5JYMA

Human p-cadherin ec12 with scfv tsp11 bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords Cadherin-3
publication title Disruption of cell adhesion by an antibody targeting the cell-adhesive intermediate (X-dimer) of human P-cadherin
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5jymA01
2V37A 4NUMA 4AXWB 1Q1PA 4QD2E 3LNIA 1WUZA 4ZTEA 5CZRA 3LNEA 4NQQA 4AK1A 4ZMNA 1SUHA 3PPEA 3K6DA 4ZMZA 1NCGA 4ZMPA 3Q2WA 5KJ4A 2EE0A 2A4EA 4ZI8A 2A4CA 2WBXA 3K6FA 2OMWB 3LNDA 3Q2NA 4ZT1A 5DZVA 1O6SB 1ZXKA 3UBGA 1WYJA 3LNFA 2WD0A 4AQ8C 4AQ8A 3QRBA 4NUQA 1NCHA 2QVIA 5JYLA 3UBHA 1EDHA 1NCIA 4ZMQA 1FF5A 4AQEB 2O72A 3Q2VA 2WCPA 2YQGA 2OMZB 3K6IA 4ZMXA 5JYMA 4ZMOA 4AQEA 4ZMTA 3K5RA 3MVSA 2X2UA 2YSTA 4ZMLA 3Q2LA 3LNGA 4XXWC 4XXWA 4ZMVA 5CO1A 3FF7A 1OP4A 1ZVNA 4APXA 4NUPA 4ZMYA 3K5SA 1L3WA 3FF8A 2QVFB 2OMYB 4APXB 2OMTB 4AQAA 1NCJA 4AXWA 2OMVB 2WHVA 3LNHA 2OMXB 4ZMWA 4OY9A 4AQAB 2OMUB 3UBFA
chains in the Genus database with same CATH superfamily
1JZHA 4KTDH 3K8LA 3A4AA 2XN9A 2BP5M 1U2CA 3KL0A 3WNNA 3Q1SH 1PSKL 3P3TA 4Y4FC 4AI7A 4NQUA 4WSJA 2FWOB 5TE6L 2B4CH 3G5YA 4ADGA 3UAJC 3F64A 4KROD 5BS0B 2WBJA 3VJ6B 2MTAA 3EDDA 3GKZA 3QORD 2ZWLT 3DHUA 3GXNA 2CR6A 5D7LB 4E42A 1FO0A 1O0VA 4E9YA 2CCVA 5E94A 2EDLA 4ZMZA 3DNKA 1JHTA 4KJWC 5C0NC 2B59A 1NEZA 3MUHL 4EJ1C 4M7LL 2YMXH 4NNYB 1NIFA 1JS4A 3PHOB 2NX5D 3NSJA 1V3LA 5HHOE 1QBLH 4FZ8L 5E4AA 1HCVA 1H5BA 2FBRA 4XBGB 1BZDA 4Z95L 4U6HA 3AJ7A 3JV6B 4XZ4A 3QI9D 4QRSA 1PQZA 4IU3A 4HSCX 4YSUA 4X7FC 3DJTA 1YNTB 4K7PY 5E1AA 4Z1PA 1G5GA 2DWEA 2VZVA 1MFCH 3MV7B 1U92B 4H7VA 3MRMB 1D6EA 1EH9A 1KJVA 3OBAA 4BZYA 4LSTL 1K5NB 1O5PA 2E9GA 4R0LA 2VL5B 4RA0C 5E8EB 32C2B 4L1SA 3EADA 4KPHH 1A14L 4HJJH 4OLWL 4D9LH 2HUHA 3D6GA 3MJ9A 3GSQA 3FQ1A 3QUYB 4LDOB 1KGCE 4TLTA 4P06A 3NCXA 3BVWA 2QGDA 4NKIL 1KTBA 4PUBL 1DDTA 4DGWC 4TSBH 5B8CB 4IRJB 5EHFA 1MCQA 3P0VH 5KSVB 3UTZB 1CXEA 3HBQA 1ET7A 2I7SA 4YPJA 1HHIA 1TKWA 4WDIB 3WJLA 5KS9E 1OSPL 1JHLL 4P5TD 5ANME 3OD3A 4L29B 5CZVL 2B1OA 1TVHA 4Q9BA 1D7FA 3Q2LA 3LNGA 1NUNB 3SJVE 4WFED 2PXYD 4YHOH 4WFHD 1FFOB 4RNRB 3T65A 3VFRB 1F58L 1TQTA 4XPAH 4MRCA 5DFWH 2VQTA 1E8XA 3JWNC 4N26A 1SQ2N 4OF7A 2VM4A 3FF8A 4WVRA 2GJZB 2J2ZB 2YD7A 5D5ME 5B4MC 3RUGE 2GPZA 3EF7A 1GC1H 4DGIL 3LHPL 3T2NL 4WU7B 4OIAA 4MNGA 5TF1H 1UOWA 3X1BA 2KZWA 1OCOB 5DI8A 1PX4A 4OUUB 2VLLA 3KWUA 5DEFA 4EBQH 1MDAA 1OW0A 1Z5LB 2A6JB 3C60C 4WLCA 3VGFA 2XZQH 3VRLE 3DOSB 4FGMA 3MRPA 4YJZL 2MNUA 5IFHL 5TFSL 1A7NH 4P8QA 1FVCA 2APBA 4PJFA 4AC4A 5C6WH 5CU9A 4ONGL 3AT8A 5D72H 1M4KA 1D2OA 4KH2A 2Q8AL 3NCJL 3V6BR 5BS0D 4XBPB 3GB7A 1I7ZB 3DVIA 1XF2B 1BJ8A 3F7VB 3QEUB 2NY3C 2VDPL 3UO8B 4F57H 2X6BA 3ZE1F 1GGCH 1JN6B 4LSVH 1OY3B 5IFHH 3K6SA 1I1FA 2GTWA 1KV3A 4OQ1A 1MFEL 1P6FA 4OFIA 5I0VA 4CGUB 5TD4A 2WLMA 3FRUB 4HUMB 1J18A 4M1CD 5AENA 1NGXB 2VR3A 2VDRH 1BEYL 1PTZA 3MJGX 4MZ3A 4ODUB 5DJAA 2XRAL 5DJ6A 1KJ2L 2FEDC 2F54E 3HC2A 4PY8J 1OKEA 3SODB 2H6PA 1JOIA 1S78C 1WYJA 2CUAA 3WS6C 4ZSOE 4GY4A 3J7HA 1IAMA 2BNRB 4DERA 3MV7D 2LTQC 4UDUB 5D9SA 2RCSH 2Q3AA 3IETA 3OPUA 3GSRA 1PIGA 2QV2A 1REIA 3VVVA 1J1PH 1PEZA 5CN3A 3BXNB 3UYRL 4AL8H 4D2NA 4NPYA 3GLZA 4A7TA 3QZLA 2EUWA 2YUVA 3EHBB 2AF2A 3QUYD 3DX8B 1FFQA 4MMXA 1UUNA 3RWIA 2MCPH 3V4PL 2Y3AA 3FH8A 2XG4A 2UYLB 3ARSA 3WUWA 1AMYA 3U36B 4BFRA 4CL7A 3L9EA 4A2MA 4KVPA 1HXMB 4IRJD 4AGQA 2IAMC 2YSTA 2EVGA 1H15A 5AW5B 3NN8A 1BIIB 2Y1ZA 4K7PL 3W9DB 5B38G 1TTAA 4MX7B 3WI9A 2ZXBA 1IJNA 2D3LA 2VJXA 5F1NB 3T0VA 1FZKA 2R9HD 3LKNB 1NJ9B 1ZT7B 4M1GL 3MUGA 2FJGA 3I6KB 2DQDH 3VD2A 3RY4A 2I5YL 3FTUA 1BOYA 3T0XA 3LKRA 3GSNH 2EDMA 3KLAB 1A3RL 1BFSA 1G9NH 1WG3A 2QSCH 4L3CB 3WSQL 3GO1H 1CU4H 2EDOA 4M56A 3ULUH 3MJWA 3HG1D 1K4DA 1JZ6A 4ZMWA 3BN3B 4AQAB 1U8LB 5HDLA 1TNMA 1XEUA 4MDRA 9PCYA 2HXAA 3T4AC 1IBYA 4P46C 2DQGH 1TCMA 4N1HB 2G3ZA 2JK5B 4KUCF 3CFUA 2QL1A 1TF4A 3QT2A 1G0YR 2ADFL 2EACA 4ANUA 4I77H 1QNZL 5G55A 1QTPA 3B3BA 5EF0A 4BXSV 4EE2A 4ZXBA 4BFGA 1FGNH 1OO2A 3BDYL 4NB7A 1QO3A 2NNCA 3B2UD 3H0TB 4L2YA 4P3CL 5D1QD 5C0BB 2F7PA 4UTAH 2YA1A 2C9SA 5DMKB 3I6LE 2FO4B 4M6AA 2HPTA 5B1JA 3MRKB 2BJMH 3MN8A 2RQEA 3QHTC 4JKMA 2DJSA 3FSOA 3G5VA 3JWDC 3VFOB 5JO5B 4ADJA 5DVNA 1LEKA 2GC7C 2C1OA 2X4QA 3NQIA 4RZKA 1R75A 1YA5A 1TU2B 1CDCA 4LHJB 1XF4A 2EO1A 1EGJH 1KCUL 1AYOA 1N59B 4JO1H 4ODXB 1RZIA 1XEDA 4U0RC 1BQHG 4TPRL 5B1KA 3APDA 1K4CA 3QG7H 4H44C 2QKIC 1EERB 4ZD3H 4ZPTB 3SGDI 3BE1L 2E27L 3GDBA 2FT8A 1CYGA 3I9IA 3OMIB 3NZUA 5DJYB 3MGOA 4U49A 4QRRB 2BNRD 4P2CG 4KX7A 3ZHDA 4H26A 5HI5D 3VXSB 2A74A 2YEZA 4JDTH 1KWKA 4IRSC 4EEEA 3QQ4A 5MI0B 1NM4A 1J10A 4DEWA 1DJZA 1CVRA 3WFDL 5GJTH 1SLWA 1F4XH 5FV2A 1G7IB 3S3PA 1NCWH 4FCAA 4U3HA 4XMWA 4EIZC 1JYNA 5BO0D 2VABB 1KG0B 4GXFA 3KVQA 5DZLA 4FLQA 5F3HB 3SQBA 1GMEA 1JXFA 3SDXF 4BHUI 3O6LL 3ZZLA 4BQ8A 1QHQA 5T1JA 3QNXB 4JJHA 5L2KE 4WUKH 3D4ZA 3O11A 3GTNA 2D3NA 4P23A 2YSSA 4Z0BH 3WIIH 3NSFA 2MOVA 3OR6A 4PG9B 4Q0XH 4AXWA 3QUXC 5JPNA 2QSVA 1A1MB 4BA8A 3MCLL 4O02A 2BZDA 1F5WA 3O3DA 2B9BA 4UQBA 2G2RB 2EKJA 3RVXD 1PG7H 4QHKJ 3E7JA 4WFGD 1IEBB 12E8H 4AYMC 1DVZA 4OJAA 3VGBA 3NA9L 2NUPA 