3S34H

Structure of the 1121b fab fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
213
Chain Sequence
EVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVTDAFDIWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 1121B Fab light chain
publication title The Structural Basis for the Function of Two Anti-VEGF Receptor 2 Antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 51
structure length 213
sequence length 219
ec nomenclature
pdb deposition date 2011-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s34H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s34H01
5BV7H 4Y8AA 3SE9H 2KL6A 3BN9D 1UWEH 2OMNA 4FQ2L 3LCYA 5C09D 1YEIL 1RI8A 3T77A 4O2FB 5KSBA 5FYKL 1AC0A 3AM8C 3E1F1 5ERWA 3RI5K 4AJ0A 3HPLA 4Z77B 1F4AA 2NY5H 4RGMB 3HMXL 4KHXL 2XWJA 3CFEB 4NKIL 5I1HL 4JKMA 2I60H 2AK4A 2P5EA 1TMCB 3BP4A 3GI9L 1I8MB 3FT4A 1CGYA 1A3LL 2X1PA 4B0MM 1MJ7H 4OCXH 5EIVA 1IGYA 2UZYB 4X7SL 2AI0L 4E5XB 4U6XA 5C0AE 3MJ9A 4PV8A 3VGFA 1OAZL 2A1WL 1MCNA 4U6TA 4LSDA 2ZCHL 4GUPA 4OF0A 2XYCA 3QAZB 3FO1B 3KYNB 2UZIL 2YC1A 2VR5A 4MZ2A 4WTXA 2P24A 5D1QB 5JDSB 4OZGF 4HIJA 5F7EL 3QUYD 3L7FB 1OD9A 4YHMH 2LE9A 4IDLA 4M7LH 3Q5TA 1EEZB 3VDBA 3BEWB 3GDBA 3BDXA 3F12A 1T6WA 1MCHA 4YIQA 2OR7A 4OIIH 2CO7B 1RUMH 5EWIL 3G6JF 1NC4A 5DI8B 2EE3A 3H9SD 1MJUH 2Z92A 4PJAA 1ACZA 5E6ID 3LOWA 1LD9B 1QOKA 1KOAA 4NO3A 3V9FA 1XCQB 1HHHA 2XPGA 2X70A 4KVCL 1GSMA 1PYWB 3K81A 2N7AA 4OCNC 4HWBA 3GSUA 1QQDB 4GG8B 3DVGA 1P2CA 1R3HA 4OJFH 3V95A 1T66D 4MB5A 1I7TB 3MLYH 5TJWK 4HQQL 4OQTH 2H45A 1JNLH 1LEIA 3QFDA 4DAGH 3MA9L 5F1OB 3ARGB 3BP6B 3U36B 1RUAH 1I1YB 4U1LB 4X6EA 1TZGH 2VXSL 1VHPA 1RV6X 1AC6A 4HH9B 4HS8L 4Z7QE 5DRNA 4Y5VA 4NBYB 3SBWC 1DVFD 1TQCC 2I25N 2VKWA 4M62L 3FFDB 4LIQL 5T1MA 1BWMA 2DJUA 4G8IA 1K85A 4U1NB 1YEKH 1HCFX 2ZSVA 3GJEA 3HLAA 1GAFH 4WFED 1NFIA 1AI1L 2XN9D 4ZSOE 3DYOA 4Z7QF 4ZS6D 2BXZA 1EUUA 3ZE2E 2FO1A 4Z95L 1U3YA 4LSPH 1EA9C 4FQPA 5KN5A 1EHXA 5EFIA 1KIQB 4NZUH 2XT1B 4ZQKB 3RFZC 3EO1B 1NBZB 4XZUB 1OPGH 3VFOB 4N0UB 5HD8D 4GQPH 5B3JE 3ZE2F 4Y8DC 3MJ9L 4NT6A 1M1SA 4RDQG 1BD2B 3MLSL 4JR9H 4YDIH 4PRPA 2I9LB 2O5XH 4RAVA 4LAJH 1TETL 2C7UB 4XCYB 4QOKA 5B3JF 1D5ZB 4OGYL 2NY4C 4I48A 3TO2A 1IL1B 1MQKH 2ENYA 1JHTB 1HOCB 5C70A 3EO0A 4P2OB 4QHKI 3BWUC 4WI9A 1FO0A 4LBEB 4MQSB 1ODAA 3CC5B 4WO4D 2DLFH 4BJLA 4P48A 5IHBA 1T20B 4HUWB 3V6OA 1LEKB 3TN0D 5IVNA 1R5IB 3ARUA 4S1QH 2PF6A 4UTBH 3DXAE 2HA1A 3OAUL 2YA2A 4B5EA 1G7LB 1XGTB 2PO6B 35C8L 2Z91B 1ZLWK 4Q58C 3VFWA 1QSFA 4JY4B 1WFUA 3HS0B 3RZCB 3S34H 3U30C 4BFEA 3ULVD 2AXFB 2OJZL 4EQ3A 4XAWH 2DI8A 3U1SL 1P4BL 3I50L 1WFTA 3LKPA 4RDQF 5D7SL 2PW1A 2P5WA 1CFBA 4GMTL 4C56B 4P57B 1T2QL 4FXGB 1RFDL 2OK0L 3VGAC 4QRQA 1FCCA 2NNAA 3QZWG 1QKZH 4P4RB 4A2LA 4RFOH 4ZDHA 1IILE 3B6SB 1F02I 3B43A 3VXUE 1DQDL 3LEXA 4GKZA 1KNOB 5I9QB 2Y07H 3CPLB 2V7HA 1MRDH 4LDLB 5JXED 4F15C 2PXYB 3LKQB 3MZTA 4I0PB 3BPCA 4RNRB 1YDPB 1LE9B 5CLWA 1I9EA 3RIAF 2H2PC 4YHZH 1F6AB 1U8LB 3VD4A 4FQCL 5I0ZA 2VIRB 2APVA 5I1LA 2VDRH 3T0EB 3QIUB 2A2QT 3ZKND 3BESR 4AIXA 3O4OB 2F5BH 5DUPH 1ZMYA 1UWXH 4V1DB 4KK9D 2DQCH 2DMKA 4AIZB 3ZDYE 4PJ8B 1OSZB 2WIIB 3BXNB 3CZJA 3D0LA 3Q2CA 4POYA 2Q6WB 3IAPA 5FA3B 4N90D 4KH2A 5D1XA 4LGRB 5ADPL 4DGIH 1GPOL 2CGRL 3RL1B 2VTFA 4QCIA 3MLWH 4CKVX 1R5VA 4OF5A 5J11B 4F7CA 3C09B 4Q9BA 4FNLL 4J3WA 4NC2B 3ZDYF 2IAMC 3DMMA 1UM6L 2C4FU 2V17L 2V6HA 5J6HB 2XZQH 1OGAA 4PJ5A 1PKQB 4LCWA 2OQJA 3V4UL 4EJ1C 1P6FA 1CD8A 4GRWB 1JPTH 3HR6A 1FNGB 3WNMA 3FCTA 1CGWA 3U9PH 5D6CB 5HGGS 3VG0L 5HYJB 4CW1B 2VXQL 4FTVD 1B0RA 4WW2C 4R7DB 4UQ3B 4Y1AB 1MQ8A 1VSCA 1FNSL 1FC2D 3WXWL 4JRYB 3S3PA 4QF1A 5B8CC 5IR1A 3KDMA 3OR7B 4Q97A 4BFIA 1Q9WB 4Y19B 5BJTB 4HMEA 1LO0L 1P7QB 2Q76B 4Q9RH 5E5UB 3BPNB 1BFTA 4UT9H 5AAMA 4WENB 3RVWC 4XNUL 4DJMA 1NFKA 4M8QB 2DIBA 4BSWB 2NTFB 4NUGH 4XMPL 3K4ZA 1ERNA 2VR9A 5L6YH 1S7RB 1UB6B 1I7ZA 4ZXBD 3MRNA 3QO1B 4JKLA 1ZAGA 4LASL 3HC0A 4X6BA 1UGNA 5HHOB 5HHVL 3UTZA 3PWPE 3MO1A 1KN4H 4FQHB 1QLEL 3U0WH 2DYPD 3BZFB 4OFKA 3O3UN 2JIXD 2Q3ZA 1MCFA 1XF5B 3A6BH 1UADC 3BD5A 5JW3L 2GSIA 1K2DA 3IB4A 4QY8A 4GRWF 4M7ZC 4MD4A 4R2GD 4BFBD 1FYTE 1WZ1H 2GCYA 3DIFB 2QR0A 5DJ0B 4N9OB 1U8PB 1VGKA 5GRWA 1A6AA 2NR6C 4LLUA 5IVXE 2NXZB 3G08A 4L8SB 1BFVH 1ZVSB 4YAQA 5L8KB 3QULB 1JWSA 4IRJD 2JJTC 1HHJA 4NP4H 5CEZD 5A2FA 3BP5B 3PGCB 4G9FD 4AQOA 1SY6A 2CMRL 3ARRA 4NOFA 4KKBC 4ODXB 5IVXF 5C0CE 4LGSB 5JO5B 3B2UC 4WFHE 4MCYB 3IFOB 4Z76B 1DQML 1CQKA 1XIWB 1Y18A 1J1PH 4X6DE 1EAPB 4S1SL 5DRWA 2R2CA 3SDCC 1DQJB 5GXBB 1IMHC 4UQ2A 3QIWB 4KGJA 2VLRD 2Z8RA 4YHPA 1A1OB 1REIA 3JTTA 4OD1L 3NPSC 4LAQL 1OT1A 4NQDA 4NNPH 1IT9L 3HG1D 4EI6A 4M1CC 1S7SA 4HBCH 5HDQH 1ZLSH 3MGAA 3KHOA 3MLTB 3RY5A 5HXMA 4LSVH 3OPZL 4WFGD 4F9PC 2I24N 5E2TL 2E6QA 2KQMA 2W9EH 2IFGA 1JVKA 4RBPK 3ETBF 1KUMA 1A7OH 1A9EA 4G42A 1AGFB 1QZ1A 4U1IB 3TBWB 2D2OA 3SKMA 3FTGA 1ACYH 5C3LD 4KXZI 12E8L 1KTDA 1KJ2H 4FMKA 4UIKL 1G1CA 1OAKH 2FX8H 1MHPH 2P8MA 4K3DL 3X12B 4KY1H 4UT7H 4OLYH 5DR5H 3DI2B 3U6RA 4UOW1 2HJFB 3KPSD 1HKFA 3GMQA 3QDJD 4NGHH 1F4YH 1VFBB 4DZBB 1ZHNB 4PTUA 4G7YL 2VDPH 1B4RA 1BWWA 1NEZB 2GUOA 5HYSG 3MRIB 1ZT1B 3O6FD 4NFBA 