5JYMA

Human p-cadherin ec12 with scfv tsp11 bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
b'DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Disruption of cell adhesion by an antibody targeting the cell-adhesive intermediate (X-dimer) of human P-cadherin
pubmed doi rcsb
total genus 51
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5jymA01
4NUMA 1L3WA 4AQEB 3UBGA 2EE0A 2OMVB 1SUHA 1WUZA 2O72A 3LNHA 3QRBA 2QVIA 4AQEA 4AQ8C 3Q2LA 4ZMVA 3K5SA 3UBHA 2WBXA 4AXWB 3LNDA 2V37A 3K6IA 3FF8A 1NCIA 3Q2NA 2QVFB 3PPEA 3FF7A 4NQQA 4AQ8A 2WCPA 4QD2E 3LNFA 2YSTA 3Q2WA 4ZMXA 4NUPA 2OMTB 2A4EA 4AQAB 2OMWB 4ZI8A 3LNGA 5JYLA 2A4CA 4OY9A 5CZRA 3UBFA 2OMXB 4AXWA 3MVSA 5KJ4A 2WD0A 2OMZB 4NUQA 1NCGA 4ZMLA 1OP4A 5CO1A 3K6DA 1ZXKA 4AQAA 2YQGA 4ZMWA 3K5RA 3K6FA 4ZMQA 1NCHA 1NCJA 3LNEA 2OMYB 4APXB 5JYMA 4ZMYA 4ZT1A 2X2UA 4APXA 1O6SB 2WHVA 4ZMZA 4AK1A 1ZVNA 4ZMNA 4ZMOA 4ZMPA 1FF5A 4XXWA 4XXWC 3LNIA 3Q2VA 1EDHA 4ZTEA 1WYJA 2OMUB 1Q1PA 5DZVA 4ZMTA
chains in the Genus database with same CATH superfamily
1I1AC 5AG8A 5CD5C 4XC1H 1OE1A 1DJZA 5JPNB 3W11D 4E36A 1IM9A 4P2QE 1EBAA 3O6ML 1BP3B 1AO7E 4HZAA 4TSCH 5IQ7H 2H0PA 2NNFA 3UJTH 4RAHA 2EINB 2V5SA 3TO2A 4D9LL 4Y4KA 2A9NH 2NY4C 1XB8A 2WKLA 4IRSC 3SCMA 3WHE0 4CC1A 2R0WH 1KTLA 3GTTA 5ABAA 1JL8A 1UVQA 3Q2LA 1SJHA 2CMRL 3CH1A 4OLWH 5L8KB 2A0LC 2MCPH 3J7HA 2V5TA 4HUWB 1KELL 5JHLH 1HH9B 3QPKA 4WK4B 4ZTPL 4IBVA 2XSKA 4GP5B 3SBPA 5IKCA 1A3QA 4LMQI 1IUZA 1L9SA 1S7VA 1UXWB 1OT4A 3A21A 3DVFA 3J27A 3AGWA 3LIUA 2IFFH 3P2TA 4R8WH 1I1CA 1FGNL 2EZ0C 3CSYA 2IAMA 3L1FA 4MAUH 1GYAA 5A40E 1E5AA 4NBYB 5DHVA 3RNQA 3L9RB 3DRTB 3LS4L 5CIPB 5KSBE 5C0GB 1BG9A 1FL5B 4Y2LA 3WNJA 3ZTJH 1N59B 2IDQA 2XG4B 2F8IA 5D7SL 4ZUWA 2G5UA 3HB3B 3V7MA 3B9KD 2AVGA 3FUJA 4XP9L 4ELMB 1IE5A 1T1WB 4MLIA 1AC6A 4Y5VC 8CGTA 2W9LA 4P2RB 4Y5XA 1P1VA 2V5YA 1R3KB 2IIJA 2X7LB 4PRBA 4X6FB 5FCUL 5D2NA 1F11A 5HI4C 3W56A 1UXSA 1K85A 3BWZA 1D2OA 3HC3L 3MGOB 3SPVA 3QIBA 2ESVE 2K7QA 3Q0HA 4BQ9A 4PY7B 4NYLB 2PWEA 4AXWA 5J8OA 1KC5L 4WO0A 3DLQR 1FFOA 1Z3RA 2NXZD 4F7PA 1YO4A 4YNYA 3K8LA 3O45A 3VDBA 5IBUB 1GHFL 1FO0H 5K9JH 1BGXL 1NIFA 5KYXB 3GXIA 3VSQA 1QQDB 4LLQA 4FJYA 4N0CC 1LE5B 1ZHLA 3FU8A 3X3FH 1T21B 3E6FA 4HIIB 1NC2B 2BLFA 4ZT1A 5FYJU 2WHVA 3F7LA 4AJVA 3CVIL 15C8L 1AR1B 1NMBL 2CJUH 4Y16D 5GISH 4FEMA 2VR9A 3U36A 3LPOA 5DFVC 2F18A 1WAEA 3F3HA 3JBG7 1A6WH 5I66A 5E1AA 4OD1L 2DDQL 4MHHG 4BXSV 1WHOA 3VM5A 2E7LC 2ZAIA 3VFTB 4ZK8A 3T0EB 2GSIA 3OPZH 3QQNA 3QXAA 3HVDA 1YDPB 2EYSA 3MV9B 5GS0L 2VLKE 3RTQC 4MMXC 1CGSH 4M1CD 5I17A 2FD6L 3DV4A 4Y2NA 2E4FA 4IJTA 4RZKA 1GC1C 4PG9B 2IH8A 1OLLA 4AQ1C 3JVGC 1M1SA 4GOSA 4JO1H 1SUHA 2ZXQA 2LABA 2Z93B 1ADQH 2DI9A 3L95A 1QUPA 3D87B 1TKWA 3WKMH 3TV8A 1QNIA 1CK0H 3MROA 4YXLL 3QPXL 3FN9A 4I2XB 4NWUL 5DZOA 2ZP9A 4LLWB 5CBEB 4W9GC 4AMWA 4AQ8C 4N2AA 1U21A 3ARZA 4KX8A 5D7JD 1ZLUK 4EUPG 1DBBL 4KJQC 4FQXD 3IXTB 3CFUA 4PWGA 2OMBA 3T5WA 2ZKYA 3QWOA 1E6OH 1X9QA 1QUNB 4XMLH 4NAJA 2HTKD 1U93B 3QISA 4UV7H 2V37A 2QPEB 3L3KA 3CVHA 1RUML 5IB4B 4HKZA 5I5RA 1NWPA 2ADIA 2ZKHH 3GMLA 1A21A 1NCBH 5EG6C 1N4XL 3OB0K 4C4KT 5JDSB 5TQ0H 2YZ8A 5I8EA 1E8YA 1U8IB 4O2FB 5C8JB 2ZNXA 4Q58C 5HHQA 4EZKA 5A2KH 1HH9A 2MCMA 1SJVA 5E8EA 4XVJL 5CGMA 3TCXA 4OUOA 1CBVH 1HEHC 2F5BH 3S36X 4Y19D 1HL4A 2B4CC 3ESPA 3HC0A 1AACA 2UYLB 3JZ7A 2QHLA 1YSOA 4PGCA 5TH2A 2QVTA 1GOGA 1PYWB 4KAQH 2YAHA 3WXWL 2GI0A 3V0GA 3IMBA 1EXGA 4C56E 5E94B 2NY1B 2XY1A 4HJUA 4FI6A 4QO1A 1U3HC 1YPZE 3EYFA 4G8GD 2QZ5A 4RDQG 1VA9A 2P5EE 4K9EL 1SOKA 3QFDB 4O58H 1P4LA 5JPMA 2Q76A 4M8UA 3CE1A 3LV3B 4AEEA 4NN6B 1EMTH 2FL5A 3IMUA 4UNIA 2XTJC 3TPKA 4N8PA 3HG2A 1AGFA 3P9LB 5E4IA 1UT1A 3VJ6A 2DEYX 5KS9A 1ZTMA 1RK7A 2WQWA 1ETA1 5EUOB 1ZTXE 4OV5B 5DJDA 3NJGA 1YEHH 3QNXA 2WWKO 3OG4B 3RWGA 5T1DL 5I8KL 4MD0A 1H9VA 1G5AA 2VISB 1XAUA 1Z3GH 1P6AB 2IH1B 1AS8A 2BOLA 5TGBB 5J1AA 3T2QA 4Z7VE 3NTCH 1I1RA 1GRWA 4M03A 4AIXA 3AZUA 6FABH 1EGJA 2JJSA 4TNFA 4XCYA 4Y19A 1GYWA 4UU9B 2ZP0T 3FOLA 1XR9A 3IDJB 5HI3D 1HEJC 1PSKH 3DK0A 2V2XB 1G5GA 1AI1H 1QFOA 4GAJH 1YMMA 3HE6B 5ESQA 3WDJA 1IT9H 1G7PA 1O6SA 5J4MA 5LG6A 2OYPA 3K71B 2ZUWA 4G6FD 3SDAA 2X4UA 2EUZA 4V1DB 3CXHK 1K72A 1NBCA 3LNHA 4DVRL 5BUPA 1EERB 2ICCA 3MSPA 4NNXB 2NTSP 1IBZA 3CC5A 3L4TA 1AG6A 2J5LB 3OC8A 4HFWB 4FQ1H 1FUNA 1UM5L 2Z3FA 1EAQA 3QJFA 3ZDXE 5CILL 5JHBA 5IJDC 4HG4K 1I1FA 5IY5B 4ONGL 3VFPB 3FB7B 1T04A 3GZOA 5B1JA 3W9DB 3MUZ1 2DQFA 2QELA 2C26A 3NP4A 1GMEA 3FRUA 3KDMA 3NT0A 1X6LA 4WJKB 3ZZQA 4DO4A 4X8CA 2G9HA 4XI5C 3ZHNA 5GGTL 4ONGH 1ZHNB 5TDNA 3INUL 5F3BB 2E27L 1COBA 3KMDA 3VI4B 5CMAA 3QHZL 3VRLF 1HNFA 4KZ0A 3DDFA 5GSVA 3HAEA 1J0ZA 1JV2B 2D3JA 4DW2H 3A6CH 2B39A 4OD1H 4OCXH 1NBZA 3L4CA 5INCB 3OV6A 1SQMA 2HVJA 2SEBA 4Y9BA 3S37L 1HHHA 1FDLL 3DGGA 1NANH 2IDUA 4E0RB 4M7LL 4LARH 3M8OL 3TURA 3AY4A 4JDZA 4QKTA 4BQCA 4D7PA 5D1XB 4GKNB 4IOIA 2WAHA 2ZSVB 3HMXA 4JY6B 4HEMA 1TT6A 3EH5B 4JJ5A 1D5ZB 1AFVL 5I74C 4A2MA 2YPKB 1NCJA 1M7DA 1CL7I 2YMXH 3CSGA 4LSRL 2YD2A 4S10A 2H32B 1PQZA 1Q0XL 2FQEA 2VXQA 2Z35A 4KKRA 3HC0B 3K72B 2I5YH 1YNLL 3N44F 3KPLB 1ZV5A 3UGXA 3BQUA 