4BWUA

Three-dimensional structure of the k109a mutant of paracoccus pantotrophus pseudoazurin at ph 5.5
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPAKARERMDAELAQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the Surface Determinants of Paracoccus Pantotrophus Pseudoazurin
rcsb
source organism Paracoccus pantotrophus
molecule tags Electron transport
molecule keywords PSEUDOAZURIN
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4bwuA00
3KW8A 3WG7B 4A2FA 4G7SB 5B1JA 4G72B 3NP3A 3QJQB 3HB3B 1NTDA 2J55A 3UGEA 1EZLA 1OE2A 4PCYA 3CDZB 3S8FB 1CYWA 1JXFA 3CDZA 3CVBA 3H56A 3ABKB 1NZRA 1JZEA 3QPKA 3NJNA 1CC3A 4HCFA 1GYCA 3ASOB 1V54B 1KV7A 2E86A 2PPDA 2X87A 5I5MA 1RZPA 4KNUA 4P5SA 3TA4D 1SJMA 1ILSA 3NJFA 4UAHA 1NPJA 2HRHA 5AKRA 1PZBA 4KOCA 3NYKA 2VW4A 3BVDB 3UABA 3JTBA 2H5UA 2X88A 2ZWNA 4N8UA 3EHBB 5ANHA 2B08A 1X9UA 5I6NA 5I26A 3X1NA 1SF3A 1V10A 2BO0A 2EIMB 2PPFA 1M57B 2I85A 3TBCA 2BZCA 2OCCB 2AZAA 1A8ZA 1BXUA 1NIDA 4KNTA 3S8GB 3OQRA 1A3ZA 3PLYA 1IKOP 4GP4B 2BHFA 2R7EB 5PCYA 1NIFA 1BAWA 4HALA 1ZPUA 4TXVB 4G7RB 2ZONA 3T6XA 4G7QB 2J56A 1WS8A 4N4YB 2QPEB 2PPEA 2VN3A 2W88A 1IBZA 3PAUA 5B7FA 1JERA 1JOIA 1KDJA 2GC7C 2YXVA 2YAQA 3GDCA 4A66A 5I6MA 3AG3B 3WKPA 3AG4B 2YAHA 3KW7A 4DP2X 2XX0A 2AANA 2RACA 1TEGA 1FWXA 4BDVA 4W1TA 2BP8A 4K9JA 1B3IA 1OCRB 1GW0A 3ZDWA 1KCWA 1J5CA 2YAFA 1AAJA 3FYIB 1MG2C 1GS8A 1PMYA 2GIMA 3X1BA 3NJJA 2VMJA 2VM4A 5PAZA 1ASPA 2FTAA 1ADWA 2CBPA 4W9ZA 1PY0A 1KBVA 3IE9A 3H4FA 2XXGA 4HAKA 7PCYA 3CG8A 1BQKA 1AR1B 2WO3B 1NICA 1PAZA 1MZZA 2CAKA 2IDQA 3QJVB 3GYRA 1BXAA 3NJKA 4AKQA 4FAAB 4ENZA 1M56B 1XB8A 3X1EA 1PZCA 4E9TA 4F2FA 2P80A 1E5ZA 4YSOA 3FU8A 1BYPA 2GBAA 1RKRA 1J9RA 3AG1B 4BK5C 4BXVA 2UXTA 4JHUA 3CZUB 5B3SB 1DZ0A 1L9QA 3AW5A 3UAAA 1W6WA 2XYBA 4QLWA 3FQ1A 1JXDA 1PNCA 4E9WA 1OV8A 5I5JA 2JFCA 2HXAA 1T5KA 4EF3A 1WA0X 3T6WA 5AFAA 1SFDA 2PP8A 1HAWA 1KBWA 4JKNA 3PXLA 3WNJA 2QPDB 1N70A 1PLBA 1L9TA 4CSPA 2DY2A 2YAPA 2PPCA 1KCBA 3TBBA 1A65A 1ID2A 1E67A 2XXFA 1KDIA 1AZUA 4DP0X 3FSAA 3EH3B 4BDVB 2XV2A 4HZ1A 3WIAA 1PF3A 4M4RB 1ET7A 4NERA 1PZAA 3SBQA 2VW6A 4YSQA 4DPAX 1L9SA 2QDVA 1ASQA 2FT6A 4G70B 1JZFA 2IWFA 1IBYA 2XWZA 4E9QA 4KO5A 3NJMA 5TK2A 4YSUA 2NRDA 4E9RA 4Q89A 6PAZA 2HZHA 1DYZA 2EILB 4YSPA 5I6PA 1SF5A 4CSZA 2CCWA 2MRYA 2YAOA 1OCZB 2VSKB 4A67A 3IN0A 3G5WA 4DP8X 2QT6A 4AKOA 1WAEA 2HX8A 2EIKB 3N55A 3S3BB 1GSKA 2FQDA 1SDDB 3FU7B 3PAZA 1JVOA 3ABGA 1I53A 3UACA 4YVUA 1ZDSA 1ZDQA 3IEAA 1SFHA 1MZYA 3ZIYA 2H3XC 4NB7A 3V9CA 4DP9X 1AS6A 3NJGA 1AANA 3X1GA 1F56A 3T71A 1AG6A 1IUZA 1ET5A 3FT0A 4L0PB 2HX9A 1PLCA 5FC9A 4GYBA 5EHFA 3OD3A 2ZXWB 3S3CB 4AI7A 2Y1AA 4MFHA 4UF7C 3OMNB 3CVDA 1OF0A 1CYXA 3T6VA 2FJSA 1SHXA 2AFNA 1PCSA 3NJLA 2A3TA 4QKTA 2QDWA 2OV0A 4JHVA 3FPYA 5E9NA 4A2GA 5F7AA 2IDUA 2VW7A 2W8CA 4F2EA 5I6LA 1A4BA 1XB3A 2J57A 3QJTB 2GSMB 4A2HA 2UX6A 4DPBX 1NINA 3UAEA 3NSDA 4BWTA 1FA4A 1BXVA 2BP8B 2XV0A 5B7EA 1GR7A 2YAMA 3RYMA 2B3IA 1FFTB 2WO2B 7PAZA 4RH4A 5D4JA 2BP0A 3GXUB 4DP1X 2EIJB 4E9YA 3WKQA 4YSAA 1V55B 2OJ1A 4NAJA 1URIA 1E5YA 2AZUA 4YVNA 1CURA 1TKWA 2XX1A 2DYRB 4YSDA 3UADA 1SDDA 2HX7A 1NIAA 3FU7A 1ZV2A 1KYAA 2ZOOA 3PPSA 5B1BB 4HIPA 2H47C 2YAEA 5D4IA 2PP7A 4E9VA 4UANA 4Q8BA 3FQYA 4YSRA 2MTAA 2Q9OA 4YSTA 1AS7A 1JXGA 4HHWA 1TEFA 1MDAA 4DP6X 3MX0B 2UXFA 1YLBB 5D4HA 2FT8A 2FQFA 4GP5B 4WKXA 4GXFA 3ABMB 2DWTA 2IH8A 1IC0A 3SBPA 1JZHA 4KNSA 1AZCA 4DP4X 2UXGA 2IAAC 5B1KA 1AOZA 3WI9A 1JZIA 2YQBA 5I28A 1AZNA 1J9QA 3D12B 1ETJA 3H4HA 1NWPA 4KO7A 1N68A 1WA1X 3QJSB 2JXMA 3FSWA 1NIEA 1SNRA 3DTUB 1OCOB 1OE1A 1JZJA 2BP0B 2GC4C 3AY2A 1EHKB 2FWLB 2N0MA 2PCYA 3AG2B 4HCIA 4AZUA 2I7SA 3IBOA 3EF4A 2FQGA 4YSEA 3NP4A 1XB6A 4KOBA 1W6LA 3EH4B 2BZ7A 3X1FA 2DYSB 4BWUA 3IN2A 9PCYA 3HEIB 1KGYE 1NPNA 4HCGA 2IWEA 3NJIA 2VSMB 2XLLA 5TK4A 3TASA 1UATA 1NWOA 2YXWA 2XVBA 3NSFA 3N2JA 3FPXA 3U25A 5LDUA 1JZGA 1QLEB 3QQXA 1OE3A 1RCYA 1ZIAA 2IH9A 2FQEA 3DIVA 1ZIBA 4A2EA 1GY2A 4E9XA 1M9WA 3ABLB 4A2DA 1OOWA 4YSCA 8PAZA 2TSAA 2BW5A 4YSSA 2BW4A 2J5WA 1E30A 1WS7A 5I6KA 2FT7A 3C75A 2Y69B 1HFUA 2HRGA 4P5RA 2DWSA 2GI0A 3SQRA 4DP5X 1AG0A 3S3DB 3NSYA 2VM3A 1J9TA 2AVFA 3ZBMA 1QHQA 4WTQA 3FYEB 2PP9A 2PLTA 4AKPA 2XU9A 2PCFA 3V9EA 1GY1A 1JVLA 2UXVA 1QNIA 3FQ2A 1ET8A 1GS6X 1J9SA 4M3HA 2EINB 4F7KA 3CVCA 3X2QB 2DV6A 3DKHA 5IY5B 4GP8B 4DPCX 1BQRA 1AQ8A 2IDTA 3MBWB 2JKWA 2XV3A 1A4AA 4A68A 2CALA 2TSBA 2PPAA 1PLAA 5A7EA 1MG3C 1ILUA 3FU9A 4PAZA 3JT2A 1L9OA 6PCYA 1ASOA 1HAUA 3PAVA 2GHZA 3PCYA 3WNIA 3TU6A 3T9WA 2FNWA 4BWWA 1AACA 3ERXA 5B7MA 1RZQA 1AZRA 4E9SA 1J5DA 1PNDA 1TU2A 4HHGA 3L45A 5B1AB 1W8EA 3T6ZA 2I7OA 3EH5B 4DP7X 2YARA 3AZUA 1AIZA 1SHWA 1VLXA 1A4CA 1WA2X 1OCCB 2CUAA 3OM3B 1AZBA 4KO6A 2WSDA 3SBRA 5I6OA 1XMEB 5F7BA 1GS7A 4FA7B 2XUWA 3FSVA 1R1CA 3FSZA 1L9PA 1X9RA 3QJUB 2IDSA 3ASNB 4YL4A 3NT0A 2LLNA 3QJRB 4GY4A 1NDTA 3NJHA 1CUOA 4X4KA 2R7EA 1BQ5A 2UX7A 5B1JC 4G71B 5AZUA 3OMAB 3OMIB 2IDFA 3NSCA 1AS8A 1BYOA 4AX3A 1E65A 4BXSV 1NIBA 2HLEB 4KO9A 5I5IA 2GB2A 2BWIA 2BWDA 1BEXA 3BQVA 3ZX1A 2CJ3A 2P80D 3FS9A 4ZK8A 1L9RA 2IWKA 2Q5BA
chains in the Genus database with same CATH superfamily