3U7YL 3U0PA 1GZQA 3MXWL 2HVJA 4ZO7A 1E6JL 1A22B 1F8TH 4G8GB 4UBDD 3L3GB 1CT8B 4BELD 5HGDB 4OD3L 4UZGA 5C09E 4O02L 4JVUA 3T0BA 3VI3E 2NXYD 4HFWA 4P2QB 1SY6L 4ZTOL 5CSBA 4QWWD 4R8WH 1OF2A 4S0SD 4E41D 4IMKA 4YHLL 3BMWA 5TQ2L 2IPTL 1AD9B 2YS4A 1IGFL 3P2TA 2FB4H 4OI7A 3VI3F 1YPZE 1XH3A 1A7RH 1R24B 1KCSL 4ZUVB 3PP4L 4WWKC 3O3DB 5LKNA 3D2UA 1Q9OA 1FL6B 4OQTA 1CICB 2H26A 3MRBB 2AERT 3FQUA 2MPAH 5FA4A 1T4KA 1RIUL 1NCDH 3G5XA 3LKSB 2O5YH 5IMKA 3RX5A 1FCGA 2FHFA 5B39B 4N0YL 1F11B 4LKCB 2AK4D 4YO0A 1TQCB 2P5ED 1AGBA 1W72B 3CLEL 4Y2DD 3MLVH 4OAWA 5BV7L 3H9SE 1R3IH 4ZFFA 3QDGD 4OIBA 1UH4A 4PGDB 3T1FB 1J86A 1EFXA 2AEPL 1P84J 1TZIA 5FHAH 1TDQA 4P9HL 3KPRD 2IANB 5MEQB 3CFCL 5E00B 2HJKB 3CSYA 5C08B 2BVPA 4MA8H 1N7ML 4AL8L 4U6HB 3CVHH 2R2BA 3QHZH 1IRAY 2P7TA 5JIHA 1WWAX 4YBQD 5F7DA 4KV5F 1C1EH 1MJ7L 4QTIH 4YBHA 3QHTC 4BKLB 3RUGA 1I8LC 1TJHL 3LKOB 2FX9L 4LHQB 2E27L 4QKXB 4K8RH 3OKDB 1MUJA 2JJSC 1RD6A 2YK1H 4MQ7B 2WM0A 1GGBL 5SWQA 4N0CD 4Z7UA 1NCCH 2ITDA 2Y5EA 1MJ8H 2K7QA 1CXKA 2NX5D 5CKAA 5DQDH 3P9MB 3HUJA 4DQOL 3TVMA 3QEUB 2YMXL 3VCLB 4ELMA 2FO4B 2NY4B 2AK1H 2EIZA 4Y16A 4AH2B 1Q0XL 4H1LB 3ZO0A 2CH8A 2FH6A 1U8HA 1N5AB 1NBYB 4NQSB 1IEBB 3T2OA 5LGKA 4LK4A 1UM5H 5CBEA 5MEPA 2XN9E 3TO4A 4OIIL 3OG6B 2X4NA 5IF0A 3AREB 4D9LL 3FOMA 4P46A 1MJUL 3BFOA 2VDNL 1CGSH 4LLMA 5DO2D 2X4QB 5FDYA 5H94B 3TBTA 1JRHH 3HAEH 4JPKH 2A6IA 3C08L 4GAJL 2EKJA 3KXFD 1L9MA 5DHYA 3QXUA 1KLUA 1S9VB 1H3XA 1Z9SA 5I8CA 4MA7L 3MLYL 3MCKA 3U82B 2JK5B 1BVKA 1BM3H 4FP8L 3U30B 1MIML 3NIDE 3HZKA 2HLFD 4PJCE 4OQTL 1WWWX 1JNLL 4WTZA 5ALCH 2BVQA 5GSVA 4MJIB 4JFOB 1FVEB 4P3DB 1MF2L 1RUAL 5DSCB 1GGYA 1TZGL 4NQCB 4NRXA 1W0VA 1C5DB 3F62A 3VGAB 1IKFL 3B5TA 2GIYA 1AJ7H 1FH5H 3WLWD 3X3FH 5CEYB 1JGDB 2DI7A 2NY3C 3DSFH 4FOMA 4PJCF 5EZOL 3LMJH 1AGDB 5GGSY 4RMVA 3ARTA 3WD5L 2N7BA 1YEKL 1D5IH 4RGND 4F15B 2YZ1A 2CLRA 3WFZA 5B38A 2YPKB 5SX4H 3VD5A 2HRLA 3GIZH 1NMCC 4KWUA 1KPRA 2QADD 4PRPD 3OX8B 4ODTH 1BAFH 5FUOH 4CVZA 4NZUL 3RTQA 4OF6A 3QBTB 4GRLC 1F3DJ 3KYKH 1SEBA 4JZNA 3W0WB 5FUZH 5H37H 3ULVE 1UJTA 2C1PB 3JUYA 2DQFA 3OXRB 4KC3B 1N26A 2R0KL 3ARXA 1S7QB 3L3DB 4L4TD 4O58H 1OAXH 3B83A 3LS5H 4MXVE 3VXPA 1NSNH 2EXYD 4WI7A 1U8MB 3KPLA 5EU6D 4LRIA 3SJVB 3FO9A 1DQLH 2AJUH 2VXUH 3W11D 2H9GB 4YPJA 3VA6A 1MQKL 1R3LB 4HXAH 1CL7L 4P5TB 1A6ZB 32C2A 1OP5K 1KTLA 4MXVF 1PSKH 3FAXA 1C08A 1H15B 5J4MA 2DDQH 3GFUA 2DLFL 2IEPA 5GS1A 4D9RD 1K8IA 1PG7L 3OGCA 5DZOA 3WN5C 3MJ6A 1SYVA 4HV8A 4WW2B 4O2CB 5IW6A 1TVDA 5EO0B 2EDDA 1GVIA 5JORB 4XBPA 4HG4J 3FQRB 2HJLB 4AEHH 5T1DL 1CFVL 3VXRD 2AV1A 5EN2A 1C8PA 5B8CB 1A4JB 2EDXA 4XBGA 2FJHB 1KJ3H 1CS6A 2C3XA 3D25A 4N90E 1A47A 5C0NC 4Z78A 1CU4L 1T21B 1QEWA 3ARFA 5MEOA 4ZFOB 2NLJB 1LE5A 2YSSA 4HEPG 1Q1JL 1OGTB 3RVVD 4XAWL 3SDDC 5ESAB 2P4AB 3WFBL 1HQRA 3S35H 1I7RB 3O41A 2R2HB 1N59B 4NCC1 1UYWH 2FECL 1HKLL 1MFCH 4UV7H 3ZYIA 5BQ7A 1QKZL 5ECJE 3FB6B 5E0QA 1ZT4B 3QUZA 2Y5TA 5FDWB 5DUBA 1CWVA 1N2RA 2HG5B 2OL3H 4K7PH 3TCXA 4HWUA 3C6SA 3IDIA 1BQHB 3KYOB 4FTVE 4MJ6B 3OXSA 2YPVL 2ZP0T 4PRHA 5TH2B 5D7JD 5D9SB 5B22A 1FFOA 3DGGA 3ILPB 1VEOA 4M7ZB 4PGZA 4YHZL 4URTB 2D03L 2R56H 5EBMB 2VDRL 1MHHB 2AJZB 3MR9A 4WW2F 5DUPL 4OLWH 3DRTA 1IQWL 1WWCA 3O6KH 3EDJA 3TLRA 5A2KH 2W9DH 3DMMC 5CGTA 2XQYG 1I4FB 1A5FH 3T4YA 5FB8B 1MHCA 4LQFH 1YEDB 5C6TL 5BZWB 3NAAH 3ECBA 3DV4A 1GOFA 2G60L 2FGZA 5F8QC 5KSAA 5TFSH 4DKAA 5C8JB 4TOYH 3HCVA 4RISH 4QT5B 3RP1A 5CBAB 5CP7B 5HYQB 4B53A 1A6TB 2IQ9H 1NMAL 2PR4H 5H35A 5ESVA 2P8LA 4HT1H 3MV8D 5D7IA 3SDCB 5C6PB 3GBML 1INDH 1JZ2A 1YEFL 3MODH 1SHMA 2VQ1B 2I07B 3U9PL 1BP3B 4S1RL 1CE1L 3QDME 3NPSB 1EHAA 3SDXB 2XZZA 4Z9KB 5GZNC 3D0VB 3T2NH 3O4LD 2I9TB 2G5BA 2Y36L 3TC9A 3WFCH 1IGTB 3OJ2C 3BZDA 3BAEH 4MXQC 2AQ2A 2WBWB 1RZKC 3QNXB 1RZ8A 3GM8A 1FN4A 5LAXB 3IKCB 1M05A 5KOVC 2DF3A 3JV4B 5CEZE 5JR1L 4G9FE 3A67L 5KJRH 3DVNA 4F7TB 4NUGL 4MQXC 3Q6GH 4JDZA 1XGQA 4KI5C 5FYLE 1WZMA 4GXUM 5EU7C 4X6FA 4DCQB 3BW9A 4YNYA 1D5BB 1ZHLA 1FVDB 3I2CH 3ULUH 25C8L 3W81A 1KJ2A 1PJ9A 2DN7A 2RJMA 3IDJB 2Q7NA 4PREB 1CDJA 3F6IA 1EJOL 1KN4L 2VLRE 4LP4A 1A7QL 1W8OA 2DICA 1UXSB 4HKXA 2JB6B 3CNKA 1F90H 4X4ZA 4PP1C 5D5MA 3HG1E 5C1MB 5D7LD 2DLIA 4JFQA 5SWZA 4CGTA 2VKXA 5GS0D 4AEIH 1CI5A 3R8BB 4FQXC 2FH8A 4N68A 4PJXA 3PUCA 4NQVB 3MOQA 4G6AC 1QSZA 1U8OA 4WFGE 3V6FA 3IDNA 3RWCA 1FLTX 1P4LB 5E5MA 4FHBD 2ESVB 4G6FB 3DBXA 4XNQB 4D0DB 4JHZA 2EH7L 5CZVH 3TNNB 5LQBH 4WHYH 1NCTA 2GJJA 4ZTPH 4D3CH 1QFUH 1WT5C 4QYOA 4P9MH 2RQ8A 1ZVHA 4MJ5A 1MRFL 3KPPA 3O8XA 1NLBH 3O45A 1OLLA 3GSNB 5T3ZH 5EBWB 5AD0B 2YD3A 2YXMA 2IQAA 3BT2L 5CLTA 4S1DD 2F54B 2A38A 3H7BB 2YUXA 3QUKA 4N5UA 5AEAA 1TTGA 1CDUA 1FZJA 3FKUS 4LF3A 3SE3A 3QJHA 5HGAA 3TBYB 2EE6A 1XCTA 5F9OH 3G9VA 5HHMD 3EGSB 3KPSE 3D18A 3DO3A 4JPWH 3QDJE 2B2XH 2J5LC 2EEAA 1CVRA 5FK9A 4HAGA 3TM6A 2VSDA 1WIPA 3F6LA 3VJ6A 4KZDH 4NNPL 3TWCH 4APQA 3DX9A 4MD5A 3RDTA 1CDBA 5HDQL 2FEEL 4HIHB 3V0WH 1KG0A 2X4TA 4P9HC 1ZLSL 2XWBB 2BNUA 2AW2A 3UYPA 2FL5A 5FGRA 3GMNA 1OHQA 4LSVL 5ERWB 4PP2A 5JW4M 4PR5B 3UTQB 3ZTJH 2XWJB 3DSNA 4ODBD 1TTUA 3KG5A 4Y0GA 3DURA 2BVYA 2W9EL 2L4OA 4MCZB 2Q7YB 1LK2B 4JVWA 5TGBA 2CDEA 5DMIH 3QPQC 