4YHIA

Reversal agent for dabigatran
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGETNPRNGGTTYNEKFKGKATMTRDTSTSTAYMELSSLRSEDTAVYYCTIGTSGYDYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aDabi-Fab2a heavy chain
publication title Structure-guided residence time optimization of a dabigatran reversal agent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhiA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhiA01
1WBZB 2G75B 4TYUA 3CVHA 3S3PA 1UWGL 1F4WH 2CSPA 4ZYKB 5GHWL 5IW6A 4MA3A 3NFSL 1QQDA 4LP4A 3ZYZA 5HD8D 1ZT7B 3V5HA 1EAJA 1X9QA 1MWAH 2WSKA 3P77B 2BRRH 1QUNA 3DUSB 3V0WH 1OW0C 4PTUA 5IFHH 3G5XA 3DVIA 1YYLH 4DKFL 5K9JH 3P0VH 4JFDD 4MNQE 1AC0A 1XGYH 1VFBB 3RZCC 4S10A 3RTQA 4O2CB 2VQ1B 4F7PB 3LS4H 4NRYA 4ZFZB 3QHZL 1TZHA 3MNVB 3V6BR 5FO9A 3S37L 3TZVB 3GI8H 1MJJB 2W07A 4KRLB 3FL7A 3KPRB 1EH9A 5A2IH 5HY9B 5IESH 3JV5A 4OT1H 3CAFA 3T3MF 4QNPE 3LDBC 3RUGE 3TCLA 4C56A 3K3QA 2DKUA 2AK1L 4HUVB 4IRSA 4PY8J 1S9XB 3BPLC 4HEME 1X5FA 3NVQA 1M6OA 1TTFA 2X4TB 3PQYD 2IADA 2PTTA 5BS0E 4XZUB 4M7KL 5ITBL 5MENA 1J87A 4R0LC 2OTUB 2HG5B 4OLYH 1MVUB 5AWNL 2NW3A 5JPMB 5HYIA 4FQJH 4JFPB 2F15A 2OLDA 2PKDA 1UXSA 1JZ7A 3PNWA 1NFDE 2NY6B 5HHVL 5JO5A 4Z95H 3AU1A 3ECBB 2DIAA 3FONA 3UAJD 3GKZA 3BDXA 3SE8H 1T5WB 4KXZI 3QXDB 1J8HA 4ZO9A 3D9AH 4EXKA 1RU9H 4OSUL 5SX5K 1KEGH 3W0WB 2IC2A 4CL7A 3C2AH 4NM4L 1BFOA 2GYSA 4KZDH 5A43C 2E7MA 2YK1L 2RAMA 3QRGH 4QRRA 1TPXC 4PS4H 3DWTA 5B38B 3X11B 1I9IL 4XXCA 4YHLH 3SEPA 1BBDL 1VADB 4LLUA 1IGMH 1RV6X 4EDXB 1QSZA 2L7JA 2ZUWA 1WAAF 4OZ4B 4Z76A 4K7PL 3L1OH 1KPVB 2QV2A 2W9DL 2PW2A 4I48A 4HLZH 3WDIA 2EH8H 1KYOK 4RGNE 3PWJB 4AQ1B 1WIUA 3C08H 4ETQA 2K9UA 2HH0H 2MHAB 1QD0A 5I1EH 4OM1H 4XP4L 1Q94B 5FHAH 5IFJB 5HVGB 4X4ME 1WZ1L 5HDQL 4YHZH 4EI5B 5DEGB 3TVMC 4DKAA 2VABA 3T0BA 3BN9C 3CMGA 1YMME 1C1EL 4QCIA 4OI8A 5GRYA 4DN4H 5C0NC 1RVFL 4R2GB 4X8JA 2CUHA 3WNOA 3BP7B 4MD0A 5F9JA 2VDKH 1NLDL 1IQDB 5AUMB 1A4KB 5C08A 4J4PA 5FA4A 1UJ3A 1S78C 4WTZA 2LU4A 4NQCD 4FZEL 2J6EH 4YLQT 1MCQA 3MRRB 2ORBL 5GRXG 5CIPH 4JZJB 2I25N 3DV4B 4Q2ZB 4K71B 1WGOA 3TBTA 2EDEA 1IBGH 4U49A 1SHMA 1EX0A 3SJVD 4OD2A 3ARXA 5JDSA 4U05A 3DGCR 4XBEL 3WXWL 2DLGA 1DN0B 5I75B 4UIKH 3HCVB 3LAFA 2VUOA 4PRNA 1NGYB 5F7MC 4LPWA 1ND0B 1V3KA 1EO8L 2ICEB 4HT1H 2C9AA 5DRZB 3JWOH 2CMRL 3O6LL 4Q0XL 2FH6A 3NCEB 3TBSB 1CF8H 3IDNB 5M94B 4HK0A 4JZNB 2R1YA 3FRUB 5F7HA 1DUZA 1HHGA 4GG8A 1EV2E 1N3NB 4XNYH 1MHHB 1YEDA 4OGAC 2F5AL 5D72L 4Y2OA 4UT6L 2L0DA 4JQVA 3MYJB 1T83A 4XGZB 4OTXH 2OK0H 1AXIB 1DCLA 3PJSA 3ROLA 4PJEF 1CD9B 1QSFD 2AXJA 5DD3L 1FL5A 3HR5A 4MQSB 4FOMA 1UWGH 2FCBA 2R4SH 5GHWH 2H3NB 3TO2A 5C0IA 4B50A 5DRNA 3NFSH 4F7EB 3CC5A 4B41A 3VXRD 4XP1L 3QCTL 5CP3A 4PJ7F 4I5BB 2I26N 2RR3A 1FGNL 3OKEA 1A1OA 1F13A 2FHCA 3B5HA 1OT2A 4HUNB 4UINL 2W65A 1JYWA 1KTLA 3TT3L 4U1JA 5HHOE 3P30H 1CTOA 2AJ3B 3QUMA 1MVFA 3QHZH 1N5YL 3VFUB 2IJ0C 3GGWB 3JV4B 2DRUA 3QISA 4LKCB 1DBML 2H2SD 2GSGA 2P7TB 3VXPB 5HVHC 5JXAL 5I8KL 1Q9LA 4YDVA 2H8PB 4ZQKA 4GS7B 1A4JB 5D71L 2XOTA 3U30C 2AAVA 4ZXBD 2AK1H 5E1AA 5E7FA 4ONFL 5F6HJ 3WJLA 1F2XK 5L8LB 1K4CB 4N9GA 5FOBA 1F58L 1X5YA 5DVOA 3E2HB 3LSOA 4M7KH 5ITBH 1AD0A 3E1F1 4HW6A 3GMRA 3T2QA 4WU5B 5H94B 4P4KC 4N0RA 4Z7VA 5JPNB 1U8KB 3D18A 4F37F 3L3JB 2WUCL 3GIVB 2E6JA 1BVLB 3IJSB 1RZJC 2BVTA 5L0QB 4I4WB 4OLEA 2EDLA 1OSZB 5ADOL 2BFVL 1MCKA 3LRGA 5GIRB 3T0EB 2H2PC 3NCYP 4YGAB 5A2LH 2VN4A 3CD4A 1LEGB 4W70A 3RHWK 5C6TL 1Q72L 4W68A 2BVYA 2P5EE 3FAWA 2ZNXA 1C5DB 1U8JA 3NIDE 3P11L 1QRNE 3F62A 4NPYA 4OSUH 1ED3B 1YMHB 3WL9A 4PRBA 4NM4H 4MX7B 3PHOA 2IANA 2R56L 5DRWA 5HD8C 3PL6A 3IFOB 2YK1H 5DJCB 3VXQA 3ZTJG 3FT4B 5IMOB 3HTLX 3MGOA 4UAOC 2ATPA 2HT4C 5CSBA 1LO5B 4ORGA 4WWKB 1ZGLM 2JIXA 4M7LL 5IWLA 2VLLA 1OGAE 3KJ4C 3HG1B 4GMTL 4K7PH 1EEZB 2W9DH 4HWEL 5EU5A 3D85A 4WFHE 1U8QA 2E9WA 4WEBL 4YEEA 4WI4A 2P5WE 4A6YL 4ELKA 1IRAY 3QUXB 1JPSL 4XP4H 1T2XA 4N8PA 5D1ZC 3EOAA 1WZ1H 4WUUB 5HDQH 1RJLB 4HJGB 1X5GA 4NJ9L 5D7LD 4FQQA 3SKMA 1AD9A 3HE6C 3G9AB 1XF4A 5CEZL 1B4JL 4KV5F 1RVFH 3ARBD 1CFSB 4MB3A 5KAQF 4NGHH 3RL2A 3HZMB 1NLDH 1AP2B 2FGWL 2GT9A 4TNVF 4GSDL 5MENE 3U0TA 4JQXC 4BYHA 2B2XL 5ITFA 3QA3A 2ORBH 4F7CA 4R96A 3T3PE 1AFVL 2CQVA 3Q6GH 4Z5RA 5TQ0L 1IM9A 4K9EL 5KS9B 1U93B 5ERWB 3GMLA 3WKNA 4LPXA 4XBEH 3WXWH 4I18A 5DJ8A 2DMCA 3RWFA 5MERA 5IB2B 5ENWB 4ZDHA 4MSWB 5SWQA 1JGDB 4Y88A 5BRZE 1J8HE 5I1DB 5EO1A 3RL1B 4FQ1L 2ATKA 1U9KA 2CMRH 4JPIB 4OZHF 3O6LH 4Q0XH 5CJXA 1WIPA 3ZHLA 4BQ9A 5F9DC 4XVSL 4P2RE 4KKAD 5LGJB 4KRPD 3MRNA 5IQ9B 2AV1B 1N7ML 4KHTL 3U36A 2F5AH 5SWZB 4UT6H 1ORSA 3IDMA 5F7YC 2B8OT 2DM4A 1WF5A 1D6EB 3LKOA 3MLTA 4LP5A 4F9LC 4IRJD 4DEPB 5DD3H 3BO8A 2D7PA 5C0EB 4DK3A 3CFKB 2EECA 5DUBB 4PJ8B 4YDLB 3VD5A 1RI8A 3DNKA 4GRMB 4XP1H 1BBJA 2A6KA 3CSYB 2AEIT 4M5YL 1C7TA 2Z93B 3O41A 1YC8A 2ZNWA 1FGNH 3QJFB 1T22A 5E8EB 3TNNB 4G6KL 5L2KE 3V0VA 3S35X 4D9QE 5K59F 5KVMC 4UINH 4LBEB 4WI9A 5C86A 2Z31C 1VFUA 4YBQD 3TT3H 4LRNL 2AQ2A 1F02I 1N5YH 1T66D 1DBMH 3NPZB 1HCFX 2CKBL 5D2NB 5JXAH 5I8KH 1TVBA 3BJ91 4OZFG 1LO3L 3BWAB 3ULVC 4I13B 2GFBA 4Z7NE 4ONFH 5T33H 1PG7X 5HYQA 1ETZB 3TYGL 