5C3TA 2H0EA 3ABZA 4MVBC 2B39A 3KL5A 2ZX7A 1KTRL 1DBJH 1NDMA 2GSIA 4FQHA 5I2IB 1E4XI 4UTAA 4DGVL 2OMXB 3E8UL 1CFTA 4NRXB 3EO1B 2P49B 3IDIA 4ODXB 2HKFL 3QEQA 4NP4L 3ZJAA 5ILTH 3B2UC 1VFMA 3GMNA 4M62H 1EHAA 1YUKB 3HZVA 1Z3RA 5BV7L 3UBXG 1KV7A 3BEVA 4PRNB 5HVHC 4GG8A 3AREB 3TA4D 1FL6A 1F41A 1CFSA 1NPJA 1WFJA 1TNNA 3GGWA 1AO7A 5KSBE 1X5GA 5IVOA 4WY7L 2EUVA 3QE5A 1WIPA 2HKFH 5IROD 1N6UA 1KPUA 2OR8A 5DFWH 1ADQH 1KFAL 1KN4H 2FX7H 5EG6C 3DO3A 5E4EC 1RD6A 1T1XA 1OP5K 4F5CE 4YK4B 1RJCA 2BVOA 5F88A 3QNFA 3GSVA 3MTRA 4R2GC 3P0GB 3QDMB 5BS0B 5D1XE 2WWKT 5DK3A 3RFZC 2WXGA 5LCVL 3D39D 2C9VA 3REVB 4KNTA 2ZKWA 4PJGB 3SE9H 3EFFB 4Z3FA 3BP7B 2BHFA 3BKYL 5GIRB 5E94B 3UG4A 3FQ4A 5ALCH 2VDLB 4IKLA 2E9JA 5F8RC 5GIRA 4PRIA 2FIKB 2N59A 5EH1A 3FQUB 1FC2D 2QSTA 4RISL 1WWBX 2XKSA 1W0VA 4N2MA 2EYRB 2E47A 3LAFA 3SDDB 4ELMF 3ATFA 3FCSA 5B7FA 4YXHH 5DJ8B 4JFEB 2CKBH 1ZGLP 5JHMA 3V0HA 4OT1H 4BKSC 3MLVL 5K9JH 3GIZL 2FBOJ 4LCCC 1N8ZA 4M5YL 3RDJA 4DP2X 1A9BA 2RACA 4X6EB 1CD1A 1NC2B 5LNEA 1XEUA 4JHWL 3E6HA 3W9EB 5FW7A 1KCWA 4L8SB 3MV9E 4X5LA 5CLWA 5E03A 2XWBA 3OC5A 5TF1H 4CVZB 3BVWA 1RI8A 2AABH 2FTAA 3EOYG 3RUGB 5JW3H 3IS1X 3UPRB 3VFUB 1OARH 4LCCA 4ORGB 3P40A 4GQPH 5D7JB 4APQA 3VJ6A 5IZ7A 3LV3A 4HISA 2MKLC 4JFQA 4YDKH 2EDOA 3MLRH 4U6VL 1NCBL 4JRXB 4L37B 1ZANL 1XGUA 1G7HB 4XBEL 2XY1A 5EIIG 2NY5C 1N8ZB 1BYPA 4CMMB 1QPKA 4RGMB 4HEPG 1GGBH 3DMMB 4XI5D 1IGJB 5AVXB 5IB4A 1VENA 4AGQA 2OMVB 1HT6A 2E7MA 3FO2A 2CKBB 4PJ9C 3TV3L 1NBCA 2ZWKA 4LHJB 1CFNA 1DSFH 1QA9A 3BFQG 3AT0A 4BZ2H 3EYOA 5GS1B 4KKBD 5K69A 4QRPD 2COQA 1HYSC 2GEQA 1EGJA 4YDMA 3BPLC 1MFNA 2VITB 43C9B 3QPQC 1TJHL 1FVEA 2AJYH 2NUPA 5IB2A 5K9KB 4PJ9A 3KWUA 1YEFL 4J8RB 3DUUA 3BHBB 4AQ1C 4RX4D 4DOHB 1S7QB 1GRWA 1XGUB 1OSPH 3O6FA 2DS4A 4OI9A 3VTAA 1NLDH 1JGDA 3H3PH 3AUWB 4UIKL 5IK3B 2DYPA 1HU8A 3UIYA 2VDKH 1N9PA 3WKML 2NY6C 4GG6B 3BD4A 1ASQA 1RJZA 1YA5A 3IMRA 4S11A 1DTUA 2F54E 2XZCH 5FIEA 4ELME 4NZUH 5J06A 4Y4HA 1OAYH 2YGNA 1F4XH 4PHXA 2UVEA 1R3KB 2YUXA 5DC2A 1JMXA 1WZMA 1FVEB 4L23A 2OX5A 1E43A 2QT6A 1E27B 1ZLWH 1TTFA 3PQYD 5C9JA 4KKBC 2OBGA 2ZE0A 3OAUL 5HJBA 5T1LB 3N50A 1G9MC 5I1AA 3D85D 5FO9B 3GTNA 3QIWB 4BKTC 1A7NH 3LQMA 5DK2B 4HEME 4QUOA 1XGQA 3QHFH 2R23B 3SYPA 3SDAB 1MZYA 4KTYA 4NB7A 1B2WL 3GMMA 4KRLB 3NQKA 5I0ZA 1MY7A 4XTRD 3J07A 4FLRA 1ORQB 1HSAB 5LG1A 5D5MF 5ID0B 2F1AA 3VD5A 3BISA 3S3CB 1JF1B 2XWXA 4MJIB 5ICZA 3QHFL 5DVPA 2EVIA 1F3DH 3CVDA 5EC1B 2OW7A 1ETB1 3UTTA 4LIQE 5DJAA 1PCSA 1KACB 4FYSA 1A7PH 2QDWA 4O02A 3PXHA 3HG3A 4G8EA 1DQLH 5FGSA 1JWUA 1KTJA 3VAEA 4UV4H 4ZTOL 5LUMA 1CLCA 4ODTH 4QO1A 3TBWB 2P28B 4LESA 3WHE0 4UIMA 2I9LA 4ZDHB 3FB6A 1HHHB 2DMKA 1I8AA 5EZLB 3Q2NA 5DLLA 4OGXH 3EG9B 3UEQA 3HMWH 4LE8A 4MBRA 3WY4A 2BIIA 3MOBL 2PTUA 3LH9A 1GGIL 3PWPB 4PRNA 1CBJA 5F1IB 1R75A 2BP0A 3GXUB 1OPOA 1QFWH 3ZE1B 2IH3A 2ZG1A 4C8XA 1BOGA 1E5YA 1OTSC 1X5FA 3T3MB 4HFWA 2GY5A 1C08A 4L4VD 4LO9A 2RAMA 1AI1H 4L1SA 2NX5D 1QLRB 3PDOA 4HFUH 1KG0A 4JFHD 5DWUH 1NLBH 5EPMA 1KJVA 1YPZA 2GK0A 1VKXB 5IJCC 4OD1H 2IH1A 2L3BA 4N68A 4QWWD 2HP4A 1LGVA 1J0ZA 2AJVL 5C2BH 2ATPA 2EEAA 1VGKB 1YDPB 3EAKA 4OAWA 3ZDYB 4TUOA 4KVCH 1AQMA 4AJVA 2FYYA 3TP4A 3DJZA 1NCAL 2R4SL 2NUTB 2KS0A 3V0WL 1W0VB 3H2WA 4H2AA 4AGMA 2IH8A 3IF1B 1O5PA 4C4UA 8FABA 4PP2A 3AXIA 4LCWE 1DJXA 1XZWA 3T3PB 2IAAC 1XEDA 1XR9B 5DJ2B 3WI9A 2YQBA 1E6JL 2XZAH 2ZOWA 1IAOA 3BZ4A 1TJIH 2XBDA 4QYOA 1FZOB 3HRZC 4MCNA 4R97C 3EO1A 1DBBH 2NY4B 2E8ZA 3L4UA 2R39A 1UTDA 2IAND 4LK4A 3AM8A 1SNRA 2LAGB 3DTUB 3G9AB 4LXFA 5E8NB 3VG9C 2HN7B 2Y5TA 2HG0A 5C0JA 2GABA 1LD9B 4GEJA 1KCSH 1FDLL 1KT2A 1JK8A 1SMDA 3HI1B 1ED3B 4JY4B 2OK0H 3BP5B 2GKIA 4JZJA 1XGYH 4MMZC 2N7SA 3ZU8A 2GBVA 2Z64C 5EN2B 1A7QH 3W56A 2LU3A 4UDUB 5C09D 3WEOA 4HCGA 5KANG 4EN2A 3SCMA 4YHNA 5GS0C 3NPSC 5JTWA 3DX6B 3T3PF 3N2JA 2NXZC 3FT2A 4P46D 4HWBL 3FUIA 4R3SB 2BCMA 4K3JL 1CGYA 2V2XA 1GY2A 4XMUA 3ZY7A 5GQBA 4XPFH 4MCYA 2BVEA 4LBAA 3I84A 4MCZA 1U3YA 1FAIL 1XL6A 5EMYA 1IM3A 1E30A 1R3LB 3AC0A 1IAMA 5AB2A 5IV2B 2HJFA 4C4BA 1L3NA 2FT7A 2ZWZA 4QLRA 1YNTF 5T33L 1Z0NA 2W92A 2CO7B 3KPPB 4LSRH 4XCCH 3LXBA 2FDBP 1J48A 2YD1A 5SWSE 3S3DB 3QZWB 2E6QA 1K72A 2YD6A 2RH0A 3WKNA 4GKNB 4GRWF 4UT7L 4YX2H 2CCLA 3DX6A 2NTSP 2VDQL 3FUEA 3QRGH 4WTQA 5SX5H 3SKJH 4N86A 3TBTB 5A2IH 5KAQF 3BVNB 3QDME 3CN1A 5AAWC 2VERN 4Z7WA 4I1RA 4K9EH 4HJ0C 4X8XA 1NFDE 3FQ2A 5DEJA 5AG8A 2DLFL 5E9AA 2CBMA 2VLJE 5AW2B 3GHBL 4FNTA 4MA7L 3HE7D 4DJMA 4ODWA 4NFCA 1R3LA 5J12B 5JR1L 1P0SE 3NPZB 4PG9A 5C70A 5F1SA 1I7TB 1MCJA 3NACL 2BIOA 1SJVA 5D7IB 4JPSA 1KGJA 3CGTA 4X4XB 3VYOA 1HXYA 3K72B 1H9DA 4PCSA 1I1FB 3MV9D 2F8VA 1WITA 1S7VB 3U4AA 3RZCD 2EDQA 1I1AD 4PPTA 2FJHA 4DK5A 5TDNB 3CFJB 4XVOA 2V2XB 4JG0H 1BP3B 3II3A 1RZQA 3ZDYF 3M7FB 4QTIL 4HV8A 1MFCH 1J5DA 3GJEB 2W9DL 1N64H 3VDBA 3HB3C 1W8EA 1FO0B 4A04A 3ML8A 1LWJA 3HC0A 1B0RA 1EFXD 3AZUA 1AIZA 3IETB 5MEOA 2XVLA 1CLZL 4YBLC 5DQ9B 2BP3A 2QHLA 2AQNA 2QMJA 4M61A 3LS4H 5FKAA 4OIIH 1XH0A 1BG1A 1J8HD 5H37G 4NO3B 1WGVA 2VQTA 3HG5A 1L0XA 5LHDA 3H2QA 4XCNB 3FFCA 3O3BA 5AW9B 5CWSB 3OJVC 3V5HB 2EVHA 2OMUA 5D7JC 5BRZE 5D1XA 4GOSA 1NOLA 