3BSZH 2D7NA 3P77A 4MNGB 2P45B 5MEND 1ACYL 2BVEA 4EI5D 3OJDA 1KJ2L 3JUZA 2F19H 4ORGB 5DFWH 5DEFB 4M02A 4GAYA 4Q9CA 5I1DA 3L95A 4WEUD 5KS9A 3H9ZA 5DR5L 1B0WA 2DLHA 3ES6A 2APFA 4OZFH 4GG6F 1KCRH 3QISA 4JFPA 2B0SL 3NCBB 3GMLB 4E42A 2VDPL 1OTSC 2B5IC 3F12B 2XA8H 4GW5A 4F9LA 1JL8A 1KJVA 3C5ZA 4Y4FA 2DJ4A 2VQUA 4X7TA 1T89A 5IV2A 3N85H 5ABDE 4FZ8H 1KCVL 1B9ZA 2Z92B 4UDUB 1JJUA 1IKNA 2IPKA 3AAZA 3K8KA 2AK4E 2XNAA 2P5EE 5EUKA 1LDPH 3T4AA 5CMAB 1BZ9A 3QDGE 3MCLL 2XTJD 1AXTL 4DKDC 5KSBF 4KTDH 2D7PA 2VDKL 5E9DA 4JJ5B 3PWUA 4HGWB 4WUUA 2WSKA 3ARSA 3BVNB 3GSUB 1NBQA 4EBQL 1R3HB 4JO2H 1HCVA 1MCQA 5J12C 5A1AA 2X42A 5GRZA 4NOBA 5E2UL 3CU1A 1GGCL 2F53A 3M17A 3HAEA 3CU7A 2FB4L 4QRPA 3KPMA 5JMOC 1AR1C 4ZFZA 3D85A 1LP9A 3IJHB 1RK0A 4Y4HD 1T7YA 4JANB 1GGTA 2R15A 3CVIL 3H0TB 2NX5E 3BYYA 3HMWH 3CDCA 3SKOA 3MLUL 4PJAE 3MV7B 1MWAH 4X6CA 5C9JA 1NCDL 5HI4D 3IFPA 3BKCL 2GHWB 2VOTA 2OR9H 3HLAB 3BEVA 4H26B 4H0GA 3T1WA 1V5JA 3O9WA 1G0XA 5JXAL 5F9AC 1ZKAA 4XPAL 3HB3D 2X9XA 2NY3B 1G7QA 3KWWB 5KN5B 5K9OA 4G6MH 4PJAF 1A6WH 1NC2B 1BOGA 2OTWB 2ATPA 2ITCA 5FHAL 3B9AA 3LRGA 3QFJD 4Y5XA 1NMCB 1EUTA 3ARVA 4ZSOB 3GO1L 3KXFE 4H25A 2ZG2A 4RAVB 3QHZL 1QNZL 1XF2A 5AZEL 4EVNB 3TVMD 4JPVH 4GRLB 1T7ZA 1JNHB 4OD2B 3PWVB 2E9IA 4PRAA 2PCPB 4Y16D 43C9A 3HE6D 4DOHB 3GRWL 4UAOC 1YN7A 3FHQA 4NO2A 3UAJC 4K8RL 3E6FB 4LOUD 4CU8A 3FRPA 4G6KH 3RVXC 3EO0B 4U7MA 1NCCL 3TO4D 3GMRB 3FFCA 4R90H 4JKPH 5D2LB 4P46D 4WEBL 1IGIH 2Q86A 1EHNA 3VXOA 3X13A 4HMCA 5FGBA 4RA3A 1AGEB 1O5DT 5FHBL 5FOBA 2VABA 3O11B 4P59H 2APBA 4K94L 4RGNE 5DVLA 3WS3A 1UM5L 3HI6L 3VXMA 1CDCA 5HI5C 1U8KA 5JTWA 4OV5A 3FMGL 3D1MC 4PRBB 4PRPE 1KIRA 3RNQA 4XPGH 4ZS6C 3WN5B 1CGSL 5IFAH 1N4XH 1J05A 1U3HC 3WJLA 4QOKE 4TUOA 1JRHL 3MNVA 4JPKL 1IBGH 2FD6H 2MKLC 3LKPB 4L4JA 5AWNH 3MGTB 3PP3H 2XFXA 3AS2A 1OB1B 3SGDI 4RIRA 4Z5RA 3KNBA 1EMTH 4L4TE 3JWNC 3FT3B 3DECA 4XVUD 3HC3H 3N1MC 4AM0B 1R0AL 4WFFD 3U9UA 5TE4H 2X9WA 5EU6E 1QR1A 3GSOA 2IBZY 3CGTA 3SDDB 1ZA6B 4L8CA 1WIUA 5GGUB 1X5HA 3IF1A 1P5VA 4IBLT 3SN6N 5I66B 2JLLA 3BGAA 2ZUQC 5D96C 1AJ7L 4O2EB 5I17B 3X3FL 5KAQG 5CJ8A 3LMJL 3RTQD 2IADB 1ETZB 2OL3A 4IHOB 3L3KB 5IB2A 3VXUB 3I6KA 4QGYA 1UCBL 1D5IL 3Q6FA 2VO5A 3FQNA 2K9UA 3ZHKA 5J3HD 4L9DA 3D0LB 1VFMA 3UYRH 2P5WE 3VXRE 2G2RA 2EDTA 2ARJA 1JZ5A 3BD4A 5FUOL 2FHCA 4QCIB 4LRIC 2HKFL 3RWFA 6CGTA 2B39A 1NAMA 1DDHA 2WIMA 5DD1H 1U93A 3DMMB 2G9HA 4UDTA 5SWSD 5EBLA 1SM3H 3GSWA 2ZOLB 5ISZA 3UX9B 2R29H 4M6MH 2FCBA 2LQRA 1UWGH 3MRDA 4I0CC 1OGAB 4JZJA 3EYSH 2OQJB 1HHKB 4EDXB 1JWMA 2PYEA 1DQLL 2AJUL 5E6YA 3RA7H 5DEGA 2YPLB 5F6HI 4DEPC 3LKNA 1QFPA 1JZ4A 3DETC 2CK2A 3ABZA 2NZ9C 1CG9A 1KSRA 3OTTA 3B9KB 1PQZB 1D3CA 2IPUG 1ZGLA 1XR9A 4N5EC 2YD8A 5ACZA 2DWEB 3M8OL 3QXTA 1JRHI 1PG7X 5KAQF 3PL6A 3MOBH 4M7KH 4BFIB 1QSED 1HYSC 3I9GL 3ARFC 4X4MA 4OLXH 5D1ZD 4HKBA 1DFBL 3BGMA 3LH2H 3D5OF 1IAKB 4FFYL 4LARH 3ZKNC 3P40A 5TDNB 1E27A 1LWRA 1S5IH 3CAFA 4HWZB 4WY7H 2OI9C 4NKOA 5C0BB 3L5HA 4P2CG 4LCCA 1BGXH 4PJ5E 5CSZA 3FRUA 2BOCB 4R26H 4BQCA 3PWNB 4K9EL 3KLAA 4HKJB 4J6RH 4EEEA 1V7NH 2EEBA 2WK2A 3UTZB 3UZVB 5ACLA 5DC4B 4HDIB 4UNVA 2AJSH 1FE8H 2AJXL 1OCWH 3ARDD 3S35L 5DC9B 3BUYA 4PRHD 4PLKD 1UYWL 2VQTA 4UV7L 5F7FA 4QY8B 2IMMA 2GAZB 3MV8E 1FL5B 4ZUWB 3MUHL 2DQGL 3O6LH 3JV6A 2QR0B 1MREL 5I1CL 2OL3L 2WBJD 4XP4H 3D39A 3L5XL 3PWPB 3QO0B 1Z5LB 1LNUB 1QBLH 4OZHA 5A3IC 5INCA 5DFTA 2FYYA 2HT2D 3VE0B 3O4LE 3RWHB 5I30H 3MRGA 4M93C 5IBUB 5I15L 3MACH 1FORL 4FQXB 1FYTB 5I1JH 1HHJB 2H6PB 1AQDA 1BOYA 4OLWL 3VFTA 3OHXB 1NAML 3LSOA 4L3EA 1NPUA 2W9DL 1JGEA 3ARZA 2F8OA 2VNCA 1A5FL 2WZPD 2BMKB 5EORH 2LU7A 3T0WA 4BA8A 3NAAL 1N0LA 4GSDL 1MRCL 2BFVL 4JCMA 1Y18B 3RIFK 4I1NB 1OY3B 3SGEI 4X98B 3Q1SH 4U1GC 4X5LA 4BH8A 4UINL 1T0MA 3GEWB 1TVBB 4IJ3C 1TPXC 5C0CB 4GBXA 1GHFH 3QWOA 3FZUC 1KIPB 4KI5F 4KAQH 5KANI 3NN8A 3MNZA 3QPXH 3F7VA 3VXQA 3MGOB 5CHNB 2V2TB 1DE4A 4EI6B 5GS3A 3SHSA 4PY7A 1D5XA 4M4RA 4CRPA 1GZPA 2GK2A 4X6DB 4WHTB 4RFEA 3VH8G 2J5LB 5BVPH 2EYTA 4UB0H 5D7LE 5IB1B 4UT6H 4PGJA 1NCAH 1MH5A 4R2GC 5BZDB 1QLFA 2J8UA 5L2KB 5IEHA 1ZA3A 3WFEL 5LGJA 5JW4Q 2YKLH 1ZGLM 1YMMB 3WFCL 4PBVC 3BAEL 4X9IA 4YQXH 1YC8A 4U0RC 3SKMB 2VDOL 5HHPB 1NFDE 5KJRL 4IRJC 2P8MB 2BK8A 1KCLA 3GBNL 3WIIH 1HDMA 3Q6GL 2X1OA 4UUJB 4N8VA 5T5NG 4PJEA 1A0QH 2Y1VA 3I2CL 3OAZH 5SWZD 1P9MA 3G04B 3BWAB 4JM2C 5HHME 2C3GA 3QI9A 4XBEH 1A9BB 4EN3D 4R7NB 1CLOL 2FBJL 3U0PB 3ZT6A 4KUZL 3TBSA 2ARWA 1NDMB 4KTEH 1SEQL 4OZFA 2IBZX 3LQZA 1TENA 1MNUH 4Q0XL 5D72H 3L6FA 2B5IB 1X5IA 3U7WH 2EDEA 5D93C 4TNWF 1L7TH 3QNZA 4LDEB 1T5XB 4HFWB 3P4MA 3EO9L 3O8XC 2MHAA 3MJ8A 4PY8J 4ZFGH 5MI0C 5DLMH 2FSEB 3GGWB 1KCUH 2CUHA 2E7HA 3RHWF 2PN5A 3VU2A 5GZOC 4NO0D 1FNEA 5CZVL 5EPMB 4HH8A 2NY2D 4ZTPL 5LWYH 3SE3C 4D3CL 4E0RB 4MA3B 3SO5A 4N1HB 3NIFF 3D3VD 5MENE 5IQ7H 1DBAH 5JIIA 1M7XA 3GHBL 5T3ZL 3I02A 4U7SA 4J3OC 1A7NH 1AQKL 3IVKB 1IEAA 1V3KA 5B3NA 2F5AH 3RKDC 1RZJH 3D2UB 3MJ7B 2X4OA 2H26B 1JHLH 2DTSA 5T5NF 3VWJA 3RDTD 4APQC 2UUDH 4MX7B 4FN0A 1S78D 1T4KB 2MSPA 5FO7B 2CRYA 3G5XB 5E8NA 3BGFC 4RMUA 2B2XL 3HPJB 3SOBH 3CH1B 2NY1C 3IU4L 2BC4A 2CRIA 5JIKA 2VWEE 5F88A 5F96L 4PJHE 1QP1A 