4BWUA

Three-dimensional structure of the k109a mutant of paracoccus pantotrophus pseudoazurin at ph 5.5
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPAKARERMDAELAQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Exploring the Surface Determinants of Paracoccus Pantotrophus Pseudoazurin
rcsb
source organism Paracoccus pantotrophus
molecule tags Electron transport
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4bwuA00
1WS7A 2R7EB 5AKRA 4BDVB 1AZBA 2I7OA 2DV6A 3JTBA 1GR7A 1SFDA 2I7SA 1AANA 2XVBA 1NWOA 2XXGA 3PAVA 2CJ3A 4A2GA 4HHWA 3X2QB 4YVNA 2JFCA 3WKPA 2QPEB 3OMIB 1XB6A 1XB8A 2EIKB 4HIPA 3WIAA 2WSDA 1NICA 1XB3A 2J56A 2VM4A 4KO9A 2B3IA 1ASPA 2GHZA 1A4AA 1WS8A 4YSOA 4HCIA 4PCYA 1MG2C 2BHFA 2UXGA 4DPAX 1A4CA 1OOWA 1RKRA 2DYSB 5PAZA 1GW0A 3FSZA 1FWXA 2N0MA 3H4FA 4BWWA 1OCCB 1OE2A 4DP4X 2GI0A 4HZ1A 3WNJA 3FT0A 2IH9A 2IH8A 3IE9A 2QDWA 1E30A 2XYBA 4BXSV 2XUWA 3CDZA 1F56A 1NPNA 3HB3B 3PAZA 1SDDB 2EILB 5I6LA 1CUOA 5AZUA 3H56A 1BXVA 3SBRA 4GP8B 1KDIA 4YSRA 1NPJA 3GDCA 2Y1AA 1OCZB 2MTAA 3CVCA 3HEIB 1OF0A 3T6ZA 1B3IA 2BWDA 3UADA 4E9SA 2JKWA 3FQ2A 1BXAA 2CCWA 5ANHA 5EHFA 3WI9A 1URIA 4KNTA 4DPCX 3EH4B 1SHWA 3ABKB 1N70A 3NJMA 1OCOB 4QKTA 3WKQA 1ZPUA 3UGEA 1DZ0A 1IBYA 3DKHA 4GP5B 3IN2A 3UABA 4JKNA 1AZRA 1XMEB 3OMAB 1E5YA 1JZIA 1ZV2A 1EHKB 2E86A 1AAJA 3OM3B 3C75A 3U25A 2GBAA 2R7EA 4BDVA 1JVLA 2PPAA 2UXTA 2DWSA 4AZUA 3TU6A 3QJQB 1E65A 4DP6X 1BQKA 3NT0A 2PCYA 5B7EA 1NTDA 1KDJA 4TXVB 2YAQA 4YSQA 1OCRB 2UXFA 2IDFA 2EINB 1BAWA 4A68A 3PLYA 3TBBA 1IKOP 1MZYA 2XXFA 3X1NA 1FFTB 1L9TA 2FTAA 1PNCA 2VW6A 3ABLB 3EHBB 3BVDB 3FU7A 4YSPA 4CSZA 3KW7A 3OD3A 2QT6A 1W6WA 3NJKA 4UAHA 2YXWA 4GYBA 4KOCA 1GYCA 1V55B 3ASOB 4E9XA 1JZGA 4DP9X 2GSMB 2XX0A 4E9WA 1AIZA 2FJSA 2W88A 2AZAA 4Q8BA 1NIFA 4AKQA 5D4JA 2WO2B 2BZCA 7PCYA 1E5ZA 3UAEA 2IWKA 2ZOOA 4F7KA 3D12B 1SDDA 2XLLA 1HFUA 1AZNA 4P5SA 2YAHA 4KO7A 4UF7C 3SBPA 2QDVA 4NAJA 1GS8A 1NIAA 4F2EA 1SHXA 4KO5A 1OE3A 4HAKA 2BW4A 4ENZA 2IDTA 2IDUA 3PAUA 2XV0A 3CG8A 4YSEA 2UX6A 3QPKA 1NINA 5IY5B 3GXUB 2GC7C 1CYXA 1KV7A 4M3HA 5AFAA 3FSVA 6PCYA 2AVFA 2DY2A 1NWPA 2HRHA 4MFHA 2H47C 4DPBX 1ADWA 1W6LA 2GIMA 2FT8A 1ZIBA 1JZJA 5I6PA 1ILSA 2Q9OA 4X4KA 3ZDWA 1T5KA 1NIEA 2H5UA 3NJHA 4AI7A 4E9VA 1JERA 3GYRA 2VM3A 4NERA 1RZPA 3FU8A 4G7QB 2FQEA 3AY2A 3NSYA 2Q5BA 3QJVB 1JXFA 2FT7A 4AKPA 2EIMB 1PZAA 4M4RB 4G7SB 2PCFA 3X1FA 2YAFA 2XV2A 3S3CB 4YSAA 5B7FA 1IBZA 1AS7A 2UXVA 1NIBA 3WNIA 1RCYA 2CAKA 1W8EA 3SBQA 2P80D 2LLNA 4E9TA 2I85A 1JXDA 3OMNB 1GS7A 1IC0A 1PMYA 4A66A 1JZHA 1PZBA 1ZDQA 1PLCA 2CALA 1KCBA 1KCWA 4F2FA 2RACA 4HCFA 1BQ5A 2GB2A 4KO6A 1CURA 2HX8A 2AZUA 4JHUA 4DP2X 3X1GA 2YAPA 1BEXA 3WG7B 1JZFA 4A67A 1PZCA 2CBPA 4ZK8A 2HX7A 3NJJA 5D4HA 1AZCA 4WKXA 2FWLB 4YSCA 2PP8A 4HCGA 3N2JA 2XWZA 4G7RB 3IEAA 3TASA 2PPEA 3FQYA 9PCYA 4FAAB 2TSAA 1PY0A 3FQ1A 4YSUA 4NB7A 3AG4B 1JVOA 5F7AA 3ZIYA 2VSKB 3JT2A 2BW5A 1J9SA 2B08A 2HLEB 2TSBA 3FU9A 1DYZA 3PXLA 3UACA 4P5RA 5I6NA 2H3XC 4G71B 1L9SA 3V9EA 3NP3A 3QJTB 4YL4A 1J5DA 3S8GB 1X9RA 2Y69B 1V10A 3NJIA 2BP0B 1AS8A 3NYKA 4G70B 4KNUA 1UATA 2IDSA 5I6KA 1M56B 1AACA 3CVDA 1N68A 1FA4A 2YAEA 2CUAA 2DYRB 3N55A 4E9QA 2IWFA 4PAZA 1JXGA 2J5WA 2PP7A 3TA4D 2PLTA 1HAUA 3BQVA 5F7BA 5TK2A 4BWUA 3ABMB 3SQRA 1L9PA 1PF3A 2BP8B 5B1AB 6PAZA 1WA2X 1QNIA 3UAAA 1MZZA 4GP4B 4BXVA 4EF3A 1V54B 2PP9A 2QPDB 1TEGA 2ZWNA 2FNWA 3MX0B 1MDAA 1ET8A 2XX1A 3RYMA 3ZX1A 3V9CA 2FQGA 1E67A 1ID2A 4CSPA 2A3TA 3FYIB 5D4IA 4N4YB 4DP1X 3MBWB 1SJMA 2YAMA 3T6XA 1TEFA 2XV3A 4DP0X 4AKOA 2OV0A 3AG3B 3ASNB 2AFNA 2OCCB 3S3BB 3FS9A 2HRGA 4G72B 4A2DA 5I28A 4A2EA 3AW5A 1JZEA 1L9OA 2BO0A 4JHVA 3L45A 4DP7X 4KNSA 3CVBA 1CYWA 1AQ8A 2J57A 2UX7A 2VW7A 3G5WA 1X9UA 3ERXA 1SF5A 1ZIAA 2YAOA 2ZXWB 1WA1X 1I53A 2P80A 3OQRA 2OJ1A 1ETJA 1IUZA 1OE1A 2NRDA 4BWTA 4YSTA 1BYPA 5B1JC 2IAAC 3DIVA 2BP0A 5FC9A 2MRYA 3EH5B 4A2HA 2X88A 7PAZA 2IWEA 4GXFA 4W1TA 1PNDA 1BQRA 5E9NA 1NDTA 3TBCA 4W9ZA 1PAZA 2J55A 1J5CA 3FU7B 2VMJA 1BYOA 4DP5X 3FYEB 4A2FA 5LDUA 4YSSA 1KBVA 4UANA 1AR1B 1EZLA 1J9RA 1A8ZA 1YLBB 2BP8A 5I5IA 1GSKA 2FT6A 3IBOA 5PCYA 3AZUA 2HZHA 1ET5A 3NJLA 3PPSA 1M57B 1WA0X 2VW4A 3QJRB 1M9WA 1MG3C 3QJUB 5B1BB 1NZRA 3KW8A 1GY1A 4QLWA 2VSMB 3DTUB 3T71A 4YSDA 5B3SB 1KBWA 1PCSA 3FPXA 4Q89A 3QQXA 1J9QA 2FQDA 1SFHA 2VN3A 3NSDA 8PAZA 4FA7B 1SNRA 4HHGA 5I6OA 1QHQA 1BXUA 1TU2A 3T6VA 4KOBA 1TKWA 1OV8A 1VLXA 2YQBA 1J9TA 4N8UA 5B7MA 1GY2A 2YXVA 3FPYA 1PLBA 2YARA 1SF3A 2FQFA 3T6WA 2DWTA 4RH4A 2WO3B 1AG0A 1PLAA 4HALA 1JOIA 1KGYE 3NP4A 5I5MA 3H4HA 3NSCA 1A65A 2PPFA 3AG1B 3NJGA 3PCYA 5B1JA 2AANA 2GC4C 5A7EA 1AOZA 1L9RA 1NIDA 1ILUA 3NJFA 4DP8X 3CDZB 1KYAA 1QLEB 2HX9A 5B1KA 3ABGA 3NJNA 4GY4A 2X87A 3ZBMA 1HAWA 2ZONA 2BZ7A 3AG2B 1AG6A 2JXMA 1L9QA 5I6MA 3X1EA 1A4BA 2XU9A 2W8CA 2EIJB 4AX3A 4WTQA 4BK5C 3X1BA 4L0PB 4E9RA 1WAEA 2IDQA 1AZUA 1ET7A 1A3ZA 3FSWA 3EH3B 3IN0A 4YVUA 5TK4A 3S8FB 2BWIA 3QJSB 1R1CA 1ZDSA 1ASOA 3FSAA 2HXAA 1AS6A 1CC3A 1ASQA 2PPDA 4K9JA 3T9WA 4E9YA 3CZUB 3NSFA 5I26A 1GS6X 2PPCA 1RZQA 3S3DB 3EF4A 5I5JA
chains in the Genus database with same CATH superfamily
