4BWUA

Three-dimensional structure of the k109a mutant of paracoccus pantotrophus pseudoazurin at ph 5.5
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPAKARERMDAELAQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PSEUDOAZURIN
publication title Exploring the Surface Determinants of Paracoccus Pantotrophus Pseudoazurin
rcsb
source organism Paracoccus pantotrophus
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4bwuA00
2BP0B 2ZWNA 5LDUA 3CG8A 1QLEB 2GIMA 4E9RA 5I6PA 1WS7A 1GSKA 1OCOB 2J57A 1X9UA 4TXVB 4M4RB 2PCFA 1JERA 3S3CB 2IDUA 5AFAA 2PLTA 2FQDA 1OCRB 1URIA 2TSAA 1RCYA 2XVBA 3SQRA 2YAEA 2EIKB 1MDAA 4CSPA 4A2DA 2FT6A 3CDZA 1CYXA 4E9YA 1RZPA 1XB8A 1OE2A 3X2QB 4FA7B 1GS7A 1AQ8A 2FWLB 3MBWB 6PAZA 5I6NA 1L9OA 4WTQA 1E65A 2DYSB 3PPSA 4DP6X 2VM4A 3N2JA 4A2GA 2MTAA 2AFNA 5ANHA 4G7SB 1NIDA 3NYKA 5A7EA 3EHBB 2BW5A 3ABGA 4KNTA 1DYZA 4K9JA 2BP0A 1JZIA 1TEGA 3AG2B 1AS7A 2DWSA 4RH4A 1YLBB 5EHFA 3IN2A 2YAFA 7PCYA 2IWEA 2TSBA 2YAMA 2GBAA 2H5UA 4X4KA 1CC3A 3FSWA 1N68A 1XMEB 2YXWA 5F7BA 2FJSA 2XV0A 3IEAA 2YARA 2HX8A 4BXVA 2CALA 3TBCA 4UF7C 3AG1B 2I7OA 3FU7A 3S3BB 1WAEA 3CVDA 1GS6X 3S8FB 1PLCA 3OM3B 1R1CA 4W1TA 1FWXA 2UX6A 2IH8A 3GYRA 3G5WA 4AX3A 2PCYA 1RKRA 1NIEA 4HALA 2XV2A 3IBOA 4YSEA 4DP4X 4YSSA 3NJHA 4BWTA 1NIBA 1SF3A 1IBZA 2DV6A 4HCFA 1M57B 1BYOA 2FNWA 3NJIA 8PAZA 3ABKB 1NWOA 4AKOA 4A2HA 3ERXA 1ZDQA 1AZBA 3WG7B 4ZK8A 4DP5X 4F2EA 3HEIB 1AANA 3KW7A 1ILSA 2ZONA 5I28A 1PZAA 3ABLB 2J55A 1ET8A 2JKWA 4BK5C 3S3DB 4A2FA 1ASPA 2I85A 3AY2A 1L9QA 5I26A 2DWTA 3UGEA 3WNJA 3EH3B 1AG6A 2LLNA 1J9SA 2FT8A 2XX0A 2XU9A 4GP5B 4E9QA 3NJKA 3T6ZA 3CDZB 3H4FA 1AACA 1BQRA 4KO6A 2QDWA 2UXFA 5B7MA 1L9RA 1A4CA 1GY1A 1BXVA 3UABA 1OE3A 2IDFA 1SF5A 2OV0A 1HFUA 2BO0A 3C75A 1XB3A 1CURA 2QPEB 3FPXA 5B1JC 5B1AB 1ILUA 4AKPA 4YVNA 3AG3B 3U25A 1KBVA 1WA0X 2VW4A 3UACA 1KCBA 7PAZA 1ETJA 1AZUA 2JXMA 2WO2B 2EINB 2FTAA 2XLLA 2GI0A 4KNUA 3T71A 3D12B 3SBQA 1ZDSA 1PNDA 3NSFA 2VW7A 3QPKA 4GP8B 1PY0A 1L9TA 3OQRA 3TBBA 4DPAX 1QNIA 3X1NA 1XB6A 2WO3B 3FYIB 3QJUB 4Q89A 4DPCX 3FSAA 3V9EA 1KGYE 3QJVB 3WIAA 1L9PA 4L0PB 1NDTA 5B7EA 4AZUA 2X87A 4GXFA 3DTUB 4N8UA 3FU7B 1EZLA 2IAAC 2FQFA 4M3HA 1ZIBA 2B08A 2IDTA 5D4HA 1ASQA 3ZBMA 4AKQA 4YSUA 2XV3A 4JHUA 1ADWA 1W8EA 1M9WA 1HAUA 3ASOB 1BXUA 1GW0A 1SFHA 3GDCA 1SNRA 3X1BA 1BXAA 3NJJA 3OD3A 1MG2C 1SJMA 3UAEA 1E30A 3ZIYA 4PAZA 2IDSA 2CAKA 2UXGA 2FQEA 1PCSA 2JFCA 4DP9X 1BQ5A 1NTDA 1GR7A 2ZXWB 2FT7A 2BP8B 2YQBA 4G7QB 3SBPA 1JVLA 2IDQA 4Q8BA 4BWWA 4E9TA 2Y1AA 2HLEB 5F7AA 2DYRB 2NRDA 1SHWA 2RACA 3DKHA 1FA4A 1OOWA 4YSTA 2DY2A 1IKOP 2EIJB 1BQKA 1JZFA 3SBRA 4DP7X 4BWUA 5I5JA 3TASA 4A2EA 5I5IA 1IC0A 4DP8X 3WKQA 1AOZA 3TU6A 4E9VA 3NP4A 4HIPA 2PP7A 1E5ZA 5E9NA 4CSZA 1J5DA 1X9RA 3JT2A 3PLYA 4NB7A 4YSRA 4A67A 1KCWA 1KBWA 4E9SA 2W88A 1VLXA 3FQ2A 4KOBA 3NP3A 1OV8A 1PNCA 1CUOA 2GB2A 3ZDWA 3BVDB 1JZJA 1PMYA 3PCYA 1AG0A 2UXTA 2YAOA 5B1KA 4ENZA 3T6XA 5I6MA 1JZHA 2AZUA 4E9WA 3PXLA 1NWPA 4HHGA 4HAKA 3OMAB 3NJMA 1J9RA 2BP8A 5I6LA 2GHZA 2PP8A 2AANA 3AZUA 3PAZA 2IWKA 4A68A 2H3XC 1W6WA 4DP1X 1ET7A 3QJQB 4NAJA 3AG4B 1NPNA 3KW8A 4GYBA 1ZV2A 1KDJA 1FFTB 2PPEA 3CVBA 4QLWA 2P80A 2PPAA 1OCCB 2XWZA 4G70B 4YSAA 5FC9A 2XYBA 1PF3A 2QDVA 3NJFA 2CJ3A 2VMJA 3NSCA 1HAWA 4HZ1A 3PAUA 1GYCA 2E86A 3QJSB 1J9QA 3BQVA 1ID2A 4JKNA 4BXSV 3CZUB 5TK2A 2XUWA 3QJTB 5PAZA 2P80D 2CCWA 2YAHA 2Q9OA 3NJLA 3QQXA 2XXGA 2HRGA 4YSOA 1OF0A 1SHXA 1ZPUA 2A3TA 2IH9A 3TA4D 1IBYA 3X1EA 4YSQA 1DZ0A 3NSYA 4YSPA 1V54B 2W8CA 1W6LA 2AVFA 2BW4A 1IUZA 3FPYA 2R7EA 4EF3A 2BZ7A 1OCZB 3ZX1A 5I6KA 1UATA 2UX7A 2XXFA 1J9TA 2XX1A 4FAAB 4P5RA 1JXDA 1AZCA 1MZYA 1KDIA 3T9WA 2BZCA 2I7SA 2VW6A 2FQGA 1SFDA 2HRHA 3FSZA 1JXFA 1L9SA 4KO7A 3IN0A 4DPBX 1V10A 2HZHA 3FS9A 5I5MA 2PP9A 2GC4C 1WA1X 1PZBA 1AIZA 5B1JA 1AAJA 3DIVA 4KO5A 1BAWA 2OJ1A 2PPDA 1PZCA 1ET5A 4N4YB 3ABMB 4YL4A 2AZAA 2YXVA 5D4JA 1OE1A 1A4BA 1JOIA 5D4IA 6PCYA 4KO9A 1EHKB 3X1GA 2YAQA 4YSDA 5B1BB 4UAHA 1ASOA 4HCGA 1AS6A 3FU8A 2GC7C 4QKTA 1E67A 3L45A 3CVCA 3FQ1A 3T6WA 1PLAA 1WA2X 2EIMB 1M56B 3H4HA 2IWFA 2Y69B 3H56A 1TKWA 3FT0A 3IE9A 2PPCA 3FSVA 2HXAA 2VM3A 4WKXA 1AZNA 2ZOOA 2VSKB 2Q5BA 1TEFA 1I53A 4BDVB 1V55B 1JXGA 2HX7A 2VN3A 4KNSA 2X88A 4DP0X 1AZRA 5I6OA 4NERA 4AI7A 1J5CA 1JZGA 3NT0A 3OMIB 4KOCA 1AR1B 4GY4A 2J5WA 3JTBA 2BWDA 1SDDB 1N70A 3UAAA 3NJNA 1B3IA 1A3ZA 4G72B 4DP2X 2VSMB 3NJGA 1A8ZA 1A65A 2QT6A 1NINA 1T5KA 2H47C 1QHQA 2B3IA 2YAPA 1CYWA 4YSCA 5B3SB 5B7FA 3V9CA 1TU2A 3UADA 9PCYA 4HHWA 1F56A 1KYAA 2R7EB 3FQYA 1JVOA 1BYPA 4P5SA 3EF4A 1ZIAA 1KV7A 1JZEA 1GS8A 1NZRA 2N0MA 5IY5B 1NPJA 3QJRB 2CUAA 1MG3C 5TK4A 2OCCB 3MX0B 2PPFA 4W9ZA 3N55A 4G7RB 4GP4B 3GXUB 2QPDB 4BDVA 1A4AA 3FYEB 2UXVA 5AZUA 5AKRA 4F2FA 1NIFA 3AW5A 1WS8A 4HCIA 1SDDA 1GY2A 1BEXA 3WKPA 2BWIA 2BHFA 1RZQA 4YVUA 2WSDA 4E9XA 1MZZA 3X1FA 5PCYA 2GSMB 3S8GB 3RYMA 4F7KA 3ASNB 1NIAA 3EH4B 4PCYA 2CBPA 4G71B 4MFHA 4JHVA 3HB3B 3T6VA 3PAVA 4A66A 2MRYA 3EH5B 1AS8A 1PLBA 3WI9A 2HX9A 3OMNB 1NICA 3FU9A 1E5YA 4UANA 3WNIA 2J56A 2EILB 1PAZA 3NSDA
chains in the Genus database with same CATH superfamily