3CFJB 4ZFFB 1NANH 5DQJA 3LD8C 1MWAA 5T1KD 1TZIB 5GGVH 2R9HD 3V0WL 4GRWH 3ZKSD 2FR4A 5K59F 5LCVH 3W39B 3QUYB 2XTJE 1PY9A 3CSYB 4XNZC 2BVPB 4UBDC 2P44B 4OLVL 2BNQD 3MQIA 1LK3L 1XGUA 2CK0H 4KDWA 2R2BB 4KDVA 1EO8H 2XG5A 2P7TB 2BERA 5GJSH 2NXYC 4QRTA 3GIVB 2V9TA 4P4KC 4CMHC 4K8RD 3X14A 1YZZA 5E6IB 1NDGA 1T22A 3P4NA 3GSXA 2R0WH 1CFNB 4C4KO 1PFCA 1RIHH 1N6UA 5J1AB 2MJWA 5E94B 5CEXA 3WLBA 2W38A 3HUJB 4JN1H 4Y4FC 1T89C 4KROD 5FUCE 2YOCA 3DYMA 1YNTB 1IKNC 3UTTB 4DGVH 1KCRL 3TFKD 2R1YA 4GW4A 4G80A 4K94C 5E9DD 1YY9D 4WUUD 1FG9C 1VADA 1RHHA 4XI5C 1VKXA 5IWLC 1RZGA 3IFLH 3SPVB 4ZYKB 3S4SB 5IF0B 4FZ8L 1DQQA 4BUGA 5T33H 4MNQA 4RMSA 1ZWIA 1PBYA 5GGQH 1J8HA 1SJHB 5HJ3A 2D7TH 4PRNB 4JLRA 4GXUN 3RUGE 4Y2DC 5E99H 4JQXA 3SY0A 4XNXH 1S7WA 3QFJE 3CD4A 5GIRB 2HFEB 1Z9LA 2JF1A 1PG7W 1OOAA 3D85D 4MJ4A 4ESKA 1Q38A 2XN9B 1URLA 4JO2L 4LSQL 3H3PH 1DSFH 4Z7UE 3BKJH 3MCKB 4U1SA 1U3HB 3LDBB 5F70A 3RUGF 4ELME 2WMPA 2EDOA 5GSVB 3ZDXF 4JRXA 2APWA 4PJDA 2EDLA 1Z3GH 5F7YC 3SCMA 5JPNA 5F9WC 3UO1H 4DN4H 4K7PY 3R0MA 4Z7UF 4NKQB 3O9WC 2EIDA 4K3JH 1J0IA 4H88H 3HUJF 5DJ6A 2ICEA 4X9FA 4OCYL 4ELMF 2I5YH 4GW1B 5I1GH 3QDHA 4N0CC 1QRNB 4GKSB 3EDFA 4P3CH 5B38G 4YDJB 2N1KA 2DM7A 4NZDA 5IMOA 1IAIH 1U58B 4Y5XC 4Y5YA 2ZUQB 5D96B 4CDGC 1KPRB 2DRUA 4WRLA 4U31A 3MRQA 2H1PH 4G6ML 5FM4A 2E7CA 3NPZB 4TNVF 5TQ0L 4M61A 4CVZB 1KLGA 4M00A 3T09A 3QYCA 5DJXA 1HEZA 2DQFB 5GSRA 3TBVB 5I76B 3VGEA 4BZ1H 1WCBB 3IU3A 2ZPKH 3BP7A 5DHVB 4QHNA 3FFCD 3VFVA 2E9BA 3ZSSA 3G6DH 5IMMB 2WUCH 3CFBB 1IGML 4ENED 2YWYA 4ONGL 3WDHA 4WFFE 1XZ0B 5GRVK 4RSVA 4RZCB 4YBLB 5FGBC 5F7UA 4ONHB 4Z77A 2ADFH 4G6KL 2IH3A 4NC1E 2KPNA 1QUNA 3EFFB 4YE4L 1UQSB 3S3SA 2KUTA 5I8EB 1K8IB 4DEPB 2E9WA 4E5XA 3WIHH 3WLWC 3STLA 2AJVL 3OL2A 1BEYH 4P59L 5E95B 4QNPF 4XPFL 4YXHH 4HEME 4RAHA 3ZSTA 1UZ6E 5EN2B 3WHE1 1ORQB 3HZMB 4O5LH 5D1QA 4JFEB 1MOEA 5JDSA 1TJGL 4BK5A 1ORSB 3OQ3B 2NY7L 4XXCA 4QEGA 2A73B 3ARFB 1QEWB 4K9EC 3L7FA 2GT9A 1LE5B 3ARPA 2VAJA 4WNQA 1EEZA 3DO7B 1ONQB 1IBGL 2DQHL 3QHFH 4OM0H 5JOFB 1TIUA 1EDQA 3LHPH 5IP4A 1BJ8A 5SWSE 1FJ1B 1M6OB 3DROB 1JPSH 5DI8A 4QHUB 1EMTL 1YEJL 4HHAB 3BQUD 1Z9OA 5L2JB 5DMKB 2EECA 3HC3L 1LD9A 3O81A 3Q3GA 2EXYC 1N2RB 5E2WH 1LVEA 3C6SB 2W91A 1PYWA 2Y7QB 3UJTH 1NGQL 1QQDA 4I3SL 2VISB 2X89D 1CLYH 1WAAA 2FLBT 1I7TA 1WTLA 2D9QB 1J87A 5HHNA 3UTOA 5K93A 3V5HB 4QTHA 4MVBD 4C54A 5CZXD 4FFVC 5LJYH 1QSVA 5CGYD 1CK0H 3ALXA 2M2DA 1AO7D 3ARGA 3U36A 1JI1A 3W2DH 1QSEE 3UTPD 1I1YA 1T7WA 4U1LA 5BMFH 3QUXC 5ISZD 1FNFA 3R06B 1KENL 4M93B 4HH9A 5D70L 4KK5C 1YECL 2DM4A 4LEXH 1W72H 4OTXH 3FFDA 2VXVL 2ZG3A 3P9LA 1QA9B 4FQLL 2QQLH 4RMRA 1BPVA 4KRPD 4M6ML 2AEQH 1FG2A 2BP3A 2CR3A 3VW3L 1GOHA 4HF5H 5CUSH 2R1XB 4OCSH 3EYSL 4PRHE 4YZFE 1S9YB 3SGKA 4BSVB 1KIQA 1EBAA 4MB3A 4P2RB 5EZIH 3LIZL 2J7LA 4ZQKA 5BXFA 3EO1A 5D2NE 1NBZA 3PL6C 4XZUA 4HIXH 1ZEAH 2XXCB 3VFOA 4YHKL 3L3JB 3DJ9A 4IJ3B 4LMQI 4U4BA 1HINH 1BD2A 4F2MB 4KK8D 4PGBA 4YZFF 1A3RH 4NZRH 2YHGA 3RIAK 2EC9U 3WJJA 2NY0C 3VFRB 2DYPB 2C7UA 2JIXB 3MOBL 2YN5A 4XCYA 4LCCC 1GXEA 1U36A 3MSPA 1D5ZA 5D7JC 1JGVH 2O26U 4HPOL 1IL1A 3LEYL 4R2GB 2EH8H 5CD3A 3EJJX 4OLXL 4H1LH 1JHTA 5DMJB 3QWRA 2ZUTA 1HOCA 3LH2L 4ZPTA 4JO4H 3GUTB 1IC4H 3NTCH 4P3WA 4LBEA 3EDDA 4WY7L 3CC5A 4JDZB 1XGQB 15C8H 2OXGA 4U0RB 1BGXL 4X6FB 4JB9L 1T20A 3ULUD 1G1YA 4HUWA 4YNYB 1ZHLB 4R26L 5LBSL 1LEKA 1R5IA 3LB6C 4FG6D 4J6RL 6FABH 1V7NL 4IRJB 4S10A 3D39D 1XGTA 2GTZB 2D0HA 2PO6A 5E8EB 3S35X 1JF6A 2AKRA 3BDYL 2DQJL 2Z91A 3BZEB 5D7IF 1HHIB 4JY4A 2VH5H 3HS0A 4PJ9A 2OTUA 3RWDB 3RZCA 2D0FA 5K9KA 2AXFA 4JM2B 4G3YH 3U4EB 4K7PX 3E3QE 4DZ8A 1N6VA 5H8DA 4PJXB 5HDBE 4XP4L 2IH1B 1A14L 3V6FB 1MHEB 1QBLL 4C56A 4EDWL 4P57A 3P0YH 4FXGA 3QUMA 1S7XB 3QEQD 1RUPH 1RZFH 4KKLD 4KUCF 4JQVA 4JFDD 4LVNC 3MACL 3B6SA 5HDBF 4PY8I 5D93B 1INEL 3CPLA 2UWEE 3KPPB 1AP2B 4N0RA 3H6JA 4L3AA 4D9QD 4K3EH 1CXIA 2PXYA 3LKQA 5MI0B 3HNVH 3LN4B 3L9RA 4I0PA 3S5LA 5IT2L 5IGXL 3CIQA 5I18H 1X9QA 1YDPA 4RNRA 5FGSA 1LE9A 4YX2L 5EORL 5DK0B 5DYOB 3CFIC 5DD6B 1F6AA 1U8LA 1OWRM 2AJYH 4JDTL 2Z93B 4H20L 3MBXH 3Q48A 5HGAB 3T0EA 4JHAH 2QKIA 4M1DH 1MSPA 4XB7A 5SWZE 3NFSH 2VUYA 3WUWB 3VWKD 1SBSH 1J10A 2B7DT 1GHFL 1MAJA 4Z7WB 1OSZA 2WIIA 3BXNA 1KACB 4KAQL 4RCAA 5TE7H 4OBSA 5FA3A 4PJBB 1TVHB 1CFTB 4ZPVB 1I3GH 5D5MF 2GJ6A 3RL1A 5E2VH 1KG0B 3BGFB 2FL5B 4NUJB 5FYJU 5BVPL 2NY1B 1WTGT 1T1ZA 3BIKA 4PJXF 3S7GA 2QSCL 4EXPX 1N6QH 2J1KA 5J6HA 4NIKB 4O9HH 3WKMH 1IFHH 3DURB 5DC0A 3P30H 1PKQA 5F44A 4R4FH 3TYFB 3FQWB 3O6FB 4XXDA 5C0RH 4AMKH 2R8SH 2CRZA 5F1NB 5JUEL 2A0LC 1JGUL 2VZVA 5EDXA 1FNGA 1NCWL 4XNZB 1A2YB 1NKOA 4Q9QL 5D6CA 1KELL 5HYJA 4CW1A 1XR8A 1GC1H 1F4HA 1Z6JT 1HILB 4R7DA 5JDJA 5SX5K 4OZIB 1MY5A 3DX6B 4FQJL 4UQ3A 3D3VE 2APTA 2NXYB 4KJQD 3J7HA 3QI9C 4JO1H 3WIIL 5KS9B 1JN6B 2VDLL 4Q6YA 1OSPH 4P4KB 4CMHB 1W8NA 4E41B 2WLZA 3ES6B 4J4PA 1Q9WA 1F4WH 1A0QL 1MCPH 4Y19A 5BJTA 4JFPB 3M1BB 5FGCE 1P7QA 5HVHC 3ZMRA 3QEGL 4E42B 4U2YA 4M8QA 2GK0A 4BSWA 5KVFL 2NTFA 5JHLH 5M95B 4Y4FB 4XBEL 3EYOB 1PDKA 3QQ4B 1VACB 5T3XH 2MFNA 4XCFH 2IPKB 8CGTA 1S7RA 1UB6A 5F7NC 3QUML 4I77L 3QO1A 1MNUL 3T4AB 5D72L 5HHOA 2JJVA 5HDLA 3PWUB 