z7AA 5D7HA 3TA3A 4GAJL 5C3TA 4MGXA 1TZHB 2BSRB 1T83A 3TEUA 3G08A 2R9HD 4LPWA 1RJZA 1L6ZA 5IR1B 5CLTA 4PB9L 4B53A 3T2NL 2XCMC 4R26H 3U2SB 3G04A 4OF3A 1TNMA 4PJGB 3VTAA 2VM9A 1KCRH 3RBGA 3T1FA 1ZGLP 2A73A 4M6AA 5I5MA 5C7ZA 1IRAY 1EO8L 2NXYD 4UQIM 2E86A 4U6XA 1UJTA 3G5VA 2AK1L 6FABL 1BOYA 3KYKL 1QBLL 1GH7A 4CW1A 5B4MC 4H8WC 1QNZH 1AD0A 3OG6B 3ROOB 2XC8A 4I1RA 4PLJD 4M6OL 5ICXA 5I73B 5KBPA 1CK0L 4YR6A 3PWNA 3RKDC 5AEAA 2Y2TA 3MLVH 1JGUH 4LEOA 1SHSA 4JANA 3OZ9L 2J4WL 3ZHKA 4D94A 1G84A 1WBXB 2HWZH 2YIHA 1EHXA 1DZ0A 1SY6A 2FX8L 3D08A 3NJGA 4LCWD 4P99A 5LBVA 1BLNA 1V7NH 3MRCA 1LO4L 2FHCA 5HGAA 4DN4L 4WHDA 3T0VA 2IOIA 3OSKA 3UGUA 3R7RA 3D69A 1HE7A 1TJHL 1HHIA 4EN3B 4TRPH 5AG9A 2N1KA 2Y3AA 3U4AA 2UXGA 4J3BA 3ZT7A 4JG5A 3QPXH 2J72A 1NBYA 3LPOA 2OI9C 2YQBA 5EO0B 5SWQA 1EERB 2Z0UA 4N0UE 4G9DB 3AXIA 1N8ZB 3HUJB 4PJDF 3FONA 4U1NA 2Z8VC 3IF1B 1YEEL 2IAMC 3VI4F 1MJJB 1DL7L 4QRQB 4AVKA 4BFKA 2MCAA 4UT7H 5T1DH 4UQEA 1MRCH 2DD8L 1N3NB 2CXKA 4BCXA 3BOVA 1O9WA 3NCJL 3QNYB 4EQ2A 1T04B 4OBSA 1JP5A 1J5OH 1W80A 2J73A 3ARFB 1U58A 1BFSA 5JHLL 5C09D 4ZYKB 2BSED 3UBFA 3IWUA 4L4TE 2OMBA 1U95A 1OD7A 3MJ7A 2W95A 4FI6A 4XCEA 3H0TB 2BS71 8PAZA 3RIFK 2MNJB 4FQPA 3QNZA 2W92A 2HT2C 1QR1B 3ZJAA 4R4ND 4KHTL 2O6EA 3FPYA 5GJSH 5C07A 3ATFA 5FPIA 1K8DA 1GIGH 1EO7A 1PCSA 3DMMC 2XY2A 1IC7L 2HTKC 5I30H 1QFUL 5BXFB 1PLGH 5HYQB 2GTZA 1CGYA 5KVDH 4OZGE 4XBPB 4OF7A 5CGTA 5D7LD 4NUMA 3QJVB 1F4XH 2W1NA 2WOYA 3F12B 5EO0A 2APFA 5I6XB 3GSNB 4RX4D 1R34A 4G9DA 3QFDB 3D4GA 3RZCB 1OSPL 2DQFB 3UPRB 2HKHL 3BMWA 3MTRA 3WKMH 2BM3A 3LRGA 4XPHL 2DM4A 1TEYA 3B37A 4JY6A 4NOFA 4PCKA 3RWHA 5EULV 