4BDVB 1YDPB 4ZRGA 5GJSL 2I7OA 3L3IA 4OJCA 5KJRH 1U8HA 2LHAA 1ORSB 2N3JA 4D94A 3BGMA 3FOMA 4XVUD 1AANA 2XVBA 5IF0A 3FU0A 1A1MB 2B9AA 1ESOA 4V1DB 3SB3A 5D1XC 1UWXH 2BDNL 4FL4B 4XP9H 4ANVA 2LQRA 1SOXA 4FQHA 4PJBB 3F7PC 2ZXAA 4GRLC 3E6HA 3BUYA 2EE0A 2A9DA 5CP7B 4QRRA 5KSBB 1IQDA 5GS0L 3ES6B 4DGYH 1UOLA 2E9WA 2EDQA 2GJ6B 3VFSB 4PCTA 5E1AB 1KY7A 4TUJA 3KCWA 1YQVL 3ARGB 2AQQA 5GGRA 3CBKB 3LRSA 1RJLA 2H32A 4NS0A 5IUSA 1DLFL 2CLZA 5EZIH 1NGQH 2VDLB 4OLWH 3NFPB 1QA9B 3WFBH 2I60L 3X11A 4KV5F 4JRLA 4MVBC 3WFCH 3IDXH 5I1HH 2ZE0A 4F1SA 4F7TA 1B0IA 5FGBA 3ETTA 2RALA 1H8SA 3MA7A 4MJIB 3ZE0F 4X6DE 1H0DA 3S35L 2X4UA 1EPFA 5IQ9A 1E6JH 1DEEA 5HGAA 3M1BA 2DM2A 3GS0A 3VI4A 5SWSD 5F7EH 1MIEL 1PZDA 3UADA 3PNWB 1JFHA 3EJJX 4Y19D 5CZRA 1LMIA 2LW3A 1FC1A 3SYCA 4FQLL 5DRNA 3EDJA 4PGBA 3WKNA 5BW7C 2EKJA 1BFOA 3CH1A 4BINA 2VLME 3HHSB 4N20A 1P7KB 4V11A 1UH2A 1KACB 3SDCB 3WDJA 2AJXH 5DJ6A 3WHE0 4LOUD 1JZIA 1FLRL 1IEAA 5DMKB 3ASWA 4LVNC 3VRJB 3TEZA 2HVJA 3MKKA 2NY0D 4HUWB 1OY3B 3O2DH 2F19L 4D9QD 2QQKL 4YDJB 2A0LD 2HRPH 2MNWA 4UT7L 3TWYA 3QXWA 4Y4FB 5HGDA 2DWSA 1HWHB 4DGVL 4Y8DC 1IGJB 5E6RB 1NAMA 4IIQB 4Q4EA 1UGNA 3Q2NA 3I6KA 4PP1D 1FGVL 2O5XH 2FO4B 3MU3A 4ZXBD 4CNIB 3BISA 4POZC 4DEUA 2YAQA 2F53A 2HT4C 4PI0A 3QDGD 4N87A 3DIFB 1E4HA 4UU9A 4LSSH 4FABH 5INDB 4MZIA 4U1LA 5EU5A 1BEYL 1K5NA 1EUTA 3A3YB 3DX4A 3PHOA 3TF7C 2AABL 4LVEA 4CC4A 4QY8A 3RL1B 3S9DB 3L9EA 4WEMB 4JM2B 5CSGA 2MCMA 1DSYA 4JFPB 1QKZL 1UB5A 4A6YA 1OALA 3LKQA 1FGNH 3WJLA 3NJKA 3BWUC 2YXWA 4UILL 2SEBB 2WQXA 2X6BA 2J8UB 4P2QE 5F7HA 4UZUA 4CMHC 5C08A 3MUUA 4P23C 3KAAA 1MFEH 3MLSL 1NPUA 4ZS6C 4P5TD 4XODA 3CIQA 1E5ZA 1MCOL 3C09C 3CHXA 3VFOA 5GS3A 2DKMA 1FH5H 3C5ZD 5GXBB 1RJCA 2IAND 5GISL 3E7JA 3FRUB 5IOKA 3LZPA 5EZLB 3IU3B 5GZNA 2A9CA 4ENZA 4N90E 5FO8A 4UAOB 2KQNA 1JI1A 1M3IA 2K3HA 4OFYA 3VMOA 3QPKA 4HK0B 1L9MA 3GKZA 3MQIA 2GC7C 1A6PA 3EJZD 2DQDH 3DXAE 3HA0A 3ULUD 4P8QA 5DJDA 1P1ZB 4WFED 3BPLC 4HOMA 4M6AA 1R5VA 1JZJA 5CEZL 2BIQA 1NAML 1E50A 1NGXA 1K4CA 1NIEA 4AI7A 1KJ2A 2O4EA 3P77B 1BGXH 1GPOL 3GI9H 3DMMB 4YMPA 4XHJD 2VMCA 1HU8A 2BSTB 4WSJA 2IADB 4C59B 3MYZA 2EYTB 3BD4A 1VFAB 5IJVA 4X6EA 3TS8A 2EIMB 4HXAL 2FWOA 2ZOWA 4YHKL 4WHTB 3RI5K 3X1FA 1ODUA 5GGQH 1QNZH 3QIWC 4HAFA 1DBJL 4IOIA 4PSRA 2ARWA 1WWAX 3DRQB 5JR1L 1F4YL 3AT0A 3SDXA 1HCFX 3TFKC 3V52L 1VZIA 4RWYL 3W11C 1IEBA 1XF4B 1BQSA 4MMXB 4Q9BA 3AMLA 2I85A 5DS2A 4Z0XB 1RK1B 3JYBA 3MLWH 1PMYA 4HKJA 4L8DA 4W9CC 2ODIA 2WZ6A 3MR9B 1PZBA 4ALAC 5ISZE 2B2XH 3QUGA 3BWZA 4MAYD 1KYUA 2GJZA 3V4LA 5EU7C 4H8VA 4LPVA 5FGCB 3MRKB 4A67A 2AQRA 4ZK8A 5DZNA 4WGVB 4OI8A 2Q8AL 2NYZA 4N28A 2VMEA 2VR3A 4IKKA 4APXA 3WS3B 2XWZA 4KI5E 5E6ZA 3QQ9C 5BVJA 3WIFB 3SBWC 4ZUTA 5ABZA 5IEHB 3ZHFA 2YN5A 3WJMA 2WKGA 3HS8A 5E4AA 5IESH 2B08A 1SHMA 2QMJA 3U48A 3FN0H 3X3GL 3D6GA 1AHMA 1CZ8H 1L9SA 2BLFA 4LSTH 3QEGL 1KJ2L 4JUSA 4Z7WA 4YL4A 4TMPA 5L7XH 4E41A 3KNBB 3UEQA 3NIGB 2ICWA 4AIZB 1LO5A 3BP7A 3QO0A 4RAVB 5EC1B 5ID1A 1RMFH 3NYKA 1E27A 3TESA 1Z1WA 1LK2A 4BK4A 5MEOA 3TBWB 4BYHA 1QYGH 2QZ5A 2OTWA 3WKML 4RISL 5F1OB 3DGDA 2BVTA 6FABH 3GNML 4HH8A 3ZTCC 3LV3B 4XVSH 4FXLA 1TYRA 2AJSH 3LNIA 4N2EA 1W8NA 4NT6B 4QRPA 4OF5A 4PLNC 5I8CA 1PJ9A 1J0IA 2BY2A 3MGTB 3CZGA 1L9PA 3MREB 4HJ0C 1BMZA 2VLRE 1J5HA 3W3BA 5C0BB 1EEQA 4UM9A 4GP4B 4IK6A 1WT5C 2DQEH 2ZJSL 3HE6C 4D7PA 4G82A 5EU6B 1JGLL 5JHDB 4RFEA 4F92B 1ZLEA 3TH2T 3SOBL 5CU9A 2DQHH 1OVZA 3KPPB 5C2BL 3BIKA 3VFWB 4LVHB 1WHPA 1SJVA 3T0XA 1M4KA 4JFDB 1X5KA 3W0WB 1NFIB 5J9PA 3WFDL 5D1QC 4XWOC 1Q9WB 3HG3A 2XV3A 5BO1H 2Z8VC 1MI5E 3BWSA 3E0GA 3P4NA 4TRPL 3MLUL 1CFNA 2FWSA 4P2OD 1OAZH 3X14B 3QS3A 1BA9A 1J86A 4NPJA 2CK0H 4OGXH 4U6HA 3LZRA 5C0RL 3IMBA 1CXIA 2XA8H 3BAKA 1QUNA 2BSSB 1NFDA 3BAIA 3CFUA 3HC4H 3HMWL 3MFGB 4AC2A 3HPJA 5E9DA 3ZU8A 1BHGA 3DI2B 4G43B 5D1ZD 3N5AA 4HGKC 5JPMC 5K33A 1OQXA 3HUJA 5HVHC 3QUZB 3DVFA 1CVSC 3B2VL 2BHUA 4YHIA 1V7ML 4X7TB 5D71L 3QEHB 4H88H 2OJ1A 4M6MH 3QC6X 5BZDA 4NO5B 3SJVD 3CLEH 4F80A 4EI5A 2YLHA 3NRFA 2D7NA 3T1FA 1AIFA 2MRYA 3BHBA 3GKWH 1OM3H 3NFNA 2C1OA 1QSEE 1N5AB 4W1TA 3VI3A 4OZGE 3C6LB 2E9JA 2K78A 3FW6A 3IMSA 3KS0H 1VADB 3JT0A 2VDQB 3FAXA 1GTFA 3RNQA 4A2FA 1MY7A 3BGFC 3B5HA 1SOQA 1RIUH 2VL5A 1J05B 2JCCE 4HKZB 3RUGA 4IRJB 4U1MB 3D52A 4F7EB 3H3BC 4F15C 2DIEA 2YK1L 5FO2A 1A6UH 1GVIA 5DHVB 3LPPA 1THAA 1EXUB 4JFYA 3NJLA 4UV4H 4HETA 3SDDA 1COBA 4U2YA 4FGMA 2VW4A 4Z5RA 1KIRB 4PHZA 2J21A 4H8HA 4NDMA 5B1BB 2NY5C 1NZRA 3L4VA 4P46A 3IJEB 1MCCA 2G3XA 3DURB 5C3TA 3AJ7A 2YPVH 4CKQA 1DUZB 3PV6B 4JG5A 3L7EB 3PWNA 1CG9A 1DJYA 2HMIC 2O6PA 3L5WA 1RIVL 4WWKB 4YSDA 1JRHI 3IDGB 4LLMB 2CKBB 5KZCD 3D0AA 15C8L 4YHPA 3PE9A 1M7IA 1QBBA 4U1GB 4L1LA 1KCSL 2WV3A 3RL2B 1N3NA 3OKLA 3HLAB 3GJEA 1RZKL 3RILA 3JTTB 3B2UC 1UM5L 5GHWL 5L0QC 2WZ0A 4IKJA 2MQ0A 1UOWA 3N40F 1PLBA 1VGEH 1XF3B 5EIQA 4EUPB 3PL6D 1S8DA 1CU4L 3T3ME 3WY3A 4AYFB 3H9SA 5CJ8A 2E9BA 1KUMA 4N1EA 3EYVB 4PUBH 4WO4C 3W39A 5I76A 2GAZB 3LKOA 3QZWG 2M26A 1CVRA 4DCQA 4MMYA 1A65A 3P40A 4XI5D 3IKCA 4W6XB 2IJ0C 4P04A 1QLEB 5AW3B 5K9JL 5CWSA 5CJQL 5B1KA 3NCEB 4AUYA 5D70H 2V2XA 5FS5A 4ZMOA 1JGVH 1U58A 4KAQH 1RK0B 