1RSYA 3F01A 2YD6A 3LNEA 2WXQA 4MCZB 5KG9B 3VI4E 1NL0H 3F62A 4BJLA 2X4TB 5HI3C 2OYPA 4OAWA 4YDJA 5HYJE 4YDIH 3O2VL 3NJLA 2N0MA 2BWDA 1TXKA 2MIZA 4DK6A 3TBCA 2RAMA 1TR7A 1DQJA 1LILA 5AOKA 4BFIA 3UTPD 1I3RA 2DW5A 1MH5A 4NOFA 3JYBA 3HVDA 4XHJC 1Q0EA 3OKNB 2H26A 5C0BD 5B1AB 1V7NL 4HFUH 4AG4H 4F91B 5EDSA 3C5ZA 4KHXL 1BMWA 3U2SA 3ZYZA 1S7TB 4XOAA 2XV3A 3VGAC 1UWXH 5F9JB 1EJ8A 2Y4SA 1QZNA 2CO7B 4O58L 3LH2H 3RX7A 5EU3B 1F11A 2UUDH 2Q76B 3CFKB 3L6FB 3UGEA 3ZXAC 3VD9A 2NZ9C 3M1BA 4KAQL 3TYFB 4P57B 3Q2NA 1Q1JH 4N0UE 4X9BA 2JTDA 3GI9L 3I9AA 2YGNA 3VE0B 4YDVA 4OBRA 1GS6X 3PHQA 4KTEH 5I73B 3H85A 1IKNC 1I7UA 3LXBA 4LKXB 1KJ2A 1RUMH 3EO9H 3FTSA 4UWQB 4YX2H 1I1AB 3EH4B 5BNXD 4IBSA 4FMKA 3NIGF 5F96L 4HFWA 5DEGA 1CLOL 2J8UF 3FQNA 3IDYC 4YR6A 5E08L 3DPBA 4NQCE 3Q5YA 1W8NA 5I5MA 3LYRA 3ZTCC 4BIKA 1DEDA 3VXSD 3W11C 3FHAA 4PCTA 2D7TH 2X05A 5E03A 2OL3H 2V2TA 1I8KA 2YXWA 4Y4KC 1LNUB 3V4PA 1XAKA 4HKZA 4YZFE 5C2UB 3CIAA 1YECH 1ZPLA 2P7TB 3I6GB 4UIMA 3SDYH 1OQXA 3QH3A 3ZRFC 4EDWH 3BCDA 4BZ1L 3VXNB 3L9RA 3EJYD 5T3ZD 1X7QA 1DQML 4PWEA 4PHXA 3K5SA 2IDTA 3GIZH 1QRNE 4PJGE 5IHLB 4N5EC 1TCRA 2AW2A 1OK0A 4JPKL 3H9HB 3MRNB 4HZLB 1HX0A 5GRWA 4XC3L 3EJZC 1AY1L 2HKAA 3RX5A 1AZRA 4HUUA 3TA3A 3SDXA 3TO2A 1QUPA 5C7XH 3K8MA 3OKOB 1AD9A 1MDTA 1MSPA 3CK0L 3O41A 3EGDA 3WUZA 3NEEA 4ZS7L 5CD3B 2Y2WA 3CX5J 3ZDWA 3PFUA 3B7YA 1J05B 4BQ6A 4ZFZA 4N86A 3KBFA 4GQ9H 2M83A 2UWEB 4WGKA 3HFFA 2X7LB 4WHTA 4IKIA 1I9IH 4R5XA 5EIQA 4LOUC 2MTPA 5C0AE 3UPAA 1QTSA 1ETZA 1RLBA 5D70L 3GC3A 2H2PC 1P69B 3SDAB 2Y5QA 3W3BA 2ENSA 4YS4A 1UZ8B 4U6XA 1OP3K 1HXKA 2ESVB 2RGSA 3LZPA 2G3XA 3FL7A 2XVBA 4P49A 3TBTB 2W91A 1JGLL 1VFAA 2IC2A 5T5NF 2WC7A 1BOGA 1KPUA 3SKOA 1IGFL 1O9ZA 4QRTB 2C3WA 1WEJL 5HHXH 2P8LA 4L4VE 3LRKA 2JJTC 1GAFL 4R2GC 5IBTL 4PLKD 2H1LM 3MDJA 3B1UA 1OTSC 3L3JB 4FABL 1ZHKA 2CKNA 3TH4T 3RPIB 2BHFA 3L7FB 5CR1A 2MQ3A 2WLLA 3Q9QA 1T1XB 4R7LA 1R24A 1XZ0A 1F3JB 3OB0K 4EPSA 2BFVH 4JPSA 4N90D 2K3HA 4OVVA 5L6YL 1JZ5A 1FNEA 1NFDA 5DD3H 1E7UA 3FCGA 1NINA 5LNDA 2Y06H 1FHGA 5GHWH 4OCLC 4HS6B 9CGTA 4HPOL 4OZIB 5F6IB 1DLFL 1QLFB 2AKRB 3BEWA 3DTDA 3IJSB 1HINL 5I1LB 3S3CB 1I1AD 4X9HA 2ADIB 1DDHB 2XZAH 4RMQA 3OVUB 2OR9H 4QJ3B 3J07A 1JPSL 2FJFA 5ICXB 3BP7B 4ZW6A 3IFLH 3CUPB 4NN7B 1MAJA 1E4JA 4TNGA 2BCKB 4U1HB 1QD0A 2J8UA 5L8LB 3DO7A 4N8CH 4EI6B 4Z7WB 4JRXE 3N2JA 1A0QH 1JV2B 3VFMB 3RIAK 1MFVA 2CLZA 4D3CL 1CTNA 5E2VL 4MYWB 2GSIA 4JHUA 4RSVA 1P5UC 4HIHB 2XWCA 3EO0A 3G6DH 5J0BA 2DTSA 4WWNA 4PJ5A 3L81A 1WWAX 3QDGB 2AJSH 3CGTA 4IOFD 4P5MA 1GXEA 3FQ2A 1Z32X 2E3VA 2Y25A 3KYMA 3MZGB 2XOTA 3TNMB 2YEQA 4H8WL 3FT3A 4AV0A 4O51A 4I5BA 2TRYA 2E9JA 1XIWC 2PR9A 5F7UA 4Y2DC 3WEXA 4N2LA 4KUZH 4L2LA 5GGUA 1FNLA 5DHVH 1LQBC 2R56H 2VXUH 1U8PB 2G4EA 3ULVH 4NZ8A 2R4RL 4GUPB 3DLQR 4L9LA 1W91A 2GT9B 3RKDC 3RX9A 3HNVH 3LH9A 4PJEA 1KTLA 1AG6A 4LRNH 4UQAA 3S96B 2YD2A 4UZSA 3S5YA 4AYBA 2NY2C 3RZCA 3GBEA 2HT3C 4UUJA 3CN0A 2BO0A 2MHAA 1ZGLA 3RWJA 4P2QB 4L1HA 1CFQB 1J9RA 2EUZA 4OD3L 4I48B 4AEHL 5DC2A 1F2XK 5D55A 4JUTA 1ND0A 1CDJA 3HUJE 4RAUA 1E8ZA 1MFDL 5DJDA 3SDAD 3I9PA 1N5AB 3D50A 4RWYL 2RHEA 2FNWA 1MVUB 1NUFA 2FLRT 3MGTB 4H0HB 2J4WL 2ESVD 4HC1H 3ZZSA 1GOFA 3S37X 4ODWB 4NP4H 4ZX4A 1AXTH 2UZXA 3D0VB 3C6LA 5EIIA 5EBWA 1CF8L 2G0LA 1EO8H 3IPEA 2PKDA 2YPKB 1ZLUH 1MW0A 3CH8A 1CXLA 5AVXB 1AMXA 1HL5A 1PZ5B 3GTTA 5BJTA 5HYSA 4PLJD 1WD9A 3UX9B 5ALBH 4I0PA 3EZJB 1C7SA 3SDCA 1ED3A 1DP0A 5D4QA 1KZQA 1QQDB 3MCYA 3EGSA 1AD0B 4HU2A 1CXHA 4YK4C 3MLXL 4FG6C 2WWOA 4DP8X 2G60H 2AJVL 5JXAH 5IJVA 2ICES 3UBHA 1OP9A 4XOEA 1ETJA 5F0MB 1ZT1B 1QMUA 1U41A 4ZFGL 4HIEB 3P4MB 1PYWA 1H0DB 1E90A 2XV0A 1UKQA 3N85L 5KVGE 3TTYA 1ONQA 1YY9D 4MD4B 1ZV2A 4P23C 4PJ9D 5D7KE 5DHYA 1OTTD 5LCVL 1WBZA 3LPOA 1UM6H 3UFIA 4OF3A 2YPVA 5DDHB 3ZDYB 1PD6A 4GG6B 4L0ZA 4DKEH 5I0ZA 4YXLH 1LD9A 5CF3A 2DMGA 4HEPG 5EUKB 1FIEA 4ODHH 4HXAL 5DD0H 3NPSC 1HJBC 4U4BA 3VWKA 2NW3A 3P1VA 4DO4A 1I8IA 1Z9SA 3QHFL 4WGWB 5FO9B 3T8MA 1ZY9A 1CL7L 1H3PL 3IDXH 3O3EB 1V5JA 3Q8CA 1GYVA 4WRLA 2J1XA 4JY5L 3QIWA 3QCTL 4LLYA 1JNNH 2X6AA 5JR1H 4W9EC 2E9BA 5DHXB 2UZYA 1SVCP 1MCPL 4BZ1A 4HJIA 5F1IB 3Q6FB 5CLYA 2QMKA 3EYFB 3PRZA 1L3NA 1OM3H 4N87A 2HVJB 1ZLVK 4C56A 3BP4B 2ZKMX 4L8DA 2LU7A 5I19H 2JCCB 4GSQA 3GDCA 5HGHA 3IDUA 3T6XA 1S5IH 1BDYA 3GEFA 5FHBL 2PETA 4AM0B 1BA9A 3N43B 2OJZH 3C5ZC 3T3MF 4GH7B 3ARFB 1KTRL 1MCRA 5DMJB 3EBGA 5KYNA 3MA7A 3I2CH 4QTFA 3FB5A 3WAKA 1U0QA 1B4JH 3BW9A 2K70A 4QAWA 3RVTC 2ATAA 4PTTA 1PDKA 3U9UA 5K5YA 2R39A 5JHDA 1S5HB 2RACA 3AITA 1CFVL 3QIBA 4U1KB 2JWYA 1N0XH 4AJYV 5MEOA 4LCIL 1HZKA 4Y19A 4QRPE 2EICA 1DFXA 4D0BA 2BHZA 3T71A 1TZ8A 2F53E 4P2QD 4QCIA 1X4XA 2WWMC 4I2XA 5E4EB 1FL3B 5EO1A 5D7HA 5E2TL 5ILTL 2MWCA 2VDMH 4QTHB 2MPAL 2A6DB 4MVBD 4OLXH 3EBAA 4ISVA 5CJQL 2WGXA 5DS8A 2VMJA 4XP4H 3SE8H 3IKKA 1DQDL 1JL8A 1NDMB 5D1ZI 3S8WA 5H2BA 1N4XH 4C8XA 2WZAA 1H3WM 4CVZA 5CM1A 3OMAB 2FGWH 4K55A 1XH1A 2BNQE 3P30L 1DBKH 2GIMA 5I66A 1G87A 4LEXL 3C9NB 1JGUL 3DIDA 4KKLC 3UJIL 4ZO6A 5DZAA 1MI5B 3WE6B 3Q8AA 1NEPA 3L2MA 3D08A 1ZGLP 4G83A 4OQTL 4OD2B 1SJHB 4NWUL 1OCCB 1JF1B 4MKTA 3O3BB 