4YHIA

Reversal agent for dabigatran
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGETNPRNGGTTYNEKFKGKATMTRDTSTSTAYMELSSLRSEDTAVYYCTIGTSGYDYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords aDabi-Fab2a heavy chain
publication title Structure-guided residence time optimization of a dabigatran reversal agent.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhiA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhiA01
5KVGH 5F1KC 1UXWA 3FTGB 4OD2B 1FPTH 4NZDA 4LNVA 1T0NA 4F7PA 4PJEB 4CVWA 4ONFL 4KRPC 5C0ND 3EYUL 1U8HA 3D39B 5EUOF 5GISL 1U41A 1WBYA 5EOQL 2FYYB 2BNUB 4G9FD 4WFGE 1WIOA 2X9WA 3DRTB 5DZLA 5DO2D 4PS4L 4PJXE 5J0BA 1LEIB 4G8EB 2DMCA 2BY1A 5C0IA 1A7PL 5KANG 5JNYB 1R6VA 5C9JB 5ISZA 3D0VA 2MQCA 2HFFA 4P23D 3QQ9C 1NEZG 5JQHC 3QUMA 3U7WL 4KZDL 2P45B 4OGXH 1HHIA 4Q9QL 4MA8H 3ULUL 4IS6A 5TDOB 3BT2H 5IGXL 1IC4H 4K07A 4BELD 1GGUA 1U8KB 1F4HA 2HFTA 1LO4L 2NTFA 1S9KC 4KVCH 1MQ8A 3N9GL 2DIBA 2ADIA 1HXMB 3RWEB 1GAFH 5CEXA 5FOBA 1OWRM 3TIDA 1UT9A 5DQDL 3RWGB 4H25A 1EHAA 1BQHA 3QAZB 4K9EC 3BX7C 1UZ6E 4WFGD 2LV4A 2GK0B 2DWEA 3BEWB 2DJ4A 5IMMB 1IEAA 5J1AB 4OM1H 1CD9B 3TO4D 1LO2H 1OSPL 2P42B 1OCWL 3OR6A 2QQKL 2E27H 4MQXC 5T5FL 2F5AH 1T03H 2P24B 2VQ1B 5K9QG 3LHPH 1FZMA 3SO3C 2W9DL 4HKJA 1EEZB 4NWTL 3ROOA 5EO1A 5HYJB 4G8GA 3RA7H 1S5IH 2Z8WC 4WJ5A 3DUHA 2GJ6E 2ATPA 2JJSC 4CADB 2XTJC 1EHNA 2EDKA 4K23L 1Q9OA 4KZEH 1FCCA 3RWJB 2B5IC 2EYRB 2MFNA 3WNMA 5JW4R 3KPRE 2Y5EA 3JBG7 1TZIA 4PV8A 4WY7L 4I0CC 3PNWA 1T1XB 4CDHA 3PWVB 4FMFA 1YNLH 3WSQL 5I16B 2CKBA 3ARGC 3QFJA 4X9BA 1N3NB 4HUWB 4M6ML 4UBDD 3VMNA 1Y6KR 2VZVA 3QI9C 2J5LC 3LDBB 3AU1A 4ZOAA 1ZT4B 3MV7E 5J13B 2AJUL 1EVTC 1UWXK 4OCRH 4MLSA 4ONHB 2ILLA 4NO0D 4M1DL 5E9DE 3E3QE 4NN6C 2GJ6D 1DDHA 4K8RD 4D9LH 4I18B 2A83A 1OM3L 4JN2A 1U8QB 1NEZA 3ILPA 3MRIA 3B2UD 2X4NB 1HDMA 1LO5B 2Q76B 5IW1A 2X7LB 2NY4C 1FNSH 4GUPA 1B0WA 4L4TE 4WIQA 1X3DA 4OZHE 4Q0XL 2VXVH 3KPRD 3NPSB 3GBMH 4S1DD 1MJ8L 2FEDC 2I9TB 5L88H 4O00A 3QXTA 2ICWI 4G6KH 1KB5B 1UJTA 1I8LC 4RGMB 3QZWB 3E2HC 2VZ1A 3O45A 4PJAA 3ES6B 4C58B 4HT1H 2AEPH 3HB3D 2X9XA 2E7BA 5I8EA 3AC0A 1RZKL 4ZXBB 1QSFE 5I8OH 4WCYL 1RIHL 5FDYA 3CSYA 3NFPA 3MV7D 5DUML 3KS0J 1MCCA 2IH1B 3QBTB 1VFAB 1VEPA 5BJTB 5SWZB 1CLZL 4PGZA 3LOWA 1MAJA 2IPUK 5HDQL 3V7AE 1FSKB 3GSUB 3QIWD 1Q9WA 1J8HA 4FFYH 4YIQA 3K4ZA 5D93C 2FBJH 1I3GL 4Q6IB 5D70L 3SKOA 3DX6A 1MPAL 3VXQA 4L4TD 1H15A 4YE4H 4LIQH 3DUSB 3EYFA 4XH2B 4MA7L 3HI5H 4ONFH 3DVNB 3JZ7A 1OTUC 3EYUH 4YHOL 5GS0D 2D7OA 5GISH 3MUZ1 5L8KB 1G0XA 3EJZC 1TVHA 1QSFD 4PS4H 3T8XB 4F80A 5IHLB 1DVFC 1GGYA 1IEHA 1NANH 4IIQA 2XTLA 3VXOA 1GIGL 1UZ8B 1IQDA 1KXQE 3PL6A 3U7WH 4S11A 2Z35A 4KZDH 3OXRA 4Q9QH 5F6IC 5IGXH 4NQCB 3DI2B 1XR8A 1OARH 2FGWH 5B3JE 4NSKB 2IQAA 5L2KB 2X4TA 3SCMD 2UY6A 1LO4H 4JAMB 3N9GH 4X6DA 1U8NB 5DQDH 3BGAA 3V5HA 4LSDA 2JJWA 4OD3L 3RL2A 1YQ2A 5HVGB 3GUTB 1ACZA 3KPQA 5HHOE 2BJMH 1S5HB 1BQUA 5B4MD 5B8CB 5ACZA 1MCFA 1MAKA 1KF9B 1P2CB 4JM2B 5E8NB 4UILL 3NCBB 4QTIH 3SDCD 4R26L 3NIDF 1T1WA 5CJBA 5SV4A 4Z7WB 1Q1JL 5JXAH 3VRIA 2DI7A 4HSQA 4UT9L 2QQKH 1MUJB 3Q1SL 4OCLC 1G7PA 5B39G 5T5FH 4XHJD 4YDLB 5CEZL 1MVUB 3GJFA 1A6ZB 3A6BL 4PRNA 2DYPA 2KZ1B 1LO0L 1CE6B 1UA6H 4PJ5A 1N5YL 1U3HC 3QA3A 4OCXL 3FAWA 1T5XB 2J88L 5C08B 3TV3H 3VRLF 4I3SL 3QQNA 2HKHH 1C16B 4K23H 2OP4L 1P69B 2I27N 3PHQB 1N7MH 3VFNB 1A7QH 5HHOD 4JFOA 1CXEA 3UJIH 3MA7A 2VDPL 1JUFA 4JFYB 1T66D 1IEBA 1WF5A 1HOCB 3BESR 3OL2A 3UTPE 5CJOL 4Z7QE 5F9JB 1HH9B 4WY7H 1MCPL 3LV3B 3PG2A 1PLGH 5E03A 3OKEB 3WSQH 2L0DA 4OJFH 1LE5A 4ZSOA 3K1DA 1XIWD 4X4YA 5HYEA 4M8QA 4M6MH 4JDVA 4HUUA 5ELIA 2UUDK 2QADC 2X4QA 4B7LA 1GH7A 2AJUH 3MRHA 1D9KD 3ARFA 1CZ8L 2ATKB 2V7HA 4PJAF 1HQ4B 4CUCA 4H0GA 4U1SA 1PW3A 3FQXA 3OAZK 3KWWA 1CIUA 3BHBB 1I3RB 2V5SA 3DO3A 2ZG1A 1OM3H 3GHBL 1IM9A 4OGAD 3FN9A 1FCGA 1A9BB 3CDYA 5BZDA 2VZOA 1PD6A 4JGMA 2VLJA 5J9PB 2D7TH 3UTPD 4JRXB 1MJ8H 2OR8A 3WNOA 5AAWA 3NZHL 1I1FA 1KT2A 3VI4E 2SEBA 2D7PA 4JFPA 1S9XB 4YHPB 2OTPA 1MFAL 3BPCA 4Z8FL 1QSEE 1SMAA 2WBJB 4H1LG 3N06B 3P4MB 5HD8D 4R0LA 3A6OA 4AIZB 1ZT7A 1FBIL 1MCLA 4M48L 4MNQA 4EN3B 1NFDE 2VXTL 1P7KB 4NUJB 4WCYH 1RIHH 4LLVA 4UT7H 4PJGB 3BQUB 5DUMH 4J4PC 5I8CA 4J12A 1A1MB 5T3XE 5KVFH 5D2NB 3SKJH 3BUYB 2NZ9D 1G84A 1CLZH 3AVEA 1MCWW 4GSDL 3GRWA 2RFXB 3T4AB 3H42L 1DFBH 1F8TL 1VFMA 1ES0B 2YWYA 4KDTA 2BXYA 5D70H 4F2MB 4LP5A 5B39A 1FAIL 1MPAH 5DRXA 3FRPG 3MLPA 4MXVE 1R5IA 2CDEA 1OF2B 4XGZA 5EIIB 5JXEC 3UO1L 3RVWD 1K85A 5GGRA 1AO7E 5ANMA 4Y19B 3X12A 3DX9B 4YHOH 5DD1L 1QSED 1RIVL 1QFHA 4DJMA 5IHBA 4YDIL 4XPHL 2HLAB 2IALB 2DQCH 3QDGB 4RQQB 3RVTD 1NFKA 4WI2A 4OD1L 4GMTL 5I76A 1LO3L 1FC1A 5LGJA 2FJFA 2AV7B 4EDWL 4X6DF 5JZ7C 1MAMH 2XWJB 1OAKL 4XTRD 5CHNB 5T3XD 1GIGH 3MGAA 3WFDL 2B4CL 5ALBH 3N50A 2BNRB 1D6VH 2CJUH 3GFUA 4KKAC 4D94A 3X11B 3G5ZB 3L6FA 2P5WE 3H2WA 4BK5A 4ELME 2R1WA 5CBAB 5I1GL 3SE9L 1ZHLA 5GRJL 1HHKA 1VPOH 4ZOBA 3DXAB 1N5AA 4NN7B 4HFWB 5E56A 5CGYD 4MS8C 2UWEE 4U1KA 4BQ6A 2R9HD 3RGVD 3ARQA 4RX4D 4P5TA 5EZJB 3TPUB 4P59H 2P8PB 5DJ0A 2NY0B 4PUBH 4LLQB 1BFOB 5CZXD 1KJ2A 2P8MA 3MFFB 4OB5L 4ZYKB 2WWMD 3MPCA 