2P9RA 4JB9L 1S7QB 2BZ7A 2F9BT 2F74B 3NSJA 4NO0D 2N7SA 4U1NA 4FQXA 2VR6A 4FZEH 4JDEA 2XU9A 2OL3B 4O4YH 2WC7A 4HS6B 4XBEL 2V7HB 2A77L 3DX0A 3JV4B 4FLHA 4CU6A 2OK0L 3A67H 3L16A 4ZO7A 1F1GA 5TDPB 1RIHH 4HBQA 1XL6A 1CC3A 1ASQA 4H1LB 4FTVE 3L95A 4GBXC 1A3LL 5HDRA 4AL8C 4K7PL 3G5YB 2VDPB 4MDIA 3E8UL 3DECA 4O9HH 1BZ9B 1DQJA 1I9JH 2ADJA 3BUPA 4JFED 2VDOL 4NQCB 4WI9A 2BP5M 2CJ3A 3S0PA 3X2QB 5L4JA 2GTWB 3B56A 1FDLL 1ULVA 5D2LA 1BAFH 1PG7L 1QFUL 5D2NE 3FCTB 1JHLH 4HG4J 3HG1D 2EAEA 1JVKA 3OKNB 1P7BA 1UXWA 3B9KC 1GAFL 4GRWE 1WS8A 3LVTA 4YSOA 3EBHA 1NMAL 1FC2D 1M7UA 4NJ9H 3FU6A 3ZL4L 4HW6A 3QG6A 1A9VA 1AGDB 4JGNA 4Y2LA 4YNYB 2Z4QA 3VA2C 1B9KA 3H4FA 4GG6B 3KBHE 4NZTL 4JS7A 3MJ6A 4YK4B 1JV5A 4OKVB 3SGDH 3NIDB 2ZICA 2QZQA 4WEBL 4M48H 1H6TA 1AI1H 3ML8A 1KGCD 3PWPE 2XYBA 4A7UA 3B9EA 1YYCA 1KLUB 4G83A 4G8AC 3MACL 4POUB 3GMLB 4XP5H 3GTNA 1LO3L 4FD0A 4FJZA 4S2SB 5EIIG 4NNXB 3EG9B 1S3KH 2H6UA 4P3DA 4H8WC 3F7VB 4PGZA 3N91A 1NGZA 1JTOA 2IV9A 4RRPA 1ZEAL 3GTVA 3NA9H 1IAIL 4WWOA 3RP1A 2CCWA 3EHBD 2CGRL 1EJFA 2DICA 5F9WC 4KXDA 4IGBD 4ZW8A 3HAEH 3IGAB 3QWRA 4PR5B 3I74A 3TLRA 1CFMA 4TUOB 5DD1L 1D5XB 3II2A 2E76C 1UM4H 5IB3B 3LKNB 2GYSA 1RHFA 5H4YA 4KKAD 4MXVF 1U3HC 1YDPA 4BDVA 5DHEA 1ORSA 5I0ZA 1LJMA 3Q3GB 3QCTH 3LB6D 1A1MA 1GHFH 3G04B 4OQTA 4V1DA 1GMIA 2FGWH 3FFCE 2WBJC 4HSQA 4JPKL 1GGCH 5SWSB 5I0DA 4PJBA 5KOVC 4JFFD 1E4XH 3IVKA 3EO1B 5F93C 5KVGE 3BP6B 4JE0A 1HNGA 2YA1A 2CUIA 4Y19B 1CXEA 3X1NA 5MEND 2YGQA 5KSBA 5CP7A 2FTAA 3OAUL 1CWVA 5ADOL 2C3WA 3ES6A 2W9DH 2F5AL 3QCVL 4IOSD 4Q7DA 2GJ6A 4W4NA 3VFSA 3ZKNC 4OCYL 5E1AA 1NM4A 4XX1E 3ARGA 1KPUB 1OAJA 4EQ3A 1U95B 4CBPA 1JHKH 1OIOA 4FXTA 1L6ZA 1QI5A 4E9WA 1IJNA 3X17A 3DA0A 2I5YH 4ORZC 3NFPA 1QA9A 1FL5B 2AZAA 4GO9A 1WUNT 1QEWB 4TV3A 4R4ND 2XYCA 1YVLA 2WO2B 5E1IA 3QDMD 4LPXA 4TSCH 2OCFD 3BN9D 3BPCB 1RZFL 4NZRH 3SSGA 4MJIA 2HSIA 2PWDA 3UYRH 1MJUL 4XMUA 2YAHA 4UF7C 2L04A 2WP3T 4UQDA 3VWJD 3CK0L 1HKLH 1OE3A 2DOCA 4ZXBB 4J39A 1MWAB 3LRHA 1Q8MA 5TDOB 4BSWB 1U8CB 3QDGB 5FOBB 1HTYA 3CVIL 1C08B 1Z9PA 4FQIL 5E95B 1TITA 1F97A 1IZKA 1IFRA 3QPXH 2EXYC 3SE4A 2C5DC 4A04A 2AVFA 4M1CD 3HHSA 1BQLL 2ZF8A 1R0AH 3DIDA 1P7KA 3SDCA 1ZIBA 4XNUL 3NZHL 5I6PA 4Y5XC 5I74C 1AE6H 3VRJA 4HUWA 4TNWK 5JA8B 1O6VA 3OLEA 2LLGA 4OQTL 4P0DA 4BQ8A 4CGUB 3GYRA 2QV2A 2E9IA 3JTSA 4Y4FA 3TO2B 1D6EB 3AY2A 4PRBB 4M1GH 4P5TB 4IIQA 4B5ZA 1P53A 1LP9E 2FO4A 3D51A 2EXWC 2YOAA 3C5ZB 3L4YA 4CNIA 2IANB 1T1ZB 2MCG1 3FB7B 3I6GB 3DIFA 4MGXA 4RMQA 1IRAY 5INDA 1PJWA 1YEIH 5IVOA 3WNIA 3IFLH 2Y3AA 1IAIM 4LSQH 4L9DA 1W8EA 2ZXEB 2P80D 4JM4H 4JM2A 4EJ1C 2IQ9L 4ZMPA 2VDLL 4JFPA 4AVKA 3PGCB 4FFTA 4XX1G 5FYJE 1F18A 1OD9A 4JKWA 5JOEA 2P5WD 2YC1B 4KKRA 3V6FB 4DW2L 1ZDQA 2YRLA 1PLCA 5MERB 2SEBA 4XPGL 2VXVL 1HS6A 1RUQL 2J8UA 1SQMA 4N5UA 3H1ZA 4AENB 2NYYC 5EU4B 4FNLL 1S3RA 4KJWC 4TSAH 3H3KA 1NEUA 4QTIL 3A23A 5DVNA 4O5LH 3VTTA 4U6VH 3UC2A 1FFPB 1L7TH 3FRUA 4MNGB 5DUPH 2PPEA 3DX8A 5HGGS 3WEMA 5HDOA 3IU3A 4LCWE 4KHXH 2G4GA 4W9GC 4DO5A 1K9TA 3VJ6B 5HI5D 3SCMD 5CD5D 2WBXA 5IWLA 3GC3A 4G71B 2VLLB 2DWXA 3GS7A 2CLRB 1C8PA 1FYTE 2Y6SC 3Q8BA 3AS3A 4KRPD 1P1ZA 3CXDL 2BIOA 3PQYE 2Y2YA 4NXSA 4JDTH 1PPIA 3B5TA 4HGWB 1YZZA 4Q9CA 1ZXQA 2E9GA 1UATA 4KXBA 4LSVL 4PRNB 2RH0A 1E5UI 4MAYB 1II4E 1NGWB 1S2EA 3IJ9A 2IWFA 3P77A 4WI7A 5KWYC 3DMMA 5B38G 4S0SD 5I18H 5IJCC 2P8MB 4EBQH 2IADA 2EYTA 1J12A 4QPEA 5AVXB 3L3DB 3BQVA 4WHTA 3WDIA 3GUFA 3OWRA 5F7BA 2R59A 4FXGC 5I1DB 1MUJA 3LEYH 3DRQA 2X2HA 1U6AL 3KWWB 2VL4A 5C0AD 1YPZB 3HNVH 4N2CA 5ADPL 2E4TA 1XF4A 2AI0H 2XKNB 4MMXA 5DJAB 4CSSA 4NI3A 2PYEE 1NEZB 3TBYB 1TEGA 3B7UX 4JPIB 4KROD 4UQCA 4Z0XA 4CC1A 1RK1A 5IJBC 5ABDE 4LEBA 1MJ7H 1P84K 3MR9A 4WZ9A 2XVGA 2NT0A 3WIIH 1E8WA 3N41F 3LHPL 4X4YB 1JTTA 4DFIA 1BVOA 3L54A 1BQHB 4WI5A 2H9GB 3MBWB 2DLEA 2GVYA 3V7MA 3ZUCA 1O75A 3OWEA 3MCLL 4L8BB 2TAAA 1HEZB 1UH4A 3IXTA 1AQKL 3UC0L 2SODB 2WXKA 3OHXC 4R3SB 1LWHA 1NLBH 4U6TA 1F1AA 3I3EA 4Z7QF 3UBFA 1MNNA 3WS3A 3SE8H 2P5EE 4PG9A 4W9LC 1RERA 2ALWA 4C47A 3WIFA 3ALPA 4OLUL 1TU2B 3T1WA 3W9EB 1YMMD 3CN3A 3DVGB 3VG0L 3S88H 3OAZK 1IGCH 4ONHB 4NJAH 4RA3A 5SWZD 2NY7L 1SF5A 3P02A 4MAUH 3U7WL 2EIZB 1JPSL 4ZOCA 5AOIA 43CAA 1GZQB 5KVMC 2FHBA 3QWOB 4MD4A 2AXFB 4AIZA 3DIVA 4RAVA 5EC1A 1FBIH 5IEKB 4NUQA 2V6HA 2QL1A 2W65A 1P7HL 1JPEA 3TBWA 4NZUL 4JKPL 1AHWC 1R3IL 4FTDA 3CWGA 4M1DH 1TZHB 2F53E 3LV3A 2WYIA 5HHMD 1BYOA 4KHTH 5E99H 2PF6A 2Z6FA 2BHZA 4P2OB 4NT6A 2PCPB 3APNA 3TIEB 4X4ZA 4DGIL 2OXHB 2X4OA 5KBMA 3MGTA 5DEZA 3MREA 2DEXX 4MMZC 2AK1L 2HCZX 2W60B 4FMVA 2G2PA 5D1ZB 1A6WH 3EJRA 3HNSH 5EU6A 4EDWH 5FEBA 5JHDA 2VXUH 1G7JA 2XWRA 3MODL 5CCGE 3QJRB 3JWNG 1MG3C 4LU5L 1G9MC 2A9ML 1MW1A 3KPPA 3Q2WA 4H44C 2Y2TA 1HI6B 3VFWA 4WUUE 3TA3D 3V0FA 3SJVB 3D34A 4JFDA 4HEPA 1MPAL 1NFIA 4JG9A 2HKAA 1ZHKB 3UPAA 1Q9WA 3W1ZA 1CFTB 4MS6A 5IW1B 4JPSA 5CILH 1J48A 1TNMA 4PV8B 4DKFL 5KVFE 3X14A 2ILLA 2ZUVA 5CINH 1O5DT 1EZUA 2BSSA 1HXKA 1EDYA 3ZRFC 3BKCL 4G7YL 4IDLA 4KOBA 3IPBA 1F42A 2WQAA 1VFUA 4G43A 3Q7JA 1XTMA 4PYGA 4C4UA 3D08A 1KENH 3B43A 3VD9A 3L5JA 4RMRA 3QUZA 5FOJA 2EDHA 3Q43A 4S1SH 1E3FA 1QWNA 3IFPB 4GAYB 