3R8BB 2XKNA 4HGWB 5EPMB 1IC7L 4R96A 4FNLL 3L5WB 2WLKA 1A7BA 1T21B 4ZFFA 1SYSB 3LHAA 4LVNC 2YQGA 5C0JB 1NGQL 2WM0A 1SJEB 2ZOLA 1EEZA 1UM5L 4BSVB 1P5VA 1WHPA 3BP6A 4F8TA 3KPLB 5E5RB 3X1FA 1Z7JA 4WHDA 5HHQB 4JPQA 3QPQC 2DQJH 1ML0A 3PV7A 4HJ0D 4ZFOB 4PW3A 1TO4A 2PTVA 3L3KB 4ZMLA 2H7WA 4WI7A 4QYAA 1FH5H 3TJEL 2DLTA 4HWZA 5IVOA 3QJSB 1CDUA 1MLBA 4AWJC 2IVFC 3K1DA 4QEGA 4UM8A 5EBLB 4D9RD 5I30H 2GHWB 4AUJA 1JVLA 2PP9A 5IBUG 1AZBA 1V8HA 3DROA 3E6FA 3SYAA 2DJMA 1J5OL 1PJWA 3V6OC 1KBWA 4C47A 3IB4A 1VCBC 1U93A 3D5OF 1I8MA 4JR9H 3NIFE 4YHPA 2BIIA 1FI8C 3P9MB 3LN4B 1E50A 3RAJH 2QQNL 3H6AA 5BUPA 1ZCRA 3PQYE 4RIRA 4AEFA 2ZP8A 1Q9WA 1KB5B 3DVGA 5TK2A 3V0HA 5ISZA 1WF5A 2E8ZA 5CEYA 2ZONA 3S35H 3ZDZB 3HC0B 5J6HB 3ARFD 2IDQA 4XVSL 3TEXA 3ZIYA 3SEPA 1JZEA 5FDWB 3VFWA 4XPGL 4R4ND 3SDDA 2EDHA 2VDNB 1MPAH 5E8NA 3ARBC 1VA9A 1IQDB 2FGZA 3R19A 3DDGA 3KDPB 4O4YL 5IKCA 1SEBA 4LVOB 3SQRA 4NZDA 4S11A 1KLGA 4LLAA 2ILLA 1MAKA 4B3EA 3JUZA 5AD0B 1KLUA 3GMRA 3LQZB 2W92A 3ARWA 1SDDB 4M43H 3BWAA 1OSYA 2VZTA 1AACA 1KEML 5E1GA 2V2WB 4TULH 2VLRE 5HGDB 5EG6C 4R6UA 4M48L 2EE3A 4HKXA 2X40A 1QSEA 4P3DB 5LVEA 4QYOA 3FT1A 2KERA 1DN0A 2OXGB 2UZPA 2OLDA 5IEHA 1TZOA 3AZUA 4WUUE 4AE1A 2VXSH 3P4NB 1XGUA 3O4OB 2V0AA 3F58L 3BUDA 5F6HI 2DL2A 4P4KC 3WELA 1J1OH 3WIHH 4MA8H 3IDGA 1XB3A 1S3RA 5K33A 2WAHA 2Q7AA 2GVYA 2YK1H 4JHAH 4BGLA 2Y3NA 2M1KA 4LF3A 1IL1B 3E80A 5EH1A 1OP5H 2ZKYA 4NQEB 3FFCB 2ZWNA 3IJEA 2WCSA 4PJBB 2QADD 5DJZB 4RBPH 5F0PB 2NUTB 4PB9L 2XXFA 4XC1H 3VXUB 3X11A 1OAYH 2DOCA 1AZVA 4MD0A 2WGNB 3Q44A 5F9DC 3D33A 3BJLA 4GKNB 3RVVD 1UOKA 4JFEE 2ROXA 5E6IB 1MREH 2P45B 1QZ1A 2ORBH 2WXHA 1U30A 3L95B 4U6YB 1M7IB 5SWZD 3EUDA 1EZVY 5LCVA 2E7CA 4YE0A 2OCCB 3SKNB 1OP4A 5GJSH 4APXA 1BF8A 4LKCA 4ONFH 1DN2A 2R0KL 1ZLWH 3DVNB 4G42B 1KBVA 1S7XB 3NJNA 2WP3O 1YEGH 4LDLB 3KL3A 3OHMB 3H9SE 4OV5B 3RZCC 5HHVH 1CT8A 2BXYA 3BCFA 1DZ0A 4EI5C 3U4BH 4J5VA 4HX1B 4I89A 3LEVL 5DVMA 1HKLH 3CPLB 1B90A 4JZJA 2QR0B 1IQWL 3Q0HA 5EEYA 1BFVL 3PP4H 1U58B 2F5AH 4PCKA 2DIAA 3GHBH 3LQMA 3JTSB 2PWGA 2NSMA 2Y7QB 3C12A 4MMZC 5IR1A 2AVGA 5GISH 1NAKL 4JS7A 4EVNB 4G3YH 3CZFA 1E27A 2YQ3A 4XXCA 3AU1A 2ODHA 3HMXH 5KYUB 1RIHH 2X1XR 1UQSA 2EC8A 1EAPA 1N68A 4JM2A 2PLTA 2DRUA 3MACL 1TG8A 1OARH 4YDKL 2CDEB 2X6UA 2WNWA 3SYQA 1V3KA 3BKYL 3VXPB 2CAKA 4K8RD 1U95B 2FSEB 3TPKA 3U1QA 3SPVB 1NMCB 1NEZG 3CFIC 1JHKH 3NFPA 3UAAA 1M1SA 2AK1L 3EJCA 3ZLQC 8PAZA 4JPWL 4LL9A 4KU1A 1NFIB 3DARA 3QQ3A 5AKRA 2Y9RT 2GFBB 3RQ3A 5KW9H 5KSBB 2JE8A 3C6EA 1NBYB 5TQ2L 2FD6L 4HS3B 3BLBA 1F8TH 3KG5A 4ABUA 2GTZB 1EJOL 1RUKH 3AAZA 4FJ6A 4XOCA 1KCSH 2HRLA 3MTRA 1LO3L 3ZL2A 5DVLA 2G3MA 1DVXA 7PCYA 4P3WA 3MV9A 1QG3A 5DD5L 3EDFA 5D7JA 3WLWD 3GK8H 2E7LA 3FDWA 4N2BA 5JDJA 3BRDA 1FZMB 1T2XA 4XMTA 1NCNA 2FX9H 3U25A 3VXQA 2V9TA 3C5JA 2H0EA 2VERN 4XNYH 1B6UA 1A6UH 3GRBA 3PAUA 1NCAL 3H7BB 1FLRH 5CMAA 3TO4D 3OC8A 3RJDA 2EABA 1UOVA 3BUTA 1ITCA 3QIUD 4FTVE 4PGEA 4OQTA 1AO7B 3FJTA 4PRHB 3FFCD 2XYBA 2QV4A 4HEME 5SX5K 2ZUTA 4XMXA 5I18L 3VXUD 4AC2A 5E6YA 1QBAA 1HS6A 1OEZW 3MVSA 4AGLA 3TWCL 3MOAL 3HZ3A 2WQUA 2ZX5A 1T83A 4OIBA 1JFHA 3T09A 1HOCA 3N40F 5I8OL 1JP5A 1WAPA 2VDRB 4MJIB 1MLCB 3OAYH 1AP2B 1JTTA 1GH7A 3QZBA 4OJFH 1CDIA 3MRJA 4CADA 3U7WL 4PJCE 1TZGL 3F84A 5FV1L 1H6EA 2HUEA 3MRDA 3OC5A 4HGMA 3KVDD 4WU5A 4YN3A 4NZUH 4JO4L 5HY9B 1S9XB 2GTQA 5I8CB 3K91A 3RRQA 3FU0A 2XQ0A 2QVTA 3OGCB 3UTSE 3FZUD 4GG8A 5AAMA 1CGXA 3D4CA 3RFZB 1X6LA 4PV8B 4H4NA 4IBLT 2A6IA 3QORA 2E9WA 2VERA 3K4ZA 2OMUB 1P4BL 3FN0L 2DYPB 1N8ZA 2XU9A 1YSOA 5FO7B 3VG0H 4HD9A 1ZVSB 3KS0H 2C7FA 1JTPA 3KPOA 2RFXB 2OQJA 4FKHA 1G7LA 3HZMA 3MNZA 2Y7NA 2NX5A 1WUNT 1XCTB 4X6BA 5IY5B 3O3AA 2DWDB 5ID1B 1SUHA 4Q9QL 2W80C 3HR5B 1AE6H 4OLYH 3GBNL 1YEFH 3BYYA 4G6AD 4NJ9H 4OGYH 5D71H 1CFNB 2K78A 2J8HA 5D7EA 1YNTF 4O9HH 3QI9A 1NKRA 1K8DA 2CDFB 5EOCJ 1I3UA 2HX9A 4KK5C 5DQ9A 2XFXA 5AW1B 5KVDL 2BSTA 5CEZE 1HXYA 1NA8A 2OV0A 4I13B 3RPBA 1VJSA 2FYVA 3G08A 3MBWA 4HCRL 1MCDA 1NAMH 2IV8A 1KNOB 4KC3B 5C07B 2CJUH 1W8OA 4Y5XB 1WIOA 4ZUVA 5IB1A 5ICYA 2VLJE 3V7AG 1MQ8A 3T0ED 4N0YH 5I15L 1T5WB 4MAYC 5CS7A 1ES0A 2LT9A 3A4FA 5HHPA 3DX7A 3MJ8B 3L4XA 4OJCA 4ZG1A 4HG4J 3D4GA 4ONHA 3EH1A 2E5EA 5CGMA 1ZSHA 2OP4L 3DGGB 1YEEH 4X6DB 1FBIL 4ZUUA 1ZVYA 3DRQB 4H1LB 4D9QE 5EOQL 2EEDA 4YC2B 3WEMA 2VITA 3Q13A 1A65A 4YDNA 3IRZA 1V05A 3DIFB 4DKFH 3PJSB 3Q6GH 4P5TA 4N2GA 1DCLA 4YEEA 3QJQB 3S37H 2PXYA 1IBGL 2Z7UA 3QDHA 4DP0X 5FM5M 3REVA 3VFTB 5C0DA 2FHFA 1UD3A 2X4NB 3FOMB 4ZMTA 3KLQA 1AO7D 3PGCB 3GKWL 1UYWL 3AY2A 3WUWG 4LCYA 1RJLA 4PRBB 2GJPA 3TCTA 2KLTA 2ZCLH 1AHWB 3AXIA 4TQ8A 4AX3A 3LV3A 1GTNA 3IBOA 4NJAH 1DVQA 2YWZA 1JAEA 4JFHD 4XB8A 2QQKL 2X3AA 2VRAA 3RU8H 1F1GA 3WLBB 3QDME 4UQEA 1CDBA 5D1ZB 4MA3A 4QHLB 4MJID 2BK8A 2X1PA 3D9AH 1Y1DA 3NJIA 2FJHB 5CGBA 1FYTE 3CZLA 2QTVA 5CN2A 4GRMA 4DP9X 1R0AH 4JVPA 2CMRH 5SWSD 5DEJA 3LD8B 1M05B 3A67L 3S8FB 5BS0A 1FG2B 5KJRL 3VJ6A 5KANI 2IPTL 1A7RH 2ZKHH 1SMDA 3QEQE 1GY2A 2XWXA 3WN5B 3BH8A 3IJYB 3I3DA 4LCWB 4B9JA 3P0YL 2KT6A 4LP4A 2HKFH 1JFQH 1NMAH 5GRUL 1WD8A 3LB6D 4NNYA 2BIQA 3NGBC 3WMQA 3PHOA 3TN0B 3D85B 