4HQQL 2ZPKL 3VW3L 1F58H 3I6GA 1F00I 1IAKB 1N59A 3BQUA 5EOCL 1A9EB 2HT2D 4HC1L 3TF7C 1INQB 2XY2A 3QI9A 3O8XA 4MAYB 2F74B 1I75A 4YDJA 1JUFB 3QDHA 3ZKXC 3SDXE 2WUCH 2K7QA 5HI4D 5ADOH 2BFVH 3TIDB 1D5IL 2AJXL 3S3JA 4Y1AE 1Q72H 4M8QB 2X9YA 3P11H 5EUKB 1EXUA 4MJIB 2EC9T 5SX4I 5DEFA 3ARDC 5TH2B 3LZFL 1UB5B 4MHHI 1JF1A 1KXVC 2R56H 2UWEE 3HPJA 1MQKL 1WCBB 2GTZB 3G5ZB 3PWPB 4RDQG 2DLIA 4O2FB 5CILL 1YZZA 2ZKHL 3WV0A 4BZ2L 1KYOJ 2YC1A 1J1XL 1FG2B 2YSSB 4M7LH 4WGWB 3DVGB 4LGRB 4GMTH 3FO2A 4JO2L 5I71B 4PV9A 1KB9K 4PJBA 4PJDA 4HWEH 1CL7L 1I1FB 1KIUA 4WEBH 1IEBB 4JFFB 2H2SC 4LCUA 3U2SB 4A6YH 4CNIA 3GJFH 1JPSH 1F4XL 3WE6B 1T1YA 3MZGB 1UEYA 2EDDA 4DW2L 5C0GA 4XBGB 2G2RA 3JZ7A 5D7IB 5KG9A 3J7HA 4NJ9H 5CSZA 2YA2A 3KR3L 1DLHB 4MXQD 1RURH 4ZUVA 5CEZH 1B4JH 3ULUC 3LN4B 4JRXB 4NQVB 5TDOB 2R1XB 2XG5A 5D6DC 2FGWH 3PXHA 3MV9E 4GSDH 5IR1B 3DUUA 5FYJE 3EJYD 4UUJA 5TDNA 1X6NA 2B2XH 2J5LC 4LCWA 4PLJD 4OCWL 1AFVH 4NQDB 1LDPL 2XKNA 2Z91A 4RGND 4K9EH 3U9UA 5D2LA 4X9FA 3MJ8A 4LDOB 2R9HD 2JJTA 2ADGB 1MCJA 4GLRI 5I1GL 4PJFE 1YEEL 3JV6B 3L9RA 1P2CB 1I8MB 3VWKD 1R3JA 1Q9OB 1GYAA 4NNYB 1P7HL 4JVPA 3OKOB 4FQ1H 1HSAB 4IHOB 2XWJB 3DV6B 4ETYA 3EYSL 4KUCD 5DLML 2IANE 4NQXB 1HHHB 4GO6B 3FN3A 2HTLD 3L7FB 5F9AC 1N7MH 1UH4A 3EYOA 4KHTH 3W9EB 4BSVB 3ARUA 5B39B 4H1LB 4HK3N 2YA0A 3QT2A 1J0JA 2GK2A 1NL0L 3V5DA 1W0YT 5DHVB 5C2UB 3V6ZB 1HQ4A 2QHLA 3V6OA 4U6XB 1HHIB 4JDZB 3I75B 1PEZA 4ISVB 1FNGB 2PYFA 1S3KL 1B2WL 4WI6A 5ANMA 3SGDH 3GI9L 4WO4C 4IMKA 2VXVL 1CDGA 4M5YH 2FB4L 2GAZB 4QRUA 3IDJB 1HH6A 1KIQB 5HYJA 4L9LB 3LD8B 3LEXA 1CFTA 4YBLC 5KSUB 3DX7B 4CRPA 4G6KH 4X4XB 5D9SB 1PVHA 2FZ3B 2OMNA 2R4RL 5KZCB 3LOWA 2X9WA 3ARBC 1UM4L 5BVJA 4QNPF 1ONQA 3TN0A 3JTSA 3RUGF 5MEQB 4LRNH 4YHNB 4TRPL 3WUWB 2FJHB 5IOPA 4QT5A 1WLHA 4ZO8A 1A21A 2CKBH 2OP4L 3EFFB 3AB0B 4TN9A 2HJKB 5EC2B 3BPOB 2EC9U 4KC3B 1EHLL 2UY7A 3QPQC 4O51A 4KMLB 1CG9B 4PG2A 3L3IA 1LO3H 3QCVL 4Y7MA 4U1HB 2JJVA 2NY2D 3QUZB 4PJXB 3CDYA 5DSCA 5EO9A 4JY6A 5AYUL 3TYGH 1NFDF 2OQJA 2ZPKH 4J23A 4XCNB 4FQHA 5GS1A 25C8L 4X4YB 3K7UA 1CT8B 4GH7B 5F71A 5EOCH 1RZFL 3ARFB 1TJIL 3R06B 4HC1H 1GSMA 5EU6E 5IB1B 1CE6B 4JDVA 5T5FL 5B3JE 4KKAC 2CR3A 4ZAKA 1I3GL 3QG6B 3QNYB 3BDYL 5LGHL 2NX5B 4K2UL 3SCMD 4LSSL 4PG9A 1DVFD 2C3VB 4LVNB 1D5IH 2AJXH 4YHIA 3WFEL 3EO1A 3GSQA 1JV5B 1AO7A 1GZPB 1WBXB 3GIZL 4RISL 2EDNA 4IRJC 4RGOL 3VFPA 1VGKB 1J12A 1ZEAL 3VD3A 2PXYA 1EERB 1OD7A 4EQ2A 1BX2B 3LZFH 1CXFA 3MNZB 2DN7A 3TA3D 1XGRB 3KYAA 4NN7B 1KCSL 1MQKH 2FIKA 2Q3ZA 1QTYT 5CILH 3K4ZA 2X70A 3BP4A 4H5SA 4RMWA 2Q7YB 3FMGL 4BZ2H 3S36L 4G6FB 2IBZY 2XICA 1J1XH 2BSSB 1J0KA 4GRWB 4YBQC 2FSEA 5E6YA 1BF2A 4JO2H 3RIAK 1IC1A 3OV6A 1CL7H 2NW2A 5GSVA 3C5JB 1T66C 2IH3A 4JKPL 3R1GH 1WT5A 1F4XH 2IQAA 4URTB 1QRND 4LHQB 1RZJL 2QQLL 2YD8A 4NQCB 2XA3A 4GW1A 4C57C 2WWKO 2YPLA 4PGCA 5C0CE 1OAXL 1VEOA 1L0YA 1BJ1J 4NYLA 3ILPA 4QHLB 5F72S 3JVGA 3DRQB 3IU3B 4MZ3A 2HT2C 4IMLB 5J9PB 5KSVB 3H3BC 1FFNA 3MOBL 4QKXB 1U2CA 3HZKA 4WFHD 4OCWH 3S37X 1LDPH 2P5WD 1ZT4B 3JUYA 4J7RA 1JWUA 3LKQA 4Y5XA 4Z7QE 2FJFB 5L7XH 5I1GH 3FZUD 1NMCC 5TGBA 1Y0LA 5E4IA 4M7ZC 4OAWB 2KH2B 7FABL 4WI8A 3TPUB 1FO0L 4J8RB 2VIRB 1R5IB 3MUJA 5IW3A 3LMJL 1UM5H 2BVQA 3GEWB 2IGFH 1CD8A 3EYSH 5DLMH 3QUYA 3O3DA 1M71B 1ORQA 3TYFA 1NDGA 2FL5B 5F9WC 4E0RB 3IKCA 4KJPC 3KYOB 1SMOA 4Y5YB 3VI4E 3QZWB 4HFWA 3RX5A 4Z7WB 3IRZA 5JDJA 3QIUA 3L5HA 4XPFL 1NL0H 3SKOA 1MF2L 4Q9QL 4D0DA 2ZWLT 2EKSB 4ZPTA 1YNLL 1MLCB 4RRPG 3B3IA 1S3KH 1B2WH 4XMLL 4N0FB 3AGVA 1FIEA 3GI9H 5BRZD 1D5MB 1SVZA 2VXVH 1ACYH 2FB4H 4Q74A 4WW2F 1HEZB 5ILTL 5T3XE 3QDAA 2X1XR 4LU5L 4XH2A 4P2RD 3AAZA 5ACZA 1I4FB 2R4RH 4MXQC 2NY3D 2QLVB 4TUOA 1UM4H 4OM0L 2XZCL 4Y4KA 1MUJB 2LVEA 4ZXBB 1ZVSA 3EJJX 2I5YL 3MJ9A 4K3GA 4TRPH 3VXSA 1MWAA 3PDDA 4JANA 3EJYC 2AV7A 4P5KA 5JR1L 1HINL 3QXAB 2OP4H 2P8MA 4K7PX 1M7DB 4ODHL 1IARB 2HFEA 4OUUB 4YXLL 1KPRA 3VXUD 4LCWE 3QCVH 2IALA 5CWSB 1ZHLA 3SOBH 1U3HC 3ET9F 4QLRA 1WK0A 5T1LA 1T20B 1KJ3L 2R9HC 5D2LE 5DK0B 3VGBA 1TETL 4X6CA 2CLRB 4TTDD 4PGZA 3ES6B 1II4E 4JFXB 3TEUA 3OBAA 2CDFA 3VWKC 3DX6B 1G7HB 25C8H 5L2KD 3G08B 1J05B 1RZFH 1UZ8A 1TJIH 4CAGA 4HZLA 1S5HA 5B21A 3LQZA 5CP7B 1ZHNA 1AC6A 1I85A 5T5FH 3L7EA 1LK2A 1D9KA 1I3GH 4MQ7A 2G5BB 2HTLC 4B7LA 3GFUA 5LGHH 4JPVL 2M1KA 5F96L 2XFXB 2F53B 2JK5A 5FYKE 2P48B 1SM3H 2XN9B 4LSSH 5I19L 2V17L 4MB5A 5DQ9A 2ADFH 3WFEH 2ARWA 5DJYB 4WFEE 1I7UB 4KKBC 1AQKL 3GIZH 1RJZA 5E0QA 4RISH 3O4LA 4RGOH 5I18L 3H8NA 3STLA 1AIFB 1MFAL 1ZEAH 5L2JB 4UOJA 3C5ZB 4XCEA 3PHQA 5ANME 5DC9B 5A2FA 3WEXB 4M00A 3WFCH 1T7XA 4ZSOB 1KCSH 1T04A 1QFWM 3ULVL 3PWNA 4DVBA 4NKOA 5GISL 2VB5A 4OZGA 3QQ4B 4M6NH 1KB9J 3RDTD 1BECA 1P69B 1MCWW 1XF5A 1AKJD 1A5FL 3FMGH 3SGKC 1BEYL 1F3DH 1MREH 5FO8A 2BSRA 1AE6L 4MZ2A 3VRJB 1FVCA 2V5YA 1JMXA 1T21A 3MRIB 2ZOKA 4PRIA 3RWJA 3AM8C 4FQIL 1BGXL 2QR0B 4JKPH 5FB8A 5IMMB 1NAMB 2ITDB 1JHKL 1NUGA 5EBWB 3RPKA 1HH9B 1RZJH 1KNOA 4GRLA 3GUTA 3F6IA 4CW1A 2DM3A 4GXVL 1FFOA 3VA2C 1KBGL 1CFVL 1OAXH 2NY2C 2DKMA 3T3PF 3BP6B 4NOFA 2V2TA 3PV7A 5BW7A 2DYPA 1FYHB 2OR8A 4LCIL 5I74B 1TDQA 5T1KD 4X5XB 4IOSD 3EAKA 1UH3A 5SWSA 1RHHA 