1CU4H 3HE6C 3BP7B 2XTJB 1M7IB 3ULVH 4PJ7E 1T04A 4FFVC 1N5YL 3QUYD 1KJ2A 1Z0MA 3LAFA 4CU7A 1AZRA 4ODHL 5DS8A 1F3DH 4MWFA 1R0AH 3H0TA 1I4FB 2BZ7A 2HCZX 1NMAH 3GD1C 1QR1A 2W91A 1HKLL 3MCYA 5FO2A 1PVHA 1KGYE 3V0WL 4R2GC 1G7QA 3RPIB 1UKQA 3G6DH 2HX7A 2FUTA 3C5JB 4OV5B 1IAKA 4AGLA 1YY9D 5AKTA 2JIXB 3ARQA 1GAFH 3LN4A 4MLIA 4KVCL 1LP9B 2H2SD 4APQA 4H0IA 4S2SB 4XBPA 5C6TH 4JO2H 1T21B 2LAGB 2GSGB 2PWDA 2VLKB 4AGMA 3BQUB 4FJYA 5DI8B 1FFPB 5I8CB 3BE1H 3H54A 3A6BH 3QFDA 3RZCA 5FYLD 1U93A 2DQFA 2WLZA 3UFIA 1TTBA 2DDQH 5GIRA 2X10A 5FA4B 5JO5B 1YEGL 1IAMA 1URLA 1J1OH 2EKSA 2J8UF 4YZFE 3MACL 4QRRA 2C9PA 2VDNL 3CFBA 5DT1L 2ZOKB 3CD4A 2IALB 3E1ZA 2EYTB 2OSWA 3HMWH 3QPQC 4MDIB 3BP7A 4RZCB 2X2IA 2FK9A 4FOMA 5L8LB 1CDIA 4O51B 3I6KB 5MEOA 4J6RL 1MELA 1J5IA 2OMTB 1Z1WA 3ENEA 3VVWA 1E65A 1U0QA 4BZ2L 4I85A 4M7ZC 1JYWA 5I26A 4ZO6A 5DUPL 4IU2B 3QJHB 4NZUH 3QXDA 4S1DD 3NEEA 1LO0H 3N1GC 1CE6A 3I9AA 4F2MA 1ZANH 1LP9A 5F9OL 4S2SA 2VLRA 3A24A 3HPJA 3ORJA 3SPIA 4A2FA 3NDZE 4ZZFA 2DLIA 3WKQA 1PDKB 2ADIB 2XXFA 3NT0A 3BQUA 1BOGB 1MFEL 3NA9L 2AQ3A 5C2BL 4A2MA 1JI1A 2VISA 4HDIB 5HYJA 5I8CA 4I0CC 3MLSL 4G1MB 3QXUA 4KY1L 1RZJH 2JCCF 4OLWH 4FEIA 4WENB 2QVKA 3PP4H 3CH1A 3IGFA 3FO0L 1T0PB 3ZDZF 5JO5A 2LQRA 4MMZA 4CU6A 2X4OB 2ZOKA 5AW3B 2O6DA 4LSVL 1CBVH 4MDIA 1YRKA 4RZCA 1UZ6F 4ODWB 2H47C 3LD8B 2A1WH 3FB5A 5TF1L 4FQ1L 2HRGA 3BAKA 4XP9L 3LS4L 3I6KA 5E9NA 3NCMA 4KX8A 5GRYA 1OAJA 3FT9A 4PVBA 3ESUF 3L81A 1OWRM 3V4UH 2DL2A 3VDBA 4GKZB 5MENB 3UP6A 1OCRB 5DD5H 4JHVA 5TJWK 4AIOA 5DR5H 4FXTA 3EJUA 4F1SA 5AW9B 3QAZB 3KYAA 1SY6H 3G5WA 3O6LL 1BWWA 4CBPA 1SDAB 4IGBD 1WCBA 4K3JL 3TTSA 2NXZB 