4BWUA

Three-dimensional structure of the k109a mutant of paracoccus pantotrophus pseudoazurin at ph 5.5
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
123
Chain Sequence
b'ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPAKARERMDAELAQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Exploring the Surface Determinants of Paracoccus Pantotrophus Pseudoazurin
rcsb
source organism Paracoccus pantotrophus
molecule tags Electron transport
total genus 36
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4bwuA00
3PXLA 3OMIB 5D4HA 3FQ1A 5ANHA 2CALA 5I6NA 2BHFA 4P5SA 1BYPA 4GY4A 1X9RA 2VW7A 5I6KA 1JXGA 3BQVA 3G5WA 8PAZA 3T6WA 4AZUA 3NSCA 1WS8A 7PCYA 3GYRA 2XWZA 4G7RB 3BVDB 1AS7A 4N4YB 4DP2X 3NJLA 2YQBA 3T6ZA 1GS7A 3NJFA 3NSYA 1SDDB 5I28A 2OJ1A 3AG1B 2GI0A 1ASPA 4DP8X 1ZIBA 3FSZA 1JZFA 5B1JA 2Q5BA 3IN0A 3OQRA 1IUZA 1X9UA 2YAFA 2CCWA 2R7EA 3PCYA 1CYXA 1JVOA 3NJIA 4GP8B 3WNIA 1AR1B 3AZUA 1PF3A 2BP8A 4AKOA 1ET8A 3QQXA 2FTAA 1R1CA 5A7EA 2DWTA 9PCYA 3GXUB 3OMNB 1F56A 3JTBA 5EHFA 1J9RA 2B08A 3PAZA 4DP9X 3FU7B 2FT6A 2PCYA 4AI7A 4BWWA 1A4AA 1FA4A 1L9OA 1V10A 1BXAA 2BW5A 2BW4A 2IDQA 2GC4C 1FWXA 2ZWNA 6PAZA 3CDZB 1IBZA 2VW6A 4BWUA 1RKRA 3EH4B 3EHBB 2I7OA 2YAQA 3SBPA 2XYBA 4A2EA 1NTDA 4P5RA 5B1JC 2PPAA 5I5IA 1MG2C 5I6MA 1J5DA 1NWOA 3FSVA 2FT8A 1J9SA 2XV0A 4YVUA 5PCYA 1OOWA 3WKPA 1MDAA 3AW5A 1ASOA 4DP7X 4NERA 3WIAA 1ET5A 1AZCA 1NPNA 2P80D 2IDUA 2W88A 2EIJB 3TA4D 1GSKA 1OCCB 2BO0A 2BWDA 1EHKB 2YAPA 2R7EB 1PZBA 2QDVA 5F7AA 3X1FA 3ABLB 1SDDA 1PAZA 1AQ8A 2UX6A 3ZBMA 4X4KA 3IE9A 5FC9A 1N68A 2WSDA 2MRYA 2FQDA 3SBRA 2BP8B 1ZDSA 3DKHA 4BWTA 2B3IA 2VM4A 2YAEA 1PY0A 2IH9A 1NIAA 1WA2X 3V9EA 4N8UA 1SHWA 4A2DA 1OE1A 2VMJA 7PAZA 4K9JA 3WG7B 4QKTA 1OCRB 2NRDA 1XB8A 2H47C 3RYMA 1TEGA 3FU9A 2YAHA 2PP9A 2VW4A 5AFAA 5I6LA 3FU7A 4M3HA 2GB2A 2HZHA 2AVFA 2UXGA 4HZ1A 2QDWA 4Q8BA 1GR7A 4BXSV 2PCFA 3HEIB 1M57B 3UADA 1JZEA 1PLAA 3NJJA 3CDZA 1IBYA 4HHGA 5I26A 2N0MA 1FFTB 1NDTA 1A8ZA 2IWEA 1BEXA 2X88A 3N2JA 2FQFA 2DWSA 2IDSA 3PAUA 3DIVA 3TBBA 2XX1A 1NWPA 2TSBA 3IEAA 5E9NA 1B3IA 2DY2A 1WA1X 3CVDA 4W9ZA 1E30A 1XB6A 3NP4A 2I85A 4F2EA 2PLTA 1J9TA 1PLCA 1OCZB 3UAEA 1NIFA 1QNIA 2JKWA 3QJVB 1SFDA 2HRHA 1CYWA 1TU2A 4A67A 4DP1X 3AG4B 1PZCA 1NICA 3QJQB 1A4CA 2EILB 2AANA 4YSEA 3S3CB 4WKXA 4UF7C 3L45A 2UXTA 4FA7B 1N70A 4YSCA 1AANA 5LDUA 2YXVA 2HRGA 4KOCA 4YSSA 1BXUA 4HCGA 1GY2A 1ID2A 1KDJA 2PP8A 4DPBX 1DZ0A 3WKQA 3EH5B 4JHVA 1PLBA 1QHQA 1ASQA 2Y1AA 1OF0A 3MX0B 3CG8A 4YVNA 4KO7A 3X1EA 4AKPA 1MZYA 4NAJA 1JXDA 2XUWA 3CVCA 3ZX1A 3EH3B 1ZPUA 2HX7A 1L9QA 1ET7A 2UXFA 3KW8A 1AACA 