4BWUA

Three-dimensional structure of the k109a mutant of paracoccus pantotrophus pseudoazurin at ph 5.5
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPAKARERMDAELAQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Exploring the Surface Determinants of Paracoccus Pantotrophus Pseudoazurin
rcsb
source organism Paracoccus pantotrophus
molecule tags Electron transport
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4bwuA00
3X1FA 2EIJB 1A4CA 3V9EA 2AANA 4AX3A 1J5CA 2J56A 2FQFA 2VMJA 4JHUA 2BW5A 3FU7B 1ZIAA 5B7MA 5PCYA 4HCFA 1MG2C 1XB8A 2XV3A 1PZBA 2QPEB 3NJMA 1PY0A 1GSKA 3FT0A 5ANHA 4DP7X 6PAZA 5I6NA 1KCWA 3NJNA 4CSPA 2DYRB 2YAQA 2J57A 2JKWA 3FU8A 2H5UA 3PAVA 3UAEA 4A2EA 1OCOB 1WA1X 4WKXA 2FT6A 3UADA 2X88A 1BYOA 2EINB 4Q89A 2UXFA 3ZX1A 1ET8A 2I7SA 1ID2A 5LDUA 2XX0A 1BYPA 5A7EA 3IEAA 3ABKB 5I6LA 2QDVA 2B08A 2GC4C 1ASPA 1YLBB 4YL4A 3OMIB 2ZXWB 3MX0B 2FQGA 2YXWA 2XXFA 1IBYA 4AZUA 4UAHA 5D4JA 4MFHA 4KNSA 4KNTA 2VW4A 1SDDA 3FYEB 4GP5B 5PAZA 4F2FA 2ZOOA 1BAWA 1BXUA 4PCYA 3JTBA 2LLNA 1PMYA 3ZDWA 2GBAA 2XX1A 1E67A 4QKTA 1KDJA 3OM3B 3ABGA 4A2FA 1L9PA 1W8EA 3AG1B 3H4FA 4UF7C 1V55B 2X87A 3NSYA 1PLCA 2NRDA 4KOCA 2CAKA 1JXDA 2W88A 1BQRA 3NJKA 3FQ1A 2HX9A 1W6LA 1SDDB 5I28A 3FSVA 1TEGA 4YSAA 5B7FA 1AS6A 1A4BA 1HFUA 1EHKB 1GY1A 2YAMA 4TXVB 1CYXA 5AKRA 3SBQA 2XWZA 4E9QA 2H47C 2HLEB 2OV0A 2CBPA 4G7QB 1ASQA 4GP4B 1J9RA 2Q5BA 1WS8A 1GS6X 2BP0A 3S8FB 4BWUA 2MRYA 1PNDA 1PLBA 4NAJA 2UX6A 2FT7A 1HAWA 2EIMB 1OCCB 2BZCA 3NJGA 3X2QB 1NPNA 1QNIA 4W9ZA 5I5MA 3L45A 3TASA 1J5DA 1A8ZA 3NJJA 1MZZA 5I6PA 5D4IA 1AZRA 2Y69B 1OCZB 2PCYA 1UATA 3EH4B 2PCFA 4G72B 1WA2X 1ILSA 3NJIA 4GP8B 1BXAA 1KDIA 1PCSA 2BP0B 2J55A 1JXFA 3D12B 2DV6A 1VLXA 3X1GA 2PPCA 3QQXA 1OCRB 2OJ1A 4BXVA 2VN3A 1AANA 4BWTA 1JZFA 1IBZA 1NWPA 1MDAA 4YSQA 5FC9A 4YVNA 3CDZA 4A67A 2WSDA 1L9TA 5AZUA 3FQ2A 2GC7C 2BP8B 2YAEA 3PAZA 2YQBA 1A65A 1OOWA 5IY5B 2TSAA 1JZEA 4Q8BA 1MZYA 3EH3B 1IUZA 1ZIBA 3WNJA 2CCWA 4A2HA 5I6OA 1V10A 1AQ8A 3NJLA 1RKRA 2Y1AA 1SFDA 3JT2A 2AZUA 1NIAA 2XYBA 4P5SA 3UACA 1HAUA 2GB2A 3BQVA 1CURA 3V9CA 3FPXA 1SHWA 3T6ZA 1L9QA 2QPDB 2N0MA 1N70A 2I85A 3CDZB 1OE1A 1A4AA 3NT0A 3QJUB 4KO7A 3AG4B 4L0PB 4DP5X 3NP4A 4F7KA 2ZONA 4E9XA 4P5RA 1JZIA 3S8GB 1KYAA 4DP6X 1RZQA 2MTAA 1L9OA 1URIA 3UAAA 5EHFA 2JFCA 1IC0A 3X1BA 5E9NA 4QLWA 4N8UA 3HB3B 1AR1B 3NJFA 2IH9A 2JXMA 4DP2X 1KBWA 4DP1X 3QJRB 2H3XC 1E30A 1SNRA 2RACA 2AZAA 1ADWA 1PLAA 1JZGA 2I7OA 2BO0A 3FSZA 5I6KA 2FNWA 1JERA 5I5JA 2PPEA 2IDQA 1AAJA 1AACA 1AG6A 1J9SA 3QPKA 3EH5B 3FPYA 3WIAA 4M3HA 3PXLA 1M9WA 1ET5A 3NSDA 5I6MA 1AZUA 1NIFA 3IN2A 1NICA 1ET7A 3MBWB 2IDUA 1WA0X 1J9QA 2FWLB 1CC3A 2WO2B 1SF5A 2VW7A 1OE2A 1MG3C 1V54B 1CUOA 4M4RB 1IKOP 3EHBB 4KOBA 4A2DA 2IAAC 3IN0A 4W1TA 5I5IA 1PNCA 4HZ1A 2YAFA 5B3SB 5TK2A 3TBBA 1TU2A 2EIKB 4FAAB 2YAOA 4BXSV 1PZAA 1X9RA 3WI9A 1AZNA 4G71B 3SQRA 4A2GA 2FJSA 2WO3B 1JXGA 4YSRA 4FA7B 1RZPA 4N4YB 4BDVA 2E86A 2BW4A 5B1KA 2XV2A 2DWSA 3WKPA 4DP8X 2IDSA 1NTDA 4BWWA 4KO5A 3TA4D 1NINA 3PAUA 4E9TA 4E9WA 3CVCA 3CVDA 1X9UA 2W8CA 5AFAA 2HX8A 2GI0A 1EZLA 2VW6A 3S3BB 2GSMB 1A3ZA 3AG3B 2AVFA 5B1BB 4YSEA 3ABLB 2BP8A 3ERXA 1FWXA 4HAKA 3UGEA 3QJSB 4DP9X 2XXGA 2DYSB 4ENZA 4BDVB 1XB3A 1WAEA 2P80A 3KW7A 2FQEA 3NP3A 1E5YA 2A3TA 1AS7A 1SF3A 3SBRA 2YXVA 4AKQA 2HRGA 1M56B 1E65A 3PCYA 4KO9A 2FTAA 2Q9OA 4EF3A 4NERA 5B7EA 3U25A 3OQRA 3S3DB 1I53A 1PF3A 2BHFA 4YSUA 1SHXA 3T71A 1DYZA 4PAZA 3T6VA 7PCYA 2PPAA 2UX7A 1TEFA 1N68A 1KV7A 2IDTA 2CALA 3NSFA 4YSDA 1XB6A 4HHWA 1ZDSA 1JVLA 1AZCA 2IWKA 3AW5A 2HX7A 1B3IA 3KW8A 3SBPA 3FSWA 4GY4A 3FYIB 4DPBX 5F7AA 1W6WA 3FS9A 3FU9A 1NIBA 3AZUA 2XLLA 4E9RA 1SFHA 3GDCA 3QJTB 5F7BA 7PAZA 2YARA 1BEXA 3TU6A 2IWFA 3CZUB 1GYCA 4G7SB 2PP7A 3EF4A 4G70B 4X4KA 2XUWA 1NDTA 3S3CB 1CYWA 4F2EA 4E9VA 3PPSA 2FQDA 2UXGA 2HXAA 3FSAA 5B1JC 1NIDA 2XV0A 2R7EA 4UANA 4HIPA 1GY2A 2CJ3A 1KCBA 3RYMA 3ZBMA 2QT6A 1PAZA 2BZ7A 3X1EA 2VM3A 2OCCB 3TBCA 3WNIA 1PZCA 1GR7A 2TSBA 4GYBA 4JHVA 1AZBA 2DY2A 3C75A 4YSPA 2PP8A 2DWTA 1XMEB 4HCGA 3QJVB 1L9RA 2PP9A 4E9YA 1TKWA 4E9SA 1JZHA 3NYKA 2XVBA 1ZPUA 4DPCX 2R7EB 3ABMB 1M57B 1JVOA 2HRHA 4JKNA 3PLYA 1ILUA 5B1JA 4AKPA 1NIEA 1R1CA 1AIZA 2BWDA 4KNUA 3ASNB 2J5WA 2ZWNA 4NB7A 5B1AB 2AFNA 2XU9A 4YSOA 1ASOA 1FFTB 4YSTA 3FQYA 1BQ5A 1SJMA 3DTUB 4G7RB 3X1NA 4DP0X 4HHGA 4A68A 1AG0A 2IH8A 2GHZA 3ASOB 3NJHA 4DPAX 3BVDB 1BQKA 3UABA 3T6XA 1JOIA 1ETJA 3QJQB 5D4HA 3ZIYA 3OMNB 2YAHA 1GW0A 2IDFA 2HZHA 4CSZA 1AOZA 3CG8A 2VSKB 2BWIA 9PCYA 3NSCA 4KO6A 1KGYE 2YAPA 4DP4X 3IBOA 3CVBA 4HALA 3T9WA 1FA4A 1ZDQA 4WTQA 1GS7A 3AG2B 4BK5C 3GYRA 4YVUA 1GS8A 3WG7B 2PPDA 1NPJA 6PCYA 4YSCA 1OV8A 3H56A 3OMAB 5I26A 1F56A 1J9TA 1JZJA 2GIMA 3T6WA 2B3IA 1QLEB 3H4HA 3IE9A 2UXTA 4HCIA 3OD3A 3HEIB 4ZK8A 1T5KA 4GXFA 1BXVA 1AS8A 1OF0A 1OE3A 1QHQA 3N2JA 3GXUB 1NWOA 1L9SA 2P80D 1WS7A 2UXVA 2VSMB 3FU7A 1NZRA 2PLTA 4AI7A 1DZ0A 2QDWA 5TK4A 3WKQA 3DIVA 2FT8A 2CUAA 4A66A 2EILB 1ZV2A 3DKHA 8PAZA 3N55A 3AY2A 4AKOA 4K9JA 1KBVA 1RCYA 1E5ZA 3G5WA 2VM4A 4RH4A 2IWEA 4YSSA 2PPFA
chains in the Genus database with same CATH superfamily