3MRHA 3H1ZA 5DQJB 5BXFB 5J6GB 3VH8B 3V8OA 4K3EL 3ZGHA 4U1IB 4LIQL 3ARGC 1FVEB 1KBBA 2IOMA 2DLGA 1MELA 4KFZC 3UL4A 3EYOB 3JV6A 3QYNA 3BVDB 1UACH 3O6FC 1HIML 2C9XA 1D9KB 4ELMB 2XI9A 2C9PA 1W72B 1YNTA 2E56A 2ZYIA 3LOWA 5IHWA 4POZC 5T5FL 4JANA 4MXWH 3MV7A 1U92A 3TJPA 3MRMA 4AEIH 5DXWA 4B0MM 4P9HH 3PL6D 5C07D 3QUMH 1K5NA 4PYGA 1XMWA 1RMFH 3DMMC 3CN2A 5IUCA 2OS7A 2NY5L 5E8EA 32C2A 1GJWA 4NFBA 5CJXA 5KSAB 4JO3H 5D2NE 4EKXA 1ZEAL 2OX5B 3QUYA 2ADGB 4JFUA 4XPHL 1X5ZA 4HKBB 5KYWB 3CVDA 1OPGH 5B8CA 7TAAA 4IRJA 2AXJA 2J6EH 3JV5A 1GKEA 5T3ZL 1ZDQA 3UTZA 4R26L 4WF7A 5KSVA 1S9VA 1AANA 2F7QA 1YYML 2DQTH 4WDIA 4IMKC 1NPUA 5H37A 4ZMXA 4L29A 5D2LE 1BQSA 2PPCA 3MLYL 1QLEL 1FFOA 4RNRA 4V1DB 5HDQH 3VFRA 4CAGA 2WNKA 2W60A 5A1AA 3BPLB 4Z8FH 3EFDL 2V3DA 4BKLB 5LXGL 3BMWA 2LLLA 3OQRA 3MFFB 2J2ZA 5AW6B 1AIFB 1U3JA 4LBAA 5DJ8B 5JUEH 3JWOC 3SKMB 2ZQKA 1FDLL 3HG1A 1O7DE 1W0WB 1OT1A 2ZXQA 3H8NA 2AK4E 2HT4C 2X4RA 2YPLE 5BRZE 1J1XL 2XY1A 1LLAA 2B3RA 4HETA 2ZUYA 3L1GA 4EXKA 1FZOA 4ORZC 2AJXL 4H8VA 3VXME 4OUUA 4FZEH 5D1ZD 3FT2B 4UIKH 5SWQB 5BV7H 1MCKA 4R4FH 1RZPA 1Z5LA 2A6JA 4AGNA 5HDBE 2CBMA 4WNSA 3DOSA 1E6JH 3WCYA 1QWUA 3BUBA 1MHHB 3AGVA 2IQ9L 2R0WL 3WHXA 2V37A 2H6UA 4NAQA 3PWNB 4UINL 5D5MB 3L16A 3PNWB 4XWGH 3RUGB 4WKZA 2KLRA 3TCXA 4GEIA 4AUYA 2X4SB 5A3ID 3ES6B 4XBPA 1I7ZA 2V17H 3GJFH 3B9AA 4PBVC 1FFPB 1XGRB 1AQ8A 3F7VA 1AZNA 3QEUA 4O2EA 1XF2A 1A4BA 1JN6A 2G0KA 3CFCL 5HDWA 2FIKA 1IC5L 3G5ZB 2IWKA 3D85D 3N40P 1QWNA 4X99B 1QW9A 2NYKA 1NGXA 1FUNA 4ZOAA 5EU4A 1NMBL 1JUFB 2CIKB 2WSPA 4AT6A 4ODUA 4JM4H 5J6SA 5EA0H 5CZKA 3SPIA 2DD8H 1RZJL 2IOOA 2Z31D 4AH2B 3RI5F 3AB0B 1H9DA 1D9KD 1P4LB 2DEXX 2YLKA 3CMOL 3CX5K 1P2CB 1FH2A 4HCRA 1MJJB 2N7SA 4QNPE 4NIKB 1HYRC 2R2BB 2BNRA 3QEGL 4XNZB 3UG5A 4EAEA 1Q72H 4YVUA 1JPFB 1JNLH 2KMWA 1IGYA 1U4FA 4F5CA 1F1AA 2EDFA 2GKIA 1KXQE 2XXCB 3B9DA 3ZKND 2Z7WA 1HC1A 5D96B 3HE7B 1KDJA 3BXNA 4DWHA 3FUKA 1VKXB 3TEYA 1B2YA 3DX8A 4QO1B 1CYWA 3TOPA 2X9ZA 2VZUA 2J7LA 4FFYL 3U36A 4MZ2A 1CDGA 4QHPA 3RDTD 1HXMA 3Q9PA 4CC0A 3TZVC 3D3VE 3CSBA 3OR7B 5MEPB 2F6AA 2DQUH 3BQVA 1BIIA 1NLBH 2EVFA 2F7IA 3W9DA 5CP3A 5I1JH 1WE5A 3KE0A 4L1LA 4MX7A 4Y9GA 3JT2A 5F1NA 5J13C 3VFUB 1XSKA 1E67A 3IE9A 3LKNA 1NJ9A 1ZT7A 3BKCH 4QXUH 1EUTA 3I6KA 4V1DD 4DAGL 5MP6H 4UNTA 1A47A 1PF3A 3E0GA 5LGJB 1THCA 1MHPL 4Z7VE 4Z3GA 4XMUA 1MEXL 1M57B 1DVUA 5AB0A 4HPYH 3GLEA 4TNWF 2R23B 3KLAA 1CUOA 4BV1A 5DUPH 1TMCB 1JGVH 4YDLC 2DN7A 4AYGA 1QFPA 5IJKA 3ARDC 1R3IH 5K9JH 1DANT 4AQAA 3VM5A 2J88H 5KTEL 3OJVC 2PO6C 3QI9C 4JKLA 4XVJH 1OSZB 2AXHA 3ZL4L 3R7QA 2RMNA 2JK5A 5CEZH 1J5HA 4WTXA 2EEFA 2YR3A 1ZVHA 5BMFL 4Q74A 1ZA3A 3RZWA 3BT0A 1FE8H 3CHPA 4OSUL 1ZT4B 3H0TA 5CXPA 2P52A 4OTXH 5C0BA 1EZSA 1CLZH 5DMKA 4HK3J 2FO4A 5E2UH 1AS6A 1EBAA 3AWFA 3MPCA 3MRKA 4MD5B 5C6PB 1CIUA 5CSGA 3AT0A 4Q9RL 2GQHA 1BAGA 1LWJA 2BX5A 4LSRL 4PRDA 3VFOA 5JO5A 4QTIH 1J0ZA 4M62L 2GUYA 3AACA 3MLSH 2HFEA 2HLFD 3KH4A 3L13A 2O5XH 3DOIA 4U3SB 1TU2A 2C1PB 1ZHLB 1RCYA 3TIEB 4ODXA 4AYDC 4GRWE 3FQUB 1U42A 2PXYC 4OCXL 3V4UL 2IXQA 5EC2A 5KSUB 3OXRA 4PRPE 4N3TA 3STLB 1HWGB 5EU6B 5GRJL 5T33L 3KCWA 5DHVB 3V0VB 4XNUL 4TNWK 2ZE0A 2AITA 1D5ZB 2PCPB 5T5FA 1J86A 5DJYA 4IRZL 5EZJB 4UZUA 4I9XA 5SX4H 2NOYA 4P5KB 1W2KT 2H3XC 1P1ZB 1UXSB 4M4PA 1S9WA 4P59H 3VXSA 3VX1A 4JMNA 4EI0A 3I50H 2R1WB 1D5MB 5CBAB 1X3DA 4PJXE 3HZKB 4DUXA 4YVNA 4K07A 2ZYHA 1TJHH 1K2DB 1DJIA 2QGBA 5EF1A 2W07B 1CJYA 2KH2B 4IW4C 1G7IA 2ICEB 3WKQA 1TLMA 4FEMA 3QJHB 2ADJA 1CD1B 1QR4A 2D4DA 3QO0B 4QOKB 2VABA 1UJ3C 1KG0A 2QZ5A 4YHLH 1M7XA 3RURA 1W0VB 4Y8AA 2WXIA 4EKJA 3BWUC 5F3HA 4ENZA 1K9TA 5FKAB 2M8XA 1F3DH 3ZHKA 4CMHB 2Q8BL 3PHSA 5GS0H 1NGPL 2EYSA 3OMNB 2I25N 5F7WC 4JREC 4PGCB 2DM3A 2OCJA 4K2UH 3GSOB 5CD5D 2IWFA 3VSTA 1ZXQA 2YD1A 2XTSA 2F1BA 2UWEF 1A1MA 3HE6C 1F3RB 1IGCL 2AHIA 4FLSA 5F6HJ 5IW6B 1PLGH 1YG9A 1H3VA 3CQQA 3VD0A 3LMJL 4PW4A 1GPOL 1B0GA 1VB9A 4M5ZL 3HNTL 4Q6IC 1IEBA 4AQ1C 1G9ML 2CBTA 5FYJE 3HMWH 3IDIB 4IOIA 4ATWA 2ZP0T 4MCZA 3K74B 5KG9A 3IPFA 3LN5B 4QD2E 1U3NA 4GUQA 5HPMB 3V9EA 1N2RB 3GZQA 4ALAL 5HVHB 3K72A 3HS0C 2DMBA 4ZMNA 5L8KB 5L4FA 5C09E 1PLAA 2OZ4H 2ZG3A 4FS0A 2J44A 1DFBH 1UFGA 3RE0A 4WFFE 3FU7A 3OKNA 1OALA 1R3LB 4PU2A 5E2WH 4X4YB 3O4LB 4CW1B 4Y1AE 2WQSA 1S7TA 2B5IC 4HCFA 4MNHB 3MV8E 2V9QA 2CO7A 4O2CA 4QIRA 4JCWA 5B8CC 5EU3A 1PVHA 1MJUH 2Q76A 3CFKA 1J9QA 3TYFA 4PJAE 4P57A 3KBPA 2C3HA 2Q6WB 1SUJA 1UT1A 1FCGA 1VIWA 4G7YL 4OZIF 3A4DA 3ASOB 4P07A 1KEGL 5EIIG 4Q6KA 4IU2B 3VE0A 2YGVA 2ZIDA 5GGQH 2OFQA 5SV3A 5JW4M 1HH6B 1U8HB 1ZHNB 4LKXA 2V6HA 1AFVH 1KJMB 1LHZA 4JFTA 1MVYA 5T5NG 4AVIA 1Q9LA 2J5LB 4N8VB 1I1AA 5FYLE 5HYSG 4XP5H 5EU6D 3C09C 4AQ8C 4AQZA 4NUQA 4YWGH 4PY7A 4ICWA 5BOZG 2JKXA 3ULVD 3M88A 5IHUH 3QWRD 4KNTA 4Z7WF 2JB5L 2O5NA 1CZ8L 1L9SA 4ODTL 2JI3A 3LKSB 5E9NA 5JIIA 5IHHA 4N0UB 2Z8WC 2IPKB 1NIEA 4HIQA 4E9RA 1LNUA 1JCVA 2A9DA 3TBWB 3EYUH 4AGOA 1IFRA 3MSPA 2Y5TA 5DZJA 2P7TA 1UD8A 3I6GA 3L3HB 4FFYA 1L6PA 4XCCH 4JFPB 2VDMB 2KBGA 1P9MA 3R4RA 3IU4H 3G6JE 4KBPA 3FUMA 4UQ2A 3VDAA 2GIYA 4GW5B 4QOKD 3PXJA 2R2EA 1WISA 3VSVA 1NC2B 3BVUA 3V52L 3MRNA 