1Y6MR 3MOBH 3RWGA 1DBBH 5C09E 3BP5B 3ARGD 3SE3C 1MJ8H 3EO9L 3EIFA 5I8EA 3RGHA 4J3UA 3B9KD 1P9MC 4NO0D 5JOFA 3SCMC 2HLAB 4KRPB 3IF1A 3MPCA 3PXJA 4N0UA 5AEAA 4P5TD 3GSRA 3SDAD 5B38G 4GBXB 4DUVA 4JY4A 2J6EA 7FABH 1AO7E 4UQ2A 1FO0H 2LTQB 3BIKA 5C0BE 3VJ6A 4GXUN 1A6PA 3GSNB 1F5WA 1YEKL 2ZOLA 4X9HA 3TCXA 3LMJH 4JO4L 4N68A 4UV4L 3FO1B 3TA3C 4E5XA 5ESAB 1BQHG 3SDYL 2FECI 3PGDB 4CUCA 2J8OA 4WHYG 5INCB 3WS3A 5AZ2L 3UMTA 5GRVK 3C60B 2AVGA 1WSST 4Z7OE 5C7XL 3ULUL 5JMRA 3NGBB 1CICB 4ZFOL 1NANH 3DROB 1LO0L 4RMQA 32C2B 3VXOB 4XPFH 4JG0L 1MF2H 1S9KC 4Q9QH 2AGJL 4UZGA 3KXFD 3QDGA 3VRIB 4CMMA 2PCPA 1YNLH 3DBXA 4MA1B 2EDHA 3CFJB 4WHTB 1HN1A 4GKSB 4ODWA 1P4LA 3RVVD 4I2XA 1L9NA 3WHXA 3X14A 5ILTH 2YXMA 1I1YA 2FWOB 4LU5H 4QRTA 5GGRB 1Q38A 3N9GH 1FFPB 4QXGH 3SDDA 4GG6A 4OM0H 2XTJE 4PRDB 4L3AA 2XZCH 4OF8A 4M1GL 5E8OB 4HKJA 4Z7NF 2I5YH 1G9NC 1C12A 1R0AL 5LXGL 1UWXH 1UM6H 4Y2DB 5JR1H 3HI6L 1HINH 5DWUH 3RX8A 1LP9A 3HZYA 1BLNB 4YXLH 2Q8BH 3T0WA 4MNQB 2Y5TA 2BMKA 4ZG1A 4ZUTA 5IJKC 3MJ7B 3PIQB 4Z0XB 1KJ3H 1M05B 2WNGA 5D1XD 5ADPL 1TETH 2YRPA 3OR7B 4XVTL 4RWHA 3OJ2C 5J6HB 3FQXA 1BQLL 4PGEA 1XIWB 3RGVB 1UXWA 1QACA 2VLMD 3HS0A 1EHAA 4Y4HA 4KI5F 1Q0XL 1YN7B 3KPQA 1G7QB 4XCFL 3RUGB 5CJ8A 4IS6A 4LHUA 3J8F7 1S9VB 3CFIC 4F33B 1UACL 1FYTA 2V5RA 3TO4A 1O7SA 4KJYB 5IHLB 5IB4A 5BS0B 5ALBL 4JPVH 5F96H 2FX8L 4AJ0A 2FEEI 5I19H 2I07A 2V17H 3FO0H 5JIKA 4FHBD 1ODAA 1AQKH 1BOGA 2HT3C 4OLWL 5DXWA 2E7CA 1VFMA 5J12C 4PUBL 2NZ9D 1MFAH 1GGIH 3MSPA 4Y16B 3NFPB 1NFDB 2R29L 4UB0L 1JN6B 1I8KB 1LHZA 1N6VA 4JPKL 3TC9A 4NRXA 3PABB 3ULVH 4HIEA 3F12B 3L3OA 5GISH 5EU6D 2P8LA 2QADD 4ZS6D 1EVUA 2X5PA 3MUGB 4QOKD 3KHOA 1A5FH 2X89D 1BEYH 3K81A 3IJYA 3P4OB 1AE6H 2NY3C 3CDCA 2VDPL 3EKCA 4L8SA 4MNGA 1TQBB 4PJ9A 3OL2A 3ZDYF 2AK4A 2ZZUT 3HRPA 3ZT5A 4GXUM 5EU4B 3WDHA 1K4DA 4FQIH 1BGXH 4RRPA 4Y4FD 1T7YA 1VKXA 3VXSE 1ZHBB 1CGTA 1EBAA 4BFIB 3EDEA 3WS6A 1JHKH 1S7XB 1DQQA 1XGUB 4EN3A 1N0XL 4P3CH 4G9DA 4KDWA 5KTEL 2MKLC 2WBJA 1XEDA 2EDKA 4GXVH 4PJIA 1KBGH 1CFVH 4Z7VF 4E41D 4OGXL 1FNLA 4RGNB 1RIUL 4YNYB 4TTDC 5LBSL 2A9ML 3VCLA 5C8JA 4PJGA 1KLUB 1MLBB 2E8ZA 1SJHB 5JA8B 1PLGL 1TENA 3AVEA 2JJWA 1QPPA 2EYRB 3AREA 4IOFD 6CGTA 1QFWL 3SBWC 3QIBD 2BNRA 1YMMB 3DO7B 3OHXB 2NXYD 4IIQB 4P48A 2DWEB 1YY8A 2P42B 3EO9H 2NTSP 1B3JA 1T89A 3QWQB 2VAAB 3BGMA 5J6GB 1YNTA 4L29B 3ZKQD 2MTPA 1W8OA 5DYOB 3BH8A 4E9LA 2H1PL 3VGHA 4YK4C 3LQAC 5CGTA 3C9NB 1F6FB 3ARSA 4K23L 1U0QA 1NLBL 3O4LE 4CBPA 1YEKH 4JO4H 3CCHA 5IB2A 2G75A 1B6UA 2CIKA 4UV4H 4I0PC 3FO9A 4ZYKA 5FV2A 3SDYH 5EZIL 2C1PA 4S0SD 3FB8B 3RDTC 5C7XH 2D9CA 3LN5A 3ULUH 4PIRF 3U4BL 3BAEL 1LO0H 4XWOD 4K94H 3GSOA 4JG0H 2H32H 5GRZA 5IGXL 4Y5VC 3HI1A 5CBEB 2AGJH 4XHQA 1SJXA 3BDBA 3L3KB 2IWGA 3B8YA 4O2CA 1JF5A 2VQ1A 4F7PA 2GK0A 3RKPA 4V2CB 3TZVA 2EIZB 2OL3B 1WICA 4ONGL 3KPRA 5DJ2B 4YWGL 5HY9A 5DI8B 2V5MA 4RMTA 4S0TD 5LCVL 2Y9RT 3IXAB 3H7BA 4FQ2H 4M1GH 4JPWH 4GKZB 1JGUL 2R0ZH 2GSIA 1S9XA 3RNQA 2N7AA 1U8HB 3L6FB 4HUXA 4XC3L 5E5MB 1R0AH 2X4TA 3REVB 3MV11 4OBRA 3GHBH 5GQBA 4EI6B 3HI6H 3QIWA 3QDJD 4MQXD 3W11D 5C07D 2HG5A 3ARGC 4HIXL 1MVUA 5DHYB 4NO5A 4ZFGL 3HE7D 5JPMA 4RA0C 5HHOB 5JXED 5B3JF 3QHFL 4P5TC 5ADPH 4WW2B 3GRWL 4TSBL 3RWHB 3SDAC 5ABDE 4XVTH 1UKSA 2MJWA 2ZSVB 4M62L 3ECBA 2R2BA 2BVPB 3ROOB 1BQLH 4JR9L 3VD9A 1DVFB 1H0DB 1Z2KA 2I9LB 2VR9A 3IGAA 1Q0XH 1KG0A 3QXDA 3CFCL 3BKML 5C92A 3QDMD 4XCFH 3C2SA 4U7MA 4JRYE 2VL5B 1VGEL 3MCG1 5D7JC 4XVUD 4UOW0 2UVFA 1MRDL 5KN5B 3GK8H 3GSWB 5ALBH 5CBAB 3I3DA 3DSFL 3VRLE 2FX8H 3HFMH 2VZSA 5GGRY 2EIEA 2N1KA 3O3BB 1YPZA 5I76B 3X11A 1NMBL 2DJ4A 1BJMA 4OLWH 5DO2D 1VADA 3OKMA 3QDGE 4HBCL 2VLJD 2JTDA 1IAIM 4OZ4A 5I6XC 3FQUB 1KPVA 4O2EB 4OFKA 3ILQC 3JWDC 4UB0H 1FQ9C 1XR9B 4I0CC 3KLHD 4DJMA 3I6KB 1G1CA 3RVVC 3VFSA 5HGBB 4I2XE 2JJSC 2P5EB 1Q94A 4LCYB 1TCRB 2APXA 4NYLB 3GMOB 2JCCE 5HGDA 5ESVB 2YD7A 1QRNB 2LQRA 4EI5A 2R69L 4F9PC 4GMSH 3FFCD 2VDPH 1TZIA 1U8NB 2ZSWB 4MA3B 4GG6E 3VDCA 5FYKD 3UTSD 3KPOA 3W5MA 4WIQA 1A9BB 2WIMA 3BP7A 3AB0C 3M17B 2E7HA 5FCUL 1SY6L 5AUMA 4OF3A 3GHEL 2VOTA 3MV01 1N0XH 2D7OA 3G5XB 5KTEH 2B0SL 1OGAB 5EOQH 3IDYB 1IAII 1H15A 3RTQB 3DV4A 4RGMB 5K9KB 4HUWA 5D1XC 1TZHB 1DEDA 1RIUH 5FO9B 2IPUG 2A9MH 5LBSH 1P84K 3EDJA 4OFYA 2P5WB 4L4TD 4MXWL 3AS1A 4Q97A 4WCYH 1PLGH 4OD3L 2ICES 2R15A 4LQ1A 1QFWH 2HVJA 3A67H 3A6CL 4CN6A 2OR9L 5DRZA 3B8SA 3QXWA 4GW5A 4IRSB 1FYTE 3VGFA 1N0LA 3TBSA 4JZNA 1M6OB 3FRUA 5J11C 2YBRA 2Q3AA 4IRZL 5MENB 2VWEE 1MHHA 4FRWA 4OLVL 1X5HA 4F15B 4XGZA 3MYJA 2WQ8A 1EZVX 3BEWB 4K23H 1KB5B 2NZ9C 1NLBH 2UVEA 3JV0A 3ME0A 4NC1E 5D1QD 1UXSB 3QFDB 4J3OC 4PR5A 4WI2A 5JW4R 1T7VA 2H3NA 4PJBF 4PJDF 1IE5A 3AUVA 5EZIH 3S7GA 2QADC 4ZS6C 2X41A 3QEQD 1JWSA 3KPSD 1J8HB 5BRZB 3L5IA 4JVWA 3U4BH 3BAEH 4NFBA 4OLZL 4ZFFB 1E4JA 1KFAL 5IGXH 1DANT 1U58B 2ZUTA 1IAOA 4MNGE 1BFOB 4KDTA 4P2RB 4X4ZA 1E6OH 4U6HB 3BD3A 4Y4FC 4L4VE 1S9WB 3WHE0 1YUHB 1GAFH 1RZ8B 5E9DD 3GGWA 3VFUA 3JV4A 4HCRL 4DGIL 3BGFB 2JKXA 5FCSH 2DLFL 2P7TA 4ONGH 4LLUB 3EZ8A 1WFTA 4HPOL 4YWGH 5FYLL 3OTTA 2EIBA 1MCPH 1A4JA 1TNMA 5LCVH 4I48B 2VE6A 2YKLL 1DQJB 2D7MA 1ZE3C 4LFHG 4ETQB 