1TZIA 5F9JA 3HS0B 5ACZB 2NY0B 4N0UB 4DUVA 2DQDH 3LEYH 4KRNA 1QG3A 1NJ9A 4R96B 4XPBH 3RPIA 2J56A 2VMJA 5EU6B 4Y9EA 2O5XL 5DMGD 5KSVB 1MG2C 2XV3A 1A7NH 3RY4A 2QPEB 3WNKA 1GSKA 5LKNA 3B7TA 2UWEA 4OCSL 2BNRE 4S11A 1I7UA 1QNZL 4MA1C 3QIBB 3MX0A 4YHPA 5EDSA 1S9YA 1IFGA 4YIQB 3ARVA 4LLVA 4KXDA 4LCCB 1A3QA 5CCKH 3DJSA 4Q89A 2WJ7A 1E6JH 3GM8A 3BZ4B 2AF2A 1P7HL 1GZPB 3P2TA 4YE4L 2PCXA 4BEIA 4C54A 1I7TB 3BZDA 4Q6IC 2F5AL 3FT3B 3QO1A 1GHFH 3UZQB 5JXAL 3NCFB 4WAFA 3QK0A 4N0FB 1AH1A 2WLIB 3SCMD 1JHKL 4P2QE 5IVOA 4KNTA 2FB4H 3OAUL 2HJLA 3AS1A 2A6KA 4JFDD 4L2LA 4M3KB 3TO2B 5IB1A 1YNTF 2CLRB 1T3FB 2ERJC 3FQXB 3OB8A 4WUUE 4P23C 3BAJA 1TQUA 3LHPH 4DQOH 4HSCX 4JFWA 3CDCA 4R8WH 3KE0A 4YXLH 5C0EA 2OI9C 2YD8A 1PG7X 3H4FA 3MODL 4NN7C 3FCTA 2VXSL 1IZKA 1MF2L 1IV8A 5IREA 1BQRA 2WUCH 4Q6IA 1EUTA 3AREB 1OARH 5E95B 1RSFA 4B6ZA 1UM5L 3VSTA 1EEZA 4ZMYA 5EF2A 1RZKL 5LAXA 1HFUA 3SOBL 3ULAB 4XC1H 1I9JL 4R97C 2MOQA 5A40E 5CIPH 4YBQC 3G6DL 4XP1H 1C5CL 2R8SH 2X10A 1JF5A 4NO5B 4F9PC 2PW2B 4GMSH 3OHXB 4P23A 5JMOC 3PV6B 2ENJA 1AZZC 2D7MA 1MIEH 2FIKA 4DEUA 5AB9A 2QQNH 2GI7A 4PJXB 2XCMC 4LSRL 1YY8B 2ZNWA 1VGEH 5FYLL 3RWCB 3KWVA 5ALBL 4ZXBC 4MXQC 4JS7A 3WFDL 3EJYD 3MJ8B 4K15A 4GAGL 4IBWA 1ZHNA 4MAYD 4X6BA 1JN6A 3IDMB 4QOKA 3SDAC 5C3TA 5EH1A 1M71B 1OO2A 5GRXG 1FDLL 2JTDA 4A39A 1BAFH 5I66B 3K3QA 3U7AA 4MASA 3UTSD 3BVTA 5LGHH 3PABA 3LPFA 4LPXA 3P9LA 1SHSA 3LSOA 5CD5C 2QPFA 4S2SB 4LSUL 5SWSA 4QO1B 2X2HA 3GTNA 2CK0L 4PRPB 2PCFB 1JPFA 3HNTL 5FDYA 2H2SC 3RX5A 4ZXBA 3O3DB 3FFCD 2ZJSL 4FQXC 4ECNA 4MS8D 3ZZSA 1FCGA 1XAKA 4WWPA 1L3NA 1YJDC 2DYPB 4QTHA 4GXVL 1UKTA 4YQXH 3GIVA 4ABVA 4N5UA 3SDAA 5CEZH 3U0WH 4MXVF 5LB1A 3T8XA 2K1MA 4DK5A 3MNVA 5SV4A 3NA9H 1IAIL 3SE8L 2V2TA 1FZKB 4AQEA 1OT1A 1O0VA 4DAGH 5F9OL 1R3KB 4IYKA 2AQSA 4JN1H 5F6HJ 3UG4A 3FCSA 1L9QA 4KQ4H 4FQQA 2QPDB 1UZ8B 1VCAA 5E5LA 2EVHA 1J0HA 4ZOCA 1I3GH 3R06A 3LPOA 1X5YA 1FG2B 1X9LA 3C8KB 4I4WB 5MEND 1I82A 1C7TA 3K5SA 3MDJA 3LS4H 2NW3B 3C60C 1HWHB 2R2BA 5E5MB 4APXB 3TCXA 3SGKA 3CN4A 5EU4A 1NBCA 2KPNA 2DKMA 4FQXA 4X9GA 4L4VA 3FB8A 2QGEA 2CIKA 1EANA 2QELA 1OPGH 1KBWA 3GSOB 4R0LB 3V0HA 3WHE0 3KGRA 3EYFB 4LSPH 2C3WA 2I7OA 4HQQL 4XZUA 4DZBA 3OGCB 4BV1A 1OM3H 1ZANH 1S7WA 3ULUF 2EABA 2IANB 3INUH 4PGBB 1AC6A 3OQ3B 4WFEE 1VEPA 3FPYA 3MLVL 3CCHB 3MRDB 2DMHA 1LNUA 3EUUA 5FOJA 1C5BH 2AGJL 4JG1H 4YO0B 5HHQB 1FL5A 4AOFA 3C60A 1MFAH 2GJZA 3KYNA 4OB5L 4X9FA 3C6EA 1CC3A 3ESOA 4XO8A 2YXMA 1RURH 3HI6L 4Z0XB 1PYWA 4GAFB 1Z9PA 5CZVL 2OCFD 1P2CA 1PNCA 2Y07H 2X4UB 3LN4A 1KTLA 5GSRB 1DFXA 2VLKD 5TK2A 1M2VA 1TU2A 3IDIB 1PD1A 3KJ4C 5DZPA 4L1BA 5T3XE 1JV2A 2X70B 3ZU8A 3PNRB 3MFFB 5KYXA 3ELQA 3VU1A 1DUYA 1BVNT 1V8HA 4RMTA 5D8JL 2YIHA 2ATKB 2YD4A 2X2JA 3SKOB 1NINA 4QGYA 2QL1A 4UM9D 4J2QA 4F7MB 3ARGC 1TIUA 1AE6L 2YC1B 5IG7A 4F2MB 1F4XL 3L6FB 2YEQA 1CFBA 3CSFA 4F58H 1KIPA 1PVHA 2WXOA 4XOCA 1BPLB 3MI6A 3E80A 2ZG2A 3CQFA 3LQZA 3DV6B 3WFBH 4XWGL 4ZNEA 1Z9MA 1HHKB 2WIMA 1MXDA 1B4JL 1HXYB 2PYFA 3G5VA 5I0DA 1P5UC 1TVHB 1E5YA 4NKOA 5CU9A 4HK0A 5KVGH 1WGOA 5J6GB 3X3GL 3NABL 2VLJA 1UCTA 1XCTA 3D25B 3PJSA 4YGAB 3GXFA 3ZTNH 4AMKL 4GG6F 1UXLA 3PDGA 1ORSB 2JTYA 4JFEE 4XB8A 4PGCA 1Y18B 1P5VA 3QEGH 4FYSA 3R8BB 1SYSA 1MWAB 5DGQA 2GK0B 3ARGA 3AFLA 5KW9L 4G6ML 3B7SA 4WVRA 3RWJB 4FS0A 4HHWA 1T22B 1XTLA 2IWKA 2VTFA 4YHLH 3C6LD 5CIPA 2M1KA 1KGJA 1CFMA 3FFDB 4X80L 3X11A 4JQIH 1MCSA 3QNZB 5DJ0A 1J7VR 3ZN6A 2P5WE 4LIQE 4ANKA 2CHWA 2DQCH 3OZ9L 4FL4C 4UMSA 4YE4H 1P5UA 5K59E 2OMVA 4HUUB 2GTQA 4PSRA 1E3XA 3BGMB 4U1GC 4G42A 1IM9A 5I18L 2JE8A 1RQ5A 4PI2A 5F96H 7PAZA 1A1NB 1T6BX 4J3OH 1F02I 5AB1A 4K3JL 1F6FB 2YEZB 4O2FB 2J5LC 3EG9B 2NT1A 2D73A 2P24B 3OAUH 1VACB 5GHWL 4X4KA 1WFOA 4XVUD 5L2KE 5HYJA 4U1MB 2Y7OA 4JB9L 4GO8A 3ILQC 3QUKA 4AEHL 1ZT4A 2YD9A 1LXMA 3EYVB 4LKCA 4WSKA 4Z95L 4YLBA 3L2LA 3TA3C 3ZIMA 2LFGA 2X4RB 1BQUA 4OZGA 4YNYA 5DJCB 2XPGB 5BS0D 1HHJA 3LZPA 5H2BA 1F97A 3MGTB 3QEHA 1BZ7B 3MODH 1BFVL 1F1GA 1R5VA 1GOFA 3EJZD 3LXUX 4GW5B 4HS3A 2OMZB 5BZWB 2VXSH 1NCCL 2A9DA 1ORQA 2WMPA 4FNQA 3US9A 3V5DA 3MOBL 3R1GL 1LE5A 4KRMB 3I6GA 4OCRL 3DNKA 3D2TA 1RUQH 4TLUA 3QJVB 5KVDH 4E9SA 3WGVB 2R7EB 3IDGA 2I5YL 3OKNA 4KAQH 4K71C 3U1SL 1TFHA 3VXTB 3WJLC 3EH2A 2HFEA 3F5WB 2DIJA 4NFCA 1TOXA 1IBDA 1PPIA 3BMWA 4NQED 5DJ8B 2J5WA 4M6OL 3AS0A 3TA3A 1NKGA 3ES6A 1R9FA 3SE9L 3L5HA 3MOAL 2G5RA 1E9OB 4FTVA 2AJXL 4QXTA 5LBGA 2ZUUA 3AWGA 5JIHA 4M93B 3KPNA 3SN6N 4RA3A 3O0LA 1DEEB 2H1PH 4MJJA 5ALBH 4Q9CA 4LCUB 3BUTA 1MLBB 3VXUD 5T1KD 3O41A 4L5FL 1AKPA 3QNYA 3EYSL 1D6EB 2IDCA 2EECA 3UO1H 3AMLA 2AK1L 2ICWB 4Y2OB 2NY2D 2DMBA 3L4XA 1EHAA 1QPPA 2V7NB 3H9SE 2HZHA 4DWHA 5C0ND 1FIEA 1PX3A 2CLVA 3MRJB 3WJLA 4Q9BA 4X0KB 2YAPA 1FJ1A 1NBVL 1BGXL 3OV6A 3WTYA 2F6AA 4WEMB 4G6KL 3W9DA 3BKMH 5ETUA 2FEEI 3WG7B 3CQQA 1SQ2N 1UM6L 2J8UF 5HHOB 1DBJH 4H13C 2RJMA 5I71C 3F04A 5JQIB 3MLXH 3Q43A 1MCLA 2CZNA 5KOMC 4EZJA 4Y88A 1W72B 2YUWA 1DSYA 1E3FA 2ZUWA 1U4EA 2ZJSH 5SX4H 1EAPB 4GEIA 4HIJB 1SY6A 1UB5A 2B3IA 3MRLB 4XVTH 1ZT1A 4DGIH 2R56L 1D7FA 4XRCA 4Q9QH 4RISH 5MEQA 1BF2A 4MA3B 1ZTXH 1LEKA 1WZAA 1U8HA 1QMUA 3G6AA 3MUJA 2ICWI 4UT7H 5E2TH 