5GIRB 4G6KH 3V0VB 5B7MA 4LDOB 4JBSA 1I1AC 4X7TA 3QEHA 5I71B 3G08B 4FNSA 3NEXA 1A2YB 1OP9A 2Y22A 2ID5A 2EDRA 2GT9B 1T7VA 4NWUH 4R0LC 2O5ZH 3PCYA 1N5AA 1U8KB 3CMOL 3C6LA 1A64A 2R0LL 1VADA 3NABH 1A47A 1FSKC 3NJNA 1ZLWH 5KZCB 2CO6B 3FUJA 3BC9A 5EIVA 1BJ1H 2FLBT 4LIQE 5EOTA 4F8OA 1J05A 4IRJA 3MLVH 4U1MA 4Y7OC 1J5OH 4F7EA 4EZLA 2CDEB 2B4CC 4QUOA 4MWFB 1IKFL 1CICD 1EXUA 3CE1A 2P43B 4XPHH 1IM9D 4PJ7B 4OJEH 1PL3A 3R8BB 1SN2A 3Q5OA 3MO1B 6TAAA 2DJ4A 1IAKB 3IJEA 3P11L 3DURA 3PL6B 2HT3C 1DEDA 1DUZA 2Z8RA 3MV8D 3PV6A 5ICYB 4HSCX 3L7EA 1RZQA 4N5EC 2GCYB 35C8L 4WK2B 4WWKA 5AKRA 1PS3A 3HB3D 5G4OA 4DEPB 2NXZB 5I73C 4LLMA 2CKBA 4NRYB 2ZAHA 2WNKA 1I3GH 3P9LB 5C92A 2HFGL 3RVWC 1IU1A 4G5ZH 2XQBL 4X7EC 2CWRA 1OSPH 3Q0HA 3G6JB 5T1DH 2B1AH 2J20A 1TNNA 2P49B 3LN9A 3RL2A 4Y1AD 2AQ1A 1D2PA 1TQCB 3WIAA 1AMXA 2BVYA 4Q9RH 5BVPH 5EEVA 1UM6H 2YJLA 4KO9A 2B3IA 3JTTA 5I1CL 2H1XA 5CLTA 4NO0B 4NQDD 3QP3A 5D8JH 4JL2A 3WGUB 3BPNB 1XF3A 3L6FB 4EUPA 3NCBB 3CAFA 4AYFA 2ZYSA 2OQJB 2VDQL 4X8GA 1AGFB 4YLBA 3EYVA 2GAZA 4U1KB 4L4JA 2F7PA 2NY3D 2XTJD 2ZWKA 4PB0H 1CI3M 3NRQA 1E5CA 2VISB 3GZKA 4GOSA 5L9DH 3LXCA 1O9VA 4IJ3B 1NGYB 3OC8A 3M88A 3I84A 4JFEB 3AACA 2QGDA 1U3NA 3H56A 2UZPA 2ZOUA 1SVCP 3G6DH 1NPJA 1S7QA 4QRTB 3W9DB 4WU5B 1OCZB 3BXNB 1SMAA 3FQ2A 1R34A 2Y1VA 4XVOA 3HG1B 5TPWH 4PQXA 4HS6A 3ZHLA 4KNTA 3JV4A 3ZJAA 4BKTC 5DZPA 4RGNE 2JCCF 3AM8C 1JL8A 5J06A 4Y5VC 5TDPA 3FUKA 2CKBL 4PJDB 1CS6A 2K6YA 5ESQB 1A9BB 1OTTD 5I8OL 3ULVL 3V4VH 3G5YA 2JLPA 2HPOA 3QIBC 1CT8B 1BZ9A 4FHJA 1NFDE 4XMPH 3QQ4B 4M29A 1N0LB 4Y16C 3TU6A 2DQ6A 2XFGB 4NQCA 5AVYB 3CHQA 4DAGH 4MLSA 4YGVB 1F6FB 3NT0A 2GTWA 3GLDA 3N9GH 2OFQA 4J28A 4IJTA 2EVFA 4TVPE 3FCTA 4YSQA 1DVFC 3OKNA 1NMCC 3FNKA 2DAVA 2EINB 2DS4A 3BQUC 5AVRB 4OLZH 5HDBE 1AGBB 4B9KC 4PG2C 3FU7A 3EHBB 3Q5YA 2KT6A 3UGXA 4W9HC 4IKLA 1AGDA 4P59H 4G9FE 2BOBB 2DW5A 4XP6H 2E7LA 1BVZA 4YNYA 4XXWA 4IGBB 3EBAA 3U6XS 1QLEL 2ENPA 2CJTA 1DP0A 2XDHA 4K3EH 4OU3A 1ZTXL 5T1KD 4JRYA 3HVDA 4OKVA 2N0KA 1CL7H 5F1NB 4AIOA 4HJGB 5F1SA 1H5BC 2FEDD 5EEUA 3SKJL 3GHBH 3IRZA 4LGRB 3B8YA 4J2XA 1NBVL 5CEXB 3ZZQA 3AROA 1AKJD 3MV01 1KLUA 4F7KA 4JQXC 2D31B 2EE9A 3OSVA 1HFUA 1KLFB 2GFBB 1MVFA 2UUDH 3GMLA 4YDIH 5TE6H 1WFNA 3S2CA 1J8HE 4ESKA 1MRCH 3ARDD 3L1EA 3EDEA 3TEXA 4NAJA 4NNXA 1NIAA 3EG9A 1EHNA 1U91B 3F7VA 4QKXB 3NRPA 2IDUA 3EGXB 3PAUA 3PIQB 2DI7A 4J1UB 2K6WA 1IC4L 1SXCA 4GRMA 2ARJB 4JFFB 4XXCC 2NNAB 4UTBL 2MOQA 1B2YA 4PJIE 2VDPL 3TPUA 4WFFE 6PCYA 2H0JA 4J3OC 1ONQB 2YZ8A 4ODSL 4PIRF 4PR5A 3WJJC 5GZOC 4LEEA 4TUOA 2AV1B 2FT8A 3FOLB 3BCFA 5DVOA 1D5XA 3KPLB 5IB3A 5I0WA 4K55A 4FN0A 1KEML 4UT6H 2YD1A 2VN4A 1FNLA 1MCWW 2FB4H 3NGBB 3LVEA 4O02L 2WM0A 4NAMA 3DETC 1DBMH 3QDMB 2C7UB 3Q3GA 2DQFB 1E4KC 4NLHA 2FX7L 1Q1JL 3G04A 1AD9B 1WE5A 1OOAA 5CP3H 1OK0A 3O2WL 3UOAB 1QTPA 4NYLA 5AYQA 3VWJB 1XGYL 3M17B 5SWSA 2OMWB 3CDYA 4QDGA 1O6SB 4GMSH 3LPFA 2H2PD 3K0WA 4M7JH 1DN0B 4H13C 3EO1A 1HCVA 2AJUL 3BP6A 3V0AC 4M56A 4Y19A 3QPQD 4OZ4B 3MJGX 5B39G 4Z7NB 3U4AA 2R2EB 3ZE2E 2EO7A 3TIDB 3HS9A 1KPUA 3VH8B 2HVKB 3GSNH 1U95A 3OG6B 4NLAA 3QG7L 2H4EA 1HNYA 1BQ5A 2QBWA 4YE4H 1KXVC 4IOFC 1HYSD 4JZJC 3QDJD 1FL5A 1QEWA 2ARJQ 1DBKL 2B77A 2CCLA 2WJ5A 4FG6C 1CDHA 3D85D 1OARL 3SE3C 1KB5H 3GPEA 2DLFH 3BPCA 2FR4B 4PJXB 3NDYE 4ZW6A 2ZOLB 3GXNA 5HXMA 1Y18B 4HLEA 5KSAC 1T2QH 4NKDB 3W2DH 1C8QA 1RVFH 2P3YA 2ADYA 4QGTA 2G5RA 4ZXBA 5IFHH 5AZ2H 5I0XA 1MWAA 4OCMC 5FOBA 1CLZL 5TDOA 1U8CA 4BSWA 1C08A 3BH4A 5JHLH 3EXJA 2EH7H 5AQ0A 1QRNE 4R4FL 5KJ4A 1HHHB 1UOVA 5D6DA 4JHWH 5KBDA 3N1PC 2VDMB 3GBML 1X9RA 1GJIA 1V10A 2P5WB 5A2LH 4ZDHB 3WL9B 4N25A 1MHPL 5I8EB 3P69A 4AYDC 5CIPB 1NANI 4OB5H 3TO2A 3KJ4C 3WNLA 5T3XE 1D6EA 4Z95L 3VXUE 4PRBA 4P5TA 4NM4L 3L3OC 1BF8A 1U8QB 3H2WA 3D05A 2VXSH 2D0FA 3C5ZA 2ZXGA 2IANA 1BFVL 1T1ZA 4IS6B 3MROA 3I6GA 3NZSA 3CJJA 4FP8H 3LH9A 1PF3A 3V4PH 2H1LM 1PZ5B 4N8CH 2Z34A 2OP4L 2WXPA 4KKLD 2Y7LA 3MA9H 5H37G 3SCMB 2ICWI 3RB7A 5DLLA 2XACC 2YC1A 2Z7WA 5EF0A 3V6FA 3IAGC 4Z7UE 5MERA 1CDBA 4Z7OB 2OSLB 4KRPB 4UQEA 4MYPA 4KZEH 4ODHH 3U4EB 5D93C 4ZPVB 4AENA 2X3BA 5EU4A 5E51A 4D8OA 2C4FT 3TT3L 4LBEB 1YAZA 4WKZB 4R7NB 2WXLA 1SJEB 2BMKB 5EV7A 4Q2ZB 4YLCA 3STBA 4R9HA 3CQQA 1FFPA 1JZEA 3QYCA 3MNZB 4N8VG 4MNGA 2BNRD 3OAYK 3L45A 5DD0L 5IBTL 4CVWA 1AY1L 4KMLB 4BFKA 4KKCC 4QXUH 2ZPKL 4TNGA 5CJXA 2CHWA 4G59C 2FSEB 1CFQB 3VJ6A 4LSUL 5FK9A 3FXIC 5C0AB 1YEEH 3ERXA 4AEEA 1QZ1A 5I1KL 2YAOA 2CLRA 1IC7H 1BM3H 2B1HH 3QZLA 4NN6B 5CZKA 2O61B 3HN8A 2CMRH 1N8OE 1PQZB 2A9AA 4XP1H 4KROB 4GH7B 4MS8D 5B1JC 3GSVB 5F7LB 4MB4A 4HGWA 2WYTA 3FONA 2CUMA 5DRZB 3MRDB 1EEZB 4PRNA 3QJHB 4ZZFA 1T6BX 3N44F 4MAYA 1Y0LB 1BP3B 1XZ0B 1A6VH 1XXDC 3BKYL 3RGVD 1U3ZA 4W9ZA 3UBGA 3ZTNL 2P8MA 1EAJA 2YEZB 3QRFM 4LFHD 4PJBE 3L3DA 4LRIA 4P3CL 3B2XA 2VC2L 3A24A 2JJSA 5I1DA 3UAJC 4XTRD 2BDNH 1S9KC 5KSBE 4BE6A 3KWWA 3N43B 4LASH 5F71A 1YMMB 5FUZH 2ESVE 5DUMH 3BJ91 5I9QB 2XKNA 4E42B 5DJAA 1LP9F 1M57B 4XMWA 1RULL 1NEZA 3TBYA 5SWZB 4JPIA 5C0EB 1P5VB 4GAFB 1B4RA 4NFDA 4I4WA 4Y9EA 5DWPA 1YEFL 1OTUC 5DDHA 1YQVH 3I9IA 5A2JH 3RIKA 2JJWA 4I18C 5D96C 2X6MA 1BQHA 2H9GA 4TL5A 