1EO7A 1AO7D 4Y4FD 1MELA 5JA8B 2ICES 4OD3H 1GCFA 1RJZB 3QXUA 1VKXB 1NL0L 3VXRA 1T0MB 1G7IA 2J8UE 4O9HL 4XPGL 1WISA 3MRPA 3DBXA 3VWJD 5D1QB 1KG0B 2XRAL 5F7DB 3AREB 3MC0A 3S5LB 1U93B 3C6SB 4MAYD 1P84J 2WUCL 1INQB 2XT1B 1ZA6B 1F02I 4R26H 5L2JA 1NLDH 1DJSA 3KNBA 3RUGB 2P5WD 3W5NA 4MLIA 4PJHB 4DKFL 2HMIC 1AP2B 1MSPA 3BP4A 4H1LA 3A6BH 4YZFF 3O2VL 1LO0H 3AY4A 4N8CL 5CKAA 4OF5A 3RKDC 3ARPA 1N5YH 1C08A 5AEAA 3MNWB 4GKZA 3GMRB 1HHJA 4OCXH 4PRHE 3IKKA 5CZKA 4I3SH 4F7TA 5I9QB 1RAMA 1MQKL 5DT1H 4ZFZA 1A4JB 1QRNA 5GSRB 3ROLA 4CVUA 4XWGL 3BWUC 1QO3A 5D7JA 5DK0A 5HI4C 1MCEA 2VDPH 3C87A 1WK0A 3QDMA 4Y8DC 2CIIA 1HE7A 2KBGA 3HZVB 4P2RD 1L0XA 4K3JH 1EJ6A 5CJOH 1RMFL 4HULB 1M7DB 5HVWA 3FQUB 1LILA 4Y4KB 3FRPA 1PKQE 5BXFA 4RNRA 4MGXA 4Z7VF 3N1MC 4KQ3L 5DUPL 1KIRB 1F2XK 3KLAA 1MJJA 4LKXB 3QG7L 4LNRA 2HLFC 4BFBD 1DTUA 5EOTA 5GJTL 4GAFB 1S7QB 5T1DH 3RNKA 1F5WA 3LRSA 1PFCA 1OTSC 3LRGA 2PO6D 2Y5TA 4U1LB 3STZB 3S34L 3QAZC 2C7UB 5D7LE 1EEUA 4PRHD 5F7YC 5CSBA 1OWWA 3HTLX 4DGVL 3S3SA 4LVEA 4OCWH 2J12B 4DKEL 4OFIA 1M05A 5E1AA 3FMGH 3WJJA 1MVFA 3RVXD 3UTTE 5A43C 5DA4A 1UEMA 4HXAH 4JM4L 1R3JB 3NZHH 1CDJA 1YEDB 1R0AL 2B1AH 2Y36H 5E8PB 4FTVA 1QLRA 2B20A 3TBSA 3VFRB 1QBBA 4Z8FH 4E41E 3T65A 4OBRA 5FO9A 1CICA 1TZHA 1WC7A 4Z76B 1FBIH 4LVHB 3LH2H 2IAMA 3U2SA 1JGVH 1F42A 2FNBA 4G42A 4NPYA 4YDVA 1KTLA 4XVTL 1KIQA 5D7LD 4ERSL 5ESVA 2NX5B 3H42H 3MOQA 4K7FA 3WFHB 2Y25A 4XPAH 3V5KA 1A6WL 4AY0A 3IDXL 4P2OA 5IVXA 4KK8D 2IQ9H 1N4XL 4QRTB 3EOAB 3UTTD 3LDBC 3UO1H 4KKNA 2RAMA 5J13C 4HH8A 4PV9B 3V6FB 4ENED 3WLWD 4XT1C 4E42B 4E41D 4GRWH 4MNGA 1RIVH 2DMBA 2D4DA 3KR3L 5EU7C 1PYWA 3WN5B 5BZWB 4YDIH 4XPHH 2PKDA 1AI1H 3B5GA 2DD8L 4GMTH 4HBQA 1LO3H 4N0FB 5JIKA 5HGHB 2Z93B 4S1SL 4I18C 4DW2L 4P4KB 2BSSB 1QFOA 1OAKH 4ZO6A 1IILE 3B9KD 4HH9A 1UJ3A 2H45A 4KGJA 3LRHA 5GHWL 3BPLB 3L5XL 2D31B 4M1GL 1A0QL 1OGAB 1Z2KA 5I1GH 5GRJH 1IAMA 5I74B 3NPSC 4NHUB 2YK1H 1YA5A 2CRYA 2YD9A 4ETYA 1KACB 3EYVA 5D5ME 3V52L 5CSZB 4EVNA 3OMZA 2GUOB 4RGMC 3WO4B 4MNHB 5I1EH 3RPIA 2NMSA 3QEGL 2FECL 1EAPB 3GNMH 3PQYB 3ZHLA 4ZXBC 2CMRH 3HR5A 4JFZL 3O9WB 3QULB 2EH7L 1AR1C 3QUKB 4XNZB 5IHZB 4C83B 5C0RL 2AJ3B 1NL0H 3ARXA 5K9OB 4O9HH 4HHAA 2CO6B 2EE6A 1FSKC 2FATL 3LEXA 1MWAH 2XRAH 3PE9A 3MRCA 5LG1A 3L1OL 5T1MA 3S35H 3WE6A 1TVDA 1Q9KA 4Q6IC 4LHJB 2Q3AA 3T77B 2CRIA 3ZE2F 4YDKH 4M7LL 4DFIA 3GJFK 4RMQA 1F2QA 3JWOC 4UV7L 4DOHB 25C8L 4HZLB 4OF0A 3UC0H 3IDMB 4Y2DD 3MGTA 4NCC2 2AEQH 2W92A 1Q0YL 5AUMB 5F1NB 2ERJB 5C92A 3L3KA 4JG1L 3I75B 4X80L 2YPVL 3ARWA 1MLBA 2E7HA 2HT3D 3MCLL 5DEFA 5DJ8A 2QBWA 2MNUA 2X4PB 3OKKA 3QUZB 4W4NA 5JORB 5EUOB 4KMTH 4PJ9D 5DFWH 1DUZA 2AAVA 3CIQA 4J3WA 3DRQA 1IC1A 4UV4H 3C8KB 4Z77A 4R4NC 1N0LA 2V9TA 3VG0L 1FZOB 1KELL 3F5WA 4FZEL 3A6CH 5GRVL 3E1F1 2BX5A 4NRYB 3U82B 1AHWA 4DUXA 1IMHC 3PP4H 3GM0A 2CLZB 2E3VA 3LN4B 1RHFA 4PJCB 1QFPA 4ORZC 4WUKL 5DUPH 3VRJB 1TZGL 2Y7QB 3ESVF 4MX7B 5L0QB 4DZBB 2CPCA 3FHQA 1R3KB 3QG7H 3QR2A 2IADA 1S7UA 4NZTH 2Z4QA 2XIDA 2XXMB 1TFHA 3SJVB 3TZVB 1TPXB 5H37H 1U8LA 4I77H 1LE9B 4FQCL 1ORQA 1NCCL 4NKIH 3ULVF 3S34H 1BOGB 4H5SA 2PCPB 3KDMA 2MTPA 5ICYB 4NJ9L 1JV5B 3IFNL 5B8CC 1MRFL 3X14B 4ZUVA 4JM2C 4L3AA 4DGVH 4MWFB 3DETD 5DK2B 1T6VN 5B21A 5FB8B 4DKEH 2FZ3B 3C2SA 4P2QB 5TE4L 4YDLC 1K4CA 1MHHA 4PTUB 4NC0B 5IM7B 2XKNA 4CN1A 1T7WA 1X5HA 3MBED 4QKXB 3IJSA 4QCIA 4JM4H 5JR1H 3O11B 3HAEB 4K3DL 1HHHB 4JFXB 3BMWA 5IG7B 3TVMB 3W9EB 1JJUA 2ZCHH 2I07A 1UWXH 5K93A 5IVXF 4TQEL 4MJ6A 1P4BL 4JKMA 4J2XA 2OL3A 4JO4L 2B0SL 1FGVL 3L9RB 5DGRA 1J9CT 3RVVD 4HXBH 2H32B 1CE1L 1HINL 4XVTH 1NGXA 1VHPA 5AZ2L 1KEGL 3MREA 2HKFH 3NGBB 4ERSH 1SVZA 1WCBA 3H7BB 3QXVA 2NYYD 1F3DJ 5F7UA 3M17B 1I75A 1A6WH 1FIGH 3IFPA 4MCZB 1X5AA 1N8ZA 1NLBL 4OUUB 5HGAA 4YHMH 4YXLL 2IBBA 3TN0B 5I2IA 2BVPA 2A6JA 3R0NA 4AYFA 1JNNL 4PJ8B 2H2SC 3CXHK 3U6RA 1F90L 1NFIB 2HTKC 2MJWA 5E7BA 4IEFB 1S9VB 3C5ZD 2CKNA 3KR3H 5JHDB 1Z0MA 2YUVA 5TGBA 3GJEA 2YSSA 4PLJD 4QHLB 2DD8H 4XBGB 5HJ3B 5CAYB 5DD0H 2DL9A 2F74B 3EYQD 1I7TA 2HVKB 1L0QA 4LHUD 4KK9D 4BFGA 4OZFG 4M1GH 1F4WH 1A0QH 2X40A 4PRPE 2EIDA 3IDJA 4FQXA 2Z31A 1ND0B 3DMMB 4WU7B 3SDDD 2P7TA 1YUHA 1FL3A 4ZPVA 4R96A 4JLRA 1AE6H 2WBJC 4TVPH 5IMLB 4KKLC 2WV3A 5LBSH 1G7QB 1CFVL 5BO1L 1CGTA 4R4BA 1P1ZA 3LKQA 4EN3C 1NBVL 3B9DA 3HCVB 4BFIA 4N8VG 4JGUA 5J6GB 3GI9L 3BQUC 5JLZA 3VH8B 2V5MA 4KKBD 4YQXH 5DQ9A 2R4RL 1HYRC 3KPOA 3ARBD 5D2NC 2VTFA 5HDOA 4LLMA 3QUML 5IB4A 4S10A 2JIXA 1NGYA 3MNVA 1R3HB 1HCVA 3QFDA 4WW2A 4NZJA 3TA3D 5DYOA 1FFNB 1CTNA 1GC1H 3L1OH 3KYOB 1XGQB 4XX1G 5DJXA 4F3FB 1VGKA 2BVTA 1WBYB 3MTRA 3K1KC 4HBCH 3KYMB 1K2DB 3MQIA 2ARWA 4PRPD 1RQ5A 4HUXB 5I17A 2AV1B 4DCQB 35C8L 2V9QA 3MROA 4H8WL 1BJ8A 3D0VB 1BBDH 2HFFB 1XGTB 4JG1H 3SGEH 1KCRL 3D85B 3QUMB 4K2UL 3T3MF 4X80H 5BVJB 3MCLH 5H2BA 4JJ5B 3SPVB 5DSCB 1WEJL 3MXVH 1A2YA 4APQA 1OLLA 2DKMA 3IXTB 2O5XL 3PWPE 5C0EB 2NTFB 4NQXA 1KELH 4FZEH 3MYJA 4NM4L 4IHOA 5FOBB 5E2TL 3TIDB 1OQXA 3QIUD 1DBAL 1GPOL 1TVBA 2H3NA 5TQ0L 4NN7C 5FF6A 2IPKB 4H25B 3GBNL 1FL6A 4OV5A 4OFYA 5C2UB 1MOEA 1NANI 3KPMB 4JANB 4U7MA 1TZGH 5BOZG 1H9VA 1BZ9B 2NY0C 2WANA 5IJVA 4CL7A 