1KENL 3R18A 4ZMQA 1SXZA 4N8VA 1XGQA 4OCLC 3CFKA 5DUPH 4Z1PA 4CGTA 3DIVA 5DUBA 1NGWB 5CGYD 1HJCA 5K39B 1ZV2A 1XD1A 4OZGE 4N8CH 3CVHL 1MI5A 4JFZH 2Q6WA 2JELL 2YFNA 4XXCC 2VM4A 5D7JC 3PQYE 2VABB 5MHSE 3QULA 5D1XB 2VDKH 1W8OA 1KV3A 1MFUA 5D7IA 5K5YA 4M6NH 5IMKA 2EDOA 2C8NA 5F8QC 3IFPA 5JPNB 4ODUA 4JHZA 4OLVH 5JR1H 1U8CB 1XB8A 4JFYB 4O02A 3F8UB 4ZD3L 1R19A 4XX1G 4XMPH 1WFTA 1XWVA 5J1AA 2VC2L 3MLVH 3QHFL 2FEDC 5BVJB 4LBEA 3GINA 4A2EA 1IQDA 5ICYA 2DM3A 4WWOA 3DHMA 2ARWA 5J89A 4HU8A 3KBFA 2FWUA 1TZIB 2FSEA 4L1DA 2K8QA 4FTVE 1FVCB 2UXFA 4XXCA 3BUYA 3CDGA 1J05A 4J3OC 3SZKC 1EX0A 4GRLD 1L7TL 2C4XA 4OCYH 4OGQC 5FX3A 4PLKC 3HI6H 5HJ3B 5E6IC 3PF2A 5I1JL 4ACPA 4HUVB 1X3DA 2UWEB 3UFIA 4P5KB 4POUB 5EWIH 1K6QL 2ZXWB 3MX0B 2IFFL 4YHPB 5IM7A 1XGRB 5IBLC 4NQXA 3TT3L 3GXMA 4N6QA 5ID0A 4WI6A 1S9YB 4LLVB 4KROB 3ULUD 1Y1DA 4W6XB 1B6UA 5HVHC 3ARDC 3IKCA 1CL7H 4JQIA 1NCBL 4UIKH 5HXMA 1A21A 1SRDA 3OSVA 2XIBA 3K2MC 4LSQH 3M1OA 4KKAD 2XFXB 4EVNA 3VDCA 1UFUA 2EDHA 2GBAA 2Y06H 3ATEA 4HSQA 4PWJA 3V9FA 4KHXH 3EGSA 4NM8H 5EBGA 4W68A 1RZJL 1C12A 3ABGA 5IMLB 1U8LA 2QGDA 5T1DH 3QO1B 2FVNA 2X87A 4QAMB 3IJSA 5FM5M 2YA0A 1JGLL 4PTUA 4R26L 5DUMH 2GUYA 2A74C 3T0EC 5E6IA 2AJSL 3L5JA 3BIBX 3LXAA 3MU3A 4CGUB 5L88L 2A6KB 4PVNA 4MA1B 2ZICA 4V2CB 2BNQD 5IB1B 3V0EA 1ITBB 5J9PA 5I1EH 3IXAA 1X5IA 1A4BA 4QHKJ 4HVBA 4FF9A 4LB8A 1U8QB 4MDIA 3W11C 1IFHH 4JPKL 3X3GH 3GS7A 1C5DA 1HILA 3ARDA 5C0EB 4GIPD 43C9A 2HWZH 1A0QL 4OU3A 4Q9RH 3FXIC 2BP0A 4BWUA 3QFGA 2OW7A 3FCTB 5IJCC 3L3IA 4HPYL 4PJ7A 5CZKA 2JIXB 4ODXB 1QNIA 4Q6IB 1OAQH 2IPUK 2HMIC 5KW9H 1CBJA 1EEZB 3TBSA 3TASA 4KC3B 1MZZA 4LEOA 4AJWA 1K72A 2IALB 1H8NA 4NWUH 2A74A 3P4NA 1UACL 4UV4H 3C5SA 1MRDL 3NIDE 4KKBD 8CGTA 1KGIA 5HP5A 4P23B 5I73C 3QDGE 1JXFA 1WUNT 5CLXA 1K8DA 1JRHH 2G5BA 2FIKB 4XMKL 5MENA 1OCRB 1JHLH 2AQ1A 5HI4C 1U4FA 5G2NA 3U30C 5C0FB 1XEDA 1AANA 3IFOA 3WAJA 4NN7B 4JE4B 4TLSA 3FB7B 5DHEA 1K4CB 3OR6A 2RMNA 1UA6H 4K3JH 5ALCH 1KC5H 3MJ9L 1VGKA 3QI9D 1N6QL 5LNDA 2WSPA 4ERSH 3VXQA 4X6BB 2A9MH 1JN6B 4QOKB 2FGWL 1UKSA 1MXGA 2CO1A 2FEEL 4E68A 1YUKB 1ZIBA 4PW4A 2F54E 4H8HA 4R97B 1F00I 1EXHA 3Q6GH 4IKKA 2X89D 5E6UB 1S3KH 1NCNA 1XR9A 3PABB 4P2CG 4F8LA 2R23A 3KR3H 4MNGA 3LSOB 4A7SA 1E27A 3GTTA 4KXCA 1Z32X 4OJFH 5E23A 5SWSB 3WDHA 2AHIA 2O61B 1EZSA 5D93C 3MRNA 2YGPA 2JB6B 1A4AA 3QJUB 5DVOA 2X28A 4D0BA 1JL8A 3QQ9C 4F7KA 4PG2C 1JPFB 3QDJA 4ZXBB 4W81A 2QKIC 2G30A 1X5KA 1KPRA 2VN7A 3CFIC 3GIVB 5IR1A 2QMKA 1G9NL 4X4ZA 3SJVB 2H26A 3GO1H 3T8XB 3PU7A 1G0DA 3MNVB 4B9KC 1ZLWH 2V2TB 3LEXA 4AQEB 4ZI8A 2CWRA 1PCXA 4YGVA 1QUNA 1SNRA 3FCSB 2IBGA 4FQQB 3MACL 3M46A 2ENSA 3R06B 3O6KL 1J9SA 1JGUL 2VAAA 3MJGX 3RVUD 4X7DC 3N06B 3EYSH 4JG5A 2ATPA 4R84A 3T0DA 1RPKA 4JL2A 2R2BB 1EDQA 2FZ3A 5FM5O 1U8PA 1ET5A 2AK1H 5DO2D 2UY6A 4PG2A 5EU4B 1NIFA 1UUNA 4LGSB 1HNGA 1Y0LA 2QKIA 4FQXB 3N3EA 4L4VB 3FB8B 4Z7UB 3WDJA 2CIKB 5LBSL 1CCZA 4XZUB 4ZS6C 1YAIA 4HJJL 4EKJA 1S7WB 1NFDF 3MRPA 1QTPA 2NY6D 8FABA 3KPRA 5I8KH 3IS1X 1E28A 4KXZI 4NQDD 4IDLA 5CGTA 4JPSA 1LNUB 1JZ4A 3MREA 4MJ6A 4ETQA 4BXSV 1CG9A 1DZBA 3BZFB 1SBSL 4RGOH 2R56H 4HISA 5SX5H 4UOQA 5FCUH 1FL5B 1XIWC 3Q5TA 4PEEA 3F2LA 5FYLE 3S88L 2E7CA 2GJZB 2E86A 3KYNB 4S1RH 1TYEB 3C9NA 3V5HB 4TNFA 5GISH 5DLMH 2X40A 2DWSA 1UZGA 3ML9A 3KNBA 3KXFA 3FO9B 5ACLA 2P46B 3AXHA 2WZPA 1S7RA 4RZCB 1ZKAA 1PYWB 3QSKB 5DRXA 3FB6A 2LLGA 3CVDA 1SVZA 4UTCA 5KSBA 3FUJA 4RFEB 2VW6A 2WZ5A 5HGAA 4ZFQA 5T1LD 1L3WA 1VHPA 1WZKA 3SY6A 4IJ3C 2H2PD 4FQLL 3BE1H 3TONA 1BZQK 5E6ZA 1WAEA 3TFBA 3VNYA 1HKLH 1AGFB 3RVVC 5JMRA 4MNGE 4JKPL 3SBRA 1N67A 2ZXEB 3NCJL 1XIWA 2YKLL 4GFTB 4JM2F 4FA8A 5IOPA 4WW2C 3I50H 5IG7B 3O6ML 5F7KC 3TS8A 3QDJE 3U25A 4ZD3H 4GB9A 4UQ2B 1Q1JH 1BW8A 4J7RA 4Z7WA 1M3IA 4JRXD 1KIPB 4PVBA 3LKNB 1CICC 5A43C 2OSYA 2UX7A 1CU4H 3K6FA 5HDWA 1BOYA 4WKZA 1RUML 1ZPLA 1A7RH 1LM8V 3CFCL 2Y1ZA 1YHPA 3G5VB 2PYFB 2VLMD 3DX9B 4KZ0A 4NKOB 4NO2A 4TQIA 3DMMC 4RDQF 1YEEH 2ADFH 2WTRA 1X5FA 4OI7A 2VLJB 3ECQA 1XCTB 4J4PC 3PJSB 3U1QA 2FE0A 4AEIH 2UZYA 3FQUB 4KVNL 4X42A 3RWDA 2ZOKA 4PGCB 2F9BT 3WGUB 6TAAA 5KEZA 1P5VB 3UH8A 4HC1L 1SYSB 3ARRA 1HK6A 1Q0XL 2HRLA 2FSDA 4XN7A 1K6QH 1S78D 2X41A 4WW2A 3FJTA 2P5PA 3VFVA 4U6TA 1AY1L 1YEFL 1I9RL 1MY5A 4PV8B 4LNVA 2WUBL 4O9HL 4HIXL 1CLCA 4B27A 4AE1A 4X4YA 5CIPB 5D9SB 1U8MB 1NDMB 4C56B 3WLBB 4YHKL 1NIDA 4X0NA 2XV0A 2F5BL 1BP3B 1IRAY 3KG5A 3E6FA 4LU5L 1P5UB 1YMMA 4NFDA 2FD6H 3WDIA 3DMMA 3MZTA 3MXWL 4G42B 1IM9B 1F41A 1M1SA 4J4PA 4ORGB 1NLBH 5DVNA 2O4EA 2A99A 4I77H 4JCWA 4NZUH 1N6VA 3QJFA 3WEBA 2P8PA 4MZ3A 2DWXA 3QORD 4GAJH 4H2AA 2PO6D 3CFMA 1WVZA 1KN4H 1ROWA 2BSRB 3IPBA 4LP5A 4K23H 1UD4A 5HYJB 4MXWH 3VWJC 3QUKB 1ZT4B 4XR8C 4JRYE 1DSWA 4LKCB 4M6ML 3GBML 1WHPA 3VI4B 3VSUA 2AXWA 2HG0A 4JPKH 4OZGB 4YNYB 4NZRH 3V7AE 1X7QA 3PLYA 1HHJB 5E6RB 1I3RA 4GJTB 4L9DA 2FLMA 2BWDA 2R29H 4W93A 4OI8A 3AAZB 2ZKWA 4FL4B 2GJ6D 3A0OA 5DJDB 5MI0B 3DWTA 1ORQB 3DV4A 2WMPB 5JIPA 1Q9WB 4YSTA 2XKSA 3V5DB 2J4WH 5J13C 4U1GB 1J8HD 4JHWL 2HAZA 2KUTA 3T3MF 1IBFA 4OLYH 1AG0A 5AL8A 5TF1H 2IH8A 2GHZA 3DHPA 4JPVL 4NQUA 3CFQA 3GDBA 1CLZH 3IDGB 4L4JA 4Q2ZB 