3GHBL 4FXGB 5FS5A 2YUZA 1JNJA 1RJYA 5CP3A 3RUGF 4MAYB 1PDKA 1ZHKB 3CN3A 1RIHL 2YSTA 3QZWB 4PP2A 4X6EA 3HG4A 4MJ4A 2AV7A 5FK9A 4G1MA 3MXVH 4N1EA 1QEWA 3EYOB 3BO8B 2IFFL 5HHPB 2O5ZL 5E2UL 2CGYA 1M42A 5DRWB 5BV7L 1EZLA 3M8OL 4OLVL 4ZUSB 4OCWL 4P3WA 2X4OA 2JJWA 1A1MB 2BK8A 2HG0A 4HIJB 2QVTA 3VRJB 4U49A 4G1EB 1EJFA 4RQQA 2ZJSH 3JUYA 5DURD 3QDME 4HT1H 4HS8L 4I9XA 2FNWA 1MKFA 2CALA 3SKJL 4UQ9A 4RAVB 1GC1L 3D51A 2VAAA 4XPFL 1UOLA 4DHLA 4HUKB 4IRJD 2YGPA 1BXAA 5BUAA 3X13B 3S36L 3D18A 5IMMB 3AFLA 2DWEB 3DYOA 4PY7B 4M8UA 1YNTF 1BQKA 1XV8A 2RFXA 1C08B 4HU2A 7TAAA 1I3GL 3CIAA 1O5DT 4AMKL 1EJOH 2F53D 4IOFD 4J2XA 4G72B 5JIQA 3CBKB 3MJGX 4KMTH 1UCBH 5JPMA 4FXGA 4BD4A 1PSKL 4M9OA 4IRSC 3TJHD 2W9DH 2PXYC 3UTSE 5AKRA 4AIZA 3I6LD 4HS3A 4MAYA 5KZCB 1NCGA 5I1JH 3QZWA 7PCYA 2HRHA 4PRHE 2VMCA 5GGRB 3C6EA 4BA8A 2APBA 3HC3L 1BAGA 4JDZA 1DDTA 3K80A 4GRWH 1ED3A 4GXUM 1UC6A 5HHVL 4P9HC 1V3MA 5SWZD 5DVMA 1JMZA 1YMHB 2P5WB 1EX0A 4ZUSA 3FQWB 3TGXA 1FHNA 1P5UA 1WZAA 4RAHA 1DUZA 1USQA 3FOMB 4J12A 4J8RB 1WIPA 3CN0A 4HISA 1DO6A 1RURH 5F93C 3RAJH 4MQXC 1QLFB 4G1EA 1A6ZB 1GYUA 3O3EB 1YYLH 1JIBA 1Z5YD 1G4MA 3D5OF 4HHAA 5AW1B 1S3KL 1UD5A 3EYSL 4MKTA 2HKFH 3PWJB 4M61A 1KJ2H 2WBJC 3GMNA 2OR9L 4OAWB 4OTXH 2YMXH 4PFEA 3BDBA 1H3VA 1HH9A 1ZSDA 1S4IA 2Y1AA 3B9KD 1NFDF 4P59H 5DZAA 4G3YH 2MTAA 4PY7A 4I1PA 2D0FA 1FL6A 3QIBC 4EDXA 2R4RL 1INEH 2QPEB 1TMQA 1C08A 3ROLB 2OQJB 1RIUH 4PP1D 4TTGA 3PV6B 3IDNB 3WFEH 5FECB 5HI5C 3IFOA 5AB0A 1AE6L 3BI9X 1F1DA 2ZCZA 1ZPLA 5CR8A 1UD3A 2C7UB 2V5YA 5CR1A 2BY0A 2D7OA 2PCFB 3DHUA 2GSIB 4BFBD 3MRQB 5TDNB 3NJJA 2BRRH 2VXSL 4HIEB 1KTJA 2ROYA 2BCKB 