3K2MC 4GKSA 3CFEB 3IXTA 4O2CB 5TDNA 3V0DA 3MRNA 3FRPG 3PABA 3NDYE 4G1EA 5B1JC 1DQKA 1N5YL 4X6DB 2BRQA 5IFHH 4JZOB 3P3YA 3LKRA 3L9RB 3PQYB 4P5TD 1EO8L 1KLUA 3UP1A 2EEBA 3G5XB 1SXCA 3LS5L 4UU9B 3BLBA 3INUL 3H9HB 4RAUA 1RIHH 1FE8H 2Y36L 3PGDA 3WFEL 3T8MA 3JV4A 3RVUD 3BZFA 3DV4B 4A2FA 3RP1A 1V7MH 1Z9NA 1I7RA 3GHPA 3MBWA 4F33B 2J3SA 4YDJA 3B43A 3NFSL 1WFNA 4DO5A 4MMXB 4AEIH 1FF5A 1YRKA 5I1KH 3KNBB 3S8FB 3W5MA 4NN7B 3WNKA 5I1HL 4W4OA 2AP2A 2Y9RT 2APTA 3ABKB 3DRTB 1LHZA 4PRAA 3NJNA 4WDIB 4XMKH 4XP1H 4ZMNA 5KYYB 1T0OA 3HPLB 4NM4H 2A6IB 3H9SB 2PW1B 2ADIB 4EI6A 5C3LD 3C60D 1FNAA 3Q7JA 5FXCH 3KVDD 1FYTE 4ZD3L 3M17B 4KJQC 2BNRA 2YD5A 4X6DF 2YK1H 2I26N 3UPAA 3LX9A 5EPMB 1MHCB 3V7MA 3II2A 1F90H 1LEIA 3FT4B 3FFCB 3V5DA 3CXHJ 3KWTA 1SJHA 4Q6IC 2E7DA 2ZYIA 5F3FA 1I7UB 5H37H 1MFBH 3U4BL 5KJRH 1A3ZA 1G6RB 1UURA 1UENA 2MPAH 5IEHA 1A2YA 5L8LB 1ZLSH 4XPAH 1URZA 4WHTA 1U95B 32C2A 4M5ZL 1HN1A 1QR1B 4PRPD 4R9HA 4NUGL 5CHNB 4D0BB 3KPSA 2LW3A 3O45A 2P8MB 5HJ3B 4WU5B 5CCKH 3RNQA 4NKMA 1Q1PA 1EAPA 4EN3B 2GYSA 5T3XD 1P9MA 2JH2A 3ULSA 1Y6NR 4IBYA 3F58H 3HI1A 4X6CB 5SWZD 5KS9B 2FATL 5I8EB 5T5FH 1JWUB 4ZG1A 3ARBB 1QKZH 1KG0B 2J2ZB 4FZ8H 4KGLA 4TQ8A 1G9EA 3QNZA 4L4VA 5T5NF 5I1GH 3O2DH 5FB8A 2WKOA 1XIWA 3IFPB 1NSNH 4R4FH 2P5WD 4OIFA 5C0RL 5MENE 5CBAA 1EMTH 4BDVA 4JGNA 2EECA 1QSFA 3IT8D 1AHWA 1OO2A 2GCYA 2XY2A 2BVUA 5EZJB 4Q6KA 3S37X 5EBLB 1MSPA 5ICUA 1K9TA 3QUXC 2RD0A 2NW2B 1JNHA 3H1ZA 4O2FA 2QFRA 4XNMA 2DTSA 3S5YA 2A2QT 3QGVA 4NQDE 2XKNA 4MA3B 2G5RA 3S0PA 1GL4B 2B1HL 3NEXA 1JD9A 2C34A 4WGWB 5IVXF 2L0DA 4LSQL 4LLMB 4FYRA 4HHAA 2TAAA 3BP5A 3U1PA 1HWHB 1ZS8B 2WLZA 1U92B 4FAAB 3V8OA 1C8QA 2ZYHA 1IGCL 3TFKD 3HHRB 3SDCA 4N22A 3O4OB 3VTTA 5I73B 4PP1D 1HL9A 4WNQB 3OAYK 2AEWA 2X9WA 3NESA 1JMZA 4JNXA 1JFQL 2WANA 3WFBH 2VMEA 1C5DA 4NENA 4TQPA 1QBMH 4XC1L 3LSOB 4NQSA 5LXGL 1Z1WA 4U31A 5L4IA 4FEMA 3EXJA 1BZ8A 3UYRH 2OMTA 1UOVA 2K6WA 3GM0A 5C0IB 1RJLB 4F7EA 3D9AH 1KBWA 5DHYA 4ZUUA 1TVHB 4KZCA 2DTMH 3KL3A 3SSGA 1OWWA 3O2WL 2VC2B 4JO1H 1AQKH 1L9TA 3MZGB 5F9DC 1NMAH 5FFGA 1S7RB 2YN3A 5FYJL 3G5ZB 3GMOB 4DKFL 2ZF8A 1MCBA 4OZGA 1CZ8H 4GW1A 4L1LA 4KVCL 2XWDA 1J11A 1B0GA 1JDAA 4LVHC 2C3GA 1EHXA 1EBPA 3BE1L 1T03H 3RRQA 2ZAHA 3E6HB 2OMZB 1L9SA 3D18A 3HFML 4W9EC 1J5HA 3T1WA 4PJCF 1TETL 4ODVH 1GCYA 1ZT7A 4S1SL 1IBYA 4X5WA 5FM4A 1RHFA 4QF1B 5L0QB 3CDGB 1J1OL 1ODUA 1DCLA 4CGUB 5F96L 1I7ZB 5L6YH 3WS3B 5I6PA 3ET9F 1T03L 3MRDB 2C9QA 4WO4D 2Q8BH 3GXFA 4APQB 3PG2A 4NPKA 4RGOH 2E75C 1KOAA 3HS8A 1DQDH 4EOWH 4IOSD 2AI0H 2JCCA 5IBLC 4OM0L 4N0UE 2F1EA 1ZA3B 4G9FD 3HFFA 2ZOKB 1DQQA 2EEFA 2YXFA 1PIFA 3Q05A 3B9KB 2DYPB 4QY8A 3HRPA 1ZT4A 3QFDA 3BIAX 1SFHA 1T66D 2A1WH 4RA3A 5DK2A 1MCNA 1HHJB 2W60A 1N26A 5H94B 4JG1L 3THMH 4HF5H 4YXLH 3B37A 4FTVA 4EQ3A 5ICYB 5JQHC 3T71A 5IREA 4X4YB 4DZBA 1OKEA 2BSED 1HQRA 4RFEB 4HKXB 4XHJC 1RLBA 4HKXA 3RWGA 5E2WH 2GHWB 3CN4A 4WAFA 3QFJB 4LASH 1CYXA 3AWFA 3T6VA 3MYJA 5I75B 1D5MA 4N5UA 1SXAA 1JRHH 1NEZG 1TR7A 3C6LC 5F6IB 1XBRA 2B2XL 3OKEA 5E9NA 4MXVE 3SOBL 3FHAA 2PYEB 4P48A 5I74B 1Y1DA 4FQ2H 1DQQB 1IAII 4NOFA 5FLUA 3E9UA 3BXNB 4QRUB 2W0KA 1NINA 2MTPA 5IK3A 4X7TA 4HUUB 1IL1A 1JGIA 3P4NA 1FIEA 5E2TL 3UX9B 1D6VL 5D6CA 3TIEB 2VL4A 3QDGB 2OTPA 5AB0A 1TXKA 1RJZB 4FEIA 4FRWA 3GXPA 4EI5A 3NOIA 1ROWA 4LSUL 2WO2B 1EFXB 2WQUA 1DDHA 4KUCD 3II1A 4UINH 4PW4A 3U0WH 3D3VD 1TU2B 2HSIA 4F37K 4F9PC 3WTSA 3ME0A 1SOQA 1CL7L 4FJ6A 4TKWA 1JPFA 5INCB 5C0RH 5ECJE 4ZUTA 1CDUA 1T1YA 2DQJH 4N24A 5IMOA 4J6IA 1CURA 4RAVA 2L7UA 4L4TE 1MKFA 1S9VB 3L5XL 1VEMA 2FBJL 4XNQB 3QNYB 2DLTA 1J0IA 1GPOL 2F7IA 2VTFA 3PPSA 3CZLA 4EO5A 3H42L 3W39B 1J8HA 1XR8A 4N85A 4BSJA 1H3WM 3MXVL 4ETQB 4YSRA 3OGCA 1UXSB 2VC2H 1SLXA 1XSKA 4EXPX 1H3XA 5LNGA 1FI8C 4DGIL 2ODHA 4WW2C 1Z7JA 2Y7QB 3TA3C 1T80A 3EBAA 5DR5L 1NFDB 4NKIH 4QHMB 4DP6X 4GUOA 3FZUC 5ICZB 2P5EB 4XMPH 2FT8A 2FL5B 3LZQA 3QI9D 5JIKA 3CBJB 3T77B 1JPFB 3U79A 3LN5A 1IGIL 3NCFB 2R29H 1YSOA 4NLAA 2AQQA 5FDWB 1HEHC 2P3YA 3R8QA 3GZPA 4YDVA 3HBGA 3VDAA 2K70A 3KPRB 3DSFL 1DVSA 1DR9A 1PKQA 3LB6D 1U42A 2A74B 1OLZA 2E3VA 4TSAL 3E2HC 3MREB 5HI5C 1FVCA 4JGUA 2Y72A 2V8LA 1MF2L 2DM3A 3IGUA 4D3CH 2E9IA 3SYCA 2XXCB 3K2IA 4FI8A 2V3EA 3CFQA 3LKPA 2FECL 5KVEE 1P7HL 3NH7L 4ZOEA 2NTFA 3SJVB 5JHAA 1X4YA 3N06B 4LPYA 3D33A 4WUKL 5INCA 4J27A 1UKTA 2PABA 3E80A 3UBHA 4F58H 4IU3A 3MLPA 3W2DH 1P5UB 1UZGA 3QB7C 4TSBL 4GMTH 4UQ2A 3D69B 2CLZB 2FWOB 2P5WA 2KERA 3KD4A 3N3EA 4HC1L 1W6LA 3D1MC 1WBYB 1JF6A 4ZAKD 4BKLB 3VB8A 4XAKE 2JKJA 3HEIB 2OL3H 1H0DB 3DLQR 2JV6A 3NIDB 4J3TA 4IRJA 2R29A 1J7VR 1OY3B 1WWCA 2JI3A 2XPZA 4TSBH 3JZ7A 1RCYA 1YNKL 3K6NA 3BRFA 3OG4B 2CUHA 1TOXA 2ICWI 3COOA 3KXFB 4AIEA 3H9SA 2JE8A 3GMLB 1OOWA 8PAZA 1NBQA 2WXKA 5C0EB 1E5AA 2VLMD 3H9YA 3T1FB 4GFTB 4ZPTB 1MI5E 4ODSL 4UNTA 1G6RH 5GJTH 2EDMA 3L6FA 1I85C 1J18A 3FCSB 1HFUA 4BCXA 1JXJA 1N6QL 3ATDA 1JZ6A 4JL2A 4X9IA 5KTEL 3T3PE 1LO4L 1CXIA 4H1LG 4LCWB 4LCYB 4GMSL 2R69L 1LEKA 2DKUA 4PBDA 3NRPA 1KTLA 3CSYB 1DCEA 4NWUL 1IFGA 4M4PA 3LIUA 4QHUB 3FTXA 2ZXEB 3TBSB 3WIFA 5E94A 4C56B 4RWYL 4AV0A 2JCCF 2R1XA 3MKKA 3T65A 1MHPL 4KKCD 4OY9A 1GS6X 