3NJVA 2OMTA 3UOAB 3V6ZB 1T5XB 4HC1H 3WJJC 2H47C 2ZOUA 4BWTA 2GTWB 1PFOA 2AQ3A 1DL7L 1EIBA 5TF1H 1IBBA 1WYJA 1UD4A 4M1DL 4DETA 1X4XA 5AYUH 3NSFA 1NAMH 3SKNA 2DH3A 3WLBB 1NFKA 2Z0UA 1QOKA 2QR0B 4JR9H 3VD3A 4L0YA 4MB4A 4FERA 1I4FA 2WTOA 2XNAB 5GJSL 3S4SG 4U1SA 1OF0A 3VSTA 1NFAA 1BF8A 4YXKH 1LK3H 4UB0H 3JV6B 4L0PB 4YHPA 1HXMB 2VXQH 2C1OB 2OCFD 1HC1A 3V6OE 4PLOB 3FOMB 1P4BH 2E6JA 1OAYH 1FL6B 1NJ9A 1N8ZB 4Z7AA 4H8VA 1ZGLM 2GITA 2GT9A 5CNHA 3QE5A 3B4NA 3HC3H 2D73A 3AXLA 1EH9A 3IXAB 2E6QA 2Y7QB 4PJ5D 1HJCA 4KITB 4KFZC 3CFBA 4XP4H 2QPSA 4TVPE 3TZVC 3IGFA 5I1JH 3HS9A 1OHQA 4ZRGA 3LY6A 1INQA 2BNQB 2DLFH 4NM4L 1WC7B 4X99A 1L0YA 1NGQL 2AVFA 1BF5A 3HHMA 2F19L 3GMNB 4LSSH 3EGDA 2VAAA 1NPJA 3UTTB 1UC6A 1MCLA 1Z9SA 5EEYA 2RGSA 1DN0B 4GSXA 3IPFA 2VXVH 3HB3C 3WN5B 3DOSA 3RWDB 1SLXA 3D48R 2R69L 3BDYL 2B14A 3SJVD 3PV6B 4KJQD 3SDXF 5L0QB 3FN0L 5JIHA 1B2WH 3CDZB 5HHPB 5EEUA 4PJ7A 1G84A 4WO4D 5KUKA 4NI3A 4EQ3A 3EKCA 4M7JL 4KHTL 4LSQH 1FNSH 1D5XA 2QHRL 3MLWL 4JHAH 4XRCA 5D2LA 3FRUB 4AY0A 3UTQA 1S4IA 1SN5A 2R27A 3MLYL 2V4LA 2O5XH 2DMCA 2BIIA 3HS8A 1NGWA 5AWNL 4JY5H 2AI0H 4U1KA 5EO9B 4MXVF 1FFQA 3FB5B 3AG1B 5DEZA 2BVEA 4DEWA 2NY4B 4IRSB 2FUQA 2J12B 3IN2A 4MAUL 3HAEB 2DIEA 1K4CB 2F15A 3GSVB 2NY7H 2IALA 4ZPTA 3SKMB 4JG1H 2Y36L 4EDXB 3EDFA 2JJUA 2JCCF 3L1EA 1W15A 1ACCA 4FFTA 1PSKL 4MRCA 4QHKJ 4K3HA 1IGML 1P4IL 2N56A 1A4CA 1TLKA 3OMZA 1RUKL 3MV01 3UTSB 5F6HJ 5IMMB 3ZZ1A 2J8UB 1S3KH 1T21A 3E6FB 4HIIA 3LB6D 1ZPLA 3PJLA 3WTXA 2FQFA 2VJ0A 5KN5B 3EUDA 4IRZL 4QAWA 4OCLC 1ILSA 4N2IA 1UWFA 3SE3A 5IFJA 1JN6B 1AS7A 4OBSA 2BW5A 3U2SA 2HA1A 3E1F1 3P9MA 1LO4L 4JB9L 1WHPA 5AVTB 1EQWA 3B9DA 1WZAA 3O0RL 1WS8A 5E1AB 3U9UA 3AADB 1JIBA 4XXDA 3WBDA 1ZANH 5F7FA 4B50A 2VRKA 2DLGA 5HYFA 5DEGA 2CPCA 4YDMA 4OBRA 4PY8I 4GQRA 1J9RA 2FYYB 4WW2B 5ITFB 5IB2A 4HJ0D 3FQNB 1ETB1 3TWCL 4QNPE 3DX0A 2CCWA 1WS7A 2NOYA 4QRPB 4CRPA 3BAEL 3KD4A 4ELKB 4XWOC 4LEBA 2X4OA 1L4IA 3NN8A 3RWEA 5DCCA 5HHOE 2FX8H 4C8XA 1DE4B 4LF3B 4XMPL 1CDBA 3NK3A 3UFIA 1EZUA 2R56L 1RZJL 2APSA 1Q72H 3E80A 4P3CH 1GS6X 4B96A 2KLTA 3VVWA 5EORL 5KVGL 2X9ZA 1AXTH 4M6ML 4BIKA 1CF1A 4H25A 4U1LA 2BVOA 5DUMH 4XN9A 1SJEA 2J44A 1MZZA 3QJVB 4IHBA 3QFJD 3CN3A 4WGVB 5E8PB 3WNMA 3ZKNC 2ICWA 5E00B 5CXPA 4WKZA 4NCC1 4HLJA 2ITDB 2RMNA 3FRPA 1TTGA 5D1XE 4NXKA 4GG6F 1DEEA 4RAVB 1DJGA 4PTUA 4XMVA 4BV1A 1UXWA 1S7WA 1KENL 1KJMA 5FO8B 3KJ6L 5E5MA 3QIWB 5AG9A 4FJ6A 1G94A 5DEFA 3NJKA 2P24B 2NZIA 3ZDXF 1KC5H 5A2BA 1S7XA 2Y7SA 2ED9A 2OS7A 1MRFL 1H5BA 3T8VA 3CDZA 4XAWH 3SDCC 4LHUD 3ZKMD 3Q43A 1GMIA 2IADA 2LV4A 1OCWH 3FTYA 1EXUB 4AL8H 2B9AA 3GEFA 1TZOA 2Y1ZA 1G9ML 1O7DC 4KO9A 4IEFA 2E59A 4MNGA 5L4FA 4M8RA 1I31A 5KTEL 3EYQD 3NUKA 5KZCB 4AM0B 3GBDA 1YEDA 3PDGA 5C0CD 4RAUA 2W9EL 1CI3M 3VXSD 5D9SB 2NSMA 4DIXA 5KVDE 4BQ6A 5A3ID 2HG0A 3ZU8A 5CWSA 5C86A 4HUKB 1AE6L 3GRWH 1I9EA 1X7TA 1KNOA 5HPMB 1F8TL 2WCGA 2BSSA 4GI8A 3VFGL 3LEVL 1V3MA 3DECA 1J8HA 1TSHA 2ZOKB 3BZFB 2PO6C 2VISA 4UMGA 5IOPB 1YNTA 5M7QA 2MOGA 4XB7A 4OZIA 1A4AA 3OAUH 3QQ3B 3Q5YA 3UTSE 1IBGL 5E9DB 3WUZA 5K39B 4C55A 5IHHA 1XVSA 2PYED 32C2B 1KWKA 2YWZA 5JMOC 1D7CA 1CD9B 2QVMA 4I18B 4YEFA 5LBSH 2Z65C 3CFCL 5E5UB 3SKOA 3ZIMA 4S0TD 2DWEA 3P73B 1RU9L 2CK0H 3QEQE 3Q3GA 2NCEA 4ATTA 1RSYA 3ARDA 2O4EA 4RA3A 3EOTL 3VWKD 2DZEA 4DFHA 4OCMC 3B9KB 1O6TA 1XH0A 3VDAA 1A7RH 2OTUA 4PRID 1Y6NR 2DQCH 2NYYC 2VQTA 2UZYA 2PMZA 2FT8A 2ZXAA 3TJEL 1UH3A 5DEGB 2Z1PA 5DRNA 3IFNL 3S35H 3FTGB 3GSXB 4G8IB 4PG9A 4CVZA 2LHAA 1JK8B 4Z95L 5JOPD 1RMFH 1T89C 1CVRA 4UTAL 1TJGH 3QYNA 3KS0H 1MNNA 4RFEB 5CJ8A 3SYPA 4KMQA 2VR6A 2BP3A 3FZUD 4PJCB 3FQ1A 3HZKA 4LCCB 4A6YA 1AZNA 4DH2A 2BIMA 1R24B 3BN3B 4P05A 2ERJB 3IT8D 4OCRL 2G9HB 4HIQA 1E8ZA 1DLHB 5KW9H 2YFOA 1USQA 4P46A 1AXIB 4Y5YB 4KPHH 3HBGA 2FLBT 5JHMA 2HRPH 1KT2A 3OGOE 5EN3A 3GT6A 4HIXL 4XVJH 3JYBA 5EF3A 2VKXA 4K7PH 1WZKA 1MCOL 2MKLC 5JIPA 3IM1A 1MDTA 5EIQA 5GJSH 2J4WH 2DQMA 3FO1B 4K5LA 4NSKA 1LD9A 4NRXB 1P6FA 3ZBMA 4MGXA 1T1YB 5DS8B 3D39A 4ZUVA 1KGCD 5E8OB 1BZEA 4L8SC 5E2JA 5IEKA 1RK0B 1TENA 1P2CA 1BMZA 3D3VA 3BI9X 1MCOH 3LCYA 3LRLA 2ITDA 4PRIA 1QPKA 4TSBL 2P49B 5KSBA 5C0BA 2CLRA 2OMVA 4JRYD 1IGFL 5F7NC 3KPTA 3CZFB 2MTAA 4R4BA 3LTVA 4WI6A 1XZWA 3MREB 3H9ZA 4FNSA 1SY6L 4M62H 3ARFD 2VUYA 2X0VA 1IRAY 3RB5A 1JZHA 5I8OH 5LAPA 1DZBA 3O2WL 3PCYA 2VLKA 3DVGB 5D93C 3DA0A 2VXUH 4QRFA 4N0UE 1UUSA 3MBED 1T5XA 4N5EC 4ZS6C 2RJMA 3W81A 4PIRF 3Q8AA 5C70A 2CGRL 4TL4A 1ZE3H 3FMGL 5E9NA 3C60C 2FX9L 3EJZD 3F58H 2I9LB 3BP7B 3GSNH 5LQBH 1A7BA 2F1BA 5BMFL 2DQIH 5HDBB 2Q76B 3VSUA 3ETTA 1O75A 1QKZH 3QAZB 4F27A 2XKNB 3A0OA 4ONHB 4KZEL 2YMTA 5JOFB 1S7UB 5IG7A 2YIHA 3K6NA 2PYFA 1CYXA 3RGVD 1H0DB 4JGJA 1ZCRA 2OSLB 1AIFA 1JMZA 5MEPB 4C4KO 1GTNA 1OCZB 3UPRB 1BFSA 1SM3L 1J1OL 4G43B 4FQIH 5AWNH 4AKPA 3IVKA 2IH1A 4TQ8A 5F3FA 5JW5A 1KCVL 4OT1L 5MERB 5DVLA 4Q9CA 1XGYH 5T1KA 1ET8A 1P7QB 5C0BD 1SBSH 3WTWA 4YR6B 5I19L 2NX5D 3E0GA 1UURA 1SXBA 1ADQL 1RFDL 4RFNB 3TH3T 5F9OL 3CFBB 2COQA 3Q1SL 4ACTA 1MFCH 5KSVB 5FYKL 1CG9B 1MQKH 4FFYA 2O5YH 3QEHA 2YAMA 3GIVB 4NWTH 2H26A 1SYSA 1I8MB 1KN2H 2Y2TA 2DKMA 4MA8H 