1JGUH 3Q5TA 5CEYB 5D2LF 3S36X 2Y5EA 3A0OA 4XC3H 5DK3A 5TPWL 4IOFC 4LLVA 3E6FA 5EA0L 4X7DC 3QEUB 1CVSC 2NXYC 3FCTA 5L2KB 4P46D 4KU1A 4NQEE 4WU5A 3VXMA 4OF6A 4HIXH 2H6PB 4ZFGH 2Q8AL 5JPNA 1ZANL 4N9OB 5H37H 3GJFK 5K93A 1U8KA 1LVEA 1H5BC 4MD0B 5F9JB 4RCAA 3L3JA 4OIBA 4I77H 3GIVA 3GRWH 4TSBH 5DC4B 5FA4B 4U6VL 5IMKB 4I4WA 4H1LG 4M62H 5CUSL 1I1AD 4JR9H 4NO3B 5GIRA 4WHYH 1OAZH 4OQTA 1B0GB 4HDIB 1LEGA 3CFCH 3TBTB 5IROC 2ZG2A 2I9TA 3GZKA 2DS4A 1AHWC 3A6BL 1C5DA 2XTJD 1ACZA 4PRPE 4QRPE 4OD2B 2DLHA 2ZUQB 5JDSB 5JIIA 1VGEH 1ED3A 1YMHA 2MPAL 4RBPH 1MRDH 1L7TL 1RQ5A 4MX7A 1FPTL 1GGCL 3ZO0A 1BD2E 1OCWL 3QULA 3BRFA 3IFOA 3UYOD 4I9WE 3FT4A 4HC1A 1NMBH 1G9NL 4KWUA 4WWKA 2UZYB 1ZA6B 1SEBB 4J3SA 3HG1A 3SDXB 1OW0A 2A38A 3MLPA 1K8IB 3OAZH 3HC3L 3LS5L 3PWLA 3WUWG 2IFFH 3RZCA 2A6IA 3MJGX 4Y1AB 3D3VA 3QUXA 3BZFA 4P23D 3MGTA 4OIIL 4LPYA 4TNWK 2R69H 1RJLA 1FL5B 1QR1A 4GOSA 4HJGA 3TO2B 4MNHB 1MHCA 3QR2A 2UWEB 3BSZL 2HRPL 5E5RB 1CFSA 5D7SL 2VLKD 5DURD 3W11C 3PDGA 1Q9WB 3HZMA 5FCUH 4M02A 3RY6A 3OKEB 3GHEH 4HUMB 4KTEL 4NWTL 1A1OB 3K2UL 2B0SH 1GHFL 2W65B 1ZLUH 3T65B 5JXEC 4TQEL 4CN4A 1Z9MA 4GFTB 5LAXA 4LPUA 3QUMB 2YD4A 1XR8B 5KS9A 1Y18B 1U93A 1AGFB 5ERWA 4CDGC 4DGVL 1DE4B 3B9KB 5C0RL 2GSGB 4JCMA 2WMPA 3RVTD 1DANU 4OD3H 4D9RD 3AC0A 4YDVB 1IC4L 4ZQKB 2IFGA 3A6CH 2ZUYA 2OR9H 5I1DA 2HLFD 5ICZB 3RL1A 3DYOA 4U1KA 5IB3A 4ZO6A 3RVWD 2XZQL 4KY1L 3FKUS 3LSOB 3MV9B 4HUUB 4IJ3C 1AD0B 4IRZH 1EEUA 1N8ZB 5IEHB 2V5SA 4OLVH 1RZGB 1LE5B 1YPZE 5BOZG 1A6TA 2Q6WB 5J13B 1D6EA 2B1HL 3D18B 4WFGD 3KLHC 5I17A 3FOLA 5C0EA 1JPTL 4HD9A 4PJ8A 5DUBA 5IVXE 4PJFB 5F6IC 1NBZB 1WWAX 3CSYA 4L8BB 2ILLA 2DQUL 4AIZA 4PJAE 1U8JB 1YJDC 1IFHL 3LKSB 4OLZH 1KFAH 3QJFA 3MRBA 4NN6C 2AERT 4NPYB 5E8EA 3TNNA 3WL9B 2ADJB 1AXTL 5TDPA 3PHOB 2IANB 4K55A 3W39A 3PL6B 5EG6C 2QSVA 3EO0A 1T3FB 3DX8A 3GB7A 4OGYH 3FB7B 1S9YA 4ESKA 3MGOB 3OMZA 1EGJL 1JHTA 4ORGB 4HCRH 4DGIH 5FGBC 2G5RA 3P9LA 2DLFH 1B9ZA 4XCCL 3MC0A 2W0PA 3AMLA 4HKBB 4MB4A 3LQAL 3BWAA 3D85B 3OB0H 3MLXL 4L5FL 2YKLH 2G60L 2J88L 1FIGL 4ZD3L 1K6QH 3BE1L 4ELKB 1ETZA 2C5DC 4Q6IC 5EH1A 5TPWH 1ZGLP 1U8IA 1XF2A 3S34L 1VSCA 1TFHA 4RX4D 2CK0L 2EXWD 5FKAA 4PJ5D 2RCSL 1QNZL 3PWUB 1AD9B 4DVRL 5T3ZD 1AH1A 5KAQG 4MAYA 2Q8AH 5JW3L 5CEZE 1ZLVH 3OR6B 1ZANH 4RFNB 3M8OL 4YBHA 3RL2B 1I8LC 2GT9B 4U6VH 5E2WL 3QZWG 4FQXD 4TUKL 4S1RL 2CO6B 4XNXL 5CUSH 3TIDA 2YD6A 5MEPB 4R96B 3EDFA 3A6BH 4Z5RB 4D0CB 4MJIA 1FDLL 3GMLB 1KV3A 5LWYL 5DJ8B 4KROD 1UB5A 1L7TH 3FOMB 1FPTH 3RWFB 3NFNA 1OCWH 1WCBA 2GTZA 3G5ZA 3PWPA 3V4PL 5GZOD 4QHKI 5EO1B 5EU6B 4BSJA 5J1AA 4DAGH 5EBLB 2AS5M 1JI2A 1G9NH 4JCLA 5DJAB 4U1GC 3V7AE 1FG2A 3QQ9D 4L3ED 4OJFL 1A1MB 3DVGA 3MRNB 4WU7A 3BZ4A 3F7VA 3X3GL 3HC3H 3LS5H 3E3QC 4JM2B 3GO1L 3O4OB 1CD1B 1IEBA 4JFFA 1AI1L 3G5VA 2VAJA 4OIIH 1F4HA 3U0WL 3S4SB 5D7IA 4TUJA 3ZDXE 2O5XL 1E6JL 2BSTA 12E8L 4RAUB 4XVJH 3DMMD 4G5ZH 5L6YL 3MBEB 1BZ9B 1QBML 1R3LB 2HRPH 3BSZH 4JRXA 3MOAL 5D7SH 1B0RA 4WTXA 2J2ZA 5TDOA 1FHGA 4X6CF 2R1XA 3FT2B 4P46C 4U31A 4KTEH 4NWTH 5A16B 3V0VB 4LL9A 4XCYA 2DQDL 1NCAL 4JFOB 3K2UH 1P84J 4H0HB 3QIBB 3VXME 1EBPA 1K8DA 4M93C 3BPCA 4S2SA 3K80A 4TQEH 4NKIL 4NQDA 4OCMC 3KLSA 2DQCL 4YDIL 5C0RH 5DD5L 1I1AC 1QSVA 5H2BA 3P40A 3JWDL 1IC4H 4A2MA 1TJGL 2X42A 3FTGA 4MD4B 4BK5A 3IVKA 1Q9OA 4C56D 4NNYA 5C0CB 2OTPA 3D2UA 3OKOA 2Y36L 1HSAA 3OF6A 3QYCA 4IHOA 4OLUH 3DGGB 2QSQA 3DV6A 3T2NL 2XZQH 1BOYA 5AG8A 4GUPA 4KY1H 2E7LA 3I6GB 3CFBA 3BQUB 3MR9A 3L7FA 3W9EA 1QVOB 1RK0A 4BSVA 5B39A 3FQNA 4H1LA 3QI9B 4OZGF 2EE2A 4YDJB 1QSED 4QTHB 1GZQA 3V6ZA 2B1HH 4U6XA 1HHIA 5HHME 5GRJL 3I75A 4LVOB 4JFDA 4EOWL 1JPTH 3T0AA 1C08A 2PUQT 2AJYL 3IDIA 4ODXA 4R7NA 3UX9B 3D3VE 4P23C 1INDL 5JORB 2GAZA 3BZEA 1LMKA 3MRJA 3IDJA 1IFHH 4PY8I 2A0LC 3WUZA 2NY4B 4BQCA 5KSUA 1U8PA 3DX7A 1AXTH 1XGPB 3TESA 2FZ3A 4BZYA 1JF1B 5DD6A 1U92B 3O6FC 4QRRD 3U79A 3SY0B 4YDKL 5DJ0B 5MEQA 3SE4C 2N56A 2RJMA 1EGJH 1KJ2L 2FJHA 4ORZC 2OS7A 4JE4B 1DUYB 3PQYA 2FBOJ 2A6JB 5EC2A 2VXSH 4XCCH 1CG9A 4PV9B 3LQAH 3P3YA 3S88L 3HE7B 4U1HA 4MDIA 4L5FH 5F1IA 2J88H 1FIGH 1WEJL 1MJ7L 4ZD3H 1DBKL 4HIJB 4LCUB 4PJXA 4BH7A 4JM4L 5C0GB 3S34H 5CSZB 2RCSH 1QNZH 4KGJA 4JLRA 3FFDA 4DVRH 3RVWC 2XZAL 5IB1A 5GZND 5JW3H 3HAEB 4K7FB 3M8OH 4FFWD 4NKQB 3QG6A 1CLZL 3QNYA 3C6LD 3NAAL 2A74B 3DETD 4FXKA 2EXYD 3SPVB 3DUUB 5E2WH 3TT1L 2P1YA 4TUKH 4U0RB 4UUJB 4S11A 5TDNB 4OZIA 3VFTB 2C3VA 2NY0B 1D7FA 1GGYA 1JV5A 2E9IA 4LCWB 3HRZB 1GZPA 1WBXA 3HC4L 1HHKB 2WINA 2Z91B 4P4RB 5HVWA 1WZLA 1VB9A 3U9UB 4Z78B 5D2LB 1OSPL 1MIML 5J8OA 1FDLH 3MJ8B 5LWYH 2W92A 1XGRA 2BNUA 1JZ5A 3L9RB 4MDJB 3F7QA 3LY6A 2XRAL 4NQED 3V4PH 4NZRL 2LU3A 2B1AL 4ZODA 3F7PC 5IT2L 2DQJL 2BSSA 4IOIB 1E0OB 3FRPG 4OJFH 1TQCC 4J3VA 3G6AA 1DR9A 2VISA 2IEPA 3X3GH 4GG6F 4FXGA 4KI5D 3BMVA 3UTSB 3UZVB 3GO1H 1A6UL 1BQSA 1XZ0B 4X8XA 4EZMA 2P49B 1AXSB 5DJDB 3THML 1AGBA 1AI1H 1OAQL 2DMKA 4PRPD 4QRPD 4GQPH 3U0WH 4NQCA 4PGDB 1LP9F 2O5XH 1BJ1H 1E6JH 3INUH 1BD2D 12E8H 3JSSA 1GOHA 5ANMB 5L6YH 4EUPB 1QBMH 4I9WD 3DRQA 3MOAH 4LVHB 4QRUB 1DQLL 2EXWC 4G9FD 3O11A 3LEXB 5DFVD 2E9BA 1ZKAA 4IMLA 3MREA 1CU4H 1MCDA 