1EEYB 1CMOA 1N6VA 5I1LB 1RK0B 4AM0Q 1UM4H 3HI6L 5FYKL 1OL0A 2BC4B 4HQQH 2Z34A 1CG9B 2MMXA 1JERA 2JKXA 3D39A 1X6NA 1CF8H 1EAPB 5GS0L 1JNNL 4S11A 2WXOA 1MCHA 4JY4B 4MJID 2WIIA 4QRAA 1RIUL 3FFDB 2X2JA 1F5WA 4E9YA 3RWEB 4O9HH 1UURA 1L5GB 2AQRA 4H20H 1FNAA 6PAZA 3EG9A 5CLZA 4P2QB 1S7XA 2VDOL 4NT6A 1R75A 1AVAA 3P0YH 1D5RA 4X5PA 1FZMB 4UBDD 3QWNA 4BUGA 5L9DL 4H8VA 5C09D 3QZMA 5DJCA 4P9HC 3ZW3A 1RMFH 3MJ8B 3U79A 1AHMA 2BP0A 4JRXB 5LNEA 2R0LH 1DZBA 3QUHA 4TNWK 1SMOA 2DWSA 4WWKA 1A2YA 4FFZA 2VITB 4FERA 2BP5M 1J9CT 1LK3L 3BUDA 3I3DA 3KXFE 4CJ0A 3L3KA 1ML0A 3SOBH 1NBVL 2QV2A 2Z93B 4Z3IA 3M46A 2VOTA 1Q38A 4UIMB 3P54A 3JV6A 3H3KA 4KH2A 4P5TC 4YDLB 3ULVL 4M6OL 3R1GH 3MLZH 5GGRY 5KJRL 4YK4C 5CZXC 1QP1A 4TUJA 4OZHA 5EWIH 1NC4B 1QA9B 1H6UA 2PR4L 2QHRH 1Y7VA 2EZ0C 2XWXA 1F4WH 3S5YA 4G5AA 5DMIL 4ZZFA 4TUKH 3GSNL 5HDBF 1U6AH 3NZ8A 5DU7A 2PN5A 3GRGA 4P0DA 3V7AG 1GL4B 1HHIB 5LJYH 5IMMB 2Z91A 3EYUH 1FWXA 4DETA 3O2DL 5L2JA 5E2WL 4U33A 1LNUA 3S4SB 2LQRA 5J1AB 4XMXA 3QG6B 1EAQA 1QR1A 1TQTA 3B2PA 3ZGHA 1CXEA 4HAFA 1SBBA 2XICA 4OZGE 2AQ1A 4QYOB 2NYKA 5SWSA 5M7QA 3VWJA 2C26A 1KULA 1Z9MA 1CXFA 3HUJB 3IB4A 1OAZH 3KW7A 5BNXD 1OALA 2IGFH 1VFUA 5DRNA 5C71A 2ITCA 3EGSA 4R7XA 3VE0B 1F8TH 5DUBA 5B4MD 2P7TB 1HZLA 1PX3A 2IXQA 3LN4B 2ATKA 1UD3A 3CFKA 1Q4NX 3MRQA 3WAKA 5CD3B 1P5UB 1EQWA 2WKLA 3EH1A 3QIWD 5CU5A 1S46A 4PJ6A 2NZ9C 3F5WA 3X13A 1BAGA 1CBVL 1G7MA 4XCCH 1OB1A 4OJCA 3KJ4B 4KTEL 4WK2B 5A3IC 4NO2B 2GFBA 2QDWA 4ZO8A 5FYLH 4M8UA 2LU5A 1A4CA 1IEAB 4J23A 4GEJA 1AC6A 1FO0H 5DD1H 1GXEA 1CFTB 5I1DB 4DN3L 5GGVL 2VXUH 2YLKA 3DOHA 4UT9H 3TVMA 3Q8EA 1N3NB 5GGUA 4ZNEE 1A1MA 1IC7L 4NPYB 1T0NB 4TNGA 3RUGE 5AUMB 1KCBA 4TUOB 1Q72H 4YLBA 1ETJA 3RJDA 2EINB 4ZUSA 3DX1A 4QR7A 1YAIA 1AYOA 2IGLA 1G6RL 3D12B 1S7UA 1XV8A 3ASWA 4IBLT 3FUDA 3HS0A 1HE7A 5INDB 3ESVF 2MJWA 3OQRA 4ZTOL 4XVSH 4YHYC 4N2DA 4TNFA 2QVIA 3QJOA 1TQBC 2AKRB 4O2FA 4WSJA 5DVLA 5J4MA 4M4PA 3SHSA 3IDUA 3K6IA 3OKNA 4CU8A 4YSUA 1MW2A 1ZIBA 3PL6D 5HHNB 4IKIA 4X8GA 3DV4B 1BM3H 3VWKA 4D0CB 1HXKA 4IS6A 3CU7A 4U6TA 3NEOA 4CU7A 2O61B 3FUNA 4XBEH 4P5MA 1O5PA 1RZIB 3DTDA 4D8OA 3ZZQA 3CZFA 4JPSA 2JLLA 4WK0B 2K0RA 2GEQA 1IL1B 2XWEA 3DVFA 3POCA 3LNIA 1LWRA 5KVFH 4Z7OB 1CDGA 1S2EA 2J8UB 2VKXA 3TA3D 4UZGA 1PCSA 5CLTA 2NY3B 3RKDD 3KWTA 1NTDA 3MBEA 4J39A 3O6LH 3FF8A 4TRPH 5B38A 4ZAKB 2JKTM 2A7BA 1UKSA 3DRQB 4HXAL 2PWFA 4JW3A 1L6XA 3AXHA 4IMLB 2DLHA 4JO1L 1YEJH 5EZJA 2WCSA 3MO1B 2RACA 4OSUH 4QRUA 2DY2A 1IKOP 2WIMA 3O6FB 1I3RB 4N90D 4LIQE 3RVWC 3VI4A 5HYSB 1JWMB 3VGAB 1OGSA 1NEUA 1A9EB 4JKPL 4QGYA 5DSCB 1PIGA 1E5CA 1T21B 3MOQA 3CXFA 2D8KA 4NM4H 1S4IA 3BUYB 1A14H 5DZPA 1KCVH 4N2MA 5AYUH 1PPIA 5IGXH 1UH2A 1OV8A 4XNXH 4HIJA 2H6PB 2EKSB 3F7RA 3C6EA 3MROA 4P9ML 2ZCLL 3MRNB 4CW1B 1JZHA 2L4OA 1XX9C 4M5SA 4GFXA 1OP5K 4OLUH 5FLUA 5CEZE 3NJMA 1EHAA 1IFGA 2NX5A 2Z31A 1HINH 3VD5A 4PJCF 4UIKH 4BEIA 4Z78A 5DK3A 1E9QA 1LDSA 1GVIA 2H9GB 3I9GL 1W6WA 3BYTA 2QPFA 1AO7B 4FQIL 4QRPA 2IADB 1IGYB 3FH5A 3WXWL 5CZVL 4OI8A 3KW8A 4F33A 4PJAF 2YR3A 3OQ3B 2XWCA 4KXCA 3EDFA 3GJFK 2AXWA 1S7VA 2KH2B 4HUXA 1P7KB 3CZJA 4XXDB 1TZIB 4BKSC 1OT2A 4FXGB 2ZT9C 4XMVA 4EVNB 2AV1A 4DERA 4ZS7H 4DQOL 4XPHH 4MA3A 3SPHA 3J7HA 3FMGL 4HOZA 1MN4A 3MREA 3BQVA 1RZ8A 2QFPA 3MU3A 4BXSV 3U0WH 1MJUH 1UM4L 2WXMA 3CZUB 3SE4A 2OXGB 2Y1ZA 2XUWA 3DLQR 4HQQL 4IOIA 4AGOA 3TTYA 4Z76A 4L4TE 3IRPX 3APFA 1CF8L 4HA1A 3LPWA 4CSSA 5SX4H 4YSOA 4P2YA 3BEWA 4KH9A 3KYKL 4AVKA 2NR6D 3HBQA 2X09A 4JFQB 3OR6A 4BK8A 1XR9A 2OMVA 4O9HL 3ENEA 1OTUC 1TJHH 1UATA 3Q0HA 3IGUA 4H20L 3UP1A 3DO4A 5KS9E 3HMXA 4P5RA 2F5BH 2QPSA 1OWRM 4JAMA 3TEYA 1KOAA 2Q20A 4JLRB 4MNQA 4X98A 3P0YL 4MCYB 5F7FA 1X5LA 4YFLF 2MKLC 3VAEA 5T1KA 1SEBB 1XGQA 4GUCA 1CS6A 2AEOA 4ZG1A 2G3XA 1ZAGA 1NGPH 4K5NA 1F11B 2R0LL 3KM1A 3L3DA 5JXED 3LH9A 2ICWA 2VDNL 5C97A 1XCTA 4GXUM 1AIZA 3DX6A 1AAJA 1KJ2B 4LPUA 3SOBL 3D7PA 3OG6B 2Z65C 4OM1H 1NC2D 4YN3A 3N44F 1OE1A 5D8JH 3PQYE 3MLZL 1D9KD 1XF1A 4XN8A 5GZND 1EHKB 2J1WA 5EO9B 5EWIL 2YAQA 1N0LB 5KVEL 1P5VB 3KL3A 4HCGA 1DQLH 2QHRL 3T6WA 1F4WL 2EIMB 2W60B 4ZX5A 3ZQWA 4TUKL 2QKSA 3VXSE 1WDAA 4R96A 4P4RB 3TIDA 1Y18A 5HDRA 3WAJA 5SX5H 3WTXA 5DWPA 1ONQA 4BM7A 4ORZC 3ARUA 4L3EA 4RZCA 1BZQK 5C2UB 2WZAA 1WCQA 4GQQA 1QSFA 2V8LA 3QZWG 1TEFA 4L37B 3U2SA 3HHSA 2CUIA 1JXGA 2F54E 4M7KH 2X9ZA 3BN9D 4FNUA 1MUJA 2BM3A 1GOHA 3UFIA 4I9WD 4PH8A 1FFQA 2IOMA 2Z31C 3LRMA 4FZ8H 4ODBD 4Q74A 1OAZL 2YPVH 4YDVB 5IESH 2IGFL 3NG5A 5IVXF 1YY9C 4HGWB 4WAFA 1OHZA 1F8TL 4Y8DC 5FYJH 4QJ4B 3B9AA 2ZUSA 1QBLH 1YMMB 2X2IA 5FYJU 4BSWB 5K9QI 4CN1A 3TC9A 3DUSB 3JTSA 3VXPA 4R3SA 1QBBA 3QDAA 3DUUB 1Z66A 4XBPA 2OZ4A 5C0DB 3MRMA 4XCCL 1FG9C 2R7EB 3QCTH 1OGAB 4R4BB 1U95A 1JVOA 2RCSH 3SKMA 4F7EB 5FYLL 5BOZG 1SOSA 3SE4C 1ZVNA 2X4PA 5DD1L 1GS8A 5E6IC 3IU4L 2ID5A 2VXUL 5CJQH 3VD3A 1LQSR 4TQHA 5TK4A 4W4OA 4TNVK 4UT9L 4XP6L 3OF6D 1TYJA 2QVTA 3EKCA 3GXUB 3FCBA 4K94L 4TSCH 2OMYA 1TZ8A 1Q72L 1BCIA 4UNVA 3GLEA 5DEGA 3VXUE 4DPRA 5J11B 2J73A 3HAEG 2WSDA 4V2CB 4WU5B 2COVD 4I13B 4KHTL 2G5RA 4XVSL 4F7KA 2AK4D 1KB9K 3CBJB 1NOFA 3W56A 1O7SA 4H1LG 5C0CE 3SPVA 4HWZB 4YGAB 43CAB 5IKCA 