3F6LA 5CN1A 4LPVA 1HINH 1TENA 5L88L 2P5PA 5FCUH 4YPJA 4EI5D 3OV6A 2ZPKL 2OP4H 2W38A 4IDJH 4FL4B 3TFKD 1NIAA 3SDDD 3IPEA 3HI1B 7FABL 4H8PA 5IMKB 1Q38A 4XNXL 5DMIH 3IU4H 4ZUVB 2BVOB 3PWPB 2X38A 2YEQA 3ZT6A 1F8TL 2B16A 5LO7A 3WY4A 3K4AA 5TDOB 2K4AA 4Y9BA 3JSSA 4P46B 1QLFA 4IBQA 5K9OA 4K71C 4KJPD 4GG6B 5DMGD 1ZOXA 3TVMC 1F45A 2RIKA 5T1KA 2BFVL 2R0KH 2EYRB 4W4NA 4E5XA 3PWJA 1A7RH 5IVOA 4FFWC 3GMLA 4JFQB 2NXYB 4NM4L 2YD0A 4OAWA 4ZXBB 3P11H 4WO4C 1S7XB 3C6LD 1H6UA 1QPXA 1RI8A 3CAFA 3PHSA 5BRQA 3TWCL 5D4IA 2DS4A 2GJ6D 3NSJA 4ACPA 5EWIH 1X5YA 1NLDL 3HG0A 3Q2VA 2OQJA 3ROLA 2VKXA 3GK8L 2CGZA 4G7VL 3H6AA 1FNGA 3PV6A 3QJQB 3IDNA 5FECA 3QFJE 1TPXC 1R5IA 2WVVB 2ADGA 1IFRA 2C7UA 4LIQH 1W16A 1CXLA 1I85C 2PCFA 4MD5B 2GSIA 5F3HA 1MAMH 5J1AA 5KBDA 4LCWB 2IPKA 4R26L 1U9KA 4HIEA 3FRUA 5BRZE 4Z3FA 1MQKH 2WYZA 5HD8C 1ZJAA 2HUHA 1QSEB 3F7LA 1UXWB 4DP2X 1U30A 5E70A 1BQLH 2K70A 1HYRC 3FT4A 1KFAH 1QNZL 3O8XC 3LXBA 2JMRA 4LL4A 2C3XA 3L4YA 5IMKA 3SIKA 5IBUG 4NENA 4Y5XB 2BVOA 3VXMB 2Y06H 3KGSA 3MLVL 1JGUL 1Y1DA 4K9EC 4KQ4H 5B39A 1GOGA 2B0SH 2JQMA 5JORB 5L2JB 4EI6B 4XXCC 2HWZL 4GG6A 3NN8A 1R5VA 3IBOA 3BWUC 2EYRA 1V7NL 1A14H 4LK4A 1UVQB 4PPTA 1CLYL 4OFDA 4JFQA 4ZXBA 5ICZB 1HILA 4Q58C 4TRPL 1P2CB 2VJ0A 2D3LA 4LOVA 2YKLH 3FDWA 3EGXA 4YH6A 1RK7A 3QPXL 3LHPL 2NY7H 1Q9OA 2O30A 4ZBJA 1OTUC 4KVNH 3KXFE 5IB5A 1CUOA 5J8OA 1BQUA 4JZOB 3O11A 5FGCB 3RL1A 1BM7A 1OGAD 1AHWC 3FTSA 2ARJA 1U42A 1NICA 3QYNA 3DGDA 5CP3H 4UT7L 1B4JH 2B3IA 2I69A 3ISWA 2X41A 1LNUB 3H3KA 1EANA 1U3ZA 1J5OL 1TJMA 4K8RC 5HI3D 4OZIE 2JKTM 1P4IH 1NGYA 3A4AA 3MBEA 4NYLB 5D7LB 43C9A 4W81A 2P5EE 3C09C 3QA3A 