4ZAKD 4MDIB 4OFDA 1L7TL 1YEEL 4FQHA 3VXSD 1FL3B 4NRYB 3BZFA 2W0PA 2BNQE 5DLML 3RWJB 4UOJA 5E6ZA 1G7JB 5E08H 4Y4KC 1T04B 3HAEG 4KRNA 4Y2DB 4P23D 3TT3H 4B7IA 3VWJC 4X4YA 1BMGA 5F21B 1U2HA 3IXTB 5DJ0A 1U8PA 4MHHI 2HYMA 3E2HC 2E7BA 1DBAL 3KPRB 4MA1C 5I1AA 2YBRA 3O2VH 1C16B 3C6LD 4PJGB 1JNJA 4L8SA 5KS9F 3O6MH 3PNWA 4W4NA 5GISH 3L1OL 4IMLB 1ZVSA 1E4WL 3MLXH 3BKYH 4NWTH 4ALAL 1NQBA 3QULA 2KDGA 4IRZH 4PJIB 3KPNA 3BPOC 5F9WB 4WGVB 3BP5A 3PGCA 2OZ4H 5K9QI 1MFDH 1N64L 5E9DE 5JO5A 4KZEH 1XEDA 2QSQA 4WUUE 2A77L 2WUBH 3RVTD 3U79A 4OUUB 4MCYA 3IFOA 2NX5B 2R1WB 4LNVA 1BOGB 4Z7VB 2ATPB 4KKAD 2AEIT 3UJIL 4ODUB 3MRJB 1DQJA 4Y5XB 2VZ3A 4DUVA 3QIWA 5LCVL 2OM5A 4YH6A 2DKSA 3VXNA 4QRPE 5L7XH 1A1OA 4Z0BH 3CUPB 2BXYA 4RWYL 3IJSA 2ORBH 4M3KB 1LP9E 1EO8L 4OFYD 4YDVB 4JFFD 5GJSL 1HYRC 3C60A 4JKWA 5H37G 4PG2A 5TE6H 5L88L 2Z8VC 2D3VA 1YEIH 1LO2H 1YN7B 2DAVA 3MLTA 5FYKH 4NO2B 4NN7C 4HUVB 3FOLA 4X6CE 5DRZB 3BH9A 1PVHA 4OGAD 4JQIH 5DA0B 5I1HH 4NKIH 4IRSC 2W9LA 1JZ6A 3IDXH 2B1HH 3KXFB 2E8ZA 5M94B 1A3LH 4K3HA 4J3XA 4IOFD 4M5YL 3DUUB 3TBWA 3V79C 1CGVA 4X7SH 2AI0H 4MNQD 5E7FA 1RURH 3VXOB 3X13B 2W0KA 3MCG1 4X6CF 4DGVL 3AM8A 4FRWA 1OAZH 1DTUA 5AYUL 5CD5C 1ES0A 2ZCHH 2AVGA 4LHJB 3LRHA 2EC9T 3S96A 4JQXC 3VXMB 3X12A 1BFOB 3IFLL 2G75B 3N06B 1T2XA 5JQ6H 2DJSA 3C2AL 2HJFA 1J05B 5GGQL 2D7TL 3GNML 4WV1C 4ZD3H 4ZNEA 1P7KB 3KYAA 1VFBA 3MNVB 4DZBA 4XNXL 1SJXA 3MRIA 3AB0C 1BVZA 5EWIH 1WV7T 1WGOA 3KNBB 4I3GA 5F71A 1XMWA 3MA7B 3BKJL 2QADB 4G8EB 2V2XB 3FFCE 3W9EB 4G8GA 4F7EB 1QR1B 1EO5A 3RGVD 1UG9A 3L3GA 2C3WA 5HGDA 3RJQB 1QFOA 1DQTA 4LHUD 1U92B 2BRQA 1F3JB 4JREB 4P2QA 3TZVA 1OAQL 3HE6C 1NANI 4EUPB 4K3JL 1AXSB 5IBLC 4H88L 1UB5A 4NQED 3KLHD 2I5YL 1AD9A 3RU8H 5I1GL 3A6CH 4XPBH 1UH3A 4JGJA 1UACL 1F97A 5EU6B 1H5BC 3MA9H 3UZEA 3FQNB 4QHLB 4PJFE 1R24A 4X83A 4CU7A 1BIIB 5EZJB 3ZDZE 2VN4A 3H3KA 1CZ8L 1K4DB 4HS8H 3O3DA 2EDYA 3WO4B 1S9XA 1FL6A 2CLVB 3W5MA 1CICA 1NAKL 3MRBA 1CXHA 4M62H 1EK3A 2F74B 3KJ4B 1NAMB 4OUOA 5GRUL 1U93B 3QUXB 3LKSA 5FOJA 1AI1H 1PAMA 4BZ1L 1I8IA 4Z95H 5B39A 1F11A 4LKCA 3SBWA 4RGMC 1MCEA 3TNMB 1W72A 3VXRB 1JWMB 1RULH 2V5SA 4Q2ZB 4PGDA 2WUCL 3T1FA 5LGHL 2OCFD 3OKNA 4OLEA 4R4ND 4PLNC 4NKMB 1J11A 5T1LA 3BZ4B 3SDAA 2IANA 3V5DA 5E00A 4FXKB 2HJKA 1DZBA 1KC5L 5C08A 4TQEH 1A64A 1ZGLB 1XR9B 4U6HA 5E4EB 5D1QD 1TETH 5IFHH 3BDBA 3EW3B 4CVUA 1YQVL 4OGYH 4BKLA 5E1AB 2QJDA 3LKOA 1N5YH 1C5CL 5TDPB 4QRRA 3OKDA 3REVB 3OGOE 4MJ2A 1AO7E 4MQ7A 1MCLA 5B4MD 2NY0B 3TT1L 3UTPE 5ISZE 1YJDL 3QSKB 3P9MA 1G9NL 1KPUB 2H32A 4LCCB 3WNOA 3QEUA 5D7JB 4P2YA 3EOAB 3RJDA 2J12B 2PYEE 5JHDA 3MPCA 4AH2A 2FIKB 2YWZA 3OB0H 4LSTL 2ZKHH 4JHWH 4LPTA 4HUNB 1NBYA 4XAKD 2WWMD 3M45A 4NQSA 3AMKA 1ZT7B 1SVCP 4WHDA 2C1OB 1L6ZA 3ROLB 3AREA 4XGZB 4U49A 3TYGL 3ARBA 4NQUA 2X4QA 2OJZH 3U1SH 2A74B 4X4ME 5D7SH 3UJTL 4GMTH 4OZHB 1SQ2N 1S9VA 1T2QH 3W9DB 1CLYL 4YXLH 1RVFL 1N0XH 1J0JA 2JK5A 4Z0XB 3BPLC 5J13B 4BZYA 2J2ZA 1XF3B 3P3YA 1DQDH 5IHZB 4MJIA 7FABL 1CK0L 4JFOA 3VFTB 1QO3A 4TVSa 1FVEA 4P3DA 5E4IA 1SJEA 5TDOA 3UPCA 4L3EB 5DSCA 2ICWJ 4TTDC 4OV6F 4NQCA 1QVOB 3RVUC 4OFVA 2EE2A 3SKUD 2XV6B 4WHYG 3UPRB 5CEYA 1JGDA 4LEXL 4LVNB 5GJTL 3THML 1AGDA 2FLRT 4OTXL 3WUZA 2P47B 3SGKC 2ZUVA 3DXAD 3ULUE 1O7SA 2YD2A 3RY6A 1QBBA 5KZCB 1I9IL 1WZLA 2YPKA 2F8XC 1T0MB 2J6EL 4POZC 4W68A 3D39E 3MLZL 3NN8B 3OX8A 4HF5L 2AXHA 5CUSL 4OCSL 3WJJC 5ADPH 3ULUF 1GPOH 2CGRH 5I19L 3H8NA 4W4OC 2R0LH 4FNLH 3W0WA 5EOTB 5ITBH 2C1PA 2RHEA 1RPQA 5GGVY 1UM6H 4Z7NF 4LSRL 4WIQA 4XP6L 4YDLB 2V17H 3LS4H 3PABB 5I8OL 1H8SA 1S7QA 3L3DA 4P2OD 4OZHF 1A3RL 4NZRL 3BH8B 4KTYA 3W82A 5IHUH 1OM3H 4OSUH 5FYJH 4YLQT 1U8MA 3V4UH 1WEJH 3SJVA 3QEQE 1JK8B 4G43B 5DRXB 1R3LA 3VG0H 5D7LB 4P5TA 3ARYA 3ZTJG 4I18A 2CLZA 1A6ZA 3JTSA 4KK6D 4D9QE 4WU5B 1BJMA 4FFZL 3NTCL 2PO6C 3WXWH 4TVPL 15C8L 4N8VB 1CLCA 3DRQA 4KI1A 1U2CA 1LO0H 2YRZA 4PJ9C 3RZCC 4O2CA 5EO0A 4S0TD 3FQRA 1NFDB 4PLOB 1B88A 4XMPH 1RJZB 2J8UE 4ZMAT 5B8CA 1S8DB 1XF1A 4KJPC 4NQTA 3TBSB 1EAJA 4XTRD 4OZFG 3JBG7 3K8MA 2R0ZH 3QRGL 1ZLUK 4PJ7E 1T21A 5HHVH 2KKQA 2XWTB 4ZFOA 2NLJA 4JQVC 1NGPH 4G3YL 4KPHH 4M9OA 1OGTA 4DFIA 5ESAA 1B2WH 3VH8B 2J8UF 4OCRL 1OW0A 2PXYD 3P4MB 2EKSB 1I7RA 1N59A 1ULVA 3P0YL 5JW3H 4I0PC 4KMLB 1RUPL 1LEGA 3R1GH 4MD0B 2RR3A 4XT1C 5ADOL 2X41A 4JKKA 3T0ED 3FB6A 3QIUD 1ZT4A 4PJEE 4XPTH 2HG5A 2XQYK 4V1DD 2IFFL 4K3EL 4PJ8D 3KYOA 5TH2A 3HNVL 5D9SA 3V7AG 2B1AH 3ILPA 4Y4KB 5AUMB 2UVFA 3O0RH 1G0DA 4PJEF 2AJYL 2COQA 3CK0L 3E6HB 4MLSA 3VWJB 3MBXL 5EBMA 4JHAL 5F72S 1GH7A 3E2HB 2X09A 4MA1B 2CMRH 3C2SA 2X40A 3NFSL 5MENB 4NBXB 1I4FA 4EI5B 5EUOE 5FB8A 3EUUA 1YEDA 2W60B 1VCAA 5F88B 4CJ0A 4PB0L 5BZWA 3MRLB 4X7FC 5I1IL 4UOW0 1DQMH 2JJTA 4S1SH 3BPOB 5E2VL 3U4BH 4AQ1B 3OJMB 2OZ4A 2LTQC 3FQXB 2FR4B 5C8JA 1D6VL 2BSTB 4QT5A 1BFSA 3IYLW 5HYJD 1FRGL 4LCUB 4XHJC 5CP7A 2CIIB 4X5XB 4OD1H 4Y1AD 5HYQA 5FKPB 1XGUB 3M07A 1A6TA 1IFHL 3VXSE 1W0WA 3SKNB 1IT9H 4JRYD 4PJHB 1KPVB 3SDCA 2OSLB 3VFGH 5L8JB 3X14B 5IIEB 2HTKD 2DLTA 1RZ7L 2VQ1A 2QTEA 2I07A 5C0JA 2Z35A 4WU7B 1GC1L 3OAYK 3SDXA 3NCJL 5E2TH 4X99B 3EFDL 1EERB 5HHXL 2CRMA 3SQOH 2I9TA 4JO1L 5IBTH 5DZNA 3TJEH 