2OW7A 1HU8A 4HUWA 2OTUB 2N7AA 4JFPB 4HUVA 3HN8A 5AOKA 5GGSY 1IBGH 4JFDB 1TDQA 4PS7A 4JE4B 1UWFA 2HX9A 4A37A 3ORJA 4FNPA 1DANT 1U3ZA 4GI8A 4FXKB 1BLIA 1P4IL 5JW3H 3BPNB 2DYPD 3GXFA 3R18A 5BO1H 5L6YH 1VFBA 5B22A 1R24B 4G9FD 4ADGA 4PJGA 1X7TA 3TZVD 5FM4A 4LHQB 4KI5D 4O51A 4XNZB 1XGRB 4AG4H 4LGRB 1FPTH 5KVFL 4KKAC 3WL9B 4K0OA 2ARJA 1IQDB 2VO5A 4NN6B 5I1GL 2EVJA 2Q2EB 5D2LB 4QRTA 3NH7H 2N7SA 3O6LL 2Q87A 2LU7A 4PBXA 1MDAA 5FA3A 3VFGH 4CSPA 1UJ3B 2CO4A 4UU9B 15C8H 3OKOB 4KGJA 1J1PH 5I9QB 5I18L 4ZPVB 1CYXA 3C09B 4L23A 1G6VK 1RZPA 1YEJL 4P2QE 1D5MB 4HETA 1XGTB 1C5CH 3CSPA 3H7BB 2ZICA 4QGTA 4OSUL 4A7SA 1L9OA 4LCIL 3DECA 2BJMH 1JJUA 4M6MH 4NI6A 4X7CC 3PPSA 5DHVB 4DP6X 3HHRB 3IPFA 5E99H 1INEH 4OGYH 5DRZA 1F2XK 4YHOH 3D3VD 4JRXE 5JDJA 2WZ5A 1HDMA 5ADPH 4PJBF 3TYGH 3K46A 4BGDA 5BQ7A 4PJFB 3MBXH 3LPOA 1G43A 1RZ7H 4LSVH 4XO8A 3EO0B 5F3FA 4AVIA 4TKWA 3TN0A 4QHPA 5A2KH 2VXQA 2ZP9A 3LNDA 4NM4L 1A14L 2V5RA 3GO1H 4EI0A 1KCVL 2WLHA 4X4XA 1HEJC 5IGXL 4KFZC 3KLAB 5B3JE 2H5UA 4M7ZB 2AXGB 3ZY7A 2R2CA 4Y16B 5DK2B 3C5ZC 3FU3A 5A2AA 5I8CB 2XV0A 4ABUA 4BKTC 4OLUL 1R33A 3GBNH 4PG2A 1XZWA 1HINL 5E0FA 5DC0A 5BS0D 3D0VB 3EJPA 3P9WB 3Q8CA 5E8PA 4UIKL 5BJTA 4X6CF 2CALA 3O6FC 1UD2A 3KM2A 4KKBC 4W4OC 3STZA 1WWWX 3BVNB 4YO0B 1SHMA 5IOPB 5JHDD 1QOKA 1KPRA 1AD9A 3QUXA 4GBXD 1UZ8B 2HFEA 3ARFC 3VYNA 1QHOA 1B0WA 3GXPA 4OZGF 4U4IA 4P3CL 4ZS7L 4XPHL 2K6ZA 2HJFA 3VGBA 4MS8D 3AREC 4P5KA 1H8NA 3HUJE 2AJ3B 2ENQA 3RGBA 1MJUL 2Z8VC 3U0WL 4A2HA 1WFTA 3ARBC 1AZBA 4N9OB 3QEQB 4ORGA 5BZDA 1EO8L 1H0DA 1WZMA 2ZXQA 4GKNB 4XR8C 3SQOH 1PZAA 5AVWB 4TPRH 1IGCH 2WVVA 3CLFH 1F18A 3T1FB 5D9SA 2R23A 3TESA 2YBRA 1BFTA 3RL2B 3ES6B 4GRWF 1EZSA 1QD0A 5EPMB 3II2A 3JXAA 1JV5B 1FYHB 3BGMA 1J9SA 1TJHL 5J6GB 1JN6A 4ZMVA 2XQYK 3UG4A 2F5BL 1D7BA 5KSAC 5E51A 1NBQA 1OAQH 2WXHA 1TJIH 1I1AB 4B9YA 3KCPB 3ZR5A 2BRRH 1YUKB 4KVPA 5DWUH 4JJOA 1QFPA 4WEUD 2VMFA 5DJAA 4N20A 3VI3A 3A0OA 4EIGB 1KY7A 4GSDH 5AAWC 1MCFA 5MEOB 3WN5C 1BWMA 4F37K 4MJIA 2GT9A 4OM1L 2WO2B 1I7UB 5J1TC 4MQSB 5D8JL 4G82A 3O9WB 3Q8AA 4MNHA 2R69H 5C0ND 4WTZG 5G2NA 5EEZA 2CRZA 4M29A 1DQLL 5LHDA 4WW2B 3HLAA 2DKUA 5CBEA 1HH6B 1XIWB 4FQ1H 1O7DE 4DPCX 4GIAA 3P3SA 5DJ0B 2EE0A 4XCYA 4IOSA 5E8OA 1GKEA 4OFDA 5D7KD 1NANH 4ZFFA 2ZAIA 4MAYB 3QR1A 3L9RB 3PHOA 4LCWD 4Y88A 2C7FA 5D4HA 5KG9B 3OAUH 3KPRB 4JHUA 1NH6A 4HIQA 1FIGL 1CPUA 2WBKA 4AMWA 3HOGA 3VQ2C 5DC9B 4M7KL 1WRFA 5BW7A 4IJ3B 4Z7OE 1JHKH 4BQCA 3HRZC 4Z0XB 2J8UE 4FZ8L 5CGBA 2OCFD 5IESL 2YPVL 3LN5A 4AW4A 5D1QB 4LLVB 4YC2B 4NUJB 5HGDA 2NY0D 4BH7A 1G7LA 1MCQA 5FYJL 2FQEA 2GK2A 4N2GA 4HJ0D 3D52A 1DCEA 3FUHA 3QGVA 1YDPB 3MV7B 3ULUH 2I27N 3KVDD 3FT4B 3OMZA 3UAFA 3G5VB 4WCYH 4KZCA 2R2EA 4WV1B 3QRLA 3PABB 4AGLA 1WBYA 4Z7NB 1IIIA 3QCTL 4U7SA 4F2MB 4BZ1H 2RCSL 1KB9J 4GO6B 1SYSA 3MRHA 3VXTB 1DVUA 2O6PA 2H7WA 4BD4A 1JZ7A 1NMCC 1AQDB 4KMQA 1U3HB 4CNIA 3VD4A 2JTDA 4WI6A 1M7DA 1DN0A 3WIIL 1DVFD 3ATDA 1NEZB 2D9CA 3A6BL 4OUUA 1BECA 1MCSA 5LBGA 4YBLB 3WCYA 2W91A 4DOHB 4HULB 2VLME 1J5DA 1Y07A 5D1ZB 4YSRA 4XNQA 4JPQA 5MENB 3NFPA 1KV3A 2WSKA 3ISWA 3L9YA 5E9DD 4KOBA 3NP3A 4JY5L 4MYWB 1X5AA 2F15A 1AG0A 3GZKA 3EO1B 5EZIH 4E9WA 1F1GA 5J0BA 1XF2A 4ZO7A 1O6TA 3TL5A 1M1XB 3MRPA 4LKCA 2WHVA 4MRBA 2YGQA 1AO7E 3VXMB 4EZMA 5EEUA 2NMSA 2HFFA 3AZUA 3MJ7B 1SJEA 3HG3A 3H3PH 4BA0A 1EHXA 1S9VA 3EOAB 1KB5B 2GUOB 1NBCA 2GKIA 3MGTA 2HT3C 1IBGL 1BFOA 3EGXA 3IDJA 3ZYOA 3WFHB 1DFBH 4LHUB 2OQJB 2HTLC 2X9WA 4R84A 2V37A 4CL7A 2P80A 2VAAB 2VZ3A 5JW3L 1HQ4B 1N8ZB 2FLMA 3FTYA 5EU4A 5BO1L 4CVXA 4QHUB 5L6YL 3QARA 1O9ZA 2ZYSA 1U8KB 4I2XB 1ND0B 3O3DA 1YECH 3GMRA 1UKQA 1YEKH 5IHHA 3H1ZA 2ZCKH 3MRBB 3UO1L 4AJYV 1FPTL 2Y7QB 3CN2A 4L0ZA 5EFIA 1FYTB 2G4GA 1BGXL 1IKNA 1NBZA 3NH7L 5DURD 4UBDC 5E4EB 1SHXA 2A3TA 2ZNXA 1S7WB 4CAGA 3QPXH 5JQ6H 2ZUUA 1IBYA 2WC7A 3VFGL 3ILQC 1DZ0A 2A74C 4YSPA 5T1JA 15C8L 1G7QB 1W6LA 1J1PL 3QHTC 1EGJL 3KS0H 3T0XA 3KNBB 5KS9F 3N3EA 5DJZA 5A40E 4QXUH 1C5CL 4YL9A 4L9DA 1KJ3H 1I7RB 1MI5D 1IAKB 1VCAA 2PW2A 2VAJA 3KPPA 4ICWA 5DEJA 1NL0H 1FORH 4HIXH 5C0JB 2G9KA 2BJML 3POHA 3O3BB 4M6ML 3BVXA 5ICXB 4LL9A 2ICWJ 1U42A 3RNKA 1INEL 1E9OB 2J8OA 4OGYL 3VXQB 1E9PB 4XP1H 4YHOL 5ADPL 3ETSA 3TYGL 2HRHA 4LNVA 3ZDZF 1UWYA 1CFQB 2ZXAA 3HPLB 3MCKA 4W9CC 3OSKA 3MBXL 2Y25A 1RZ7L 4LSVL 2FH8A 1M05B 3TA3A 1BFVL 3VVVA 3TFKD 3VCLB 5IHUH 3RZWA 1GYUA 3GO1L 4A63A 5TDPA 3QI9D 5BRZB 4P4KD 4PY7A 3SDXB 3ZXAC 5L2KB 4R8WH 1Y0LA 3NCYP 4O00A 4NZFA 2R1XB 1A4BA 1UJ3C 3BZFB 2DI8A 4NQCA 3GBNL 1PU0A 5L4FA 3C09C 4YSDA 4U6VH 2E5EA 4CGTA 4MA1C 5CS7A 4JK0D 4JQIA 4YOKA 1VFMA 1ADQL 1FDLH 2UZXA 4CUCA 1M56B 1OK0A 3QUMA 2ED6A 4L5FE 3IJSB 4BGLA 4I5BA 4ETQB 3ZT7A 1CTOA 2CO7B 3SQBB 3T77B 3FHAA 4DO6A 1TQSA 3KLHD 2ENPA 5B4MC 1K5NA 1MCPL 2HXAA 2FX9H 1AHWA 1T5XB 3MXVH 5FV2A 3ZMEA 2OK0L 3SJVB 1PS3A 2OL3H 2BY0A 3NN8B 3J07A 3LRSB 1BLNA 3O6MH 3P77A 3QIWC 3U9WA 2VN3A 1BIIB 4J28A 2GBVA 5JOEA 1IGFH 1T5WA 2K7PA 3OMIB 4U6YB 3B6SA 4GY4A 1NFDB 4HWNA 1SDDB 1PTZA 2VLJD 4N0UB 1YMME 3SQOL 4TPRL 2EDBA 1IGCL 1PJWA 3CLFL 3CHOA 5EO0B 4YX2L 3DX4A 3CDCA 3NJGA 3O11A 1NCWH 1A8ZA 3VX0A 2UYLB 4UQCA 3PWVB 1Z5LB 