5IQLA 4P2OC 1WDAA 3VXMA 3R7QA 5KS9F 1ACZA 2CLRB 3VFVB 4PIBA 2AJSH 5JORA 3NJLA 5K9KB 3F6JA 5CINH 1KTKE 1UKTA 2NY3D 1DZBA 1H5BC 2Y2WA 5GJSL 1GIGL 4LSSH 4AKOA 1RKRA 2D7TL 2FBRA 4HAGA 3ULVD 4HQQL 5GS1B 5L8KB 1KC5L 5ICZA 5I0WA 5I30L 1WT5C 1PLGL 1BCIA 4XO5A 1NFAA 5KVDL 5FDWA 1AOZA 1P2CA 4PBVC 1F6AA 1LMKA 1F4XL 2PCPA 5DJDB 1VKXA 12E8L 3IMBA 2DWTA 4TVPH 1AH1A 1CCZA 3OPZL 4Y9EA 5TPWH 2IH1A 2NZ9D 1U92B 4TQHA 4P2RD 1PKQB 1VHPA 2KUTA 2AJZA 4MB3A 3WKML 4JFED 1J7VR 5EDSA 3BZEA 1T20B 3MRKA 4NGHH 1MZYA 4V2BA 1ZDSA 4JCMA 4PJXF 2EDFA 4KKCC 1D6VH 1KXQE 5KTEH 1XCXA 1CU4L 2OCFD 1HHGB 2VDKL 3ULVL 5AOIA 1MCSA 1KEGH 4RGND 1JV2A 1SHMA 5CJQH 5I0ZA 5F21B 1GGTA 2A4ZA 3SE4A 1OSYA 1Y1UA 4RWYH 2UY7A 4LLQA 1TIUA 2XV6B 3L3OB 3DETD 3VFVA 2FBJH 1GS6X 4WCYH 3WS6C 1NMAL 3EJZC 3FUHA 3BCFA 5G5DA 1UZ8B 3RX9A 2A5UA 2JI2A 4TYUA 4XI5C 1DBAH 4N8VB 3LH2H 4ZW8A 1MFBH 1OEZW 4OZGA 5ANMB 1GZHA 3G6DL 4GSRA 4KI1A 4YBLB 2WOBA 5E94A 2NY2C 3Q44A 2W0LA 1GAFL 3K8LA 2HPOA 4N25A 1ZV9A 5GGVY 1MCHA 2WVSA 5EEUA 3CSTA 3HBPA 4JO2L 4U2ZA 3ML8A 2ZG2A 5I82A 4WI9A 1ZY9A 2DQMA 3BWZA 3AB0C 3RX5A 4Q4EA 4QRPE 2VKWA 3FN0H 5ACZB 4DF9A 5CBEB 3BKYH 1AVAA 1XH2A 3BE1L 4M7LH 1U92A 3A6BL 3B1TA 4WIQA 4W1TA 1PKQA 5C0BD 3C5SB 3BAJA 2YBRB 3ZOAA 4R8WH 2F2HA 1T20A 1J1OL 3FQNA 3MGOA 5BZWB 3EG9B 4M1CD 1GCYA 2GHZA 4ZOCA 5HDBF 5LGYA 3H85A 3HMWL 2Z35B 3SO3C 3SQBA 2NX5D 3HKZA 3KPQB 3NCEB 4Z7WF 4G70B 4CADB 3A6CH 1RD6A 1E9OB 3KG5A 3X17A 3B7TA 4BH7B 1HVXA 4Y16D 1KCSH 4XNBA 3HBGA 2BSDA 3EGDB 3DI2B 1TEGA 1HCZA 3ARYA 3R0NA 4U1MB 4UI2A 3TEZA 3QXAB 1IC4H 5LGKA 3KPRD 4XMKH 1ET5A 3FTZA 4NDMB 2EEBA 2Z8WC 4PHZA 2ENYA 3EJQA 4C57C 