4G8GD 2D0FA 2DQDH 1NCAH 4APQC 5J9PA 4R4FL 5BVJB 3TN0B 3JTSB 3O9WC 4NKIH 2FGZA 1IGFL 1ZVHA 5M7QA 1FV1B 2DQCH 4FQXC 4NBXB 4YDIH 1ZT4A 1CXLA 3VFMB 1JWMA 4FZ8L 2AP2A 2FJFA 3JWDH 4O51B 5E6ID 2APWA 4OAWA 1TJGH 3H6JA 4J8RA 2VIRA 5JHDE 1KJMB 4YQXL 2EC8A 1UH2A 2Y36H 5D1QB 3TBYA 1UWXK 5HI5D 1PD6A 1QSFA 5EO9B 3T2NH 4JY6B 5I9QC 2FX9L 3UBXG 4FQHB 2FL5A 3VXRA 3KYOA 4Y5YA 2OTWA 3QZWA 4Z7WA 5EOCJ 5C09B 3NABL 1DEEA 2RFXB 1A7RH 2P4AB 1PDKA 1S7QA 4NN5B 4LMQE 2FLBT 4R4BB 4EOWH 4P2OC 4PG9B 4YHIB 3HN3A 4N0FA 4HH9B 2AJYH 2BY1A 2VSDA 1AO7B 1CXIA 3GSUB 2JJUA 4M4PA 5C0BB 1DBAH 3VFPB 4X5WB 1HEZA 2PXYB 4R97C 3DMMC 1I4FA 4PJIF 1YECL 2X6MA 4ZUUB 1MUJA 2FIKB 5F7UA 4ZXBA 4YDKH 2X70B 3SE9H 4OCSL 1B88A 1KJ2H 4PJGF 3QXAA 1ZA3B 2NY1D 1M7DA 4UNTA 1JI1A 1FP5A 5D6DA 2FSEB 4D9LH 5F1KC 1W0WB 3C09C 4JFHE 2NW2B 5GSVB 1KACB 4M1DH 4NKMB 2IH3B 1WEJH 1MJ7H 1DBKH 5DK0A 3EJZD 2V2WB 2CLRA 4AEIL 3N50A 3NH7L 2EDRA 4JFXA 4JM4H 4XNMA 3CXHK 2MQ3A 4GW1B 1RPQA 3G08A 1J05A 4HAGA 1ZLSH 4CKVX 4PGCB 1FZOB 4RA3A 1YEFL 2XZAH 3WD5L 2XTJB 1BREA 1YJDL 4BSWA 1CLZH 3QUKB 2E27L 2G5BA 3P9MA 3O3UN 1ERNA 2XFXA 2XN9A 5HYSA 3UEZA 1FFNB 5F1NB 2HWZL 2I27N 2GJ6D 4Q7DA 1OP9A 3HC4H 1UVQA 3U83A 2XPGB 5L2JA 1OSPH 1MIMH 4RAVB 3DTXA 5HHNB 4JFDE 1UWEL 3C5ZA 3H3PL 1JWUB 1E4WL 2B5IC 3LKQB 5F88A 2CK2A 1W72L 5FUCC 4KI1A 2WIIA 1ADQH 1Y0LB 3L3DB 4ZSOA 1EHNA 2XRAH 5TE4L 4D3CL 4HEPG 2ERJC 4NZRH 2B1AH 2GJJA 2BVQB 5I16A 5IT2H 2DQJH 3VRJA 1MI5D 5JLZB 3LHPL 1QO3B 5D7LA 5J0BA 3O3DB 1LGVA 2XQYK 2UZIL 3AXLA 2HFGL 3P4MA 4XXCC 4YXHL 5DMIL 1MRCL 5CHNA 1VACB 3QIUB 2QR0A 2HN7B 1CLYL 1H9VA 3DOSA 2ITDA 3PQYE 3MRFB 5CKGA 3THMH 2XT1B 5EBWA 1HH9A 3RI5K 4D0DB 4X80L 4ZPTB 3L5WB 5AAWA 2MCG1 4YHYB 3B3IB 4M1CC 1KN4H 2IAMD 3BP6A 3WKML 4HPYH 3QEGL 4K3DL 1HNFA 3MCKB 1J18A 1G6RB 1DQLH 4FFVD 3VDBA 1UEMA 1X5KA 4F7MA 4ZS7L 5MEOB 3CIQA 4WTWA 4G8EB 4V1DE 4MGXA 5ACZB 5I66A 2V7NB 1A7BA 1DBJL 3D69B 4R4FH 4TUOB 3BD4A 5GZNC 3BP5A 4M61A 4FFWC 4XRCA 2F9BT 4Y4KB 3C6LC 1OTTC 2OMBA 3C5SA 3DETC 1UJ3C 3VXSB 1MWAB 2AV7B 4P5KB 2HLAA 1CIUA 4OF0A 3P0YL 4OZIE 3KLDA 4LHJB 5B8CB 4OCYL 3GM0A 3MRGB 1YPZF 3GKWL 1ZHLB 3GSNA 3LKRB 5T1LB 4CU8A 4NZTL 4X6DE 3OAYH 5E7BA 4OB5L 1JTPA 5ESAA 3B2UD 2CDFB 3PGDA 1F3JB 5INCA 5ICYA 5J1TC 1PQZB 1UZ8B 4HZLB 3FT3B 1ZHNB 3DROA 3VXOA 1CLCA 32C2A 5EZLB 3U6RA 3EYFB 4O4YL 4MQ7B 1GRWA 3VRIA 3RAJH 1XFPA 3UJIL 4KI5C 3S35L 1KCRL 4WEUD 4UTBL 1K85A 1T83C 2CD0A 5CEXB 1V7NL 3CFJA 5F97E 3QSKB 2X4PB 3RWEA 1VA9A 3O4LB 2J1KA 1OVZA 3STLB 4KK6D 2VXQH 2FWOA 1M7XA 2R2CA 3I02B 3MV7E 4XCEB 3I2CL 3PHQB 1FFPA 2OXGA 4XNZC 2YPVL 1YNKL 1T04B 1UCTA 4PYGA 3QNXA 3SJVE 3PWNB 5E8OA 4DVBB 3ULVE 2QEJA 4OCSH 2FH8A 5KVEL 1WQVT 5DFVC 1I9RL 1TJHH 4Y2DA 1J1PL 3Q5OA 2FX7H 1FVCB 4NNXB 1F3DJ 1BLNA 4U33A 4IM8A 4MNQA 2ZOKB 5L8JB 4X9IA 3RWJB 4F57L 5IBTL 5EUOE 3MJ7A 2ID5A 4CMHB 4U4BA 4Z0XA 3JTTA 2KZ1B 3EFDL 3DJ9A 3UO1L 1M05A 3BRDA 5J6HA 3NH7H 1NGQL 1ZMYA 5E6IC 4GRLB 1XIWA 3RGVA 4CW1B 1VEPA 2AKRA 1FFOB 4YUEL 4D2NA 4LLMA 5HI5C 1YEFH 3WJLC 3WD5H 1QSFE 1YJDH 1S9VA 4F33A 2ICWJ 4L8CA 3PP4L 2E27H 4KROB 5BS0A 1G7JB 3VXRE 2ZUVA 4LSQL 2NY5C 5J3HD 4WV1B 4X98B 5ID1A 4RMUA 2HWZH 1OP5K 3BESR 4JHZA 1N6QL 5HDBF 3VG9C 2YEZB 3H3PH 1E4WH 1JN6A 1I8KA 1W72H 3GSRB 3FB5A 4JZOA 4XAKD 5I1AB 3PABA 5TE4H 4D3CH 3BIKB 3VJ6B 5CIPB 5K9QG 5BQ7A 3MUGA 4JRYB 3P4OA 4NO2B 2OZ4L 1TLKA 2BHUA 3VE0B 3LHPH 3ZDXF 3QXTA 3S8WA 2UZIH 3NIFE 2HFGH 5EU4A 2C26A 3N1FC 1QR4A 5DMIH 2RGSA 4OD1L 1MRCH 3ULUE 1NCNA 1ZHBA 5IWLC 4BFIA 3ZSTA 3QDGB 4X80H 1EPFA 4CMMB 4LGSB 5E1HB 3LB6C 2PCPB 3DBXB 1EUTA 3L3GB 2Z8RA 5MI0B 2IBZX 3WFZA 5JW5A 3EJZC 1MSPA 1WC7B 3LPWA 4YNYA 3WKMH 4ODWB 1OPGL 1A3RL 3QEGH 4YX2L 1MLBA 2R1WB 4I2XB 1HHJA 2YD9A 1FN4A 3RJDA 3LRHA 4ZS7H 2JCCB 4QGTA 4YR6B 1CK0H 1DJSA 1U41A 3TVMD 3VWKA 3OHXA 3BN9D 5IUSA 1CYGA 1KCLA 4GG6B 5BV7C 1TTUA 2J12B 5F7WC 4TOYH 4UQ3A 2VAAA 5C0ND 3IFLL 3ORJA 5C1MB 4L29A 1BF8A 4S1QL 3P0YH 3KYMB 1R3IL 1S78D 4OCYH 1QYGL 3C9NA 4F58L 4LSVL 3GKWH 2F54D 4ZUTB 2CLVA 4YHPB 4I18C 3UXFA 2PNDA 4OB5H 3IAPA 5EIIA 1J86A 3FQXB 4PGEB 1UXWB 4UMGA 1R5WB 2EEAA 2VKXA 2QSCL 3FB8A 5CJXC 3T0VA 1XGTB 5EC1A 2PW1B 1U91B 3SDCB 4LHUB 4M6OL 3U1SL 1NJ9A 4ZAKD 1FYTB 4O4YH 2QKIB 5CBEA 4G80A 2YMXL 3KYNA 5D7LE 3SGKA 5IMLA 1NEZA 3L3KA 3UJIH 3S35H 1F42A 4UTBH 1KSRA 2W59A 4OCLC 1V7NH 1H3GA 3QWRD 5JHDD 2EIZA 2OL3A 2X4RB 4RBPK 5DJ2A 1LDSA 4DUWA 2OR7A 4MA8L 4NBYB 5DI8A 2VLRE 3I2CH 1XGQA 3IXAA 2IAMC 4AT6A 2YPVH 2LVCA 2A9NL 1YNKH 3N0PB 3IAQA 3MUY1 5FK9A 1KTDA 1F6LL 2V2XA 4HIEB 4GKZA 1VFOA 3MV8E 1AR1C 4FFVC 5KS9F 1UQSB 3OJVC 5KVEH 4M43L 3REVA 1PG7H 1I9RH 2FEDD 4U1IB 3CJJA 1J1PH 2V9TA 3IJYB 3GSXB 4X7FC 3SGEH 4MNGB 4PJ9B 1RSFA 2HVKA 1CS6A 3CXHJ 4XTRC 4L4VB 5HHOA 4F57H 5IBTH 1VKXB 3SE3A 3EFDH 5DRXB 3UO1H 5IF0B 3RWHA 1DQQB 4U0QB 2DB8A 2FJGB 5TF1L 1NGQH 2ZSVA 2BVPA 2A73A 3SCMA 4KZEH 1DVFA 1H0DA 3H9ZA 1MRFL 4KJWD 2YPLD 3MX0A 3SKNA 4YUEH 5KSAD 4HS6B 4L4JA 4O58H 3VH8A 2VL5A 4LSDA 3B43A 3CVHL 4D0BA 3B2UC 5C8JB 2Q87A 1IZKA 2PO6D 3D39E 5KN5A 3Q1SL 3PP4H 4JO1H 4M3JA 4BM7A 3GSWA 3OX8B 4TSCH 3TA3A 3ZKNC 1B4RA 2RHEA 4LSQH 2EZ0C 3AS3A 3O8XC 4GAGH 