4U33A 1OP5H 1C5DB 3BAYA 4L1TA 1VSCA 5I6XB 1S7SB 1RZIB 1CXKA 1RIVL 3MLXH 2YRZA 2B20A 5LAXA 4YDKL 5C07B 1DTUA 1WF5A 3FC8A 4O02A 2VN6A 1EVUA 4M5ZH 4DVRH 3CC1A 4J8RA 1PKOA 1CD8A 2ZXBA 3VFPA 1LEKB 5AUMA 5KTEH 5AW9B 1T4KA 2C9PA 4ZUSA 2I27N 3RFZC 1U2YA 1KN4L 3GXTA 1N4XH 5AZEH 3QULB 3EBIA 4ZUWB 2GJ6B 4JKMA 4NFCA 3V4UL 5CFAA 4LARL 4P5MB 2VE6B 5D7KD 2ZOWA 3BIBX 1CICB 5EIIG 5AVZB 1FC1A 3EYSH 4Z7OE 3HR5B 3MA7A 4UWQB 3UTQB 1NLBL 3K91A 2DN7A 1HEZA 3HKZA 4A7GF 2AQ2A 3HPJB 1E4WL 4M43L 5GSRA 4KROD 3BPNC 3L13A 3MV7A 4AJ0A 3SCMB 2Y7NA 2OV0A 2J73A 2JFCA 4WU5A 1MLCB 5E08H 3MV8A 2IBZX 2DQJL 1G7MB 1NCCH 1BLNB 4K23L 5C0AE 1RHFA 1HYSC 4WFED 2QKIB 3ZE0B 4JO2L 3GJFA 35C8H 4RLDA 1DQQB 5J6HB 5K5YA 1LE5A 1QYGH 2EE2A 3Q6GH 2C9VA 5E08L 4AVJA 5GGSA 5IROA 1XCXA 1FNHA 5AFAA 2FEDD 1UT9A 1IBDA 2NY7L 4X5XB 2YXFA 1V3KA 4Y4KD 3TBTB 2XYCA 4GKLA 3S2AA 3PGFH 5HXMA 4OZGA 1I7UA 4TUJB 5INDB 3STZA 3SPHA 3L3DA 5JLZA 4GXVL 4MJ2A 4P4RB 3ZYJA 3UO1H 4NPKA 5ACMA 2B15A 3OKLB 5FCSH 1QSFA 3MGOA 4K2UL 3SPVB 2LW3A 3F2LA 1SY6A 5F93C 3MXWH 1M53A 3ECWA 4N9GA 5JHLA 1BQSA 1G9MH 1N5AA 1EAPB 3MMEB 5G4NA 3V52H 4TN9A 3QXUA 3S0PA 1HS6A 4DPCX 2HT2C 2JKLA 3BSHA 2ZSWA 5IEHA 3VVVA 4U1SB 2OMZA 4Q6IC 4S1SH 4E9TA 1KYAA 1PG7W 1CL7L 5DJXB 4OZHF 3ROLA 1H0DA 4H0HB 1X44A 2ZKXA 1G87A 4HDIA 4F24A 1KBBA 3TA3A 4LPUA 2VDQH 4K3GA 5MENA 2GT9B 4QXVA 2ZX5A 1XMEB 2Y69B 2E7MA 1HKLH 1FI8C 4IYKA 2F08A 4KQ4H 3ULVL 2J20A 3EYOA 1JXDA 1TVDA 5I6KA 1QWNA 5JA8B 1WCBA 4LNRB 4QCIB 4ZO8A 4AIZB 3K1DA 4GLRH 4O2CA 3LKPB 4RMUA 1X5KA 1JHLH 4YIQB 3RWHB 5IW1B 1LO0L 3QR1A 4HOMA 4L0ZA 3US1A 3ZMEA 5CD5D 4PJAA 2YPLA 2GPZA 3H9SA 4J1UA 2OULB 3FUHA 4OSUH 1T2QH 3NCMA 3ROOA 1Z9SB 2V2WA 4UTBA 4K3JH 1NCNA 2IMNA 5KYNA 4KK8C 2Z93A 1G1CA 1MVUB 1YEJL 1FG2B 1I85A 2ZCKH 4KVPA 4NRZA 2PCXA 2QGCA 4MJHA 3TA4D 3MROB 2YKKA 4PGCB 5CBEA 3IMRA 4AZ8B 1CCZA 3RTQD 3WE6A 3JTTB 2C3VA 1TJGL 3PE9A 3KPPB 3T9WA 5C6PB 5TF1L 4XP6H 4QOKE 1CLYL 2Z31B 4G5ZL 4G9FE 5F21B 7FABH 1U93A 4XPTL 2CJ3A 3QORC 5DZVA 3IMVA 4QHUB 5G4OA 3DXAA 3ABZA 3T8XA 4Y16B 1FLRL 4UIKH 2WAQA 2RALA 1E0OB 1MCSA 4HBCH 4P5TB 3SY6A 1A7QL 4RAUB 3AREC 1DQVA 4X4ME 5GS1C 2BWQA 4BEIA 1X9UA 4L1HA 1CFBA 4G5ZH 3H1ZA 4L3EB 5JR1L 3BUBA 2AF2A 3MV8B 3LZFH 2IO5A 5DFTA 4DGIH 4JHVA 4R4FH 1Y07A 1MFUA 3DHPA 4LGRB 1YUHB 3LPWA 3ZE1B 5A16A 3EOBB 3GBML 3TVMC 1TYJA 2G75A 4GMSH 1IGMH 4R0LA 4XTRC 1T1ZB 5KVFH 3P0YH 1F2XK 2XG5A 5CSBA 4PG2A 1U8OB 3IDJA 5B4MD 32C2A 1R3IL 2LAGB 4YDVA 3S4SA 3EO1A 3QUGA 4FTVB 3BVDB 1CYWA 1OAQL 5HGDB 1VFOA 4FNLL 1VADB 4YBQC 1HHKA 3L45A 1T5WB 4FE9A 1RH8A 4BZYA 5B4MC 1BYPA 3QCUH 2W94A 2CJSA 3RVUC 3Q8FA 2WJ5A 4X80L 1U6AH 1Q90A 4HFWA 5BQDA 3NMEA 2UZYB 3GSRB 4NZDA 1GJWA 2DKSA 4S2SA 2A6KB 3NACH 3HNSH 4JKKA 3TBYB 4MQXD 4Y2DD 4XCFH 3X3FL 3D4GA 4K7FA 1KCRL 2GABA 5EUOA 1BQHG 9CGTA 3MRFA 3L6FA 3HBZA 5K33A 4LASH 2J43A 3ARDC 4J12A 1JTTA 2MTPA 3HBPA 3VXQA 5F0LB 2X0WA 2JI2A 1YEHL 3V5KA 2HSIA 3QO0B 4N2BA 4AEIL 4AQAA 3MUGB 3TNNB 4HWBA 1AXSA 2R4RL 5CFHA 3K3QA 1XCWA 4L4TA 1INEH 5HYSG 1EMTL 2VDOH 2X4RB 3GPSA 2MNWA 4K7PX 2EDOA 4LCWA 4JM4L 2XWJB 1TDQA 3ECQA 2Y9RT 4I9WD 4OCSL 5DJ8A 3BCDA 2X70B 4CSPA 2PTUA 1NDMB 2AQTA 3ZLQC 1FHNA 3S3CB 4L8CA 1LD9B 3MJGX 4NRXA 4WNQB 3P2BA 1CLOL 1MAMH 5DUML 5D1XA 2FECL 4YLQT 1BEYH 2ZWZA 1LP9B 1GGYA 3QJFB 3P2DA 5E8DH 5BRZE 3CVCA 4ZZFA 3S8WA 4JAMB 2V2WB 4Q89A 2BPBA 5FO8A 1T0MA 3CZFA 3UABA 3VFMA 1A0QL 3OZ9L 2VLJD 4XP5H 1BVLA 3GKZA 1U91A 1KYFA 3R0NA 2B9BA 3KYAA 3VGAC 4DAGH 1I85C 5D55A 3WUWA 2HYMA 3GDCA 4XP1H 3QUXA 3ULUE 2VABA 3N44B 4JO4L 3DTXA 1EUUA 4U6VH 3VI4A 5I30H 1NDGA 1NFDA 3VXUE 1J1XH 1UD6A 5KBDA 2OL3A 2VXSH 3GMRA 3BAXA 4MBRA 2ENJA 3WFDH 2I7SA 5FUOH 5CCKH 2DW5A 1O0VA 2XA3A 5D1QB 3BZ4A 1FIEA 1IEBA 4PGJA 2D7TL 2IGFH 3VG9C 2A6IA 4P49A 4UDUA 4PYHA 4MAZA 2MEJB 3TVMB 4XCCH 4F58H 2GTQA 4EN3D 2A9CA 4JB9H 2WWOA 4OF6A 3FDWA 5TK2A 1NCUA 5JOFA 3U48A 4YHPB 5F1NB 4HV8A 2W9EH 1S7TA 3UG3A 4CJ0A 4XN1A 1IQWH 5G4MA 5D7JA 4PLKD 3C2SA 5L2KD 4HT1L 2XZZA 3E7JA 3TESA 4TVUA 4XO3A 5J7CC 4MCYA 1UASA 2FX9H 1N3NB 2Z34A 5IW3A 4M7KH 3N43B 3AT8A 1O6VA 4HAGA 4HETA 2Q6WB 4P5TC 2MOQA 1TMCB 1HHGB 1X5ZA 2CO1A 3FQRA 3IJ8A 3AC0A 1VCBC 4F15B 4HT1H 2J6EL 2OMTB 1OT1A 3KPRB 5DK2B 2R2CA 1S2EA 4JZJB 4R97B 4TOYL 1WC7A 1DVQA 4N8CH 3QXWA 3TFKD 4ALAH 2D03L 2X3BA 2OM5A 3U30B 3NYKA 4HPOL 5DK0A 3EGDB 4XOBA 2V9RA 2ZKWA 1BEYL 2K3HA 3O6LH 4N4YB 2K8MA 3NZHH 4AH2A 5DUBA 4IKLA 1KBKA 1QNZL 3NFNA 1W0WB 5LGYA 1YUKB 1NAML 3QGVA 4KKNA 4P5KB 3OKOA 1MXDA 3TBYA 2J56A 4LSVH 1QHQA 3TN0C 1FVDB 5AUMB 1LEKA 4TMPA 2ZXDA 5DMKB 4DGIL 2C1OA 1Z9MA 4QRTA 4XP1L 4YH6A 4LCCA 5F7UA 4JG5A 4Z3GA 1KXVC 1N5YH 2BY3A 4RMVA 2R83A 5DHDA 1TJHH 4PJAE 2WVVB 3RVWD 2HUEA 1EJ6A 3APCA 4Y5YA 4UOZA 1WFIA 4QTIL 3RX9A 3OJDB 1C16A 4YBQD 1TJIH 5H35B 3VXOA 3QWQB 4K15A 4JUTA 3CLFH 5DJ6B 2PWGA 4DP5X 4N0UB 1BQ5A 1AQKL 1X9LA 2ITEA 4ZPTB 1P9MA 3HRZC 4OAWB 3SKMA 1Q0YL 1QI5A 2WLNA 3NCJH 4PRHB 3SE4A 4PWJA 3VH8B 3QUZA 15C8H 1G7MA 5IQ9A 4Z8FL 2EXYC 1Z9OA 2VXUL 3VWKB 1B4TA 3C6LC 5HHXL 2BFVH 3AS1A 3KGRA 1U0QA 4NZTH 4JFEA 3JSSA 5FX3A 1LM8V 1UZ6F 1YPZF 3U0TA 4J4PC 4PB9L 4RZCB 1MOEA 5L8LB 