2BNUA 2J5LB 3DSFL 1HH9B 3K8LA 3OKNB 3OKMA 4DJMA 4LARH 4ZFFA 5J12C 5GGUA 2XN9D 2HFEB 2BERA 1MRDH 5D7EA 3VWJA 3ISRA 5IESH 1IGTA 2C9UA 4MB4A 4M8UA 5C09E 1NEPA 3ES6B 2D7QA 1QBAA 3GRWL 3FTWA 2BWIA 4UQ9A 4JGNA 2OA9A 4QYAA 4WFFD 3IRZA 1TG8A 4FTVB 4QXTB 3H0TB 1R34A 4MRCA 1MCFA 1BX2B 1CGTA 4D9RE 2ZX9A 1FN4A 5EIQA 2X9XA 3D39D 4D2NA 3QNYB 1JPSL 4N68A 1MNUL 5I26A 4M43H 5KBMA 1SJEA 3MA9L 4Q4EA 2GIMA 4X7FC 4XVJH 4PRHE 1CQKA 2CLVB 5DFVD 1T6WA 5FHBL 1CFNA 2R2HA 5I1KH 5HGGS 1FJ1B 2AJVL 5GGQH 1GOHA 2Y7MA 1N19A 4BKLA 4GSDL 3TJEL 5FO7A 3WNPA 5ETUB 5AB2A 3VXSA 4Y16C 1CDIA 2GBVA 4O58L 2IMMA 4A55A 4JZJB 2JSFA 1J8RA 2DWYA 1G87A 1W0VA 3SPVA 3CK0H 1ADQL 1YMME 3JYCA 2BY0A 2K3HA 2Q7YA 4Y5YC 4HUWB 1U2HA 4Q0XL 1BBJA 1KGWA 4XRCB 1BM7A 4RH4A 1JNNL 3J07A 1VFAA 3BCDA 4WFGE 4LCIL 4MMXA 3EJTA 5MEQB 3Q8EA 2DBJA 1U8HB 2E47A 3G6AB 3QZWG 2F1EA 1UWFA 3ARBA 4LFHD 4G1MA 2IF7A 3GJFH 2AANA 1KZQA 2GUOA 3QEQA 4N8VB 4ZUVA 2NZ1A 1XGQB 3CFKB 3ETSA 3FZUC 4TULH 1TJMA 3OPZH 2WYHA 4I85A 1ZK9A 3HB3D 3TCTA 5ADPL 3FRPA 5C8JA 2BVQB 2O72A 4BFIA 3CLEL 4DH2A 1JGUH 2CDFA 3HR5A 4Y16A 1Z0NA 5F1SA 2DYRB 4R83A 1MI5B 5EORL 2Z7YA 2Q6WB 3SDDD 2ZCKH 2NDFA 2X6UA 5I71B 1INEH 4XB7A 1EHLH 4IBTA 1WZ1H 1J1OH 2HT2C 3CGTA 3S5YA 2NLJA 2OXHA 1G9EA 2DQJH 1AP2A 5MERA 1H6FA 3K1KC 4Y5YA 5D7IB 2EINB 3SKNA 5IBUG 1CJYA 1X6LA 3K2UH 4DT2A 5IMKB 5I19H 4ZTOH 4MA7H 5A7EA 1ZA6A 4DZ8A 5I6LA 3VQ1C 4ODUB 4AUJA 3IK2A 1OAJA 1DSFL 2B08A 3AXIA 4BQBA 2XY1A 3GZKA 4UQ3A 3HG4A 5JTWA 1WAAA 5J1AB 1JUFB 3BC9A 4DCQA 3U83A 5JHDB 3T2PA 4GQRA 2I9LA 2V9TA 4LBEB 1L6PA 2VOTA 2LU5A 3M8OH 4JUTA 5BO1H 3AU0A 1IQDB 3VH8G 5ICYB 5HD8D 2ZPKH 1KLUA 3H8NA 5PAZA 2FSEB 1Z9SA 3LZQA 6FABL 1IGMH 4TF4A 4JM0A 1PMYA 1ZCRA 1J05B 1XXFC 2XN0A 5D7JB 3VVVA 3W57A 1BHGA 1J48A 3F84A 3O11A 2G60L 1NGPH 4L5FE 1I1FA 4M8QA 4F15B 4A2FA 1RZ7L 4HIHB 4XNQA 1N3NB 2GJJA 3OLIA 3WMSA 5IM7B 4KHTH 3RX9A 5KJRH 4UAOC 1LTXA 1E8YA 1T0PB 1ZV9A 2VDQL 3DROA 5ID0B 4LLDB 5KBLA 3QWQB 3IKKA 4KQ3H 5KZCD 2YPLA 3IKCB 5TH2A 3RUGF 2CIIA 3LKQA 2ED6A 4OLUL 4EVNB 4LVHC 3EGSB 3DUUA 1C12B 1JWUA 1IC5H 4YWGL 3OXRB 4QT5A 4N9GB 4FNSA 5F6IC 2YMOA 1L6XA 2Q5BA 4YDMA 2V33A 3AUWB 3S8FB 1AD9A 3IJSB 5E56A 4JFHD 4PTUB 3NFPA 4UB0L 1KACB 3OLEA 3FUEA 4M03A 3TYGL 5EB9A 2BZCA 5E6IB 5I1CH 2A9BA 4K8RL 2AQ3A 1H0DB 5J9PB 2CHNA 3HRPA 4ZO9A 3WFCH 2IGTA 3HG1D 3IXAB 1CFSA 3CFCH 1XGYL 2X1PA 4WO4C 3VGAC 4MDIB 3FOLA 4ZUUA 5FYJL 4U3XA 3QEQE 1T2QL 3BAEL 5HVHB 3ARDB 4JG0H 5JQ6L 1Z9OA 2A7BA 4G72B 3ROLB 3TBWA 1WA2X 5IOKA 4R7XA 4DN4H 4GKNA 1VFUA 2BP0B 5I30L 4JMXA 1ZHLA 4OCMC 2H32A 2NUPA 3QT2A 1QR1A 4KV5F 3L3IB 5FW7A 4PJ7B 4XHQA 4JM2D 1YEFH 3BEVA 2YMTA 3TBSB 4NZTL 2YS4A 1F4YH 1MDAA 4LDLB 2K6ZA 4LEOB 4M5ZL 3P0VL 4Z77B 3AADB 5AKTA 2A74B 3T0EB 1EFXD 2ZUQC 4UT9H 5I8CA 2E7BA 4GW1A 3P4NB 1TSRA 4MJ5A 3ALWA 3C5SB 1JZ6A 4OIIH 1OOWA 4RBPH 3WS3A 4XE5B 4WO4A 1IGJB 1IUZA 3GMRA 4R90H 2YPVL 2CCWA 3MVSA 4UDUB 1M4KA 1K8DB 3CHRA 2GAZB 3NJLA 3WY1A 4B96A 5MENB 2Y1AA 2A2QT 3D06A 1TTBA 3IFOB 3PIQA 3TTYA 3BWZA 3SCMC 1CGVA 2KPWA 2X6MA 3MJ9A 2X2UA 3P77B 4G3YL 4JZOB 4PP2A 5T1MA 5HHPA 5AAWC 4TTGA 2J25A 4FFZL 5J11C 3S2CA 4AIOA 2X3CA 2L7EA 3VQ2C 1HINL 5I0XA 3EO1A 5DU7A 3TWCH 3PL6D 4XXWA 2WTOA 4MTMA 2YLHA 3D6GA 4NO0B 2IQAA 5GPRA 2MPVA 2NXYD 3ZT7A 3WKYA 4UQBA 4B5EA 3S8GB 3V6OE 4Z7OE 1IC0A 1KLFA 2EEDA 4NOBA 5IJVA 3QQDA 1N5AA 4LMQE 5FUOL 1KXQA 1MJ7H 5HHMD 5I73B 1KLGA 3W2DH 4WO0A 2R23B 2B2XL 1E27B 3RX7A 5IHZA 1A6PA 1E30A 3U30B 4JHWH 4OJEH 4S1SH 1U21A 3I6KB 1JZGA 3MRNB 1XBRA 4HLZH 3SCMA 2VZOA 1D9KC 3CSBA 4NWTL 5CD3A 2DQHL 5KVFL 5AAWA 5JA9A 3CFEA 1JF6A 5DD3L 3ZTEA 1KPRB 2XBTA 5IR1B 2J73A 4QRPD 4V1DE 5AG8A 2ADYA 4BQ9A 2H26B 2OTPA 3QYMA 2EH8H 3G08B 2VXVL 4F1SA 3KWUA 1CI5A 5E2UL 1KB5H 2MJWA 3GJFA 4PJHA 4PRBA 1KYOK 2NY3C 4N22A 4YGVB 1QUNB 1HHHA 2ZG1A 1YO4A 5KG9A 2LAAA 1FIGH 1SN2A 2BOCB 5CAYB 4J2XA 2CJSA 3EBHA 4OLXH 2WXFA 4ABQA 3AGWA 5I23A 1EHXA 2FZ3B 1NAKH 1U8PB 2J6WA 3KCPA 3QCVH 4OF7A 1ZY9A 1D9KA 2VDKB 2YAOA 1X9RA 2UY6B 3CFBB 5ECJE 5F3HA 4HJEA 1AZNA 2CHZA 4XMTA 5J56B 3DGGA 4KUZH 1Y0LB 4R7DA 2W07A 3ZE2E 3SIKA 1PZDA 3CX5K 5SX4I 2DF3A 2OULB 2NY7L 4LRIC 1DVZA 1ITCA 3KLKA 3REWA 1AO7D 3GF8A 3VO0A 1U8OA 4GSDH 3ZPDA 2HJKA 3GT6A 1YPZA 3MRPB 1XH0A 3HG3A 1UHVA 2Q8BL 8FABB 3QAZC 3RL2B 3KPRB 1NC2A 2EEFA 5TQ2H 1JGIA 4DVBB 1E28B 1FRGL 1X9UA 2VISB 1YUHB 2BXZA 1MVUA 1N64L 3OB0H 4R4BA 2O1AA 3ILDA 4PTTA 3MREB 4HWBL 3AG3B 5K93A 4ETQB 3RBSA 3HUJA 3QYCA 4R9HA 4DGVH 5LQBL 1FNHA 1Z5YD 1OWRM 4LCIH 1RXLA 1G7PA 3C9NB 5G4MA 4PWHA 4L0ZA 3KNBB 3KXFB 2QZQA 4V2BA 1S7RB 3SKMA 4GKLA 3DTXA 5DRXB 3U7YL 4ZMTA 4NERA 2YPKA 4LRIA 5KSBB 5JXEC 2H1XA 1PF3A 3GXIA 2WLYA 1U9KA 5HGAB 3WUWA 2KDGA 5DEZA 3ZHDA 1IAMA 4FHBD 4APQC 2R1XA 1KXQE 5D7LA 2AV1A 1MQKH 3FFCA 3NCCB 4RDBA 5E99H 2CO6A 5BMFL 3L4TA 3RTQB 4XP9H 4FFWD 3NZHL 3O6FD 5DZLA 4AVKA 4LNRB 4C4UA 1XIWB 1CTOA 4F80A 5IOPB 2ENYA 4W4NA 4PJCA 1WQVT 5CR8A 2HKHH 3VH8B 4Z7WB 5EF3A 3LAFA 1F4WL 3EBIA 3WELA 3HC3H 3G04A 1CTMA 3A6BH 4BKTC 2VDMH 1CS6A 3QWRA 4P48A 4WKZB 4MYWB 5JXEA 1R3IL 5C0BE 5IQNA 2J6EH 1HIMH 4HMDA 1ZS2A 4NO2B 1NANH 2OR7A 4F2EA 4EIGB 4IJ3B 5KJ7E 4I9WE 