4YPGB 3MBWA 5K39B 1P5UC 2I60H 2CNZA 3T71A 4L8BA 1HEZA 2XZQL 2PCXA 4KZ0A 5KSUB 3GIZH 1TIUA 3IF1B 5DR5L 4R3SA 3WOVA 2VDRL 4HJ1A 4N6QA 1D9KC 2CKNA 2ZUUA 3S35H 1T89A 3HC3L 5ICZB 1HXYA 5HHMB 1KXQE 1XH2A 4PSPA 4E2OA 1K6QL 1TU2A 2WKOA 3W9EA 2XY2A 3DVGA 3GO1L 1H9VA 1GRWA 1IBGL 4DGUA 3K8LA 1JAEA 4RESB 3E2HB 3RU8L 3V5DB 4JHAL 2XWXA 1PD0A 2EIZA 1NOAA 4LARL 4IHBA 5IEKA 1HH9B 3PGDA 4WTWA 2XETA 2WUBL 5EUKB 3FT1A 3TA3B 5J11B 1ROCA 3CX5K 5IHBA 1TJGL 3HI6L 1ILUA 4DP8X 4TVSa 1S46A 5AZEL 4DGVH 1TZHA 2DWDB 1A7NL 4P06A 5D7LD 2XZCH 3QB7C 1DVUA 1KIQB 4P2OA 2PCPA 3VSVA 1X7QB 3FO9A 3LH8A 3TIEA 3U9PL 2OXHA 2ZONA 3AG2B 3LAFA 2F54D 5DC9B 2CGZA 1FF5A 2C9VA 2AQPA 2W60A 4FRWA 5D1ZA 2AABH 1ND0B 1MSPA 2PTVA 4L0PB 2WVSA 4M6NL 5CJOH 1NEPA 1WAEA 1QKZH 1ET7A 1EGJL 3S5LG 3K2MC 3FQRB 5T5NF 1HESA 3S8FB 5TK4A 1XGUB 4LB8A 1HI6A 4UM8A 1R24B 3SJVA 25C8L 3CZUB 5HD8C 3WFHB 2A1WL 3CFKB 3A0OA 3CU7A 4TQEL 3FRPB 4KRLB 4P49A 4QXTB 1UKSA 4Y5YC 1QI4A 1YY8B 2Y06L 2AQSA 1L7IL 4MVBD 4I0KA 4PV8A 4Y88A 1UT2A 3LMJL 4NQTA 5CGYD 5GISH 1RURL 3KS0J 4Y9GA 4N2LA 2ZUQC 4L1HA 1FLTX 4WFGE 2WSDA 1MFBL 3T2LA 5EEZA 2EUVA 2J56A 3QHFH 3VI4F 4CRPA 3MUY1 3H8NA 5D4QA 3RVUC 4OZIE 4WW2B 1IGFL 4GAYA 3IFPA 5GIRA 3VM7A 1H9DA 3V0VA 3NH7L 1IM9B 1TPXB 2DTMH 3SYPA 1A4CA 1LK3L 3G08A 3NFSL 4KI5C 1OOWA 2VZVA 1UZ6E 1A2YA 1AOHA 1GW0A 5HYFA 2JI2A 1IIKA 2X70B 1OTSC 4TTDC 3TJPA 4BWWA 5CEZH 5JPNC 2R23B 4AQZA 2GT9A 5E6IC 2FYYB 3FQXB 2DIBA 4W4OA 4UCFA 5T3ZE 3MV8B 1H6EA 2W07B 3DROB 1O7DE 2IH9A 4ZW7A 1U8KA 2QHRL 4OVUA 1GPOH 1KCUH 3KL3A 3HB3B 1QPXA 5I6LA 1VKXB 5AAWC 2CO6A 1RL1A 5AZUA 2I69A 4X5QA 4LO9A 1J5IA 3V0JA 5FV2A 5DD3H 1DBJH 2G75B 1E90A 1KZYA 2CDEA 4FG2A 5DC0A 1GGUA 5FIEA 1WD8A 4POZD 4Y1AB 3O6FC 2HT4D 4MWFA 2YPKB 4FERA 2L0DA 4PJ7A 3NPSB 5ETUB 2OS7A 4EIBA 1ZK9A 4NQDB 1I3RB 2JWYA 1IBYA 3MO1A 2QGCA 3PDDA 1IAKA 3QBTB 4FJYA 2HKHH 5ICYA 4X9YA 2I9LB 4PJHB 2GCYA 3D50A 4NKOB 1ANUA 2XTJB 4WSKA 5D72L 1G9MH 4NRYA 1LILA 2PO6C 2PTUA 3P9LA 4A55A 3HMXA 2Q8AH 1U92B 1VEPA 3CU1A 3MRGA 3TN0C 3G6JA 4L9LC 1A25A 4YOKA 4KTYA 2HFTA 3KPRE 3WUWB 3N42F 4TN9A 5E08L 2W38A 3KPQB 1NUFA 3QNXB 4I3RH 1TSHA 4PMEA 1OAYL 4HP5A 4NO0A 2LV4A 2ZXCA 3OVUB 3NIGE 1G7PB 3X3GH 4I7ZC 1FL3B 2YWYA 5DZ9A 3WO3B 3QEGH 2JF1A 4N8PA 5IROA 1ZOXA 3UZEA 1ZHLB 3PHSA 3RWDB 2ZD0A 2EEXA 2AAVA 2GJRA 2OQJA 1AGFA 2NZ1A 3UDWC 1X5YA 5FM8A 4BQCA 4U1KA 1I7ZB 4PD4K 3FULA 1JE6A 3V0DA 1QASA 1WICA 2WK2A 2XJKA 2VISA 5TF0A 2KKQA 3ECUA 2M2DA 3BH9B 3VGHA 3WKMH 1NGYA 2YBRB 1VACB 2X42A 3S4SG 4FXKC 5E03A 2NYKA 5C0BE 2HG5B 4FQ1L 2HJFB 4JG1H 4MRBA 3SBPA 3VSQA 4MZ3A 3WN5C 4N86A 3W9DA 1Z9SB 3BP5B 4WU5A 5JUEH 4OW6A 3BXNA 3Q5TA 3OPZL 3M46A 3K4ZA 5J6HB 2I07B 2YD9A 3QIWD 3WE6B 3HG1A 4M7ZB 3EOTH 4Z7IA 3QGVA 3SDXF 3SQOL 2VR8A 3DOSB 5IY5B 1JGLH 1QTSA 3VGEA 1XH0A 5DRXB 3W0WE 3O6LL 3GHEH 3SOBH 5J0BA 3AADB 4F57L 5G4MA 5D7IE 2UZIL 5C2BH 4PJDA 3HMXL 4V33A 4XO4A 3BSGA 5CN2A 5ESQA 1A9BA 2CM5A 2ICEB 3F2LA 3WFDH 3CFMA 3CC5B 1REIA 4ZMVA 1FFOB 1G1YA 4ANKA 2X2IA 5EO1B 5F97E 1SBSH 3QQ4A 1TSRA 1UCTA 3DPDA 1U8MB 1I1CA 3MLUH 4K0OA 4TRPH 1WAAE 2FT7A 2X6CA 1AKJB 3KM1A 4GW4B 3LY6A 4YGVA 5C0RH 5JYLA 1L9NA 5FECB 5A2BA 3HMWH 4PS4L 3ARDB 3IMVA 2WUCL 3IAQA 4X5XB 4GUPA 1EK3A 2DBJA 3F5WB 1B0GB 1BIIB 3AS0A 3AXLB 4NQEA 3QUXC 1RCYA 1T80A 1UENA 4JDVB 2N7BA 4HFUL 1AGBA 4W9IC 1V7MH 3OMNB 4LRNL 1CTOA 5ABAA 1KULA 3FN3A 5DVMA 2BOBA 3N1FC 3L3HB 1BD2D 1F13A 4QHLB 4IGBA 5AW0B 3TF4A 2C3XA 4E0RA 4NBZB 3T2PA 4Z7WF 2XWCA 4WCYL 1X4YA 4ZBJA 5F1NA 1UWGL 4HJGA 3PP3H 1BWMA 1JNLH 4X9FA 1IVLA 4OLEA 1T0NB 2ZUYA 3TTSA 5CEXA 1MW3A 2D31A 3KDPB 1BQUA 3RWJB 1KLFA 2GFBA 2Q1EA 2ATAA 3V6OA 4UNUA 1CDCA 4UTAH 4JFVA 5GS1B 3LKRB 5FLVA 1I8KB 5CNHA 1U91A 3C2AL 1R5WB 4UWQB 4YSUA 1P7QD 3SKNB 3EGXA 3PIQA 2YK1H 2F8VA 3VXOB 4ES8A 2R1WB 2PR4L 3B37A 1KELL 1JG9A 5EEWA 4J1UA 5IW6B 2E5EA 1BG1A 1BLNB 2NNAA 3SGJA 4ZX6A 2IC2A 1MHEB 1VFOA 4M43H 3MOBL 2R8SH 3GLAA 1ONQA 5D7EA 4PJ9D 4XPTH 1U42A 3FOLA 5TE4L 2FJGB 3T3PF 4DF9A 4ELKB 4ELDA 5J6SA 2CE6A 3KPLA 3VD5A 2W0FB 5FF6B 4RDBA 4J6RL 1FAIL 2MKLC 1W0WB 2H41A 4I13B 3QDJB 1M2VB 3U2IA 4AVIA 4BZ1L 1MFCL 1SXSA 3D85B 1KYDA 2UWEB 3QDMA 2UZXB 2DQFA 4AJVA 4LGSB 3ZE1B 1L5GB 4LP5A 1AD9A 3QORC 1KCSH 4WI4A 3PFUA 1E43A 1N9PA 3DO3A 3VWJA 2VRKA 3M17A 3T2QA 4DNLA 2OMWA 6PAZA 1RZKH 1NFDF 1O6SA 3A21A 2HPTA 3MRPB 2WQVA 1DN0A 5E0FA 5EFIB 3O9WD 5GHWH 3ZHNA 3VW3L 2R0WL 4OZ4A 3HUJF 2WQSA 1IO4C 4DEWA 2R2EA 2VAJA 4R5XA 5CXPA 3RYMA 3GK8H 4JFOB 2BIHA 3TIDA 3VH8A 5D2NC 2HVKA 1I8LC 2ZP0T 1LWRA 2QV4A 5G5DA 3A6CH 2MPAL 4PMFA 4WJG3 3THML 5TH2B 3M45A 4KTEL 5DA4A 2CSPA 2IO5A 2OCCB 3LZLA 4L1DA 3ZRCC 5A40E 2FR4A 4PJXA 4G72B 4BFEA 3RWIB 5IHZB 5CJQH 3EGSB 2ZOLA 5DD6B 3VI3F 1Y18A 3ZDXB 3TBVB 4NKDA 5I1JL 1HQRB 4R2GC 2G4EA 5JXEC 1T4KB 3K5SA 4JB9H 4NGHL 2H26B 3O4LD 2PXYC 2YPLE 2F8IA 3RUGF 2COQA 2JJUA 5KVEE 3MSPA 5ACMA 3CDFA 4KMTH 1MLBB 5C6TL 5DK3A 4TUKL 1F0LA 3WTWA 4HWZB 5JIPA 3VQ2C 1Q9KB 1M1SA 1IBFA 5ID0B 4ACTA 2P80A 2ZUWA 2CDFB 3OQRA 1V7NH 2FHCA 4YXLL 1JBJA 4ZDHA 3WL9A 4YC2B 1G4RA 1A3LH 5I8EA 3SPGA 2IWEA 1UEYA 3HRZB 4J3OH 2WMPB 2EE3A 3RTQC 4G8IB 3TJHD 4AC4A 2VDOH 3SPJA 