1NCBH 3HZYA 2K3TA 3G5XA 1ODAA 3RQ3A 3FQWB 5CZVH 5SWSA 2VLRE 4FQCH 3ZE0E 4BM7A 3ZMRA 2R0LL 3H7LA 4F58L 2B4CC 1IGCL 4GH7B 4J3UA 5J1SC 4MB5A 2E7LC 4OI8A 1X7QA 3KYKL 3UXFA 2FWOA 4NJ9H 4YHYB 5F7NC 3QUXD 1R5VB 5LGKA 5D1QC 5FYLL 5B22A 3AREC 1FZMB 1YPZA 2R2CA 2VDNH 3PGDA 4HKJB 1MCJA 4OZFA 2CKBL 1TCMA 1DQTA 2MKWA 2XFXA 4KI5D 4UQ3B 3P4OA 3PWPD 1FC2D 2XA3A 3OKMA 1T20B 2JJTA 3ECBB 2RR3A 4WJ5B 3ME0A 3HE6B 1JZ3A 5TE4H 4XVJL 5E5RB 2UUDH 3HC0B 4PY8J 3SKUD 1N2RA 1OT2A 2PW1B 5F7FA 3PP3H 4H0HB 4XI5C 1YEIL 4U6HA 1P4BH 4N8VA 3MJ7B 1M4KA 3L95A 3P0YL 4OTXH 3OAZH 3FOMB 4GW5A 3VGAB 1TZIB 4PBWD 3GK8L 3RTQA 4F9LC 1MI5E 4KUZL 4FFZL 2VLRD 5FXCH 3FB8B 3FN0L 4NUGL 5CGTA 1HINH 3O4OB 1YQVL 5AZ2H 3NVQA 4C59B 2BMKA 4I1NB 5EC1A 5C0GA 3ZT5A 1KN2L 3ZHKA 3OAYK 2X9YA 3HUJF 4YR6B 4PGBA 1E4WH 3GMPB 5E95B 4Y4KC 3WXVL 3PDOB 2F19H 1UVQA 4YXLH 5HI3D 1LNUA 3NCYP 1LWRA 4YFLF 3UTZA 2AJXL 2J7LA 4K3EH 1JNNH 1BD2A 4NQEB 5KS9B 4JN2B 5DDHA 1F90H 4JQVC 3MV8E 2A38A 4WU5A 4CRPA 3AAZA 3O3EA 1D5MA 1DQQB 3B9VA 4GUPB 4D0BA 3V0VA 3G5YA 1AGCA 1MI5D 4LKCA 3OG6B 1A5FL 3G6DH 4NNYA 2CR3A 3QUYB 3NA4A 2BY2A 3LKOA 3REVA 5E9DA 1HZHL 3QEUA 2L7JA 3QIWA 4Y4HA 3MUHL 4YHLH 3K8MA 1KIPA 4CMMB 1JGUL 3E6FA 1I8MA 2DICA 3HNVH 3S4SG 1MHCB 5EU5A 1IT9H 2JB5L 4GMSH 2WLYA 4B7IA 3SGKA 3BSZL 1VCAA 4LVHC 4YIQB 1JWUA 2NW2B 1NBVH 1SM3L 3IYLW 2VZTA 4OT1H 1S7TA 2G75A 1UQSA 2AQ1A 1J0ZA 3QDAA 5AD0A 4IOFD 2DIAA 3MV8D 2JJVA 5DA0B 2R4RH 3TH2T 4K8RH 1FYHB 5CFHA 5I71B 2I5YL 1EK3A 4HF5L 4IRSD 5IB3A 5J12B 1CGYA 4ODWB 2G2RB 1NAKL 1S7XA 2A0LC 4IMLA 3MJ8A 4EOWL 3MUGA 3TH4T 3OBAA 1J8KA 3NTCH 3O3UN 4X4XB 5CP7B 3S36H 3G6JE 5IP4A 3MLTB 4QOKE 1ED3A 1MNUH 4H8WH 4XB7A 3WHXB 5GGSY 4D0DA 4NN5B 1N59A 3PF2A 3WN5C 3D3VA 4OF7A 3OXRB 2AJZB 4WI5A 1W0VB 1DQMH 3L3HA 3RDTB 5J7CC 1WEJH 1C5DB 2EDQA 4P4KC 3RY4A 3FB7B 1C5CL 1J87A 3BPLC 2O5XH 5F1IB 4Y16D 3D2UB 3LKRB 32C2B 1NC4A 4FHBD 4NM4H 5E2TH 5EO0A 5I74C 1DBAH 5C0BB 5TQ0H 3RL2B 5GZOC 3WO4C 1UZ6F 1V3LA 4U6XA 5GS0H 1TNNA 5DMGD 1LK2B 2WQRA 3GSNH 3IU3B 4QOKD 3O9WC 5JTWA 5CBEB 4XNZC 1ORSA 1NUGA 2R2EB 4E0RA 1IGCH 5JDJA 4FP8H 4KROB 3VRIB 3IJYB 3HNSL 3ISWA 3KYKH 1V05A 3PGCB 4JPKL 4M1CC 5BQ7A 2DYPB 4MJID 4RGOL 2DLGA 5A16B 3OKDB 3ZT6A 1U91B 1Z9MA 5ID0A 3LQAC 1PBYA 3M1BB 3Q2CA 2OMBA 2R0KL 1J5OL 2FDBP 3VW3L 3S4SA 2BRQA 2YN5A 4M61B 4XVJH 5BW7A 5F7HA 1HEZA 3I50L 5DHYA 3MOAH 5BV7B 4MYWB 1PSKL 2IH3A 3FL7A 3FOLA 2A73B 5F3HA 3QJFA 1CGSL 1YEIH 1RK0A 5GRWA 2ERJC 1NDMA 3GM8A 4LLDA 4OKVB 4RMUA 1YDPA 1NDGB 1YEJL 1JI2A 3BGMB 1FLRH 3OJMB 3GK8H 3QUZC 4N0YL 3P77A 4BZ2L 3MV9A 1CLCA 2BFVH 3STLA 2A6IA 4LPTA 5KSAA 3TBWA 1YQVH 1RZGB 1LE5B 1LEGA 2WZPD 4PR5A 3MRLA 4YHNA 4X4YB 3O8XB 3GSQA 4HUUB 4YUEH 2X4QB 4ZUWB 4B5EA 5JW3H 4A6YB 5DJYA 2ITCA 3PGFL 4S1RL 1AGDB 2JJSA 5L0QC 2APTA 4U1SB 2DBLL 5T1KD 1U36A 3TZVC 1TPXC 4Z7VB 1RJYB 3QYCA 1HN1A 4OM0H 3FQTB 3GRWL 5BZDB 4CW1A 3QPQD 3D5OF 1KLUB 3EYSH 4NQDB 1TQBB 4KRPD 5CD5C 2E6QA 2Q87A 3ARGA 2SEBB 1G7LB 1A5FH 2VZ3A 3K74B 4ZUUA 1QFWM 3SDXA 3VFTA 2PNDA 3QI9A 2A6DA 2CRZA 1KPVB 3KHOA 4P46B 1QPXA 4KHTL 4OFVA 1HZHH 3RZCD 4NKDA 5KAQF 4I48A 1JGUH 3UTQB 3MLXL 1FVCB 1SJXA 2FEEL 3KXFB 4LAQH 4MD0A 2NW3A 4BQCA 3G6AA 4XPBH 4J8RA 3TVMC 4XCCL 3KPSA 1BIIB 4QT5B 3SDYL 3UX9B 2KKQA 3V6ZA 3BSZH 3FN3A 3TCXA 4G80B 3NMEA 4XCYA 3K7UA 1SM3H 3ZE1E 5INDA 1PZ5A 2JCCE 1NC2A 4QRUA 1FGNL 3P4NA 2ZCLH 2AXFB 3NGBC 2I5YH 1QR4A 1I8LA 2FSEB 1LD9B 5GGRB 4U4BA 4UUJA 1I1CA 1X44A 2W60A 2WQ8A 3X12B 4PGEA 4P57A 2EXWC 5D2LE 3VCLB 5TJWK 4HS6A 5FGCE 3TN0C 1EZVX 1INEL 1NMBH 2ZCKL 1KJ2L 1NGQL 5C07E 1AKJB 43C9B 4NJAL 1NJ9A 1WTLA 1FFPA 4X8XA 4PJ8C 1UH4A 4HWEH 1J11A 1R3LB 1CFNB 3U30B 2O61B 4DTGH 3T04D 4XVUC 1CXFA 4MQXD 3PDDA 4JY5L 4NP4H 3EJYC 3RBGA 2R1WB 3QDJA 3HRZB 4U3HA 4BK4A 1N5AB 4PRDA 4OSUL 3D48R 4LGRB 2C5DC 2BERA 4DGIH 5INCA 3ORJA 3JWNC 5DFVD 2HG5B 3CZFA 3T08A 5DJ0B 1IAKB 1RHHA 4N68A 4PJBA 1U8IB 3CLFL 4MXQC 4I3GA 4JZNA 3GJFH 1S3KH 3HG1E 4BJLA 3OJDB 2N7BA 1AGBA 2Y72A 3DMMC 3R8BB 3MRBB 1VADB 2EE9A 2NY1D 3UP1A 5I1LB 1LP9E 3MRPB 1FH5H 4K71B 4HMCA 4KRMB 5C07D 2IGFH 3PWUB 2XYCA 4K94L 1MCOH 3BOVA 4HV8B 3DV6B 4POZC 5F7EL 3KPLB 3OR7A 3DNKA 4NO3A 1OP5K 1ULVA 3VXME 3V9FA 3RVUD 4OLXL 2F53E 3CK0H 5DD6B 4ODVL 3F6IA 1BECA 4RGOH 1TETH 3AS0A 2NY3D 3BRDA 2ARJA 5DURD 1C08B 3OWEA 3EJJX 4GKZB 4OAWA 1HHJB 3DVFA 2R0KH 1J5OH 2Q7YB 3HG1D 5F1SA 1MJUL 1YN7A 5ADOL 4JPWL 3I50H 1QRNB 1PSKH 1CGSH 2OYPA 2VLKB 3LEVL 4FQ2H 3WUWB 1JHKH 2FEDD 3THMH 3ZT7A 5E99L 4F33A 4JQXC 3IRZA 4Z7QF 4BZ2H 2FB4L 2DKSA 2AABL 1QHPA 4RNRB 3I2CL 4C55A 3KLAB 1MJJB 3VWKB 5GIRB 3AMKA 3VXMD 4FQLL 4LNRB 2MMXA 1UM6L 2F53D 2FGZA 5IVZA 1QFWH 3LRSB 1T83A 1QD0A 5KG9A 1OHQA 1A7RH 3PGFH 3ULVL 1RY7B 3O6FA 4PREA 5MENE 1Y0LB 5HGDA 1OAZH 5I1CH 3BP6A 2IMMA 4HEME 3U0PA 5E2VH 1I1RA 1U6AL 4KJPC 1A9EB 1I7UB 1A6VL 2DBLH 4NNPH 5EORL 1P5UA 3JTSB 1EFXA 1U0QA 3BZFB 4X6EB 3B2VH 4F15B 5KSBB 4P9ML 4J23A 5E1AB 4CNIB 1VENA 3VD4A 4JPIA 4MD5B 5MP6L 4ZFFA 1FVDA 5EO9B 5F6HI 5E2JA 3O3DB 5F72S 1ACYH 4YHYC 3ZSTA 4CVZB 4Z7UA 4JFFA 3FT4A 4X99A 3T2QA 2ARJQ 1AY1L 3TBSB 3UYOD 3VI4F 1CT8A 1AGEA 3LN5A 3T65B 2BOBA 5DZNA 1ZTXL 