3UZEA 1CXEA 4MZ2A 5DRWB 4XOEA 3GHEH 2XV6B 1CN4A 1IAII 3QORD 4WHTB 3RPBA 2HXAA 2B1AH 4A2HA 5IESH 1CR9L 2V7HB 1KIUA 1AD9B 4FTVE 5MEQB 3ZO9A 4DTGL 1KB5H 1VJSA 3U0PA 1T7WA 3APFA 3CH8A 2OLDA 3UDWC 5HVGB 2NXYD 5AAMA 1BWMA 3HFFA 3HE7C 3L2MA 4F9PC 4HULB 1NEPA 3QPQD 1CDYA 1VEPA 3BDBA 3CVHH 4WWKD 2VLME 4QHPA 4LVNC 3V5DA 3OHXB 3JWNH 1EDYA 3IBEA 2CIIB 1J8KA 3KPQB 2IXQA 1LO3L 1IQDA 1EO8H 1M7IA 4LL1A 4M61A 4YHOL 3TBWB 3RVXC 5IG7B 4LU5L 3IJEA 4KMLB 4UIMA 1PLGH 1U41A 1XB3A 2ZXEB 3OKMA 4KZEH 5DZPA 1JWUA 2BNQE 3HI1A 4HISA 4YPGA 1JUFB 2AANA 1C5CH 4H0LC 4ZOCA 2B5IC 2XFXA 4LAQL 4R0LC 4LLDB 3TC9A 3DJRA 1CLOH 2XWRA 5DT1L 5C2BH 2AXFA 5B8CA 1JTOA 1H6FA 3NRQA 3MUY1 2CM5A 4PJFB 3SCMC 1MW0A 4UTAH 4L2LA 4G83A 5TE7H 4ZTOL 4L2YA 2J55A 5F9AC 3U2IA 2YFNA 3ARFB 2FBJL 4PS7A 4CC4C 4ZNEE 1XD1A 3BUQA 5DQ9A 3RWHA 3P30H 4FDWA 5GGVL 4ZMYA 3DMMD 1JWMA 2ZF9A 1DVYA 5I5IA 2ADFH 2NY3D 3C5ZC 5B3SB 3TYGH 2ICWJ 3BDXA 4WW2A 2O26U 5DSCB 5ITFA 3L5XH 2F53A 1MCWM 3AWFA 1I7TB 2OR7A 2J88L 2HB0A 4KKAD 1PZ2A 4OF5A 4ZPVB 4I3RL 3RFZB 1HNGA 3RVVD 1WT5A 4M6NH 1H3UA 1JHKH 3NN8B 4F7KA 3VXTB 1KXHA 2CO6B 1SEBA 1A7PH 2ZJSH 4WSKA 3NACL 1J5HA 1EGJH 1WVZA 1KBWA 2XIIA 3HMWH 5AQ0A 3IKCA 1RZQA 5E2UH 4P5MA 2JQZA 1TTFA 3O6KL 1VFBA 2ZWKA 2ZICA 4XE0A 4P07A 3ORJA 3F01A 2P8LB 1PY4A 2Y3NA 3QUMH 1HYRC 3BP5A 1MDAA 4QJ4B 5ICUA 2G2RA 3CV5A 1TZHA 5CZXC 4G82A 3VGFA 4BFFA 3TH2T 2ARJA 3MLTB 3GSUA 4QGTA 3A67L 2DWYA 4QRRA 1U58A 4GIOA 5DMYA 3QZBA 1JNJA 1MJJA 1J9SA 1FVCA 1B0RB 5C97A 3BVVA 4OVVA 3RI5F 1E4XI 3NCYS 3GRWA 3OTTA 1ETZA 3BZEB 2NUPA 1J48A 2EIZB 3PYCA 2N59A 1J5CA 4QXGL 2WXPA 4JPIA 1DEDA 2CH8A 3VXUA 4K9JA 3QAZC 4BA0A 1TLMA 2GK0A 2PW2A 2MPAL 2NR6C 4P3WA 4LLUA 5EC1B 4S0SD 3RYMA 3O11A 4HOWA 4CKVX 5F1SA 3HE7A 4X50A 2R9HD 2BRQA 2A6DB 2WTPA 3MRCB 2QADB 4K94C 3RL1B 2VGLM 4L5FE 3RPKA 5ACZA 1IC7H 4B27A 3U6RA 1ULVA 3QQ9C 1WA2X 3UERA 4IRZH 4OGXL 3T77A 1XGTB 4RQQA 4JN1L 4GG6E 4I3SL 5F7DA 4IHOA 4DKEH 2MMXA 2FEDC 2IG2H 2BWDA 3W0WA 1JK8A 1P4IH 5HVHB 1WWWX 3HZMA 3CHSA 4UI2A 3RGBA 3VFVA 2CPUA 2VWEE 1NFIA 1W0YT 4HJJH 2AMUA 4LNVA 4QRUB 3WY1A 2L7JA 2IANA 3MRFB 4AW4A 5HPMA 1OTUD 1UD8A 4LHUA 1AE6H 1BFOB 4KV5E 3WD5L 5K69A 3KWWA 4IKJA 4XBGA 5E8NB 4MCMA 5FYLH 1A6UH 5ID0A 2DWDA 1O5PA 2YSSB 4TS6A 4APQC 3CDYA 1GCYA 1OTUC 3MO1B 4PS4L 3PWUA 5HD8C 2HJLB 4ZMNA 4NQUA 1CTMA 4QRQA 1DANU 5EC2B 3MNZB 1BVKB 5CEYA 3P1VA 5CEZD 4OW6A 1ZMYA 1KDJA 4DCQA 4LNRA 3P73A 1AR2A 4EOWH 4GS7B 2EXWD 2EVFA 4M8VA 5TPWL 1FL6A 3T0VA 3D69B 2QGDA 4YWGL 5CEXB 2E47A 4DFIA 1SOQA 4F7MB 4K3DH 3KPSB 5IW1A 2NNCA 1IQWL 3WJLA 2VDKB 1UJTA 3S36H 1CGUA 1ES0B 1H3GA 2Y1YA 3GHEL 2GSIB 4NPYB 1XTLA 1T2JA 2XHNA 5KBPA 1G9NC 2KHAA 3BISA 3D7PA 3L2NA 4K94L 1A4BA 1CGXA 2QMJA 4RFOL 1OAUH 5JXEA 1E67A 1GGUA 5IW6B 4V11A 4XC3H 2OMVB 1X4ZA 1MFDL 1P5VA 3H3PH 3QH3B 5BS0B 5HYJD 1RHHA 3TN0A 3M7FB 4BGDA 4UDTB 2R15A 4JFZL 4MMZC 4NQEE 3TJPA 5BW7A 3OQ3B 1JPTH 3LIZA 4PJBA 4AMKH 2ZWNA 4PJCA 1IFHH 4UOW1 5SWZB 4N2MA 3MC0A 2CO6A 3G6JF 4PJXA 5I1IH 4BQBA 3MGTB 2P46B 3I85A 1CT8A 5TFSL 2YKLL 4P46B 3FSOA 1XF3A 3OX8A 1P69B 2GJJA 3HI5H 3QUYD 4FP8L 3F7KA 3O6LL 1F02I 1RZ7L 3ZUCA 4KK8D 3SKUD 4KK9C 3ECVA 2FDBP 2WKGA 1X5IA 4PJFF 3EXLA 4WCYH 1MY7A 4P5TA 5AB2A 2X28A 4PJAF 4HKXB 2W38A 3INOA 3NP3A 3NVQA 4DHLA 5HGAB 4ANVA 1SVZA 43C9B 1BXXA 5HBBA 1KCWA 2B1OA 1U8IA 3GD1C 2B1HL 1F86A 3EYUL 2HX9A 5T3ZE 2BWIA 4FX5A 4I48A 4Z7WE 2B4CH 2X9XA 2PW1B 2R0LL 3K46A 4P2AA 4R4BB 5H37H 2ZUTA 5GS0C 3O3UN 3RIAK 2EYTA 2EIZA 3GXDA 4WV1C 4FKKA 2PR4H 1WWAX 2YN3A 1FORH 2E9GA 4DW2L 3PRZA 3B6SA 4ELMF 3EO1B 4PGEB 1FVEB 3ARTA 5IB3A 1TCRB 2WWNA 2TRHA 1ORSB 3D34A 1M6UA 3HOGA 4X4ZA 1QTPA 1XTMA 5ACZB 2VMJA 4S1RL 3I75B 2IFGA 1IE4A 3ARFC 4NFDA 3ZPDA 4KVNL 2Y07H 4YDJB 3ASOB 1HZKA 5F7DB 4W6XB 1A4JA 1F0LA 1W0WA 4RSYA 3U6XA 2XWTB 1A3ZA 2AQPA 3L3JB 2HLFC 5IT2H 2VDLB 1LILA 4KQ0A 3DIVA 4X7CC 1YJDC 4HKBA 1F2QA 5EO0A 1AGEA 2ZG2A 2GJ6A 2EUWA 2B5IB 4K5PA 3RWGB 2EQDA 2AQSA 5MERA 5GZOD 4AX3A 3D85D 2X42A 3VUAA 1MZYA 3LS5H 4AI7A 4MQXC 5BZZA 1OAZL 2X4RA 1OOWA 4P59L 2O1AA 2AJYH 1G9MC 2O5NA 3VNZA 2WYIA 4Y4HC 2ZQKA 4B7LA 5GZOC 4MNQB 1DVSA 1OPGH 1V05A 4UU9A 3SYQA 4OLWL 3TYFA 1KULA 1H3XA 3BKCH 5E99L 3BYYA 1QSEE 4KDTC 1I8MA 2WXIA 1CLZH 1LDPH 4R4FL 3K71A 2JB6B 4B9IA 1ID5I 4O2EA 4F5CA 3GMMA 5EF2A 4BDVB 4KTDH 1UACH 3PV7A 4PLJD 3O2VH 4J6IA 4O02B 4D0BB 3KPOB 3NJMA 5C92A 3H3BC 2B16A 5EBLA 5F0MB 4Y1AB 3ZDZF 1X6NA 3MRIA 4HD9A 4X7EC 1T4KB 4P23D 4UNTA 4RZCA 5E8DL 2O6FA 2WP3T 3VRLE 4G59C 1RQ5A 2LTQC 3IDXL 2CG9X 4JE0A 4CVWA 3TEXA 4URTB 1S78D 1P4UA 2A2QT 2H6PB 5IFHL 1HOEA 2J1YA 1ZDSA 4ELMA 1MIML 1KIUB 1RUPH 3QDAA 5MEQA 5B1JC 1SF5A 3R7QA 3LD8C 4XWGL 3CTTA 4U1HA 1S78C 3IRCA 5JUEH 1HQ4A 2X4NB 4P2YA 4UYPA 3CFDB 1QO3B 2Q9OA 3L1OL 2FZ3A 1KF9B 2OMWB 2UVFA 4OZ4A 3QCVL 4QY8A 5AVUB 2VUKA 4K73A 5KANI 3VD4A 3QRFM 2I60L 2VLLA 2B3IA 3GHBH 4LRIC 4DGYH 1TNNA 1Q72L 2K4WA 1RZ8A 1G1YA 1YAIA 3QI9C 1BZ9B 4KH2A 2WD0A 4NUQA 4B9JA 4MA1B 2J6EH 3PWJB 2JB5L 1F6AB 4YSRA 2AQRA 2HVKB 4M7LT 2Q8AH 4ETQB 2OYMA 2J3SA 3F58L 5GIRB 4ZMWA 1MAKA 4J3BA 5EWIL 4KROC 4HDIB 5IBLC 4LCWE 5BO0D 4PEEA 5C07D 1JZGA 2EILB 