4LPVA 3MNWB 5BRZB 4X0KA 1RZKH 3QNXA 4WCYH 4NN7B 5HHOD 5LAXA 3TJHC 4XRCB 3IKCA 12E8H 5EZLB 4G80B 1PX3A 4UIKH 4ZFOL 1WISA 4IRSB 3QA3B 2P42B 1S78C 1H8NA 3F58L 4HS6A 4F7TA 1RZGB 4K3DH 4MSWA 5IEKB 1DQQB 4NZTL 3O3EB 1G7MB 1TNMA 5T3XL 4XCFL 2CKBA 4DCQA 1ZWIB 1D5BA 4RX4A 1UZ8A 1FVDA 5HJ3B 1Y6NR 2NY6C 3EYVB 1DCLA 3GB7A 3IDJA 4PREA 4G7YH 2DD8H 3MJGX 5ESQA 4OI8A 5JOEA 1T7XA 3U7YH 2NXZD 1UXSA 2KZ1B 3I75A 2JB6A 1M7DB 1E6JH 3IKKA 3QB7C 4L8SC 2DTMH 2ZNXA 4JFYB 2ADJB 4JFFE 4OQ1A 5E08L 2HFGL 4WV1B 4YDKL 4KDTA 1FHGA 4JRXB 4PJDB 1HQ4B 4OD3H 2BNRD 3QT2A 4O02H 1NGWA 3D6GA 3AB0B 5HSFA 5JPNB 4M1GL 3CMGA 1T5WB 3O2VL 3GSRB 2BDNH 5DJ6B 1P4LA 3O6ML 2IPTH 3EJZD 2ESVA 4D0DA 3MLXL 4XNQA 2SEBB 5ANMB 4DVBB 1XIWD 1CE6B 1S7VB 5ILTL 1MLCA 1JZ8A 3HE7C 4MNQE 4LHUG 3QIWD 4J23A 4ODVL 1KCSH 1F13A 2OZ4L 2R69L 3HE6B 2R4SL 3GSNA 5AD0A 4MLIA 1UEYA 2HH0L 1TCRA 2PNDA 2WUBL 5EOCJ 4LMQE 1SYSB 2DWDA 2F54A 3H7BA 2DQUL 4M6OL 2X4UB 1IQDA 3T2PA 4OGZA 2YD1A 4XMLL 4M61B 2PW2B 1H5BB 3C60C 1DEEB 4HUXB 3TBYA 1WQVT 2BRRL 3MRCB 4KJWC 2VLKA 4N0FB 4PG2C 3EGSA 4PFEA 5L7XL 3NMEA 2YUWA 2ORBL 2BVOB 1L4IA 3CLEH 3CJJA 4PRID 1BZ7A 1OARH 3L3HB 1UCTA 5TE6L 2AEPH 4HIHA 4P9HH 5EU3B 2XWBA 4PJDF 1LO2L 2QL1A 3DARA 3CFCH 1C7TA 1B6UA 2ZUWA 4PR5A 3UTQA 4TUKL 4JQIL 1N7MH 1AR2A 1QRKA 4AL8H 2FJGB 1SVZA 2IH3B 4HAFA 4L4VA 2VC2H 5DVMA 3KPOA 3U0TB 3IDXL 2B1HL 2Q7YA 4MCZA 1LK2A 1I1AA 1U42A 5A2LH 4NQEE 2YRLA 4I0KA 4X9HA 1RURL 2LU3A 5DVOA 3LVEA 2CKBL 1TJHH 4OZGE 2FX9H 2E27H 1BJ1J 3JV5A 4MNGA 3STLB 1T2JA 4LLYB 3V6BR 1FFNB 1GGBH 4ORGA 2VL5B 5DEFA 2JE8A 1YJDC 5D7KE 4G5ZL 4AT6B 4DQOH 4NNYB 4F7PA 1G9NC 3JVGC 2YMXH 5JQ6L 3G6JE 3NGBC 5DK2B 4FZEH 4G8GD 1I8LA 4G7VH 1ZTXL 2X4RA 2RAMA 1Q0XH 2JJSA 2JTDA 4U2ZA 2GT9B 3WV0A 5F93C 4WNQB 4ZD3L 1D6EB 3GMLA 4KRLB 4P2QD 1QPXA 1VA9A 3TZVC 3ROOB 4NJ9L 4D9LH 2VDNH 4UDUA 5IROA 2MWCA 4JEGB 5CMAA 3Q3GB 4XNMB 1JF5A 2XKNB 4JJ5A 3C08H 4GAJH 4HGWA 2VLJB 3BVNA 2FBOJ 5SWSB 1EV2E 3GSNL 1F2QA 1ZE3C 1WBXA 3C8DA 4MA7H 5I1KH 5HHNB 4FP8H 1MIMH 1U3ZA 3RU8L 4QTHB 2XY2A 3FT2B 5A40E 3B2VL 3A6CL 3QR2A 4XPBL 1ZANL 2YD7A 1CICC 4D0CB 1MF2H 1MCKA 2EEDA 3IJHA 3QEHB 3KJ6L 3BPLB 1U6AL 4JANA 1IKFH 3H0TA 4M7JL 5EZOH 1M4KA 3I6GB 4M43H 5HPOA 3DHMA 3WFDL 3LZFL 4GAFB 3WD5H 4L3CB 3MV7A 2D31B 4LLVB 3P9LB 1W2KT 3KR3H 2IAND 4H26A 5TPWL 4LL9A 4XAKE 3SDAC 2VN7A 1QHPA 4F33A 3UTSB 1FG2B 2DIJA 3KWWA 1RUKL 1IC7L 3F8UB 1WAAE 2H3NB 3IRZA 5JMRA 1NC2A 1OQOA 5BXFB 1RULL 3VMPA 4C55A 2OTWA 1JPFB 5BS0B 4GMSL 4ONOA 4HK0B 3BQUC 2NTSP 1T6VN 4DGYL 1AKJD 1S5HB 3OKEB 3MREB 4F58H 2R0KH 3EHBC 1MFEL 4ZSOA 4MHHG 4TQEL 4PGBB 4FQ1L 1WAAF 4U7KA 2VDML 4Q74A 1U3JA 4EVNA 2HT4C 5DT1L 4GRLA 1QR4A 2NY4D 5IFHL 1FPTH 2X1WL 3FO0H 1JNHA 4OD2A 3PWVA 3F7QA 2PCPA 3BIBX 3EDEA 1F58L 5CD3B 1N5YL 1JV5B 1JCKA 1CL7H 3E6FA 5I0DA 2EDWA 3V0VB 5CZXC 4ZPTB 3OSKA 5CGYC 5BCAA 5K9QG 5IG7B 2WBJB 3GMRA 1VFUA 3S98A 2E6JA 3QCTL 5IB4B 1KTRL 1IC1A 1X6LA 2QQKH 5D2LA 1PG7H 3AREC 1Q8MA 4L8BA 3ARBC 3X3GL 3QXVA 1AGEA 2GQHA 4JHBA 2ZKHL 4JHWL 3O11A 4N0UE 2GW5A 2FHBA 5T1DH 4LPUA 1CFVH 3NZHL 4YUEL 2AKRB 5C0EA 4Y89A 3TA3A 3BHBA 4PRBA 3WN5A 3MUY1 2WNGA 1CU4H 4PJ9B 1X4YA 2OTUB 2QHRL 5K9KB 4C83A 3V8OA 1NH6A 1Q1JH 4ERSL 4DZ8B 3MGTA 1F00I 5E1HB 3WFBH 4NQCD 4XP1H 2EDJA 4CBPA 2A9NL 3IGAB 1OB1A 3TH4T 5C7XL 4YXLL 3OKMB 3K74B 3QUMB 1HKLH 3FT3A 4CMMB 1N0XL 4AM0A 1YNKL 4X7EC 3EYUH 3SDDA 1ZA6A 3O3AB 1NUNB 5GGUA 3RY6C 3EZJB 4G8FB 2YPVH 3S5LB 3L9RB 1YUHB 2EICA 2H2PD 4JFHE 5I66A 3RL2B 5F7MC 2MCG1 4O2EA 2NMSA 5I17A 1WBZB 1K4CB 2YUVA 2IGFH 4HFUL 2XY1A 2HFFB 3OKKB 4NFCA 2D03H 2IADA 1UA6L 1ETZA 5F9DC 4IHOA 2QKIB 3L3KA 5FECB 1P53A 3VXUA 1IQWH 3W0WD 4FABL 1U95B 1AGCB 2UWEB 4GFTB 4FG6C 1ED3B 5DHVH 5C6TH 4C56E 2GJ6B 5EC2B 1FSKC 2G60H 2H2SC 4JY6B 3ZHDA 2IAMD 3WBDA 3A6OA 2R0LL 5ITBL 1WK0A 1T1ZB 1CXEA 3BIKB 3QP3A 4QXWA 3QCVH 2IPUK 3LS4L 2ZOLA 4P5TC 3PQYB 2HTLC 3AUVA 4I18C 1NMAH 4OKVA 5IHUL 1OM3L 4OSUL 5TF1L 5FYJL 1HHKA 2WLYA 4EDXA 4XXDB 4I5BB 1WEJL 3FL7A 2LTQB 5I71C 2P8PB 3GBMH 4IOSD 4X8JB 2YPLA 2J8OA 1YEFH 3T0EE 4S1RH 1CE1H 5HGHA 1XR8B 1GC1C 2FJFB 3X11B 1KXVC 3B9KA 1PQZA 1RQ5A 4V1DE 5KVGL 3PGDB 3ZKQD 2DWEA 2Y36H 1E28A 4NNXB 3V6ZB 1A7PL 3SDYL 2EYSA 4NO0B 3RVWD 1JMZA 3LEVH 5JR1H 4UI2A 3WDIA 2GK0B 3A67H 1IAKA 1P1ZA 5TDNA 4HWZA 2WQ8A 1KGCD 1OW0C 5C0BA 4KU1A 1HSBB 1PKQE 2R0ZL 4D0BB 2BOCA 25C8H 3PWNA 3TH3T 4GRWE 4HKJA 4Y2OA 4KPHL 1NGPL 5FM8A 3VI4F 4HDIA 3PIQB 1EJOH 1B2WL 2ID5A 4XCCL 5HYJE 2N56A 1A7QH 1HN1A 3AFLA 3O3BA 5ID0B 2HLAB 4Y1AE 5FO8B 2DQDL 2EDBA 2R23B 3S6CA 3MRHB 1J1XL 4F57L 3R1GL 4JRYE 3ZKMC 2GAZA 4F7MB 1HH6B 1FL5A 4ZUWA 2NY6B 2HRPH 2WV3A 4S2SB 5HI3C 3DYPA 4X4YB 4HLZH 3QDMD 5T1KB 2EE9A 4Y19E 4GO6B 4XPTL 3PF2A 4HIIB 4KKNA 1YEGH 3PWPA 2NR6D 3QO0A 2Q8BH 1Z5LA 3KYMB 4CADB 5I1AB 1LNUA 2YBRB 1X4ZA 3T0VA 2Z4QB 3RPIB 1ZK9A 3PNWB 2B1AL 4H5SB 2BNQB 3VE0A 1YNLL 3RWHA 5EU4B 2EH7H 3O0RL 4MS8D 2ZJSL 1EEUA 4CU6A 3JWDL 4FQXA 4J1UB 1KEGL 3KPNB 1FYTA 1JTOA 2H6PA 4EOWL 4KKBD 5F1SA 1MRFH 3OHXA 5HHOE 5F7LB 4PUBL 3B2UD 2IALA 2CKNA 3BT2H 5FYLD 3EOBB 2BMKA 1U8JB 2VRAA 4W6XB 1R3JB 4LPWA 3HE7B 1WT5A 3DTXB 4X98A 2GSGB 3U4BL 4TNWK 5CWSA 3C5SB 1UEMA 