1CXLA 1DVFD 1MJ7L 4CVXA 3HE6C 1BVKB 4DZ8A 3JV4B 2V2TB 4JQIL 3MLXH 4LSUH 2ZUUA 3TJHD 2ZG2A 4YDVB 1UC6A 2QHLA 5MEND 1KTLB 4M62L 4ZDHA 4XCCH 1BX2A 3MSPA 1T0PB 5ESVB 4QXUH 2YUZA 2X4UA 4POYA 1NUDA 3I9GL 3U0WL 3VXPB 1OP9A 3D0LB 3U7AA 1RZJL 2J6EA 3LSOA 3VGAC 4HIJB 5C8JA 4P2OB 3PV6A 4TSBH 1MWAB 5I66A 3BZ4A 3O4OC 3IKCA 5HY9B 5CP3H 1WV7T 1FE8L 3DGGA 3P9WB 5T1LB 2W07A 5D8JL 3UAJD 4PJFE 1MIML 3ZO0A 2HN7B 2HRLA 5FYJE 4JKLA 4J6RL 1U8OB 3MMEB 1PYWB 4J4PA 3UTOA 5HHXL 4PJBF 4RZCA 3ALXA 1INEH 2ZCKH 1KJ2H 5BS0A 1NGQH 4UB0L 3TBTA 5HHPA 5ICZB 3VXUD 4L8BB 4R2GD 1FYTE 1UJ3B 2KL6A 3ILQC 4NT6B 3NZ8B 4GKSB 4QRPB 3VGFA 4X6CA 1KBGL 2IBZY 2A1WH 1BGXH 4JY5H 3B9AA 2HAZA 3RX5A 3N1FC 2VL5B 3MA9H 4N0UE 4OSUH 5EU6E 2BOCB 3O6LH 3EYOA 3EYVB 4WO4B 3QUYC 4IDJL 3B5HA 1U3HD 3R1GH 4FMKA 2VITB 2EYTA 1J7VR 1BEYL 4KTDL 5JXEA 4PRIB 1RU9L 3CLFH 4LDOB 1K5NB 2D03L 4HUMB 2P1YA 3ARDB 3WXWL 3BZEB 3HR5B 3GSXA 1UG9A 2EKSA 4UU9B 1IL1A 5KN5A 3I3DA 5EH1A 4MD4A 2PYED 3PWJB 2WK2A 4WTXA 4HHAB 4QRRA 4OFDA 3U36A 1J18A 3CSBA 4XP1L 3RWFA 1URLA 3MRCB 5T1MB 4DAGL 3I6GA 3WE6B 1Q9KB 2R1XA 1FV1A 3G9AB 1JRHL 1FYTD 2H9GA 5F7EH 1WWCA 4ALAL 1Q72H 4V2CB 2R15A 2C3VA 2GTZB 3IDIB 5I71C 3V6OE 1YEEL 5C09B 5J12C 5KVDH 2N4IA 1Z9OA 4DQOL 1FNLA 5EIVA 1JGEA 2FECI 4ZPTA 3GSRA 5EU6D 2HFEB 5D96B 4Y1AA 3L3OA 3P2TA 2UZIL 3C2AL 4GW4B 4C54A 4XXCC 5DC0A 3ZDYE 1KPRA 1Y18B 1SQ2N 3L3KB 4WTWA 1J1XL 3DSNA 3VU2A 4HIIA 2X4SB 1UWGL 5DEFB 2KPNA 1IZJA 5DJ8B 2ZSWB 3C6LB 3CFCL 3OKOB 2YBRB 4U3XA 3LB6C 5A2LH 1F3JB 2AP2A 1OVZA 1PQZA 2P5EB 4NN5C 5CUSH 1SJVA 5JO5A 4AIXA 5JDSA 1UYWL 1JHTA 4WGVB 3RDTC 2FL5A 4C56B 3VJ6B 2F9BT 3EFFB 4TTDC 2FB4H 1EUTA 2WLZA 3FTGA 5KTEL 1B6UA 4OD2A 4P5MB 3QEQA 4PJEA 5T5NG 3WD5H 1XF3B 1UM6H 4RFEB 2EDFA 3D39A 4XMKL 2FYYA 1Y6MR 2BNUA 3SGEI 5F1OB 4Z7UF 5HVFB 3DRTA 1ORQB 3HA0A 1T4KA 3HE7B 1XF5A 1LEIA 4OQTH 2ZWLT 4EI5B 4G6ML 1CVRA 4G8EA 2OL3L 4M5YH 1JPGB 3NCJH 2V5RA 4TNWF 1A6VH 2X4RB 5JNYA 1I7ZB 5E8EA 1U9KA 1FFOB 2FO4B 4KAQL 5E2WL 4AEIH 3D6GA 4H20L 4JEGB 4KROC 5EA0L 5BRZE 1MHHB 2F5BH 1U8KA 3NCCB 4YBQC 4FXLA 3OAYH 3CUPB 2MKLC 2R8SH 1C8PA 2B8OT 3QZWG 4Y5YA 3DYOA 4JRYB 2GJJA 2IANE 1HXMA 1F00I 3O2DH 4HQQL 3RWGA 1WTGT 4JFDE 5EZOL 1ZTXH 2ENYA 4NQSB 3QEHB 5DVMA 3PDGA 5DMYA 1ZSDA 4V1DB 4JE4B 4JQIH 2R0ZL 3T2NL 5DUBB 1XCTA 2YKLH 4G8FB 2LU7A 5BV7C 2GK0A 1DQJB 3BEWA 5TE7H 5HPOA 5D72H 5IMMA 2KDGA 1JWMB 2P46B 3RNQB 1EVUA 1WCBB 3W0WE 3I9GH 3QIBD 4KXZH 3U0WH 2VOTA 1RZJH 4MJ4A 3PV7A 1NCAL 3QQ3B 2VN4A 2YPKB 1PG7H 2ZKHH 2AJVL 3IFPB 4HIEA 4AEFA 3LS5H 4GRLB 2P24A 4RAVB 4B53A 1P7QB 5C9KA 4NM8L 4X6CF 5BRZD 3O8XC 2BVPB 4FZ8H 4BSVB 1MHPL 2K7PA 3DSFL 4FG6D 1EEZA 5H94B 5HYJA 1MIMH 4P4RA 4XBEL 2ENSA 2IAND 4J6RH 4CADA 2F15A 2EDRA 3EIFA 4L3EB 2AK4B 2EECA 4JFDD 5D7IE 3HUJB 2EYRA 5TFSL 4UB0H 5EWIH 1F13A 1F4YL 1H3VA 1CI5A 2ADFH 5J57B 5JPNB 2X1WL 4KQ4H 1K8DB 2UZYB 3W0WD 2XN9E 3BYTA 2HMID 1IFHH 6CGTA 1T1XA 1WIPA 4HUKB 1TQBC 5I16A 4FQXB 2Z31B 5IWLA 1N3NA 4HUWA 4IDJH 1VACB 4UINL 5IT2L 3AFLA 4FFVD 4KTDH 4JKKA 3V4UL 2HT4C 4P46C 1ZT4A 3BRGC 4XVSL 3LY6A 4KU1A 1AH1A 3O0RH 4RMVA 2D03H 3ULUE 4L8CB 4ONHA 3WXWH 4BUGA 5DJCB 2VXQH 1BM3H 4G9FB 4I18A 4PJ7E 4YWGL 1NGYB 4JN1L 1XF4B 1U8QA 1CLYL 4XP1H 3PXJA 2X4NA 2BDNL 4O4YL 1PVHA 1LO5A 2NXZD 1VGKB 2Q76A 1J1PL 2X7LA 1JRHH 1KXTB 4ALAH 3OHXB 2VQUA 4P23B 2I9TA 1DCLA 1KB5A 1HHGB 1S9WB 5F3BB 3QZWA 3P4LA 5ABDE 4XAKE 1AQKL 4W81A 3NIFF 1WWAX 2R29H 5IKCB 3BUTA 3MROB 2UZIH 3C2AH 1D5XB 1VDGA 1J1XH 5E4IA 4PJEF 1UWGH 2IH1A 4UIKL 5H2BB 1AIFB 4AENA 3ULUD 3S3JA 5BJTA 3HMXA 5SWZA 3CFCH 4ZO9A 4APQB 2RCSL 1W0WB 3GMNB 3U30C 3VGBA 1YYML 4NYLB 3TC9A 1M7XA 5I1IL 2AI0H 2BNQA 4LSPL 1UYWH 1KEML 4PJXB 3PWLB 1EPFA 2HTLD 2WM0A 1H3XA 3RHWF 4YGVB 5KTEH 3DUSA 4XH2A 4JZJB 3DVNA 1KUMA 4XMKH 4XAKD 1CIDA 1XF2B 1PAMA 3QSKB 4XC1H 4HFUL 3T8XA 2XZAH 4KKCC 4DN3L 1OTTD 4G6MH 1BHGA 4G9DB 1UZ8A 2Y6SC 1J1OH 5D1ZD 3DROB 4K71C 1ZEAL 3RBSA 5GZND 4G43A 5EIQA 2X70A 5DI8A 1S7WB 4OZFB 2YD8A 3S3PA 4HX1B 2ZSVB 3LZFL 4G7YL 4H20H 5AG8A 4F7CB 3OKMB 5AYUL 3HZKB 4NQCA 4PBXA 5EA0H 1RULL 1OAYH 1DLHB 4LLWB 4V2BA 4NSKA 1CU4L 5K9JL 3WIHA 2DQFB 5L2KA 3U48A 2BHUA 1X5ZA 4KJWD 4IBLT 4BUHA 3AY4C 1OD7A 4E5XB 4JAMA 2F8VA 1WAAA 1U8NA 2XQYG 3FO0L 4HK3J 1B4RA 4HQQH 1OAUL 2YMXH 4GT7A 2EE3A 2Z9TA 4GW5B 3GUTA 1FFQA 3K8KA 4K94C 4CKVX 3BO8B 5I1AA 2VDMH 4OZIE 5B8CA 3ABZA 4PGJA 4JM2A 1CCZA 1V7NL 4NO0B 5EC2A 5E8NA 3BPOB 5F9WB 2GJ6B 4XPFH 3NCFB 4Z7WA 1U3ZA 2OZ4A 2E8YA 1NCAH 4D0CB 3OGOE 2XQBL 4WUUE 1MUJA 3MO1B 5FYKL 3VWKC 1UVQB 1M1SA 1A6ZA 1RI8A 4MAUL 1BZ7B 1LNUB 2WIIB 1CE6A 1MHPH 3DSFH 1IAIM 4XBPA 1EH9A 3KPRB 5KANI 1IC7L 4XBEH 2FIRT 1QQDB 1T5XA 4RA3A 3AS3A 5C08A 5T5NF 5F7KC 4PLNC 3N85L 2Q1EA 4LEOB 3AAZB 1D5MB 1GGIH 1MFBL 3ETBF 4YO0B 2AJSH 2DQJH 2OS7A 3PHQA 4YHIB 3VFNA 4JRWA 5GGQL 4J3SA 3MV7B 1JZ2A 4JFYA 4MZ2A 1HNGA 1F4YH 3BE1L 3P0GB 4F15C 3RU8L 2E7MA 1HH9A 4RFNB 1BZQK 4NNXB 5E9DB 1N6QH 1MY5A 3JV0A 4JR9L 3T1FB 3QIWB 1H3WM 4TTGA 4OF6A 3EO9H 3E6FB 3FFCE 2R56L 4XP5L 4OZGE 4WUUD 2NXYD 4UINH 5IT2H 1FNGA 3C09B 4AT6B 2ESVE 3WMSA 5A3ID 4L4TB 4OZHB 2X2YA 3GO1L 2ATKA 4I4WB 3VFWB 3BKML 3U83A 