4FL4C 3UGEA 2GFBA 2VYRE 4HX1B 1PBYA 3WJMB 4KJWC 4HUVA 2EDFA 4IOSD 4W70A 1CR9H 2DWSA 3BH8B 1RZKH 2ZOOA 4JFHD 3U36B 4JGNA 1CQYA 3GM0A 4FA8A 2Y3AA 2FCBA 2YUXA 4JFXB 3L3DB 3NGBC 3RGHA 1MHPL 1PZ3A 3GPEA 4XI5D 1QFPA 3IFOA 5JHDD 4ADJA 3EO0B 4KJYB 4G6ML 4AENB 1WICA 2OXGA 4XH2A 4XPAH 2IANE 4GJTB 3CPLA 4EZMA 3U30C 1C5BL 3QYMA 1QZ1A 1FNAA 3PNWB 4HU2A 1MCDA 3SPIA 1NOFA 4W9IC 3RWIA 1IMHC 1RZKL 4AVIA 3BO8B 1QACA 1ITCA 2DWTA 2QQNL 5KBLA 1XF5B 4Z7VF 5I17B 3UTPE 5ITBH 3D3VE 3VQLA 3U6XS 1IAKA 4ZPVA 4NEHB 1WWCA 4B9FA 4BCZA 4P5KA 2BP8A 3TTSA 4GI6A 4HPHA 1Q1JH 4I3SH 5IB1A 4I0PB 2CIKB 3L3JA 3MJ8B 2O6DA 3QS2A 3BWUC 2FGWH 3GXUB 5FYJL 3C2AH 2R1YA 2ZUQB 5CZXD 2Z0BA 1RUQH 3HG1E 3WEAA 1R75A 4GXFA 5I1GL 1MFBH 3LMJL 2DQGH 2X05A 2HT2D 3SD5A 3VXRB 3N43F 3EYOB 5AAWC 2Y1AA 4BFOA 1O9VA 1X7SA 3TO2B 2VQ1B 4OCWL 4DZBA 4W9DC 5D1QC 1J12A 3O9WA 2JMRA 1FG9C 1YEGH 3ARGA 3K2IA 1L7IL 3L5WB 3P40A 2KDYA 2BMKA 4JHWL 4JO3H 4BK5A 3SB3A 4D3CH 2WXNA 3H6AA 1VESA 4UBDD 5FYJE 4U3HA 4AYDC 1UCBL 3GMNA 1TJXA 4KZDH 1H8SA 1B0GA 4XNXL 3DV6B 3T4YB 1FG2A 1D5MB 3QZWG 3VGAB 3G6JB 1CLVA 3G5YB 5FGSA 5MHSD 4UQAA 3NJFA 3WL9B 2V0AA 4PV1C 4FKHA 4C83A 3CIAA 4Z7NF 2VLRE 1QABA 3PQYE 3Q7JA 5JW3L 3PS6A 3QR2A 3U0WH 1KTCA 3WTTA 2UYLA 2OBGA 3K74B 1RLBA 4PI0A 1SN0A 4UCFA 5TE6H 4FTVA 4UT9H 3SPJA 2FEEI 3KW8A 3S88H 5ISZB 4L18A 2RHEA 1EEZB 4E41B 2NDGA 3C6LA 3MV9D 1M56B 2ALWA 5I6MA 4JQIH 4QO1B 2X7LA 1R3KA 1A7OL 1WO2A 2EXTA 5D7HA 4CC0A 5D7LD 5GGSY 3PJSB 5J3HD 4TVPH 3T8XB 3V0FA 3WDIA 1Q0EA 3O8XD 1C08A 1XCQA 3VX0A 2VQUA 4KJPC 4BH7A 3V5DB 3HN5A 3VFUA 2C34A 1DUZA 1FZMA 5T1MB 5B7FA 4L8DA 4WTZA 5GGQH 5CGTA 1SDDA 2VLLB 4J6RL 2MQ3A 2BZ7A 4QXUL 2N3JA 4J3UA 5IVZA 5F1IB 4OV5A 3KPNB 4KUCF 4QRUA 3R7RA 1NLDH 1JPFA 4Q8BA 1JD9A 4PRHD 3V5KB 4JO5A 4NHUA 5E03A 1U8CB 3SO3B 1T80A 3QUYB 1JUFA 3I9AA 3WNNA 3IGKA 2YR3A 4K8RD 1LK2A 1KLGB 3A6OA 5J06A 1GZPB 1HZHL 1AQ8A 1ACYH 1NGYB 3KXFD 3UCRA 2QFRA 1SBSL 4PJFA 1JDAA 1V10A 2FJUB 2C1PA 3SIKA 4M4RB 3VXNB 1RZFL 5C2BL 1MPAL 1R5WB 1GR7A 2PWFA 2Q8BL 4JQVA 5DQDL 4BINA 3JV4B 2YOCA 3IPBA 3MHZA 4P2OB 4HWBL 4NLHA 2P8PB 3GRWL 5I75B 3CZLA 3EO0A 1JWMB 2MSPA 2E0PA 2YC1B 4NNYB 3VA6A 4OI8A 1IIKA 1YY9C 1NPUA 2GSGA 2V33A 4Z7QF 3P30L 3AAZB 1BBJB 1ZGLA 4PJCF 1WLHA 1SYVB 2QVIA 4P48A 2FYVA 1ZLUH 5GISL 4ESKA 1L6ZA 5AOZA 4K5OA 4NQCD 3NOIA 2WO4A 3P9WB 2NR6A 1AJ7H 4QRPA 3UPCA 3FMGH 2IDCA 1JZJA 4DZ8B 1I9RL 1F4WH 1EK3A 4L3ED 4Q2ZB 3QUXB 4AC4A 5E1GA 2GUOA 1DE4A 3U7WL 4A2FA 5K9KA 2L04A 4YVNA 2A3TA 4JJOA 3RE0A 3GQFA 5C09E 4W9KC 1NH6A 2CLVB 4OZFB 4M62L 3W0WE 4DVBB 2UZIH 1UD3A 2G2RB 3MRBA 4I4WB 1A6TA 1EO8L 5EU4B 1K2DA 5FA3A 5FWQA 1S9XA 1CYGA 5L8JB 5CHNB 3DVNB 3HRPA 1EHNA 1XGZA 5JNYB 2WYZA 4AG4L 4HV8B 3HI6L 4A38A 1NMCC 1EDQA 1OPGL 2YBRA 3FL7A 2IBBA 3DMMB 1E65A 2BJML 4XR8C 4MJJA 1FGVL 3FRPB 3BZEA 1LLAA 1UQSB 3KYKH 2XQBH 2YEVB 2YD7A 4H8PA 1QRNB 3NABL 4MNHA 4NN6C 1S5IH 2XA8H 5L88L 5E5MB 1MG3C 1OGPA 1JFHA 3VGEA 5DEFB 1RIVH 3P4MB 1RUQL 3ZKMC 5I6NA 1N5YL 1KJ3L 5IJCC 1ZT7A 4UQ3B 2HJFB 1LK3L 4UB0L 4I0PC 1THAA 2WP3O 4OLZL 4KI5D 2NY1C 5B1BB 4UQBA 4KQ3H 4N5UA 5D71L 5F89B 3MRRB 1OTTD 4Z76B 4IEFB 4MNGB 2WXKA 2I7OA 5DC2A 1QR1A 1MHEA 1MWAB 2UX6A 1YPZA 1F97A 2Q5BA 1E2VA 3PWNA 3LV3A 3HBQA 2YPVL 4XBPB 2YXWA 5DZ9A 4WUUE 3O6FB 5J1SC 2BIOA 3ZE0F 3FCBA 1SJMA 1MY5A 1SY6H 4HJGA 5C0IB 1BVOA 4U4IA 5BO1L 5KBKA 3W82A 4O02H 2WJ7A 5ERWA 3BKYH 1W0VA 4U1MB 4E9VA 4C54A 5ILTH 2BK8A 5HYSB 4C56B 4Z7UE 1WZ1H 3OR7B 3EDJA 2GITB 3RB7A 3NA9L 5CKAA 1B6DA 3ZZLA 4P4KD 2YA1A 1YYLL 3FQRB 4MAYC 4XBEH 4QJ5B 4FMKA 4AQOA 3HN8A 2P7TB 4KROB 2LFGA 1XB6A 2ORBL 1ITBB 3BEWB 4EBQH 4N0UA 3FN0H 3BPLC 2HT4C 4OCYL 1E9QB 1QEWB 2JCCA 3ISYA 4X4KA 1R5WA 3WS6A 4EN3A 4FZEL 3V4VB 2JB5H 5I2IA 3DURA 5LWYH 4BFIB 2LU4A 2BZCA 4K5NA 3CJJA 1JXJA 4TM9A 1BCIA 1E4WH 3HJEA 4M43H 5HDLA 1NPNA 5IVXE 4QHNA 2G5BA 5C3LD 3KH4A 4LU5H 1CD1A 5I18H 4MJIB 1RZ7H 5C0CA 5T5NG 4RGNB 1IL1A 3PPSA 4HAKA 2Q2LA 5LWYL 3RHWF 4BYHA 1FZJA 1OV8A 1GAFL 4UZGA 1MNUH 5HI3C 1RJYA 2NXZB 5D72L 3RAJH 5B3NA 2AV1A 4LCIL 4RFEA 4BCXA 4CBZA 3FU9A 1U42A 1KJ2H 5D5MF 5JHDB 4Z77B 2FB4L 4QWWC 1IFHL 2IWFA 1SHMA 3LVEA 3T0EC 2UWEA 3TZVA 2E6PA 3KLHD 4LOVA 4PYGA 4HMEA 4MAYA 1UXSB 2IOIA 4QRRE 3CG8A 4QF1A 4IS6A 3MLXL 4FOMA 1ZV9A 5GSVB 3FU0A 4Y2DA 2D2OA 2DMGA 4ZFOB 1JFQH 1Q9OA 1AR1C 3KPQA 2ADGA 4JDEA 4CN1A 3FO1A 1OM3H 1E9OA 5CHNA 4LLMB 4U6XA 3VWKA 4LLQB 3L3IB 3BLBA 2C7UA 5CJBA 4U4BA 5DQJB 5IEKB 3V4UH 4GG6B 4JJ5B 1I53A 1K8IA 2BNRB 3UBXG 4Q9RL 1M9SA 1NC2A 3FN3A 4L4TD 4YQXL 4G7VH 4W93A 2XXFA 5HGGS 3X3GL 5FKAB 2LLLA 2VSCA 4WKXA 4U6HA 4XGZB 4Y2OA 5D96B 1ZLSH 3OWEA 4LOEA 2DYRB 4WFGE 3WFBL 3WJMA 1QRKA 5BS0D 1HL5A 3F5WB 1CFVH 3EFFA 4IGBD 2R69A 1CBJA 4X5LA 3JWOC 5KEZA 5IOKA 3K72A 4IBLT 3E2HC 3U2SB 1N18A 4DOHE 5I8CA 3LEYH 3ZYZA 5IB3B 4NP9A 3HNVL 1LXMA 3QUZD 1A1OB 4Y89A 3IGAA 1JCKA 1KFAH 1VZHA 2FJFA 1NMAL 1ZLSL 5CLWA 4P46D 2YLHA 3FTUA 4AVHA 3DV4B 2KS0A 5AYQA 4PVBA 3EXJA 3BO8A 1I8IA 4AKOA 3SQRA 3TJHC 1MJ8H 1MHEB 1WTGT 2AJUL 4XZ4A 5IV2A 2WW8A 1WH0A 4LESA 4O00A 1OF2B 4EQ2A 4J2XA 4QDGA 4ZXBB 4FD0A 4GINA 1KIPB 4LL9A 2K6ZA 1MCHA 4PRAA 4BM7A 4IOFC 