2JCCB 3VXNB 2X05A 1TVBA 3DWTA 1B3JA 2XOTA 4GRMB 5C0CA 3GK8H 3PE9A 1KIPA 4JJHA 3IJSB 1QACA 2DM3A 4AYFA 5E8DL 3RHWK 1KB9K 4M1CD 3MGOA 2BCKA 5CHNA 2V2TA 3C60B 1I75A 4LLWA 5EIIB 1T3FB 3VFGL 4X6DA 5FYKD 3BIAX 1G7HB 4WHTA 5CJOH 5IB1A 3V2AR 2MOVA 3FOLB 1D9KA 4YFLI 5BZDA 3BH9B 2BNRE 3QQ9D 5F8RC 2Q1EA 5L2KA 3GJFA 5LXGL 3QIBC 5DD3H 1KN2L 3SQOL 2VE6B 5IBTL 2W59A 1YMMA 3TJEL 2VITB 3CZFB 3N9GL 4P0DA 5DMGD 5DD5L 3C6LC 5DURB 1GJIA 1U8IB 3MRFB 1RZKL 4RX4D 1BX2B 5C0FB 4WCYL 2XKSA 1LDSA 5TF0A 1ES0B 5HHPA 3S96B 4R3SA 5F89B 4N9GB 4WEMB 1T83A 3V4PH 3GMPB 1JNNH 4QXGL 4UUJA 2X1QA 2HFTA 3S88L 4GOSA 5HGBB 2Q3AA 3ZL4L 2BY3A 1F3DH 4NQXB 3SKJL 2B0SH 2V7NA 1AHWC 3G04A 3BYTA 4KDTC 3BWAA 3GMOB 1NEZG 1T0PB 2DD8L 2GITA 1NBVL 4KKAC 3LPGA 3DX7A 4MNHA 4NPYB 1A9BA 1KCVH 3NGBB 4R7NA 4U33A 4K07A 1NDMA 2X44D 3WL9B 2DTML 4LCYB 4PRIE 2FX7L 4CN6A 3O2WL 3MCLH 1YYMH 1AXTH 5C07D 1TFHA 2VDKH 1MPAL 4J8RB 1HSAA 4PS4L 4I4WB 1T5XA 3TZVB 1YN6B 4EBQH 4U3HA 4U0QB 2BDNL 5IK3B 5DJ8B 2CUMA 1UB5B 2DQTL 2FSEA 3GGWA 5E2UH 4OGAC 4NWUH 4X9GA 5C71A 5JW5B 1AY1H 4QRSB 1GGCH 1PX4A 5EPMA 2GTWB 4E0RA 4MA3A 4NFDA 4HJGB 1UKTA 2ADIB 5C09A 4LDOB 3MV9D 4WWKD 5DJDB 3IVKA 5LVEA 2AGJH 4TRPH 1NGXB 4MMZC 3CVIH 3HZVB 3MJ7A 4K23L 1S9XB 3MLUH 3SGDH 43CAB 4MX7A 2XZCH 3T08A 2CR6A 4G8GE 5FO7A 5MP6L 3MTRA 3BKCH 5I75C 1WBYB 3F7RA 5C0DB 1YPZA 3HPJA 4PJFB 5JXAH 3RNKA 1L7IL 3CH1A 1KJMB 2VL4A 1I8IB 4OLUL 4XPAH 5B39G 3CMOH 1UJ3C 3IFNL 3EYQC 2AJ3B 4YJZL 1IZJA 4P2QE 5HYSA 4J3VA 3AS1A 5GHWL 2W92A 3UP1A 1NGZA 2M8XA 3CFJA 5DVNA 2NQCA 3VGDA 1WWBX 4XVSL 1I1AC 1OARL 3OKNB 3IDGB 4KV5E 3NCEB 5FV1L 5T1LB 3MUJA 1FIGL 3SDAB 4EIZC 5MHSD 3V5DB 3QUYA 4PYGA 3W39A 1R5WB 3RGVC 3GO1H 4KMTH 1BECA 2VC2L 1QNZH 4M6AA 5AZEH 1RK1B 4HGKC 3TP4A 3BE1L 3GIVA 2EXWD 3BQUB 5I16B 2RIKA 1T1YB 1H9VA 3GRWH 5E6IA 2BSED 3HTLX 1RIVL 4QRRB 1CFNA 1F3RB 3MRKB 1E4XL 5J1AA 3NOIA 5E94A 1OTTC 1C5BL 1G9ML 1NC4D 3NCCB 4TNVK 2H32B 4WEBH 1ZLVH 5E03A 3LN5B 2X1XR 1QBMH 1K9TA 4GQ9L 4FZEL 5MERB 1YNTA 4G7VL 5IROC 3UTTA 5JHDB 4ZUTB 1UT9A 4H1LG 1OTUD 5FHBH 3T0AA 4K94H 3N0PB 1P4IL 4I9WD 2LABA 3HI6H 1XGYL 2IANE 4UTAH 3SE8L 4NN6C 3FMGH 4GAGL 3SPVA 3S4SA 4ZYKA 4ONFH 1U8QB 1H3TA 3KLSA 1FZMB 3ARBB 5GRJL 1I9JL 3I3DA 1SJHA 4PRNA 1FDLL 3HI1B 5GIRA 1KEMH 1K6QL 2HFEA 3PGFL 4LU5H 2XN9A 1FV1B 5T5FH 3UXFA 1BBJB 5I1KL 3RX8A 1R0AH 1U3HA 5CZKA 5DQ9B 4A6YA 3MV7D 4NM4L 2R2EB 1QO3B 5HY9B 5TDOB 1SJEB 3B8YA 1IGJA 1MJJA 5CP3A 3U4AA 3GM0A 1KIUA 4H8WL 4NBZB 1DUZB 2YR3A 4GW1A 2M26A 1NCBL 5FCUH 1UWXK 4M43L 1NC2D 1E4KA 2BVUA 3TCLB 5B4MC 1NJ9B 1QRNA 1A1NA 4GKSA 5C2BH 3KR3L 1UCBH 1RUQL 4TN9A 5L9DH 4YDJA 1U58A 3ZE0F 2WWMC 5GRYA 5A16B 2B4CC 4OLZL 2BOBB 4BQ9A 1WLHA 4GRLD 3MLRH 4QOKD 2FEDD 2HKFH 1PZUB 5BVJB 1FNHA 3N1GC 2W0LA 5DVKA 3TN0A 3TBVA 1P69B 5I76A 5I2IA 4F58L 1WCBA 5DHVA 2LU4A 3UBXB 3ZE1E 4NQCE 4H0IA 1IM9B 3CDYA 1FSKB 5IMMA 1O0VA 1FP5A 1IAOB 1FPTL 3WE6B 2X4SB 3CFBA 5ITFA 3FO0L 3PJSB 2LVEA 5HYIA 4HXBL 1XZ0A 3FN3A 4JG0L 4RZCA 1X5YA 4I18B 3SGEH 4ONHA 2CLZB 3JTSB 3ZE1F 3OF6A 3SE4A 2DMBA 4CNIB 2AXGB 3UC0H 4J3UA 1CR9H 1A6UL 3EFFA 1XF4B 3M8OH 5I71B 2QQKL 1QSFD 1UQSA 3DRQB 5I8EA 3TA3C 1H3GA 3QEQB 1LO3L 2EO1A 3NIGE 5I74C 3WHXB 3WNNA 1QFWH 1DP0A 1SMAA 3I9GH 5KTEL 4JFDB 1GGIH 4U1JB 1DFBH 3W0WE 4FFYH 1JWUB 5KG9B 2P5WD 1X5JA 5JXEA 5EIQA 1EX0A 1ORQA 3HZMA 5C0ND 4JFEA 3NIGF 4KKCC 1ORSA 3NZ8B 4XVJL 2A73A 3DLQR 3SJVE 4K9EH 3N1PC 3P73B 4I2XB 2ADGB 2APXA 2ZCLH 1X3DA 4A6YL 3DO7A 1ONQA 5JOFA 5EC1B 2AJXH 2W65A 4YPGB 4XP1L 1FJ1A 1M6OA 3DROA 4MAYC 3VWKB 3VFMB 4JVPA 4QHUA 2RGSA 1JMXA 5D71L 4EUPH 4HHAA 5L2JA 1LEGB 5DMKA 4PJ7B 2DQGH 4MMXC 3EYUL 1MREH 3HZYB 1L9NA 4QHKJ 5I1CH 5CJ5A 3L5XH 1MCWW 1YQ2A 3VGBA 3FONB 1BQHG 2Y7QA 3BMVA 1CTNA 1KT2A 1FBIL 2VISA 4TSBL 4XWOC 4YHOH 1D5MB 3ZTNH 5D1XD 2IGFL 4N1EA 3V5HA 5KVDL 5I15H 3NACL 1FORH 1UKQA 3JWDC 2DLEA 2O5ZL 2J4WL 4NKDB 1NAMH 3DMMD 5C86A 3D87B 4PGCB 1A6VH 1S9KC 5DFVC 4N1CA 3VFUA 3R06A 1IC5H 1OGAD 4PJ5D 4LCWD 4LPYA 5DWUL 1JHKL 3GSVA 1KGCE 4GSDH 1MRCH 2BFVH 1CL7I 3V4VL 2K1MA 4Y88A 3EJYC 2YPLD 1QA9A 1X7QA 4UINH 4ACPA 2Y6SC 1DBBL 1ZLWH 5F6IC 3WNLA 3QCVL 4R96B 2KH2B 3ULVL 2H8PB 2ZUXA 3B9KC 1W0WB 1V8HA 2XZAL 1CN4A 2R1XA 1S9YA 4BSVA 4UNTA 4P2RA 4H0HB 3L3JA 5C0JB 2Z35B 2BHUA 1EJ6A 3KS0J 1G6RA 5GZND 3WMSA 4YHYC 1EZVX 5J9PB 3IDMB 4F2MA 5J06A 4YC2C 3WFEH 5C0BD 2QEJA 5D8JH 3VXSB 3VFRA 4MXQD 2DYPA 4HLJA 5IKCB 2JIXA 4X0KB 1MFBL 1DBJH 2VDOH 2YD6A 2ICWB 1AFVL 4P23B 3LEVL 2FECI 4WGWB 4LKXA 1A4KB 4YEEA 3QIBB 4HS6B 4MQXD 3OR6B 3GUTA 4MSWB 4KI5D 4LSSL 3GBNH 1CXLA 3C6LB 1DL7H 2CKBB 3I84A 2NYYC 1UZ8B 5BOPA 1X4XA 2F8VA 5JZ7C 3GB7B 4D8PB 1U8NA 4IRJA 4WUKL 3GSQB 2GTZA 5ESQB 4G9FA 1U41A 5E8EA 1RJCA 1MCIA 5J6GA 2FGWL 3SDXE 2Z31C 4NJAH 1CLOH 2FBJH 4PP1D 3BZEA 3QXAB 4KUZH 3I75B 4M9PA 2Q87A 5E56A 1SEQH 3K3QA 3DVIA 1HHIA 2PKDA 4Q0XH 3RWDA 1AHWB 3U7AA 2HRPL 4FQXD 4JM2A 1I1RA 4V2BA 3U4EA 5IFJB 5FYKE 1CBVH 1Q9LB 3BUTA 1NGWB 4G6AD 4HK3N 2K7PA 1YEGL 3SDXF 5ID1A 2Q8BL 2IH1A 3EO9H 4FFWC 1MHEA 4RQQB 1J5OH 3D48R 3MRRA 4DTGH 3L3IB 3FN0L 1S7XA 4DK6A 2E3VA 1XGPB 4HC1H 3U46A 3QXDA 2XXMB 1MLCB 2F58L 4RAUB 3CFDB 1MELA 1Q9KB 4U6VL 