1KYFA 1L4IA 3FTUA 3OBAA 1XGZA 3V52H 5IG7B 2YAPA 1OGAE 2WQ8A 4PTUA 2VSDA 2E6JA 3L7FA 1ZXQA 1CDBA 3QFDB 4HK0B 1UOKA 3FRPG 2PWEA 1OAQL 1TJIL 4HUUA 1LEIA 3C6LD 3FXIC 4PWGA 5IFHL 2ETWA 1OO2A 2BRRL 4PD4J 5DWUL 1U8LB 3BAEH 1CI5A 1KJVA 1CFSB 3A4AA 4LCUB 4JPIA 3MX0B 2PPFA 2J6EA 4XOCA 1IVTA 3N55A 3PGCB 3IXTB 5AL0A 5DVNA 2UXVA 2NUPB 4F2FA 1M6OA 4WIQA 3RFRA 2AXFA 4F7TA 1Q8MA 2X6CA 4P2RD 3PL6C 4XE0A 3DA0A 4UAOB 2NY1B 4A2MA 1BEXA 2QELA 2R69L 1Z0MA 1AXSA 4CADA 4G80B 2GSMB 2NY5C 4XPAH 2OMUA 4JE0A 1N5YH 1PBYA 1KGJA 3PP3H 4FFYA 1EJ8A 4FQ1L 4IRJB 4JFDE 4LIQL 3HB3B 4MNGB 3SYCA 4A66A 3PIQA 5JORB 3W3BA 1IBFA 2OLDA 1C12A 4IIQC 3D25B 1LEKA 1QKZH 3TA3C 1L9NA 4FQPA 5FGCB 3WTSA 2B5IB 4R2GD 5JXEA 2V2XB 1JMXA 2R27A 3RKDC 4XNYH 4CN4A 1MW0A 4HS3A 2B1AH 3BRDA 2ZG3A 3OAUL 5A43C 3TOPA 1M7IB 4JJ5A 4TNVF 2JQAA 2Q7AA 1IJNA 4AQ8C 1MFDL 1JZ5A 1NC2A 1YHPA 4MQ7B 3B9KD 1JHKL 3FKUS 1J8RA 2H6OA 4Q9CA 3RGVB 2MFNA 3ECQA 1D9KA 3R7QA 5D2LE 1I8UA 2RALA 3O9WC 4Z7WF 2FSEB 1DSYA 3L2NA 1TO4A 4NO0B 3U7AA 4P2OA 2PLTA 5IHBA 2L7QA 4K3EH 3WXVL 1HT6A 1RCYA 3LDBC 3ZZ1A 4ZYKB 3ULUL 1RJLB 3MV8A 4C55A 1I82A 4WCYL 2AP2A 3RIFK 4ODXA 3CMGA 4HIEA 3BD3A 3EYOB 4BZ1L 1X5FA 3OXSB 2WLYA 2VDKL 3MRCA 4HH9A 2JTYA 3FQTB 4FYTA 3VU1A 4L8CA 4PJFE 2ZTBA 2IANB 3ATAA 1MELA 2BVTA 3UYOD 1DUYA 5F0PB 4ABWA 5IMLA 4XOAA 2C3VA 2VUOA 4JDZB 3GBEA 5I74C 3T0BA 4YZFE 2QL1A 2X3BA 4OD2B 4K2UH 4KKPA 3IJ8A 3E0GA 5BUPA 2CDEB 2W9DH 4G9DA 4NXSA 1SPDA 4U1JB 3LZFL 2QTVA 3S3PA 1AGEB 2DBLH 3VGHA 5I0YA 3BP4A 2JCCB 4AL8H 5HVGB 3SCMD 3CX2A 5ACMA 4K4KA 1JRHH 3NZHH 3OKYA 5EZIL 2L7UA 3C87A 1X44A 5HI3D 1SYVA 2GJ6D 4BFIA 4OZIF 1F3JA 3BZ5A 4U1LB 3IEAA 3FNKA 5JQHC 2NNRA 5KYYA 2YUXA 2K6WA 5KYNA 4PGDB 3ULSB 2MNJB 1UWXK 2CBOA 1G7JA 5TTRA 4G8GA 3W9EA 1E2WA 3E80A 3JWDL 3GM8A 3CVDA 1S5HA 3GMMB 1GS6X 2DQIH 3GSNA 1DBMH 3ECUA 3JYCA 3QYNA 3OF6A 5FM5O 3ZHFA 1LO5A 4NQED 4OQTA 3ZTNH 4B53A 3MNZA 4Z7QF 5JMOC 1NAMA 2NR6C 4AX3A 1N19A 1BJMA 5D6CA 3HUJF 3EXLA 3QEQE 1YECL 5C0GA 1U8CA 8PAZA 1WWCA 2MNWA 2PWGA 1YEKL 2YMXH 4ZFZB 3ABKB 2APSA 5AEAA 1T03H 3G5ZB 2CK0H 2ZCKL 3O3AB 3RIAK 1VENA 3ZJAA 2XWBB 2DMCA 2ZOWA 3MRDA 3IFNH 4ZD3H 4X8CA 2NCMA 2A99A 2AK4A 4FQJH 1A7OL 4QXGH 2W80C 1NGWA 2EE6A 4PY8I 1FP5A 3QPXL 5EB9A 4DGYH 3D39B 5JQ6L 1BP3B 1F4AA 1CLYH 5DRXA 4U6HA 3GXDA 5C1MB 1VSCA 1MCWM 5IB4A 4QXUL 2W0LA 1KJ3L 2V9TA 2WIIB 4H1LA 2YGVA 3IWUA 2X4SB 3NJKA 4GB9A 1FORL 4HIXL 2O30A 4Z5RB 1BQRA 4PJIF 1TF4A 4XZUA 1F3RB 5CIPH 3NMEA 4XP1L 3TZVA 5GZNC 4W9JC 4JPVH 3EG9B 4JR9H 4NM8H 1S7XB 1HC1A 1J8KA 4NT6B 5EU5A 5CSZB 2QV4A 5B1JC 3PPEA 4YVNA 3AG3B 5FB8A 3RVXD 5DA0B 4DEUA 3WTVA 1KGCD 2Y1VA 2KLRA 3SGEI 4KC3B 4O02B 4WWKB 4R8WL 3S5ZA 3SYAA 1A2YB 1V3KA 2BVQB 3CHXA 2FTAA 4FFVD 3EJRA 4AT6A 2R29H 3L3KB 4WFGE 3O2VH 3UBXB 3G6DL 8CGTA 1MCRA 3S36L 3OC5A 1YC7A 3QBTB 3BN9C 1TITA 1R5VA 4F5CE 2LAGB 4TUJB 5SV4A 3H9ZA 3FYIB 4BFEA 1ZA6B 4EUPG 4X9HA 3EJCA 1BPVA 4AZUA 5F7WC 1NFAA 2VZOA 1WHOA 3KPRE 3BMWA 1RZJH 2FX9L 3MXVL 2IDTA 4PWFA 1K2DA 2Z91B 3LPPA 2OL3L 3WBDA 5L2JB 4Z7OF 3O6ML 2J8UF 1LNUB 4AE0A 1XCXA 4OVUA 5D1QE 3D09A 2NNAA 1IGFL 3DURA 4I0KA 1QR1B 4LBEA 5KSBB 4F37F 2EUXA 2V6HA 5SWSB 3OAYK 3KLQA 1E8YA 4W81A 2BS8A 3M17A 4Y2NA 4NN5B 4PAZA 3MV7E 5EC2B 4EN3A 5DHMC 1G9MC 1NCWL 3K4ZA 4A04A 2PXYA 3GTTA 1NGYA 4Z7NE 2BP8B 2A6DB 3EGSB 1FFNB 1WHPA 3V52L 4F2ME 5DUBB 1VESA 1JGLH 4J2QA 2KT6A 4GBXA 3ARGD 1BW8A 2IXQB 2ATKB 4HXBL 1OSYA 4DF9A 1JGDB 3MRQB 4UTAL 1J10A 1OOWA 3BGFB 5JPMA 4OM0H 2V9RA 4U31A 5IF0A 1BZ7B 3F5WB 2Q10A 2V17H 3QQNA 3X13B 2VYRE 1G7MB 1XZ0B 2I5YH 1YG9A 4PYGA 1IGIH 1OB1B 4DOHE 3DDFA 3L81A 3BAEL 5MENE 1J12A 3ELQA 4HIPA 3BYYA 4B9KC 1T1WA 2XWTA 3AQDA 4M3JA 4OCSH 1SBSH 2H32H 1OPOA 3INUH 1PZ2A 5BXFA 3DVGA 3TVMB 3PRZA 5GGUB 4I1RA 3QE5A 1A1MB 4TLKA 1IE5A 3VXME 3VFTB 5EOTA 3QXWA 2MQ0A 2WTPA 3BAYA 4PJ5A 3G9VA 2B1HL 4HHGA 4ZUSB 2XFGB 1TYEB 3QFJD 4KBPA 3U7WH 1N5YL 3V9FA 2KL6A 2X4NB 3TZVC 2O5NA 4MB1A 4AUUA 4N0FB 4H0GA 2QADB 3HS0B 1WT5C 1YAZA 4YUEH 4KXZH 4OF0A 4I4WA 1RUAH 3SD5A 4JN2A 5TF1H 1E28A 1QKZL 3ELAT 5F70A 4O2FB 1QPKA 4I2XE 2R0KH 5IBLD 3K6NA 1QATA 3QDGD 1O7VA 2XSKA 1L0PA 3OKNB 4FA6A 2BCMA 3AT9A 4DESA 3AUWB 4A39A 4TTGA 1GYCA 1WWBX 1J9QA 2ZXDA 3G08A 4IS6B 5ICUA 4JKNA 1FYTE 1YZZA 3PFQA 1U0QA 4S1SH 1CIUA 4P5MB 2OPCA 1DQQA 1GZQA 3A6CH 1FNEA 4KK8D 1E4KA 2ZP8A 4HKZA 4K7PX 4Q4IA 2O93L 4K3EL 2EDEA 4DEWA 1C7TA 4C54A 4BCXA 4IRJC 1VKXB 2PWDA 3NSYA 1YEDA 4YFLI 5EH1A 4HLZG 4XP5L 4JY6A 3MBEB 5B38B 1SXSA 2WUBH 1Z9OA 2NY6C 1ODUA 3NEEA 5TDOA 1R34A 3ZHKA 1NM4A 2DICA 4UZUA 1JXDA 1KLGA 4XX1G 1MZYA 1CLVA 1PFOA 4XH2A 5EZJB 5ISZA 2BZCA 5SWZD 1U92B 4QRUB 1SFDA 4NRZB 2K8QA 1YA5A 1NCOA 1MLCB 3IM1A 3ZGIA 1BPLB 3VI4B 2YN5A 1JYNA 5INCA 1D5XA 5BRZE 4K2UL 3CQFA 5K9QG 5L2KE 3SDXE 3BZ4A 4JQVA 2GC4C 1WZAA 3P3UA 3BIKA 1LP9A 3QNXA 3W57A 4ZW6A 2DBLL 5C0AD 5IHZA 1C1EH 5E4AA 2V8MA 1DQDH 5EBGA 4AL8L 1COBA 1JRHL 1KGWA 4L29A 1JOIA 2Y6SD 2R1YA 4I7ZC 3ZTJG 1QSED 1P9MA 3FZUD 3NIGB 4MS8C 4IBQA 3S35X 5EIIA 3BDXA 1XO8A 4PWIA 2HPOA 1NOAA 1HYRC 2NX5B 3G5YB 1DVFA 4DUVA 3OJDA 1KMGA 4R97C 2DQIL 4PGCA 4Z78B 1DBML 1D7DA 2YPKA 3V4UH 3C5SA 5CILL 5LGHH 