4K94H 1ZRUA 4DZ8A 4LHUB 2AJXH 2WTPA 4AZ8B 4NZDA 1JPEA 3KDMA 1HE7A 3HE6A 1KPVA 4X0NA 3ZR6A 3DKHA 4KKQA 3O4LD 3CK0H 4ZTPL 1NGZB 5I1JH 4R6UA 2WUCL 1S5IH 4RSYA 4O51A 3ZE2B 3RUGE 4L8DA 5D7IF 4DESA 3NFNB 1A6WL 4WI9A 4OZHB 4PJCA 1NFKA 3NDZE 3UBFA 5IIEA 4PN6A 3CSPA 1KEGL 3DPDA 3P69A 3JWOL 2BVQA 2EO7A 3WE6A 3DURA 4Z18A 3T0WA 4PAZA 3VWJA 1HAUA 4PJ5A 3O6KH 5T5NG 3V4VL 4P2AA 3ZKXB 1CG9B 2OI9C 3SJVE 1NUNB 2BLFA 5F7HA 2IVFC 4Y9FA 2DJMA 3U7AA 3GKZA 5B7MA 1T66C 4WUUD 3ZYOA 4KZDH 4URTB 2XBTA 3QUHA 4OGAC 1KEGH 5H35B 3NZSA 3UJJH 1N8OE 4PVMA 1CPUA 4OCWL 4DP7X 3LKOB 3OAZK 1VLXA 2X5PA 3HUJF 4EXKA 4F8NA 4QRFA 5BCAA 5L2KD 4Q2ZA 5F7BA 2F7PA 5LAXA 3ZTNL 3U0PA 4X4XA 5E6ID 2J8OA 1R1CA 4MD4B 3MBED 4NDMB 1TNMA 2WTRA 1P7QD 2EO1A 3FSZA 3LXAA 3ARXA 3WOVA 1XBDA 4LL9A 2FK9A 4V11A 3GJFH 2HFGH 4YL4A 5TQ2L 3ZW3A 1E9PA 5D1XB 2ZXGA 3LHPL 1A7QL 3FB7A 5DEFB 5EOQL 2BOBB 1R5IA 4QTHA 5D7SH 3U2JA 3B3IB 4DVBA 2ZXAA 1OGAA 4WZ9A 2IDFA 2K4WA 1S7UB 5IVXA 2Y22A 4PJFA 5KOVC 2YD0A 4K8RD 3SGEI 2H2SC 4AM0B 3K6SB 4OGYL 2XETA 2VERA 3P4MA 4H8PA 3QFGA 1FFOB 3FCUB 2HT2C 4LSVL 4IU2B 5ADPH 3ZX1A 1G0XA 2E7LA 5EC2B 1HSBB 2HH0L 3QZWG 3F7KA 3MCLH 3QPQD 3B9KD 2YKLH 3BSHA 4M7LH 3CFDA 3GSOB 4G72B 2Q6WB 1AD9B 2CRYA 5D1QD 1NTDA 3BGMA 3QQ9D 4RFOL 5C9KA 2KQNA 2E4TA 1N3NA 3ARFD 2KPWA 4PIBA 1MOEA 4J12A 4GO8A 1G7LB 1ACYL 4Z5RA 3SKMA 1MFDH 4OQTL 1PG7H 2F54B 3GIVA 1MRDL 3HG0A 4Y0GA 5CZXD 1HKFA 1CDYA 1XCWA 5ALBH 1ZE3H 1Q94B 3GK8L 4LLYB 4ANWA 1ZLUH 1EJ6A 1IC5L 2YLHA 2B1OA 2F19H 4GFXA 3KWVA 1R24B 1H3GA 2PPFA 4BFBD 4DOHE 3FTWA 5KYXA 1WBZB 4QJ5B 4OD2A 3NH7H 3TJHC 3DOIA 4EKXA 1NCCL 5AKTA 2D7MA 3WAKA 1QACA 2YPVH 1NBYB 1NMAL 5DZOA 4X6BB 3SKOB 5B39B 3JYBA 5PCYA 5EBMA 1EERB 4PTUB 3QEQE 1A6ZB 4HFUL 2QKSA 5HI5D 3DBXA 3BLKA 2DLGA 1UWXK 4X6DA 3HUJE 1XD0A 2OMNA 4PJXB 3EXLA 4JR9L 4HW6A 2ZKYA 1MUJB 5D2LF 4ZXBC 2ZYRA 4HIQA 3VM5A 3QORB 4WW1B 3T6XA 5I0YA 2J56A 4O2EB 4X4MA 5KVFH 3IDMB 3HAEA 3OLDA 5HYSB 1UVQA 3WFBL 1JYVA 1NFAA 3GBMH 3QJHA 1KDJA 1JOIA 2ESVE 3ZIMA 1WWAX 3T08A 3HE7C 4NO3A 3OSKA 1IAIL 5ADOH 2NX5E 2CHNA 1VFBA 5E23A 1TYJA 3MCKB 5TF0A 2H9GB 1OSZA 2ICCA 4BUHA 4DO4A 3FN3A 4KQ4H 3KNBA 1OF2A 5LG6A 3DIDA 4LEBA 3UYOD 4K9JA 3QG6A 3LMJL 3CDFA 5L9DH 5KANI 1ZTMA 5I75C 4MD0B 2EKJA 2YAFA 4X9YA 1RUPH 3OF6A 1B6DA 3C6LB 3KEHA 4P07A 2F7QA 1LP9E 2K8MA 3MJ7A 1EJOL 3MLUH 4HIHA 4M6AA 4NO0A 4PGDA 5DS8A 5AYUL 5HY9A 4XH2A 2CBPA 4W9ZA 4GAFB 5D2NB 2GJZB 1CL7I 5DD6A 1NDGB 3HC3H 3CZNA 3D6GA 5ETUA 4N1EA 1IEAA 3A6CH 4BEIA 3BRGC 4N6RA 4N0YL 5CEXA 4L5FL 3RVXD 5G5DB 3TFBA 2ZXQA 3HI6H 4B3EA 3MRJA 5AENA 2G2NA 1AQDB 3CMGA 3VNZA 4DN4L 4LF3A 3SE3C 5TDOA 4BXVA 1ZTXH 4JHUA 5AWNH 1DZ0A 1L9QA 3K1DA 5FHAL 4QLWA 4P59H 4QTFA 4F8LA 1PNCA 1H3PL 2C9AA 3MJ9H 4U1HB 3WY2A 4ISVB 1BVKA 2ZXCA 3VD1A 2B14A 4HJSA 4AL8H 1HJBC 3FCTA 4I89A 5I1GL 1EH9A 1XF3B 3EYUL 4H8WH 4X8JA 1H9VA 1PS3A 3UAJA 5AZEL 1PKQE 1HAWA 5DJXB 2QPDB 3AWEA 2ICEB 1LD9A 3FU5A 2XWRA 5A3IC 5KW9L 4Q0XH 2DY2A 3OLEA 5LDSA 1NA8A 3V6OC 5DQDH 5FR3A 4DKAA 1AHMA 4M03A 3PWUA 5J9PA 1GGUA 4KUZH 2B1AH 4K3DL 5A7BA 5IHUL 5GISL 4E68A 3VXUD 4MNHB 2BVQB 3GLAA 3MREA 3H9ZA 1U8QB 5T5FA 3MPCA 3BH9B 1U8LA 2DBLL 3EYQC 4FA8A 1R46A 1ID5I 3LRHA 5KSUA 4ZFOL 4PJAF 3G5VB 6FABH 4PJBA 3P1VA 1MCLA 1A4JB 1MHHB 3LQAH 2DH2A 2FCBA 1M6OB 4E9RA 2C9PA 4EN3D 3JTTA 2WZ0A 1A5FL 2VB5A 3KDMB 2VQ1A 4YSPA 2CCWA 4M6ML 4B9KC 5I23A 4G8GA 4KRPD 4OZ4A 1WAEA 4RQQA 3QH3B 5K1JA 1M7IB 2P5WB 3HKZA 1ZPLA 3VXMD 2V0AA 3VXUA 2V17L 1JGEA 1DJHA 5I1IH 4V1DA 3VGDA 4PJ5D 4M93B 4UAOC 2XN9D 3FULA 3ARRA 5EU5B 5FEBA 1G0DA 4TNWK 4YHIB 4GKNA 1NGPH 3DTXB 5I1DB 1S5IL 3C5SB 4LEXH 4XCEB 5FO2A 2P8PB 3V4VB 3P0VH 3CK0L 4ZTPH 4Z7VB 4AQ1A 1LE5B 4U6VH 2LLLA 5IJKA 1AG6A 3GB7B 1HIML 1LO0H 2NXZD 2WINA 1ZA6A 4A2LA 2W65B 3QQDA 2ZG2A 3JTSB 2JIXA 1IM3B 1OHQA 3GSWA 3SIKA 4EVNA 5L2KA 1DUYB 2WZ6A 4C4KO 3WL9A 2A3TA 5IB1B 5K1VA 3PF2A 2BNQE 1P7QA 1IC4H 4DW2H 3HLAA 5CP3H 1BAFH 2IDUA 3U0PB 3IDGA 3B2XA 1A4BA 2J6WA 3O6FB 5F7FA 4NHUA 1LDSA 2X4OB 3KPOB 4YS4A 2LTQB 2Z0BA 1SLWA 1D5ZA 5HHVH 3WS6A 1WAAA 2CIKB 5I17A 4WUUB 1YEEH 4NZRH 1GMIA 2IAMB 3N40F 5D1QC 4IBVA 1BM7A 4PREA 3SYOA 4OZHF 1ZJBA 3RYMA 4G6MH 2UY7B 4G6FB 3FO1B 4S2SA 3N04A 3BAYA 2XJLA 5F1OB 4YFEA 4RH4A 4X4ZA 1F1DA 1XMWA 1PZ2A 1KCRL 1E4KC 4PEEA 3HPJB 2J12B 3WKQA 1KEMH 2Z35A 2EKSB 2JJWA 2OKMA 2VXQL 3ME0B 3QO0B 3P4OB 3QUZD 3O3AA 1AGDA 1RH8A 5C0BD 2OQJA 4BQ6A 4YC2B 5D7SL 3CVIH 2EDRA 5IW6A 1U6AL 4L3FA 1QFUH 3CFNA 5E8DL 5LAXB 1G7HA 2FVNA 3WCYA 5D1ZD 5T3ZH 4O4YH 5AD0B 1MCDA 4X7TB 1AP2A 1DBAL 4Q58C 1OQOA 4YWGH 3DX1A 3BAKA 1RSFA 2QGDA 3HI5L 4XZ4A 3RZCC 2YUWA 3GSRB 1EMTL 1I1AC 4WO4A 1PG7X 4PIRF 3W0WE 2UXFA 1YLBB 3AJ7A 3RUGA 3O2DL 2P5EA 3BUDA 4PJHF 5DU7A 3VXOA 1SBSL 4JFFE 4QRAA 3S88H 2D2CC 1G84A 4ZODA 4XXCA 2F18A 1COBA 3ZKNC 3I50L 1TYRA 4DKDC 3KZ8A 1PLGH 4P9HC 2OYMA 1E7UA 1RZIB 1WUNT 3A4AA 4M6MH 1ZT4B 3QFDB 1T4KA 1DN2A 2O5ZL 3H4HA 4ZDHA 3L5WB 3V7AE 5DTFB 1T21B 1FZMB 1YPZF 1KLFB 3FSWA 1NIEA 4XB8A 1ORQA 3KS0H 4NM8L 4Y4HB 1TVDA 5DQJB 3PWVB 1RUQH 3ZKQD 2EVFA 2FL5A 5GGUA 3KH4A 1O9ZA 1F90L 5C07E 4B7LA 4B7IA 4E5XB 4P3CH 5BUAA 3IJSB 1AYOA 2I7SA 2NUPB 4IGBB 