5ANMA 3DRQB 1S9WB 1LO0L 4B9PA 2VQTA 2W07A 2FT7A 4WFGD 2XV0A 1MI5A 4WNQB 4TTDC 1R75A 2WXHA 4AQ1C 1ZANL 4DEWA 4PJCE 5E4EB 1MFNA 5D7IE 4TMPA 3EIFA 1T2XA 1JRHH 2BHZA 5DTFB 3TC9A 1WS7A 4OQTA 3PHQB 1T03H 1A9BB 2YRLA 1EZVX 3HB3C 1LQSR 2VZ1A 1H15B 3K6IA 3QG6B 1JNLH 1TTFA 3OKLB 5EEVA 1CXHA 2B8OT 3L16A 4PJDB 2PPDA 3AG1B 4OLWL 3VI4B 4JJ5B 4NO0B 1FFTB 1FAIH 3VFPA 2WY3B 3EG9A 5KVFH 2XN1A 3Q6FB 5I71B 1TVHA 4N0FA 2F9BT 2FJHB 2Z35A 5E1HB 3WL9B 1WZMA 4X9FA 1BEYL 1ITBB 1WQVT 4CADA 4LSUH 5ELIA 1P4BH 1E9OA 1MWAA 2OYPA 2A4EA 4BH7A 4NNXA 1PX3A 3RA7H 2O61A 4RAUB 3EGDA 1BIIA 3H2PA 1QBMH 1N0XL 4U1MA 1HL5A 3QXAA 3G5YA 3V4UL 4BFIB 3U30B 1AGCB 1A22B 4OB5H 3C5ZD 3D06A 4NDMA 4WFHD 5DD5L 5L4FA 1BZ7B 3SPJA 2WZAA 5DR5L 5F9WB 1Z5LA 2VRAA 1V7ML 2DQUH 3DRQA 4DERA 5IIEA 3H9SE 5DD3H 1UURA 1SY6L 2VZTA 3L9EA 2G30A 2ZYRA 2H1LM 3GPEA 4G6FD 5ESAA 2XWBA 1OE1A 1M9SA 5T5FA 4QJ4B 1Q90A 1OB1B 2F68X 3BZ5A 3NIFE 4BKTC 3QR2A 2I07B 1VCBC 3MX0A 5KYWA 1V3LA 3WXVH 1JCVA 1I9RL 2GTWA 3CVHB 3QG6A 4HWNA 4IRJB 4CC4C 4KNQA 3MBWB 1E50A 4JFHD 4YSCA 3OHXC 4U1IA 2IAMA 2FUQA 5AOLA 4A6YA 4LOUD 4XO9A 1P7HL 5DEZA 5KSBF 3FU5A 3VGHA 1KG0A 2F53B 1SEBB 4PH8A 3E2HC 1W0VB 1LTXA 1BG1A 3GXTA 2FJHA 3WL9A 1C5CL 4UNUA 1B3JA 1U8HA 4G59C 4QWWD 5DQ9A 2B1HH 1UFUA 2ZJSL 4HT1L 2IWGA 4NPKA 5EO1B 3QULA 4HSAC 1MHHB 4OVVA 4F3FA 4MHHG 3IFPA 3PIQA 1AGCA 4I2XA 4HV8B 4DFHA 5JIMA 4J3WA 5SWZB 1HOEA 1I3RB 1CT8A 1FO0B 5T3XH 1EJOL 1N4XL 3RVVD 2RB8A 4CAGA 1PG7X 3P4LA 1XBRA 2SEBB 4KMTL 3TV3H 5KSAC 4LSPH 5DHEA 1KY6A 2P26A 2EZ0D 5AQ0A 4EEEA 2W9DL 1OAYH 1NDGB 2WO4A 2WB1A 2YN3A 1ZLWH 5I1JL 4YHIB 1SM3H 1CQYA 2V0AA 3EOTH 3HG2A 2ZWLT 