1J9QA 2GHZA 3QJTB 4E9VA 2CBPA 1V55B 1XMEB 3NSFA 1DYZA 2EINB 4L0PB 4DP6X 2P80A 1BQRA 2XLLA 1PMYA 1MZZA 1KBVA 2YXWA 5I6PA 2E86A 1SF3A 1T5KA 1AOZA 1JZIA 2VN3A 4HAKA 4YSOA 3OD3A 2GBAA 2UXVA 2XV2A 2VSMB 4E9XA 1W6LA 1L9PA 5B1BB 4YSUA 1UATA 5PAZA 1NINA 3FPXA 1ILSA 4G72B 4GYBA 4HHWA 5B7MA 1KYAA 1BAWA 2CUAA 2GIMA 2PPDA 3ASOB 1JXFA 1HFUA 1PCSA 4A66A 3FQ2A 3DTUB 1AZNA 1MG3C 2CAKA 1JZGA 2IDTA 2VSKB 1A3ZA 4AKQA 4YSDA 1JVLA 1AIZA 3OMAB 1WAEA 4E9WA 1ADWA 3TU6A 1ZV2A 2IH8A 1L9RA 4ZK8A 2XU9A 4A2FA 4DP5X 3C75A 5AKRA 2YARA 2YAMA 2PPFA 4NB7A 2BZCA 3SQRA 3ZDWA 1NIBA 2AZAA 3T6VA 2BP0B 3H56A 2VM3A 3ABGA 2XXGA 4Q89A 3ABKB 4HIPA 3S3BB 1V54B 2A3TA 1KCBA 1RZQA 4CSZA 3NSDA 1ILUA 2FWLB 1GY1A 1AZUA 2ZONA 3JT2A 2QPEB 3TBCA 2EIKB 1TKWA 2TSAA 4GP5B 2HX9A 4JHUA 4DP4X 5B1AB 2J55A 1KDIA 2BWIA 2RACA 1YLBB 3FS9A 2IWFA 3FYIB 4PAZA 3WI9A 2XX0A 1EZLA 1QLEB 1AZBA 1URIA 2Y69B 3FSAA 3T71A 5B7FA 3UGEA 3ASNB 1BQ5A 2PPEA 3IBOA 2J5WA 3TASA 1PNCA 4E9RA 1SNRA 4F7KA 2FT7A 1SFHA 4G7QB 1JERA 2QPDB 3S3DB 4PCYA 1GW0A 4EF3A 5B1KA 3WNJA 1GS8A 3H4FA 3S8GB 2HX8A 4F2FA 1W8EA 4KNTA 2XV3A 2WO3B 3ERXA 1A65A 4YSRA 4YSAA 3NJHA 1RZPA 1KGYE 1OE3A 1JZHA 1OE2A 4DP0X 1E67A 2CJ3A 1AG0A 3QJUB 3PAVA 2GC7C 5D4JA 4BDVB 5IY5B 2GSMB 1E5ZA 3FPYA 2OCCB 4DPAX 2UX7A 2QT6A 3NT0A 3OM3B 1KCWA 1GYCA 4UANA 2IAAC 4M4RB 2FQEA 3KW7A 4FAAB 3CVBA 3UACA 5F7BA 2BP0A 3T6XA 2Q9OA 1PZAA 4A2HA 1IKOP 1HAWA 1XB3A 2HXAA 4A2GA 1ZIAA 1JZJA 1CURA 4MFHA 1BQKA 4KO9A 2LLNA 2JFCA 1ETJA 4GXFA 4GP4B 3D12B 3QPKA 1AZRA 4HCFA 4YSPA 4CSPA 2MTAA 2HLEB 5B7EA 3AG3B 3T9WA 4YL4A 3EF4A 1NPJA 1WS7A 4YSTA 3V9CA 1A4BA 3NP3A 4E9YA 1BYOA 4E9TA 4ENZA 1HAUA 4G7SB 2H5UA 4G70B 2J57A 2J56A 1L9TA 2EIMB 1AG6A 3U25A 1JOIA 1BXVA 4A68A 4YSQA 4KO5A 4KOBA 4TXVB 3UABA 5I6OA 2YAOA 3FQYA 3HB3B 2IWKA 4JKNA 3ABMB 1KV7A 2FJSA 1M56B 5B3SB 1AS6A 5TK2A 4W1TA 3NJGA 2X87A 1IC0A 2AFNA 1OCOB 3X2QB 4BDVA 3N55A 2AZUA 2WO2B 1WA0X 2FNWA 3NYKA 3FSWA 3ZIYA 3NJNA 1NZRA 4E9QA 3NJMA 1M9WA 4UAHA 1AAJA 4RH4A 1VLXA 3QJRB 5I5JA 4KO6A 1W6WA 1CUOA 2OV0A 2I7SA 2PP7A 3MBWB 2PPCA 2XVBA 4KNUA 4BK5C 1OV8A 1NIDA 1CC3A 2JXMA 3X1NA 1PNDA 1NIEA 3SBQA 4DPCX 3FYEB 5TK4A 2DYSB 2FQGA 3CZUB 5I5MA 1L9SA 2ZXWB 3H4HA 3PPSA 3UAAA 3GDCA 6PCYA 1SHXA 1SF5A 4HCIA 1RCYA 2BZ7A 4KNSA 3QJSB 1E5YA 1I53A 2DV6A 1J5CA 1GS6X 3FT0A 4E9SA 1TEFA 4WTQA 1SJMA 1E65A 3AY2A 4HALA 2W8CA 1AS8A 4G71B 2DYRB 3PLYA 5AZUA 4BXVA 3AG2B 3X1GA 3NJKA 1KBWA 4AX3A 5D4IA 3X1BA 2H3XC 2XXFA 2ZOOA 2IDFA 3FU8A 1ZDQA 4QLWA 3IN2A 3S8FB
chains in the Genus database with same CATH superfamily