4C56D 3U2SB 2ZWYA 2JLLA 5EU3B 1U8QA 1NQBA 4YSSA 1FDLH 1HC1A 4XWGL 1PG7H 4UIKH 4IS6A 1TEYA 4F1ZA 2BNRB 2FCBA 2MQGA 3G9VA 4JHZA 1PZ5A 3UPRB 1XR8A 4U3HA 3AZUA 2XIIA 3HAEB 4JM0A 4GG6E 2QLVB 3PPSA 2KERA 1NMAH 2DQIH 4L1SA 1IL1B 3SCMA 3VFRB 3ZL4H 4OF7A 3RBSA 5J57B 1BPVA 2O1AA 2OSLA 3C6SB 4CAGA 2MQ3A 3U4EA 3QISA 1KXTB 4ZPVA 3QXDB 3CFIC 1LO2L 4H0GA 3Q8EA 4HCRA 4LBEA 2J1YA 1SEQL 4WKZA 4R7NA 1SJEA 2BMKA 5KN5B 3ZE2F 1A7QH 1MJJB 1ETA1 3TX4A 1N59B 3WY1A 4Q89A 3RGVB 1V3KA 5C0CE 5ILTL 1LO3H 3MNZA 5HYJD 5EZPA 2CJSA 2A74C 2J43A 3UTZB 4GXUN 3I9PA 4MA1C 4FE9A 2VDML 1MQ8A 3MLXL 1T66C 5IMOB 4OJAA 5A43C 5CM1A 1NOFA 2FSEA 1CFQA 1SLXA 4CA4A 3WMPA 1VFMA 2CGRH 3UBXG 3BMWA 5AD0B 4NN7B 2O61A 5ACLA 4P3WA 1YN7B 2DWTA 2C3GA 1PQZA 3KLAB 4FQJL 4TQPA 5DD1H 1Z6JT 3GSVA 3VXSE 1O6TA 2VJXA 1IGYB 3W5MA 1DVZA 2VO8A 4JRFA 5DRZA 5E5LA 1BV8A 3MRDA 3FQTB 1EEZA 4XCEA 5I5MA 1MQKL 3QJHA 5HDWA 3DX9B 1Y0LA 4GBXD 2XN9B 1W15A 1XZ0A 2YKLH 4Y2DD 3O8XC 1S7RB 4BZYA 2VN6A 1YEJL 1PKQB 1MOEA 3C8HA 4MA8L 1HYRC 2BNQD 4BUHA 3B2MA 1TLMA 3ZBMA 4JPKH 4XGZB 4PB9L 1Q9OB 1GGBL 2DPKA 4H0IA 5D2LF 4HS8H 1YMMA 1OB0A 3M7FB 3N1QC 5KJRL 4E42A 1AFVL 3OJ2C 3ZHKA 3U30C 2X1QA 3R4RA 3UJTH 5SWZA 4MJJA 3OAUH 1P5VA 4CILA 5C0EA 4HCRL 3QCVH 1YUHB 2F5AH 4MNQD 2ZAIA 3IN0A 1WITA 4PHXA 5DQ9A 1NAKH 4NX0A 2Q6WB 4OVVA 4MZRA 1VGKB 1NDGB 4YPGA 5K39A 2YUZA 2ZUSA 3RY5A 2FDBP 3ILQD 4LLUB 1UT9A 4TNVK 2BIIA 5KSUA 1F8TH 3V55A 4XN1A 3IF1A 1RZFH 1PKOA 1DVQA 4A2GA 2EO1A 5CKAA 4GKLA 1LDPL 5ICZA 1MJUH 3QDGE 2P8LB 5D7LB 2Y5TB 3CK0H 1S7WB 3I75B 2XPYA 2EIKB 4PYHA 2XZAL 2AMUA 2I25N 3ARTA 4G9DB 3PWLB 3RIFK 1NICA 4JLRB 5EZIL 1NGQL 2EDWA 4OLWL 4QRAA 3RAJL 2F54B 2AQTA 2WWNA 1G9HA 3CVIH 3V4UL 3EJTA 3LX9A 3WFCL 2ATPB 4PI2A 5I1HL 3VACA 4WY7L 3V5DA 3N1GC 2E75C 1BQLH 4M6OL 1RUKL 2J73A 2XBZA 2N0MA 3BAEH 2IAMC 3FSZA 3ZDZB 3NZHH 2Z31C 2NTFB 4N68A 1HH9A 3UIYA 2YQ3A 5EUKA 3U0PB 3TA3A 4OQTH 4FQCL 1RLWA 1E40A 4NKIL 1YA5A 2D8KA 4PY7B 3L9RB 1U3HD 3SQBA 5J7CC 5F3HA 2EILB 2VUKA 3FO0L 4F37K 3MUGB 2WXJA 4NRXB 1KIQA 3P9WB 3K91A 3A22A 1X7QA 4PWIA 3BH8B 4Y4KC 1GZHC 4UUJB 2YRPA 3G7TA 4RGMC 5EN2B 4GAJH 4GNKB 4B9YA 5ECJE 3QI9A 1ND0A 3ULUE 4PJBF 4WFEE 2IQ9H 2RA1A 5JNYB 2V9UA 4LLDB 3MXVL 1QBAA 1ZPUA 4GP5B 1FUNA 3FQRA 4JREC 2O5XL 2VOTA 3DTDA 1E4JA 4BK5A 5IVXA 1XGUA 5KSBF 1AZRA 4O51B 3M8OL 1E5YA 5BS0D 3ECBB 1R24A 1ZV2A 4NNPH 3D2TA 3ZKND 3TURA 1AJ7H 4RZCB 3WFHA 3ALWA 2E6QA 1AAJA 3CFKA 3LZOA 5GGRY 1V5JA 4FNLH 2H45A 3U83A 4S0TD 1F6AB 4Y7MA 2UXTA 4GO8A 4QTIH 4QXTA 1XF2A 4Q97A 4LVNB 1MY5A 3DHMA 3RJDA 1YY8A 1DVSA 1MF2L 2J5LC 2BSRB 1L4IA 2E8YA 4Q74A 1NTDA 4X7DC 2AK4B 2XY1A 3C8DA 1CLCA 4L8CB 1Z0MA 1FZOB 4QMEA 1BJ1J 4YE0A 4WHDA 4NNYB 1MFEL 2RFXB 4WW2A 2X89D 4J23A 1DTUA 1IM9A 3T8XB 1CD0A 1H8NA 3NK3A 5DI8B 8PAZA 2F58H 2WOYA 5K1NA 1BBJB 1H6FA 3KW7A 5LNGA 4UAHA 2EXYD 1JRHH 1VENA 3V0WH 1S7SB 2R23A 4E9XA 2FYYA 1RZJL 3FQXA 2WXMA 4ENEC 3MV8A 4LSVH 3DROA 4DWHA 2R29A 2AXGB 1A7RL 4MA3A 4L3FA 1JPGA 3D87B 4HX1B 2LFEA 4CMHB 1VKXA 4XZ4A 4P23B 1QSFD 4I0PC 2AGJL 3AQZA 1YPZE 4UIMB 1LTXA 2F1EA 3BSHA 3C09B 4F2EA 5F88B 2N1KA 2G75A 3S98A 2QPSA 1U6AH 5F7WC 1QI3A 4RQQB 5FDWB 5HVFB 4WK4B 1G9NC 2P24B 1TFPA 2YPKA 1NINA 5ADPH 3U0TB 3ISYA 5ETUA 4NQDA 2IG2H 1W16A 3FSVA 1I3RA 1JIBA 2H47C 2WNXA 3ME0B 4JM2F 2WLNA 1S7TB 1PD6A 2X4NB 5IKCB 5J1TC 2X7LB 4PW3A 4CC4C 3LHPH 1QNZL 1P9MA 4AYBA 2I9LA 4PJHA 1DJGA 5K1JA 3BPLB 3B3BA 1QR4A 2A4CA 2ODHA 3WJLC 2J8UF 1RH8A 3UL4A 3FUDA 2NYYD 3H0TB 5C2UB 3CFQA 2ZKYA 4XBPB 2NX5D 1IM3D 4L4VE 1U92A 3MLWL 3H9HB 1TYJA 4AKPA 2OTUB 5DK2B 4EAEA 5BRZE 4FDWA 1HDMB 2EACA 4HLJA 4OLUH 3WUWA 5FFGA 4YSAA 4B9CA 3KPQA 3QNXA 1H3XA 3QRBA 3MPCA 1G7PA 3QIWB 1FL3A 2QPUA 2R29L 4UDUB 4EZJA 5L4MA 4MHHI 2VERA 4YHYC 1JPSH 1ZHLA 1ZWIB 3RWDA 4PJGB 2IBZX 4QYOB 1K2DB 2AXJA 2GI7A 1QACA 3VWKC 4YHNB 5KBKA 3D69B 2H0PA 4PJEB 1XGRB 3HN3A 1IB5A 3FF7A 1R3IH 5IESL 4CU7A 4R5TA 1CZ8L 3HKZA 4YSCA 2YBRA 5ES4B 5KS9E 3US0A 1VACA 1RFDL 1OM9A 2HG5A 5L7XL 2HJFA 1SMOA 1OO2A 1U8NB 1Z9SA 4K94C 4AYEC 3IMWA 4IBYA 4IDJL 3AG4B 5DJXB 5J6HA 2I07A 3BFWA 2BW5A 1QYGL 1EAPB 3UACA 3DOSA 2PW1B 2QFRA 6FABL 3SJVE 5DRXA 3WIHA 5I66B 3MODH 3D4GA 1BMGA 4OQ1A 2VSCA 1R4XA 4LU5H 2X44D 2A9MH 4BFIB 3GM0A 3ATEA 2Y69B 1BD2B 2RBLA 2BP0B 4OI9A 1X5JA 5I6KA 2W81C 5E56A 4A7GA 2ICEA 2HKFL 1FA4A 1UJ3C 3LH2L 1HVXA 3CC5A 1FFOA 1FFRA 5DQDH 2DQEL 5EO1A 3FBQA 5BOJA 1QABA 4IBQA 2WINB 1U8MA 2ZX7A 5DD5H 3TV8A 3MV7A 1AKJA 2DQHL 3NZUA 3BYYA 4GW4A 4F93B 5IIEB 4U7MA 4WI2A 1S78C 5FECA 2OW7A 4GQ9H 4YZFE 1UD6A 3ARDA 5BZWB 4G7YH 3WNKA 2E27L 4X5XA 4P9HC 3HNTH 1E7UA 3SQRA 4A2LA 3K2UL 2DH2A 3UTSE 3F5WA 1B0GA 1BIIA 4NPYA 3AXLA 2LU4A 4HG4K 1P7QB 4ZTOL 1T83C 4JDVA 3WTVA 5CEZD 5JW4N 1D5RA 2NY1C 4MA7L 5JORB 2YPVA 1OP3K 3L3HA 1SXBA 4QHLA 4OGXL 5FO7B 1P6WA 5GRUH 3HC4L 4AMKL 3OC5A 3NIGF 5GSVB 4KJPD 3QE5A 2DM3A 1S4IA 1T0NA 2L7JA 2YA0A 2JK5B 4AQ8C 2KI6A 1FG9C 2H2SD 1CLVA 2VABA 1NUNB 3RWJA 3WNOA 3NCMA 5GS2D 4M6ML 1AO7E 4U7KA 5GS1A 4PJ7E 3LKRA 3WIHL 1I8KA 3CN2A 1YNLL 1R5WA 2QVKA 2YD0A 3ZPDA 5CSZB 4LPTA 5EUOE 3VXOA 1OM3L 3PWVB 2MFNA 2R1WA 1IKFH 2WO4A 1SDAB 2UX7A 4OFKA 3DNKA 5B8CC 