2DLFL 3C60D 1HQ4A 1RUKL 3TPKA 5FK9B 3TJEL 2HH0H 5F88B 5TPWL 1I3RA 3GSNB 5E6ID 4K3HA 2GITA 3EHBD 4JN1H 4F37F 1EV2E 1QSFB 1A9BA 1AXTL 3QB7C 3S5LG 4O4YH 5HGBB 2GY5A 3RJDA 4IMLB 1BOYA 5J9PA 4P2OC 4ZO7A 1OSZB 4BFEA 3Q5TA 4JRXA 2ZJSL 2OXGA 3WNKA 3Q6GL 4YEEA 1HI6B 1S9XA 1AFVH 4YHPA 1YMHB 4XC3L 3C5JA 4F7MB 2WBJA 1QA9A 5DJ6B 3P4MA 3MGOB 5E6ZA 4AIZA 2ZP0T 3D18B 3UBXB 1W8NA 4BKLB 4EN3A 1MCBA 4N90E 4GXUM 3BKYL 3VDBA 4NUJA 2VR4A 2ESVD 3SCMB 4PJGA 3BQUA 1HIML 1A1MA 1IQWH 4OZ4B 3MJ9A 3EUUA 4UIKH 3IXAA 3KPTA 5D2NA 3BUYA 4XP4H 5SV3A 4MMXC 5F97E 4DWHA 2RCSH 2RFXA 3T4AA 5J1TC 5A2JH 4J3OC 4GXUN 4U05A 5EUKA 1X4XA 5GS1B 4AH2B 2AERT 1JL8A 4HGMA 4F2MA 2GT9B 3DARA 1INDH 2DQIL 5CJ5A 3HHRB 3SDCB 4JB9H 4WO4C 3UJJL 2ZUXA 1OF2A 3GSVB 4NQTA 2ZG3A 2VDLL 3DX9A 4K9EL 1LDPH 1XT5A 3ARDC 3UTSE 3F58H 3VD5A 4KTEH 4LFHG 1T1YB 3WIIH 2HLAA 2IALA 3CFBB 3QDGA 4MQTB 4O2CB 4RQQA 4E0RB 2AXGB 4GW1B 4N90D 4LPUA 5E94B 2AV7A 1M7IB 4DN3H 4F57L 4MA3B 2XWJA 3QWRA 5CHNA 1MCKA 3Q6FB 1VB9A 2BNRA 2YN3A 3DPBA 7FABH 3BN9D 1JYXA 2XA8L 2WIMA 5C6TL 5CBAA 2W0FA 5CCKL 2IF7A 4Z78B 3RRQA 3ZL4H 4JM2F 4LARL 3NIGE 2Z91B 1RULH 4OFKA 4X8JB 2H2SD 1HEZB 5EZJA 5FEBA 5K9JH 5CJ8A 3IDNA 1JIBA 5GGTA 3SO5A 5D96C 1G1YA 4LLQA 3UCRA 5F3HB 5FCSH 4L9LB 4M4RA 1IAIH 3MFFA 4ZYKA 3FO0H 1OAUH 4PLKC 3TYFB 3UTSD 3ALPA 1RJZA 4ZNEA 1CTOA 3C6LC 3P77B 2E7LA 1T0MA 3STLB 1D9KB 2GCYB 5KSAB 5D1QA 1KG0A 3AREA 3VMOA 3MBXL 2OTUB 3S5LA 4YHNB 1U93A 1YN6B 1W2KT 1INQA 2YC1A 4KHXL 4Q6YA 5KSVA 2VDRH 4ZUTB 3OKNB 5DEGA 1D5IL 4BYHA 3KJ6L 1GSMA 2YUXA 2X10A 3RUGA 5D7KE 4X83A 4U7SA 2XQBH 1ONQA 5C0JA 5FO7A 5JA9A 1CFQB 2BY3A 5FYKH 2X89A 1AP2A 4MAUH 3WYRA 3GI8L 1HCFX 5GRZA 3S97C 3CFKB 4G7VL 3QDHA 3H0TB 4TULL 1IGIL 3MNWA 4XCFL 1Z3GL 5CJQH 5DFTA 5IIEB 3BVNB 2K1MA 3HE7C 3G08B 3N85H 4CW1B 4EI5C 2V2WB 4O02L 1O7VA 4F9LA 4DVBB 1A4JA 4RWYL 5GSRA 4LBEB 1B2WL 1MFBH 2PYFA 1QKZL 3DXAE 3Q48A 5HTSA 5GGQH 2MQ3A 2VR9A 4ZS7H 3BE1H 3Q5OA 3VFTB 4BH7B 1QFWI 4ODTL 3HZVA 4GRWE 4PB9H 3RU8H 1NGPH 4EUPH 3L5WB 4N5ED 5F9AC 4JR9H 5BMFL 4U6VL 2W0LA 3NH7H 1VEMA 3LS4L 4Y4KA 4I48B 2QLVB 2EXYD 1KIRA 4G6JH 2J2ZA 2NW3B 2R56H 4Y19D 5D7KD 5T3XL 3TLRA 3G6AB 3MV11 3LMJH 1QR1B 3C5SA 1L9MA 4FFWD 1HKLL 2QHRL 2XY2A 1NKOA 3MACL 3V6ZB 4ORGB 3CH8A 1IAOB 4JQVA 4XNXL 4Q74A 3WFEL 3OX8B 4MHHG 1X5LA 1EBAA 3STZA 1XGYH 2C7UA 2GKIA 1J0HA 3LIZL 2EKJA 4QRUB 5JIPA 3SHSA 4GO6B 3WFBL 1QSEB 3TJEH 1KLGA 2HT2C 4NRXA 5IFJB 5TPWH 1NPUA 4U2YA 4JFEE 1KFAH 1IARB 4PJGF 3T0BA 4PJHE 1GZQB 1NFDB 3DXAD 1IKFL 5TQ2L 1P4LB 3T0DA 1AXTH 1TJHL 3B43A 2CR6A 2HJLB 5ITBL 2W60B 4PGEB 2QQLH 4ZAKD 4GRLC 2FEEI 5DHVH 1R3JA 2FHFA 2Q86B 1A6TA 3IETB 3Q6GH 3VI3F 1YEDA 4TUJB 1OOAA 2VZSA 3VFRA 1VFUA 5EZIH 4H26B 4U1JA 3RGVB 4S2SB 1IGML 4Z76A 4X7FC 3BKYH 2Y1VA 5IBLC 3A0OA 1ITBB 1ZLWK 1HIMH 1G7MB 5F96L 5C0CE 4EJ1C 2ID5A 3H9SE 1EMTH 1P84K 2G60H 3TT3L 1FRGH 4YJZL 1AO7B 4Y4FB 5C0AE 4DUWA 3LEYL 4OLYL 5L7XL 4MQ7B 1GGCL 5MEOB 3WFHA 3ZDZF 4JFED 1ETZA 4AMKL 1ZLSL 3VWJB 4EZMA 4FQXC 2Z31C 4QRTA 4MAYB 2DLIA 3O2WL 1Y6NR 1P4IL 3KG5A 4FQQB 2I60H 3UJJH 1WT5C 1PJ9A 4Q9BA 3MLUH 2P5WB 4OCSL 2VDLH 1JNJA 4UTAL 2V6HA 3V6FA 1ZGLM 5JOFB 2VL4A 4K9EH 1T7XA 4E42A 1BJ1J 2I25N 4TUKL 3WN5A 5BZWA 2UWEB 3BH8A 5GGUA 5C0NC 4NFDA 3R0MA 5IQ9B 4N0FA 1TJGL 2Z93A 5HGHA 4WTZG 4P4KA 4U1NB 5C0CD 2VWEC 2VZUA 3UPRB 4K55A 5DO2C 3H9SD 5GJSL 2R4SL 2DQUL 4HG4K 5J6HA 4N1HB 3L3GB 5C0AD 3K81A 1MLCB 1S78C 3EO0B 2NLJA 2J8UB 4NHUA 1EEYB 4P23C 3T0WA 2YPLE 4LARH 5E7FA 3S98A 2LTQB 4R8WL 5CSZA 2GUOA 3T0XA 4I5BB 4MNHA 3EKCA 3HAEG 5I18L 1EAPA 3PQYA 3RUGF 2Y06L 1G7JB 2D0FA 1XCQB 2NX5E 3T0EA 3HNTL 3O9WA 1JPSH 1CFSB 5C2BL 4C83A 5IW6B 3NACH 4LCIL 2AJ3A 1MFCL 3RL1A 3T3PF 2PO6B 4APQC 1J05B 2C4FT 1CL7H 3W9DB 4POUB 3H3PL 5FHAL 5DZOA 3LKSB 4WWKD 5IVZB 4KHXH 5D1XD 1X5IA 4O51A 3T77A 1LQSR 1D5IH 4FABL 3KJ6H 4OIBA 3O6FB 2BSRB 3D25B 5HGDB 2ZNWA 3TO4C 3BP6B 5I1HL 4HZLA 3IDMA 1LMKA 1PY9A 2FLBT 2YPLD 3TBVB 1K9TA 1T7YA 4JZJC 5AUMA 2B2XH 1A7OH 2W9EH 5F1NA 4G7VH 2A9NH 1I9JH 4TULH 1UM5L 1IGIH 4AZ8A 4QNPE 1Z3GH 1O0VA 3I75A 1PKQB 2EDOA 2GQHA 2RBLA 4JPIB 1JF5A 1V7ML 2NX5D 2APXA 1I1AD 1QFUL 3QUZA 4O02H 5EUOA 4LRNL 4RWYH 1I7RB 1B2WH 2J6EL 5BCAA 1QKZH 1ZHKB 1A8JH 2F54E 3VG9B 3C8KA 5J06A 3FT4B 2ADJB 1FZOA 4XNYL 4D3CL 4ODTH 3W81A 3KLDA 1H3GA 3VXSE 2JJTC 4GKOA 3AROA 2NNAB 2CLZA 3B3IB 5BMFH 5DMIH 4PJCA 3VRJA 2Y7QA 4MX7A 4ZNCD 1R3KA 5DTFB 3U4EA 1JZ8A 2FIKA 3V6BR 1TMCB 1HKLH 2QHRH 3SJVA 3LN9A 3TZVA 1BF8A 3MACH 4NZUH 2H2PD 1I9EA 1YYLH 4JO3L 4UBDC 2H1PH 4M4PA 3UTTB 3WFEH 4YX2L 1LVEA 4NGHL 2OJEB 5I1DB 1BOGA 4G3YL 3LIZH 1PY4A 1E4XL 2PCPA 4K7PL 2FX8L 3ZE1F 4WTZA 5ICYA 3WFBH 1JV5A 3QXAB 4E41B 3DVIA 5CEYB 2PTUA 3BPOC 5F9WC 5FB8A 1OGAD 1A21A 1NKRA 3QCVL 2FZ3A 4K8RC 1IKFH 4FQHB 2F54D 1TJHH 5ITBH 4BZ1H 4FN0A 1E28B 1PGRB 3FZUC 3B9KB 4P2QA 2UYLB 3CFEA 3CVHB 3WCYA 4ZFGH 1A47A 1CR9L 5F21B 3B2UC 4PTUA 5IM7A 4KFZC 4MXWH 3VXSD 3HAEA 1UCBL 4JFXA 5IG7A 3TVMA 3W9EA 2XQYK 5HHPB 4S1DC 3HPJA 4KXZI 1IGMH 4P48A 1RVFL 1DEDA 1EO5A 1BPVA 3P9LA 3L9RA 4BSJA 2G5BB 3HB3C 5JMOC 3ZSSA 3TT3H 1T1ZA 3L3IB 3LEYH 3H7BA 5L7XH 2EYTB 4TPRL 3MRGA 4RFNC 