3T3PB 4GO8A 1LYQA 2Y23A 2FGWH 4W6YB 3I02B 3S96A 3VFGL 2CALA 2VMFA 1QFHA 3V6OE 4POUB 4MD5A 5E2WH 1OM3H 1JXGA 3SJVA 1RD6A 3DOHA 5EBLA 4HGWA 3T6WA 4AZUA 1KTLA 2VLJE 5BW7C 4HXAL 4XP4H 4FN0A 3NJLA 2J12B 3K6DA 4HFUH 2F54B 5E70A 1SDDB 4JFYB 4MNHB 5TDNB 4DESA 4D8PB 2PCPA 3L3OC 5CUSH 1X5HA 4UYQA 5IFAH 2Q8BH 4PJCF 1HS6A 5KBDA 3FFCA 1KENH 2WLLA 5B1JA 2X1QA 4CN4A 1J12A 2BSRB 2YAFA 2GK0A 4R3SA 1MFAH 4E42A 3JXAA 3NAAL 4NZFA 4V2BA 5IWLC 1NC2D 4NKIL 5DVOA 5K39A 3GXDA 4GEIA 5KZCD 3C5ZA 1K8IA 5C9KA 2EYTA 5T5FA 3ISWA 2ZYIA 5AVVB 2FTAA 5DO2C 4ANKA 4XXDA 1N10A 5MENA 1RZJL 3N0AA 4HQQL 1IB5A 2I9TA 4XMVA 2X4PA 3WD5L 5K69A 4PRPB 4YDLB 1O7VA 4XBEH 1X5MA 1SYSB 3FU7B 1BEYH 4XCFL 1MOEA 2QQQA 2W92A 3QWOB 2NZIA 4BJLA 3D0LA 1F00I 1RZKL 5FYKD 3UDWC 3BDYH 2VXTH 3OV6A 3EXLA 3QCUH 5HVGB 2VW6A 3DTDA 4JO3L 2GT9B 1M71B 4EJ1C 1E8YA 1QNZH 3FQTB 3QARA 1SBSH 1DJSA 1I9IL 2QEJA 4I2XB 4WI2A 5ICZB 5HHPB 3P40A 3G5YB 4UI2A 1GGYA 3QR0A 2UWEA 3BWAB 2YSSA 2O5XH 1NWOA 2W59A 1PD6A 4PB9L 2XV0A 3DX9A 1T22A 5E5LA 3WIAA 2A74A 2KKQA 1L0PA 1PIGA 3H9SD 5H35B 1IEAA 1ZVSB 1NPNA 4UOW1 3GLEA 4NP4H 5KVFL 4K3DH 4NO0A 3GHBL 2XQYG 4LSRL 4O5LL 1GTFA 3OBAA 5F3HB 2AQSA 4R5VA 3P4NB 4PEEA 4X6FB 1P4BH 3L6FB 1AQ8A 3CXDH 2X4UB 3FO2A 3IKCA 3DNKA 5DXWA 3ZBMA 2WSDA 3ECBB 3KLQA 2C4FT 4DQAA 4GJTB 1YEDB 4OCXH 1A6AA 5DMJB 4AQ8A 1HH6A 5DHMC 2E9IA 2I60L 3TC9A 4DKEL 5JXED 1OE1A 5D5MF 2V3DA 5CJ8A 5LBSH 1EXUA 3WIHL 1NMCC 2DMGA 4J2QA 5DK0A 1EJ6A 1QLEL 4FKEA 5IHZB 1DEEB 4JPSA 3QDMB 4ELDA 5LGYA 4JFWA 2PP9A 5D1QD 3RTQA 2J1KA 3UTTE 1UOWA 4XNMB 4MS8C 4NP9A 3HPLB 4KH2A 3V5HB 5E8DH 4RFOH 2CM6A 4F8OA 2N0MA 2ZKMX 4TTGA 3LKRB 1A8ZA 5EU6E 1HKFA 4F7MB 2LVEA 4GRLD 3MCKA 4WHCA 1IFRA 5EMYA 3D25B 4UZGA 2NTSP 2WNGA 2P28B 2DI7A 2TSBA 3A6BL 4ZRGA 5LVEA 1SHMA 1B4TA 1AD0A 1XB6A 3BEWA 3CC1A 4N2FA 1EHLL 3RY4A 4YLBA 5T1MA 2AQ1A 4FA6A 2JKWA 3GI8L 3LZFL 4HJGA 4U6YB 4N2OA 1NMBL 3X3GL 3QZOA 1IEHA 2IAMD 3CX5J 4Z7NB 5AYUL 2B9BA 4FXGA 4PJ7F 4QIRA 1KWGA 2RTTA 1JK8B 2F7QA 5DD6A 3BZEB 2ADFH 3DTXB 2ZOLB 5F3BB 5TE6L 1JWUB 4JO8A 2X6BA 4L4JA 4Y4HB 3KPPB 4X8GA 1HL8A 1V3KA 2J6EH 3KWXA 4FLOA 3D8MA 3RVWD 1GY2A 2EO9A 4W9FC 3O45A 1G7MA 4C83A 4Y2DC 4FYQA 4UDTB 2Y1AA 3B8SA 3FTYA 3FB7B 3IYLW 4P5TC 4NO5B 3SPVA 1T04B 1PIFA 4QWWC 1W8NA 4Z7VE 3VXSA 4NAJA 1GC1H 4PJDE 3MBED 4KK8D 3GM8A 5I15H 1FO0H 4B9GA 3EH3B 4CJ1A 4ZXBA 5E56A 4I1NB 1L9QA 3RWFB 4QXGH 5KYWA 2ATKA 4AEHL 4E9VA 1N6UA 3FUNA 5IB1B 5KVGL 5E99H 1B4LA 3SQOL 4JFHD 4L0PB 1HDMA 4NQSA 2FJFA 1FIGL 2AV7B 1RSFA 2GIXA 3AABA 1JGIA 1ZAGA 1GCYA 3ZUNC 3E2HC 2UYLA 3NEEA 4N2NA 5EEXA 1MAJA 3O6FB 4KZ0A 2GJZB 4L23A 3VCLA 4YSOA 1VFMA 4WEBL 1FN4A 5MEQB 3EKCA 1Q9LA 5FWRA 2X3CA 1CL7H 