4OTXH 3H7BA 2NPLX 1OP3H 4APQA 1H3PH 1PZ3A 3LMJH 4HLJA 5KN5A 2LV4A 4WI7A 1CL7I 5EU7C 2UZYB 5K9JL 2OZ4L 1J1PL 2O6EA 4F37K 5B38A 1KB3A 2ZOKB 3RWDB 3GEWB 5CJXC 4HC1A 1DVFB 1AFVL 1GZHC 2Y7LA 1YY9C 4ZX3A 1QEWA 3JUYA 4QTIL 4M62L 4WW2B 3DYPA 5E6SB 1T83C 1PLGH 4Y9FA 4EDXA 3SD5A 1MHPH 1QRNA 4U1JB 5CJQH 2P7TB 1F3JA 3DI2B 3GZPA 5DR5L 1IC1A 4X4YB 2WLKA 4JREC 1CICB 3P54A 1A6UH 1U92B 3UEZA 2UUDH 3BISA 3HFFA 4P4KD 4WZ9A 4OLUH 5F7EL 3RWIB 1YPZE 3DMMB 1F90L 4G82A 2EVFA 1KJMB 1AIZA 1EEQA 4KNUA 2RCSL 3O0RH 1C7SA 1DVYA 1XSKA 3QZMA 3QZOA 4I8DA 4QXUH 4IGBB 5DTFA 4N1EA 2P8PB 3IFNL 4H4NA 4WEBL 5CJXA 1WC7A 1GZHA 2YGOA 4HAFA 2DH3A 5GRZA 5IW3A 1CLVA 1MPAL 5FW8A 2GG1A 1H6UA 2D7TH 1T83A 5CUSH 2HFGL 1N10A 1CB4A 1AR2A 2F7OA 2OSLB 3S3PA 5HJDA 3T3PB 1BF8A 3UABA 3GZQA 4OIBA 3ULVL 5FV2A 5AW0B 5GZOC 1F13A 5EA0L 3ZIYA 5JDSB 5GGSY 3V4UL 2QHLA 1I3RB 4G6AD 3UYRL 3LXBA 3VFSB 3HZMA 2IDFA 1FHNA 4AH2A 5FK9B 4J5VA 3DO3A 3I3DA 2DD8L 3DV4B 1A7QL 2GKIA 4NQVB 3U2SA 2GSGA 1T7ZA 5EPMA 3BLPX 4HALA 1E6OH 3U7WL 4EQ3A 5D7LE 2OYMA 2QSVA 2VITA 3WXVH 1XZWA 3GQFA 5KTEH 1NPJA 4G43A 3P0VH 3QRGH 4Z7NE 4XBEL 5I1LB 1IVLA 3OKMB 3W0WD 4QNPE 3NVQA 5CMAA 2HLAB 2XWBA 3LQMA 3SDXB 3BAYA 4OCWH 3VWJB 4AQAA 2ICEC 4OZHA 1IGTB 4ADIA 2X7LA 4GFXA 1KB5A 4OD1L 5HVWA 3WD5L 3R0NA 3OD3A 4OLZH 1KCVL 2WVVA 3ZVVA 5GZOA 4GRMA 4WJ5B 5I8OH 2X12A 4GKZA 1NCAH 5CJOL 5DMIH 2IPUG 2XNAA 3V0FA 2XA8H 4U6VH 1QHQA 4XVUC 4FFZH 3DXAA 3QJXA 1RZGA 5ENWB 3N9GL 3AU1A 5J13B 1ZEAL 3OAYH 4PBDA 4QHLA 2ZCHL 1OTSD 1HEHC 4UNIA 4AI7A 4KU1A 1TZGH 2FT8A 1QVOA 5DFWH 3ECVA 1WP6A 2XWRA 4PJIE 3ULUH 2A9AA 3U4BL 1QA9A 3IBEA 1E7VA 5ANME 4K4KA 5KVEL 4J12A 3T5WA 4OGZA 2Z4QA 2AXHA 4HULB 5J12B 3IDJA 4URTB 4LVOB 2R2HB 3GBDA 4F7TA 3L4WA 2F7IA 4BKLB 2ICEA 3HE6D 2ZX8A 1QRNE 2XWEA 5FO7B 4K73A 3HAEG 4OM0H 3VXSB 3GMLA 1KFAL 3TEYA 4ODHL 2G2PA 3VFRB 1XT5A 3UTTA 1DCEA 4JM4L 3QO0A 4L3FA 1JCKA 2ZQKA 1W0VB 5INDA 3SPVB 4DP7X 5HBBA 1ADQA 2HT3D 1KCWA 1AHWB 3CXDH 2ADGA 1BZ9A 5DD3H 1W0WA 4PJ9D 1BBJB 1F8TL 2B59A 1OCOB 2K7PA 4E5XG 1QAWA 2V9UA 4AQZA 4YDKH 2FNBA 4ONHA 3ATDA 3IJEB 2XZAH 2IPTH 4G1MB 4ZUVB 3ZQ9A 1VIWA 2MHAB 5FGRA 4JFFA 1G5AA 5DDHB 3JWNG 3HN8A 1UOWA 3FRPB 5C8JB 4PB0H 4BFIB 3HR5B 2CDFB 4B9ZA 2OP4L 4QLRA 1KY6A 5C0CB 3X13A 2ARJQ 3C5XA 3EAKA 2JLLA 2X4SA 4PGDB 4GBXC 5C0NC 4OGYH 4AZUA 4G9FD 4HS8L 2NLJB 2OXHB 4JFSA 3LNDA 1AP2B 1BJMA 4N90D 5MERB 4Y5YB 2F7PA 1YNTA 3SKNB 4JHAL 3LZFL 3DX3A 4JO3H 4OIAA 1QLEL 4YHMH 4DAGL 1ZA6B 3PAYA 1YN6B 2QSCH 2NOYA 3STBA 3I9GL 4AENA 3GUFA 4LOVA 2VWEC 3B9KD 5I2IA 4A7GF 4UQ3B 4M7KH 1BECA 3GHBL 5CP7A 5C0AA 4DCQB 1U33A 3KLQA 2I9LB 2HT4C 5BRZA 4WY7L 5J6HA 2J6EA 2RD0A 3G6JE 4G6JH 1KLUB 1K4DA 4Z3TA 1X5JA 1EHKB 2YAMA 4GBXA 1CYXA 3TV8A 2Y25A 3CFTA 4KZEL 2K4WA 3O11B 1I1FB 3ILPA 4M8QB 4UOW0 2XHNA 4ZW7A 4TM9A 4G8GE 4XNQB 3B43A 3GMNA 5AAPA 4ONFL 2CO2A 2E9JA 4WTZG 3VXMD 3HHMA 3GS4A 3G3LA 5B3JF 3P69A 5A2JH 2UY7A 2VXUH 2YPLB 5TH2B 1Q9OA 2DLIA 1M6OA 2CIIB 3LKQB 3MXVL 3NQKA 4U1NA 4W9IC 3NCWA 4PCTA 5JUEL 1D7CA 4IOSD 4L48A 2G0LA 3NZHH 3DUUB 2QFPA 2W0FA 1JWUB 1OP9A 3C08L 4QT5B 4X6CB 2E75C 4GIAA 2BVUA 2IG2H 4HBCL 1AD9B 2AJYL 4GT0A 1BMZA 2CH8A 3NFPB 4FI7A 2J20A 4JFXA 1B4RA 4GMTL 1XL6A 4CNIA 4YAQA 5FB8A 4A6YL 3HOGA 4L8CA 4UAOB 1BFOA 1CFSB 3ZDZB 1IBZA 1E5AA 4IOIA 5CBAA 4ZUUB 2QPUA 1S7XA 2NY0D 1VZIA 3JYBA 1QHOA 1OAKH 2BDNL 3L5IA 5DJ2A 2GC7C 2VR9A 3PAZA 5IHBA 3KS0H 4XN1A 4GKNB 2PCPA 1QSED 4PJEE 4BCYA 4FC3E 1RK0A 1T7YA 4LVHB 1ZHLB 2NUPB 3V0AC 2E9GA 3HE7B 3CDYA 3MJ7B 4EIUA 1XCWA 3BWAA 3IPFA 5KYUB 5C07A 3NFSH 3HVNA 2X4OA 4BQ8A 5F6IB 1J5OL 4LLUA 4JFUA 3BEVB 3JV6A 3ULUC 2P9RA 1KPUA 1NSNH 2VJ0A 1IC4H 4KMLB 3LVTA 1GGBL 4QAWA 2AJUL 1KJ2H 1HS6A 1X5AA 2N56A 3BD3A 3DI3B 1TTFA 4GW1B 5HHNA 1LJMA 4HLZG 3GNMH 3K8KA 4XP5L 3BN3B 1GGCH 1SOSA 5BVPH 3WS3B 4AEFA 3NQIA 2YPVA 3VGAB 3GMRB 5HGBB 5KBDA 3APFA 1PG7H 5EULV 5C0AE 3QGVA 3RAJL 3ESUF 1G7IA 2PTTA 2UYLA 1OSZA 5E9NA 2QQQA 1AYRA 1PX4A 1XF5A 4R4FH 5KWYC 1IARB 4XN8A 4Z3GA 4U4BA 5BRZE 1MNNA 4FFZA 4HKJA 5HHPB 1AQHA 1TZAA 5HYFA 3NGBC 1FZJA 4J3WA 3CZLA 2A6IA 3EO1B 3FSZA 2Z8WC 1NMBH 4DOHE 5BZDA 1JDAA 2C4FU 2IQAB 3QPKA 3NCYP 4OZFH 5F1IA 1S8DA 4L8SB 4Y9BA 1MREL 5I1GL 4TUKH 2FX8L 1DN0A 1UTDA 5IJVB 2CA3A 3QQDB 1XF4A 3O2WH 5H35A 1EAJA 1A6WL 4W9DC 2VWEE 1INQA 2IDUA 4KJYA 3VX0A 5DJYA 3GLDA 4GNKB 3IWUA 5F3BA 4S1QL 1NEZA 3WKML 1G7LB 2AEIT 4P2YA 2DJ4A 3VD5A 3F6JA 4QHNA 3SCMB 5I1IL 2WNKA 1CUOA 3VRIA 4KOBA 4BZYA 5CD3B 3L3HA 2APFA 3IFLL 3CFEB 4KY2A 3I9AA 2LU3A 3F7PC 5J11B 4DEWA 2H8PA 2XIDA 3B5TA 3ZE0E 1FUNA 2O6FA 3MBEC 3A5VA 3VQMA 1RJZA 2Y6SC 3WD5H 5LCVL 4PRBB 3GJFB 4PJHB 5FYKD 1ZLDA 4P9ML 2DRUA 3GSUA 4HSAC 4P3WA 2ZP0T 2MNUA 1HHHB 4DP8X 2Q87A 4ZFZB 5FYJE 2WCGA 5JOPE 4AGNA 4IMLA 5D7SL 1EVTC 1EEYA 1RUPL 1WDAA 2BRRL 3WE1A 1FV1A 1JTTA 3L16A 2NYKA 2WLLB 2AVGA 4JFVA 4J6RL 3S3BB 1CYGA 5EN3A 2GPZA 4KK6D 1N0XL 1XH3A 3DK0A 5F3HB 1ZLSL 3DGGB 3RP1A 2W07B 5A3IC 2B5IC 3Q9PA 4HJIA 2FLRT 4NKIL 1JGVH 2VDPL 4FXTA 2FQEA 4JO5A 3MBEA 5LBVA 1ZVSB 4LHUG 3IRCA 1U8OB 4KZDH 2OXGA 5T8IA 2D31A 1ZMYA 2G3NA 2HJKB 4HJGA 2VDOH 1YPZB 4M5YL 3RHWF 3VFOB 4NO3A 4AKQA 3RVWD 2EE2A 