3E3QC 3QIWC 3M17A 4XHQA 1DN0B 1WWWX 4MCZA 4GOSA 4OUUA 3RFZC 4R90H 1IL1B 2XACC 4TYUA 3TN0A 3QQ4B 3O2WH 1P4IH 1I4FB 3HLAB 1BBJB 2BC4A 3O4LE 4U33A 3C09C 4PJ8A 5LGHL 3U36B 5KZCD 4OCSH 1V8HA 4LSSH 4UTAH 1NFIA 2NZIA 2R2BB 3I6GB 3ZTNL 4TUKH 1JGLL 4WFFE 4Y2DB 3VA2C 2H9GB 5JHDA 4I0PD 4LPXA 4M7KL 5D5MB 5GS0C 4QHLA 2C3VB 4XBGA 5HJ3A 1I9RL 2F74A 1CQKA 2HVKA 2X1XR 5GJSH 2R4SH 3GSRB 3ZTJH 4PJ9B 1CVSC 3HS0B 2D2OA 4YHZH 3S37X 4M6NL 4YXHL 3WHE1 4ZOEA 1ND0A 2X4OA 3QHTC 2KH2B 1CXIA 2DAVA 1IGTB 2ZUQB 3WDIA 4OCNC 4PG9A 1P7HL 2Y06H 2X1QA 4GAJH 3O4LD 3W39B 3HCVA 1RZ8A 1PQZB 1JRHI 5J6GA 3SCMC 3V6OA 1MF2L 5C2BH 3K4AA 4B0MM 3RWCB 2AKRB 4AQOA 5C70A 4QF1B 1KCVL 2C9AA 4LCIH 4WFFD 1MFCH 1W72B 5HYSB 1SY6A 1YEGL 1S8DB 1HWGB 1R3HA 1TQCB 3QEQB 1FFNA 4AG4L 5GS1C 3KYOA 1XGQA 4O5LH 4F3FA 4WW1B 5B4MC 3IAGC 1VFOA 2XICA 4FABH 3KYMA 4JY6B 3SDCC 1K2DA 3NABL 1T4KB 1XF5B 2VAAB 5IBTL 2GSIB 4HUXA 3DUUB 1RUQL 4X9IA 1JK8B 2AV1A 9CGTA 2EC8A 3MLVL 4DCQA 2DTML 3OPZL 5E8EB 2IFFL 4XHJC 3B4NA 3MNZB 3MBEB 1BF2A 4PJCF 1UM5H 2H26B 1XGTA 1NMCB 2BZDA 4U1IB 4JKWA 3D85A 4PBVC 5BVJA 4LCWE 4I2XE 1RK1B 4JJ5A 4JQXA 5CKGA 5DSCA 3SPVA 1V7MH 3ZKMD 1ROWA 1DBJL 4LRNH 3B6SB 3IXTA 2BVOB 2P8LB 4JDZB 3EO1A 3SOBH 5C0EA 4M7JL 4Y5YB 1F6AA 3B8YA 4PJDE 2VXSH 2A9ML 1N6VA 4ZTOL 2D9CA 1T66C 2IPKA 1ZSDB 4L1DA 5BW7C 3KPMA 4JANA 4XCEA 1A6UL 1WZLA 1XCTB 3VXTB 1YMME 1DSFL 1BZ9A 2LAAA 1L7TH 3KS0H 4XVUD 3Q5YA 1WLHA 1WZ1L 1DQLL 3KPNB 4L9LC 4X4MA 1EGJH 3FQWA 4Y5XB 4UNTA 1QNZL 3HI6L 1V3JA 4JO3H 5I0DA 1NUFA 2EICA 1BLNB 4YX2H 1JYVA 2QSCH 4NGHH 4G3YH 1E4XH 4K7PH 2FX8H 4HIEB 2MPAH 4OCMC 3QG6B 1D9KC 4LCWD 3MLYL 3C5ZB 3KYNB 1FAKT 3I6KB 1R5VA 5KSAC 1UB5B 3CX2A 3VA6A 3IJHB 5TF1L 4FQ1H 1D6EB 1EXUB 4P4RB 4UQ3A 3DMMD 4Y89A 1T20A 3ECBA 4OGAC 5ISZE 3HE6A 1CR9H 3LPWA 4KI1A 4LHUB 4EXKA 5EPMB 1X5XA 4JZOB 3HC0A 4JCLA 4MZ3A 4LQ1A 4U49A 3PIQA 3HPLB 2PW1A 1YMMD 3FT3B 3SDDB 4GBXD 4M9PA 3MJ7A 5L9DL 1FORL 4TRPL 3FOMA 3BP5A 5F9OH 2ZPKL 1OPGL 4G6AC 4HS8H 1EJOL 4X7DC 3FB8A 15C8L 3GHEH 3MLWL 4HEPG 4GQ9L 3SN6N 3H8NA 2EDDA 3ARBB 1YJDL 2NZ9C 3GB7B 4TPRH 4JKPL 5AZEH 4YR6A 6FABH 1BFVL 1KB5L 1GXEA 3GMPA 4ONGL 4HPOL 3TA3B 3PDOA 3IDGB 1ZWIB 3GGWB 1I1YB 5ISZD 5C0FB 3DO7B 5IEHB 2VIRB 4NQEA 4ZTPL 5KS9A 4R3SA 2XN9A 4PRPB 2VXUL 4ODHH 2DMKA 3HMXL 4QGYA 4R4FL 5EU4B 4GQPH 2VKWA 1DQQA 4G5ZH 1NAMH 1MFDL 1FO0L 4G8GE 1K8IA 3VFSB 3QUYA 3RVTC 1A6AB 1IM3B 4OI9A 3SQBA 1NUNB 1HSBB 3JWOL 3E6HB 2CQVA 3MR9A 3IFOB 4XTRC 1B4JL 4CMMA 4CJ1A 5H35B 2DIJA 2VSCA 2CUHA 2JLLA 4M6NH 3DIFA 5AWNH 3U1SL 1MHCA 4AENB 1FG2B 5FYLE 4Y5VA 5HHME 3QIUB 4U0RB 5CGYC 3TBYB 5LKNA 2R9HC 3RGVC 1FO0B 2NW2A 3QFJE 4XNMB 1KXVC 2BNQB 4XMLL 3VRLE 3RX7A 2APBA 5I0ZA 3OB0K 3CU7A 3BMVA 1KCVH 5CZXC 2WWMC 1U2CA 5D6CA 4Y4FC 4G8GD 4ODWA 2G2RA 4HAGA 4KRLB 4TNVF 5IOPA 4AG4H 4HWUA 3DOSA 3O3BB 3PABB 4HLZH 5EOQH 2YA2A 3QUXB 4QEGA 2CDGB 4XXCA 3VWJC 3WIHL 3MLZL 4QHMB 1YY9D 4MAYC 3NABH 2O5ZL 4X4XA 5CP7A 4Q7DA 3PWPB 3FT2B 1SYSB 4HKZA 1A7PH 1CDBA 3MLTA 2APFA 3IAQA 2DTMH 4XP6L 3TF7C 2IEPA 4AM0B 5FYLD 1JF6A 4G43B 5HHMD 2X70B 3IT8D 5DI8B 3WHXA 1G9NC 4PJAE 5EZLB 2AJZA 1BJMA 3QFJD 1W0VA 3ULUH 3VFVB 2R2HB 3C08L 3RDTA 3E8UL 1C5DA 1DBJH 3OKLB 2OZ4L 1RUML 3MRJA 3S9DB 3FB7A 4NDMB 2APWA 1MCRA 2IPTL 5F1IA 4M7JH 3D2UA 3LKRA 32C2A 2VE6B 4U1MB 2NCMA 4ZODA 3BP7B 3I3EA 5C0BA 2VUOA 2A9MH 1J8HE 4ZTOH 3BW9B 2ICWB 4M03A 1ZKAA 1UADC 4IRZL 2LTQC 1LK3L 1A6UH 5I1AB 1SEQL 5CIPH 1T6WA 1CGUA 4PIRF 2CLRA 1A1NB 1LK2A 5EC2B 1DQLH 3TFKD 1RZIB 3IU3A 1QNZH 5FUOL 4J3XA 1GOFA 2R2EA 5CBEA 1OSPH 2XWBB 2L7UA 3CMOL 1OCWH 4N1EA 4OV6F 5GRVK 3IJYA 4QXTB 1HILA 2PO6C 1CD1B 1CDCA 1X5GA 2DJSA 3PGCA 1WWBX 1T5WB 1XF1A 5TF1H 5A16A 5E24E 3EW3B 1R5WB 3OKDA 1U91A 2W9DH 4MJ5B 4NWTH 1IAII 4XBPB 4NKMA 3M1BA 1ZXQA 3UYRL 4BQBA 1T83C 2R1YB 1MI5B 3O6FC 2JB6A 4QXGL 1TJIL 4M61A 1CDGA 3RWHA 4RBPK 4L8DA 1J8HD 3VFUB 4LASL 3NA9L 3V95A 4WENB 2A73A 2CUIA 2W65A 3LKNA 2COQA 4OKVA 3UDWC 1NDGA 4KDVA 5L9DH 3NCYS 3BGMA 1I9IL 4HGWB 3ESUF 2L4OA 5GSVB 4HJ0D 1F58L 1EJOH 4X6DE 5KS9F 15C8H 4B41A 5EULV 2JTDA 1RZGA 2FJGB 4HWBA 3VG9C 3MLWH 4GQ9H 3QPXL 3MV8B 3O8XA 1FNGB 3K0WA 3FFDB 3V4PL 2H41A 4ZUWA 4A6YA 3ZKNC 4QHKI 1FJ1B 1DZBA 1BFVH 1KB5H 1KV3A 4IRSB 4C4KT 4ONGH 1AGDA 3NBNA 4M1DH 3S35X 4KMLB 5C7XL 4LCYA 3MLRL 5ADPL 4KK8C 3F7VA 4LAJH 3PL6D 3TWCL 2GITB 3MJ9L 1RIUL 4Z7VA 4X6FB 1RJYA 1ZLWH 4I9WE 2VXUH 3HMXH 4R4FH 3FQTA 4TTDD 5HHNB 3FFCA 4HUVB 4QRQA 1UXSB 1KLUA 4PJ5E 5K33A 2Z8VC 4NKQB 3WLWC 4NQDA 4ENEC 1MFDH 4Q2ZB 3VGGA 4Q0XH 2X42A 5IQ7L 3KPPB 5MEPB 1IRAY 1G7LA 1FN4A 5GGRY 3S96A 3C5JB 1R24B 2EZ0D 1QA9B 3QHFL 3BWAB 1KPVA 1FL5B 4P46A 1MRCL 1B4JH 3B9KC 1RZKH 3SEPA 3L5IA 1KNOB 3U7YL 3UTQA 1FVCA 3KXFA 2GTWB 4Y16B 1G6RB 2Q6WB 5ENWB 3FO2B 3JWDC 3U1SH 1DLFL 3IXAB 4OGYL 4YZFE 4QT5A 1BIIA 5FA3B 5JW4Q 4PYHA 2NY5C 5HDQH 2CGRL 1ZANL 4G80A 4KROD 5EUKB 4ZSOE 5MI0B 4XMLH 3WUWG 1I3GH 4WI3A 4I9WD 2DYPD 1I3UA 3G6JB 1GVIA 4Q97A 1WBXB 2AXFA 5BOPA 4QOKB 5DJDB 4YK4B 3INUL 1CFTB 4PJ5D 2WNGA 4FXGA 2FSEA 2H8PB 2LABA 1LD9A 3HRPA 1ZS8B 4MA7H 4RGNE 2XOTA 1BAFL 3WIHH 2WBWB 3VCLA 5GGTL 3BDYL 1AKJA 43C9A 2XG4A 2VLJE 3RIAF 