1F97A 2VLJB 5DEGA 4OI7A 1IGCH 5GS0C 4QRQB 4JRYA 3B2PA 5IBLC 4XNQB 1F58H 2KQNA 3D05A 3KYAA 4UINH 3OHXA 2AJXH 4JM2D 1P7KA 3T04D 4FXTA 1RZ7H 5T8IA 4OZHE 1DJIA 2NY7H 5EBMB 2XXMB 2H2PC 5I8OH 5FYLL 1JZGA 3HHMA 2ARJA 4L1HA 1N5YL 4YSDA 3M17B 1PZ3A 5AUMB 4R2GC 3S3JA 1BFVH 3PWNA 2HKFL 2MCG1 3ZUCA 2Y3AA 4WNQA 4DGVH 4NLHA 1OAKL 4KRMB 4M93B 1T89A 1PX8A 2WVVA 3U1QA 2YARA 2VDOH 3ZDYE 4PJEA 2WO4A 4HHAB 3LPGA 1BD2D 1PZ5A 3FTZA 3QRLA 5HI3D 1IGMH 1CLOH 1AXSA 1Q0YL 2B2XL 4OD2B 1F6LL 3SB3A 4MNGB 5EZIL 1FAKT 4U6HB 3L3JA 5DFAA 1PKQE 1JK9A 2Y6SD 3MFFA 1LO3H 5C0RH 2EUZA 5FGCE 1TLKA 1A14H 4HWBL 3T0EC 1QRNA 4DZBA 1M6UA 5AG9A 4KDVA 1RZQA 4IW4C 1QPPA 2ITDA 4X0NA 3VB8A 3MRGB 3L3IB 2QGCA 3OR7A 5C1MB 5HDLA 3MREA 1BPLB 2HX9A 4ZO9A 1LM8V 1M1XA 3S7GA 3HLAA 5DRZB 2BWIA 4G6JH 4R7NA 4JFQB 5HGDB 2BCKA 4PWEA 5LJYH 1OIOA 3K2IA 3GLZA 1W72B 4HKXB 3KZ8A 5K9JL 2X2YA 3BZ4B 4J5VA 2ZG3A 4HS3A 1TJIH 1R3HB 2G5BA 4Y5VA 3GXNA 4QXWA 1AR2A 3ROOA 3CIQA 1P6FA 2IPUG 3T8MA 4X6DE 3JWNC 3ZOAA 4KITB 3BVVA 2XV3A 3PV7A 1U93B 1WZKA 2BC4B 4NT6B 4NRXA 4PJAA 5E6IC 5ABDE 5KSBA 3VFTB 5IB4A 2F6AA 2OA9A 3V6FA 4J4PA 1IGYA 4QHMA 5E7BA 4QAWA 4F57L 4N3TA 1IE4A 3L81A 5EOTB 4Z0BH 3E8VA 3FQWB 3H3PH 2HLFC 3LZPA 3QZWA 1SM3H 4PJBE 4OUUB 3APMA 3HC4H 2W9EH 3O11A 3RIAK 3T5WA 3OB0K 2NUPB 3NK4A 3VE0A 2OCCB 1TETL 3DO3A 4DPAX 3MQIA 2D2OA 3FFDB 1FV1B 2B0SL 5G5DB 2RHEA 3RZCD 1NAMB 2MIZA 4BA8A 2XRAH 1UH2A 5E4EB 3UTTB 3T1WA 2AJZA 3HI6H 1A6TA 1QSZA 4LDCA 4LSTL 1VFOA 3REWA 3TZVA 2JXMB 3NCWA 4XC3L 1EQWA 3EJYC 1JE6A 1VFUA 3VWJB 2DQUH 3SDXF 3K8MA 1JPFB 5E08L 1DR9A 3OKMB 1S6NA 7TAAA 5EU6B 1EO8H 2E6PA 4E5XG 1OAXH 5EF2A 2NY5L 2BMKB 1ECYA 1MFEH 4PWHA 2G3NA 1M42A 3ZT5A 1I7UB 2DM2A 2YO3A 4ETQA 1LMIA 4YSPA 3DROA 5BO1H 2MTAA 4PFEA 1BAGA 4WU7B 3GO1L 3QH3A 1G7IA 3HB3C 5KS9E 3CUPA 4JQIH 3UGXA 3DSFH 5EU7C 3NP3A 3QNYA 1MCEA 3U1SH 4I85A 3VFNB 5ICUA 1ACCA 4HWEH 5C2BH 1IBBA 4ZT1A 4YPJA 1CFSB 5L2KD 3OB0H 3QK0A 3MGOB 1QUPA 1BXVA 1QZ1A 3AXLB 5E00A 1NGYA 4B53A 5JR1L 5I6OA 3LZRA 5DQJA 4KAQH 3PHSA 3NABL 3QAZC 2Y5QA 5DJ8B 3WS3B 1DLFH 3ISRA 2K0RA 5HHQB 4EZMA 3HR5A 1CFBA 2FX9H 2WVTA 3SGDI 2YIHA 3MCYA 4OSUH 4HIXH 5GISL 1IC0A 4F8LA 5C0CD 1R5IB 3VH8B 3DX8A 2OM5A 4JL1A 4Z7VB 4JPIB 1WZ1H 2WO2B 3DVGA 3O81A 2ENSA 3JWDH 1B88A 1UM5L 4M5TA 4PJDB 3VYPA 3UTSD 4TNWF 3MRHA 2V2XA 2X9XA 1FHGA 2CDFA 3LKNB 5DJYB 5CEYB 3KWTA 5F7KC 2RD0A 4A37A 4PWKA 2D0GA 2HN7B 5CIPB 4HZLA 2WCSA 4FLRA 5ENWA 3V10A 4UM8A 3ARED 3Q3GB 4P3CL 3KPRE 4OCRL 3QNXB 3FYEB 3HS0B 4TSCL 5H94B 3RDJA 1QVOB 1KG0B 3IJYB 3QIBA 4FQ1H 5ECJE 3U7YH 4LSPH 1UXSA 3GDCA 2H1PL 1KIUB 3QG6B 1RK0A 4P4KC 2EQDA 1EFXB 