5INCA 1ND0B 1AGDB 3N1PC 5BCAA 3RIAK 3DIDA 5AW0B 1T7XA 2HH0H 1P7BA 3B9KB 4IKLA 4BWTA 3KBEA 3QUZD 4ENEC 1F00I 3CU7A 3LXAA 1H0DB 1L5GA 2Y07H 1GCFA 2AXWA 2DJMA 2J8UB 2IBZX 1MFMA 1RZKC 3ZO9A 5ISZE 5GGRY 1OGPA 3FT2B 3GJEA 3QDMA 4LDEB 3ZSSA 4D0BA 3HE6A 4NLAA 2XETA 1CDBA 3RAJL 4OLZH 1KACB 1RURL 2XPGA 2RMNA 2KKQA 3RILA 4P5KB 1YYLL 2GVYA 1S7SA 3W39B 3OJMB 2X0UA 1O9ZA 5EO1A 4X2UA 3S8WA 1KJ2L 1J1XH 3GJFA 3QIUB 4P04A 2B59B 5CJOH 5D8JL 4OTXL 3GRBA 2YMXL 1WAAE 4Z6AT 1QVOA 2AJXL 3RGVD 1MNNA 2JJUA 3EYFA 4EI5B 4BELD 2IANE 3QEUA 5GRVK 4P59L 2DI9A 4GXVH 3SDDB 3DX0A 1LE5A 1I3RA 4AIEA 4WWKD 1INEL 3PAZA 1ZT1B 2WXQA 1FO0A 1NZRA 5BOPA 1RIUL 3WFEL 3DHPA 1B90A 2WUCH 2GUOA 1NL0H 4JN1H 1FFOA 3GRWA 5ITFA 1KBWA 3U4BL 1NDGA 4ZX3A 4NN5C 5DC4B 3O3AB 4MNQE 4NRXA 2BRRL 4YHIA 2PTUA 5E0QA 3S8GB 4WI4A 1ND0A 3S2CA 4AVJA 3GB7B 5KW9H 1ILUA 1HINL 1E4XH 3K81A 5D7SL 1G1YA 2Q6WA 3MA7B 2DEWX 4ZMLA 2C1OA 2OP4L 4IDJL 4PJ9D 5LAPA 4Q89A 3CWGA 4CVXB 5GRVL 6PCYA 3D0LB 2J8UA 4MXWL 3BD5A 5DMIL 3IU4L 4ZMYA 3VGEA 2DM2A 2E8YA 4U6HA 4KX9A 1E7VA 3K72B 4LCCC 1XO8A 2TRYA 1N19A 1QMUA 3CHXA 4FXKC 2VITB 3GMQB 3IDJB 2X6BA 3WN5C 1M53A 3FW6A 2L7QA 4M6NH 3UBGA 2UY6B 3C08H 2R0KL 3NJHA 4P57B 1NOLA 4XN4A 4LNRB 1A7RL 4GO6B 3QIUA 5CZRA 3P11L 1UA3A 5BOZG 4ZMWA 2WYTA 4F8PA 1E90A 4KROB 1U3HD 5MHSE 5EWIL 3VW3H 3UAJA 4QO1B 1WVZA 2COVD 2FQDA 2Q3AA 4GBXB 4LIQL 4GW4B 3RUGB 5CEZE 1JF1B 2ENPA 5GS0C 5DRNB 1MAML 2YN5A 2WLIB 3NCYS 3U6RA 5FOBB 5EA0H 1MQKL 2ROXA 4N2GA 1OAQH 1K4CB 3QQXA 2JCCA 2K45A 1BQLL 4OQTH 4GKNA 5E1QA 3OSVA 5IEHB 4LL9A 4FQ2H 4GIAA 3UROR 1FFNB 4NZ8A 3P77B 3KH4A 3MRDB 1AXTH 2FJUB 2TAAA 2Y06L 3BVNA 4XAKD 