5DJZB 1R3LA 5IBUB 5I19L 4XP6H 1G1CA 1CFNA 3F8UB 5HYFA 2O61A 2VERN 5DC4B 4LU5L 2J4WL 4Y2DC 3WEXB 3J8F7 3RZWA 2W0FB 5KSUA 1V5JA 1T89C 2HFGL 3HRZA 4Q58C 4EDXA 5AG9A 4F8QA 4X9GA 4MNQE 4WEBL 1XH3B 2R39A 4YFDB 1EEQA 2OZ4H 3FONB 2HG5A 3TNMA 3IDNB 5ILTL 1IAKA 3GMQB 3ARFD 1U8IA 4YDJB 3QWOB 1FFRA 4PJ9C 5TDPB 5HYQA 3OJDA 3BZDA 3REWB 4RGND 5DEZA 1QSZA 3MRBA 1VADA 1LK3H 1G9MC 1IM9D 2ZUQC 5I1LA 4H0IA 2DQHL 1SEQH 5JHLL 4P2RE 1MFEL 3SDAA 3PWUA 2VLJD 4UILH 2Y4SA 2ADGA 4HV8A 2YC1B 1JI1A 3DV6A 5FUOH 5T1KB 5KSVB 2EE2A 3KPLA 4IRJA 2XNAB 5DEGB 1Q1JH 1S7SB 5ANME 3OXSB 1ONQB 2LQRA 5HI5D 4UT9H 5C0JB 2V17L 1EHLL 3Q1SH 5FO7B 5CEZH 5DD6A 1TQCC 4MNQD 5DHVB 3UYRH 4NQUA 3DETC 4MVBD 3MRNB 3P9MB 1PZUB 1XFPA 2Q7YA 3K80A 1NBYA 2J88H 4QXGH 2NY2D 3X3GL 1RURL 1B0GB 5A2KH 3W5MA 1CL7I 2OP4H 5HHQB 3RZCB 2RHEA 5M94B 2J3SA 3HR6A 1CGVA 2PYFB 1O5DT 4YHKL 3MBEC 2VLKA 1NMCC 3BDXA 3WUWA 3F7YB 3OF6A 2LU4A 1NCWL 1F58H 3U0TB 1MCPH 4HG4J 5DVKA 3BRFA 5F7WC 3VWKA 5GIRA 5AAMA 5ITFB 5EBGA 5TF0A 5ECJE 3C5SB 3RVVC 4Y5YC 3V4PH 3CFJB 3VXRE 4L3CB 2K9UA 4LGSB 1P6FA 2GIYA 1Y0LA 1KC5L 1KCLA 1CZ8H 3MCKB 1NGWB 1LEKB 3VXNA 2ICWJ 2NYYC 5C7XH 1A9EA 1QLFB 1I7UA 2PN5A 5I30L 3JTSA 1KLGB 4NRXB 5H37G 3MLRH 5ADPH 4FNLL 1H0DB 1HSAB 1D5BB 3TWCH 1F3RB 4YAQB 1HK6A 3MJ9H 4Y5XC 1RIUH 5JMRA 3GHBH 3BZFA 4X6EA 5KSBA 4CNIA 1I8KB 4ZO8A 4MD5A 4GG8B 2CK0L 4LPYA 5FV2A 3PWNB 4P5TD 4XXDB 1W8OA 1OW0C 3O3DA 1JTPA 3CMGA 5EO9A 5ESAB 3UJTL 3WNNA 4CVZA 3C5ZC 5FYJU 4DKAA 3X3FL 5IQ7H 1A6TB 4KK5D 1MFAH 1LHZA 5BVPL 4PLJC 2XWTB 3U9PL 1QRNE 3OV6A 2JCCB 2B1HL 5CILL 4U1JB 3UMTA 1Z0NA 2X09A 4M48H 4KKCD 3TYGL 3EYQC 3WDHA 1BVKA 2VXTH 3CCHB 3VXRD 3JV4A 2V2TA 3B8SA 5ID1B 3U7YH 3QDME 1A6PA 3AXLB 4KK9C 1DLFH 4OGYH 4WHDA 1DP0A 1OQOA 4GSDH 2CGRH 1ZANH 4N9GA 5LQBL 3SDDC 1F8TH 3MRMB 3VXPA 2QQNL 2NY1B 2R69L 3D0LA 5DJ2B 4YPGB 4S0TD 5FGCB 1ETZB 4HIJA 1FNAA 4P5KB 5FGSA 1MWAA 3DWTA 5C07B 1FAIH 4CJ0A 3VDAA 4NHCL 5IEKB 2Q7NA 5HY9A 3INUH 4GXVL 1JN6B 5IWLC 5T1LA 4KKBC 3ARBC 3ET9F 4Z7NF 4LLYB 4JO1L 5GGVL 2HN7A 5DD1H 1ZA3B 1BAFH 1U8OA 3MMEA 3TA3C 1QRND 5FECB 4AJ0A 3FAXA 5GGTH 5JW5A 2NY3B 3BH8B 5GGUB 3QXDB 5DURB 5D7JD 5MERA 3BDYH 4OD1H 1G7HB 2ED7A 3QDMD 4EDWH 5ICZA 4XNUL 3ZKSD 4L8BA 3WFDH 2B4CH 2KQNA 3HG1B 5I19H 2FLRT 4NT6A 4WFEE 3NZ8A 4GKSA 4QRPA 3TO2A 4KY1L 3CLEL 4L4JA 1EAJA 4LU5H 5J6HB 3ULVE 1QPPA 3M8OL 4FTVE 2OBGA 4ODSL 3VGDA 3SE9H 5FO8B 5IESL 4KV5E 2HFGH 2NLJB 1CK0L 1YJDC 3SE4C 2VL5A 1LP9B 5F9DC 3LQAL 2BOCA 1B0RB 4WO4A 4WEBH 3NIGF 1A7BA 3NFSL 2VITA 2EDLA 3D87B 3QO0A 4NQVB 4PRIA 5ILTH 4GS7B 1K5NA 5EOCL 3ARDA 3BZEA 4OB5H 3VXMB 5KVMC 3T0EB 5I73B 5DRNA 1K6QL 4UU9A 2FJHB 3QCTL 2F53B 5SX4H 4LQFL 2VDQL 3PWJA 3H6JA 3QIUC 3DX7B 4JDTL 3RL1B 4U0RC 3I84A 4XPGH 4HKBB 5IVXE 5JHLH 1MFEH 4L1HA 4XZUA 2A6KB 2WUCH 1AC0A 5CLWA 4WFED 4O51B 4RWHA 3S7GA 3ULVD 2GTZA 3IDIA 3QO1B 4QWWD 4FTVD 1F3DH 3QHZL 1EHLH 4MNGE 2CXGA 5C09A 4DKFH 1CICD 4XWOD 4G6FB 4PRAB 4XPTL 3O2VH 2OSLB 2HFEA 4N8CH 2IAMD 5IF0A 4GW4A 3QUXC 1Y18A 4L4VA 2YZ8A 1SEBB 2X4SA 8CGTA 5T3ZL 2NR6D 4PGDB 1RURH 2ZSWA 3C6LA 1MQKH 4KGLA 3OKOA 4UOW0 2YBRA 3WFCL 4XWGH 1ZGLB 3ZKXB 4ODXB 4RMWA 1F3JA 2AGJL 1DBML 4P2OD 2P5EA 5MENB 4L29B 4NIKB 2DJUA 2IG2L 5IUSA 1RMFH 4GRWF 2C4XA 3TNNB 4C56A 2HJKA 2FCBA 1NCWH 4UOJA 3VJ6A 3EFFA 5K59F 4KQ3H 5F70A 4R9HA 5KSBF 5KVEL 4P5MA 3CH1B 4PPTA 3SQOL 3U4EB 2FIKB 4HZAA 5D9SB 1XF3A 1DE4B 4RFEA 5GJTH 3V79C 3WO3B 3ZYIA 3UYPA 5EFIB 1F6LL 4RAUB 2DM4A 4KUCF 4ZS6C 2HYMA 3HE7A 3ZYJA 2PXYA 4EI5A 3MJ6A 1JPGA 2M8XA 2DWDA 2A2QT 5T33L 2XZQL 2X4RA 5I30H 1I7ZA 1MHEB 4W4OA 4FNLH 3OZ9L 1FFOA 2FO4A 3DJ9A 3G04B 4QXWA 5HI3C 1E4JA 3GMLB 2Z8SA 3OGCB 3S36X 4HC1A 1J88A 4R2GB 3CFEB 5FYJL 1L7IL 2QEJA 43CAA 3ARUA 4EBQL 4F7EB 3X3FH 3CUPA 4C4KO 5KVGL 3M45A 1CYGA 5MEQB 1R0AH 1FPTL 5BVPH 5DLML 4JRYA 4XNQA 2BP3A 3U9PH 3HPJB 4W68A 1KB9J 4NQSA 2JK5B 3T1WA 3QEHA 3TYGH 4V1DA 3H9YA 1E4XI 1X5FA 2LU3A 3P9LB 5DUBA 4G8FA 1X6NA 4ZOCA 1KTKE 1DQJA 3DYMA 4PGCA 3BAEL 4PJFB 1GZPB 1JWMA 3RNQA 2WINB 1T1ZB 5LQBH 3T3ME 2E6JA 1JYWA 3MRGB 3QQ3A 2NY6B 2YPKA 3IDXH 4MA8L 4GRLA 4HLJA 4RAVA 1IC4L 1N4XH 1P7QA 1MH5A 2J8HA 4NHCH 2YRZA 2VLLB 1FYTB 4GXVH 4IOFC 4BSVA 2BC4B 3LVEA 3QNZB 2HP4A 5H94A 3QNYB 3FHAA 4IRSC 4JO1H 5GGVH 1F97A 3GSWB 3CPLB 3G5VB 3MRKB 1WZMA 4N0UB 3GMOA 5EU6B 4NC1E 1SJEB 4L3EA 2AK4A 3V5DB 3HUJA 1PEWA 4MSWB 4S1SH 1YC8A 4DW2H 4XNUH 1UFUA 5E70A 4OM1L 5GHWH 3OB0H 4KY1H 3L5XH 5JPNA 1K8DA 1SY6L 3M8OH 4ODSH 5J3HD 3BYYA 1CK0H 1T03L 2X4OB 3LQAH 5ERWA 3V52H 1VACA 1WT5A 3NFSH 3NCMA 5EB9A 4HK0A 4PG9B 1XZ0B 3QEGH 3U79A 3C9NB 2V9RA 4KMQA 1S5IL 1RZ8B 4L8CA 3DGCR 4JFZH 2EH7H 4Y16C 1K6QH 4Y7MA 5DJCA 5HHVL 3QCTH 4LQFH 5C0RH 4M8VA 4G9FA 3DV4A 3MV01 1XF4A 4NKOB 2FATH 3QJHB 3PJSB 2AS5M 2GFBB 2HRPL 1H3UA 1Q0XL 2OI9B 5E8OB 5MI0C 1DBBL 1IKNC 3F12B 1SYVB 5K9KB 1CWVA 3OHXA 4QRSB 4BSWB 4M7LH 4P23A 5J4MA 1HQRB 4YK4C 4LOUD 2YA0A 4RDQF 3QHZH 4UV7H 1HHGA 1I85C 1S9WA 25C8H 5F3BA 4ODUA 1A7NL 1WIUA 2NY7L 1Q0YH 5IKCA 5CSGA 2W38A 1D5XA 3H3BC 4R97B 3A67L 3MODL 4ZFOA 4QNPF 2YPVH 3CDFA 1AIFA 3FKUS 3K3QA 5CWSB 5DRWB 3WFCH 4HCRA 1W0WA 3GMNA 4HWNA 3EO1B 4KI5E 