1TTCA 4OJFH 4CKVX 5D1XC 3O41B 1LNUA 1TSHA 4Z7UF 5D2NE 1U2CA 3CFMA 3KYKL 2ZAIA 5FECA 1S9WA 4EIZC 5IW6B 1W72L 4L8CA 4HWUA 4XNZC 3WUWB 2YD2A 3QUYA 3VFOA 2BHUA 4HJ1A 4KGJA 5E95B 3L95B 3QEHB 4U0RB 5ESVA 1QBBA 5IKCA 3PUUA 5KZCB 1W16A 4M6NH 3TT3L 2D3LA 3BCFA 1KIQA 5ESAA 3D3VB 4NJAH 1ZHLB 5D72H 3I9AA 1TMCB 1Y18B 3DRQA 5CEZE 3F64A 5CLZA 1R3JB 4FNPA 4AYDC 3ECQA 4DVRL 5CJ5A 5DMKB 1QFWM 3ARQA 4KVPA 4HPOH 2VDLH 1H8LA 3B9AA 1BXXA 4KKLC 3L13A 1QLEH 1OB1B 2SEBB 4PB0H 1SY6L 2HRGA 3KR3L 2DWSA 2JB5L 2WXLA 2D7PA 5KBMA 3OKOA 3S5LB 5KVDL 2OTWB 3NCWA 3CCHB 4XN7A 5CZKA 1RZ7H 1X4ZA 1OIOA 3V5KB 4A38A 8CGTA 5EEWA 3FDWA 3PWNB 4NWTH 5CBEA 2R23A 4YGVA 1EXHA 1O6TA 1NGQL 3LNFA 4GQ9H 3WTVA 1CFQA 1WAPA 1B6UA 3HI6L 3V9EA 2UXVA 3VACA 2IADA 2P24B 3LZLA 5I6XB 4AQAA 2AI0L 4DUVA 3LKPB 3ATEA 3LPGA 4YFLF 1Y0LA 3C5JA 3JV5A 3BAXA 4GG8B 2YRBA 2P8MA 3LZNA 3BIKA 1NC4D 4UTBL 1UWYA 1IQWL 1FZJB 2VXUL 2X9ZA 1F6FB 4HBQA 4Z77A 1AQHA 1NUDA 1BLIA 1WD8A 1QO3A 3VRLE 2VUOA 1XSOA 2XV3A 3MGAA 3NABL 1I9IL 1RZJH 2BDNL 4H0IA 3ZO9A 4LSSL 1MRFH 1E28B 3BZDA 5C7XH 1DQTA 2IJ0C 3HZMB 3C9NA 4M8QB 1XH1A 3HZMA 5D6DC 3CU7A 1AACA 5FYJH 1DHKA 4N1HB 5CJXC 3IDNA 1RZJL 1SEBA 1B2YA 5DHVA 2YJLA 4LAJH 3L4YA 1XCXA 4XO4A 1GZQA 2DL9A 2CPCA 5HHOD 1ZS8A 4DGUA 4X6CA 2WKLA 2BS8A 1FO0L 1VFAA 5C0CD 4IRJD 4UQ3B 1IRAY 4YIQB 1G87A 4J3UA 4TUJA 1B0GB 1FFPA 3DTXA 4XO3A 1A6UL 1ERNA 3IDIB 4MQXC 4ODXA 4JQVC 3VFPB 4ZTEA 4A7VA 2BIMA 2NW2A 3K3QA 4RMSA 4Y5VB 2DQEL 1Q72L 3CBKB 3I74A 5IQ9A 3ROLA 3PIQA 2FIKA 2GEEA 3TVMC 4ANUA 1PBYA 1SQ2N 3DSNA 2IEPA 5E4EB 5JLZB 1IEHA 1JYWA 1AS8A 1M4KA 2VDOL 3ARDC 3WTYA 5JO5A 3G6AA 3LVEA 2CR6A 4I3RH 1M7DB 3MLYH 4PJAB 15C8H 4P59L 2IGFH 1OAXH 2ZKMX 4IOIB 3W1ZA 3EJZD 2IPKA 4P0DA 1T1XB 1BFSA 3CVHH 4DVRH 4JFOB 1EEZB 5JXED 2AGJL 2WZ5A 5FO7B 3QUZC 4WVRA 2QLYA 5FYLH 4C56D 5D7LD 1HZLA 5E2JA 4HJTA 4XNXH 2YKLL 3HHSB 3M45A 3ECBA 2VDQB 2UY7A 5A2AA 3HE6D 4HSQA 3FU0A 1MQ8A 3BEVB 4QHLA 1NFDF 2FUTA 1V54B 1OAQH 3IAGC 1RULH 3SGKA 3ASWA 5GSRB 5AW0B 2EIDA 3O9WD 2L7JA 2XC8A 1PZBA 1IBDA 3ISWA 4GRWE 5DJZB 1U8IA 2IV9A 5E8EA 4HHAB 2CJUH 1JGEB 5EOQH 3RI5K 1V10A 4Q9QL 2DH3A 3BZ5A 2DLIA 2HFFA 4YHKL 3ARDD 4FLQA 4FI6A 5KBKA 5IMKA 2CH8A 3QSKB 3LDBB 1WCBB 2WKGA 4O02H 3UJJL 2RQEA 2IDCA 4QRSA 4G6FD 3DJRA 1C5DB 5EORL 1UQSA 2M8XA 1A1OA 3E1F1 5H4YA 2CO1A 4W9CC 2OMTB 2QADB 4GINA 3BKCH 2WIIB 2B9AA 3ZLQC 5C07A 1WLHA 2Q10A 2FD6L 2X4UA 3CXFA 4GAAA 4NHCH 1MRFL 3BAWA 1MFBL 4Y19A 1IT9H 1IBZA 4R0LA 4JDVA 5DGRA 2FSEA 2VXQA 3G6JE 1JERA 3H9HA 4RAUB 2YXVA 2XDHA 3LN9A 2YAQA 3GDCA 5KYXB 3FB5A 2E7CA 3KW7A 1ZHKB 2XX0A 2Z92A 1TEGA 1I1FA 3W9DA 3CXDL 2BP8A 3BO8B 3L4XA 1OCRB 4P4KC 4JRWA 1T1ZB 1IM9D 4W4NA 1PYWA 4M29A 3KS0J 3MRMB 4HA1A 3RKDD 3Q43A 4GPVA 4DKFH 1FE8L 4GAJL 4ZW5A 4FFWD 2AJ3A 2V5TA 3EFOA 3CPUA 1G7PB 1P4IH 3L9RA 2PW1A 3IE9A 1KBGH 1JI1A 2QVTA 3DXAE 3MHZA 3OBAA 5BVJA 1OQXA 3IDMA 1YQVL 1G5AA 2KZBA 2D73A 2DD8H 2BS9A 2C26A 3DGGA 5B22A 2BNRB 3P4OA 4JRYB 3QJVB 4ZMYA 5D1QA 1EEYA 4HYTB 1QPXA 1QRKA 4JREC 1M56B 1FYTD 1OT4A 1T0NA 4P2RE 4NAQA 3RILA 2A6KA 5GGQL 2H32A 3ARFB 3OKLA 4OJYA 3WO3B 5I18H 2Z92B 4OLYL 1KBKA 1FRGH 4XMWA 2WC7A 1G1CA 1OF2B 3IGFA 1P9MC 1LK3H 2F08A 4B9CA 1Q4NX 2EXTA 4MJJA 5KVMC 2P47B 3B6SB 1U8HB 3LZOA 3Q6FA 4Y4KA 5ESQA 5J6HB 4IKKA 5HHXL 4ISVA 2JFCA 4P5TC 3L9EA 3ARGA 2YEZB 3GDBA 4F7MB 3NGBC 2HYMA 1WA0X 2P26A 4OCYL 3LKRB 4X8JB 4OLYH 3LNGA 4WIQA 1WP6A 3BKYH 1XFPA 1JPSH 3BPOB 1A3LL 1DVFD 5F6HI 3B7SA 4X5XA 2C4XA 5F7MC 4EJ1C 2ZSVA 2PWDA 4L4VB 3KCPB 3FAXA 4NJ9H 5E99H 1PF3A 3EO0B 1GCFA 1S7WB 1LM8V 3ZZSA 3C5ZD 4CAGA 3DVGA 4D9LL 4HOZA 1E5UI 2AF2A 3M88A 4WWPA 4I3GA 1LVEA 2ZTBA 3MJ7B 4PGDB 1R5VB 2VNCA 2ZUYA 3G04B 3NJMA 5IESL 4H25A 4BA8A 4PJIF 5FFOA 3VQMA 2GAZA 4Q89A 2GAZB 1A9EB 2J8UB 1IVLA 2NY7H 4IJ3C 4K5OA 5ETUB 4WTZA 2GJRA 1F2XK 5K1NA 2O5ZH 1OAKL 4MD5A 5GHWL 5ABAA 4DQOL 3UXFA 1NOFA 3F85A 1P69B 3JQOB 5FF6B 2VLRA 2BSSA 2NR6C 3VQ2C 1NL0L 1YUHB 3Q3GB 4YR6B 5FO8B 2WLLA 2VR3A 2OLDA 4YDJB 4Y4HC 5DF0A 3KCPA 1RUQL 2EIZB 1I53A 1OSZB 2X0WA 2FD6H 3A6BH 1D6EB 3IEAA 2VXVH 2ENJA 4YHPB 5CEZH 3MROB 4Q97A 2P5WE 4FX5A 5HTSA 2G3ZA 2WXNA 4L0PB 2UUDK 1AFVL 4I18A 4GYBA 3HPLA 2QVIA 5EHFA 1IAKA 4KUZL 1FPTH 1RL1A 3ILQD 5KSBF 4BH7A 1VF5C 2BK8A 3A6BL 5EN3A 1IC7L 3CPLB 4OF3A 3ARED 4P2OC 3KWWA 1DVQA 4PJ7F 3APNA 1CIUA 4Y2OA 2OV0A 5BZDB 2ALAA 2WLLB 4EUPA 4HWBH 1Y6KR 3W5NA 4NPYA 4NSKB 2BX5A 3ZUCA 3QIBC 1EJFA 4HJ0D 5FO7A 5EZLA 4IBSA 5CU5A 3BQUC 2FWSA 4YZFF 5C09B 2WQXA 3W11D 4PRPA 2AS5M 2H26A 4ODSH 1BQLL 4PGCA 4ELDA 4DN4H 3BKJL 2WSPA 3GI8L 7PAZA 3LZFL 4UILH 1XSJA 5SX5K 1QFUL 1DZBA 5E8DH 1RFDL 1JZ5A 5J89A 3B8SA 3L3IB 2I9TA 4Y1SA 2X05A 2HCZX 2VR5A 3ML9A 2CDEB 2IOOA 1TMQA 2EDLA 3FJTA 4G7VH 4JQVA 5F7DB 4GBXB 2YWYA 3UADA 3LPFA 2HX7A 4DPRA 4ZI8A 5I6XC 4BKLA 4GQZA 3OKDB 5D7LA 2EYTB 5EZOL 3IMVA 1I4FA 2CK0H 3FQRB 2H1PL 4E9VA 3EDEA 4NKOA 4H1LB 4XCYA 3DO7A 1KMGA 4GMTL 1PX3A 1R33A 1UH3A 4ZOAA 2L4OA 1HZHH 3O8XB 2ZUQB 4MJ2A 4KRPB 3BDYH 2Y25A 1MDAA 5AYQA 2WIIA 3HBZA 1KCKA 1U8OA 2A1WL 4Q74A 1YEHL 4XN1A 3GT6A 5HHNB 4CKQA 5BRQA 4KMLB 3PHOB 1NKOA 3MXWH 2HJFB 4A7QA 1KJ3H 5JW5A 3MODL 1N0LB 5D7JD 4DNLA 