3BLBA 3HC0B 4JL2A 3IJ8A 2RAMA 2R2BB 1BZ9A 1TQCC 2HG5B 3PGDB 3QORD 4KQ4L 3P9MA 3F64A 1K6QH 2B0SL 3WHXB 4XHJC 4MJ6B 3VX1A 2WQ8A 3GMQA 3MJ8B 4ATTA 3GWJA 3IMUA 2HT4D 4L3CB 5GHWH 2UY6A 2GT9B 5DYOB 1A14L 1MXGA 2KLSA 3GZPA 2N59A 1UT2A 4Q6IB 1MWAH 1P9MC 2IF7A 5CNHA 1JHLH 3ZLQC 2XWCA 2YSSB 3A4EA 1F90H 1YNTB 4ICXA 4KKZA 1D9KB 2R15A 4FZ8H 2XG4B 2J5WA 4NRYB 4E41B 3F7YB 2O5XH 1P1ZA 4ORGB 3P1VA 4A2DA 3IXAB 2NY7L 4XWOD 3RP1A 4DAGH 2NY5L 2DY2A 3AREC 4HCIA 4KVNL 1DDHB 2C9VA 2HTLD 5D5MF 4GBXA 3RUGA 3VYNA 2F7OA 4YJZL 1SHWA 5DRNA 4NSKB 4F8LA 1NKOA 2J44A 5EHFA 5FOBA 4Z7QF 4IBWA 1FG9C 4JLRA 4IBYA 1B4JL 5T5FH 1OPGH 5BJTA 5TE6H 1ZV2A 3E6HA 3JWNC 4JGUA 3X1GA 1E2WA 1QFWI 4E2OA 1BJ1H 3VJ6B 1BV8A 1P4IL 3P77A 4TVPD 4EKXA 3TZVC 1P5VB 1T6BX 1LXMA 4WI2A 3BN9C 4UAHA 4R5TA 2HG5A 4X4YB 4OKVA 1D5BA 1NAMB 1Q9LB 1CS6A 4PCSA 2XRAH 4A6YH 4MS8D 2YXWA 3QEHB 4MJ6A 1GSMA 4HGMA 1J0KA 4XXDB 3CH8A 5CINL 4TXVB 4DZBA 1S7RA 4JFEB 4X50A 1XF4B 2CO2A 1JZJA 3GXNA 1D2OA 1T89A 4NRZA 1X9LA 4LSSL 1DEDA 4OM0H 4B27A 5TDPB 2ZX6A 4FE9A 4NQDE 1NFDB 3IETA 4MDJB 3OMAB 3CFJA 3O2DA 5D4HA 2LVEA 4S1QH 4G8FB 1KWKA 2XG4A 4RGNB 1FYTD 1JWSA 3SJVD 4E41A 1OK8A 5DVKA 1D2PA 4GY4A 3HPLB 4RMVA 5A6MA 4PMEA 3N1MC 2IH3A 3QZLA 4ENZA 4TVPL 5TPWL 3U9UB 1QABA 4PJHF 1DDHA 2R29A 4OCNC 1KCKA 4KXZI 3N40P 2Y2YA 4NSKA 2WJ5A 1WWCA 2N4IA 1VDGA 3WTSA 4OZIA 2XU9A 4NGHL 1QASA 1CGWA 5KTEL 1A3LH 1D6VL 2EC8A 2A6DB 2BNQE 3HLKA 3W38A 1KEGL 3EHBB 3O9WC 2CIIB 3FCGA 5CJQL 4X6CE 4WJG3 2HJKB 4F27A 1QATA 3NUKA 1LO5A 1P53A 1P5VA 4UZGA 4YNYB 4RWYL 3K8KA 4H1LA 2EXWC 4OIIH 4X98B 4X4YA 4J3OC 4JN2A 2FBJL 4WCYL 5D2NE 5KANG 3KLAA 2MQGA 4QRRB