4NYLA 1JPST 2AGJH 4TUOB 1DBMH 4AL8L 3VG0H 1F6AB 4PJXA 4WI7A 5FUCE 3KLHD 3PWLA 3TCLB 4YGVA 3TO4A 3GBML 3QIBB 3ZLQC 4WUKH 5L88L 4XCEB 1JP5A 2F58L 4G6KL 5KVEH 4P2YA 1KTDB 3BDBA 4JZJA 1RSFA 1BFSA 4HT1L 3HAEH 1XF2A 5BRZB 5I8OL 1NCCH 4GG6E 2VYRE 5TE6L 4CMHB 4JREC 1U8MB 2VUYA 4G9DA 3IFNH 1MRFH 2IANB 3DROA 5DQJB 1A3QA 5KAQG 2EDEA 1S7WA 4JFDB 2H32H 3BIKB 4QHUA 5FA4B 1NAMB 3WDJA 1H8NA 4FQXD 2O26U 2ZSVA 3CC5A 4HX1A 5A40E 2FBJL 5I75B 1U42A 4F7CA 1OY3B 3HZKA 1N26A 1DLHA 1II4E 2ZUYA 4LLWA 5DC9B 3V7AG 4EBQH 2DQFA 4HPYL 3QPQC 1S7RB 4K3DH 3W0WB 3PIQB 1E6OL 4HJGB 4LCUB 4YE4L 4LIQL 5EOCJ 3WLBB 3OTTA 4E5XA 5DLMH 3HI5L 4TQEH 3Q0HA 3UBXG 5I8KL 4JO4H 5C3TA 2B0SH 4I3RL 4ZUSB 2JIXD 3BP5B 2Q8AL 1FGVH 3WS3B 1J12A 3RZCC 3BO8A 1CE1H 3LQZB 3BAEH 1KEGH 4NO0A 4XP9L 1S78D 2GJ6A 4QLRA 3P73B 4JVWA 3G9VA 3FQNA 3IF1B 2WSKA 4JVPA 3D9AL 2N56A 2OTWB 5D7IB 4D0CA 1A4KA 3MO1A 3ZYOA 2GAZB 4LRIC 4PJIE 1NLBH 5SWSE 1OARL 2NXZB 2FGWL 1BZ7A 5EBWB 2WIIA 4JG0L 1BVLB 1I8IB 3BJ91 3GMMA 1Q8MA 3KPRA 1Z5LA 4R3SB 1T3FA 2XN9B 1HNFA 1QQDA 4BH8B 3WS6C 3BISA 1YPZE 1UKSA 4LEOA 3IFLL 2Z92A 4APQD 4YC2B 3J7HA 4YO0A 1LGVA 4YHIA 2EIZB 1IGJB 5GRYA 2BJML 2PW2B 3MV7A 4JPVL 1K8IB 1MCWM 3IGAB 4RSVA 2B39A 1XGPB 1D5ZB 4NCDA 1JPTL 2BXZA 3MRDB 4QTIL 4NNXA 3MR9B 1SY6H 4OFYD 3T1FA 2EC9T 3SKMB 1WCQA 5JXAL 4PJ7B 5HDBF 1JHLL 3O6ML 4GFTB 3DIFB 4LPCA 2VR5A 1A14L 4Y5VB 5SWSD 5DGQA 4U1HA 4AT6A 1CFVH 5BO1H 1UA6L 4B50A 4L4TA 4OZHA 5DHXB 5DFVC 1FNHA 4I4WA 3VFWA 4XX1E 1H8SA 3GI9H 1TTGA 5CIPB 3TV3L 5IV2B 5HHVH 3K4DA 4PTTB 5FK9A 2R23B 2C1OB 2HKHL 4JFHE 2HJFB 5F88A 3W11C 3GSNA 3QUMH 1N7ML 1VEOA 5D6CB 2YOCA 5CGMA 1A7QL 3UJIL 1JMZA 4X98B 1QSFA 1T2JA 2XPGB 3S37L 2HRPH 2NY1C 4M02A 1Q0XH 5IOPB 5HGBA 1DBBH 1JF1B 3S6CA 3B5TA 5D1ZB 1BD2E 1OSZA 3I02B 3NFNB 1EHXA 4YGAB 1FP5A 1PLGL 5DD5L 1HI6A 3VGEA 1YMHA 3FJTA 4OJFL 1QG3A 1A7NH 4HKZB 4PJXF 4F7MA 5FKAB 2VAJA 2JF1A 5DJ6A 4WWID 3BXNB 4X0KB 35C8H 5E4EB 3MGOA 2NY7H 2ZOLB 3RVUC 1QBLL 4FXKB 3UBXA 3D18A 3RTQD 4BKLA 3A67H 3SCMA 1KCRH 4K2UH 1BWMA 3MODH 2NY3C 1CGXA 4OZ4A 5FYKE 3MFGB 4MJIE 4FQIL 4KH2A 1BQSA 5DJAA 3MRJB 4JFHD 4UAOB 1JYNA 1JZ6A 3FZUD 8FABB 3RKPA 5GS1A 1L6ZA 3VFPB 4AH2A 4AL8H 2VISB 1YEFL 2DQEL 2ZZUT 2GT9A 1GPOH 4PJDF 2D7TL 3SDCA 3GBNH 3N1QC 1BD2D 3MUJA 4YXKL 2CDFB 1KGCE 3H3KA 3GSVA 4JFQB 2GJZB 2F58H 4WHYH 3BH9B 4XRCA 4GS7C 2CLRB 4A2LA 2W59A 5FGRA 4F9PC 2V7NA 5BV7L 3T0EC 2DBJA 5I73C 1T1YA 3CFBA 4TOYL 3SE3C 2R0LH 3P0VL 4O2CA 4F58H 2YD5A 2AXGA 4UT7L 4GW1A 4Z7OE 5E94A 5TE6H 1M7IA 4PY7A 4MA3A 1HILB 5KVFL 4MDIB 4N1CA 3SKJL 4F8TA 5FYKD 3Q6FA 5E9DD 1J86A 4P9HC 5FYLH 1ZHBB 4Y4HD 4ETQA 4U3CA 1DFBL 4Z5RB 4NKMB 2CKBH 3SGJC 4HWBL 5HHOA 5E8DL 2IMNA 4Z78A 3DHJA 1V3KA 2JB6B 2Z91A 4HW6A 4OZIB 1KYOJ 3RWHB 4A6YL 4X8JA 5JQ6L 4L8DB 4HPYH 3D3VE 2MSPA 1E6OH 2OR7A 4RFOL 1KGCD 2W65B 3FB6B 4L9LA 3LKNB 4AK1A 4CN4A 5IMKB 2M2DA 1AXIB 4WUUB 1XIWA 5JW4M 2NXYB 5I8KH 3P0YH 4M3JA 3TYFA 2F8OA 3T4YB 4I3RH 1MREL 1WGOA 2Q8AH 2DQCL 3D1MC 4KUZH 4FFZH 1C12B 1D9KA 2GCYA 3CAFA 3FN0H 4NUGH 3R06B 3ZKXC 4I0KA 1MAML 4KJQD 4XP9H 2RGSA 2OTUA 3C60B 5ALBL 3TJHC 1YN6A 1KN2H 1D6VL 5JW4N 2CJUL 1F4XL 1SHMA 4ZUTA 3OKNA 5E6IB 3D9AH 3RWIA 1W0YT 3IU4L 5FDWB 3WXVH 1VPOL 2ED9A 1CFQA 1CBVL 2PUQT 4Y2OA 1ZHNB 3BD3A 1YEKL 4JG0H 4LCYB 4P59L 3CFKA 4HIHA 3F7VB 4IMKC 2AJXH 3H0TA 4PUBL 3D3VD 4ZQKB 3IS0X 5IIEA 3BVNA 3UAJC 3G08A 3FFCB 4M93B 3F62A 3IFLH 2V2WA 4OZGB 3VFGL 4QRQB 3OAUL 4DVBA 3UROR 3NPZB 4LBEA 2XZZA 1XR9B 4ISVB 4U6YB 2ESVB 4OZHF 1NC4D 4JPVH 1FN4B 3S96B 3L5HA 3D69B 4BH7A 4HKXB 1JPTH 4I8DA 2D7MA 4WFHE 1EX0A 3L5WA 1NLDL 4R2GC 4MJ2A 2C1PB 3L3DB 4ONOA 3MZTA 1ZGLP 1JHLH 3O6MH 1JNHB 3HKFA 3DX8A 1A14H 2JB5H 1QR1A 1JWSA 3QQ9D 5GS2H 2YD1A 3GKWL 3MV9E 1A64A 4ORGA 3WL9A 1IAOA 2DF3A 3OX8A 1U58A 5FOJA 1NGZB 4XMPL 4NBXB 1QSEA 5DT1L 5IFJA 4HF5H 5FAAA 1FDLL 2XTJE 4FXGB 1GZQA 1NFDA 1P4LA 3S37H 1NAKH 2HJLA 3EZJB 2NY6C 4K3JL 3PUCA 4EOWH 3PHSA 4JHWL 2EDBA 2BVQB 4WFHD 3EOBB 2Q86A 3IETA 4CDGC 5IB5A 5DD5H 4TUJA 4HIXL 1J0KA 2D4FA 4H26A 1QBLH 5T1DL 4S2SA 3RGVA 4RX4A 4LSRL 3MV9D 1IZKA 1G6VK 3PP3K 4J3TA 3SDXE 5KSAD 1G7MA 5KSUB 4EDXB 4Q9CA 4MB3A 2M26A 3L5JA 4FQIH 1AO7A 4Y4FA 2RIKA 4L5FL 4JY4B 4M9OA 4X7TA 2FBOJ 3VD7A 5B3JF 3UTSB 5ESQB 4MQ7A 3TNMB 1C5CH 1A22B 4J1UB 5MEOA 3QH3A 4OCWL 5FKPB 4OQ1A 3KPSE 3HI1B 2XTJD 1YEFH 1YZZA 2DQEH 3FMGL 5EU3B 5HYQB 2V2XB 3VWJA 1DUYB 4MAYA 3O3AB 4FQQA 4HXAL 4YXKH 4K3GA 1PG7X 2P5WA 2B1AL 2Y36L 1ZLVK 4ELMA 5JOFA 3SDAB 2HA1A 2UVFA 5BV7H 4G6AD 2ADGB 3V6OC 3LH2L 2Q8BL 2UWEA 2P47B 4TOYH 4IRJB 3P0VH 1JGVL 3ARGD 5IQ9A 12E8L 2I24N 3HNSH 4EIGB 3H9HB 3QI9D 4U1NA 3UZQA 3UPRA 4JPKH 3B9EA 2OI9C 4R7DB 4X5WB 3L3GA 1S7VB 1RZ7L 4N5UA 1XAUA 1MLCA 3EO0A 4HWBH 4XPAL 5E8DH 2EIBA 2J8UA 1EEYA 3VW3H 3KPSD 5SX4I 1B90A 1NBYB 4UQ2A 1SJHB 4YLQT 2IQ9L 4P2RA 2GSGB 4A6YH 5JQ6H 2VABB 1JBJA 4I5BA 1T21B 3QDJE 1M71B 3FO1B 1G7JA 2HVJB 4URTB 4RFOH 4R97C 3V8OA 2NY4D 4LLUB 1NC2D 2BHYA 1XCQA 4RMTA 1OAQL 1NBZB 1CFSA 1YECL 1YEJH 5ETUA 5A1AA 1JPFA 4PJBE 5IW6A 1MREH 4N0YH 1AI1L 3CFDB 2OR9L 2PO6A 3VE0B 1J05A 4DN4L 3I6LE 3W9DA 2C3WA 1N0XL 4PRHA 5IB1B 3LKSA 1F4XH