4YHYB 4GAJH 4HF5L 4YXLL 5ITFA 3KAAA 3OKKA 1BGXH 1KXHA 4D9RE 1I1YB 4WV1A 4A39A 4Z7VE 2WTRB 1MCQA 2YWZA 2GTQA 1YQVH 4FNQA 4HX1A 4E9LA 3MRCA 5CP3A 2R0LH 3MLXH 4JS7A 1WA1X 3FT2B 1P6FA 5AUMA 3R4DA 4HEPA 5DT1H 5TE7L 3FO0L 2X3CA 4LB8A 3R1GH 3ULUC 2C9SA 2F5AH 5JLZA 1OE1A 2CNYA 3EYQD 1NCNA 3DK0A 2BY0A 2BXYA 4K7PH 4OF8A 4W68A 2HLFC 4B9ZA 1QLFB 2V4LA 4OFQA 3IBOA 1UWEL 4ONHB 3M46A 4IKJA 4B3VA 4OZHA 4Y5VC 2XIDA 3RTQB 1ZHNA 3MV8A 4OJEH 4PLKC 1H3TA 2HA1A 1MFVA 1DBKL 4M9OA 4N2DA 3I3EA 4TSCH 4U1IA 5KYWA 2ICWB 2AITA 3QUYB 2AMGA 4Z76B 3OXSA 4LGRB 3WN5B 2JKXA 1FIGH 4HDIB 2QADD 4JE4B 4MHHG 5CXPA 2XWJB 4BELD 1F4YH 1PTZA 2DQJL 2WBXA 2IH9A 2P7TA 3QNXA 4PB0L 4GKOA 2WZAA 4MJ5B 4MCYB 7FABL 3ZHLA 1OOAA 2B1AL 2BW5A 2TSAA 2W38A 1M9SA 3E9TA 1KIUB 4KJYA 3WFHB 4BCYA 1FYTA 1KYOJ 4F3FB 3JVFC 1UA7A 1OM9A 4G9FA 4HWZA 2X4PA 3D34A 4PRHE 3P9WB 2WPGA 1O9WA 1TENA 2Y4SA 3VFGL 3ZR5A 4P05A 4P57B 3FB8B 5D1QE 1MNUL 1TQUA 5T1LD 3U6RA 4HPOL 3ZBMA 3GSXA 1A3RH 3P11H 3FQWB 1TTAA 1ITCA 2Z4QA 4HBCL 5DEFA 4YH6A 4BFNA 1GZPB 2YN5A 2XHNA 2XXMB 3P9MB 1HQRB 3CJJA 4TM9A 5I8CA 3GI9H 1BDYA 4WHYH 5TGBB 4MJIA 5GGUB 4MB5A 5IG7A 4I4WB 1FYTB 3OG6B 2QZ5A 1GSMA 1OB1A 3BHBA 4OD3H 1AQ8A 2D4FA 3ZHNA 1HTYA 4H26A 2XG5A 1LP9B 3GKWH 2OTWA 2ENQA 3TO4D 2Q7YB 1F58H 3CH1A 4PI0A 1A6TB 1RK0A 4HZLA 4Y4HD 3PCYA 4ADGA 1NJ9B 4ONOA 1NCIA 4QXWA 4WEBL 1BJ8A 2QSCL 3QZOA 4YGAB 4XOEA 2JB6A 5AYTA 3T9WA 2BFGA 3HS9A 4B97A 2FATH 1U3NA 5D1ZC 5JHBA 1E4XH 1IFRA 4LRNL 4TUOB 1JCVA 3IFLL 5DEZA 5DJ6A 1GHFH 5B1AB 2DIBA 3SO3C 4CC0A 4Y4FB 3GGWB 2VN5A 2G3MA 2H6PA 1T7ZA 3FCGA 1SHWA 4S1DD 2CO3A 2HWZH 1LNUB 1AZBA 2EQDA 2WSDA 2XG5B 4XNYH 5I6OA 1AXSB 1OAJA 2HVJA 1GS7A 1OT2A 3AMKA 3CCHA 3CFCL 4L8CB 4MDJA 4ZMVA 4D8PA 4TPRL 2F5BL 2A74A 2H2PC 3B4NA 3UCQA 4FLHA 1K5NA 2VDMB 1E2WA 1NAMB 3Q6GL 2QHRL 3F04A 1A6VH 4OZIF 3QEGH 4GY4A 4LKCA 1NDTA 1NL0H 3QS2A 5F9WB 5C92A 1KFGA 2AEPH 4YLCA 5I82A 1BQ5A 5AZUA 3GSUA 4AXWB 5JOPD 1BM3L 3VB9A 3U4EB 5IR1B 3ARYA 1I3VA 4AX3A 3QWQB 4HC1A 5BJTB 1SMAA 1UJTA 3KGTA 3ULSB 2Y23A 4KFZC 3K8KA 2Q76B 3HS0A 2P80D 4WGVB 2ZKXA 4ZPVA 5DVOA 1NGWB 3I75B 1VFAB 2BY1A 3L4CA 4G7SB 4ZUSB 3RY4A 5GGTH 3UGEA 1EZLA 3OR6B 2YRLA 3BDBA 5FGBC 1DLHA 5EIIA 1Y07A 2A9AA 3CVBA 3PYCA 3ZYJA 1I7UA 2UY6B 3SPVB 1G7IA 1JWMA 2E56A 3TCXA 1VPOL 1UC6A 1DQMH 2WXMA 3IDNB 4YMPA 5I18L 3TEZA 1GYCA 4JFYA 1A7PL 1G9MH 1S2EA 3V4PL 2OR9L 3MA9L 5GJSL 4N28A 5HYJE 5FUZH 5TPWH 3MKGA 1R3IH 3HRZA 5DD1H 2NNXA 2B5IC 3KXFE 2ZWNA 5DO2D 4ZAKA 3I9GL 2CLZA 4UCFA 1KCVL 3VJ6B 3VFTA 1RSYA 1MLCB 5DRXB 3QNZB 1WH0A 1ZTXE 2OYKA 1U2YA 1AZZC 4IJ3B 3WNLA 4XMZA 3DX3A 1T0MB 1LTXA 4OZFB 2W9DH 3A67L 3DGDA 4F58L 2X4RA 4JAMB 1W72H 3ESMA 4FTVE 4MMZA 1KB5A 3GMNB 3HNTH 3LS4L 5F7EL 3RDTD 3U46B 4CILA 2CR0A 3ZDZB 2F53D 5A6LA 3ZPDA 2EDBA 1KC5L 3SPHA 3RAJL 2HVKA 3D7PA 1XH3B 1Z5LB 4PW9A 3GSQB 1TVHA 1SVZA 5I73C 3AABA 3QXDB 3VI4F 4J3OD 3LV3B 4TF4A 1X9LA 5DD3H 3L16A 2HLFD 5HDBF 4K3GA 1FPTL 2APWA 3MLSH 3BUQA 3MRCB 1T5XB 3GHBH 5EWIH 2OXHA 4AGNA 1JWMB 3WJJA 3EFFA 1IGIH 3MZTA 5DLMH 4P2OB 3CE1A 3TPUA 4AQ1B 2B15A 4Z7VA 3I50H 1F4AA 3ZE2F 5JR1H 3VRLF 3EUDA 4PV9B 3ZL2A 2W65A 3L3JA 4BFIB 3TH4T 2RBLA 1JHTB 3AGWA 3ZTJG 1XQ4A 3JUYA 1C1EL 2X6MA 1ULVA 1UHVA 5EU6B 4DGIH 4C83A 2CU9A 1L7TL 3BQUB 3QDJD 3OB0H 2IDQA 4BH8A 4PHZA 4JCWA 3QFJD 4LVOB 4PJDF 3BT2L 3G5ZA 4U1GC 3SCMD 1U3JA 2ZT9C 2VOTA 5EU6E 3LKNB 4UTCA 4CC4A 4C56E 3FB8A 3IFNH 4E9TA 1E9OB 1YO4A 5B3SB 4XMLH 3MUUA 3QJZA 1KY6A 4KTGA 2R1WA 1I9EA 4ZFOB 3U2IA 3VWKD 3QIUA 3BP7A 4PJBE 1JIBA 3IJ7A 4P23D 3B7TA 3QDGA 3QNXB 4PGEA 5CO1A 3FF7A 4TL4A 4YDKL 2Q3AA 3R7RA 2F68X 1RUAH 2VSDA 4LHQB 1X44A 4I0PB 3DJSA 3VD9A 5HHNA 5CINH 4MQSB 1MI5B 1QX1A 4X7EC 3B9KC 3TCTA 3QO0A 5DMIH 1LK3L 3CZSA 5JW5B 4WO0A 1RUPL 1DQML 3SN6N 3W38A 4PJ8D 1Q0YL 2ZUQC 2WGNB 4OCYH 4R7NB 3VE0B 3BPNB 2F8IA 3FSAA 2IQAB 2KPNA 3KLAA 4XBGA 1HDMA 4LLDA 3MCKA 4QXVA 1KEML 3GC3A 5I16B 5KG9B 4HD5A 5JMOC 3SBQA 3OKMA 4YE4L 2QDVA 4LDEB 3NIDE 4QR7A 2W07A 1WRFA 2G0LA 1F3DJ 1F86A 3FKUS 4FTVB 5J6SA 5DEGA 3RWJA 5CZXC 2JKTM 4DUXA 4JJHA 1L9NA 1MCCA 1ZCRA 2G9KA 3NN8A 4KQ4L 3UGUA 3QORA 4WW1A 3FCBA 1FNLA 3X13A 4Z78B 2FHBA 1M71A 2H3NB 3K71A 2NSQA 2YUZA 3BUIA 3K8MA 4IBZA 4HPHA 1LL1A 2HX8A 3QI9B 4IMKA 4AQEA 1UD8A 4RDQF 5F71A 2Q87A 4XP6H 2OJZH 1YUHA 3Q3GA 4DWHA 5FO8A 1QFWI 4E41A 2BSRB 1J1OH 3NSJA 2GJJA 1M42A 1INQA 4NT6A 4Y2DA 1OHZA 4JM2D 3L7EB 3QCVH 3ZYIA 1BLNA 4PRBB 3ZKMC 4BFFA 4MD0A 1AANA 4W93A 4M1GL 5HHPA 3QUMH 5DJDB 2OCJA 3RX8A 5J6HA 1M05A 3TEXA 4P9MH 1GTFA 4XH2B 1R3HA 3FCTB 3Q8FA 1Q9LB 2NNFA 3KLKA 5CAYB 4NN6B 5CHNA 3QUYC 3V0AC 4X9BA 1B0RB 4MASA 4UDTA 5TH2B 4ZO7A 5DJXA 3CFKA 3DJTA 3NJLA 1OGPA 5C0GA 2FYVA 1ACYH 4LT7A 5GGSA 3M8OH 3QEUA 5BV7H 3UTZA 1E3XA 4X6FB 2HT4D 5IVZB 4TOYH 1RZFH 1S7WA 4CMHB 1AXTH 3EO0A 3M86A 1PX4A 4HKBB 2WXOA 3VFMA 2CJUL 3MXWL 1BXVA 3O2WH 2W95A 1FA4A 2BNQB 1QTYT 4I48B 4ZS7L 2UVFA 3S34L 2WOYA 2H8PA 3B56A 2YR3A 3WEXB 2JB5H 1SDYA 4GI9A 4NAMA 4NUJB 1EXUB 2A74C 3E2HB 1JFQH 4N6RB 4YVNA 3Q9PA 1M7XA 4QPEA 1FJ1A 5FF6A 3SDXA 3DV4A 4YSDA 4LBEB 3BAIA 4OZHE 1R9FA 2ZG3A 4UINL 1LO2L 4HPYH 2VN7A 2ZOOA 4Z3IA 5EA0H 2ZNWA 4S1RL 1A25A 