4KO9A 1URLA 3BGAA 2NY3B 4P59H 4AGQA 4GG6A 4XNYH 4CN6A 2H1LM 5F7LB 3ATAA 5B7EA 3HBQA 4M48H 4QD2E 3VXRE 4HWBA 5AVXB 4DKTA 4WTXA 4PTTB 3G7TA 4ZQTA 4MAYB 2AKRA 3CHPA 3HUJB 3MRRA 4BSJA 2EUZA 1HNYA 1RP8A 1U8NA 2WK2A 4NUGL 2AABL 4L9LC 3OR7A 4WGKA 3CFJA 1MCWM 2A77H 4YSDA 3MQIA 3W5NA 1G7PB 5JIDA 3GGWA 4XCFL 4NHUA 2JI2A 2UZXB 4PJ6A 1T04B 5FKPB 1K5WA 1JK9B 4Z0BL 4XPGH 2E5EA 2ICES 2A73A 2X89A 4GAYB 5EO0B 3QUZC 2K3TA 4LRNH 5ILTH 3AZUA 4ZS7H 4DKFL 3SQBB 2ZXQA 3WUWB 1MCOL 2GY5A 4FQ2L 4I1PA 2R1WB 1NDGA 3P9MA 4Z3IA 4BCZA 4X7SH 1URZA 2R1XB 3UERA 5D7LB 2AV1B 3FFCB 3H42L 5DC4B 3WEXB 1U3JA 3WUZA 1QO3A 2F53A 2CO6B 3LIZL 4KKZA 5LLIC 1NDTA 3G9VA 4GI9A 3QUML 4PJ5E 2FQDA 3BAXA 4Z7QE 3H3BC 4AYID 1I1RA 4L9LA 4PREA 4NI6A 1CFVH 5I75B 1FPTH 4PJCB 3ZKMC 5KVFE 2QT6A 1JTOA 3K6SB 3G04B 5TE7H 4ZYKA 3T0VA 5FAAA 1S5IL 3QUZA 4CDGC 4Z7VA 3OKKB 4MDJA 4RGNC 1AKJA 1D5BA 3ZKQD 2WWMD 5IW1A 2HB0A 3QXDA 3LRHA 5AVVB 4R7NA 4LOUD 4OKVB 1YEGL 1O6SB 2XQBL 4QXVA 4I3RL 4APQB 5KN5B 2XVBA 1D7BA 2WXNA 3L5XH 4PIRF 5B38B 3QCTH 5E00B 4TV3A 1OOAA 2CRMA 2LVEA 4JFPA 2D3JA 4JKNA 2H9GA 4FLRA 4HUCA 3L13A 1QEWB 3IGAA 1AQDA 4BFEA 4E41A 3CJJA 2AFNA 1H9VA 1T6VN 2NXZC 4TRPH 4LPTA 2DQUL 1Q72L 4KH9A 4TQ8A 3SYAA 4EDXB 4EMZA 4YXHH 1QRNB 1ICTA 3ULVC 1F3JB 1KJ2A 4P49A 3T2NL 2W9EL 2AK4A 2XPYA 2O5NA 1B2WH 3BVUA 1MCQA 3DOHA 4C8XA 4NCC1 4LPWA 1NCDH 2XZCH 1XF2A 1JOIA 3HHRB 4PYGA 4ELME 3L1EA 4NRYA 1R0AL 3Q2LA 2BZDA 2E8ZA 1CDGA 1WZLA 4LCVA 3X3FH 5H37H 3VFGL 1SJVA 4Y4FC 5DTFB 2DKUA 1RLWA 2YQGA 1WC7B 3PNWA 1D6VL 5J0BA 4KJQC 5F1NA 2CMRL 2VLKB 3TZVD 4PGEB 5AVYB 3GI8L 4LOEA 4YBLB 3N44B 3FULA 4EBQH 2MNWA 1PL3A 1PZSA 1P7BA 1L6ZA 4WDIA 1KTCA 2IGFL 4JREB 2DB8A 3QDMA 3BDXA 5DQ9A 3ROOB 4TL5A 4GAAA 1I4FB 3VMOA 3HZMB 3IF1B 4AH2B 2F8XC 3PGFL 3D2UA 4UM9B 2Q3XA 2QZ5A 4KPHL 1S78C 3HEIB 4NNPH 3U2SB 2GSGB 1CXLA 2ZWKA 4ZPVA 1OZTG 4OQTL 1YEKL 3JXAA 3LTVA 4RQQA 2DLFH 2AQ2A 2VITB 1DJSA 5IBTH 2F53E 1FYTA 3D85D 4Y4FA 4G43B 4ODBD 5GRJH 2Q2LA 2MFNA 3S34L 2CSPA 5CMAB 1ZLEA 4UDTA 4ZSOE 4XNUL 2CHDA 2UV3A 5GGSA 2VE6A 1YEJH 2A1WL 4AQAB 1BJ1H 3N55A 3BYTA 1DBAL 4OZHB 2BVYA 1JYWA 2X7LB 3DIFA 1KB5B 2UVFA 3G5WA 2EDDA 2WVVB 3PHQB 4X7EC 4Z7VE 2XQ0A 1JYXA 3QORC 4GKZB 1C8QA 4N2EA 4ZRGA 2XNAB 3X1FA 5C0JA 3CXHJ 2PO6C 1P7KA 3GIZH 2LW3A 4AVIA 3DXAB 1RZGB 3KPMA 4JHUA 5DD5H 3AU1B 4M8VA 4XH2A 4AYFA 5C7ZA 4DO5A 4NP4L 3EJUA 4AEEA 1QVOB 4G7YH 3UBXG 3QH3B 2HVBA 1JIBA 3WFHA 3KBHE 4MVBD 1QA9B 5D2NA 4E9LA 5ECGA 3WEAA 2WN3A 5L7XL 4F7PB 1DBBH 2Z4QB 3P30L 3IDJB 2KS0A 4E41E 1IC7L 4F7TB 1LO0H 5E8NA 4WKXA 3UADA 4LASL 2X88A 1A6WH 2ICEB 3CHQA 3STLB 3CV5A 2XWTA 4MMYA 5LDUA 3EYQC 1TTGA 2O5YL 3UTTB 1SM3H 2NCMA 3QO0B 3S98A 2JMRA 4OUUA 5I1IH 1P1VA 4G1EB 5INDB 3F7KA 2PO6A 4YL4A 3P0GB 1KWKA 1N4XL 1QSFA 2ADGB 3CIQA 4RWHA 5F9AC 1W0WB 1U3YA 2UZPA 2B59B 4LLWA 3VU2A 3B3IA 3CSYA 3NZSA 5K59F 2GJPA 1LILA 4DKEL 5BS0B 3QNXA 3VE0A 2I69A 5F7DA 3JTBA 2VXQL 4UILL 4JFFB 2GJ6A 4XAWL 1EAQA 3E3QC 35C8L 4E0RB 4P04A 3VGGA 1ZV5A 2W91A 1L9PA 3ULVE 3RZCC 4BE5A 1RUPH 5ITBH 3QJHA 4X4XB 2BNRD 3LN5B 3PHSA 3QDME 3X13B 4KOCA 1AOHA 1V7NH 2X4SB 1RVFH 2YMXL 4OFQA 4YDZA 2W88A 4C4KO 3OLGA 2XN9A 5DFVC 4OW6A 2DICA 1YNTB 5FGBC 5DVLA 1TMQA 1ECYA 1AS6A 1GC1H 1TZOA 3BKYL 4LZKA 3TBYA 4HWUA 5EF0A 4NNYB 4XBGA 1XVSA 4UOW1 4WUKL 4F27A 5H4ZA 2E6PA 1LP9E 5I2IB 3ZYOA 1MCEA 2VDMB 1X4YA 4QHKI 3WBDA 5EZOL 5CP7B 3WJJC 2ESVE 2F7RA 1FC2D 3S6CA 3VXUB 4XVSL 1OGSA 1A3RH 3D39A 5GRVK 5J6HB 4P57B 4KTGA 2N7SA 5C9JB 3RZCA 4PS4H 5FHAL 4ISVB 1UJTA 3LZNA 1OP5K 2I60H 1I9IH 4K94L 3D18A 4N24A 4GBXB 1AZRA 1P84K 1PZUB 1OY3B 2V5RA 4WUUD 1LYQA 1UGKA 3I2CL 4LEXH 3S36X 3VFWA 2BJML 3M1CA 3GHPA 4QRQA 5DD1H 4B97A 1ILSA 2PTVA 3HB3C 1I8KA 2J55A 5DI8B 1KEGH 2JKXA 3X1GA 1TETL 2PPCA 5KVEE 1ED3A 5D2NE 2XKNA 3EBGA 5AZ2L 2UY7B 1CLYH 3WJJA 3L3DA 4TKWA 1BMGA 1D3CA 1M6OB 2E46A 4MAUH 3PWNA 3T0AA 2WP3T 1KTBA 2XBDA 2XJLA 2EH7L 5ISZA 4YVNA 12E8L 2DS4A 2NW2A 3V4PH 2W0FB 4F7CA 4JDTH 1S5HA 1ACCA 1TQSA 3WNJA 3ZDXE 4XPFL 4BM7A 4POZD 1QSFE 2AAVA 4CL7A 2DBLH 4PVLA 2HRPL 4A2LA 1B0RA 4YAQB 5FB8B 5F7YC 1WFIA 5HD8C 3IAQA 4WENB 5EF1A 1E5UI 5B4MC 2GB2A 3MNZA 3IVKA 1BFOB 2CKNA 2WNWA 3MR9A 5IUCA 3L95A 3P2BA 1KCUL 1R3HA 4IOIB 2C3GA 2N0MA 5CBAB 1S7XB 1YEGH 3LS5H 3RNQA 4I3RH 4IKNA 1UWGH 1NC4A 2ZONA 4Q56A 3OKOA 2PCPB 1RK0B 1OTUD 4PN6A 2CGRH 4OAWA 3BFQG 4H20H 5C07B 3WOVA 2AEPL 2X4OB 3HZ3A 1L4IA 4DTGL 2OK0H 1XAUA 3H9HA 4LLUB 3S37L 3JV6B 4N2IA 1KPUB 3NJFA 4KROD 1FVDB 1IIIA 4OZGF 4U1HA 1VFMA 4UU9A 3VA6A 4ALAH 5HHNB 1T0NA 5E4EC 5I5JA 3GSXA 3N42F 4M4RA 2B1OA 4XT1C 4Z6AT 3WIAA 3QCUL 1VPOL 3HPLA 3FTYA 1M9WA 2PW1A 4F92B 3DX4A 2PTTB 1OSZB 1DQDL 2Z35A 3E3QE 3WNNA 4OZ4B 3UTZA 5EOQH 4YHZH 5FECA 2VDNB 2DJUA 2WO2B 3NIGE 3O4LA 2A6IB 1M42A 4R5TA 5BV7H 4Y19A 2CD0A 1NFDA 2XKUA 4FJ6A 5BZDB 2O30A 2G2RA 1S8DB 4MNQA 1DN0B 4DUXA 2BHUA 4HFUH 3QRFM 3KLSA 5DK0A 3NZ8A 5EMYA 4AK2A 4G71B 1TKWB 3OKEA 5H35B 3GKZA 4HOMA 3OXSA 1IKFH 4BH7B 1INQB 4KJYB 1EMTL 2YSTA 5F3BB 1CGSH 1NEZB 1RH8A 5FO2A 3D50A 1I7ZB 4QHNB 1QBLH 3VRIB 5ISZE 2BNQB 3NGBB 3LQAH 5C1MB 2KYIA 2OMXA 1GC1C 2HX8A 2IBBA 4FXKC 5D6DC 3VI3E 3VQLA 3IXTA 