5DA0B 4NQEB 2YHGA 1FLRL 4QF1B 4P4KD 3A6OA 3WYRA 2DJUA 5KOVC 1JZ8A 1F11B 4PBVC 3FHQA 1YNTB 1N6QH 1UZ6E 1H3WM 2B7DT 2PYED 3U4AA 4UNVA 5LKNA 4NCDA 1XR9A 1E4XI 2VZVA 2KDGA 2YD5A 4BQBA 1NCBH 4U7KA 2Z92B 3QAZB 3U46B 3VGAB 2H2PD 1G6RH 4KK6C 4LLDB 3WO4B 5HGBA 5E8DL 5E70A 4LCYA 4PRPB 3CCHB 4QRPB 5ESVA 1QRNA 5KVGL 2CIKB 2OZ4H 3FO9B 1U8NA 2ZSWA 5HDLA 3TPKA 1WISA 1BD2B 4HK3J 3R0MA 2A77L 1CTNA 2C1PB 3JXAA 2MQCA 5JHLL 2NTFB 5E4EC 3LV3A 3LN5B 1A9BA 3MGAA 4OD1H 3ZKSD 3FHAA 3M17A 5IVZA 3GSOB 5F21B 4LCCB 4NNPL 2HT4D 3HI1B 1JF6A 3N1GC 4NUGL 4PTTB 4GKNA 1BVZA 1OGAA 2GHWB 2Y23A 5KVDL 2GK0B 5K9KA 4TPRL 4PJHE 3MROB 4ONOA 1OPGH 1A3RH 3UJTL 5IJKA 2P5WA 4YX2H 4P9ML 2D31B 3MXWL 3MLVL 5D1ZD 1ZHKA 1RUPL 3H7BB 3M45A 2E6PA 4KK5D 3HE6D 2GSIB 4LLAA 5CZXD 3RNQB 3RQ3A 2AXHA 1LE9B 3IFLH 4HUXB 1DSFL 5GSRB 3V9FA 3QIWB 4S1QH 5J3HC 2R2EB 3AY4A 4QHMB 3OB0K 1R3IH 1NCUA 4NO5B 1RZKC 1QYGH 5ISZE 4F58H 3BEWA 1KB5A 1FSKB 2JJTC 4UT9L 1YYML 3QFDA 4LLYB 1OAKL 4MLSA 3T1FA 2R2BB 3REWA 4H25A 4V1DD 3IGAB 3MFFA 4JREC 1ZLVK 1KG0B 2QSCH 5BRZA 4BFEA 2BNQE 4LEOB 1RIHL 4ZFFA 3ARPA 4M6OH 3U1SH 1JMZA 4JHBA 5DS8B 1U58A 1V3JA 2A1WL 1K5NB 3O2VL 5D7IF 2YMXH 1AQDA 1NUNB 4P2RA 5T3ZH 4U6HA 3F5WB 3MMEA 2CLZA 1HNGA 1EMTL 1S9WA 1UFUA 1FAKT 5C0DA 1YUHA 1YPZB 1RZ8A 3IDXL 2P8PB 3V6OC 2GUOB 4NRZA 3BI9X 1RUAL 4KDVA 3OKMB 4K8RD 3F8UB 2AEWA 2NY1B 5D96B 1J7VR 2NXZC 1JRHI 4MA8H 2BDNH 4XMPL 5HHPB 3VXUA 4YE4L 4K3HA 5IVXB 1DQJA 2A9NH 2BVEA 3KNBB 4JHAL 3QPXL 1JTTA 3VFSB 4C83A 5CEYA 2QJDA 4PJAB 4M43H 1WIOA 4MJ2A 5HGDB 4B0MM 5EO0B 3QEUA 2VXTL 3N06B 2ZG3A 1TZIB 3O3AB 4KK8D 5L2KA 1A0QL 3MRPB 1QP1A 5E95B 2H6PA 3SBWA 5CMAA 3TH3T 3KPOB 2J4WL 2IH1A 2Z31D 3QCUL 5INDB 1Q9KB 1EGJA 2DQFB 4PG2C 5KJRL 5IMKA 4KAQH 1JE6A 4XI5D 3BPNC 3ESUF 4NO3A 2IBBA 3MV7D 4KPHH 1H15B 1B0GA 4HDIA 1KGCE 4YC2C 4HUWB 4MMZC 1CD0A 1CCZA 4I0KA 1JPGB 1WV7T 3CVHH 3ULVD 5GS1C 4PREA 3K1KC 3MRQA 3NIGE 2DYPD 1JK8A 4A6YB 3Q1SH 3MUHL 3GJFB 5DK2A 1EVTC 3MBXL 3U0PB 3V8OA 5SWSD 4DKEL 2HVJB 4HFUL 1FRGL 4MQTB 1ZT1B 1FLRH 4ZAKC 2ENYA 1BM3L 3OXRA 3B9VA 4GW5B 3D25B 3RDTA 1OQOA 4NBZB 4L3CA 1QLRA 2DBLL 3HNTL 1SJEB 1ZA6A 1SEBA 1RJCA 3MRMB 3H9SD 2LE9A 3SDXA 4ACPA 2YBRB 1U3JA 3WIFA 4W4OC 1K8IA 1NGZA 3QUML 3OJDB 4N8VA 4JFEE 4Y1AA 5E8DH 4NZUH 2QQQA 4PR5B 3LH2L 3VWJD 5KVGH 4NQUA 4HULB 3D48R 4AMKL 5DTFA 3BX7C 4MNHA 3ARDD 5FM5O 4FN0A 4HSQA 2UWEA 3GBLA 4PV8B 2IPKB 1JWSB 4HKZA 1CGYA 2FEDC 4PJXF 4ZOAA 4RWYL 1Q9WA 3C8HA 3ZHDA 1A1NA 3NCYS 4NNPH 1CQYA 2X10A 1IAOB 5C9KA 3V52L 4NUGH 4DKFH 5DMKB 2NY5L 1P7QD 3ETBF 4ZO7A 3PGCB 1W0VB 5KVDH 4KKCD 3T65A 4U1LB 3ARGA 4TPRH 1XR8A 1S7SA 1Y18A 3S37H 1AGFA 1DE4A 3UJTH 3B9KA 3Q3GB 4DCQB 4NO0A 4P9MH 4DZBB 4X7CC 4CVUA 4KJWC 4P5TA 5KSAC 5TF0A 4OZIF 1JFQL 3SDDD 5L88L 2DTML 2VE6B 2VDRL 1RUPH 5ICZA 1ZK9A 2PO6C 2IPUK 4Z77A 3ULUD 3CZFB 5FKPB 3HNVL 4P9HC 1CE1L 5I73C 1X5IA 4LLVB 3E6FB 3BIBX 5I1IL 3MLZL 3MV9A 4HUUA 1IZJA 2QQKL 2XXMB 3FCTB 1N8ZA 5IEHA 4G3YL 4KKLC 3VXMB 1RZGA 4E42B 1LE5A 5AWNH 3BUYB 3VI3E 4CVWA 2Q6WA 4PRHD 1PEWA 4JAMA 4UT9H 4Y5XC 5D5MA 1YYMH 1RK1B 4X7TA 1QEWB 4EDWL 5HHVH 5HHQA 4GRWF 2CKBB 1SMAA 4PJFA 5EZOL 4I3GA 3M07A 4Y4HD 1NBZA 3GM8A 2ENSA 4Q9RL 4L8BA 2LU7A 4WVRA 4F3FB 4F80A 2I9TB 4GT7A 1NFIB 3G6DL 4Z7UA 3LKSA 1RIHH 2YD3A 3QUYC 1FFQA 3T8XA 2A1WH 2ADJA 3X3FL 3O2VH 3LKNB 4EUPG 3QNZA 1L0XA 1F2QA 3QULB 1MAKA 2YWYA 1QPXA 1T3FA 5LQBL 3HZVB 1EMTH 3FB7A 3KPLA 5BV7L 3G04B 4FQPA 4XBPB 1NCWL 2Z0BA 2FRGP 1I9IH 1PX4A 3IDXH 4XNUL 5E03A 1QBBA 3FQWB 1BBDH 1A22B 3N85L 2VKWA 1FVEB 1YQ2A 1C8PA 4HKBA 4PD4J 4XMPH 5HHMB 4YE4H 2K1MA 3PWLB 5HI3C 1KCKA 3RZCB 2A6IB 4JHAH 5C0AD 3QPXH 5IHUL 3D3VB 4WO4D 5D1XA 2AI0L 4AQOA 3BZFB 1HK6A 4HMDA 3MGTB 5BCAA 2VXTH 1QR1B 4ZTPL 2AK4D 3HMWL 3UC0L 1A0QH 1C1EH 1JTOA 5FDWA 4KK5C 1MHCB 1ZVYA 1BZ7B 3PWUA 5CZXC 3E6HB 3S5LB 5C6PB 3OR6A 2J4WH 3LDBB 3QCUH 2CXGA 2F19L 3ZLQC 5CD5D 4HHAB 3BPLB 5FAAA 5KJRH 1JZ2A 1PFCA 3EDKA 2B20A 4FZEH 3QPQD 2VLRD 4Y19E 5MEPA 3PDOB 3BGAA 4R0LB 4Z7WF 3BRGC 5IW1A 5DVMA 5LAXB 3L3HB 1UT9A 3H0TB 4D0CA 4R90L 3MV8D 1G7IA 3QEHA 3EOTL 3FOMA 1DTUA 3MBXH 3S98A 4DKEH 2BNRD 1I85C 1PAMA 4C55A 2XA8L 1EO8H 4HFUH 4KVNL 1FRGH 4HJJL 3TWCL 2L7UA 4C59B 5EU6A 4TVSa 1D9KC 1YY9D 2BVOA 5EBLA 4U1KB 5IB3B 1L6XA 4ODSL 5DJAA 3IFNL 4UV7L 2X89A 5IM7A 3HNTH 1NC2B 3U4EA 1A1MA 1PYWA 1FLTX 3T2OA 2R0WL 3NACL 4PRAB 5FV1L 4J1UA 4JM2A 5D72H 5FGCE 3SQOL 1CD1A 1IEHA 2JB5L 4Y4FA 4BA8A 1A6TB 1TZGL 1TPXB 4K8RC 3DXAD 3LEYL 1ZGLB 2ESVE 4IDJL 4TULL 3LH2H 3S4SA 2BOCA 1SYSB 3D39D 3VXUE 5I17B 3FOLB 2C1OA 1N4XL 3P9WB 1RY7B 4JVUA 4RAUA 3P73B 5F3HB 3MBEA 4RFEA 1BZ9A 4YZFF 3VA6A 4QY8A 1ADQA 3QCTH 5GRWA 1R3LA 4DZ8A 3X13B 2DQEL 1JYVA 4S1SL 4AIZB 5LGKA 4U2YA 4RWYH 3FT2A 4KK8C 3MRBB 3P0GB 2VDML 3ZE2F 3VFNB 5A16A 5TDPB 1DLFL 3V52H 1B0WA 4JFOA 3QIBA 2Z35B 3EDDA 3TVMB 1QZ1A 3W39B 2W91A 1TVHA 3CXDL 1U36A 3GB7B 3EO0B 3DX8B 1KENL 3HC0A 3PWVA 4MHHG 4W81A 1S9YB 3TZVD 1NGXB 1JHTB 3TJEL 4XI5C 3EZJB 3P9LB 2X4UA 1HKFA 1HSBB 2RBLA 3RWDA 1VHPA 4OCXL 3T3ME 1JFQH 4MD4A 3QXVA 4GQ9L 2DTMH 5D71H 5L88H 5BW7C 5C0CA 2DQGL 4N1EA 4HIIA 5IROA 5FYJU 3DGGA 2ICCA 5I8CA 4IDLA 