4XAKE 3UPRB 1THCA 3QW9A 1NLDH 4DO5A 2ZCHL 1E65A 2R4SH 3GUTA 2W8CA 4XXCA 3NA4A 4FI7A 4EN3B 3KDMA 2F0CA 1ZTMA 1OWWA 4QT5B 1XF5A 3CVHB 5DRNB 3FMGL 1FFOB 4MB4A 4UQ2A 3D2UD 2BJMH 2CGZA 3UJIH 4GAJL 3KE0A 1CQYA 3K6IA 4U31A 5I16B 1RZGA 2N3JA 1BX2A 4M5YH 4V1DA 2ZD0A 3SYAA 3MODL 5IMMB 1JV2A 3PXLA 4OZHB 3CZFB 3D7PA 5I6NA 4P5SA 3GSUA 1NKOA 4PJ8D 2EH8L 4U1GC 5LGHH 4HG4J 3FUMA 1H8SA 4NPYA 3CPLA 4B5ZA 4UT6H 1H6TA 2WGNB 3K74B 2DBJA 3WEXA 5D1XE 4L2LA 4QDGA 5DHEA 4YE0A 3EOBA 3ARBA 3BUYB 4L8SC 4JO4L 3B7TA 3P3SA 3PHQA 1FNGB 4YXHL 1C5DB 4ZSOB 2NDFA 3X12A 2DF3A 5LCVH 3ZDYB 1IZJA 1N18A 1HXMA 5AAMA 4Y9FA 5D1ZC 1LE5B 1JZ3A 1LDPH 1S7UA 3WNIA 3RA7L 2JQAA 4UM9D 1PKQB 2Y5TA 5B8CC 1LP9F 5DRWA 3AGVA 1E3FA 4DEUA 4KQ3L 4FQHA 5LQBL 1U21A 1WLHA 4Y4FA 1OSZA 5EN2A 1DQLH 4DVRH 1F56A 4DUXA 1D5BB 3AQZA 2WKGA 3DVNA 4TVSa 3TESA 2BVOA 5DD1L 2XTJC 2ICEC 4BWWA 3KPSD 1G7HB 3ZYIA 3IMBA 3LHPL 3BUBA 5IG7B 4F9LC 1NOAA 2A9BA 2FWSA 4U1HA 5HDQH 2WQUA 1UTDA 3FC8A 3MRRB 4PGDA 2H2SC 3T8XB 2IH3B 1FORH 1HL5A 3VO0A 4BWUA 4OD1L 1DBBL 1KNOA 3EHBB 1DE4B 1UCBH 4OZGA 5IVZB 2AEWA 5GS2H 1NTDA 4OF8A 2E0PA 2WC7A 2YR3A 4JQVA 4IHOA 5FW6A 5EO0A 3K5RA 2EO7A 4Z7WA 5FO7A 4CC4C 4YHKH 4ODUB 1J9SA 3Q5OA 2VUKA 4L37A 4PRIA 4LCUB 3LJ3A 4A55A 4JE4B 1ET5A 1V3JA 3OJDA 5CR8A 1H5BB 3HCVB 1XF3A 3QUMH 3PL6C 2F53D 4PJBB 2ESVD 2WWNA 1OCCB 1OLZA 4JM4H 3GSRA 3QUXC 4R83A 3KBFA 1LDSA 4NX0A 2XZQL 4P2OB 5SWSE 2GTWA 4QTIH 4JK0D 4FNTA 4BRVA 1GC1C 3EOAB 3HUJB 4HIJB 3OMZA 2AK4A 3ARGD 3MCLL 3K8KA 5CU9A 5IM7B 4EDXB 2NY6B 1ZXQA 4WUUA 3U36B 1KCSL 5I2IA 2FR4B 1J1XH 3BT0A 1GMIA 2HT3C 1T3FB 1AHKA 1G0DA 2PXYB 3PFUA 1KEGL 1LWHA 2BVUA 3FB8B 3IJ8A 4RISL 4Q6KA 1KOAA 4X7DC 3ASWA 4EQ2A 3PJLA 2P5EA 2P52A 2F1AA 5CJBA 2O26U 5F9JA 1FG2B 2N59A 5D7EA 4ADGA 5F7MC 5C6PB 1UT1A 2H9GB 4EBQH 4F58L 4YLCA 1WZAA 5DI8B 4YHYC 4BXSV 2GYSA 5KS9B 2WLZA 3C09C 2GITA 1E9PA 1GZHA 1DVFC 3I6KB 3RWIB 3F7VB 3NCJH 2WIIB 4LHJB 2LTQC 4KWUA 1E4XH 4F15C 3E1ZA 2X88A 1ZT4A 3ET9F 3UTPD 2FQFA 2BOBB 1F1AA 1XCXA 2XXCB 3HG2A 1F6AA 2RQEA 5IQ7L 1HJCA 4AIZA 2P8PA 4P57A 3IFOB 4S1RL 5CJOH 2YZ8A 1J87A 3IEAA 3BDXA 3IU3A 5GGQH 3COOA 3C8KB 3GK8L 4P59L 3SYCA 3IDGB 2OSYA 1QLFB 3S35X 3TV3H 4JCWA 1TJGL 1AR1C 2EEFA 1DVQA 3W81A 5L8KB 1DL7H 1JP5A 4PGEB 2VR9A 4PVMA 2F7RA 5IP4A 4ODVL 1UB5A 4I18B 4OCWH 4F7TA 4UU9B 1EEZB 1Y1UA 3TFKC 4JHAH 5CEXB 3ILEA 5GS1A 3UCRA 1NL0L 2VAAA 2VLRA 4JM2F 5F0LB 1J8HA 3VFUB 4JKPL 4PRNA 2IC2A 4YSEA 2X4OB 2DQCH 3GBNH 4UOJA 2YD1A 5DLLA 2N7AA 1HHHA 3SODB 4B0MM 4BINA 2Q3XA 4MCMA 2YXVA 5LDUA 4QRSA 2GUOA 3TJHD 1MF2H 3P69A 3OF6D 3KS0H 1LK2B 2VN7A 4QHNB 4JHVA 4K3GA 5IHBA 3P1VA 