3SJVE 5CSGA 4GAGL 4PEEA 1V7NH 4WVRA 1F1DA 2JH2A 3VD1A 2HRPH 3LEYH 4F33B 3T2OA 2P5EA 4JFYA 3GINA 1JV2A 1S7VB 2FL5B 5E9DA 2DIBA 4DKEH 1NFDE 3QSKB 3H9SA 5DXWA 1T03L 2AJVH 2CK0L 3K80A 1JTPA 4N0UE 1J5CA 4MA3B 1YN6A 2X4OA 1R3LA 2VUKA 3GPSA 3MREB 4FMVA 4LASH 2NY4B 4ZD3L 2O1AA 4A1RA 3NJNA 4FQJL 4NP9A 1OW0C 3IDMB 4FYQA 4QXGL 1XSJA 2BVUA 4DP2X 4IOIB 1G7IB 3UGUA 3G6AA 2EDFA 1A65A 3EUUA 4DGYL 1KT2A 1ETB1 3S3SA 1CLYL 5F7NC 2NTFA 3KH4A 2V5TA 4X6DA 2MEJB 5I73C 4L3AA 4QHMA 1QHQA 1NAKL 3BEWB 3WO3B 3LPGA 2I26N 4RFEA 4HHWA 1NUDA 3OR6B 3ZKND 2EO1A 1XR9B 2OMVB 2EDYA 1ID5I 1I1FA 2FD6H 2V5YA 3G6JB 1ZIAA 3FK3A 3K2KA 3BAXA 3GC3A 3U36A 3FFCA 2K4AA 4JPVL 3T0VA 4JR9L 4NM8L 5C0NC 4X98B 1FO0A 4AGPA 4BELD 4KJWD 4Q9BA 3MFFA 4OB5H 5T1KB 2WAHA 4J2XA 4UT9A 1F90L 5ABAA 1A4JB 3V2AR 3TT3H 4MRCA 3K6SA 3UYPB 4GSRA 5D6DC 2A6JA 3AQZA 3L3DB 1D6EA 2A9NH 1I9IH 3LRKA 2F0CA 4QMEA 1XCTB 3OWRA 4J6RH 5T3ZD 2R29L 3RDTD 5F9DC 3O2VL 4YVUA 1MI5A 4RA0C 4Z3JA 4MNGE 5I23A 2XN9D 1P2CA 2A2QT 2BY3A 5AW0B 4H5SA 5FGCE 4J3VA 4PSPA 3NGBC 1L9MA 4FCHA 4QTHB 4AH2A 3B3IB 4FLSA 3T2NL 2NY0C 1B4TA 4XB3A 1RZJL 4MCZA 4HJ0C 3V7MA 3EH2A 3GLZA 4R96B 3ZMNA 3VXOA 2BS71 4GW5A 3TIDB 1E5YA 1YNTA 1Y18B 2W94A 1MCJA 3CZKA 4P4KA 3TP4A 1XSIA 3BH4A 1MJJB 4GO8A 4L3EB 5D2LF 4F58H 3G5XB 3K81A 1T7XA 3WDHA 2BOBA 3SDCD 4G8EB 4LK4A 2K9FB 4MHHI 1KN4L 3U2SB 1FVEA 3HHSB 5SWQA 1ANUA 2I60L 4DSYA 5TPWH 1MUJB 4AGQA 1FBIL 1FZJB 3EDKA 3RTQD 4RDQG 1AIFB 2D03H 5F1KC 5JW4N 4PJ8A 3ML8A 4LSSH 2FEDD 3STBA 3LEXB 2QGDA 1DLFH 1I1YB 3BCDA 4W93A 1OK8A 4ODHH 4N0CD 5I8KH 1QFWH 2O5YH 1XCQA 2K1MA 3GSXA 1QUNA 1WITA 4UYQA 5AKSA 2OZNA 4EN2A 5AB2A 5C6PB 3JTSB 4PJDA 4R3SB 2IANE 2GIXA 4PJFF 4OM0L 1UXSA 3HS8A 3MRGA 1WG3A 3WV0A 3MRMB 2I5YL 3K74B 3O3UN 1IGIL 3UIZA 1U95B 4G7SB 4P57A 1BVNP 4PJHA 2VDPB 3SKMB 3SPGA 1N67A 4FZEH 3GM0A 1AQHA 1KXTA 1W15A 2X4PB 4PJEA 2VLJA 2X12A 2V7NA 4NNYA 4OCSL 1SBSL 2GCYA 5FO8A 5KSVA 1X4XA 2OJEA 2JCCE 3AABA 2JKNA 3L3OC 1XCWA 3DSNA 4ZRGA 3RVUD 2P45B 5GRWA 1YUHA 4ZFGL 2QKIA 4PRNB 5DEGB 4ZMXA 2PO6A 3U7WL 1LQBC 2OMNA 2VDLH 5CJOH 4XWOD 4YUEL 4MMXA 3H2WA 3C6LA 3L6FB 3OB0H 3ARDD 1E3XA 3MTRA 1RUAL 1MFEH 1I3GH 1XGYH 4ZFOL 3AWFA 4HIIA 4P59L 2VLKD 3SPVB 1DJGA 4HUWB 2ERJB 3FRPA 2R0KL 5C0EB 1NBYA 4HUVB 2CIKA 2ZJSH 3E1ZA 2F19L 3GTVA 2PCYA 1RKRA 3D4ZA 3OAZH 3LYRA 5DS8A 3R0MA 5T5FH 1EWHA 1W0WA 2IQAB 3QEUA 3FTGB 4KTYA 1C8QA 1SF3A 1T20A 5DFTA 1EHLL 3K8KA 4Y4HA 2WINA 3WD5H 2HN7B 4S1SL 1EJ6A 3DTXA 2LT9A 2UZIL 2CLRA 2PW1B 3A6CL 3QUZB 3RWHA 3HCVB 3D39E 5L8JB 4GG8A 2ZE0A 2HWZH 4O51B 1UEMA 2D7TL 2YEZA 1UYWH 1U4EA 4UQEA 3U2IA 1GGYA 4A2FA 1FV1B 2ARJB 2WJ5A 4AYFA 2DWTA 1TCRB 4QRTB 3ZT6A 1XXDC 4R4ND 5FA3B 2GG1A 3QI9C 1DBAH 2TRYA 2F53A 4H7VA 4LVOB 5GS2H 2EP6A 4G8FA 4PW9A 1PGRB 3T6ZA 2E7CA 3IMTA 1I75A 1ZHLB 1N18A 3QIUB 4WO0A 4WUKL 2A83A 2F1BA 1JPFB 1MCDA 4B3EA 3VFWA 3CN3A 3UABA 5D55A 4JFWA 5JXAH 2WZPA 1OARL 3FO2A 4AKPA 2EUZA 2VNCA 3HW7A 5BQ7B 1V5JA 1HNFA 1ZLUK 3RIAF 2P4AB 1CGYA 4WFEE 1C1EL 3COOA 1OD9A 3TN0B 3KLHC 1DQDL 2A4EA 1FC2D 2DOCA 5BV7H 3MOBL 1PNDA 2CO1A 2X89A 2XPYA 1EXUA 2M26A 4MX7A 1M4KA 1VJSA 3Q06A 4HMCA 1ZHKB 3BISA 5DF0A 4AGNA 3Q2VA 5CKAA 5H35A 2ZKMX 1Z9SA 4NKIL 5HDWA 1ZA3A 5B39A 2LR4A 4IRSD 3QJUB 3V9EA 1FHGA 4L0PB 1NDTA 5BJTB 3D2TA 4ZW7A 2A4ZA 4JCWA 3V4UL 5EV7A 2WCGA 3MJ6A 5LGHL 1V7NL 5FYKD 3STZB 2Q7YA 1AD0A 3FB7A 4H8QA 2IAAC 3LEYL 4PLJD 2H1PH 4DK6A 1AD9B 3QUXB 4F7CB 1W8EA 1WZKA 4WHTB 5KSBE 2QKIC 4DKEL 2WXLA 3VRIB 2KBGA 1DLHA 5DUPL 2WP3T 4NDMA 2AJVL 4FP8H 4O4YH 5K39A 5SWSE 1BXUA 4C59B 3BSHA 2WOBA 2HJFB 3QJHB 3WS3A 1QRNA 2YGNA 4LASL 3I02A 3S6CA 4U7MA 3B34A 2C5DC 4MMXC 3ZIYA 2WXJA 5BO0D 3LKOA 4ORGB 4PLOB 5BZDB 2CAKA 4Z7NF 3K8LA 1FE8H 1H0DB 1UB6A 4B96A 3SB3A 2W0PA 3U6XS 2IDQA 2ZUYA 5D9SB 2R23B 3RZCD 1TT6A 2YBRB 1BJ1J 3BZDA 2DYRB 1BD2D 4OF3A 3V55A 2VE6A 3BGMB 2FD6L 4Y5YB 2ENSA 4PBVC 3VQLA 1JN6B 5FF6A 4RLDA 3BIAX 2ODHA 2IALA 4PJXA 3LH8A 3CHRA 4GG6A 3BX7C 4BZYA 4OB5L 2DQGH 2ZXBA 1YJDC 1H3PH 3TT3L 4A67A 5DJAB 1IBBA 3FO1A 1VLXA 2A9NL 5JUEH 1I9IL 2WQWA 2C1OB 4J6RL 1IFHH 4IRZH 4DEPB 1XFPA 3BVDB 4J3OH 3F3HA 3UBHA 2GT9B 5D7LA 5A16A 1EX0A 4POZD 4HF5H 1TUPA 3WDJA 1H3XA 4UQ2B 4OAWA 4E5XG 3B9KC 4LPYA 1KIPB 4W6XB 1NCHA 5AW1B 2H3XC 2ITDB 3WDIA 1RHHA 3L5XH 3LKQA 3CVBA 4QLWA 4XCYB 5E8OB 2EYTA 4JG1H 4RMWA 2G30A 4UQAA 1NKRA 1YYMH 5GRUH 3O0RH 2GVYA 4G6KH 3PHOB 1VDGA 4NKDA 5EDSA 3GWJA 4X7EC 1VGKA 5TPWL 3CN0A 4HUMB 3FBKA 4KRPD 4WU7A 2XFXA 2LVCA 1PY9A 2D03L 2W07B 3QQXA 3BPOB 4OZFG 3GJEA 4LSSL 5HGDB 3DNKA 4EIUA 1M1SA 2EYRA 1QW9A 1DLFL 1G94A 3B1UA 5E8NA 4ZMAT 1X5IA 5GJTL 4ODHL 4TMPA 1RSYA 4W70A 1QFWL 2O5YL 1T66D 3I6KA 4M8RA 4EEEA 3MAWA 4KUCD 3DO7A 4M7LT 1Q9LA 3SDAB 1IV8A 1GA2A 4GEIA 2R2EB 4RGND 1U36A 1Q9OA 3RWCA 1NCUA 1TJMA 3SCMC 5E03A 5J7CC 5FW6A 3VI4E 1ZHBA 3RY5A 4UDUA 2JJSA 1SYSB 3F6JA 4JBSA 4NFCA 2LTQC 5BMFH 1FJ1A 3QNYA 2A6IA 3SDXF 4CNIB 4M43L 1J11A 1UFGA 4DKDC 4AYBA 3APMA 1Q94A 1DN0B 1JGIA 2PP9A 5EF2A 4OUUB 1CL7H 2UZPA 1QZNA 5AW7B 2JELH 2NXYD 2EECA 1TETH 4K5PA 1BAWA 2OJ1A 2Y5QA 4XNQB 3WUWG 4E41B 3NFPB 1RUPH 2AZAA 4NO3A 3NIGE 5D4JA 3FBQA 4J3XA 4U1MB 3ARGA 