2X6VA 2VDPB 3BYTA 3BC9A 4U1IA 4ELDA 3GJFK 3SQBA 5B3JF 5E1IA 2JCCE 2CUAA 3I9GL 4AEIH 4X8XA 3EH1A 4QHKI 4X7TA 5D7JC 4WV1B 4ZO9A 4G43A 1EAJA 3G3LA 4LPVA 4CGTA 4F3FB 5HDOA 1IT9L 4AC2A 3AACA 2KZBA 2PTTA 5KYYB 1CDJA 2DQHL 4YGVA 1TTAA 4M3HA 2C4FT 2CKBL 4YC2C 1SF3A 5GRJH 3HTLX 4YR6A 4Y1SA 2XXCB 1BJ1H 1DFBH 5D4JA 1G7JB 4J3OC 3ARPA 4WHCA 4ORZC 5CJOL 4PM1A 5SX5H 5DMIL 4YAQB 2YSTA 1QEWA 1BREA 2JCCB 5CILH 5ITBL 4MCNA 5AD0B 4AT6B 2O5ZH 4HJ1A 5C6TH 2WZ5A 1VPOH 1NCDL 3W39A 1LMIA 3DUUA 4FNLH 1T03L 3VXTA 3I50H 1YEIH 1Q9LB 5FOBA 4WF7A 2GK0B 2PW2B 4OJCA 5C9KA 2ROXA 2AW2A 3TEZA 2FAUA 2Z7ZA 1IKFH 3GUTA 1R3JA 2XRAL 4LQ1A 3VM7A 2F6AA 1YN7B 1F1GA 2VZ3A 4NO3B 3T1FB 1A9BA 4YHKH 4G8EB 3LXUX 1T7ZA 2Y6SD 1IGJB 5T8IA 3CLFL 3E9UA 3HMXL 5AL0A 2A7BA 4KJPD 1YYLH 4MMZB 4XBEL 1ZEAH 4AQ1A 2F53D 4R2GB 1AC0A 3OLDA 3W0WB 1KCSL 3RLSA 1BFVH 3MZTA 4Y2DB 4WI3A 3L4UA 1OQXA 4Y9CA 4YBHA 4LIQL 2PR9A 7CGTA 1FVCB 1E27B 2QQQA 2EKSB 4Y5YC 3WSQL 1FE8H 1JK9A 3FYIB 4GS7C 2WCSA 1U8HB 1UWXK 5L9DH 3F7QA 3U2JA 1R3HA 5J6HA 1GYCA 3UTSA 3ZN6A 4LP5A 3L3OC 3B9EA 2IBZY 2EAEA 2P45B 5FHBH 1SLUA 2D7OA 1W8OA 3L1GA 5I23A 3F7YA 1XSKA 4J5VA 2A0LD 3DYOA 4Y2OB 5FC9A 2I9TA 2A74A 1CTNA 5T3XE 3NSDA 1FAIL 1X5AA 4GP4B 1N0LA 3CIQA 5IQLA 1YY9D 2BP5M 3MCKA 5KYWB 2IAAC 2IJ0C 3VB8A 2ZWSA 3N6YA 3GI8L 5I8CB 2ZX7A 4TQEH 3ZR5A 4KTEL 1MI5A 4HSCX 4ZS6D 4NGHL 4NP4L 4S1QL 3IGAB 4LBEA 3TXAA 5FYKH 3WUWG 3W5MA 1B4LA 1BVZA 3FSWA 3MV7D 1D5BA 1D7DA 1WUNT 3BE1L 4WSJA 3ARQA 2VN7A 1LWHA 1BIIB 3MBXH 5K1VA 2ZKHL 5AW4B 3LRSA 5E9DE 5C09B 3FFCB 3N40P 4OF8A 1JGLH 5I1LB 4X6BA 3LZOA 5F9WC 3MJ8A 1TFPA 1FYHB 4PJ9D 3GXMA 2GUOB 4FQCH 5DJXA 1JF5A 5EHFA 4PJDB 2O61B 3ULVE 1ZS2A 5F3BA 1W91A 3KBEA 5E4EC 1I8LA 2VM9A 2XKUA 3A4FA 4AUJA 1ZVHA 5GS1A 5FW8A 3DO3A 2ZG1A 4GKSB 2HVJB 5I0DA 3S5ZA 4N0CD 4HHAB 4JFFE 4GMSL 4JO4H 4X4YB 2FH8A 2JKXA 4ORGA 1BFTA 3BVUA 1T1YA 3R8BB 4DJMA 4N22A 1AKJA 4FXGC 4ZO6A 2H41A 5DWUL 5EU6D 4XB3A 1IM3B 4ZXBC 3O4LD 3D09A 4JO8A 3PXJA 2WVTA 3H9SB 3IRZA 4WTZG 3TEUA 1B2WL 3K4ZA 3D39E 2VDPL 4UT6A 1WBXA 4V33A 5F7HA 3UXFA 1TTUA 1OP9A 4MNHB 3WG7B 5KVEL 2OSXA 4XVOA 5DFWH 5H37A 4N2GA 4PJXB 4X98A 3LOWA 1GC1L 2J6EA 3POCA 3V4PL 1GIGL 2F19H 3C9NB 4LSSL 1UKSA 5SWQB 1JZ6A 2BW4A 2R23A 3L3GA 3MAWA 4L1SA 4HUNB 2HUHA 1HOCA 3WOVA 1I8KA 3Q2CA 3QDGD 3FT0A 3IWVA 4Q6KA 5MEND 3F04A 4UOW0 1H5BC 3ZQXA 2EEDA 2Z31A 4NUMA 5C0EA 1JBJA 4JG0H 3V95A 1QFUH 3OSKA 2R4RH 3BIKB 4AITA 3MPCA 3PP4H 3MRGB 4LSTH 3MLSL 1FNEB 1SFDA 2D03H 3VTAA 3D25B 4WENB 3CX5J 3GBLA 1JF1A 3NCEB 1YEKL 3GTVA 2P5EA 4MQSB 3DRQA 4NWTL 2DBJA 2OJ1A 5AVSB 1W0VB 1C1EH 4TTDD 1VKXB 4U1JB 2Z64C 4MS8D 2HT4D 4A7GA 1AZZC 5BVPL 1DVFC 5GGRY 4DNLA 4X9HA 1KB5B 1MHCB 1K6QL 1OGSA 1WBZA 2D7PA 1YN6A 5E56A 1R33A 4FXTA 3I2CH 3UJJL 4MKMA 5EEWA 1OM3L 5F7MC 4U7KA 1EV2E 4AGMA 2XN9D 4YDKH 4ODVH 5F6HI 3RDTC 4K5MA 4NQQA 1A5FL 2E27H 5DQDH 4WZ9A 4JM2A 5FM8A 5EBLB 3SGEH 4WUKH 1IVTA 2X4TA 3IMSA 5DRNB 4LBEB 1WISA 5CR8A 1B9ZA 3P77B 3X1GA 3NIDF 1U3ZA 1ZEAL 2R2BA 4QMEA 5I1AA 2EDKA 1XL6A 3ZK0A 4F7TA 4LEOA 3BP4B 2TSAA 4IQHA 3CU7A 3LAFA 4UTAA 3ESNA 1NCGA 1QI4A 1IAMA 1G7IA 2XI9A 4P57B 4PBDA 3BGMA 5KVGH 3W37A 4LEEA 1FYTE 2AGJL 4RWHA 5FM5M 3GNMH 1ICTA 2UY6A 5I8OL 1MW2A 2DL9A 3DX8B 4BE5A 4GB9A 1T2QL 3OM3B 5DD1L 4APQA 4IS6B 5EEXA 3HLAA 3JT0A 4DQOL 1YMHA 4G42B 3RNKB 2Q10A 4D9QD 4OIIL 2FLRT 1BQLL 3UP6A 4URKA 2ENSA 3FZUC 4ZAKB 1QYGL 3Q6GL 4ORGB 2E7DA 3T6ZA 3OJVC 3CDCA 3KPOA 2CNZA 2BM3A 3BUTA 1N64H 2XN9A 4CVXA 2EUXA 2A9NL 2I25N 3AY2A 3Q6FA 4X5WA 1QBML 3QI9A 1OAXL 4G7YH 3U1SH 4MASA 1MRFH 4OLUL 5JR1H 1MFAL 5FKAA 4K7PL 4YDNA 3C6EA 3HLKA 1P53A 3MREA 4F2EA 4BUQA 4E9RA 3QFGA 1VGEL 3O3DA 3A23A 5AKVA 3G5ZB 1RJZB 3QUMB 3FUNA 4NJAL 2ZZUT 5JIDA 1UACL 3KLAB 3UYOD 4HVBA 1EFXD 1IAOA 3E6HB 3GGWA 5ICYA 4Z7NE 4U1HB 1J1XL 4Y4FC 5HGBB 3RWIB 5I6OA 1L7IH 1Q9WB 1F3JA 1D5IH 3H4HA 4OZ4B 1NBVL 3ULSB 1R5IB 1AKPA 3FQNA 2ODHA 2EEFA 3OWRA 5EU5B 1JWSB 4GT0A 1AP2B 4N8VG 4M7ZB 3QCUL 4J3WA 2VMCA 3UAJD 1OEZW 4DGVL 1FFPB 4G72B 1HKFA 4LDCA 4FG4A 4M5ZL 5EH1A 2Y23A 3TVMA 4NQSA 1UD2A 2AQNA 2F5AL 4JZJC 3J07A 4QRSA 1OAQH 3EAKA 5C0IA 3MBEB 3PGCB 3U0WL 5JW3H 3G6DH 4HCRL 1IKNA 2QVFB 3ESVF 3EG9A 3L1OH 3SPCA 1YNKH 4JHBA 1MSPA 3T1WA 2OXHA 4MB3A 2HKFH 4X7TB 2XWBB 3I3DA 4YZFE 3FUDA 3FQWB 4HA1A 4MZRA 3C60D 3QI9D 1TZ8A 4S11A 4KY1H 1U4EA 5K59E 2HG5B 4K0OA 1LL1A 4Y1AE 1MJ7L 3OG6B 4MJ4A 4QCIA 1TU2B 4BSVB 3H85A 1K4DB 1JS4A 2AFNA 4L8BA 4R7NA 3S37H 2DAVA 3PNWA 1E3FA 4JFFB 2M83A 3EIFA 4OZGE 4PRPA 5DC9B 2WIIA 1S7SA 3AQDA 4IU3A 3LPGA 3DV6A 1UM4L 3THML 2DMBA 3OLGA 1P7QD 3G5YA 5LBSL 4MMXA 1FH5L 4LO9A 2C3XA 4MQTB 1Q9KA 3BRGC 3SE3C 3TBVA 2NW2A 1IJ9A 2X2UA 2X6CA 1WQVT 3UTZB 1HZHH 2UWEE 2AV1B 5TQ2L 3T2NH 3FQ4A 3BP4A 4NC2B 2BIQA 3O0LA 3FFCE 3RGVB 1YN7A 2DWXA 1J5IA 1MNUL 1BHGA 3BMWA 4JPVL 4B9PA 1NGPH 1G7IB 3HR5A 3S3DB 1ETJA 4H8WH 3GBEA 2AXWA 3DXAE 3U79A 4W9JC 1YEKH 3PJSA 1P7BA 2PTVA 5FK9B 1PZCA 4PJ7E 5EMYA 4YSQA 3QDJE 1EUTA 4AE1A 4DP8X 4OZIF 4ZFOA 3ARGB 2CDGA 4Y16A 3P4OB 2H1PH 3CFEA 1G6RL 5D6CA 5DLLA 1C16B 1AQMA 2NY2C 4BZ2A 3CZKA 1CXLA 3FB6B 4FQHB 2CNYA 5GGVY 5DJ6A 3T0AA 1MFCL 2GJ6D 