1OTTD 1TQWA 4K71C 5I1CH 3DI3B 1WWWX 4LQFL 3VDCA 2W0FA 4JY6B 1YEKH 3BCDA 1BFOA 3L54A 3QG6B 4PJHA 3KJ4C 3S37H 2BNQA 3ZL1A 1W2KT 3NFPB 2QEJA 3D3VE 4GW5A 4NFBA 3KR3H 3ZE1F 1N5AA 2FGWL 2PXYD 3QR2A 3SY0B 4HGMA 5JZ7C 4NN5C 4WKZB 5BV7C 3UJIH 4CBZA 1YQ2A 2GG1A 4LQFH 1LK2B 4KROC 5JW4R 1PD0A 1UM5L 4GP5B 4HCRL 4KRMB 3QUXA 4NBYB 1FNHA 3I6LD 4L18A 1IGML 4BFKA 4NJAL 5D72L 5DZ9A 4UOW0 4HUWB 4P46C 3ULUE 5C0ND 3EJYD 5MEND 5T1MA 2MNUA 1JV5B 2X9YA 3I3DA 5T1DH 3QS3A 3SO3B 4JW3A 2FEEI 3HC3L 3EJPA 4AEFA 2IBGA 3BD5A 2ITDB 2HUHA 1CG9A 4JCMA 2JXMA 5F97E 3L3KB 5FHBH 3BSZA 5ECGA 3L3KA 1UGNA 2VDNB 1FCGA 2J6EA 1JZ8A 3L3JB 5BUGA 5KYUB 5DC0A 1WEJL 2NY2C 1EHKB 3MLXL 1EXUA 2RMNA 1NKRA 2VO5A 4PW3A 3AG2B 3MJGX 1GZQB 4AZUA 2BSEA 4HIXL 2ADFH 3L1OL 4B5ZA 3DHPA 1OTUD 4YPGB 4JE0A 1WV7T 2FQGA 3MA7B 3ZRCC 1ACXA 1XB6A 5F9WC 4MQ7B 3U9WA 2APFA 2IPKB 1EHLH 4KOBA 5DZVA 2VM9A 2NYYC 2BZ7A 4NCC1 5LN4A 2DWYA 2JQAA 4QGYA 4H20L 2VYRE 1NPNA 1SXNA 3EJZC 3WFDH 5HPOA 1WCBA 1UD5A 4AYGA 5DI8B 4QYOB 5J12C 1UB5B 1SVCP 3FONB 1JZGA 3HOGA 4Q7DA 3GXNA 2X28A 2WWNA 4P06A 3BPCA 1DQJA 3HS0C 2IXQB 5J6GA 4E9XA 4A2EA 2BERA 2ZX9A 4EBQH 4OSUH 4TQEL 5DZPA 4U6YB 4A2DA 1GKOA 3CVIL 3OZLA 1KUMA 4NWUH 2IWGA 3CIQA 4HS3A 2CK0L 1BFVL 1T7VA 5BZZA 4NO5A 5TFSH 4YDLB 4ONGL 1F6AB 4QRRD 5F1KC 3O11A 1HS6A 1U21A 2FSEB 1VERA 2Y69B 3L3GA 3ZKXC 4AQ8C 4QD2E 2NLJA 4WWKA 1NC2D 3JT0A 1YC8A 2NY2D 3NCMA 5IBUG 1E4KA 1AG0A 3NSYA 4XR8C 3KPNB 5E8PA 5BZWB 1J9TA 2G5BA 4P2OD 3K72A 1VGEL 1OXYA 2EC8A 5DFVD 1CE6A 2K3HA 5DFAA 5JW3L 4YBLB 3HB3D 1XCQA 3DARA 4OM1L 4C56A 3Q5YA 3EJUA 3MLRL 3CZKA 25C8L 5GRWA 4RMUA 4J6RL 1XCTA 1HX0A 3OB0K 1CQKA 3LTVA 3DDGA 3FOLB 2C5DC 4MCZB 5JO5B 4TTDD 2X6CA 4WI7A 4H44C 2VL5A 4IU2A 1QW8A 1FFOA 3CN3A 1NGXA 1B2WH 3LKSA 4JZNA 4UTBA 3QARA 4JKKA 1MWAH 5HBBA 3CFDB 1VZIA 4NQDB 2F8XC 5BRZB 3QDJA 2WWMD 4AYID 2E0PA 2P45B 2O6DA 4LL1A 3VXME 3OKLB 4LGSB 3I6KA 1HWGB 4LARH 4WUKH 1T1WA 5I76B 1QNZL 3L95A 4OCMC 4WEUD 4F7PA 3S9DB 4DW2L 3CFJA 1WPCA 4HUCA 5IHHA 4DF9A 5DJDA 5IUSA 3CD4A 3PHAA 3SKMB 3L5JA 5LGJA 3VFNB 4MMXC 2V2TA 2EH8H 2E9BA 4FXTA 1TU2A 5J13C 3T6ZA 4JK0D 3CBRA 4MDIA 3QUZA 3X13B 3VSVA 5EC1A 5HJGA 3FTVA 4PJ8B 4FXLA 5JA9A 3EOAB 1BW8A 1OCCB 3BN3B 3KYAA 2BOLA 3QXAB 1XGPA 3WSQH 4HG4K 5GGSB 2AXWA 1HNGA 5CLXA 4FA7B 1PY9A 2OW6A 3N9GH 3TWYA 5IMLB 3L7FA 4M5ZH 3QJXA 3EJJX 4FTVD 2AW2A 1I1RA 3SDAA 3V6ZB 1AC0A 4JFFB 3C60C 3L5WA 4TNVF 1KXVA 1YEDB 1GGCL 4RLDA 1OAUH 5JIIA 1D7CA 2LLNA 2BNUB 5FGRA 1JUFB 2WBJC 2APVA 5ENWA 1Y18A 1O6SA 3HKFA 1J1XH 2LAAA 2V7NB 3LOWA 4AMKH 1BWWA 3IWVA 2HLEB 3C6LD 2Z3FA 3IPBA 2G9HA 5ID1A 3ZO0A 2FZ3A 3CX2A 1FG2A 1U4FA 3H9SE 5D7EA 4K94L 1QLRA 5ILTL 5FECB 2O6CA 3IDXH 4ES9A 3SDAD 1PKQB 3ELQA 5L88L 2DWEB 4S0SD 4I0PC 4AGLA 4QRUA 3LS5H 3PWNA 3MRKB 4UZUA 2V5RA 3S5LG 1CYWA 3MRKA 4NQVB 3ILDA 1PYWB 3NJVA 5CR1A 3VXRA 3H56A 3SOBH 2F74B 1BZOA 3ARBC 4MJID 5LLIC 3LH8A 1WIUA 2GJPA 1I3UA 2H1XA 4U1SA 4QHMA 3U1QA 2YBRA 3HNVH 3P11L 3QHZH 1ZHBA 5K59E 1C16A 1VADB 3MYZA 1CGTA 4WUUE 4Y19E 4XNXL 5BO1L 1JCKA 3IXAA 1QI4A 2H5UA 2X88A 1YEIL 2P5PA 3EHBB 4UM9D 1YEEL 1IBBA 1MCFA 2M83A 3T0ED 1NCHA 1QEWA 2FH8A 1S9WB 2BO0A 5B38A 2EIMB 1M57B 2I85A 2DJSA 1B4JH 3BH8B 2BNQD 5CJBA 1UD4A 4QRTA 4Z7WE 3LEVH 3MV7D 4POZD 3V6ZA 2GIYA 1R3IL 4R26L 5D2NC 4OZFA 3U48A 1TG8A 4NZ8A 5KEZA 1Z9MA 1NJ9A 2YFOA 4FQJH 5F7KC 4OW6A 5KVGL 3ZE2E 2HT3C 2J7LA 4FI7A 5F3HA 4IMKC 1U3ZA 4Y4FD 2OJEB 3CFIC 4UQEA 3MMEB 1DBMH 5FUCE 4TUUA 5C0IA 2BSTB 4IKIA 3ZE0F 3IAPA 2NX5B 1LE9B 5CFHA 1TF4A 2PPEA 3BN9D 3V6BR 5HYFA 1VZGA 2GJ6E 3P0VL 2NMSA 2H7WA 1FVDB 2SEBA 8FABB 2DM7A 4O9HH 4TV3A 4S1SH 5AVQB 3CN0A 4D7PA 4P3WA 3AG3B 3P02A 2WNKA 1TO5A 2I9LB 1WGOA 4NN6C 3SPIA 5L6YL 2BIQA 3QP3A 1B3IA 1FL5A 1HNFA 4KZ0A 4PJFF 4AVHA 1FL5B 3AADB 5B4MC 1WYJA 1QMUA 5D7IE 2XT1B 2I07B 3QUKB 1RERA 3Q6GH 1Q0XH 5T1KD 4WCYL 4CMHC 4DTGL 4UT7H 4O02L 2CG9X 1YEJH 3X14A 2QSCH 3FQTA 3T4YA 5MENB 3GYRA 1BXAA 4JRYE 3CSGA 3O4LB 2DOCA 4JFQB 1WBYA 4NZTH 1PG7L 3W82A 2IFFL 2LVEA 4PD4J 4Z6AT 1LJMA 2DMCA 4QRTB 4PMFA 4S1DC 4UQBA 4XPGL 9CGTA 1YEHH 2DKMA 1SYSA 5EV7A 3L3HB 4OD3L 2DL2A 1Z32X 4AIZB 5M95B 1GW6A 1W6WA 2ICWJ 4Q0XL 5FYKU 4HIXH 2DKSA 4YHKH 5DFVC 3OC8A 1OV8A 2VLJD 3VU2A 4AT6A 3GHEL 4X4ME 5DVNA 4G6AC 1ZEAH 4HS3B 4NYLB 3PWPE 1L7IH 3DVIA 4WWKD 1MNNA 4BSWA 4ZO8A 3EH2A 1A65A 4L3EE 3A4DA 4MAZA 3S36H 4E0RA 1Z9PA 2EYTA 4GW1B 5C0AA 4BDVB 3P4LA 3NZ8A 5E6UB 4CMMA 1R34A 2X4OA 1BF2A 2F53B 1HHJA 2F53A 1IL1B 3OXSB 3P4NB 4NO2B 1KNOB 4RRPM 3WN5A 2FT6A 5F6IC 5DC4B 1HCYA 5T5FL 3RX9A 1A4JA 4N6QA 4F57H 5EA0L 2F58L 3ZDXF 2QQLL 1R4XA 2JCWA 3QO1B 1A6UH 2CCVA 1A3RL 1NOAA 2WWKO 4NQCE 3PV6B 5D55A 2VSKB 4Z3GA 1S78C 3IJHB 1LEGA 1OGTB 4WSGA 2EIKB 2GQHA 1OAYL 4GEIA 1JSYA 4ZSOA 4OFKA 5E0QA 2VKWA 1P7KB 4WFFD 4GAYA 4UQDA 2W60B 1U3HB 3D18B 3RWCA 2PR9A 4OJFL 4RETB 2M26A 4G8IB 5DFTA 3C09B 1U8KA 3X1GA 3FT0A 4L4TB 4BBWA 4X6DE 2DZEA 2FEDC 4PJXE 3UEZA 2YK1L 3WTXA 3NA9L 5D1ZI 2XZAL 2UYLB 2BOCA 4G42A 5G4NA 2Y1AA 4FCHA 3RVVC 2RR3A 2AJVH 4H8UA 3Q01A 4X5PA 2R2HA 1FG2B 3QAZC 5IB2B 5CEYB 3EO9L 2DI8A 4IGBD 3MV8B 3RZCB 2DMHA 2L04A 1XB3A 5JHDB 4P4KD 1I1AB 3N85L 3O3BB 