1HZKA 1B9ZA 2RGSA 5GSVA 2BSBA 3T4YA 1S9KC 2VDLL 2NX5E 1IC5L 3D48R 4UNUA 2VQ1A 1BZDA 2J3SA 1VA9A 4L4JA 5ENWA 5FKAA 2DJSA 3L1OH 2IVFC 3CVCA 4YPJA 1XF2B 4PB0H 1MFEL 3OLGA 4XRCA 4AQOA 2R8SH 1XGYL 3MRPB 4QNPE 2IWFA 2VJ8A 2AI0H 2HFFB 5CGTA 1RH8A 1SJEB 4GRWH 1S9VB 3MGTB 5GISL 2ZJSL 3EGXB 1BFOB 1U3NA 3IDJB 5FWRA 2KUTA 1NFDF 3CDGA 5DFVD 3WHE0 3BZEA 3HZVA 2OI9B 1FZOA 4F3FA 2NW2A 5T5FL 3PV6A 5E2TH 4JN1H 2FUTA 4WSKA 5FDWA 3IS0X 3N5AA 5HHPA 2EVIA 3ZTEA 4UCFA 2IAMA 1E3FA 5EU4B 3WD5L 2ZCHH 3NT0A 3O3DB 1S9WB 1MFNA 3GMRB 2W81C 4HOXA 2HWZL 4G7VH 2ROXA 3EJSA 5AAPA 1UYWL 2B59B 2XZZA 5EFIB 2R1WB 5FR3A 1E5BA 1CQKA 1GJWA 4L1HA 3S5LG 5JZ7D 3T0AA 4NCC1 3CZLA 3FH7A 4F9PC 2B3IA 3RVXC 3KPNA 2ATPB 1BBJB 5DHXB 1TU2A 4WFFD 5JOFB 3MA9H 1RJCA 3OR7A 3G6JE 1F56A 3ZU8A 3AFLA 3HZYA 3FSOA 1PDKA 2CUHA 2CLVA 2PYED 5DJZB 2Z64C 3KPPB 5F88B 2Q86B 5C07D 2EEBA 3GSVA 5DMGD 1SJHB 2KZ1B 1NPJA 5T5NF 5JXAL 3RNKB 3DHUA 4L8BA 2LABA 4XVJH 5E8DL 2X0VA 1MG3C 2QR0A 3SDDB 2I9TA 4XBMA 3N41B 3P3TA 3JTTA 3MCKB 4P9HH 5TE7H 1SN2A 3PG2A 1MNUH 3CPLA 1T3FA 1MFBH 1GGIH 4W9FC 1LL1A 3TV3H 1IVLA 4EKJA 5TDPB 5BV7L 5CCHE 5BVPH 4YPGA 2XQBL 2IWGA 1DBKH 3CFCH 3RX8A 4NBYB 2VLRD 4X42A 1BQHG 2JJSC 2ZUWA 4FNSA 1OIOA 1PD1A 5FW8A 4ANUA 1THAA 4NQCB 2XWRA 4MFHA 4XMUA 4JRYA 2OX5A 5GZOC 4ODTH 4QDGA 3BW9B 4KV5E 1MHPH 2UZXB 4XTRC 3V6OA 3KR3H 4IU3B 4I5BB 4CDHA 1IGTA 1K85A 3OKLA 2H1PL 4L3EE 3HNTH 4KXDA 4MZRA 3VXRD 2N4IA 3KMDA 1K5NB 5GGQH 1AGBB 4I18A 3C6SA 4O4YL 2G5BA 5AVTB 5LNGA 4RSVA 4AIXA 4ESKA 3CHSA 3P77B 4K3GA 4LGPB 3L3IA 1UC6A 2Z0UA 1JDDA 1CLCA 1T5WB 1YVLA 3MZGB 1QWUA 1TENA 3WHXB 3B6SB 2XTJB 3QZLA 1D5IL 3IGAA 5C2BH 3ZYZA 3SQRA 4BFFA 5ESQA 1N2RB 2YUVA 2XA3A 3O11B 2B1OA 4WKZA 5IK3B 1CDIA 2K6YA 1CIDA 3CDZA 3RY6C 3DJZA 4ZUUA 3V0EA 2F7PA 4FNRA 4JM2B 4Z0BH 4POUB 1IAII 3OJVC 4BCYA 4JFZH 5KBLA 4BZ1A 3PWJB 5FGSA 1R17A 4PTTB 2WVTA 3RX7A 3L7FB 4GIOA 2E75C 5CUSH 2M1KA 5C0FA 5EZPA 3UZEA 2DQGL 4TL5A 3ARZA 1E3ZA 1XXFC 1LE9A 4AXWA 3H6AA 1X5GA 4JPIB 4LSQH 4AW7A 5J13C 3RWJA 1B6UA 3AY4A 5JUEL 4O2EA 2Y5TA 3LV3B 3NCMA 1IFHL 4IRZL 1M6OB 5IBLC 2BNUA 2XY2A 4F7TB 4PYHA 2V2WA 4PHXA 3LEVH 5T3XE 1R3IL 3VRJA 3BE1H 4M02A 1R47A 4K5OA 4HF5L 1DJYA 4PLKC 1C16A 2WOYA 2WTOA 2BVPA 1OLLA 4I0PB 1AXSB 4AZ8A 4CADB 3CFEA 3FL7A 4Q2ZA 4Y5YC 1K8IA 1T89A 2K3HA 4KK8C 5LCVA 4JFFD 2X6BA 1UOVA 3L5XL 4Y2DD 2WQAA 3PIQB 1AQKH 1H6FA 5E4OA 3U1SH 1YYML 1LEKB 5CWSB 2N7BA 5I1AB 3O0RL 4CRPA 4G6KL 1R3KA 4FFZH 3TXAA 5JNYA 3T2PA 5JW4Q 4KRMB 3ZT5A 3JZ7A 2LGNA 3GMNA 4HS3B 4Y5XA 1E27A 3BRGC 5DEZA 1JRHI 2ZKYA 4JJ5B 3RDTA 1BZOA 4BH8A 1ZDQA 3FAXA 2AJXH 1OSEA 2ESVA 3W0WA 2WXGA 3GRWA 3P2DA 4F1ZA 3L1GA 5AYTA 3LKRA 3MXWH 4P2OB 4ELMB 1GGCH 4NQDE 5EMYA 3TEXA 4MD4A 2EDWA 2XCMC 3L4VA 4K5LA 4PRID 1IC1A 2FT8A 3MV8B 4GP5B 4ODXB 5I0VA 2PR9A 2G5UA 4JHZA 1O9WA 2XKNA 4H4NA 4B7IA 4E42A 4I88A 4NENA 2Y6SC 4XE5B 5B7MA 1GY1A 3O41A 3BVWA 5BMFL 4AGMA 2ZZUT 5EUOF 4HH9B 3MRCB 1THCA 4JFSA 1OE3A 2OV0A 4WGKA 4HBQA 3SDCA 4D2NA 4OKVA 1RAMA 3UDWA 5HJGA 5I30H 2VDOB 1CURA 2VMEA 4N2FA 1DUYB 4R7NB 5B1AB 3RTQA 5IMLB 2C3VB 1LK2A 4JL2A 3IBEA 3QWOA 1HCZA 1CL7L 1EEZA 3S98A 2JELL 1KBVA 3JV0A 3WE6A 2OMXA 4MXVE 1TETL 1MOEA 5F9JA 3ISYA 1RK1A 1RUPL 2H26A 2ED9A 1NFKA 5A2BA 1JPGA 3CSYA 2YK1H 1RP9A 2HFGH 2YC1A 4XC3H 3B83A 1ZDSA 3MI6A 3MA7A 1OPGL 4Y4KD 5LBSH 3T3MF 2E56A 3WN6A 4D0BA 3HE7A 1CDUA 5C0BD 4L9LC 4AQ1C 3QDJA 1A7BA 4BFIB 1SYVB 4D9QE 2P3YA 3L1OL 5ANMB 4BCZA 1BF8A 1SQ2N 3A21A 4PB0L 2R8SL 1CTNA 5KYYB 2AI0L 5H37G 3MRJB 1G7JB 1DVTA 4G8GB 3W9EB 1S78C 1XTLA 3VSTA 3QNZB 3AAZA 3O6KH 3P4LA 1KJMA 1S5HB 4AKQA 3ZBMA 3GSNB 1ASQA 5KSBF 4KU1A 5E70A 1J8HD 4FRWA 2DH3A 4QTIH 5E2TL 4JN1L 3BO8A 5D2NC 1UVQB 3MNZB 4JPKH 2OL3A 1NAMB 5IJCC 2E7BA 3BQUB 1MQ8A 5D6CB 3X14B 3ZKNC 2YD0A 2ZCHL 1G9NH 4XHJD 3SBWC 1GW0A 2H3KA 3GDCA 2IC2A 5C0GB 2YD7A 1W80A 4DUXA 4QEGA 1AZVA 1HL9A 3NFSL 2CQVA 2YPLD 3MRDB 4NKOA 4KJWC 4NHUA 4LVEA 4P8QA 2AK4B 3QEHA 3DYMA 1H8OA 3SBPA 5D5MA 1JVLA 2P46B 5JPNC 2VLKA 3MA9L 1ZHNA 5HVHB 5DRXB 4U6HB 1K8DA 3VFVA 4Y4FD 4J6IA 1GJUA 4LB8A 3O81A 4M1DH 5IB4B 5CEYA 2Q7NA 3LY6A 4OH2A 3LRLA 5DHYA 4XZUB 4N5ED 4XVJL 5AW9B 3TU6A 1FUNA 4Y2LA 3L4ZA 4UT7H 1N6UA 3FUKA 4Y5VA 1BIHA 4V1DE 3KVQA 3D05A 4P9HL 4NB7A 5TE7L 3VGEA 3QHZH 1KG0A 3BAIA 1MNUL 3UTZA 2W38A 3EJYC 4FJ6A 4U1GC 1H6TA 5FB8B 1GGIL 3E8UH 3B5TA 4OZFB 3WU1A 3OLIA 3BWUC 5FFLA 5D71H 2KC0A 2D3VA 2R4RH 3T65A 5BVPL 1PMYA 3TH3T 2NSXA 1FAKT 2TRHA 3DETD 3ETBJ 3CFCL 4PP1D 3QUYD 2JJUA 5FCUH 4BSJA 1UXMA 3SDCC 2WN2A 1PEWA 1DP0A 3HC4H 4J7RA 2EE9A 4ODTL 2XI9A 4H40A 2IWKA 4MJ4A 4FQXA 5DHEA 1V8HA 1MHPL 2Q3ZA 4NAJA 3KPOA 3KR3L 1AFVH 1NPNA 4GYBA 5EBLA 3QCUH 2FEDC 3SDDC 3HNTL 5CFAA 2XWZA 5FC9A 5E24E 3L54A 1PF3A 2L3BA 3T4AA 2X4RA 2CJTA 4HZ1A 4X7SH 4CVUA 1K2DB 1A1OA 1AGFA 1S5IH 3HJ0A 2Y06H 1I7ZB 2X1OA 1OP3H 2WQVA 2WXFA 3QJTB 2NNAB 2XA8H 1KIRA 3DURB 3GBLA 3RBGA 2VABB 1RFDH 4LBEB 3SE9H 3I6LD 2E0PA 4KXZI 2AXHA 2XXGA 5I16A 5C2BL 3IJEA 4IRSA 1XHHA 3M17B 4ZUVA 2PETA 1MFCH 1Z0NA 3EFOA 2OS7A 4EN3B 2WAQA 4HKJA 2PXYB 5ILTH 4JHWL 5HPMA 2BZ7A 5IWLC 2IBBA 4PU2A 4Z0BL 1EUUA 4XN4A 4EIBA 3OKDA 4IBZA 4JFZL 3VI4F 4Y2OA 