3HNVH 1XT5A 1DQTA 1CE1H 1AGCB 1AGDB 2A83A 1U8IB 1HZHL 1XF2B 2DTSA 5DF0A 5I1IH 5AG9A 2QQKH 5FKAB 1QVOA 4G3YH 3I3BA 2BJML 2GKIA 3WNMA 3ZT7A 5J4MA 2BSED 4QTHA 3KS0J 1RZIA 4HAFA 2NY6D 4UDTB 4EDWH 3WBDA 1MFCL 4UU9A 4MMXC 1U3ZA 5EZOH 1J0HA 4BKLB 5ESQA 3N1PC 3NPSC 4Y0GA 3KVQA 3U7YL 3TH2T 4F37K 5C6TH 5JHDB 5JORA 4POYA 3VWJC 3G6DH 2W0FB 43CAB 1T4KA 4KXZH 4KRNA 3W0WD 1XGPA 3X3FH 2YA1A 3NFNB 3TIEA 1OM3L 2YUVA 1U92A 1U8OB 5LQBH 1KUMA 3SY0A 5DJ0A 5BV7H 4JB9L 4G8IA 4KJPD 4D8PA 5ISZD 1NCWH 5J1AB 1HOCA 4KTYA 4QTIL 2XV6B 2HKFL 4XNUH 3CMOL 3B2VL 1DUYA 3W9DB 3DLQR 2RQ8A 1WAAE 2WK2A 3N85H 2A6JA 5DZLA 4KKCC 3ZHKA 1IGYB 2Z8SA 1ITCA 4WU7B 3BZ4B 3F7VB 4WENB 3HE7A 1RZKL 3BEVB 2NPLX 4M48L 4EJ1C 5JXEA 2DAVA 4HIJA 5IHUH 3DSNA 1TNNA 4QYOA 2AI0H 2BNQD 3G5VB 4EI5D 4LRIC 5CS7A 3SDDC 1Z5LA 4TUJB 5HVHB 4ZTPH 2IF7A 2BSTB 2W0LA 3HMWH 1X4YA 5ETUB 5TFSL 3UC0H 5EU3A 1X4ZA 4R2GD 3HAEA 4K7FA 3U30B 1B0RB 4HH8A 2P47B 2F19H 2OM5A 4DWHA 3ZZ1A 2A74A 5BZDA 2XI9A 5D93C 3SPVA 4XCYB 1HDMB 3VFTA 4ODUB 1K8DB 3BPCB 4S2SB 3HRZA 4P4KB 1HHKA 1CDYA 4P4RA 4TNVK 5DQDL 3MFGB 5D5ME 1P1ZA 5TQ0H 1X7QB 4R90H 3UTTE 1U3HD 3KXFE 4Z78A 1IKNA 2VLJA 2VUYA 3FB6B 1KEML 2PYEB 3EOTH 4Y4HC 1UENA 5H2BB 5EN2A 5BJTB 4UDUA 2VO5A 1UJTA 1AJ7L 3SO3C 3ULSB 4MDJA 1JNLL 3CSBA 3FTGB 4RQQA 4WI3A 3IVKB 4QXUL 2XA8H 4KVNH 3TWCH 4HJJH 1M7IB 1XF1A 1Z9SA 3D2UB 4Z7UE 3TO4C 2ICWB 1Z9OA 3L5XL 4ODSH 4UV7H 5GGQL 2C4FT 4IOIA 1KN2L 2VYRE 4DGYL 3PUCA 4XVSH 1ZTXL 4GUPB 3FFCA 2O93L 2UUDK 1X6LA 3CFBB 4CU6A 3VFVB 1OL0A 3MR9B 2R0WH 1T0PB 3NACH 1RK0B 3UTSA 1CIDA 3FQNB 3QQ3B 3SQOH 2JB5H 1XZ0A 1CFNA 3UTPE 3OAYK 1TZGH 3BMWA 1KGCD 1AXSA 3MYZA 4PJEE 5DJDA 3LEYH 4UAOB 1GZQB 4KKBD 4LARL 4IDJH 3HLAB 4TULH 5FGBA 1HWGB 4OCNC 4PGDA 4JFDB 1N4XH 3KJ4B 3IETB 2K7PA 1C08B 1J11A 5EOTA 4EUPA 3IDIB 4PJ7E 4ODXB 4R7NB 4FTVE 2Q7NA 1PX3A 3V79C 1FO0B 4OUOA 4S1SH 3KGRA 4AEEA 3MRJB 2AQ3A 5IB5A 3BZEB 1CGWA 4OV5B 3B5TA 4L4TA 4L8SC 4HGMA 4JY5L 3MOQA 1U8PB 2FLRT 2VLME 5D1ZB 1DLFH 4HLZG 4ELMA 5DD6B 3B9AA 3CXDH 3V5KB 1I9JL 1KENH 3VGDA 4HWBL 3HE6B 2VR5A 5CD5C 4EN3C 1AR2A 4JFED 1FV1A 3TJEH 3PQYB 3VFMA 3U7AA 2WBJC 2XWBB 1IMHC 5EBMA 1I8LA 4WFFD 4OCXH 2EDXA 5FGSA 1E27A 5HSFA 4GQ9H 4TVPD 4AEFA 4MDIB 5I0ZA 5F1IB 1KJMA 3O6ML 5EWIL 2BRQA 3MRLB 5D1QA 2OI9C 4OFDA 4BH7B 3AREC 35C8L 1LEKA 3WN5C 4HQQH 4X6FA 1I1RA 3VW3H 3T04D 4JG1L 5KANI 4FP8L 1NDMB 3UTOA 4V1DB 1YY9C 3NMEA 4JLRB 3FFDB 2BJMH 1KPUB 1T89C 4LLQB 5FM5M 5C09A 4CU7A 4QOKE 3B6SB 3KLAA 1JL8A 1P53A 2RFXA 1RAMA 2DQIL 4KMTL 4N5ED 4FXKB 4TTGA 3ARQA 1MFCH 4R4BA 3UPRB 5GGSB 1TCMA 5HBBA 4OZIB 1BFVL 3T0ED 5FYLD 2KL6A 4HH9A 2CXKA 2HFTA 3U7YH 3ARVA 3KWWB 3GSUA 2EIDA 5E9DA 5C0BA 2WINB 2EYTB 4X5WA 5CD3B 3KG5A 4X6DB 2R0LL 4M8VA 4M7JL 4P2QE 4ZNEA 4E41E 3RNKB 2BNUB 4C4KT 1URLA 1OM3H 4MXVE 4ZUUA 4X99B 3OJMB 2Y1VA 3N1QC 4JB9H 2ZKHH 3SGJA 5I2IB 3QFJE 4QTIH 4WWKD 2HKFH 2AABL 3CMOH 3B2VH 4P9HL 5D70L 4NIKB 1ZA3A 4LGPB 1A3QA 3HG1D 1OY3B 3G6AB 1P4BL 2VISB 1W0WA 3AROA 3R4DA 4DFIA 4FXGB 1RZKH 4M48H 5F70A 3TZVC 5EBGA 3O0RL 2Z31B 4NKMA 3VXNB 5J57B 1JYXA 1CDUA 2V2WA 4KUCF 1AGBB 4AL8L 3MACL 3QO0A 3VDAA 4WUUD 4DW2H 1G1YA 2C4FU 1I1AA 3UCRA 5TFSH 1FVDA 3MV7B 1FZOA 3KR3H 3MRHA 4KV5E 4AYFA 2LAGB 3SJVB 1KLFA 2WWMD 3QG7L 1NBQA 1UGNA 1WWCA 3QUKA 4M9PA 3K1DA 3O11B 4DOHE 3T2PA 4M6ML 4MWFB 3MREB 3MLRL 5F1NA 4LHUG 3NN8B 1P7KA 2NY6C 5EUOB 2XPGA 1WFUA 4Z0BL 3WHE1 2V6HA 4RAVA 2WP3T 5HHNA 1JWMB 1T1WB 1KEMH 1NGWA 3DUHA 3ZKXB 5KOMC 3RY4A 1YEEH 1AJ7H 3L3DA 1HWHB 3MLUL 1JNLH 1SYVA 1JGVL 3LCYA 1BPVA 4QXUH 3ZTJH 4OZHE 1ITBB 1JZ3A 1S8DA 5AZEL 4DTGL 3TBYB 4NZDA 3WJJA 4P23A 3L5XH 1H3XA 1QSFB 3GMNA 5FYKU 5GGQH 3QRFM 1G0XA 3OXSA 1KN2H 4DGYH 1H8SA 5JLZA 1ZTXH 1QO3A 4EXPX 3ARDB 1D6VL 1D5XB 3VXRB 5SWZD 2OTWB 4U1NB 3MJ9L 4NKDB 3ALXA 1OT1A 1VACA 4Y19D 2HN7A 2ZCKL 4WRLA 2VLKA 1DEEB 3V0AC 4LSUL 3MRFA 3SE4A 3QDJE 5C07E 1S7QB 2IPTL 2HT3D 1JYNA 2X1WL 1QFHA 4LARH 3L5WA 2BC4A 1NH6A 3CLFL 1XGYL 5ICXB 3CU1A 3LS4L 2WZPD 1U8LB 4BH8A 3RVXD 2BHYA 3MCKA 2ITCA 4EI5C 1G6RA 2NCMA 3QB7C 2CRIA 2CDGB 4NJAL 4JY5H 5MEOA 5GGVL 2H26B 4G8EA 4JN1L 5K59E 3RBGA 2V7NA 5DUPL 2OZ4A 4R2GC 2EEDA 3D69A 3QDME 3GMMA 5DJZB 1I9JH 4JKWA 4HWBH 3X17A 5JNYB 2X4NB 4ZFOB 5F7EL 3ARTA 4S1DD 2H32B 3FQRB 2ESVD 1EHLH 4N90E 4JZJC 2KQMA 2W60B 4K71C 5B8CA 2W0KA 3MRGA 5C2BL 2J5LB 2WAHA 3LKRA 3O6MH 5EWIH 3U9PL 3VI3F 4K8RL 2VLJE 5I75C 35C8H 5AYUH 3UPCA 4XNMB 4R4ND 1F3JA 3MODL 2ZP0T 4FP8H 1PQZA 4QRQA 2Y7QA 2RB8A 4HZAA 3FT3A 4OF7A 4RSVA 3D9AL 5EZLA 3HKFA 3EYFA 2E3VA 3NIDF 4BSWB 4KMTH 3FFCE 1F4AA 3QH3A 3P9MB 3BDYH 1ZLWK 4K2UH 1T1ZB 3AFLA 3UTSE 5HYSB 1FL3B 5CEXA 1BFVH 1KXQE 4AENA 2X4PA 5F7NC 1UVQB 3V4UL 2YN3A 2YUZA 4MJID 4G42B 4NC2B 3DTXB 5IJVA 4M7JH 5F88B 1K9TA 3I02A 4I0PD 2WIIB 1FNFA 5SX4H 3D0VB 5DDHB 1EA9C 5GS2D 4JKKA 5EIVA 2XWTB 1VDGA 4CDHA 1IVLA 1S7TA 4OM1L 1YN6A 2W1NA 4XXDA 1KCVL 4LPCA 4WO4B 3BFOA 4L4TE 2GCYA 1IGJB 2AABH 5I16B 4KDTC 4P9HH 2NY7L 3S36H 5CJOL 5D70H 4LEXL 1CLOL 4RX4A 4ELME 4NNXA 2IMMA 5D7LB 2X1QA 2VITA 1P4BH 3NZHL 3AXLB 4JQIL 3D5OF 4YBLB 5GPRA 4OIAA 8FABB 3P4MB 4OZFH 4W6YB 3TM6A 3ARBB 5CHNB 1JPFA 3ZL4L 