4TSBH 5DTFB 2ZX9A 4JFYB 5EULV 4CW1B 4Z8FH 4AOFA 1OB1A 2EKSA 4GRLC 5BZDA 2W0KA 2EDJA 5B39B 1WE5A 3QA3B 2RH0A 3G6JA 4PJXF 3BWSA 6PAZA 5CZVH 3MCLH 1A47A 1W6WA 2E7BA 5LNDA 4YSDA 2J4WL 5BV7H 4CMMA 3BHBA 3ULUF 5DHVB 1KB9K 2GEQA 4GSUA 5DJYB 5AW1B 2OYLA 3HFML 3KL0A 3ARDB 4XPBL 1C8PA 3COOA 3HZVB 2AK4E 4P2OA 3SD2A 3F7PC 1AD9A 1IAOB 4Z3FA 4MSWA 2XWCA 1TEFA 1P7HL 1F11B 4HLEA 1ED3A 4JRXE 3QQ4B 4POZD 4HGWA 1EZVY 3GJFH 4P23A 4FFWD 1MFMA 1GAFH 1PZDA 2RCSH 1AGBB 3BLPX 2DTSA 3QJZA 5F7BA 3VYOA 4B95C 2QQLH 3ZGIA 4M7LH 5F3HA 1M71B 2Y5TB 3QEQA 1J1OH 3ZDXB 1KMGA 2DQEL 2OK0H 3KEDA 4J3TA 3HC4L 4XX5A 4LE8A 4WI9A 1ONQA 1ZA6A 1T0NA 2OZ4H 5CZRA 4X7SL 3VQ2C 3UBFA 4PJ8A 4UIMB 3ROLB 4TQPA 5C0DA 1F4XH 3C6LD 5CSZB 1KV3A 5HHVL 5LG1A 3V10A 3IBOA 1QZNA 3UTTE 3RIFK 3FBQA 2CBMA 4WU7B 4ZFZA 3AM8C 4PRPE 1ODUA 1XIWA 2GVYA 9PCYA 4B9KC 3KPMA 1DQMH 5DMGC 4HGMA 2D31B 3D18B 3VFSA 2A1WH 2AV7B 4O5LL 2X70A 2UX7A 3QORA 2HFFB 2WLYA 2ENPA 5A2IH 4MA3A 1EO7A 1PNDA 1A4KA 1SRDA 3D39B 3BSZH 2A73A 4ZUVB 5IVXA 3V8CA 2EDMA 4B0MB 2XRAH 4YSUA 1MXGA 1ZVNA 4KXZI 2GC4C 3ZDWA 4AYGA 2J88H 5BVJB 2HT3D 3C8KA 1A14H 5FYLL 5C71A 5DSCA 3CCHB 1KGJA 1Z32X 3RWCB 1BECA 1X9RA 5C6TL 1P1ZB 2R0KL 3UJIH 4IBYA 1W2KT 5L2JA 4N26A 4RMWA 3GKWL 1GGCL 4GP8B 2HLFD 3EJTA 1A3LH 4JKNA 3NRPA 1B0IA 4KK5D 3VMPA 2EXSA 3PABB 1F4WL 5F72S 5L7XH 2LLNA 3SE6A 3VI3B 5ALBH 2HFTA 1VENA 2VJ8A 2XTJD 4Z7QB 1A9BB 4NBXB 2AEQL 4WFFD 4QLWA 3WAJA 1Z5LA 1HOCB 4AEFA 1BOGB 1ZA3B 2RQ8A 1MCWW 1UZ6E 3IGUA 4HUCA 5T1LD 3FQUA 5C0EB 5DYOA 3V6FB 3WDHA 1L9PA 4F91B 3RY4A 1BQUA 4PJ5A 3SQOH 3BP6A 4ONHA 3ZE2B 3L3HB 3BIKA 3ABGA 1NGZA 1PZBA 4L3EA 4LPTA 5SWSD 4NHCL 1TVBB 1WJ3A 4XNZC 4QGYA 1CLYH 4UTCA 5L4JA 3FFDB 3H4FA 3MRQB 4BJLA 4UINH 1RZGA 4RDBA 5C3IA 3UMTA 5AVXB 3SJVA 4P06A 4JRXA 4MZIA 4U6YA 3RDJA 1H8OA 4HYTB 3FT3B 1M2VA 3BUYA 1U8QB 4WI8A 5DJYA 2NYZA 3MI6A 4ONFH 4PJEE 5D2LF 3RTQB 5J12B 2I85A 4ZAKD 3MRRA 3MNWA 1XT5A 3UYRL 5E94A 3GSQA 5BPPA 1GXEA 3D08A 1UATA 2WLJA 2WUCH 2MH4A 2VR7A 2EDHA 2EDNA 1CWVA 4GAAA 3SDXA 4YDZA 2HWZH 1CGYA 2OJEA 3AXIA 3DUSB 2O6PA 3EDDA 5E9AA 5GGTA 1ORQA 4XVSL 3QDME 4ICXA 4CNIB 3TASA 4JFSA 4AZUA 1YECL 4N20A 1S8DA 3I84A 3KWXA 4XMKH 1HE8A 2YGQA 3G9VA 4WO4B 4FLQA 3GB7A 4WGKA 1OGAD 2ZOLB 3GFUA 3I6LE 1A6UL 1YMME 2VE6A 3MRHB 3MRJA 2DH2A 1HDMB 3NAAH 5KAQG 3H53A 3EBGA 3OXSB 1OXYA 2V9QA 3MUGA 3ARXA 5JPNA 4XN8A 1HEZB 5A43C 1IGFH 3VI3E 1P7KB 2D9CA 2J8UF 3QJOA 1QRND 1OO2A 4YOKA 4UNVA 2VW4A 2Q7AA 5EB9A 3RPIB 4JVUA 4LL4A 4KJWD 4FMVA 4WU5B 5I30L 2YN5A 2F54A 2R0LH 3U7WH 3SGJC 5C0AB 5BV7C 2V2XA 4G6KL 2VKWA 4HS8H 3BQUD 2NY6B 4FG0A 3CXFA 4YBLC 3PDDA 5L2KB 4O4YL 1N7MH 1E4XL 4HZLB 4KI1A 1B6UA 4Z7VB 1DLFH 3QO1B 1YC7A 4MMYB 3O6MH 2C9XA 1HQRA 4P9ML 5EUKB 1KYDA 1JZ3A 4R26H 4AV0A 4X5WB 5I1CL 1YCSA 3OJMB 2XV2A 3F7VB 2OCCB 4PBWD 4UV4L 1WBXB 4TLTA 3AWEA 4Z0XB 2R8SL 4TQIA 3V9EA 1VEOA 4HIHB 4JCWA 5HHOA 1EPFA 2DQFB 4HUUA 4XMPH 1KYOK 1WPCA 3MUHL 3H7BA 2YK1L 3AS3A 1MAML 2AAVA 3PFUA 4OKVB 4TV3A 5BMFH 2OFQA 1ND0A 2VABB 2YZ1A 5LCVH 3I9IA 3GXNA 3U0PB 4QF1B 2OI9B 1ASOA 4LQFH 3ZMRA 3DX3A 4KKCD 1AXTL 4M6MH 2MWCA 1L5GB 3QIBB 4LLYA 3BT2L 4OIBA 4Z5RB 2YJLA 2BSEA 1JDDA 1E7UA 2EH8H 1ET7A 3DIFB 3VXME 3QDJB 2VZVA 3QS3A 4G11A 5JDJA 2NW3A 4NO5B 2FJGA 4OTXL 3FNKA 4I0PD 3L3IA 5IK3A 1BVNP 4OLUH 1GGTA 3TF7C 2KQNA 2P5EB 4V1DD 3T6XA 2E9BA 5B1AB 1D5ZA 2VDNL 3APMA 4JHWH 2FWOB 4QT5A 4Z7OF 1ZHKA 2FHBA 3VXMB 3GBNL 1AGDA 4M6NL 5JIMA 5DU7A 4UM9B 1HIMH 2H5UA 4JANB 1BJMA 1KPVA 4YUEH 2Q7YB 5FF6A 4YGAB 4KHXH 4H0IA 4GQPH 1TCRA 5IUCA 3T0BA 3G6DL 4Y88A 2DLEA 1PNCA 3MNWB 3AITA 4BZ2H 4ZMAT 4YHYC 1CBVL 2AGJH 1H3TA 3NBNA 3UH8A 3WFBH 1KXTB 4DT2A 4YE4H 5BQ7A 1FPTL 4I7ZC 4EBQL 3C09C 5LLIC 3H9YA 1Q9LA 3W1ZA 5FOBB 2G3XA 4P5TD 5I5JA 3NIGF 3L95B 4CA4A 1N10A 3IE4A 1S46A 4LEOB 4CC4A 1T66D 4HK0B 5H2BA 5IMOA 4QRTB 4AYSA 1HXMA 2W81C 5GRUH 1GZQA 3ET9F 1NC4D 3MQIA 3S3SA 2C9UA 4RBPK 1TQSA 1GGBH 4LKXA 4V2BA 3AQYA 4ZMTA 1XCTA 1WZMA 3RZCB 3CFQA 2J25A 5D7LB 2I5YL 3QXDB 4JPQA 2CDFB 3TOPA 1TZHB 2X38A 5FYKD 3SGDI 4KI5F 4XPTH 4KO6A 1A6ZB 1PIGA 5IR1B 5EOQL 1YMHB 3RPIA 4HZ1A 2X1WL 4L8SB 4N2DA 1SJHB 4QWWD 2ZUUA 2GAZB 3ZGHA 2P5WE 3BE1H 5D8JL 2N0MA 5C8JA 1B0RA 1SXZA 1FV1B 4XNYH 2HN7B 3DSNA 4YS4A 3DI3B 2DQTH 5D1QE 5E6IC 4X6DB 3JUYA 5I0ZA 3LN9A 1UFGA 4JG9A 3F7YB 4JPWH 5HHMD 2CR3A 5CU9A 3K6IA 1SMOA 3P02A 4TRPL 5E2WL 1ZHBB 4MJIE 4P99A 2YWYA 5FV2A 2X4SA 4WW1B 3LRMA 1IGCL 3ESOA 3QUKB 1J9QA 4FZ8L 4KUZL 5HGDA 2PPAA 4G1EA 3C8DA 4X6CF 3WXVH 4OGYL 3KLAA 5SX4H 3H7BB 3QNZA 5EBWA 4P2QD 4HUXA 4BBWA 3HZVA 4ES8A 5ANME 1X5MA 3OQRA 5LN4A 1GJIA 5A2FA 2V5RA 1SMDA 3O81A 1MIEL 3IRPX 2N0KA 4KQ4L 3DPDA 2Y2WA 3GF8A 1NCBL 3LNGA 3ALWA 3CGTA 1QW9A 3HJ0A 4PV9A 4UQ2B 4WUUB 5EO9A 3F6IA 2WLIB 2FZ3B 2OMWA 4QY8B 4KC3B 2BHFA 4K7FB 1ZTXH 2XC8A 4NIKB 2GBTA 5CINL 5L6YH 2A77H 3JV5A 4JFPA 3FFCA 1JV5B 1OP4A 4KXAA 2VERN 3BAWA 3B5HA 5ABDE 2VXVL 4BGLA 3JUZA 2AJXL 3OR6B 1BFOA 2H0EA 2HKAA 2WVSA 3CFCH 3RG1C 2LLGA 3B3BA 2CHNA 2NXYB 1KXVA 3DGDA 1MCNA 1Z5HA 2IH3B 2Q2EB 4P2RE 3CUPB 5HHXH 3KHOA 2FO1A 1BAGA 1LO2L 2H8PB 3G5VA 2NXYC 1RPKA 4HEME 4N6RA 5EUOF 1IEAA 4XCEA 3REWA 