4AV4A 3MBEB 1FORH 5FGCB 3K46A 3NRPA 3M1CA 2NTSP 3VDBA 4JE4B 5DUMH 3R4DA 2PPEA 4HK0B 4AIZB 4PEEA 4AJVA 3INUH 3OKOA 4M8VA 2Y2TA 4R84A 2Z1PA 3DIVA 3TXAA 2BDNL 5CD3A 1GZHA 4YIQB 3THML 2A9NL 2XTLA 3ABLB 1J05A 3UC0H 1A8JH 3BFWA 2BMKA 4ZYKB 4JHWL 2UWEA 1IGMH 4UU9B 2X7LA 4KQ0A 5H94B 1QA9B 3B9VA 4PJGB 3FO2B 1GIGH 3MFGB 3CXDH 5EU5B 1IBFA 4KX8A 4NCDA 3D12B 4F24A 3RL1B 1WUZA 4DIXA 5GXBB 4HHAB 3SDAA 3ARYA 3NAAL 1UZ8A 2NCEA 2VJ8A 4RGNE 2ESVA 5D1XC 5KEZA 2IFFH 4Y4FB 3TBTA 2A77H 5I82A 2M26A 5CCGE 2DDQH 3VAEA 2H3NB 2VRQA 3CU7A 1SFDA 2WO4A 2OJEA 3IBEA 4QRTA 1BFTA 1ZPUA 1KELL 5I75C 2GSGB 4G8IB 5FLUA 4FQIH 4M7LT 3FS9A 1F02I 3EHBC 4GIPD 4UT7L 5C0AB 3L3JA 1CO1A 1XBRA 2GAZB 3O4LD 2NCMA 1GGYA 3RPIA 3L7FA 3QRGL 5IB3B 1CN4A 4IEFA 1F3JA 4JFOB 5DUBB 2PN5A 3ZDXE 1UA6L 4XNQB 3AUWB 2D0FA 4KXBA 3K2MC 4M7KH 5DGQA 5E24E 4E41B 2GG1A 1WTLA 3WEBA 3WFEL 5TQ0H 2YKKA 4HIXH 4QHUB 3ZDYF 4CVUA 4GG6F 4HS6A 2HLEB 4PJ9A 4OZIA 1XCQA 5F93C 1QLFA 3CVHH 1UCBH 2AKRA 3IJSA 5I1LA 5DJCB 3UPRB 2ADIA 2WO2B 1KYFA 1G43A 1R47A 2VN7A 4YLCA 3U6XS 2AQ1A 4QXWA 4XXDA 5ICXA 4IRZA 3BP7A 4W70A 1F45A 1KCRH 3WFHB 2AQTA 2BCKA 4Z7NB 2IO5A 3KPMB 4TVPE 3ZTDC 2K6YA 4CKVX 2Z3FA 4Z7WA 4EI6A 2YRBA 4XMPH 3VFMA 2SEBB 2F18A 3D0LB 4FLOA 4ADIA 2AJUH 2B2XH 1MRFL 1WFTA 2ZYRA 4NUGL 4DW2L 4FFWD 2K4AA 3BIAX 4FXGA 4HH8A 4G70B 1GKOA 2JCCF 3WKNA 2VM9A 3CLEL 1UB6B 5H35A 1KFGA 1IJ9A 3TNMA 1C5CH 2YUWA 3QCVL 4B0MB 3H4HA 3HHSB 4HQQL 3N43F 5IB2B 4MB1A 1FV1B 4GQPH 3K4DA 2ZUQC 1KB5L 4K23H 4JRXB 3MBED 4X8GA 4CSTA 2B9AA 3HKFA 4UBDD 2EIMB 5IQ7L 5K59F 3DXAE 4JQXA 2E7BA 3L1FA 4GUPA 2GT9A 4GMSL 4K8RL 4FYTA 4MDIB 1FHNA 1Z9NA 2LABA 4KV5E 5HVGB 2VDNL 3S96A 2VDOB 4HIJB 1R33A 1NZRA 1YRKA 4DP1X 5GGVL 4YHMH 1LP9E 1YMME 2TSAA 4NNPL 4MNQB 3F7YB 3F5WB 2ZSVA 5EOCL 2G75B 4GRWH 2WIIB 4P2QA 3PIQB 3IGLA 1CFQA 3PGFH 1OQOA 2J55A 5EEUA 3P02A 3OAZH 1PY4A 3O6MH 1P4UA 2QGCA 1YEHH 3MGTA 4LSSL 4HV8B 4OKVB 2W95A 3KYOB 3UAEA 2QPEB 4ODWA 4Y4FD 5C70A 3D0VA 4X5PA 4CU6A 2AEPH 1PPIA 4NM4H 1LMKA 2C9AA 2Y7MA 4CNIA 2VZOA 1NKOA 2CJSA 3UAJD 3QE5A 5E9DD 1SM3H 2YPKA 4U6VH 2N1TE 2MPVA 5FM8A 1QTYT 5MENE 2NY3B 3EJQA 4Y5YC 3CU1A 4KJWD 4X6FB 2J3SA 3SBWC 3VGGA 1QQDA 3K2IA 1RZKC 1EA9C 3MR9A 3BH9B 3TYGH 1N8OE 1I9JL 5EU7C 1BLIA 1KIPB 5TPWH 2PWFA 4WK2B 1BQUA 1ZT1A 5DVKA 5HJ3B 4E41D 4HIEA 5K93A 3P4MA 2YC1B 1PFOA 3VD7A 1H0DA 4TSAL 5L2JB 3SKUD 5HYQA 1LO2H 1V54B 4J23A 2BPBA 4NM8H 1UWEH 3QEHB 5DDHA 1IAIH 4YQXH 2BXZA 5F1KC 3FB8A 1SLVA 2D7PA 3MRCA 5AL0A 2XWRA 2HFGH 4Z7QE 2W0LA 3DETC 4G7VL 4HWBA 5GGTL 5T1DH 4OF0A 5JHBA 3QQNA 5TE4L 3R06B 1XBDA 5AZEL 4J3OF 1L9PA 3D34A 3IFOA 3G3LA 3PWPE 5FO9A 3IS1X 4G6KL 1OWRM 5HTSA 3O3EA 2VXQA 4S1RL 5E8DL 1RURL 1WC7A 4KPHL 2ED7A 4Y9BA 5J11B 4PGDB 4D9LL 2R2HB 2IAMB 4YSAA 5EORL 2XTJE 4GKSB 3E3QE 1IKFH 5LBSL 4K3DH 4S10A 2VAJA 4XAKE 4TNFA 3Q6FA 3EYFA 4W9HC 5GIRB 2HVJA 4TSBL 2OMYB 1TJGH 3BP4A 4BQCA 2JCCA 3ZDZF 3QG6B 4DGUA 1TJIH 1SDYA 3K0YA 4JBSA 1U8NA 3SYCA 1PKQE 5CCKL 5FYKH 1HNGA 3ARFA 4JRXD 4X8CA 4PRID 2O5ZH 2WXMA 2LW3A 2FQFA 4Z7IA 4IK6A 2Z8RA 2B39A 5B4MD 1DZBA 4KKRA 2O93L 3AXHA 1S5HA 4U1KA 5F89B 5HSFA 4ZTEA 4ZDHA 2ETWA 4P46B 2D3VA 4MNQD 2NY1C 4N6QA 5AAPA 4WIQA 1J12A 2ZX8A 4ATTA 3U9PL 5FYLH 1I1AC 5JLZB 1FL3A 1R3JB 4JL1A 3C60D 3V55A 4QTHA 2A6DA 3FU5A 1E9PB 4YFEA 5T1KB 4BHUA 3ZO9A 1C08B 2VW6A 4HBCH 4FXKC 3VWJC 3C6SB 2VR7A 1E9QB 2HH0H 1NDMA 1X5XA 4EBQL 1WLHA 1A2YB 4HYTB 3L5JA 1AQHA 3RJQB 4PH8A 5EO9B 4AQOA 1CR9H 4PJBF 4FQLH 4TRPL 3APCA 4YHYB 3C9NA 4PGBB 4QRPB 4WJKB 1MI5A 2B0SL 3WE6A 4KDTC 2NY3D 5D72L 4X6EB 5DZVA 2X2HA 1L9MA 4IOFC 5FWRA 4OD2A 4OCSL 4JKPL 1SJHA 3ARTA 3PWLB 3GZPA 1CS6A 1JF1A 3MLTB 3O3BA 4NQDB 4DP5X 1MQKH 4QI3A 1YNKH 3OAWA 4HGWA 1LYQA 5F70A 5EPMA 1JNJA 1OM9A 4XCYB 3L5WA 4MQ7B 4F57L 4KKQA 1XF5A 1NCCH 1T21A 3RWFB 2XPZA 1SYSA 1T2QL 3HB3C 4U0RB 1CGWA 3IXTB 5C0JA 4LT7A 5SWZA 3MQIA 1GOHA 2FEDD 1SJEA 3MV11 2DEWX 4BSVA 5MEQB 4NCC1 3IMVA 2BNQB 1P6WA 1A64A 1SLUA 3M46A 4KVNL 3EDEA 3KPLA 2V7HB 1HN1A 5HHQA 2VDRL 1S78D 4QGTA 3SPGA 3CLFH 4MJ2A 4ZFOA 4N2FA 2YS4A 3L3KA 1KIRB 5I5RA 2EH7L 4KI5C 1WAAF 1BMGA 3CXHJ 5D4JA 4IRSB 4JHVA 1WFIA 1U6AH 1ETB1 1JWUB 2WXJA 3IDJB 3REWB 2F8XC 4EOWH 4F2EA 1NAMB 4FYQA 1MCLA 4BZ2L 1YJDC 3LKQB 2IG2L 2WMPB 3KPQB 3GBMH 5EBLA 4OV6F 4HG4K 1BZ9B 1OT2A 3W5NA 1DSFL 5DO2C 4YSOA 4AMXA 2IAMD 1GGUA 4MXVE 5A2LH 2YN5A 4X7DC 1INDL 4HXBL 3ARRA 3P9MA 4N6RB 4NZRL 1F97A 2MJWA 3LN4A 3TEZA 2ZPKH 1CYXA 4A2DA 3N1GC 2OSYA 3T6VA 3BJ91 1KB5A 1XX9C 2OMWA 4S1SL 1HCFX 4Z7OB 15C8L 2YQBA 1KXTB 1JDCA 1YC7A 3HC0A 1V10A 1UADC 4PS4H 4X4KA 1UXWB 5CKAA 5FDWA 1YZZA 2BSBA 4G6MH 4PV1C 2APWA 2V7NA 4WZ9A 1BZ8A 5KSBF 2KDYA 1IQDA 1A9EB 3GXTA 4NZFA 3B1TA 4N3UA 5HYIA 2QDWA 1CICC 3UMTA 4FX5A 4NAJA 5CWSB 2HTKC 5AD0A 3LQZA 3LXUX 4M8QB 1FWXA 4P46D 1SDDA 4RMBA 4BM7A 1CQYA 4HLZH 4JFQB 5CSZB 5HGDA 4LRIA 1N7ML 3OKEB 3QB7C 4NSKB 2DQGL 3FCBA 1HSAB 2OXGA 1HU8A 3QP3A 2WTPA 4B60A 4NGHH 4L0PB 5AW9B 3P4NA 1IBHA 4WI0B 4TVPH 3QFDB 3WJJC 4E9TA 2DKUA 4M9OA 5AVRB 1EIBA 2CH8A 3TO4A 3LPPA 3D2UD 3QIUA 1BQLL 1IL1A 1GJUA 4N0CC 1P7KB 3IKCA 4QRPD 5IOPB 3FFCA 3JWOH 2VDQL 1DO6A 