3UYRL 5D6CA 4EEEA 4WW1A 5CJQL 4AL8H 4GS7C 3MACH 4PLOB 4FQXA 2QQLH 2LV4A 4L1DA 3RIFK 1F8TL 5EPMB 1BVKA 1O7VA 2VLRB 2AJSL 1FNEB 4QRSA 2GIYA 4JRXD 3UDWA 3MV8B 1GGUA 3QG7H 4KQ3L 5FUZL 3E2HC 1X5JA 4UIKL 4F7MB 2OSLA 1G7JA 4M6MH 3CUPB 3O3EA 5KW9L 1FH5L 5I66B 3MLRH 4WV1A 4X98A 1UYWL 3QEQE 3KPSE 4NDMA 4M61B 2DIBA 4XRCB 2EYSA 5JQHC 4NQDD 2D7QA 5IEKA 4N5EC 3C5SB 1L9MA 4YGVB 3QJHA 5TQ2L 5L0QC 1BWMA 4L3EA 4Z0BH 4LFHD 1FNAA 2YEZA 3T0EC 3EUUA 5I1AA 3UPAA 2YS4A 5DT1L 3MLUH 3E3QE 3PP3H 2OK0L 1JGVH 5E9DE 3DHMA 5CIPA 3OF6D 3MRDB 5AZEH 2XG4A 4DTGH 4J2XA 4JRYA 4QHNA 1GGBL 4IRJB 1U8MB 1J88A 4NO2A 4F7TB 4ZNEE 2R4SL 3D39B 3VE0A 5D7JD 3DX9B 5JTWA 3FN9A 5E24E 5CFHA 5ICYB 1D6VH 3DMMA 1HQRA 3H42L 1RULL 3HB3C 3MJ9H 4WWKC 2ZCKH 4K3EL 3U6RB 4LSUH 2SEBB 4PFEA 2IPTH 1NUDA 1EAPB 3LPFA 3UTTD 3RPIA 5HYEA 3G5YA 4MA7L 3CLFH 5I1LA 2F5BL 3L3GA 2JLLA 3P30L 1ZWIB 3ILQD 4XMLH 5B4MD 3QUXC 1WC7A 4QO1A 4LASL 3RWEB 3LEVL 4LIQL 2R1WA 3GBML 5IBUB 3IJHA 4LAJH 4NJAH 1XCQB 2JCCA 5GGVH 4YR6A 2GW5A 4JN1H 5KZCD 5DUPH 2DM7A 4RZCB 2QTEA 2WWMC 3QNXB 4QXTB 3RY6C 5IKCB 3UTPD 5F89B 1H8OA 5F7EH 4ODHH 3KHQA 3KYMA 5MHSD 1XCTB 1GGTA 3OKKA 5C2BH 3U9PH 4K8RH 4YHPA 1QSEA 3JTTB 4FTVD 4A2LA 3QUZD 3RHWF 4PJHB 8CGTA 4CN1A 3SDXF 1S7RB 3CFEB 4Q9CA 4U7SA 3MODH 2AJZB 4F8TA 3WO3B 5FFLA 2AKRB 3ARFD 1R5WA 1A2YA 1NMCB 1XGTA 5IIEB 2X7LA 4M7ZB 2PW1A 1U91A 4LLMB 4NCC2 4NHUA 3SDCA 4PGJA 3OGCA 2QBWA 2QKIA 1R5VA 4L8CB 2ED8A 2NX5D 5JW4Q 2UWEF 4XX1E 5ID1B 4DKDC 4KVCL 4W6XB 5F9WB 2VQTA 2VLKE 3V7AG 5ISZB 4DEPC 2ADIA 2X4RA 4M3KB 3V4UH 5I18H 4ERSL 4OLXL 4PJ8C 4YDLC 1I8IA 4EIZC 3FB5B 4JZOB 3RU8L 1BQHB 3CFDB 3RVXC 2Q86A 1Q8MA 1UQSA 4R9HA 5BQ7B 1KCVH 2Z4QB 4ZUSA 2BNQB 4U1IA 4G6FD 4D9RE 1JNHB 2NY7H 2VC2L 4HX1B 5CJOH 4LEXH 3GSXA 3P2TA 1MAJA 1CLOH 1NKOA 4F8QA 3NZHH 4JQIH 5A40E 1FCGA 4L4VA 4LOUD 2AXFA 4NGHL 5D2NC 5HTSA 3ZL4H 5JIPA 4S1DC 3UYRH 4X9GA 3C6LA 1PKQE 5DRXA 5IF0A 5CJQH 2VZOA 5AD0B 5FDYA 2FJGA 3FN0L 1ZOXA 1FNHA 3TH4T 1F8TH 4P2QD 1T6VN 1R6VA 2AJSH 1O5DT 1LD9A 2DLEA 3NOIA 3Q6GL 4HS6A 5JW5B 3T77B 4WFGE 5D5MF 1U3HB 4KQ3H 4R4NC 5FUZH 1JJUA 2CR6A 4NSKA 3QFJD 1HHJB 4LSPL 1FN4B 4LCIH 5EB9A 5I1CL 3OX8A 5FUOL 3ZDZE 4YIQB 4PJFF 5KW9H 1FH5H 1LILA 4MAYC 4NOBA 3VWKB 2AXGB 1UYWH 4NQEA 4Q9BA 4QF1A 4Z7UF 4UQ3B 1F11A 3H9YA 4YO0B 5TQ2H 3MO1A 5JQ6L 1M4KA 3CDGA 2OX5A 2XTLA 1I7ZB 3STZB 3VXTB 2EO1A 5DT1H 4FMFA 5GS0C 3RWIB 2Z92A 4LSRL 3U46A 1LO4L 1MQ8A 4LLDA 2CLVB 4NQSA 4CGTA 4JO3L 5E94A 3LPGA 4PRPA 1GGBH 4QRPA 2APTA 3E8UL 1Y6KR 3SGDI 2WM0A 5EZJA 5EIIB 2X1OA 4YPGA 1BD2A 2FBJL 3WLBB 5AZ2H 5GJTL 5JUEL 2NTFA 3H42H 1RULH 2FECL 5EC1B 4FMKA 4XMKL 4K3EH 4LCCA 2HFFA 1WWWX 1NJ9B 1A6WL 4G9FA 5I71C 1PY9A 4AEHL 1RD6A 4G80B 3KYNB 4PTTA 4PJ5E 4G8GA 5IMLB 1NEZB 4XPTL 3S5LG 4MA7H 5T3ZE 1KIRA 2F5BH 4PY7A 2J8UA 3CZJA 5TE6L 3W5NA 3BIAX 1FBIL 4LASH 3MROA 4JFEB 1IL1B 4LNRA 1IQWL 5DJ6A 3LEVH 3UJJL 4LIQH 3GBMH 1GJIA 2D31A 4R26L 1A7OL 4F2MA 4YEFA 5E6IA 1XGQB 4AT6B 4HWZB 3D0LB 3K2MC 3F65A 4X9BA 5FK9B 1KTDB 3B9EA 2V2XB 5T33L 1WITA 3DO3A 2NY2B 4M6AA 4OFPA 1LE9A 1A3LL 3WFHA 5GSRA 5LXGH 3R8BB 2Z8WC 2R2EA 4QHMA 2KPNA 4ZMAT 5EFIB 5HGHB 2HVKB 4EVNA 3HMXL 3TBWB 4DQOL 5EU7C 1NBYA 5E00B 1A8JH 4L3EE 4LLYA 4G8FA 4XNQB 2A73B 3SCMB 4XHJC 4JM2F 3CDFA 3BH9A 3SKNB 2C3GA 3MRKA 5IFAL 1X5LA 4LEOA 5FO7B 3VH8B 3L95B 4NCC1 4D0BB 2E7LC 5DS8A 1UACH 1K5NA 5SV3A 3UP1A 2F53D 3TA3B 4X6BB 3F5WA 2XN9D 1JZ6A 4N90D 5BVPL 4MXVF 4KVCH 1I9EA 3ZYIA 2P8PA 1TTGA 2GUOA 2FEEL 3K8KA 4LF3B 4PUBH 1PZ5B 4ERSH 1CL7I 4OLXH 4U3HA 3C5ZD 4XC1L 2R29H 2D2OA 5HHPA 5B4MC 3RU8H 5IVXA 2XNAB 3KNBA 4JPKH 1KC5L 1AGEA 4L9LC 3LD8C 1PJ9A 1G7PA 4PJAA 3W81A 2WQRA 1UKTA 3BKYL 4NM8L 2VC2H 5EO0A 2WUBL 3O3AA 4XWGL 4B7IA 3MRPA 2Y06L 4C56E 3T08A 3UZEA 3OKYA 1RURL 1MH5A 1SBBA 4X6EB 3LV3B 5INDA 5IVZB 1Q9KA 3BPOC 2DQFA 4UIMB 1I3RA 3QBTB 1QA9A 3DPBA 3FN0H 4GKNB 1KTRL 4XP6L 2EDQA 4QWWD 2EE6A 3LRSB 3O2WL 1QLEL 2GJ6A 3T0XA 3QUZC 4OGXH 1OP5H 1Q1JL 1QSEE 3OKDA 1JPGA 1MEXL 3ELAT 5JW4N 5T1MA 1GPOL 3UAJC 4A6YA 4LSPH 3GJFA 5I1CH 3SQBA 3ARFC 4G6AD 3U0PA 5FUOH 4Z7QF 2GI7A 2AJUL 1T5XB 5FUCE 2E5EA 1ZHKB 1ZT1A 4WHCA 3D25A 3OKLA 5BXFB 1SJEA 3CU7A 3MRMA 1MI5A 2GTWB 2JF1A 3PGFL 5JQ6H 4LVNC 2GQHA 4MJ4A 4GBXD 2B4CC 2H1PH 4QRRE 2YRLA 3OJDA 1WBYB 3NZ8B 3VI4F 4M7LT 4Y19B 4LSRH 4X0KA 1LO4H 4BQ8A 4JO3H 4AM0A 3E8UH 5J12B 2LFGA 4NN7C 3T1FB 4TVPL 1JNJA 4HMCA 2PF6A 3REWB 2FBJH 2ARJB 1LK3L 2DDQL 3WSQL 3C60D 1JPST 4H25B 2CJUL 5GJTH 3MFFB 2IAMA 1CICD 4PV8A 2IPKA 5JUEH 4NUJB 1NAKL 4XMKH 5ID0A 2VR4A 4O02L 2XY1A 1A6WH 4AEHH 3OKNA 1AQDB 5DMKA 4XPTH 4UI2A 3DYMA 2NY3B 3PGCA 3MMEB 1W0VA 4LOUC 2CLZB 4U1LA 3DVNA 1MFNA 5C0DB 1FL6A 1YC7A 5TE6H 5I1KL 5FGCB 1OGTB 1FBIH 5DQJA 2FHBA 5C08E 3G6JA 3Q3GA 1EJOL 1IQWH 4NRZB 4DCQA 2BHZA 3UJJH 4DZBA 5F8QC 4R26H 2ESVB 1VEMA 5F7LB 1NC4D 4OQTL 4EIGB 5DEZA 1A7OH 3K4AA 3VXUB 3ZE0E 3X12A 2ZUSA 3UZQA 1T03L 1HI6A 3JUZA 1UB6A 4C83B 1U3YA 3CZFA 3R0NA 5FKPA 3U48A 1A3LH 4Y2DD 5C70A 5FM8A 2Z8VC 4LK4A 1V7ML 1HCVA 1B90A 3IRPX 2D03L 1GIGL 1V5JA 3KPMB 4MNQD 4E42A 4LMQI 1N5AA 3BUYA 3HMXH 4UNUA 5CMAB 4DQOH 2IH1B 1T0NA 5ECJE 5GXBB 1D3CA 3QHFH