4XNUH 2FHCA 3WMPA 4P23D 1DQKA 3NAAH 4AYEC 2R1YA 4S0HA 2ZCZA 3MGAA 5LCVA 1REIA 5AYUH 3LN9A 1QP1A 5AOMA 5JW4N 1JAEA 4UMGA 2JI3A 3GSUB 4KK5D 5D96C 2XQYG 5F3FA 1IT9L 1MHCA 3KYKL 4JK0D 2YXVA 4KK8C 3OKDA 1E65A 4Y7OC 3IDUA 3PL6C 4EI5C 1FV1B 1HZHH 4HXAH 4NM4L 2JKRM 4QOKD 5A2BA 4C83A 1AGDA 1DYZA 1XH3B 1RK1A 1AVAA 1CBVH 5T3XD 3GBEA 4LP4A 3CNKA 4HOWA 2IDTA 5D1ZC 4FXKA 4YBQD 5D6DA 4JUSA 1JVLA 3MBEB 1TJXA 4YDLC 1ANUA 1LK2A 2FBJH 1TVBB 5IKCA 2AC0A 2DI7A 5HY9A 1PBYA 1UVQA 2D4DA 2XBZA 4FOMA 3EHBC 4GG6B 1CGUA 4XNMB 1MEXL 5CKAA 4ZXBD 3OMZA 5EIIG 4MXQD 1P6WA 4RWYL 4U6HA 4F33A 4N3UA 3MRRB 3UBXI 1OSEA 3BCFA 4ZMNA 5K9QG 3PL6A 1U8NB 4I3GA 3BT2L 4EI5A 3HLKA 3OR7B 1BVKA 4ZOAA 2OL3H 4PHXA 1GAFH 3NIDF 5J4MA 1SHMA 3SDAD 3V4VH 1IILE 1LWHA 3MRIA 2F74B 2ZAHA 2W0LA 1CYWA 5I76A 5LJYH 3PPSA 4FMKA 1E4XH 2B5IB 5D1ZA 3B56A 5HHVH 3O4LE 4JY4A 5I0VA 2A73B 5EC1A 4HIPA 1OM9A 3P4LA 2MQ0A 3JWDL 1HYSC 3OZKA 1GIGL 3K81A 4JFED 3UC0L 3EJPA 3T65B 2BZ7A 3UO8B 1UXWA 4RFOL 1QEXA 2EJ1A 5CD5D 4MNQE 3KEHA 1NDGB 3P9MB 3MV7E 3L54A 3Q2CA 1WV7T 1PJWA 5C0RH 2FAUA 4KTDH 3EFDH 3OJVC 4HF5L 5BRPA 1QO3B 2H2SD 4PRDA 4FQXD 4L4VD 3DUHA 3QJZA 3TM6A 1CPUA 3HC0A 5F7MC 4PREB 4Q4IA 3SDCC 1DJHA 2N3JA 3CMOH 5EFIA 2KZBA 1S4IA 3LX9A 2HRHA 1OGTA 1J5HA 1INDH 1R1CA 4XCCL 1G9HA 1RMFH 4ALAC 1BDYA 5FO8B 1I1YA 4ODSH 3E8VA 2GFBB 4RA0C 3QUZB 1NCOA 3FO0H 4HHAA 4MDJB 5HGHB 4LFHG 4NBYB 4LKXB 1KTKE 3SGEH 5IW1B 1X9QA 5IB5A 2ORBL 3IWVA 5GSVA 5CN3A 3S0PA 3C60D 5C3LD 4J3OF 1QATA 2ZCLH 4Y1AE 1NGXA 2ODHA 1U3HD 4TUOA 1BQKA 3RY5A 1ZLUK 1DVTA 2H9GB 1DQTA 1HJBC 3DVFA 1TTRA 5BV7C 3IGAB 1AQDB 4XP4H 3SDCA 2NQCA 1QFOA 1KJ3L 1KG0A 2WQXA 2M83A 4GSUA 3TJPA 3RGBA 1IU1A 1KJ2B 4BYHA 4FKHA 2YK1H 2X44D 1T7WA 2AK4B 1T1WB 2JQMA 4OFDA 4FFWC 4RGNB 3UJJH 4BE6A 3WV0A 3WIHH 3HHSB 4LQFH 4NRZA 4AY0A 1NUDA 1XF2B 3MCKA 3C12A 3UTOA 1RY7B 1YNKL 4WQOA 3VFPA 1LO4L 4NRYB 5GJSH 1N12A 1YAZA 2BSSA 2YGQA 4FG6C 3W9EA 2J12B 4OF5A 5D1QA 3CVIH 4DUWA 5EEZA 2C9XA 4PWKA 3MV8A 1E8ZA 1A3LH 2QADD 1ZLVH 3ZTDC 3LQAC 2YD0A 3PNWB 5F1NB 4LSDA 2EXYC 4XPHH 1OF0A 1ZTMA 5T1LB 1OAYL 4BH8A 2DM2A 4NSKB 2A9CA 4OZFB 4MQSB 1KCUH 1A9BA 2J8UB 4HJ1A 5FFGA 3EZ8A 2HFFA 1DJXA 2R4SL 4WDIB 1DZ0A 1I3UA 2VLJD 3PFUA 5DQ9B 2QTEA 4NLHA 4BGDA 1LEGA 5JHBA 2B8OT 2WBKA 5B39G 1KCLA 3GPSA 4G7VL 4IRZH 2YA1A 2IWEA 3NUKA 3BUQA 4ZMVA 3ARGD 1E7UA 2DEYX 4Z5RA 3HR6A 2VERN 3FSOA 3H9ZA 2HN7A 4FQJH 1J10A 4QYOA 4RQQB 2EIJB 4JRXB 5IQ7H 4F8NA 5FLUA 1FYTB 4Y4FB 4P4KC 3PHAA 4PP1C 2BW5A 2ODIA 1KCSH 3PREA 1SJHA 5PCYA 1FGNL 4HCFA 3L08A 4EZKA 4ZX5A 1UJ3C 4HW6A 3R7RA 1PY0A 3G5ZB 3WYRA 3BD4A 3Q1SL 2AQTA 2VE6B 2VN6A 5GGSB 3U0TA 1YYLH 1HVXA 3MRMA 3VJ6B 2JKWA 3DIFB 4IDJH 2NZIA 1XSOA 5EUOA 3HMWL 4UTBH 4QRUA 1FP5A 1R3LB 1E4WL 3J7HA 1FORL 2X38A 2P3YA 1P7KB 4YHNA 4WWNA 4KI5E 1HCVA 2H45A 3IEAA 3KWTA 4XH2B 1B2YA 5HYJD 1BIIA 3QZBA 3VTMA 4NPKA 5HHXH 3MGOA 4P4KA 1F6AA 3S5ZA 1QYGL 3SEPA 4WWKC 3D3VA 2PYEE 1G6RL 4U6YA 5GZND 1CD8A 4XPTH 2VW4A 4RZKA 2WVSA 5E8NB 4Z78B 4J1UA 4HAGA 2WC7A 4W6WB 2VDOB 3GC3A 5SWQA 2XWTB 3DGDA 3FT4B 4FQIL 4UM8A 4UQDA 2F2HA 3FBQA 3N85L 3JTSA 1IGIH 4XMLH 1FO0L 4U7SA 2L04A 3FQRA 3QORB 1Z7JA 3DPBA 4N2DA 4RDQG 3RBGA 3F12A 4G5AA 4CKVX 2PO6B 4FHJA 7CGTA 1MCRA 3WN5C 2BVOA 3E6HB 3NSYA 4QRTB 4QHMB 2OL3A 5D1QE 5CEZD 3ZO9A 3V4VA 3ILQD 4RESB 3B3IB 5IK3A 3CSYB 3TA3D 2GCYA 2B14A 2F19H 2MTPA 3QNXB 2Y6TE 4FTVD 4TXVB 4WWKA 4FCAA 2GJ6B 2Z1KA 5IFHH 2O26U 3KM2A 3EYUL 1OTSC 4YDIL 1SLUA 2F08A 2BOBA 3QJHB 4PJFE 2NTSP 3PWUA 4OF6A 3QYNA 5IEHA 1YC8A 3X2QB 1W8NA 1GCYA 5FUCC 3KJ6L 3WS6C 4ZTPH 4N0YL 2XN9B 5DUJA 2X9YA 4CSTA 3WN5A 2CKBH 4HCRH 4IRJC 1GJIA 4XCYA 1QQDA 4LSVH 1N8ZA 5INCA 3TBYB 3GI9H 5HYQA 2MMXA 4AIEA 2R0WH 2ZOLB 4XBGB 1H3GA 4F7EB 5EIIB 3KBEA 1FNAA 2AEQL 1KIUA 1VRSA 2QSTA 4IIZA 4L8BA 4OVUA 4CJ0A 4OZIE 5D6CA 5F9DC 1U95A 4OF8A 4CVXA 4U49A 2BVEA 5DT1L 3E1F1 5BXFB 3D39B 1MJ8L 1RLBA 1N7ML 3GSRB 4YUEH 4B5ZA 1IEBA 3WSQH 5LVEA 1IAKB 3K8MA 5DC9B 1ZSDB 3D18B 2IPKA 5DD0H 1PIFA 3IRPX 4H8QA 3UZEC 1Z3GL 4Z23A 3WS6A 3V6ZB 2V2XA 4JFDE 2WSDA 3VFWB 3X12A 4R7VA 4HXBH 4IRJA 2ADJA 4QRQB 5D7HA 4Q8BA 1P4BL 1BA9A 3HC4L 4TQPA 3BFOA 1BMWA 1M53A 3ARTA 1MCBA 1ED3B 2BFVH 1MI5D 3ECBB 3D3VE 1QZ1A 3UJTL 1CDYA 3L3DB 5K9KA 5K9QI 4XAKD 3PWNB 3OWEA 2ZOTA 4L23A 1JJUA 4KY1H 2CHXA 3WIHA 2EXWD 4JVPA 1OT4A 3OF6A 5IHUL 2NW2B 2V8LA 7FABH 4GG8A 4WW2F 2KLTA 4ODVH 3PYCA 1I7RB 1S5HB 3AQYA 4GPVA 3U2IA 3B9KC 3QQ4A 3UAJC 3UZEA 4BHUI 3QDGD 5DK3A 5FO9A 1URIA 5FYKH 2N7AA 3X1BA 1B0RB 2AQNA 3HB3B 3TBVA 4EO5A 3IVKB 3ZSTA 3A3YB 1VFBB 3MR9B 4HPHA 2FX9L 1Q0YH 3SYPA 3TIEB 2X4NA 1R3HB 1B4TA 4Y2NA 4ZQKA 2AZAA 3I75A 1TJHL 4WV1A 4C4KT 3PGCA 2ZSWB 5MP6H 1G94A 1AJ7L 3OKOB 2G3MA 4F20A 1OB1A 2IOMA 1P7QA 4I5BA 1SYVA 3O6LH 4IRZA 4ZMLA 3RJOA 2AERT 4OAWB 4M5TA 1RHHA 2ENQA 2XTJC 3IN2A 1NICA 3GWJA 3H9HB 3JWNE 3B9KA 3ESPA 3UAJA 1WA0X 3QXVA 1GH7A 1EO8L 3VFUA 2MNJB 4KITB 4ELDA 2WOBA 1Q38A 2WAHA 1T0NB 2FEDD 2Y7NA 3FUFA 4ZODA 5EOCL 4M4RB 3RZWA 4DSYA 1DFBL 5I15L 4OD3L 3MV9A 3HPLB 4H1LG 1LDPH 4QPEA 3ZY7A 2PW1B 2DQGL 4EE2A 5EOTA 2VR7A 4J3OD 4XNXH 3WIIL 2Z35B 1MFCL 4YSRA 4PLKD 1H8OA 1CK0L 1P53A 3GSNL 4GINA 