4PJBA 2WKLA 4UTAL 4PP2B 2NUTA 5JHLL 1DBMH 1AOHA 1S8DB 3SZKC 3VXUA 5BOJA 3DSFH 4KITB 4L9DA 4NQDD 4CVWA 1A25A 3S5LB 1SVBA 2NNAB 1MCWW 1J8SA 1G94A 4GKNA 4UM9B 3KLSA 3L3OB 4WUUB 1TYEB 1B9ZA 3ILDA 2VZ3A 3PHAA 4AYFB 4YLBA 1GS7A 1ILUA 3L95A 1M7IA 4U6YA 3G6AA 3KEDA 1F4WH 8FABB 5JYMA 2P49B 2GI7A 2XV6B 2RQ8A 3IDYB 3U82B 3G9AB 4JO1L 4XNBA 2R0LL 3SKNA 4KMTH 2XBDA 2XXMB 3FRPB 3OLGA 4JO2H 4TLUA 3DX0A 4BFKA 5GGTA 1S7XA 3HLKA 4DQOL 1A6TB 4IRSD 4OV5A 1I1CA 4G8FB 1WAAA 5FYJU 1IGIL 4Y4KB 3FYIB 4HX1A 4LLDB 5C92A 5GS1B 4OH2A 1II4E 3CPLA 5T1LB 1TSRA 2QR0A 1MAMH 3L45A 1NSNL 3L7EB 1U58A 1NH6A 5CLWA 4P9ML 4ALAC 2AXFB 2BVEA 3JTSA 4H5SB 2F5BL 2ITCA 5D7IA 5DRNB 5LBSA 5GJTL 3TV3H 5A2KH 5LDSA 3T6QC 1DSWA 1FL6B 5JZ7D 2EDQA 4LCVA 4EVNA 5BQ7B 2H0FA 5JQ6H 4YDZA 5DC4B 3OZKA 1CXFA 1T0OA 2FWLB 1A22B 1P7BA 3C8HA 1EMTH 4WW1B 2HRPH 2YGOA 4EN3B 2ZCKH 2CDEA 1PU0A 2Y1VA 3QUXD 4WUKL 1BHGA 3U83A 1YQ2A 3PS6A 3VXPA 1U95A 1W72L 2FSEA 4MNGE 5CINL 2ISDA 3TV8A 2LU4A 5JA9A 3WIIL 4GKLA 3ZT6A 5C08E 4A2EA 2X6MA 1TTUA 2YD5A 1AGFB 4Q0XL 2D0HA 3T0EA 1TOXA 3TIDA 1NFIA 5KSBA 1KPRB 3DURB 4GAFB 2GFBA 4CSZA 4LQFH 1M7DB 3OSKA 3E2HC 1NBYA 2WQRA 3CVBA 4OFVA 4X6DF 4HS3A 4TOYL 2GTZA 4L0YA 1U8MB 5HI3D 1CD8A 3OZLA 4PJFE 5AYTA 3KYKH 3FUIA 4PREB 4EZMA 3H9ZA 2E6JA 2QJDA 1FZMA 4Y2LA 5I5JA 4NQVA 4Y7MA 4QJ4B 4B9PA 3LQAC 3H7BA 5IBLC 4I3RH 3EIFA 3RGBA 1E4KC 1L9NA 2FR4B 1J0IA 3FCTB 4LQ1A 4G1MB 3V7AE 3VO0A 4HSAC 1P7QB 3ABZA 1AO7A 4K3HA 2NZ9D 1KTJA 2WIMA 2DI7A 4JHBA 1RVFL 4MQSB 2ZXEB 3B6SB 3NFSH 2IH1B 4XE0A 1IAIM 1D3CA 1OD7A 4M7JH 4N2HA 5KVFE 4F7MA 4HUWA 4XCFL 2BIPA 3V9CA 1F13A 3LH2L 5I74B 3QUKA 1Z6JT 5FA4B 2RTTA 2X53A 1Q1JL 5LGYA 5IQMA 1FGVH 5H37G 1JPST 1PZCA 5EDXA 2WXRA 3MYZA 2YD9A 4H8HA 4QF1B 4LLMB 1LXMA 1NPNA 5KBNC 2Z0BA 4DN4L 3GINA 5CCHE 2FLMA 2FX8H 4KTEL 4MJIA 2BW5A 1MLCA 4R4NC 1AP2A 5IV2B 2ARJB 3EO9L 3SPHA 1TUPA 3DKHA 3S9DB 1IB5A 2ZICA 3FSZA 4KDWA 5HY9A 2FCBA 5I8CA 1W0YT 5SWSA 3SE9L 3W11D 5AG8A 4L8CB 4U1MA 2Z4TA 1U8CB 4BZ2A 1Z3GH 4NENB 2IV9A 2K3TA 3TASA 1P5UB 4M6MH 4Y4KD 3X14B 3RFZA 3GWJA 4PV8A 4JB9L 4FQCH 3VGDA 3Q3GB 3KJ6L 5T1LD 2OMUA 2XZCH 2VN3A 3T04D 1M2VB 2D7TL 5FO7A 3KGUA 1ZVSA 4LARH 1BGXL 4ZK8A 2RFXA 3MCKB 1FPTL 1YEJH 5FO2A 3V8CA 4NO3B 2DMKA 3GSUB 4G5ZL 4AQEB 5C71A 4EDWL 1XIWB 3WEOA 4N5ED 3AG2B 3QQ9C 1RXLA 5ID1A 2Y0SA 4ELDA 4PWHA 2BFGA 2CO4A 2HJFB 3EJZD 3QXDA 4V33A 4WY7H 3WJMB 2R0ZH 4MFHA 4ELMF 4NOBA 1IM3D 1A5FL 4Z7UA 4F2MB 1IC4L 4RGMC 2CDFA 2EXWC 4G72B 3GMOB 4TNVF 2KKQA 1IE5A 3ZTNH 3ZR6A 4FP8H 4BWWA 3ZSSA 3FU9A 3PL6A 1A1OA 2VR8A 5C07A 1I3GH 3RVVC 4ACPA 4Y5XA 4IBVA 1P1VA 1SEQL 4LOUD 1YN6B 2PWHA 1T5WA 1LK3L 3LEXB 3MJ8A 3NIDB 2X4OB 3U30B 4ZNEE 2H2PD 2APFA 1ZK5A 2P9RA 2DQIL 1TT6A 1KIQB 5L7XH 4XOBA 2FX7H 3KPRB 4C54A 4X6DA 3QXWA 3DRQA 4K5OA 4H1LA 2I7OA 3NSCA 3TT1H 1N64H 2ZAGA 2CKBL 1U33A 3MO1B 3FN9A 3QZMA 4GB9A 4UNIA 4YBLB 3VD4A 2IALB 5A6IA 4K7PX 3DIFA 3S3DB 3WO3B 4A7VA 3PJSA 5D4IA 4R2GD 1CXIA 1IAII 4JQVA 3LIZL 5LGHH 5I1EH 1OTSD 3QUZB 1DTUA 1VCAA 2E76C 2JTYA 4NKMB 5IMLB 5HHXL 3VFTA 4J3OC 4YK4B 4UTAA 4R5VA 3FOMA 1P7QD 3OXSB 4HK3N 1KUMA 2F74B 5HHME 1HWHB 1AHWA 1T2JA 1BEXA 1VHPA 4BGDA 3EJRA 1BVLB 3QC5X 4UB0H 5GRYA 4BRVA 3U2JA 4WV1C 4PB0L 1U8KB 4TNVK 1EEUA 3WLBA 2A9BA 2BRRL 3COOA 1RP9A 2FQEA 5D1ZA 4NFDA 3QO1B 2IWGA 4JY6B 4QHLA 5TDPB 1OAZH 1RK1B 4UMSA 3NCWA 4GT0A 3D51A 1HZHL 1M7UA 4XVOA 2FJHA 5D5MF 3RUGF 3W37A 3BAXA 4LVOC 1QVOB 5I6XC 1FNGB 1L4IA 4X4ZA 3HI6L 1YYLL 1JK8B 1RIVL 4GAYA 1TZIB 3QCUL 3C75A 4OZHA 4DZBB 4OT1L 3OKDB 1M05A 2EUXA 3ESNA 2K8QA 2IQAA 1EXGA 2K7QA 2H1PH 3B9KB 5JIHA 4N8CL 4XP6H 3PREA 5JTWA 4LRIC 1IO4C 5AYQA 1EVUA 1TENA 3BRFA 1E6OH 3IJYA 4OLZH 3VRLF 4LCWA 4P2RE 5B3NA 1TVBB 1SOXA 3G6DL 4K9EH 4HLEA 3GUTB 3TNNB 1FO0H 1EBPA 2I60H 3O4OC 2ZSWB 3FUNA 2P3YA 3OM3B 4X7EC 3D85A 2VO8A 2JSFA 1OGAB 1ROCA 4QRAA 1XIWD 2A4ZA 3SOBL 3O0RH 3VH8A 5BXFA 4Y2DD 5J6GA 5CJBA 4BK8A 3S3SA 4K7FB 2B4CC 2UUDK 3EYOA 4B9FA 1GCYA 2O6DA 2Z31A 4FLHA 4JFDB 4EZLA 4L05A 3WXVH 1D9KA 4ELMA 3D7PA 1FIGL 1W72A 2HWZH 4BWUA 5IWLA 2X1OA 3ULVL 1A4JB 1U8JB 1YN7B 2AGJH 4IKKA 3RA7L 1IU1A 2AQ2A 3CAFA 4LOFA 4Q4EA 1BD2E 1KYDA 1WQVT 2WQ8A 2HT3D 1F18A 1VF5C 2E7DA 2ZXDA 4JMXA 4PJIB 3RWEA 5E6IC 1RU9H 2J72A 4LRNL 2ICWI 5G5DB 5E1QA 2ZUSA 4EDXB 5DK3A 3JV4B 1YEKL 2OX5A 4PWIA 1C1EH 2ADGA 5AZUA 4Y9CA 4ES9A 5KYWA 2GSMB 1J0HA 2ZT9C 3KPRD 1XVSA 3MJ9H 4TVSa 5G2NA 3RDTA 3P54A 1GW6A 4K94L 2ZOTA 3IRCA 2KUTA 3T8VA 3ARPA 4DPBX 1LO4H 3TJHC 1CFTB 4NP4L 3ZYOA 5FUZL 5FR3A 5HGGS 2AMGA 4XMZA 5EZPA 4IHBA 3IGFA 1FZJB 1KWGA 4F7EB 2CRMA 5DWUL 4V1DA 1EO8L 2VMFA 3K4AA 1UXMA 1WFMA 1QSFB 4HJGB 2XDHA 1JVKA 4BKLA 1S7QB 1UH2A 3HC4L 5ALBL 4ZTPH 2NXYB 4B9YA 5I1HH 1CWVA 4U1LA 1AGDB 3UZVB 4TMPA 3SKMA 3O2WH 1W0WA 5FA3B 2G60L 3VFSB 5JXAL 3WU1A 4BSWB 4LMQE 4NHUA 3T6WA 4I4WB 1NOLA 2AEQL 4MSWB 2WWKO 4YL4A 3S6CA 2HSIA 1J9TA 3FT2A 4HZAA 4TSCH 1HFUA 4NUJB 3QS3A 3LKOA 5ID0B 3NSDA 4UT6H 2ZWYA 1THAA 2X42A 1MHHA 3GRGA 2N4IA 4ZX5A 4DKEL 5L4JA 5IB5B 2ADYA 1JYVA 3PWNA 1KCBA 1JD7A 3PNWA 4ODHL 5DD0L 3UTTB 1QEXA 3VFGH 3NABL 1AH1A 1GC1C 1PZBA 2AK4B 5I1IL 2YPLB 4F7PB 2PYFB 