3KPRB 3EYUL 4NQXA 3QA3B 2CIKA 4J8QA 4JVPA 5AOIA 5EUOA 4LKCA 1DANT 4WFED 4HU8A 2OCJA 4ZODA 3OKDA 4WK0B 2R69A 5ELIA 3EYSH 4G7VL 2K9UA 5BXFA 2AP2A 3EJZD 4LSVH 1R5WB 4DQOL 3Q6GL 1DHKA 1G1KA 3P4LA 3V4PB 5GZNA 3LN5B 4YHLH 4A6YA 1DANU 2E6QA 4GRWF 4LEBA 3RZWA 2A73A 2Y06H 3MRLB 1OB0A 1UFUA 1TTRA 2C1OB 2XPGA 4KKCD 3ULUL 1X5GA 3GBML 3C08H 3U0WL 1PMYA 2DWEA 4MTMA 2E9BA 3IRZA 1A7RL 1XIWA 5TF0A 4P8QA 3Q9PA 4QRRA 3TN0A 3UZEC 2ED6A 4G8GE 1YPZF 2NYZA 3J8F7 1KCVL 2HT4C 2XHNA 1SQ2N 3RWCB 2J5LB 2K8MA 2D9QB 2GCYA 1IEBA 4APQA 3VFMA 5D1XB 4NSKB 1WE5A 3FPXA 3C87A 4JKMA 2WUCL 1P5UA 3OAWA 4AL8L 1LD9A 4FGMA 3D39D 3A23A 2XZCH 5EG6C 3EO1A 1NGPH 5T5FL 1N3NB 5E8EB 3QXDA 2VL5B 4JMXA 1S5IL 3PY9A 4HP5A 4AGNA 3TS8A 4Z3JA 2ZCKL 3SDCB 4OCSL 4N2AA 1G9NL 1MG3C 5DA4A 2VITA 1N5AA 5HHOA 4ZPTA 1BOGA 3AXHA 2FO4B 3OPZL 4ZUSB 1FE8H 3WFHB 2QGBA 4G6MH 3O2DH 4I5BA 5C8JB 4JAMB 3UTOA 5HVWA 4TVPL 2ZIDA 3UP6A 3BZFB 1ZV2A 3DX7B 4L1SA 1L9RA 4AWJC 4NQEE 5LG6A 1CLZL 3QC5X 5I82A 4UNUA 5IQLA 1BVKA 1TEYA 4OM1L 4U0QB 3DUHA 5BUAA 3N9GL 1NFKA 1JCVA 2W9DH 4BRJA 1G6RH 5DD0L 3NQIA 1TVHB 2K3HA 4PJ9A 2GAZB 1VJSA 2VN6A 3INUH 4KH9A 1NEUA 4LEEA 2Z8VC 5CLWA 4FMVA 3O3EA 2OR8A 3VFRA 1X5LA 2A3TA 2CM5A 1JRHL 3WEOA 1KIRA 4M8QA 2AQRA 5DEJA 4JPQA 4Z8FL 4P4RA 25C8L 4LT7A 1AZUA 1ROWA 3VTAA 4WI4A 2YPVA 2R9HD 4YGVB 4GP5B 1F45A 4DEPB 3RVXD 3QORA 4JFEE 5DR5H 5HJ3A 2FHFA 4K2UL 2EIZA 2RACA 2A9NH 2VDML 1MJJA 3G6JA 3B9KA 1JWMA 4PUBH 1J18A 1DLHB 1AZBA 1LEGB 2WLIA 4FQJH 2K3TA 4IRJA 5IK3A 4AVKA 1WFMA 1UA3A 5L6YL 3L4VA 4W4NA 4PB0H 5IOPA 4OU3A 3V6BR 4Z7UA 1LQBC 2NW2B 3BMVA 3CTTA 4E9RA 3ZMRA 1JZDC 5FX3A 2A7BA 2WP3O 1BXXA 4M7ZC 1MFDH 4PCYA 3OZKA 3AM8C 2GBTA 3OKOA 2KPWA 4KI5D 4HJTA 1U91A 4LIQH 5KSVB 4XO8A 2APTA 5D71H 3IMWA 3MV8A 5SWSB 4RWYL 3IFPB 2DJMA 4W9EC 3JWDC 1E6JL 2JV6A 2P8LA 2RFXB 3MNZB 2PF6A 4K5OA 1YMMA 1ZD6A 1XR8B 2YA0A 4N3UA 4X80H 3BAIA 4XWGL 1ADQH 1PD0A 5IT2H 4X9YA 4KX7A 5FM8A 3WSQH 1AG0A 3GZPA 2J44A 4KU1A 4RETB 3QFDA 5FGSA 1FJ1A 3T1FA 3FUKA 4GKSA 1B9KA 1MHHB 2RGSA 4QY8A 1ODAA 3HG0A 3RQ3A 2APBA 2ZWKA 4IS6A 2VJXA 1B4RA 1S7QA 2XZAH 3MYZA 4ZUTA 1W16A 4F27A 5AVTB 2YGVA 3ZKXB 5GRUL 3KW7A 43CAB 5B3JF 1UACH 2BY3A 2EC9T 1BVLA 4N6QA 2WM0A 3RWDB 5C08E 5FUCE 3U9PH 5JDSB 4HIHA 2EICA 4F33B 4QHLB 2XN9E 3UL4A 2WN3A 4PCKA 4BFNA 4A2GA 3FRPG 3MROB 3P0YH 3SE8H 5CILL 4BFIB 3HVDA 3I9GH 1UH3A 1CD9B 2XWDA 1BW8A 1M7IB 2ITCB 2QPFA 4RX4D 5K33A 1ZLEA 4H26A 2EC9U 5IV2B 5ITFB 5CSBA 1V5JA 3CK0H 3HS8A 1OK0A 4G1EA 5DLML 3QUYC 4L4VD 1E4WH 1RLWA 1QO3B 2HLEB 2VH5H 3EYOB 5AENA 3KPMA 3O9WB 3T9WA 1VAHA 4NKDB 1XGUA 5DQDH 3FCSA 3L9YA 1WZLA 4PJ5E 1ZWIA 