3RWFB 2GFBB 3SPGA 2ICEC 3PL6A 3ULUC 2JELL 1ZHKB 5GZNC 3VD1A 1X7QB 3U46B 3M8OH 4TLUA 4X4YA 1H6TA 3ARFA 3DO7B 5C08D 1KGYE 1T0OA 2X2YA 4L8BB 4R7NB 4XMWA 3SDAB 5IVXB 3ZKXC 2ZCKL 3L4YA 4XXDB 2XFGB 4F8OA 1F6LL 1I3RB 4H8QA 5DJCB 4A7SA 3CC5B 4M93B 4W6YB 3DVIA 3PWLA 5BUGA 1WD8A 3LN5B 3VI3F 4FABH 2FYYA 4JRLA 3SKJL 4ECNA 5FYLD 3CVHL 4CL7A 3NEEA 1JPGB 4IGBA 3RVTC 3RWCA 1BQRA 5TE4L 5EU7E 1R19A 1NTDA 4PR5A 3OF6A 2EACA 1KTBA 4NOBA 4F33B 4M3JA 5DF0A 2Y7OA 5BZWA 2WXLA 4GO8A 1JF6A 1E5YA 2VT0A 3DPBB 4R96A 3UZVB 4FS0A 3IXTA 3NJHA 2CWRA 1QLFB 3TPUB 1OZUA 4UILH 3PWPE 2HZHA 1KLUB 3HHRB 2WKOF 1QUNA 4WWPA 4GXUN 1CZ8H 2CO4A 1KG0A 2X89A 5D1QA 2ARJB 1CL7H 3MLTA 5KVEE 1DBAL 4H4NA 4R5XA 2NX5A 1VPOL 3MRGA 3CBRA 3O9WB 4U1LB 1RZPA 1ZTXL 2NPLX 3GMLB 4E0RA 4FA7B 3FB6A 5CGYD 5ACLA 1CFTA 1MH5A 2DYSB 1A22B 3V8OA 5KVFL 5I1JL 1KXQE 1NKRA 3JWNG 3B43A 4NZ8A 3EUUA 3PWPB 3TV3H 2APXA 2C9SA 2XZCL 3BD4A 2ORBH 1F18A 1R47A 5EU3B 3GWJA 3IMWA 5E8EB 2DTMH 3GLDA 5KS9F 5CJ5A 3RZCC 5GRZA 2VL5A 4S1RH 4JPIB 5ANMA 5HHNA 2YD9A 3LPFA 2ED8A 1DZ0A 1G7LA 3DSFH 3QXVA 4NQVB 4L29B 2NLJA 1YYMH 2GUYA 4A68A 1PQZB 1QFWM 3CD4A 2R56H 2LE9A 2EDLA 4UV4H 1EJFA 4UOJA 4N90E 3OF6D 4LKCA 1L0PA 2BFVL 2MHAA 2KQMA 4M02A 4C4BA 3RL1A 2VMEA 1UM6L 4ODHH 3KM1A 4TXVB 5IHLB 3KGTA 4MD4A 1JZ2A 1TEGA 3O2DL 4XMZA 3CVIH 4XZUA 4GBXB 5JHLL 1KJVA 2NTFA 2N01B 3C5ZA 4L5FL 3STLB 3DUSA 3PFQA 4RRPA 1M42A 1MCFA 3QJHA 5EIIA 2X89D 3B2VH 2R1XB 3D25A 1C08B 1XCQB 1LTXA 5J6GA 1UM6H 3ARGD 4ODHL 1JNHA 5F3HB 2J72A 5EDSA 1R9FA 4RWYH 3WGVB 4XNQA 2Z91B 1OB0A 1E40A 3Q8CA 4M1CC 1KJ3H 4H2CA 2EO9A 1BD2E 3Q9QA 3LNIA 5GZNA 2WVVA 4KTDL 4JFDA 5TGBA 1R0AL 1GW6A 1YNTB 3VW3L 1BX2B 2X44D 3GS4A 3VU2A 4F7CB 1TTCA 7PAZA 4FHKA 2H4EA 4M1GL 2FNBA 3HZ3A 3L54A 1DFXA 4NKMA 4J3OF 1OE2A 2XPYA 1KJ2L 3EFOB 5IJKC 5F7EL 1ML0A 4EI6B 5I0XA 2XVLA 1HCZA 3FK3A 2BVPB 3BVWA 1MCRA 2DJ4A 2QADD 3MACL 2P5ED 5G2NA 4ABVA 5T5NF 3DROA 2X4TB 2EXYD 1GHFH 5KG9A 3MN8A 2L7EA 3RWDA 3U0TB 1K5NB 4TPRL 5KWYC 3AS0A 1GS7A 3KYOB 4JFWA 2PLTA 4UDTA 4AVKA 4BUHA 4JLRB 2MJWA 3LKOB 4PRDB 1JGVH 1WBYB 4HQQH 1RJZA 4R90L 4PB0H 4IU2A 4TNVK 1U8NA 3IPEA 1D5XB 1IV8A 3MGTA 4AQZA 2DL2A 1PAMA 3FJTA 3OAUL 5HJ3B 3NPZB 1VRSA 5KVGE 3I3EA 4H20H 5G5DA 1MF2H 3RBSA 5LGJA 1WAPA 4DOHB 2CHZA 3UZVA 5GZND 3FQTB 4WTWA 1SDAB 1KY6A 2R69H 3BDYH 4NYLA 1R5IA 3KXFA 5T1KD 4L3FA 5CZKA 3WN5C 2J8HA 2KT6A 2JKJA 2PO6A 3IDNB 5J13C 2IXQB 3ZQWA 2XBDA 1K4CA 1DBMH 2B2XH 1Q0XH 1GSMA 2NY6C 2EIJB 3I6KA 1JSYA 2KPNA 1LWRA 1S9WA 4OY9A 4JDZB 3II2A 5BV7B 2AQQA 1TO4A 2XN9B 4CVXB 1ADQA 4HIEA 4IJ3B 2W60A 4FXKC 1D7FA 1CU4L 3ZE2F 4MXVE 4U31A 1CQKA 5TQ2H 3T2NL 1MFNA 5D8JH 1KSRA 3NIDE 1XF2A 5DRZA 4M7JH 4JO2H 3BAJA 4WI2A 2YK1H 4HUVB 3UGUA 5HHNB 4L37A 4EXKA 1G7LB 2YOAA 4ISVB 5FDWA 3UBXA 1TZIA 4N0FA 2RB8A 5JPMC 4ZUTB 2XBZA 4LCVA 5IF0A 4NLAA 2WZPA 2E76C 2QSQA 5J11C 4D8PA 4DWHA 5GQBA 2OA9A 5J5EA 3S98A 4P5RA 1N8OE 2LU5A 3QQDA 4PSPA 4MS8C 3SY0A 4RETB 1I7TA 4F1SA 3AT0A 5IBTL 1LDPL 1AP2A 2FB4H 3SKNB 4DKFH 1D5IL 2I9LA 3NESA 3ZDZB 1OW0C 5LXGH 1YPZB 5E7FA 4GAFB 4Z7UF 5F8RC 2QFPA 1HVXA 3ZZSA 1XGRB 3RVVC 4XP9H 3F8UB 2BP8B 4XP4L 5AB9A 2P3YA 4FLHA 1I1YA 4XVSH 2R39A 4ENED 1OWRM 4YDIL 1T7XA 1UZ8B 2APVA 3MTXA 2K9UA 1VHPA 2QSVA 3IKCB 3FONA 1A2YA 3QDGA 4NJ9H 3BVTA 5C0RL 3KWUA 1A8JH 1U8KB 3BP5B 1P4BL 3QJQB 2Z31D 3MRDB 1YYML 3N91A 4X8JB 4FQQB 3U7YH 3KR3L 1QWUA 3ZVVA 1BAWA 4DGVH 5IQNA 4TSAL 4YL4A 2GBVA 1JPSH 4HLZH 5T3XH 4EIZC 5CP3H 4B9GA 4ZFGH 2DQUH 3BWAA 1F1AA 4TLKA 3BEWA 4ODTL 3GSWB 3CN4A 4JFYA 4ZOAA 4X80H 1SYSB 1ZS8B 1A6AA 1QSEA 4ZSOE 3W9EA 4EVNB 5I1HH 4CVUA 2MFNA 3QO1A 4RSVA 3D85B 3RX7A 2WXHA 3D12B 3LIZH 4HWEH 5LGHL 1HXKA 5I8KH 2X40A 3V0EA 4LIQH 4XC1L 1YNLH 2FTAA 4HSAC 1LO3H 2VN4A 3GNML 3IJYA 4G9FA 4QD2E 1LJMA 3IJSB 4ZTPH 1TCMA 2AERT 4JLRA 1CK0L 4YXLH 2A6DA 3VD7A 4M29A 3RZWA 4KHTH 2A1WL 3B34A 1NCAL 2YD8A 4LSVL 5SWZE 5FK9A 1P5UB 3V0HA 2NSQA 3TA3D 1BQLH 3ARBA 5EOQH 3CLEH 1OSEA 4KXDA 3BJ91 4P4KA 3EZJB 4MNQE 4X6CA 1KYUA 2WZAA 4AM0A 3TX4A 2J5LC 1KYOJ 2FL5B 4B5EA 5EBMA 3MV7B 1AGBA 1UOLA 4XN7A 5E7BA 1E43A 3I50L 4KX9A 5AB0A 2NY0B 2IFFL 1SDDB 3BAKA 2R7EA 3FCTA 4R8WL 1JDCA 2CKBA 1E9OB 4YUEL 4WEMB 2WNWA 4LVHC 2WV3A 2YS4A 2R2HA 2VC2L 4LVOB 4LEXL 4Y16C 4ZQKB 3SJVE 3ALPA 4OZIB 1J9TA 1L6XA 3HEIB 1QSFE 4GRWE 5ESAB 3QQ3A 1U8MB 4APQD 4HX1A 4DP4X 3TIDA 1M4KA 3F12B 1FAKT 5HYJB 3HNTL 2IGTA 2OX5A 3K4DA 2EDWA 5DURD 1J7VR 2FIRT 3V0IA 4DK6A 2AEPL 2E56A 5BCAA 3D69A 4D9RD 4BXVA 4JANA 3S7GA 1XSIA 3QZOA 1UENA 4KJYA 4AENA 3K7UA 1E30A 4GRWH 5E1HB 5A2LH 3ZMNA 2WLHA 4H5SB 4F37K 3HHSA 4NENA 1IM3D 4TNWF 4A66A 1CXIA 1ED3B 3FB8B 3B2DC 5BV7L 2AEPH 3LIZL 3M1OA 2EYRB 1H3WM 1P5VB 3QH3A 4O58L 1ZT1B 3HMXH 4Y5VA 1M7UA 3RWJB 3RUGA 1L9NA 1U3HB 5BRZB 4NN5B 5JW4R 2V17H 1GJUA 5DYFA 2FIKA 2O6EA 2H2PD 3SBRA 4A39A 1T0NB 1YNTF 4YK4C 4WDIA 4ZUUA 2WLZA 5J1TC 1WDAA 4J7RA 3NCCB 5F7AA 1OAZH 4ODXB 3HB3D 1TZGL 4JDTH 6PCYA 3A67H 2D2CC 1AHKA 1ZK5A 3QJXA 2W91A 1OP3H 3CBKB 1QHOA 2V2TA 1V27A 3ZYOA 3P3UA 5TDPB 3KBFA 4DZBB 2SEBB 1OK0A 1HHHB 3DGGB 1FFNB 4ZW6A 1S9XB 1YG9A 2WQAA 2A73B 5AVYB 3TVMD 3L9BA 2JKIS 1JGDA 5E0QA