2X4SA 4KVCH 3ES6A 1YEDB 2EIJB 1YNLH 2J12B 1FFPA 1XGRA 5DZ9A 1RULL 4TUKH 2BP0B 5L0QB 1M9SA 5B38B 3AQXA 3TBBA 3BUIA 3O6KH 4A66A 2CQVA 3NH7L 3SDXE 3DGDA 4OCWH 1ITBB 5JR1L 3RTQC 1MXDA 3G5ZA 2E6QA 1KJ3H 1OGAD 1JZDC 1A7QH 4X99A 5AVVB 4DOHB 4NPKA 1BWMA 1JUFA 2CIKA 4IGBB 1ZTMA 2EIDA 4J1UB 2Q86B 1P53A 3ULVF 5CJOH 1QAWA 5CKGA 4GFTB 4FL4B 2HRHA 3ARBB 4BRJA 4KZDH 1S5IL 4AH2A 4OFKA 4JFDD 1X5HA 2EH8H 1Q94B 1MIML 2QHLA 2VKXA 3T77B 2OJZL 1P4LA 1ZRUA 1P2CA 5KVFH 1MJJA 1FNHA 2EO7A 2ZOKB 4FLRA 4QPEA 1FNAA 4EIUA 2DMHA 3OAUH 3KPSD 3PDDA 2W9DL 3D1MC 1B4JL 1JPFA 1CE6B 4YPGA 4HULB 5FEBA 2W9LA 3QWQB 2WWMD 4BKSC 4EIGB 3NJHA 3HE7A 4U0QB 3P3RA 1VKXA 3KYAA 1JWSB 4Q97A 1I1RA 3TBSB 1J8KA 3ZHFA 2IH3B 1JZGA 3EH5B 3DDFA 2WVTA 4DH2A 4N9GB 5INDB 5DURB 4C83B 4IM8A 3MJ7B 1H6TA 4P4KB 2VDML 2WQVA 2CKBA 3KXFB 4GXUM 4DF9A 3SBQA 1RUAL 1S46A 3OR7A 3NT0A 3B2VH 2FZ3A 1PY9A 3LIZA 1RZ7L 3EYQC 4K3JH 5DLMH 3VFUA 4AL8C 1DBKL 1NFDE 1YY8B 4XB3A 4LLVB 5EEXA 5LGJA 1XGQB 3U48A 2NDFA 3W56A 1QSFD 3BAEH 4W81A 4JCMA 1BVNP 1BAFL 2R23A 2GI0A 1BQHB 5EN2B 1AIZA 3IN2A 3WNIA 2JB6B 1HNYA 1TQWA 3LZQA 1IAOB 3CSFA 4RRPM 3GXFA 1LEGA 4ZW7A 3MLVH 1IGJB 4LASL 2VZ1A 3NIGE 1OSZA 3QPQD 4CUCA 1FFNB 2J8UE 4AKOA 5CLXA 1KGYE 1QASA 3CVHB 4F33B 3MXWL 4TYUA 1VZIA 5CIPB 4EI5B 4I87A 4LGSB 3X3FH 3HOGA 1ZT4A 3P77B 3QAQA 4NO0B 1UCTA 4RFNC 1FH5L 1G9NC 5E6ZA 3AY4C 3GBDA 3ZX1A 3UTTD 2CA4A 3ULUC 4BDVB 1RHHB 4GI8A 2YPLD 5IOKA 2CO6A 1JBJA 5ADPL 2P8MB 2DH2A 4X0KA 1Z66A 2LGNA 3TP4A 2AAAA 5DO8A 5FDYA 3BZ5A 1ZLUK 3ZW3A 3TL5A 2X4PB 5CSBA 3D30A 1QFUL 3ECWA 4IBYA 3TM6A 4PBXA 3B7UX 4JR9L 3VFVB 4M7LH 4PJEE 4PJ8C 4U3SA 3NESA 3VYNA 1ZHLA 3TIEA 1BV8A 3W9EB 3FQUA 4OZ4A 4IGBD 2BVOB 4J3TA 4LSQL 3AREC 4FZ8H 3STLA 5EU6A 1SBSH 2B1AL 5I6NA 3ARBD 5DHVA 1UGKA 2NPLX 5FUCC 3V0VA 1CBVH 3BZFB 4Z95H 4I1PA 1D5ZA 2PCPA 1AS8A 3QWRA 1L5GB 2P4AB 1TJMA 4M3JA 1KPVB 4HJSA 4NQTA 4OB5L 5JIMA 1NICA 2QGEA 3AWGA 3KHOA 4U1NB 1ACYL 1SN2A 4P5KA 1P1ZA 1UXSA 2PYED 3M8OH 2W81C 1D5MA 1FC1A 5ERWB 3QZNA 2F7OA 1E5BA 3GT6A 4LSTH 4PG2A 2CDGB 1B4RA 1MW1A 1HL9A 1K2DA 3HS9A 1N0LB 1KTKE 4M43L 2Y24A 4XWOC 2W07A 1A14H 5ABAA 3RIKA 4F7TB 1G0XA 2JKNA 4TULL 2YKLL 2ICEA 2IMNA 5DURD 3MRQB 3ECBB 4BQBA 3QJHA 5LXVA 1CD1A 3QO0A 4P4KD 5GS2D 3LZNA 4QOKA 5J7CC 4NKIH 3KXFD 1W0VA 2F58L 4DKAA 4HC1A 4KK9C 4XP9H 5FKAA 5AW4B 5J06A 2E74C 4TL4A 3HRZA 3CQPA 1UEMA 4MCMA 4A2LA 3MAWA 4PGCA 1OSPH 1JHLH 4R90L 4ZW3A 5EIVA 3GSOA 5AL8A 4YFLI 3WN5C 1E3FA 1BFOB 1SJMA 2C3GA 2DWSA 3LZFH 2I85A 3CZEA 1ECYA 2X2JA 1JNHB 2XWDA 1OCZB 2ZCHH 3TN0C 2VDOL 2C34A 3H53A 4PJGF 5IW6A 5JXED 1YQVL 4PAZA 5FHAL 4QJ5B 4MJHA 1YCSA 1OTUC 3V79C 1NTDA 4FFVC 4X6CE 3BKJL 3CZGA 3IDIA 1DJXA 2ORBL 3DBXB 1TQVA 4TQPA 3BT2H 3L4WA 4DGIH 3LHPH 3T2NH 3LN5A 5HPMA 4ABQA 4R7VA 1IE4A 1N2RA 4CU7A 3RZCD 1P6AB 2FL5B 3HC3L 3N50A 4EI5D 2EXSA 4ONFL 3WNMA 1N12A 3DUSB 3E9TA 4NO0D 2AI0L 4PR5B 2QFRA 4UTCA 5KSAC 3VW3L 4XN7A 4GAAA 3MNMA 2FNBA 1R3LA 1IM9B 4X4YA 2LLGA 5ENWB 5ICZB 3U4BL 3O4LA 4CW1A 4ONGH 2AEOA 3VCLB 2WW8A 1HKLL 1X5AA 1SDAB 2Q8AH 3NCJH 3MLZH 2C4FU 2YWYA 1TFPA 3PP4L 5CJ8A 2V5MA 3ZTEA 2Q6WA 1MJ7L 1XGPB 3B2XA 4NBYB 3ZQ9A 1AXIB 3JT0A 2VDPH 5E5MB 1VRSA 4DEPB 4IU2A 4AYSA 1Q8MA 1I8LC 1VSCA 5GISL 5C09B 2X6CA 2A4CA 5CJ5A 3APNA 5DA0B 1HH6A 1U8HA 1MFEH 4DK3A 1KV7A 3AG3B 1KJMA 2GY5A 1KXVA 1FCCA 2RB8A 2UV3A 2Z93B 4UV7L 4N8VA 1O7VA 2CSPA 3IGUA 2ED8A 4IK7A 5I1AB 4IBZA 1BEYH 2FECI 4Y19E 4Y1AB 1OD9A 2XRAH 1KJ2H 4Z7NF 1KFAL 2OW7A 2VSCA 4UQIM 8CGTA 3MKGA 4I2XE 4MAYB 4NRYB 3TPUB 3L54A 4KK8C 4PJAB 2ERJB 3LKSA 1HYSC 5IMOA 5AOZA 3US1A 1BM3L 3A3YB 4KHTH 3ZIMA 3Q1EA 2IPKA 4KKPA 2FJSA 3K71A 4Y4HC 3F12B 1XXDC 3TBWA 1BLNB 1R19A 3UYRH 3L3HA 4O5LL 1HILA 1ZJAA 4JFPA 1UTDA 3V4PH 1KCSL 3T0BA 3VXOB 5C0IB 1DR9A 4GW5A 5EULV 3VUAA 4FJZA 3CVIH 3FQWB 3U6RA 4F7CB 1PL3A 3MBEA 5LNGA 3QNZA 4N9OB 4XNYL 3UTOA 3CD4A 4HK0A 4WI2A 3BDXA 4NRXB 3O2DL 4JKKA 5C0CE 4CC4A 2ICWB 3NP3A 4C56D 3MI6A 4YIQA 3KGSA 3QRFM 5I76B 2JJUA 3C08L 4KRPB 3HPJB 1BWWA 2P5WB 5HHNB 4IBWA 2I5YH 4KO9A 1AVAA 1NCJA 4UU9A 2WZPD 3HI1A 1KN4L 1A3RH 2R1XA 3FO2A 1VGKB 4JLRB 5EU5A 2G4GA 2O5YL 3DVFA 4OW6A 5CILH 3RL1A 4GSXA 4HHAA 3C5SB 5KAQF 1F42A 4NLAA 2D03L 3DECA 3PFQA 2HVBA 2K9FB 5BQDA 3GMLB 4N8UA 4Y4FA 4XNZC 1KBPA 4OFQA 3OKKA 1PW3A 2H3NA 3UAJA 5E9DA 1WWWX 2X88A 3EYSL 3KPPB 4Z3IA 1ET5A 4P2OC 5BW7C 1QOKA 4RESB 3HE7C 2APXA 1FL5B 2GSGA 4G8IA 1JDDA 4Z78B 1ZMYA 3DJ9A 3BDYH 4RCAA 1FA4A 1AZUA 1IM9D 4YUEH 3N91A 1AKPA 4P3CH 2D7OA 1V7MH 3JWDL 3BIKB 3NGBB 2FH8A 5IB3A 2EDBA 4R97C 2QHRL 3E6HB 5HDRA 1ZANL 4A63A 5ISZE 4JFOA 3ECVA 5DUBA 4XNQA 3ARGB 3HZYB 2BIMA 5I8EB 4E41A 5DC0A 2OXHB 3CFJA 5EBMB 3O6FB 3MRLB 3H2WA 1GOGA 4QHUA 3T3ME 1WP6A 4RBPK 1LM8V 1JPGB 1T04B 4ETQB 3CFTA 4KK5D 3G5WA 1I9RL 1BW8A 3H3KA 4HF5L 1XHHA 5DJCA 4OGYL 3UPRA 1KCUH 5F7HA 1Z9OA 4JFXB 3FUJA 5FYKD 4E9SA 4BINA 4TPRH 3DMMB 4KQ4L 2D9CA 4OI9A 3WFHA 4MAYD 4UT9L 2FATL 3KPMA 1QSEE 2E27H 3ZDXB 2W5PA 2EEAA 4HCIA 1NAML 2IEPA 1Y18B 1QFHA 1B0IA 2L7JA 2Y07L 4JFSA 2SEBA 1LE9B 4ZUWB 4ODVL 2O6FA 2HLAB 1AZCA 1RIUL 3LRLA 3BGMB 4LSPH 3DK2A 2O6EA 4HA1A 3PXHA 1DVTA 3WFDH 