2L3BA 5IW6A 2H0EA 4DJMA 1BLNA 2MIZA 1YEKH 2ZXWB 1MHEA 5JPMB 5DLML 1FCGA 5HVHB 1M3JA 4OCLC 2EDXA 4X7FC 4BWTA 2AJYL 2FJGA 1GTNA 4DQAA 2C3VB 1WZLA 2ZSVB 4ELKA 3IKKA 4YFDB 2W0FA 1DVXA 4G6ML 4OFYD 5FF6A 2DYPD 35C8H 1T0OA 1W0WA 3TYGH 3QDJA 4DZBB 3P3UA 1M2VA 3K3QA 4RGNC 4Z7VB 2Q8BH 4A37A 4BRJA 2UWEA 2UZXA 5CCJA 1CBVL 1L5GA 4P99A 3FQ4A 2OMYB 2CDGB 2LAGB 4KH2A 2YXMA 1A02N 2YPVL 3ESVF 2AQNA 3TT1H 3US9A 3F84A 3O4LB 5HHQA 3MRPA 5EFIA 4F5CE 5I1CH 2KLSA 3E9UA 2WSPA 3FT9A 2K70A 4F15B 1QMUA 3MLTB 4JFZH 2IVFC 3PY9A 5EZOL 3ZQ9A 1UD2A 5A1AA 1I1AD 4JFOA 3DV4B 3V4VB 3OKYA 4XCNA 4NIYE 1KJ3H 2DEYX 3RX7A 4ABUA 2YGOA 2XBDA 4JFEE 4OM0H 3VU2A 2YKKA 5TH2A 5ENWB 1VCBC 1L0PA 4KUCD 1DBAH 4XNZC 2QVFB 4WENB 3P0GB 4PLKC 1I75A 1VGEL 5IHZA 1PCSA 2ENJA 2IGLA 3D39D 3EGSA 5DD6A 3NQKA 1D3CA 4C56B 1XWVA 2V7NB 3NSDA 3TBVA 3HZKB 4UNVA 1J1PH 1VA9A 1HQRA 1FFQA 3CHRA 4P2RD 3J07A 4EN3C 2HRLA 3WKYA 4AJYV 3OB0K 4FFZL 2H26A 4WLCA 5F21B 4Z7AA 1G7HB 1H3UA 2XVLA 2EDYA 3BUIA 1YJDL 3NEEA 3GMPB 1QHPA 1MLBA 4Q58C 4PJDE 1TQVA 4HWZA 1VAHA 1FJ1B 2YXVA 4TNWF 4WJ5B 1Q9KA 3T6QC 5ID0A 3ROLB 1OEZW 3B4NA 3MBXL 3VB8A 4EN2A 1JGVL 4KAQL 1RV6X 3UG5A 3ZN6A 1JF1B 4R96B 5CGBA 2CD0A 1AR2A 4XO5A 2Q3AA 5I8OH 1KGCE 3ULVH 3H4HA 1JNNH 2HT3D 2P44B 2EDTA 4YBQC 1QPKA 5CR8A 5AL8A 5E2VL 4P46C 3HRZA 3NTCL 3NJFA 2MNUA 2WMPA 3GMQB 4G8IA 2HJKB 3CQPA 3U2SA 3A67L 3LSOB 1LEKA 5HDQL 3EBGA 5EU3A 2HLFC 1X6LA 3LNHA 1J8KA 3RVWD 4AJWA 2X87A 4KVNH 5HYJB 4K7PY 3CFCL 4ELME 1I9EA 3ULVF 1L9QA 2BNRA 3RHWF 1BZ7B 3UPRA 5LBVA 2EIJB 1QPPA 3HAEA 4O9HL 5BRQA 2KS0A 1I9JL 2D3NA 2DRUA 1IL1A 2IPUG 4WEUD 3VFRA 1LO4L 4QRPD 2HJLB 5CUSL 1JDDA 1MHHA 4YHML 1IAMA 5ELIA 1QLEH 1R1CA 1ZDSA 1ASOA 3KMDA 4H20L 1BAFL 3C6SA 1F4XL 1ZTXH 3NSFA 1KXTA 1JHLL 1TJXA 1E8YA 3QXDA 4Z6AT 5E4EC 3SKJH 5FWQA 2EEDA 4XPBH 1NBVH 2EDLA 5KN5A 4GBXB 1MJJA 2Y5QA 3K6DA 4NJ9L 4Y2DB 1N59A 3BVTA 3RGVA 4S1DD 2V9RA 3NJVA 5BUPA 1EZVY 5JW4M 4FX5A 5DHMC 4I5BB 1XH1A 4JFFE 1WF5A 1ZTMA 4X5LA 2BNQB 3UTZA 3ORJA 4GRWH 1YRKA 5IMOA 4BJLA 4AWJC 5MENE 2A83B 2GHZA 3STLB 3V79C 1AI1L 1NCAH 1IC4H 1Q90A 1OP5K 3FQUB 4B7LA 4B9ZA 1RP9A 5EBMB 4IMKA 4UTBH 5AD0A 3GSNB 3IFOB 2LABA 1RKRA 1YN7A 5LQBH 1FWXA 1GCFA 3WHXB 1IGYA 5CLWA 1OE2A 2A7BA 3MJ7B 2C34A 3FQTA 2EDEA 1KB5B 2WQ8A 2VJ0A 1E30A 3DX9A 1HOCB 2XN9A 4AITA 1R3KB 1QBLH 3CVHB 4FMFA 3EYQC 1T1XB 4O02H 1S7RA 1DVYA 4LPUA 3QIBD 4PW9A 4OCRH 2HUHA 4XCFL 4G11A 4Y16D 4NZJA 3O2WH 1SVBA 4QHNB 4XGZA 5E8DH 4D2NA 3T6ZA 1Q9OA 3CPLB 1B3IA 1UM4L 1XGYH 2FLMA 4U1JB 4XN5A 5DJ2B 5CBAB 3MRLB 2JKWA 2WY3B 3ZYIA 5E2JA 2LU5A 2BH0A 2CO7A 1DVFD 3PJSB 4WI3A 2F1AA 3JWOC 2C9SA 3BQUD 3OAZH 1CXFA 5I24A 4WU7B 1YUHA 3VSUA 1GHFL 3UABA 2PWFA 2FGWL 5DFAA 2Q6WA 3CGTA 4TLKA 3KG5A 4JFHD 5DVLA 4MKMA 3QG7H 1EHKB 1VGKA 2JKNA 1NDGA 4GG6F 1N5YL 3ZY7A 3Q06A 4LLUA 1NBCA 4LHUD 3E6FB 5I1LB 3QUYA 1A0QL 3IJ8A 2AS5M 3NIDF 3SDDD 4UOW0 3L13A 4XN4A 3MRFB 2WN2A 4QD2E 4QXVA 4X4MA 4DN4H 1U3HB 2VT0A 3LIZH 2DJSA 2MOVA 3JVGA 4AZ8B 1OLZA 2P8LA 3A6BH 1SHSA 2Y5TA 5D7LA 3V4PB 3COOA 1S7WA 3V0EA 3I75A 2CJUL 5IVNA 1G0DA 2BRRH 4HUVB 1JHKL 5KVGH 3LQMA 3PWLA 4JLRA 2I5YL 1WC7A 2QKIC 4PJ6A 2F54A 1HEJC 3O41B 1ERNA 1KCRL 3U4KA 4F7CB 1XEUA 2ATPA 3CFEB 2Y6TE 4CBZA 4TSCL 5AW9B 4BFOA 2P5WE 2VW6A 2H1PL 2VAAA 4GRLA 3GBMH 3IMUA 1W6WA 2UVEA 4E68A 3NMEA 4J3OD 3MRMB 5ALBL 5FCUL 1HKLL 3CNKA 5GZOD 1XXFC 3BZEB 2NTFA 4DP9X 1S6NA 1AIZA 3U0PA 5BS0B 4O2CB 1MHPH 5T33L 1TUPA 4AKQA 4HOWA 3N85H 4DO4A 4PY7A 3CXFA 1PW3A 3L9RA 4GLRI 1OAQH 1Q94B 2A6IB 1Z3GL 3QPXL 1GGIL 1AZNA 3QXUA 4P05A 5GRVK 4NRXA 3D3VD 1R0AL 1SEBB 1FNEB 2FYVA 4KTDL 4LESA 4NO3B 3BH8A 4KO5A 5CLXA 1T21A 4ZOAA 4UUJA 1AQHA 5EN2A 4J3XA 1NH6A 3CFJB 3UG3A 4KXZI 4N9OB 3F85A 1OQOA 2FATL 3CG8A 4KQ4L 2V33A 4JX0A 1WUZA 4KJQC 2V5YA 1FNSH 2HLAB 5JNYA 1CYXA 4LLDA 4F24A 2AVGA 2ZKMX 4MFHA 3FMGL 2CHZA 4LVOC 4TNFA 5C0JB 4ILDA 3KBFA 2N56A 3LN5B 4O51A 3KWVA 5BW7A 3ECBA 2KUTA 5F7KC 4JRXD 3NPZB 1Z3RA 3CXHK 4FQXD 4RZCA 3WXVL 2Q3XA 5DO8A 1UXLA 5I15H 1F6AA 3TT3H 3LD8C 4Z0BH 4Y5XB 2EVGA 5I74B 4JM4L 3GLEA 3EDKA 3KLLA 3NSYA 2Q5BA 1RLBA 3QJVB 4FG6D 4KV5E 2B7DT 2CO4A 2BSRA 3I6LE 4GSDH 1THCA 4PJFB 2WPGA 2AK4A 2BCKA 1QSFB 1CE6B 4L8CA 5DD0H 1KIUB 4H5SB 5C0AE 3ZKMC 1ZCRA 1UUNA 1AY1H 2W91A 1FZOA 1MCLA 5IB1B 1IBZA 1O9WA 2ZPKH 4TSAL 2UXVA 1KB9K 4NNYA 3R19A 2RFXA 3N06B 5FDYA 3MC0A 3O6KH 4O5LL 3T8XA 1EERB 1IARB 5DI8A 4I2XB 4FEIA 2Z1KA 3PXJA 1BBJA 1JZDC 4ZS7H 5IM7B 4HISA 4U6YB 3ZSTA 1JZHA 1IE4A 1MDTA 3U4BH 4DIXA 2K3TA 1S7SA 3H6JA 1KCWA 3WU1A 4LE8A 4KHXL 1DR9A 4DP2X 2AXGA 3IU4H 4OCNC 2Z91B 4RWHA 6CGTA 3DX7B 3D0LB 2CBPA 3VXME 4EZMA 1KOAA 4PTTB 3BKYH 4QWWC 1BCIA 5E6YA 3ZTNH 3ULAB 4P23A 3UTTE 2NX5B 4JO2L 4HCGA 2OR7A 3L4CA 1IM3B 2YUXA 4D9RD 3TASA 4UIMA 1UACL 4ZPTB 2VC2H 3CD4A 5F88A 4G6AC 1X5AA 4GJTB 5JDSB 2WD0A 3BDYH 3Q13A 4RQQA 5FDWA 3AC0A 4L4TD 2P24A 1XBDA 3U0TA 1B6DA 4TSBL 4JRWA 3L08A 3GJFB 4Z3JA 3M1CA 1JWMB 3K80A 1B88A 4EBQL 5IF0B 4G6JH 3ME0A 2PWHA 1YEFH 4BHUI 1NGPL 1OGPA 5IKCA 1S7TA 2X4NA 5J12B 2A6JB 5SV4A 2X7LA 1CDJA 5EG6C 2BPBA 2OYPA 3TEWA 4PV9B 3KJ6L 3BLBA 2E6PA 4E9QA 3HNVL 3H0TA 2QSVA 4TTGA 1MCIA 4UOJA 4HMDA 4XBPA 