1AP2A 1MI5B 3V5KA 3RWIA 4LRNL 5F3HB 3GHBH 3CXDH 3KPQB 1TCRB 1AQKH 3LN4A 4L9LB 5CIPB 4HPYH 2DWDB 2Y9RT 4NQDD 5DEZA 2HP4A 4L8DB 5DK0A 5DYOA 1IQDB 5DD6A 3VD7A 2Z93A 1KXTB 2QV2A 5SV3A 2NW3B 2YD4A 2VAAA 1YA5A 4JE4B 2E9JA 2V5RA 2VLKB 4NDMB 2ZUSA 3WUWA 3IU4H 1D9KC 1ZS8B 3GK8L 4Z7WA 1G6RL 1BF2A 1I7UB 2W0FB 5L2KD 4PJBA 1TVHA 1CFTA 4M7LT 4ZPVA 5F96H 5KSUB 1BZ7B 2VZOA 3ILQC 4OCWH 5L8LB 1SBBA 5HHQB 3OKYA 2ESVE 5I75B 5IOPB 4HKZB 5IJKC 4NUJA 5CJOL 3KPSA 3QG7L 1UJ3B 1KB5L 3QDJA 5C07E 4OLVH 1LK3H 3CCHB 4U1KB 4L4VB 5HPMB 3KPOB 3MBEC 5D4QA 5DD3L 2FRGP 1T83C 3TYFA 3FQWA 3O6FA 1I1AB 4DWHA 1RZIB 5DXWA 2F54E 5F1NA 4JDVB 1ZHKB 3UPAA 3IXAB 3VA2C 1A2YA 3RGVB 4GG6E 1F42A 4JAMB 4LSUH 4ZO9A 4OZIA 1HILA 1ZLVK 1B90A 3DX6A 5DJZB 3MV9E 2IG2L 5CEZL 3V4PL 1G9MC 4F7PB 2ED9A 1JN6A 1JNNL 2YEZB 4P4KA 4XP5L 4E41A 3DUSB 2Y06L 3GRWA 2UYLB 4LIQE 1INQA 2D7QA 2X4RB 4FQIH 5C0AB 3M1BA 4OZGB 1OTSD 2J8HA 4QO1A 2A6DB 5KSBE 1NUDA 1Q94A 3EYOA 4QXTB 3QQ4A 3C8HA 1VACA 4K7FB 5EO9B 2VZTA 3G6JB 4NRZB 3B9DA 5A2JH 2VLLB 1YYML 2CDFA 1UVQB 3FN9A 2KBGA 5IWLA 1VERA 4MNGE 4MDIA 3BN9C 2OLDA 4NN6B 3DPBA 5MHSE 4PG9B 2DL2A 1RAMA 1FL3A 4LSQH 4NRYA 1WBXB 2XKUA 3RWJA 3D2UD 1J7VR 1G7JA 4NWUL 1AY1L 4PV9B 1G7IB 1RMFL 1T04A 4Y2DA 3PV6A 1AR1D 5F9JB 1YMHB 3QDGA 3IXTA 2LV4A 4RBPH 2WBKA 3KPRA 3X17A 4L29B 1C16A 3ZYZA 4UMGA 4PJGA 2FEEI 4PGEB 2AGJL 4TRPL 4H8WC 4OCYH 4TSCL 4IMLA 4ZO6A 3RWGB 3IDYC 2FATL 1BQLH 1G6VK 1EFXD 2XZCL 3Q5OA 4PJIA 5DJAB 5DJYA 3S36L 1I1FB 2AQ1A 3QUYC 1FAKT 4F33B 3CDGB 3CMOL 3WHE0 4I9WE 4HUMB 4OUUA 2PTTA 5DD0H 2ATKB 2NX5A 4NHUA 2R1WA 5TQ0H 4Z7VA 4L5FL 4QXUH 4ODUA 1WICA 1L0XA 3MRJA 5F1KC 1Z0NA 4IDJL 3NFNB 5E6IC 3L3OA 3BO8B 4AIOA 1E0OB 3CUPA 3GKWL 1MCBA 1DN2A 2M1KA 2PTVA 4KMTL 5DDHA 4YDVA 5A2IH 2A6KB 4UILL 5IB5B 1IGMH 4ONGH 3UTTD 3UAJD 1T66C 2RFXB 1N3NA 4U05A 2ZNWA 3MV7E 3RVXD 4HUVA 1MAML 5DRZA 3BJLA 4XWGL 4F8TA 4Q6IC 4LPXA 4JY5H 2D9CA 3KXFA 1DUYB 4YE4H 4XC3H 3G9AB 1G0YR 3VMOA 1QBML 1IARB 3DUUA 5CINL 2X7LA 1QHOA 5FM5M 4L8BB 1BZQK 5E5RB 2AJVH 1DVFC 4YGVB 4XPFH 5HI5D 1UM4L 4MAUH 4UTAL 5C0EB 1EEQA 2C9AA 3D9AL 1BFOA 2G75A 3TA3B 3FAWA 5DUMH 3HA0A 4ONFL 5F3BB 5IMLB 3BHBB 4WI4A 1TJGH 2ZSWB 5I74B 4ZG1A 2NY7H 1TZHA 1U3HD 4X80H 4MXWL 4C83B 3LDBC 1CFQA 5K9JL 2HAZA 1G7PB 1P7KA 3T04D 3DXAB 3EIFA 2DQHH 4DOHE 5IQ9B 1KBGL 1KEML 4LU5L 5HD8C 2BJML 5T5FL 5ALBL 1YEJH 5FYJE 4G8EA 3MA7A 2V2XA 3EKCA 3W9EA 4G9DB 1AXIB 3GBLA 5D2LE 4F7EA 1QRND 3QJFB 1E4KC 3V6OE 4OM1H 1U92A 1JPGB 1YEHL 1F3JA 5ETUB 4MAYB 1JYXA 1NGQH 4I3SH 4LEOA 4EUPA 3KLDA 4FQQB 4JG1H 1EXUB 5C0GB 1AXSA 4D94A 2JB5H 4Q7DA 5D2LF 4L4TA 5FCUL 1QSFE 5EU6A 4WO4C 2GEEA 4W6YB 5C2BL 1J0HA 3LQAC 4QHLA 5L9DL 2CXGA 1BIIA 5EZJA 3TN0C 3WIFB 2BY2A 3LKRB 1K4DA 1KENH 2WINB 5D70H 3G5VA 5F97E 1YECH 1PD6A 5BW7C 2CLVA 2QBWA 3CH8A 1XAUA 4HWBL 3QNYB 1MEXH 1N8ZB 2VXVH 3MLRL 2F74A 2EDNA 4FQLH 3QUXA 3B5GA 3ULVC 4YBLC 3OF6D 5DZLA 4YFLF 3T3PE 4OF3A 3VW3H 1YY8A 4OKVB 3SE4C 3TV3H 2ENSA 1MVUB 3TNMA 3VXRA 3U2SB 1JFQL 3LIZH 4Q2ZA 1U91B 4HX1B 3DETD 2NZ9D 4YHKH 3MV01 4NKMA 5F6IB 2EDRA 3QZWB 3BZ4A 3G6AB 5HGHB 4N8CL 4FXKA 1KB9J 3T3PF 5DF0A 3JWOC 4R0LA 4N5ED 1I9RL 3DHJA 3H42L 1HXMB 3UC0L 1T1WB 1CR9L 2V5YA 3FHAA 3GHEL 7CGTA 1NGYA 4JFED 5JXEC 1IM3A 1E28B 3JV0A 4JN2A 2LFGA 5E1AA 1HYSD 5E8PB 1VGEH 2HN7A 2DM2A 3ARFD 1QFWL 4HPOH 3KHQA 2EYSB 3LEYH 5DTFA 5TDPA 3RZWA 3VFNB 3ZT7A 1GGIL 1HHGB 4RFNB 4YHYB 1I3RA 2VXTH 3REVA 4LLDA 2YN3A 4YC2B 4KFZC 1P1ZB 2CIKB 4YR6A 4HIEB 1OAUL 4ELKB 1KPUA 4KK9C 1OGAE 4XPHL 4JB9H 5D7JA 4HS3A 4LCWE 3EOAA 5GGSA 1IEHA 3CSBA 5LBSH 2FIKA 1QFWM 3QUZD 5J7CC 2YPLE 2ZCLL 4IOIB 4P5MA 1ZT7A 4BUHA 2C1OA 1AE6L 3BDYH 2DQJH 3O3BB 5EULV 3ROLA 2YXFA 1H3WM 4XGZA 4OKDA 1PEWA 3NA9H 2V9RA 3LV3A 5IESL 2BSSB 1FO0L 1UKSA 3HRPA 5SV4A 1FFPB 2HT3D 4NSKB 2DI9A 4F8QA 2A74A 5A3ID 4HUUB 2Z31B 4F37F 1A14H 4PBXA 4XB8A 3VRJB 4EDWH 1DLFH 1L0YA 4P49A 3MFFA 3W9DA 1M7IA 4YHOL 4Z0XA 3ZTNL 5C0BE 3IDUA 5GGRB 5IBUG 2ZWLT 1X5XA 3MV8A 1XF3A 2QQNL 1OP5H 1L0QA 3HNTL 5KSAD 5IHZA 1INEH 4OT1L 3HNSL 4WDIB 4OF8A 1ZVYA 1VPOL 1A3QA 4LCIL 2IALB 1A6VL 1A1MB 3ME0A 1YYLL 3BOVA 5IGXH 1QVOA 4HC1A 1IC5L 5IVXB 5IT2H 4YX2H 3UPRA 4KI5E 4BM7A 4ORZC 4JDTH 3O4LA 4H20H 5EU7E 2GFBA 4P2RD 4IS6B 2N4IA 5CWSB 3BRDA 3CXHK 4ZXBC 1Y6KR 1IVLA 3FZUD 4XCEA 1QD0A 3ULSB 1HIMH 1QFWI 2BCKB 3EOYG 5E8OB 3WKNA 4LLWB 4U3CA 3P4OB 1MFAH 4KUCD 3CFKB 5EOTA 5EOQL 1IGCL 1D9KB 1RU9L 2QSCH 3PABA 5HDOA 4O51A 1X5LA 3GJFB 5IB3B 4LNRB 1DN0B 3BH8A 3R8QA 5D8JL 3CX5K 1NKRA 4ODHL 3MROB 3RPKA 5JUEH 3Q0HA 1JGUH 4M5ZH 1JK8A 1F4XL 3TPUB 4G43A 3S37H 1DBJL 1NCWH 1UENA 5DRXA 4Q9QH 5BO1L 1KELH 5D7LA 3VRIA 3VDAA 1I85C 4MS8C 4UV4L 3MBEB 4FQJH 4R3SB 2BNRB 1EFQA 4WU5A 1TITA 1JGLH 2VDLH 5AG9A 1BBDH 1DL7L 1CD1A 2VDQL 4NQDE 4WI8A 4TSAH 1U9KA 2DBLL 4JFZL 4JM2D 2V7NB 3QEGH 4POUB 5ICZB 5CAYB 2GITB 5KVFH 2ZOKA 4PRDB 2L7JA 1NFDA 1Q72L 3DX7B 3HRZA 4MNHB 2PYFB 1RJZA 3AVEA 4NJAL 1S8DA 5L2KE 3QUMH 4I77H 3EBAA 2EYRB 4X6DF 1YMME 2EC8A 4ODWB 1JYWA 2XWTA 4BFGA 1CYGA 1CBVL 1J0YA 3I6LE 1HSAB 3PDOB 4UIMB 1T03H 1YEEH 3O8XD 3VH8A 4HJ0D 1JF1A 3S8WA 3NIFE 2EKSA 5KVEL 1J5OL 4WI2A 4DTGL 3ORJA 5GZOD 3ISWA 4HC1L