1P84J 1J0KA 1I1YA 2BOBB 1UB6A 4KJQC 1YEEL 3FQTB 3HZVA 3I6SA 3HW7A 1DVFC 3HHSA 1IC0A 4PMFA 3U4EB 4LL4A 5IB2A 1FV1A 4XXWC 1AG0A 1AGEB 5CUSH 2P80D 3FMGL 2VUKA 4L1BA 4JRXA 3WIHA 1PGRB 4F58L 4PRIA 3O6LH 3KLHC 4XR8C 3KR3L 3WENA 3M6DA 1TSHA 1KTDB 3L5XL 5EUOB 3DWTA 4MDIA 3PWUB 3MOBL 2AQQA 4XVUC 2FRGP 3OB0H 4HIJA 2NRDA 3L4CA 2P5WD 4I9WD 2APVA 2B3IA 2E46A 2YLHA 4MNQA 4I18B 3F7YA 2BC4B 1PZSA 3U46B 2G75A 3L1OL 1MKFA 2WIIA 3PIQA 4GEJA 4MJ5B 3C60A 5IQOA 2JCWA 4G8EB 5C2BH 1ILSA 3NA9H 3S36X 5I16B 4HV8A 2DQCL 4OKVA 5H8DA 2L8AA 3KYOA 1XGZA 4IJTA 2CK0H 2WZ0A 2BH0A 2G5RA 5MHSE 1I4FA 1XSJA 2H9GA 1EXHA 5IB4B 3TEWA 1RJYB 4W6WB 1R0AL 2CMRL 1VADB 4X8XA 4X6FA 1F90L 1X5MA 3AUVA 1T20B 4Q8BA 1ODUA 1Z0MA 2L7EA 1V7NH 3TS8A 4AIXA 4KHXH 3CC5B 4HISA 4KWUA 3BAYA 3BH9A 5DRZB 4WJ5B 1XR8B 3JQOB 3MHZA 4G1EB 1KIPA 4O58H 5JQHC 2X6VA 2NQ3A 3ARGD 4ZOBA 2LFGA 5HJ3A 1J5CA 3CTTA 4KAQH 3D4YA 1HAUA 2YC1A 2IANB 2AANA 3O6FD 4JCLA 2C3VB 4PJDB 4XMKL 3WFBL 3QFJE 2G9KA 3GI9H 1PIFA 3WS6A 1UZ6E 1T03L 5EZOL 3UABA 4POZD 1CPUA 2ZUWA 1N67A 1Q0XL 2NXZB 2OTPA 1NCIA 3EOTH 3PNRB 1D5BB 5AZ2L 3BC9A 1E2ZA 3DMMD 3V5KB 1RK0B 2KDGA 1DQVA 3R06A 5LBGA 4AEIL 1RMFL 3P2TA 4MJ6B 4DCQB 3FB6A 5ALCL 4PGDA 1MFNA 2R2HA 2IAMA 4JO3L 4LLUB 2FYYB 4GKSA 4FQXB 3TZVB 1RUQH 1T89C 5FO8B 3WXWL 4LCUB 4HUVB 3GHEL 4K5NA 3UAFA 4Z7QB 1O5DT 1TMQA 1T6VN 2EE2A 3QSKB 5GIRA 4R8WL 2OMYA 4Z7OF 2ICWJ 3QG6A 4BZ1H 4POUB 1KC5L 1X9QA 1HHJB 4V2BA 1QLRA 1XB6A 4Y9FA 2DQTL 2VXTH 1RY7B 1Z3RA 4J3UA 3PWPB 1OT4A 2HPOA 4XAWH 1MW2A 4ZPVB 5EEWA 3O2DA 3N55A 2Y72A 1D5IH 4XC3H 4GAGL 4WEBH 1FSKC 1KYAA 4OCYL 3NZ8A 4X7SH 2XTJB 5EEZA 4LCCC 3ARDB 1A7PH 3CK0H 5F89A 4BUGA 5J8OA 2PO6B 5IW1B 3T4AA 4P46A 4LDCA 1Q1PA 3AMKA 4AZ8B 5FXCH 1IIIA 3OLIA 2W65A 2J5LC 5AOIA 5JLZA 3ORJA 3WNKA 3T3PE 4S2SA 1BF5A 1E9PA 1NLDH 2BM3A 1NDTA 1CMOA 4DQAA 3IWVA 2COVD 5D70H 2CG9X 3C6SA 4UIKL 4TUOB 2YZ1A 1E9QA 1PAMA 1R6VA 3N1PC 2WN3A 2CRIA 1A2YA 4EO5A 4JG1H 2CWRA 4L3ED 1MHEB 2GITB 4P2AA 1TZHB 3TBYB 2DQEL 5EO9A 4IIQB 1JGLH 1BVKA 2DYSB 4FQ1L 1CGUA 2NX5E 2KS0A 1OANA 3DBSA 4PGBA 4QRPA 5PAZA 4XWGL 1QR1B 1CGSL 1DEEB 4C59B 4YHZH 4X6EA 5I71B 1C5BL 2VWEE 1GAFH 3PWLA 3MLTA 2X0VA 4NQDA 1PJ9A 2BHYA 3X3GL 1ZLVH 4XCYA 2CR0A 4MQ7A 4YBQC 4IBQA 2BRQA 3IXTA 3BZDA 3P4OB 2IAND 2X2YA 4O2FA 5MEQA 2L7QA 2BNQA 3NDZE 5L6YH 1E3ZA 2C9UA 3BD5A 1NCBL 5I6PA 2J5WA 1R34A 1CFSB 1COBA 2A2QT 4ZMQA 4HPOH 1U2HA 1KIRA 5BRQA 3DJRA 1HINH 4ABWA 3WDJA 3DYMA 3LS5L 4IRSA 1CC3A 2Z4QB 2VT0A 1JWUA 3IDJA 4PS3A 2ZKWA 1JPSH 4UT9A 3REWA 1NAMA 3DV6B 4JDVB 1YUHB 3LKQA 1PAZA 2WMPA 4DTGH 2VDLH 3KPQA 5B39A 5KBLA 2EUVA 4BFJA 2DZEA 1EQWA 3ZKQD 3BQUB 1BZ9A 2EADA 4DN3H 2BVQB 4D3CH 1UJ3B 3O9WC 5E2VH 1HE7A 1EZVX 5TDOA 7CGTA 2A83B 3TZVD 4WFEE 1ASOA 4WFHE 4BK5C 4G71B 4WO4C 1N26A 2HVKA 2YOCA 2UY6A 4JREB 3P11H 3UCRA 4AVJA 1EDYA 4H8WH 2MKWA 3ZKSD 5FPIA 2DQUL 3ZHLA 4ABVA 1NLBL 3LCYA 4CILA 4TLKA 3MXVL 3QUXA 3PWPD 3B43A 1UXWA 3L3IB 3HE6B 4OUOA 3MRRB 3MYJB 3LVTA 3TX4A 4W68A 4WKXA 3MV01 1A9EA 2YFNA 2R4RH 5CR8A 3NFNA 3ARDD 4Q6IB 4AQ1B 2XETA 5CWSA 4M8QA 2PO6D 4HPYL 5CZRA 5KN5B 3U4AA 2F8VA 4IBTA 1JGVL 3OPZL 3TEUA 4MWFB 4CKQA 4JFQA 2WY3B 4OZGE 5CSZA 1R3IL 5CZXC 5E99L 4L4TD 2ZD0A 5KUKA 3OKEA 3HS0B 2J88L 4NSKA 4OD3H 1HSAA 3OF6D 3GXPA 4AEHH 5BS0E 2Z8VC 4PJHA 5A2AA 2Q9OA 1IVTA 5JW4N 1C7TA 2W8CA 4B5ZA 1R3HB 4LEEA 1IT9L 2ALWA 4WI0A 3GTVA 4GT7A 1A6AB 4RWYH 3QFDA 4BH8B 2J4WH 1FE8L 1T0PB 4M6NL 3L4UA 5ACLA 2YD3A 2B5IB 2XIBA 1XH2A 1CDYA 4H8PA 4E2OA 2FH6A 1P7KA 3OKLA 5IOPA 4OTXL 4RISH 4PP2A 1XGYL 4OD1H 1S8DA 3GMQB 3G5YB 4H1LG 1BJ1H 2WK2A 3OJDA 3UG4A 5HXMA 2NNAA 2OKMA 3ESOA 3UZQB 5A2JH 1IKNA 4WUUA 3CFNA 2Y6TE 4N2EA 1FO0B 5E94B 1SPDA 3MLXH 4AYFA 2DI9A 2AJVH 4V2CB 2R69L 3MV7E 3C09B 3MLSL 3B5GA 4ZFGH 8FABA 4V11A 3F65A 3PAYA 3N85H 2D7NA 4RFOL 4O02L 1SXNA 3FRPA 1EHKB 1HZLA 1CQKA 4M6OH 5LCVH 1H5BB 3FSWA 4DT2A 2P5EB 4G6FB 3Q5OA 2L04A 3GM0A 1JPTL 1A6TA 3FNKA 5BCAA 4G8FA 1FNSH 4YBHA 2XV2A 1NBVL 4Y4KA 1G1OA 4HUNB 4HXAH 1E43A 4IU3B 4LLDA 4JHZA 3AVEA 2DWEB 3PG2A 4LDEB 5T1LA 3BPCB 4HLJA 4TL5A 3VFPB 4J39A 3QHFH 3BQUD 3L7EA 1VFMA 2AXFA 4H5SA 1CL7H 1A6PA 4R0LB 3AGWA 1FL6A 2A7BA 2A9ML 4JG9A 5BQ7A 3QCTH 4ZW5A 3FCUB 2J6EA 1WICA 1S2EA 1X9LA 2JJSA 4YHLL 2OTWB 5D7LD 2QZQA 3LDBB 1RZFL 4WW1A 1IM3A 1QWHA 4ANWA 5ACZB 4GKZA 5DZOA 1L3WA 3HG1E 1QNIA 5FHBH 3LEYH 2OR8A 5CFHA 1EJFA 3HE6D 5KOMC 4CA4A 5HGAB 1Q9OA 3B2DC 3NIDF 2G30A 1AGFA 2C26A 3T2LA 3WY3A 4AUUA 3DURA 3VH8G 2IBZY 2CCWA 3L5IA 4WNQA 5B7FA 1M7DA 3VRIB 5AOLA 1CFVH 1PLGL 1UB5B 2BSCA 4RZCB 1U8MA 3O8XC 3SIKA 3VRJB 5D1XB 4G6JH 1G7PB 2CHDA 1UM4H 3DX3A 5D1QE 5F8QC 1W15A 4X5WB 3HMWL 4NLHA 3IK2A 4PREA 5E2TH 5AYUH 5ILTH 3WY2A 5FKPA 4MNGB 4FQ2H 3QXAB 4QRUA 5GSRA 4P48A 5I75B 3KEHA 5C08B 1ROWA 2JJTA 1G9HA 2YN3A 4XE5B 2X41A 5TK4A 3LNDA 4J3BA 1DQDH 5DEFB 5FECA 4ENEC 2FR4A 5GZND 4G9DB 3FCTA 3EG9B 4DUWA 4G1MA 5J11C 2AABH 3P30H 1LE5B 1P7QA 2XICA 4MZIA 4LEXH 5E2WL 4PJFB 3MKKA 1JGUH 5E95B 2XVGA 2CZNA 5CLZA 2XG5B 5KVDE 4NWUH 4GIAA 3BZEB 1TPXC 5HGBB 3BLPX 3RGVC 2BNUB 3G9VA 3S34L 1JYXA 1ZLDA 1MHCB 1IC7H 4FNLH 1AR2A 1HQRB 2BOCB 1CGTA