1N2RB 2WWKT 2VDRH 1I8IB 5D55A 3QWRD 2PP7A 4A7QA 3TA4D 1DFBL 3HC3H 3H9HA 5FM5M 1CPUA 1CTMA 2NTSP 1MJ7L 2OTUA 2QSCL 5DK2A 1K6QH 3WIIL 3WEBA 4EZKA 7FABL 4I3GA 1FVEB 5F8RC 5B1AB 3GO1H 2VDKL 4JVPA 4N0UE 1IBGH 2HG0A 5F7FA 4OH2A 4KK9C 5DZJA 3RVVD 4DK5A 5DJZB 4KKCD 4EF3A 4AH2B 5DO2C 4ZTEA 3QIWA 4AUUA 1V54B 1J1XL 2ENSA 2DL9A 3FCSB 2QPDB 1UB6B 4JHAH 4UDUA 1FNHA 1NLBL 1PFOA 2QFPA 3JWNH 3AWFA 4N0YH 5GPRA 1ZWIA 4ES9A 1YC7A 3IT8D 4PJGA 3PNRB 4QYOA 1K2DA 4FNPA 2EDJA 4YHNA 3D69A 3I9GL 4PJEA 1XGRA 2WXHA 1IGCL 1SN5A 3AQDA 1CF1A 1KLGB 3QNFA 4NJAL 5IQLA 4GKSB 3B9AA 3HI6H 2O6CA 5AZEH 3S3BB 5C6PB 4URTB 4WTXA 4MTMA 4MAUL 1KT2A 1VPOL 4A2EA 1ZLVK 2G2RB 1XR9B 1IKNC 1KYOK 1U8NA 3OHXB 3U9PH 3VSTA 4XN9A 4U1HA 1FBIL 1IEAB 1TKWB 3GMRB 4QXWA 2HVJB 2LU3A 3D30A 4M8VA 4PLOB 5DJXA 5LCVA 1O7DC 1LEIB 4GFXA 3UAJD 3P2BA 4F7MB 4YDMA 1QW9A 4JFQB 1DE4B 2J25A 3VFMB 4M6NH 1JWSB 1G6RH 1YPZF 1JK8B 2J1XA 4KHTL 1EGJH 4BFIA 3O3BB 3WE1A 1BD2A 1JYVA 2BP0A 25C8H 3MV9D 2A1WH 3EXLA 4TQEH 2FH8A 3BMVA 1WSST 3QAQA 4UU9B 5JO5B 4LLYB 3INUH 3BE1L 1H15A 1MREH 1A22B 4EDWL 2WINA 3HNSL 2VXUL 1J5CA 1HL8A 1L7IH 1TJMA 4UB0L 5IIEA 3LMJH 1AHWB 3FYEB 1P2CB 3ZZ1A 1NL0H 4GEJA 5AUMB 4HWEL 5BZWA 1QVOB 4UANA 1MFAL 3MRBA 1MFBH 3R1GL 1ED3B 1GSKA 2WKOF 3LQAC 1P7QA 4P2QD 5IJDC 5EF1A 1IGFH 5M95B 2XQYG 3Q1EA 3NH7H 5JORA 1TQTA 4ALAL 4MMZB 3VVVA 1LK3H 3NFSH 3MV8E 2AEIT 2N01B 2Y2WA 1WT5A 3HE6A 5FO7A 3KGUA 5LKNA 1BLIA 5IW3A 4YX2H 1KENL 3BPOC 1WRFA 1FCCA 4KK5C 5EO9B 5KVFH 2JK5A 3FFOA 2DYPB 4S1SL 3RQ3A 1WFUA 3B2PA 4G6KL 5LCVL 5KYXB 4Y1AE 1XCWA 4PGCB 2VUOA 1N0XL 4M7KH 4DHLA 3DXAD 4UQ9A 5AENA 4RDQF 4DKEL 2IH3B 1QFWI 2XKSA 4G8FB 4NQDE 5CSZA 5EF2A 3PWVA 3QAZC 2X6UA 4LMQE 3CCHB 4P2AA 3FPYA 3B7SA 5JPMA 5KANG 3GRBA 4X6EB 2PN5A 2C3VA 2ZSVA 5DMGD 4HWBA 1Z9MA 1I1AB 2R1YB 2XTJE 3MLVL 5IMKB 3B34A 5TDNB 1J5OL 5MI0C 1KGYE 1G4MA 3OL2A 4L5FL 4V2CB 5HD8D 4ZAKC 4XPHL 1UT1A 1IEBB 3K1DA 4DZBA 1LHZA 3LNEA 4U3XA 2NZ9C 4AM0B 4Z7VA 4LIQH 4R0LB 3WO4C 3DLQR 3NAAL 3B6SB 3D39B 3GSUB 4RFOH 2CDGA 1WK0A 5TQ0H 4P2RB 1XGTB 5MHSE 5ISZD 1FSKB 3D4CA 1YN6A 5I6MA 5E08H 4JZNB 3O4LA 2BVEA 1RPUA 4KK8C 1OAYH 5DS8B 5DU7A 2L7EA 4FF9A 1BZOA 3WEOA 2E46A 2K7PA 4ZD3L 1MJ8L 3FZUC 1QW8A 3MLTA 4G5ZL 4ZUUB 2ROXA 4ETYA 2DB8A 3P3RA 4P9HH 2CRMA 3V4VA 4DFHA 4KI5D 1SZNA 4QXGL 3TL5A 1TZAA 3K46A 5BVPL 3RKDC 1UM6L 4YHZH 4HJEA 2R7EB 5GSRB 5ENWA 1J11A 4PS7A 5DYOB 2CO3A 5C09E 3TOPA 5C7XH 2AQ3A 1NWOA 2DN7A 3ZYJA 5JOPE 4C56A 2V7NA 5M94B 3HZKA 2JFCA 4D8PB 1PFCA 3FJTA 3OMIB 1KN2L 1G7HA 2WXOA 5GRVL 4BRVA 3GMPA 4TQIA 4A39A 4N26A 4K3GA 3GMNB 3DOIA 4HGMA 4HWBL 2B39A 1DQQB 2GBUA 4N2KA 5L9DL 1FJ1A 3O6FD 4WJ5A 3OKKA 4YH6A 3ROLA 5B4MD 3O6LH 2UXGA 3BD3A 4NQQA 4PJ7F 3FTXA 4UTCA 3HR6A 2UZIH 4QRPB 5HJBA 1JF1A 3HMXH 4R96A 5I8CB 3AGVA 5E8NB 4OM1H 2GK0B 1JD7A 3ZDYB 4G2AA 5FO9B 2ITEA 5KBNC 3FT0A 3TNMB 2RR3A 1WAPA 3ZKSD 3ARBC 4OZHB 4AUJA 1P4BH 2VLRD 4I48A 3GJFK 2HJKA 1NPNA 3S37L 1BJ8A 3Q44A 5CO1A 1OL0A 4X83A 4WWKC 4DT2A 2FEEL 4I85A 5HYJA 3EYSH 3TN0D 4B27A 3G6JF 2K9FB 1BZ7A 4N2NA 2BSED 4QGYA 3V4VL 3EUDA 3SPVB 5J8OA 1DO6A 4GAGH 1MRDL 3OAYH 4BSVB 4P4RA 3VD4A 2EO9A 4M02A 4FFVD 4XMPL 1PBYA 2BCMA 2DBLL 2WXGA 2NY5L 1HZHH 3IXAB 2FX9H 1CFNB 1MI5D 1OAKH 4DAGL 1DZ0A 2HJLA 4JHBA 4UT6A 3BP4A 3QFGA 5ERWB 4S1QH 1ZMYA 3CSBA 4JCLA 2B14A 3EAKA 4XRCB 4LXFA 1UWGH 3NIFB 1D7BA 1JVLA 5EU6D 5D5MB 2X0WA 1AXSB 3DV6B 4GBXA 4YFEA 5FR3A 4FLRA 2IPTH 1UADC 4Y2OB 4FFYH 4XP6L 3CFBB 3QIBB 5B7EA 4UZGA 5BZDB 1QWUA 2PCFB 3QZBA 4Y16B 7CGTA 2BY0A 2BNQA 4K3EL 3C2AH 1UHVA 1CL7L 4NC2B 4GKZB 2PR4H 1V3LA 2A83A 1KELH 5K93A 3STLA 3GHBL 4AGMA 2V5SA 3SKMB 5F0PB 3FQUA 1QSED 2XXFA 5EBMA 5H4ZA 5KAQF 1FFTB 5GJTH 4M93C 1DVFB 2E7HA 1SM3L 4XT1C 4HLZG 3IFOA 1NMCB 3BQUB 1ZLSL 5TE4H 3WHXA 3OB8A 4I87A 2X0VA 5MEQB 3AXIA 3MJ7A 1EDHA 3GZPA 3O0RH 4ADIA 1OXYA 5KANI 4PJDF 1KB5A 2RQ8A 4M7LH 3G5VB 1FAIH 1HOCA 1I1YB 3B1TA 1R3KA 3CVHA 3OZ9L 3EGDB 1T1XA 4LHUB 1Z9NA 5LBGA 3WELA 4BZ1H 1MFNA 1MFCH 3BT2L 1IC1A 3SDDB 3LEVL 3VXQB 3MLZH 3UTPE 1AGEB 4QOKA 5AVVB 4FC3E 3RB5A 1GS8A 5IT2L 2OI9C 2VB5A 1JTPA 2A6KB 4QHNA 5KVDE 2BW4A 3CPLA 4U1JA 5DJ2A 4EQ2A 5JHLA 5CBAA 3MRLA 5LGHL 4LLQA 3SDAC 2BSDA 2Q3ZA 3PJSA 4DZ8B 3L4WA 1P4UA 1K8IB 2VWEE 3QUXD 5AFAA 4WU7A 4YHPB 4P57B 1T0MB 4AIXA 4EVNB 4M9PA 3BN3B 5ANME 3VFNB 4AL8L 4LCWD 2Q7AA 2G0LA 2X3AA 2D9QB 4HD9A 3DTXA 3ESNA 2VDOB 4LLVB 3ESOA 3E6FA 4KTEH 5ESVB 4M7JL 5I1LA 4NERA 4RBPK 2XWEA 5HGHB 3F58L 3PABA 1BECA 3MRFA 4YK4C 1INEL 2JE8A 4XE5B 1U3HA 5DHXB 4AZ8A 5I1JH 4G7SB 1SGKA 3D3VB 4J4PC 4NGHH 2GQHA 3FUHA 3ZL1A 4HUVA 2GEQA 5JLZA 4OJYA 3QH3B 1NIBA 3WLBB 3O41A 4F7CA 3HG0A 5C6TH 3V0IA 3CFEA 4TUKH 4EO5A 1HINL 5H37H 2DLFL 2OYLA 4CW1B 3M6DA 5INCB 5DSCB 1WWBX 3CVHL 3FSOA 3Q8AA 2IGTA 4JO5A 1AH1A 1PZ2A 1RVFL 3MRMA 1KCBA 1WZKA 4XR8C 2O93L 4G7VH 3K74B 5LHDA 1M1XB 5IFHL 3O4OC 4O2CA 1Z5HA 5BS0A 4JRXB 2G0KA 4FQXB 4LP8A 3VDBA 4OLVH 2YEQA 4B96A 5JHLL 5D4HA 2EH7L 4KVPA 2ZUTA 5ITBH 4TF4A 3JV0A 1Q94A 2A6IA 2HTKC 5I19H 4JZJB 4ODXB 4JHWL 3NOIA 1KTRL 4RETB 1SEBA 1FNEA 2NQDA 4H8WL 4NO3A 5HVGB 5IB4B 1MW2A 4XWGH 3V2AR 5DZLA 1MCPH 3JBG7 3SN6N 1CD9B 3QORD