2KKQA 2VXUH 1S5HA 5DVMA 4QEGA 1IEBA 1ZSDB 1J05B 2YEQA 2YMOA 1L3WA 3NSDA 4OF6A 4U6HA 4WCYH 3UPCA 3VD4A 4BWTA 5I5RA 2XV0A 4N25A 2Y3AA 5E08L 4ZUWA 2IALB 3C6LA 4DZBB 1MI5D 4JPKL 4J3OH 1NCCH 4G43B 2XWTB 1KJ2L 2QQKL 4RVBA 1R0AH 3VRJB 2EIJB 4OGXL 2R0LL 4CW1B 4DFHA 5FOBB 1D9KA 1B4TA 4K7PX 1KB9J 1HQ4A 1RZ7L 3RA7L 3O41A 4G6JH 3UYRL 1E4WH 4H26B 2WXRA 2VXTL 1T83C 3QJFB 2WVVB 5C86A 3C12A 2H41A 3QXTA 3IMTA 2DTML 4XN9A 1I9RH 2R59A 4XBMA 4CDGC 5B21A 4Z76A 4XNBA 2YS4A 4N0FB 4NUPA 1P5UC 3MRHA 4G7VL 4PLJD 3DYOA 3TBYA 4B5EA 1T21A 4Z95L 3CFEA 3IXTB 1AVAA 2LFGA 3GQFA 3CFUA 3HG1B 1G5GA 4IW4C 5DS8B 5GZOC 2FX9L 2ZUWA 3O0LA 2EXWC 1A9EA 2J8UA 2WVTA 2E7HA 1MRCL 5DUBA 2H1PH 3QUMA 2NNAB 3IXAB 1T2XA 2DIAA 3MRGB 2VRKA 1UB6B 4XO5A 5JXAH 5G4MA 4WU7A 1A7OL 5B1KA 3SDXF 2C3VB 1CS6A 2J1ZA 2OMYA 4JM2A 1H6TA 2OL3A 4K55A 1EVUA 1JZIA 3PJLA 2UZIH 3SKUD 3L4ZA 1KWGA 1JV5A 3QA3A 1BMWA 2EDKA 2FO4A 2JK5B 3WMQA 2X7LA 1UKQA 3QHZL 4PJ8C 4O2CA 3DROB 3Q9QA 3QWRA 2E7BA 1AGFA 1E4HA 2HKHH 1QSED 3MLTB 4NRYB 4JZOA 4N0CC 1Z5HA 3AY2A 2WY3B 5KSVB 1DVFA 4XNDA 1JHLH 5I0WA 1KGUA 3T0EB 4HCIA 5LGKA 3DDFA 4YPGA 5JPMC 4JQIH 5G5DA 4Y16A 4PJGE 4JFDD 3BEWB 4LRNH 2DMGA 1CDIA 5C0FB 1KGYE 3HMXA 5CCKL 4XO8A 3JWNE 1OP3H 1ORSA 3OF6D 5C0CB 3FQRA 2XVBA 3NSFA 4M43H 3LJ3A 4NUGH 3U25A 4ALAC 4FL4C 2FGZA 3D0AA 4TUKL 5F7NC 4W81A 3QR0A 2COVD 1JHKL 2X2IA 4QNPE 4I18B 2A73A 2EC9U 4X98A 4TYUA 4EUPG 1DVUA 4OFYA 2X40A 4ECNA 5KVDE 4NQQA 5SWZB 5EFIA 3EYFB 1PL3A 5L2KE 5IP4A 4JFDA 2OI9B 3OX8B 4K3JH 4GBXA 4XGZB 5HDLA 1S4IA 1QI3A 4XGZA 1AE6H 3F2LA 4LRIC 1O7VA 3Q1SH 2PO6D 4GW4B 3V10A 5FM5M 2AJXL 4G80A 5EBWA 5EUKB 4OU3A 4XODA 3WIHL 4XRCA 4LFHD 1QHQA 1RULL 4RMVA 3KWXA 2X09A 2X44D 3FTZA 4P3DB 2PLTA 2JXMB 3V4VA 2XN9B 3T0DA 4JZJC 1GY1A 1UCBH 2DICA 1V7ML 2H26B 3PWLA 4JUTA 4WHTB 3PWLB 5FV1L 3B3IA 4QYAA 4FQ2L 4YZFE 4JX0A 1Z9OA 5T3XL 4ZMAT 1LO4H 4KQ0A 2E27H 2ZQKA 4KKPA 1JNLH 5JNYA 2AQTA 4LARL 4AM0A 1RVFL 1LO3H 5E00A 3I2CH 4AEHH 4PCKA 4QRPA 2O30A 5FM5O 2XA8L 5E2VH 5E4IA 4XVUC 3STLB 4KTDH 4ATWA 5FFLA 2LGNA 3APCA 1ZK5A 4G9FE 5CKAA 3F7VA 4PY7A 4AIOA 1MRCH 2QQNL 3NFNA 1OGSA 1DUZB 4XAKD 4J3OC 3U83A 5EEYA 3WDJA 4ZMQA 2PPAA 2NY4D 4BSVA 3PRZA 4JFOA 1HHKB 3A0OA 4JM4H 5IQ7L 2IANB 5IBLD 1HH9B 2MOVA 2UWEB 1I9JL 4E2OA 3ARDB 4YE0A 3O6FD 1OP9A 4Z9KB 1JRHL 1IC4L 2B59A 3CLEH 1L6ZA 1U58B 3DA0A 4X5QA 4QWWC 3FBQA 5GSRA 5M7QA 1ZOXA 5JNYB 1VGEH 1Z5LA 2VN6A 1UZ8A 2GUOA 3BOVA 3CZGA 2YGVA 4JPIB 5CIPB 3BUBA 2A99A 4NX0A 1JK8B 2CUAA 2DRUA 5GGVH 4NNXA 4FXGA 1HSBA 1IE5A 4X8GA 3T2NL 2YPKB 4PJCB 3B1TA 4PJDA 1MIMH 1KJ2H 4UDUA 4TUJB 1N0XL 4XBGB 5LGHH 2MNWA 1UUNA 1ZGLM 5FK9A 3AROA 3EJQA 4N90D 4AC2A 4JY5L 2BFVL 4EMZA 3OHXB 1PU0A 4FQPA 4HOWA 2BOBA 4QTHB 5J1AB 2R29L 5I1IL 2KH2B 2AXHA 4G71B 2F7RA 1RQ5A 4TPRH 1KJMA 1CZ8L 4RRPG 2F54A 2AV7A 1JNNL 1MUJA 3DSFH 5GRVK 4BXSV 4CC4C 5EO9B 2YMTA 5BVJB 1MVUB 2AXFA 2FLMA 5FOBA 5K93A 3RVTD 5I8OH 1HOCA 2EDEA 3R06B 4QXGH 3FS9A 4ZK8A 3MRLB 2DLFH 3SODB 4JPWL 2WAHA 3TZVA 5IHZB 4K9EL 1QTSA 3L1EA 5F7UA 35C8L 2GITA 1MJJB 1PQZA 1AD9A 3UJTH 4BA0A 2QADC 3EUUA 4JRFA 2ALWA 1DQVA 3OKNA 2XPGB 3F6JA 1MWAA 4XXDB 3RURA 1I8LA 3REWB 5DURB 3VO0A 1T0PB 4PRHB 4DERA 3S97C 1NZRA 1CGSH 3DIFB 2IALA 2W80C 3HE7B 4HV8B 5GXBB 4CBPA 1AQKL 1YY8A 3VSQA 3HVDA 4PLJC 3C6SB 3U9PL 3HA0A 1DBJL 4PH8A 3GIVB 4YEEA 4HLEA 5DUBB 4GG6E 4N0UA 2ERJB 4ZUTB 5IMOB 1NCGA 2M1KA 3ARWA 3JTBA 5G55A 4L48A 4I13B 1WFMA 1CI5A 2P42B 4BRVA 1UT9A 2B08A 4LZKA 4OLZH 4AL8L 4P4KB 5LXGH 3N1PC 3FL7A 2BJMH 5BXFA 4POUB 3VYNA 3IDJB 3OAWA 3T09A 3MJ9L 1TFHA 1ZLEA 2D7QA 2LFEA 3GI8H 4IMLB 4CSTA 4M6OH 1HKLH 2BRRL 1WC7B 4I1NB 3DUHA 4ZW7A 5HDRA 5GRZA 2RQ8A 3W9DB 1PJ9A 1U3HA 4HUUA 3MRBA 3PS6A 3UBGA 1CIDA 2W07B 2DBJA 5HVGB 3QG7L 1XGYL 1NCUA 4JREB 5AEAA 3NAAL 2CBQA 4PVLA 3FBKA 4JFVA 3SZ6A 3VRIA 5DXWA 4N4YB 3FUKA 3VRJA 5IQOA 2YMXL 1A21A 4LEOA 4JHBA 4WTXA 1U3HC 2GFBB 1FZJA 3Q5TA 3MRPA 3OXRB 2CRMA 3PU7A 3UYPB 5I15H 1T7XA 1YN7A 4BZ1A 3TO4C 5E1AA 2DQUL 1F0LA 4M7ZC 3GHEH 5HDBB 5HHOA 4PGBB 3NGBB 1ZSDA 2KI6A 4PV1C 3JXAA 2FX9H 4OH2A 3S5ZA 1QSZA 4W1TA 2BY3A 4OI8A 3M6DA 4XMXA 4EOWL 1YEJL 2VAAA 3SE8L 3GMMB 2WWMC 1PD1A 4FZ8L 3ZQXA 2QFPA 1AAJA 2R4RL 2EXSA 3NJJA 2VM4A 5LBSA 3ZRFC 1MELA 4F37F 2DM4A 4PUBL 1NANH 5LO7A 3GLEA 7PCYA 3T77A 1HOEA 2R8SL 1BQKA 4H5SB 5J3HC 4G9DA 2WO3B 4UDTB 4LOUC 2WLYA 3CWGA 5E51A 3PP4L 4N2BA 3ZSSA 2XN2A 5C9JB 5HYQB 2FWOA 1C7TA 4ZPVB 4ENZA 3WENA 4JMNA 2WLHA 3BH8A 1HI6A 2O5YH 1PZCA 3D08A 4HH9B 1ZVHA 3OR6A 4WFEE 5JDJA 2IPUG 4MS8C 3V0WH 3GF8A 4MRBA 1AGCA 2CHZA 2UXTA 1FUNA 1M1XA 1FFPB 2VDRH 5ALBL 3VQLA 1JNJA 5I8KH 3AW5A 3L3HA 5F93C 1JXDA 1CD8A 4FF9A 1K6QL 4M8RA 2G60L 4ZNEA 1IGYA 4HXBL 5GGVL 3SY6A 1XIWC 3UZEA 1ACCA 1JE6A 2VH5H 5C0EA 2ZWSA 4P9HH 4GO6B 4NNPL 1GGBL 5E6YA 5T3ZL 2AK4B 1RZKL 4N9OB 3SE3A 1PDKB 5DJAB 3TT1H 3WNJA 1LE9A 2B20A 3KVPA 3UMTA 1X5ZA 2ESVB 4ZAKB 2D7OA 4G1MA 5HYJD 3TBBA 4WW2A 2MQCA 3VW3L 5DZAA 3OKOB 2UV3A 2JSFA 3PGCA 1LEKB 5AVUB 5HGGS 3QDMA 4HZ1A 4ZX6A 1SXSA 1ET7A 1QFWL 4LLWA 3EG9A 4XVJH 3KM2A 4AENB 1G6RL 1Y6MR 4LOEA 4PBXA 3AS0A 4HLJA 2WNXA 4L8SA 1Q0YH 2XWZA 3V6OA 2HH0H 1PEWA 4PV9A 2NTFB 3SJVA