4GBXB 3RVUC 5HSFA 3KJ6H 3S2CA 1L3NA 3SPCA 4YE4H 5AENA 5KW9H 2WO4A 3O3EA 4X6EA 5IF0B 1GIGH 2DM4A 1IJ9A 2C4FT 1JVKA 4XWOC 2MCPH 3EJQA 3ARDC 3JWNG 4I87A 4OFIA 4E41E 4LSQL 1J86A 2CUMA 1PZBA 1WVZA 3NIGF 2V5MA 3VTAA 3BWAA 3PHQA 1WV7T 1BVKA 3K1KC 5BXFB 4CVZA 3DVGB 1DO6A 2NQDA 1JUFA 3AU1A 5KAQG 3LEVL 3BE1L 5IBUB 3RNQA 5D1XA 2BY2A 3GGWA 1KFGA 2FGWH 2VWEE 3LD8C 3L08A 1KGXA 1MQKH 4R0LC 4QNPF 3HMXH 5EOTB 4LO9A 4PJ5B 4CKVX 2B39A 5CBAB 2WZ6A 3EJUA 4K3DH 5E0QA 1TJGH 2FR4A 1TJXA 3F65A 4WUUD 2FNBA 2N0KA 3KEHA 4DIXA 1CD0A 1D2PA 2VLLA 4I4WB 3D1MC 4K7FA 3U1SL 2PPCA 1I3UA 2IQ9L 7FABL 3TNNA 4FFZL 4O5LH 5B8CC 2P5WD 4RAUA 5HY9A 3JVGC 3KCWA 1R4XA 1CTMA 3QIBC 4R4NC 5LXVA 4AI7A 2ZF8A 2MKWA 4N6QA 4WWPA 4RFNC 2AJXL 4G6AD 3G08B 1H3VA 1N4XH 4OI9A 25C8H 2W9EH 4O58L 4ANVA 5IQOA 3KLLA 3QORD 4OFVA 3VJ6B 3THMH 2L0DA 2VSMB 1GZQB 3AXLB 3MXWL 5IJKA 1DCLA 1GZHC 4U0RC 1ZLWH 1WH0A 1A0QL 1GGCL 2CHDA 2HLFC 3G6JF 4FEIA 3MODH 4YDKH 4YSCA 9PCYA 4LVHB 4E5XA 1P6AB 4FOMA 5C8JA 1RZKC 4FQQA 4JY6B 2E9GA 3EAKA 2VXTH 5EIVA 1BYNA 2P49B 1BYPA 3QRBA 4P5SA 4XMLH 3RURA 3UZVA 4MHHG 4N26A 1FCCA 4IGBA 1Z1WA 5TDOB 3ZSTA 3VD0A 2HCZX 5CIPA 1HL5A 1D5BB 1KLGB 2DQJH 4XH2B 3E6HA 1HWGB 3I74A 5I30L 1JZ8A 5ISZB 2CUAA 1TZAA 4LU5H 3B9EA 4IRSC 4XMPL 4G7RB 3KYOA 4URTB 3V10A 4ZW5A 3MKGA 1D5XB 4PV1C 1OQOA 5KN5A 4ELKA 1WS8A 4M93B 3BZ4B 4PS3A 3I75A 4MB3A 1NGQL 1ZT4B 2QTEA 5AOMA 3BIKB 4OW6A 1LP9B 1GY2A 2YK1L 2GK0A 3QNXB 2HFGL 1UH4A 4XC3L 2GIYA 5IHZB 2BHFA 1JIBA 2ZX8A 5GGVY 4TQIA 4NQCE 5GS0C 2OZ4H 2NXZB 4J4PD 4XB8A 1WUNT 4KVNH 2R1YB 5B1CA 1V3LA 2Q0ZX 2VQUA 4PCYA 3BFOA 4KV5F 2CBPA 2ZG1A 3ROLA 1NLDH 1WEJH 3EDDA 4XOEA 3KXFD 5EIIB 1AKPA 2D31A 4WEBH 3BOVA 1FIEA 4N8VA 5IW6A 3S7GA 1DVFB 3C9NA 3OJDB 1UCBH 1AYRA 4PGCB 2X4QA 4ZXBD 2V2TB 2YPKB 3GBMH 3C5SB 4UQDA 4QTIL 4OGXL 3LQAL 4RIRB 4JPKL 1KFAH 1PAZA 3ULAB 2I69A 3RZCC 4GJTB 5LDUA 1MHHA 4ZS6D 2P5EB 4JFYB 1G9NL 3TGXA 2XTJE 3H9SB 5I19H 1T2JA 4TULH 3N1GC 4F7MA 1JE6A 3WUWA 1R3LB 3ARPA 2EUWA 3UPCA 3QAQA 3EDEA 3GMLA 3H85A 3RP1A 4AENA 3QO1A 2ZWSA 3ULVC 2XVBA 3ZDXB 1WBZA 3QXVA 3S96A 1A3RL 2HB0A 1U91A 3G6AB 4M9OA 3BLKA 4MD5B 5DVOA 1KT2B 5HXMA 1MCCA 2DQDH 2P9RA 3EDJA 1KTDA 2PCPA 5TF0A 4OV5A 1QQDA 2VERA 3MQIA 4X6DB 1EV2E 4M9PA 3AMKA 2EDNA 5HHOD 4AJVA 3OZLA 1J0YA 4XNDA 4RFEB 3CD4A 4WTQA 4B9IA 2DYSB 3N2JA 2AFNA 4AEFA 4QRRD 4POZC 3DBXA 4WI4A 4FQ2H 4EJ1C 2AABL 3C8DA 3FFCB 4KNTA 4UT7L 3U36B 3CLEH 1U8QA 3K4AA 4PM1A 1FO0B 5H2BA 1JTTA 3MFFB 4XMZA 1YLBB 3UTTA 3CFMA 4JO5A 4F8QA 3E8UL 3KHOA 4MQXD 1DDHA 3U0TA 5D71L 1DJZA 5IB3B 2E9WA 3WEAA 2R4RL 2EDJA 1MKFA 3E3QE 4F15B 4X4KA 4JZJC 3K6SB 1TVBA 4KROB 2XZAH 4GW1A 3DYPA 5F7BA 4C4UA 3Q3GB 3U2JA 5ID1A 2YARA 4WJ5B 1VB9A 4M03A 1MI5B 3ZTCC 3HZMA 5C07A 1G9HA 1T04A 2HVJA 3EYFB 4NS0A 3BPLB 3DXAB 4UF7C 4LEOB 1USZA 4XMWA 1WAEA 4KRPC 1P2CB 3PGFH 5IUSA 4H5SB 1JZDC 2LE9A 4ZFOA 3QCUL 4AH2B 5JHLH 3X17A 1U2HA 1OWWA 4JVPA 3HS9A 3SZ6A 1M2VA 2CR3A 3WLWC 1YQVH 4MCZB 4MMYA 1T66C 2RR3A 4P3DB 3VXOB 4ZI8A 4GW5B 2DWXA 1P4LB 1S5IL 3NJIA 5FUZL 3IRZA 4P4KB 2FYVA 4P04A 4B7LA 1NCDH 4RGNC 2P8PA 4ZODA 4DP5X 2EIBA 2K70A 2XA8L 2VLRA 3HEIB 4PCTA 1RFDL 3N1FC 2BOBB 1MCIA 3SE9L 3AS2A 3GHPA 4ELME 3AUVA 4FD0A 5SWQB 5GS3A 4UQBA 4AOFA 4HDIA 1PYWB 1A7PH 5I24A 1RP8A 4LLQA 4NBXB 3MV8E 2VL4A 5ILTL 4TSAH 4PJ8B 1BQHA 5D7JD 2NXYC 1KXVA 4PCKA 1TNMA 1K9TA 3MJ9A 3GSXB 3GSOB 1QUNB 2MNUA 2VR5A 3D2UD 3KJ6L 4LCCB 1BAFL 1OP9A 4YE4L 5KW9L 4ES9A 5IQ9A 5CMAA 2QEJA 1QTSA 4PJDB 1HJBC 2JJVA 1K4CA 1QFWM 3AXIA 2ISDA 3MRGB 1GIGL 2LVEA 4I9WE 1NCBH 4W9DC 2MCPL 4P57B 2CKBH 4PJHB 5BVJA 3X11A 4MXVF 2MCMA 4ZMPA 4QRSB 1KXTB 2X1XR 2H2SD 1ZT7A 4PV8B 1A6UH 1WA0X 2VLJB 3M45A 2V7NB 1U3JA 4NNYB 5E5MA 4MXQD 4Z7IA 1A22B 3UPRB 3OHXC 1Y6KR 3WSQH 5FO8B 5JMRA 5KSVB 2OJEB 2Y7NA 1TQVA 5D70H 2ZXEB 1L0QA 5DFVC 3DSNB 1HSBA 5ANME 4TS6A 1YUHB 4NX0A 4GLRH 1PY0A 4L8SC 3HMXL 4PREA 1QWNA 4BE5A 2PO6B 1EAOA 4G8GE 2AEWA 4HS6A 2YN3A 4K3DL 3SIKA 3WO4B 1TJGL 1KGYE 4P46A 3Q2WA 3CMOH 2YD1A 2F68X 2Y07H 3C6LB 3I2CH 2YRBA 3BWZA 3DTUB 2UVFA 4HHAB 1ZXKA 2YD6A 2DKSA 4R5XA 2EVHA 4HIIB 1ZTXE 2J5LB 5CEZD 2XV3A 4GQ9H 4O5LL 2ZD0A 2KDGA 5AWNH 1NBYB 1WUZA 2CIKB 4NFDA 4UOZA 1VEMA 1V05A 1H9DA 4KKLD 4A7TA 3GSRA 4DH2A 5DS8B 4MDRA 3V4PA 1LM8V 4ZMLA 3QEUB 1PG7W 5EEYA 1IGML 1T20B 2P8MA 1N4XL 25C8L 2W9EL 3FT2A 3LRHA 1WLHA 4Y4HB 4FG2A 2WINB 5HPOA 3DTXB 4KJYA 5KOVC 2CLRB 3THML 1ACCA 1T80A 1TEYA 3RWHB 2CM5A 2FO4B 3MRLA 2B0SH 2UVEA 4GG8B 1T2QH 3MYJB 1JYXA 5D1ZI 4Y2DA 2YEZB 3LMJH 3MODL 4Q8BA 4YDKL 4M3KB 3WNNA 4BWWA 4F92B 3WNOA 1B0GA 3MZTA 4AYFB 1IBDA 4HPOL 3CVIL 3VFMA 2VXTL 3BGAA 2QJDA 3MLUH 4L4TD 1NOLA 4N9GA 4L0YA 2EIJB 5AVSB 3TEUA 4DP7X 2F53B 2H1LM 2BPBA 5MERA 2WD0A 2H1XA 4G8FB 4A2EA 5MP6H 1ZV9A 5BRPA 4KI5E 4D9LH 1HEZA 4MZIA 3NPZB 4HS8H 2A83B 1TOXA 4LU5L 1I7TA 4KDTA 3UJJH 2CJUH 2DKMA 2UY7A 5G5DA 2X1PA 3HG1A 1KCWA 2DIEA 3FO2B 1A3LH 4G8IA 1WBXA 4UUJA 3OTTA 4CU6A 2RIKA 2FBRA 3F83A 3EYVA 1QFOA 5J9PA 2FDBP 4TVUA 4PRIA 1KN2H 2Z7WA 2ZSWB 3VYPA 2OZ4L 4LVHC 4XVOA 3CIAA 5IMKA 4KVNL 1LMIA 4YLQT 1JDAA 1JI2A 2C7UA 3HE6D 2WM0A 1FLRH 2LU4A 4MX7B 1NLDL 4AM0B 1WEJL 4GS7B 4HCRA 