5FECB 4P3CL 3VXMA 4X83A 2L7QA 4PRNA 5FGCE 2IADA 1UOKA 3QUGA 4GSXA 5IBLD 4W4OC 1UH4A 2W81C 4Y19B 2EP6A 4RVBA 1NFDB 3PAUA 3QWOA 3C2AL 2R83A 4U0RC 4LCWE 5KZCB 3WFEL 2J43A 4K0OA 2G2RB 4Y4HD 5B39B 1M1XA 2JJSC 5I82A 3SGJC 3BP4B 3L4YA 3KVPA 2R0ZL 2GSMB 4RGMB 5E4EB 4FQHB 4MQ7A 3GUTA 4IOSA 4H8WL 5DK0B 3NZ8B 2K6WA 3QQ3A 3A4AA 5B1BB 5TE4H 2BP8A 3OKEB 4OFIA 3CFDA 3ERXA 5C2BL 3QUYD 3JT0A 4HWNA 4G7VH 4B9GA 4GQZA 1XB3A 2DMCA 3LYRA 1G7QA 2HKAA 3BP5A 3EBAA 3MLSL 3Q1EA 4J6IA 2AW2A 1LMIA 4KTEL 3CZNA 4KKCC 1V3LA 1NOFA 2DQEH 2Y7SA 3D08A 4P0DA 1ZRUA 2ZTBA 4DGUA 2QVIA 2OMXB 1RZ8A 3HG1B 2OSWA 3S3DB 4K3EH 4JO2H 4W4OA 4P99A 4WF7A 2PUQT 1DQLH 5DRWA 4XN4A 1JDCA 3QR2A 1XH2A 2R1YB 3W11D 3S5LA 3A23A 2Q8AL 1A9EA 2IOIA 2JJSA 3SE3C 3LPPA 4N0CC 1NAMH 2IWGA 3QC6X 2EC9U 3IJHB 4XP6L 3SGJA 2FATL 3V0IA 3VCLB 2YXFA 4S0TD 1UWEH 3RPKA 1H8SA 1MHCB 2B0SL 5C9KA 3WTWA 3F58L 3ECWA 5HDBE 3OKDB 4JY6B 2HTLC 2VT0A 5DJ6A 3ZRSA 4DPBX 2G0KA 2PWHA 4CVZA 2MQGA 3NA4A 4Y4KC 2HMID 4CMHC 1FBIH 2D7NA 3O2DH 4C83B 2APSA 3WXWL 2ZX7A 1AGDB 4NEHB 1EFXB 5EZIL 1TT6A 1RK1B 4AMWA 2YARA 2CKBA 4HCRA 2CGZA 2B9AA 3T77A 4Y8AA 3ZGHA 1OVZA 4TSCH 4FXKB 4WJKB 2OJEA 2C7UA 3L9RA 1SDYA 1J18A 5SWZE 3HNSL 5DHYA 4DO6A 4OM1L 1WG3A 5IKCB 1T5WA 2P44B 4FQIH 4PFEA 4X9HA 3SE3A 1UVQB 5HY9B 3IDYC 3SDYL 1KCBA 2Q3ZA 1C1EL 1QW9A 1TQVA 3ZBMA 4D9LL 2W38A 3QDJD 1PSKH 3X1EA 2VM3A 4G8AC 1W0YT 3MV9E 4GKSA 4U6HB 3TPKA 2R0KL 4F33B 3PL6B 4FGMA 4Y4KA 5CN1A 1I3VA 3MRIB 1HL4A 3BKCH 1W15A 4LEEA 2Y4SA 2JB5L 1S3RA 4M7LH 2M2DA 5I76B 5M95B 5IFAH 3ZZ1A 1L9RA 5D1ZB 3T1WA 1KCRH 4FZ8H 2XVGA 2XTJE 4P2OC 5EC1B 3FTVA 4XC3L 3TIDB 5KUKA 3DHUA 1GYAA 4YDLB 1F4AA 1KBGH 1UXWB 4FULA 5BRQA 2IEPA 5DA4A 3NESA 2HVJA 4X99A 3VM7A 4FP8L 1F2QA 2NNAB 3FUNA 2XU9A 5FDWA 4X5RA 3RVXC 1QACA 3QQ9D 2XDHA 5IVXE 3V4LA 3BIKA 4L2YA 3V6FA 4FKKA 4JCLA 4EUPH 2WHVA 3V4PB 1QFWI 1ESOA 4Z7OF 3HC0B 3B37A 3VXPB 1T0OA 3D69A 1U3NA 3ASWA 1WBXA 5E7FA 4DFIA 2R0LH 1ETJA 4PG9A 1JZ2A 1MOEA 1OGTB 2NTFB 1UENA 2YAHA 4WHTA 1N0LA 1TXKA 4NDMA 4P2OA 1FNLA 1I1YB 4NBZB 3GXNA 3AROA 4BZ1L 1T1YA 3APNA 3UIZA 3NFNB 3OLDA 4HK3J 1ZDQA 4O2CB 4WTQA 3RIKA 2VH5L 1N7MH 5GSVB 4GQ9H 5J3HD 4ATTA 5ESAA 4M7JL 4FI6A 4XODA 4D3CH 3CPUA 3RB7A 4L4TA 4TUOB 4JRYD 4POYA 3LKPA 2NSQA 2HCZX 1A6AA 1XGPA 3APDA 3MBXH 1BLIA 3F7QA 4H0IA 1JWMB 3HC4H 4YR6A 2C7FA 2YR3A 2ITFA 1M05A 3CH8A 2UXTA 4ZS6D 1OT2A 4GRWE 2JJVA 2QFRA 3HMXH 1TJGL 3QNFA 4MJIA 2DDQL 3D34A 4N1HB 4K9EH 5IJBC 2O5ZH 1QOKA 3NPSC 2QKSA 4AJ0A 3IYLW 2HKFH 4NRZB 3INOA 3MCKB 1WWBX 3ZE2F 3IETB 4A66A 1HWGB 1EJ8A 3VFPB 1XIWD 2BSSB 1WEJL 3W9EB 3LH9A 1MFVA 4AXWB 4FZEL 4AC2A 4KJPD 1KEML 4ZFOL 2DN7A 3VXOA 4XO5A 1RCYA 1E5ZA 3MRCB 5C09D 2BY1A 3MV8B 4UWQB 3ZYZA 2EVJA 4LVNC 4LSTH 4DNLA 2W60A 3CD4A 5BV7B 4NQEE 3CU1A 3DPDA 2ILLA 2B4CL 1BSIA 1KIQA 2WWMC 3TFKC 5F72S 1BVLA 4BH8B 5A1AA 5HVFB 1OKEA 1HC1A 4D9RD 1OD9A 2FQFA 3N04A 3KMDA 2KERA 2HFFB 3QZPA 1TJHH 5JW4M 1HZLA 1ACYH 2QR0A 4EOWH 5I9QC 4H5SA 5CNHA 1BM3H 1AJ7H 4MDRA 4XPAL 1LEGB 1WTGT 5A2LH 3RVVD 5IGXH 3TBTB 3BEWA 3O2VL 2ZP9A 4P8QA 3T2OA 2ALAA 4ELKB 4Z5RB 5FOBA 3L5WB 4N2KA 2DWDA 1DQMH 4IBYA 2R69H 1ET8A 4P2RA 1FNSL 3FRUA 1EO8H 2EKSA 3ZTJG 1SJHB 2QDVA 4A2MA 2I9TB 4X9BA 2I24N 4OSUH 2VO8A 1GYWA 3U0TB 3HNVL 1A4JA 2A83A 1YMMD 2YXWA 3BXNA 3MRMB 3DMMD 2BIQA 1NAMA 4H40A 4NZFA 5ADOL 5EUOB 4J4PD 4K7PY 4N20A 2JI1A 5FPIA 4WFGD 3B5GA 4QRUB 1SDDA 1OSPL 4GP5B 4H44C 3TZVC 3ZW3A 2P8LB 5KUMA 2V9RA 4NNXA 4OFYA 4TPRH 1BIIB 3KPSA 1CLOH 1IFRA 1TTAA 3O2DA 1KDJA 3OGOE 4L4TE 4RRPM 4X5LA 3TL5A 3C2AH 1IGYA 3MGOB 1WBZA 1CE1L 4P4KB 5AW7B 1F6AB 2M26A 2V5SA 4YDVA 2XY2A 3V79C 1ZWIA 1AHKA 1OIOA 1YQ2A 5KS9A 1UJ3B 4QGTA 4U6YB 5CSBA 3C2SA 1W6LA 2X9ZA 1B9KA 2Q76A 3U9PH 2BH0A 1U8IA 4J1UB 1ECZA 4BZ2H 5TJWK 5SWQB 2FX7L 4MJIE 1GTFA 3BX7C 4HT1L 4QEGA 3GB7B 3QG6B 4RRPA 4UM8B 4J3SA 1FO0A 3JTSB 1N5YH 2C1PA 3IJYA 3LXCA 3S4SG 1TCMA 3FQRB 2BC4A 3DPBB 3D4GA 4XBPB 2Y36H 3F12B 3PY9A 2W9DH 1QSVA 3P73A 4PIBA 5GGTL 3WE6B 3TF7C 4GP4B 2NYYC 4HEME 4HG4K 2OR9H 1CF8H 2APVA 1T4WA 2CJTA 2M8XA 1RZFL 1Z3RA 2OL3B 4HEPA 3DUSA 5HYSA 3V4VB 1BD2A 1U91A 2EIMB 5FGSA 3VWJD 4CVWA 1CMOA 1BQLL 5IK3B 1F3RB 1YPZF 2YJLA 4Y1TA 1G0YR 1PIGA 3GHEL 5DGRA 3ZKXC 1J0IA 3U9UA 4F3FB 2FATH 4P9HL 2VLRA 4J8QA 3P0YL 2FBRA 3A6CL 1HTYA 1FVEB 5D5ME 3RFZC 3L3OC 2ZKHL 3QXWA 3EH4B 4YMPA 1RL1A 1QFWL 4UZSA 1DL7H 3KDPB 3VTAA 5F7UA 3KPTA 2IMNA 3NJIA 2I32A 4GP8B 3SKJH 2A6JB 5AG9A 3PWUB 1QFUH 3BDYL 3D85A 2Y5TB 5IEHB 4DN3L 2X6BA 4P2AA 4HK3N 5TGBB 3W0WB 4YX2L 3LNIA 4EUPA 5CWSA 1F1DA 3WN5B 4KVCL 3SPCA 4XCYB 1QQDB 2WD0A 5INCB 1NWPA 2WIIA 5HYQB 3H53A 5BZXA 1YSOA 1OAUH 3HNSH 4GSQA 4P2RE 4A67A 3VXSD 3MRQB 3VB9A 1QPXA 1KIUB 1V7MH 3FNKA 3MRHA 3HPJA 5D6CB 1E4XI 3EH3B 3SDYH 1U95B 5EC2A 1J86A 4CVXB 2CCLA 2COVD 2RALA 5DHXB 4LLMA 3RFZA 3L3OA 4Z7NF 3THML 1NIAA 4I13B 4MMZB 4QNPF 4UIMA 1LLAA 3ARSA 1IEBB 4HH9A 4QXGL 1SMDA 3AGVA 3V9CA 4IRSC 3Q2NA 2IPKB 5GRUH 4HIEA 1RIUH 1FNEA 2WPGA 2V2XB 1OE1A 2AMGA 3D05A 3ARBD 3ML8A 2OX5A 4R5XA 5JIKA 3UOAB 3NP4A 3QEQD 4IRJB 2WQRA 1UT1A 3KPSE 3WTTA 5D71L 2YEVB 3HE6B 4DW2H 4Z3EA 1VA9A 2EDNA 4NKQB 4OLWH 2FO4A 5KAQF