4IOIB 2IGFL 1BVNP 2MHAA 4MZRA 2P5WE 3BAEH 3QDMD 1PQZB 2JSFA 4NGHH 4RIRA 5HGHA 5FR3A 4MJ4A 1NCNA 1AG6A 2HJKA 4Z5RA 4HSCX 4HOMA 2H0JA 4N8CH 1IQDA 1NFDF 3GMPB 1M2OA 4TL4A 4PBDA 2IWKA 1IT9H 3PQYE 4WJG3 5IUCA 1IL1A 3PP4L 4FHJA 4I3SL 2ZQKA 1L7IH 4JFOA 4W1TA 3KLLA 5AW8B 3CFNA 5MI0C 1J8SA 1YEEH 4HPYL 3DO7A 1XO8A 2N4IA 3WMQA 1ES0A 2FNWA 4RAVA 4OZFA 3IGFA 1NZRA 2G60H 3NJMA 3HFML 1UM6H 1F13A 3QPXL 1JI2A 3MGTB 3ZSSA 3DETD 4FCAA 3BZ5A 3CFCH 3GNMH 4Q9QL 3OX8B 4PJHA 1C1EH 5BW7A 3L4YA 5KVDL 3EDJA 3M8OH 5T1LB 5DMGD 1FNEB 2K4AA 1EZVX 1BGXH 4KROC 4I0PB 1PY4A 2IBZY 5EZJA 2R2EB 4IYKA 2ZKXA 4Z95L 4YHPA 3NFNB 4B9IA 5A16A 2R0LL 4YWGH 4HUKB 3B7SA 4G8GB 3ARFA 3MDJA 3ILDA 4HALA 4B9FA 5IWLA 2DYRB 4G42B 3FN9A 1T1XB 2DDQH 4FZEH 3BMWA 4MSWA 2ZOOA 3TFBA 4YQXL 4IOSA 2X3AA 1HEZB 3IN2A 1IGIL 4ZW8A 1KTRL 2FATH 2Y1VA 3HA0A 2HUEA 3ETTA 4JZNB 1AP2A 1QFOA 2BXZA 4RQQB 3CQFA 1YY9C 5T5NF 5KSAA 5T5NG 2R1WA 1N12A 5JHDA 4K55A 5D7SH 1S78C 2ZXGA 4TUJA 2FL5A 3TT1H 1WS8A 2XWJA 3BQUC 3M1CA 4N4YB 1VDGA 2D0FA 3QWRA 2MPAH 1X7QB 1XTLA 4K94H 4RGMC 3CU7A 5SX4I 4HUMB 4HWNA 4NQEB 4QMEA 1ASPA 5EOCH 1FIEA 1LLAA 1MRDL 2EP6A 4CDHA 1LJMA 2C7UB 5ADPH 2CBMA 1IUZA 3DUSB 2WXJA 2Q1EA 2G4EA 3O6FD 3CSBA 2ZG2A 3QZMA 4MQXC 4EVNA 4BE6A 3A21A 2EDXA 1OAUH 4WENB 3IPEA 4ZD3H 4BSJA 5J12B 1ZTXH 1HOCA 3L95A 3OSVA 2HPOA 3BRDA 1AO7A 1CGUA 3IDXL 1NCHA 2HUHA 4OFKA 4YMPA 4JPWL 1CDHA 1EVUA 3J07A 4WY7L 4OIIH 4AI7A 3RVVC 2X3BA 2XWRA 1U8QA 3CZGA 4JFEB 4BKLB 1ZJBA 2NX5E 2W5PA 2D31A 4K7FB 5JPMB 1BFSA 4E0RB 3L4WA 4R4BA 1EJOL 2XWBA 3QFGA 5KOMC 5BNXD 5K9KA 1NC4D 4ZAKC 4HZAA 2GHWB 3E3QE 4JO2H 2A6KA 3HN5A 1MJ8L 1AQKH 3W0WE 1HCZA 1Z5LA 2CHWA 4CADA 1V7NH 2XT1B 4OQTA 5F96H 4UQEA 1JNNH 3JUZA 3B7UX 4OFYD 1JFQH 2QKIB 4Y16D 1Z9OA 2WHVA 3FB5A 4FQIL 2OAAA 2ZZUT 1OAYL 1K3ZA 2E5EA 2NSMA 1TIUA 4G80A 3TBYB 1TZGL 5F9WB 4XO9A 3TCTA 5I0VA 4OZ4A 3H3BC 3O41A 5ESVA 4NC1E 3AMLA 3NIFE 1EDHA 1P53A 3EFOA 2NY4B 4P3DA 3BN9D 4KKLC 1HXKA 2MCMA 5K9OA 1XF4A 1NKRA 1IKNC 3RB7A 2BINA 4O4YL 3T3ME 2DEXX 4IBLT 3RIFF 2EADA 2VM4A 1INDL 3OZ9L 3QQ9D 2IH9A 4LKXB 1G5GA 4A2DA 3ZR5A 1AGEA 3LKSB 1IIIA 4IK7A 4PGBB 1S9VB 4G5AA 5C08B 4AYID 4UNIA 1KY6A 2UZYB 2XN9B 4PTTA 5BV7B 2WXLA 5I1DA 1DJYA 5DGQA 1G6VK 5EO9B 2BH0A 2ADYA 1LO5B 1OP9A 4TRPH 3RYMA 3MOAH 3GINA 3VQMA 3OLGA 5CCJA 3DX1A 3HRPA 3NZSA 4HDIA 1UVQB 3REVA 4F3FB 5IB3A 2J4WH 3AT8A 5SX5K 4O9HH 2F2HA 3H2QA 2OMBA 2F5AL 4FD0A 1IVLA 2G2RB 2DQGL 2FHBA 2ZKHL 1EHAA 4LSUH 1HQRA 1I1AC 1OSPL 4FHKA 1TFHA 5EWIL 3ZR6A 2QLVB 4PJ5B 2XJLA 2HRLA 4Y2DA 5GGVY 3KGTA 4LLYB 2P5WB 4YDJB 3AVEA 4FNLH 4P5TA 4XPBH 5GRVK 3BLPX 1T0NB 1MREH 