1GGTA 5F7MC 2XWDA 3TBYA 4WEBL 1X7QA 1Z9SB 5B39B 2M83A 2X3AA 2G3MA 3Q1SH 1UCBL 4M5YH 3LSOA 1HI6A 2WBJA 2A1WH 3GBML 3T08A 2WGXA 4N2OA 1TFPA 3VX1A 2FSDA 1AD0B 3BHBA 3FB7B 1KFAL 2Q7YB 1YSOA 2E86A 2TAAA 5DRWA 3QISA 1PZSA 4W9LC 2W0FA 5HJ3A 3EFDH 3VXSD 4N24A 3UAJD 3P9MA 4Y4KA 4MDIA 5LO7A 1DLHB 5I19L 4TULL 4NDMB 4G43A 1MIEH 2QSCH 2BCKB 5D7IB 5C0BA 4Q9QL 2N56A 3LKSA 2YAHA 4U3CA 3VDBA 1QRNB 2JIXD 2IBGA 1GYVA 3BUPA 5E6ZA 5EO1A 4RBPK 3NCCB 1FFPA 1AR1D 3TA4D 4YLCA 2F54D 2E4FA 4IU2A 4KZEH 1UB6B 4JVWA 1RUKL 2DQDL 3JQOB 2G75A 1L6ZA 4HD5A 2XIBA 2CJSA 4FMKA 4IDLA 4Y89A 4LAJH 4YQXH 3ZX1A 4K9EH 4Z3FA 3Q48A 1WC7A 2ZX9A 2JKJA 5H37A 3HI5H 4KTDH 1F45A 3ZUCA 3T9WA 2I7SA 5EZLA 2FQGA 3PJSB 4LLYA 1ZS8A 3DVIA 4PJCA 1KLFA 4MJJA 5FF6B 4KK6C 4ODWA 2Y1YA 1JXFA 2JJTA 3FT3A 3CLEL 2IALB 5ECGA 3S35H 1AKJA 1E90A 2JKIS 4ALAC 5I66A 3Q6FB 4Z7UB 3K5SA 2YPLA 3UZQA 4Y9FA 1I8AA 4KNQA 2JQMA 4M8VA 1CE6A 1IM9D 4YL4A 3SY6A 3FO1B 2EJ1A 3VXNA 4PJ5E 4HWEH 2E76C 2FVNA 1OSZA 4X7FC 2WXNA 5D4QA 5FGBA 5FIEA 1YO4A 2E59A 1HHGB 5FUCC 1P1ZB 1AY1H 2W5PA 1G4MA 4XNAA 5D7LB 5A16B 3N06B 4LOFA 3FQ1A 2C9UA 4DZ8A 2B8OT 2ZOLB 5GJSH 3PGFL 3VXUD 3UTQA 2Y69B 3LS4L 4MJ5A 3TO4A 3U4AA 5HVFB 3N50A 3PDOA 4NGHH 4EOWH 2Z3FA 2WLNA 4WTXA 1UWXH 5HI5D 1RHHB 1ETZA 3LKQB 4LZKA 4DUWA 2XV6B 4WKXA 3FONA 1YQVL 3JWOC 4QHLA 5KZCB 2A4CA 2ZOOA 1M7XA 2F08A 5ICZB 3SSGA 5C0CD 5T5FA 3TH2T 4PB9H 4DP0X 4KQ0A 1NCDL 5KWYC 4NKDB 2J12B 2V5SA 4F15C 3L5WA 4K94C 5GHWH 2BWDA 3LZLA 1IKFH 3UAAA 1MRCH 4XBGA 1VGKB 1KPVB 4G42A 1SVCP 4JQIH 1A7PL 4WU7B 2XFXB 4Z3TA 4H88H 3QUMH 4ZDHA 4K8RL 2BDNH 1KXQA 4TSAL 5D7KE 5B3SB 5D96C 3VG9B 4XN9A 4OJFL 4OJDH 2NSQA 2E8ZA 4NRXA 2V3EA 4N2KA 3I6KB 1HQRA 1MPAH 3TWCH 1T7WA 5ISZE 3PDDA 3N41F 4B9PA 1Q9LB 2DMGA 5AOJA 4Y4KC 2DZEA 1P7QB 1Q9OB 1JL8A 4Z3HA 3V4VH 2QHLA 4BJLA 4XXCA 4TLTA 4FJZA 2X7LA 2NSMA 2OCCB 2X44D 3OKMA 4P2QD 5I76A 1FJ1B 3QNYB 2A6IB 4J3UA 4OIIH 3T0EB 1A6UL 1OB0A 5AVZB 4XMTA 3RB7A 1LP9E 1PQZB 1Q94B 3VRLE 1H5BA 2RQ8A 3HVDA 1UD8A 4CMHC 4JREC 4NQVA 3ZL4H 5I0DA 5D70L 4XPGH 5AVQB 5IBTH 4NWTH 3CIQA 4LPCA 2BWIA 2JI1A 2APTA 2HSIA 1ACZA 4C47A 3GF8A 1XF4A 2QQKH 2YGPA 2ZWZA 3ARGB 4LLWA 4PRPD 5GSVB 3CV5A 1NIAA 3SZKC 4LCCC 3T4YB 4XHJC 1YNKH 3L3HA 5IVXA 3I6SA 4MASA 3IS1X 4FTVD 3T6VA 3CMOL 5FKAB 5ENWB 3FU5A 1YY9D 2ZOKA 2Y07L 3I2CL 3WHE1 1J5HA 1NC4D 1RLBA 3F85A 4Q6YA 1VAHA 2BHZA 3KG5A 3NFNA 4K3JH 2J6EH 3S4SG 4IBWA 4F7PA 2P5EE 5AWNL 1TZHA 2ADJA 3IDYB 1SXZA 2J56A 1NLBH 3AM8A 2X42A 2OULB 1QHPA 3H9SE 5F0JB 4ZZKA 3CDGB 3HZVB 1FZOB 4Y4FC 3PV6B 5FGBC 1J88A 5F44A 5FK9A 5I6PA 5FDWB 3S48A 5C0RH 2J57A 3MJWA 1IRAY 1X9UA 4GOSA 2IAMB 3ZE1B 2CHNA 4TXVB 3ZDXE 5LQBL 2WKOF 1U8JB 2PCFA 4M4RB 3S3CB 2WP3O 4DGVH 3R06A 2IDUA 5E6ID 3EADA 3N0PB 5K1VA 5E1AB 4JM2F 5AFAA 3KL0A 5M95B 3WJLC 4N5EC 2JK5A 5E6SB 4E9LA 1T2QL 4OLVL 3B37A 4UILH 2NY2B 1A6VH 3GMOA 1HHKA 2CHZA 4X6DE 3MV11 3I50H 3LMJL 1QLFA 4NKMA 1MNNA 3OAYH 2GITA 5A2LH 4XCFH 5EU7C 4ELDA 1RZGB 1HVXA 2CMRL 3L5JA 1H9VA 3MLUL 5IHWA 3F7YA 5AVYB 2IG2H 3KLDA 4N2HA 2P5WA 5I6NA 4JDVA 2YGOA 3QAZB 1DBJH 3ROOB 1X4ZA 3HZYB 3FFCE 3DETC 1JGEB 4M8QA 4CC4C 5MP6L 4PP1C 1TVHB 2CLVB 3V0VA 4JHBA 5A7EA 3EHBB 3QHFH 3QUYC 5F7YC 4D9LL 5CGMA 5JO5A 4NOFA 3MUZ1 1EHNA 2AEIT 5J5EA 2WK2A 2BNQB 2CJUL 4NBZB 1N5AB 4XAKE 5TQ2H 4L8BB 5DMKB 3AG2B 4RH4A 3FCTA 3Q1EA 1A3LL 4LQ1A 4MMZC 1YPZF 4AYSA 5F96H 4RESB 3B1TA 4QYAA 1OEZW 1QX1A 2GBAA 3NEXA 4I77L 3CPLB 3IFLH 1CC3A 4QRQA 1KN2L 1T3FB 2DEWX 2J8HA 4TOYL 4IRZA 3RWFA 2FJSA 4NI3A 5F3HA 1MI5E 4MB4A 2CLZB 2EEFA 3WY1A 3BLBA 3DXAE 4N6RA 4BXVA 1XBDA 4LNRA 1FLRL 5SV3A 4NEHB 2CIIA 3AU0A 3W37A 4JFOA 1MY5A 5F0LB 1VFOA 3ESOA 4JRYB 2OX5B 3Q1SL 5FFOA 5MEQA 1N26A 4M5YL 1R1CA 2EDXA 4ANKA 3QDMD 1AJ7H 4WI0A 4B9CA 2EH7H 1TLKA 3DC0A 3SKJL 5B3NA 4WFHD 4KK9C 5KUKA 2X40A 4H44C 1IGTB 3FO0H 3OKLB 4KAQH 2C9QA 4ZOBA 4ZOEA 1TTCA 3UXFA 3QZNA 2D3NA 4I18B 4PWHA 3C6SB 4ZK8A 5F6HI 1LO0H 4ELMF 1MIEL 2UV3A 3CXHK 5K9JL 3QG7H 4J4PA 3GXTA 4PJBA 1IEBA 2F9BT 2Q2LA 5F8RC 3LXCA 5KVFE 3RWIA 4D0DA 4QJ5B 2P42B 3DMMA 4G8AC 3TCLA 4NRYA 1A6WH 2YUWA 4BK5C 3VW3L 2OR7A 2I85A 1WZLA 4WI3A 5CCJA 3N42F 1NPUA 3F01A 2DRUA 2VDQB 3IGAB 1CFNA 2RD0A 4MWFB 3L95A 4N0YH 5ESQB 4YQXL 4K9EL 4OQTH 4PJDE 2Z6FA 4JFEA 3LXAA 4MA7H 4WKZB 1UHVA 1JI1A 3CDZB 3H4FA 4ZAKD 4ZUUB 4KTDL 1SZNA 3KVPA 4EZKA 3GSUA 1R5WA 3C5ZD 3UBXI 4X9IA 3JWNC 1Q0YL 5AVRB 4ZMYA 5HYSG 1EZUA 4PJHE 3CPUA 5GS1A 2ALAA 4X6CA 3UG5A 1BMZA 1SF5A 3FCUB 3S35L 1OHQA 2JCWA 3O6FD 1B2WL 2QPEB 1PZ5A 1JPSH 3A23A 1CK0H 1G0DA 4HZLB 1IZKA 1OSPH 1R3JA 4AEHH 1E4XH 4XC1L 4HC1H 3NABH 4MDJA 4AXWB 3HAEH 1OCWL 4G6JH 4OLYH 4DGUA 3ULVF 3ARFD 2OW6A 1AZUA 1FNLA 3N1QC 3RWJB 2XLLA 3PWNA 1W9XA 5AW8B 3T2QA 3VFPB 4HWEL 2Y5TB 4PGJA 3GQFA 3DPBB 4H1LH 5HHOA 2BNUB 3W82A 1AY1L 2VLMD 4U3SA 4AVJA 2V2WB 5JDSA 3RFZC 3ARBD 4LXFA 1QNIA 5E9AA 2YD3A 4G6AC 2CRIA 3MRFB 3WIAA 4L1BA 3QPQC 5EIQA 5GJSL 4QRRA 3E2HB 4BFKA 3BJ91 3LJ3A 4HKBA 3IKCA 4AZ8B 4PY8J 4Q2ZB 3QORC 1K8IB 2I32A 1SMDA 2XKSA 4GNKB 4NGHL 4EOWL 1SJVA 2IGTA 3MJGX 3ZKSD 4YFEA 3TF4A 1MVUA 2LFGA 1S6NA 4XWGH 1AO7D 3HIZA 4JFTA 5AKVA 1R3KB 4PB9L 4JEGB 2WY3B 3II1A