4AXWA 3RGHA 1XH3A 1ZT7A 3BWUF 3NDZE 2O5ZL 1KJ3L 1NEZA 3UTTD 1JPGB 1WA1X 3AT0A 4Y1AE 4NKOA 4NQDA 4TULL 4FMFA 1VGEL 2BY1A 3KYOB 3PQYB 4KHTH 4OJEH 2E47A 4N9OB 5FKAB 1PLCA 3VWJD 1T03H 5EEZA 3FTUA 4ES9A 1C8QA 2EIBA 1QPXA 4YFLF 1Z7JA 1GZPA 5EV7A 4Y7OC 3BP7B 2R56H 4GB9A 5C0DB 1WISA 2CRIA 2QVKA 1CLYL 3F64A 1PZCA 4FNRA 4JDTH 4XOAA 4ANXA 4JGUA 2BSCA 1OTUC 2W80C 4HVBA 3EGXA 4TQEH 4R4FL 4L0YA 4LO9A 1CXLA 2C3VA 3NACH 5JIHA 4ZMTA 1JVKA 3N91A 2AMUA 4OLWL 1W9XA 3OKEA 1M7DA 1WAAA 3BVWA 2YGOA 3BT2L 1XGTA 1DBMH 2FJGA 4CN1A 3HC2A 3Q8EA 3GS0A 4ANVA 4B9YA 4D0BA 4JL2A 4G6KH 1AGDA 2VDKB 2VGLM 2VDQH 4WV1C 1SXAA 3PGFH 4XX1E 1GAFL 3SKOA 2WBJD 1Q38A 3WNNA 5IFJB 3ULVH 4X8JB 3HN8A 1HINL 3N1GC 1KIPB 1LO0L 1MVUA 4PJ6A 5IQMA 5D9SA 3P9MA 3IBEA 1J0KA 1ZPUA 1F4WL 1SXNA 4ABQA 3S36H 4I77H 2VDPB 2V2TA 1MNUL 4N9GA 4PRHA 3PUUA 4CDGC 1AKJA 3QJXA 4NUJA 4M8UA 5EORL 3NTCL 1VESA 3VD4A 3QPQD 4L5FL 4AYEC 4XCYB 3VFVB 1NBVL 4IKLA 4IKJA 4LLVA 4TF4A 3S37H 1WBYB 4H0HB 4MHHI 3CMOH 3B7RL 3TPKA 2CBTA 1K9TA 1RHFA 1U3ZA 1N26A 4HAKA 3JWOC 2EDJA 1RK1B 4FI8A 2DEWX 3O6ML 4DVBA 4L8CA 4WW2A 2V8LA 1MRCL 1TU2B 5D6CB 4PCTA 3T0EA 4KKZA 4YHNA 4PSRA 3DMMC 3P54A 2HRPH 2XKNB 3N40F 5F88A 3DBXB 4X7CC 1DBKL 4TUOB 4HIIA 3M45A 4KI5F 1C8PA 1EFXD 3S35L 2AI0L 1A3RL 2VDRL 1F4XL 2FWOB 2CAKA 2X9YA 3GSNB 4JPKL 1T2JA 2X1OA 4UTAH 2FX7H 4EN3D 4ENED 4EOWL 5E8OB 5T1DH 3CFUA 3SOBH 3QXUA 5AL8A 4P49A 1FVDB 3VNYA 5H37A 4JFSA 5IROD 4HXAH 1YY8A 3VXQA 2BZCA 2N7SA 3JVGA 4MX7B 2IXQB 4OCNC 2NX5B 3ZE0F 2HA1A 4WWKC 5E6IA 4CVUA 4YHOL 3VTTA 3RGVB 4LASL 3ABGA 1Z66A 3EFDH 4IIQC 1QQDB 4FQXB 5CZVH 3S3BB 2GABA 4HMCA 1U8HB 1ACXA 4CSZA 4NKIH 4R7XA 2HMID 1X9QA 4ZFOB 3OXSA 3JT2A 2QPEB 3F05A 2EIKB 3SQBB 3P2TA 3W0WB 1BLNA 1WD9A 4EZLA 4FC3E 2Z91B 2BVPA 3F12A 5JLZB 4IRSB 1AI1L 1U2HA 1W0VB 5B38B 3QI9D 4UILL 5HI5D 2BNQA 2V5TA 3FO1B 1FNFA 4X7EC 5I24A 4B7LA 2PPEA 1JWSA 2PW1B 3TFKD 1DJGA 3HC0A 5HGGS 1HTYA 3NIFB 4F7KA 3N44B 5IHUL 3RWJA 2I9LB 5HJGA 4WU5A 3U7WL 3L7FB 2R0WL 4JO3H 3EO9L 1OGAD 4PYGA 3WO4C 3QO0B 4N22A 4QXUH 2LFEA 2QVIA 4FL4B 3KCPB 3CZNA 3FK3A 3T3MB 2EDOA 1XGYL 3N1QC 3X11A 3C9NA 3GKWL 3HKFA 4HBQA 3ZTEA 4KKBC 4JY6B 1WCQA 4PJ8C 1U41A 3VGFA 1KGYE 3GMMA 1LEKB 3EHBD 3IRPX 4NZDA 4PB9H 4O51A 1XAUA 5AW9B 5EU4B 1CFNB 4OVVA 3W5NA 4PS4L 5I18H 3ZTCC 5KVFH 1E5ZA 5HVHC 3Q0HA 3Q8CA 4GG6E 3GHBH 5J13B 1FVEA 1RULH 3OM3B 4LSRH 4GXUM 2ATPA 4MAYC 1WRFA 4ONOA 3SDYH 1E40A 4FXKC 1J5IA 2BSTA 1YMHB 3KHOA 3MV9A 5CP3H 1MCDA 2YD9A 4FAAB 1YNTA 1R75A 2WYIA 1FZMB 5E94A 3QIWC 1P7QA 4FLSA 3O6KL 3TX4A 4QO1A 3QAQA 3T6XA 1JF1A 1E8XA 5J11C 2DYPA 2QADB 1XB3A 4AEFA 3ZK0A 2OMYA 4UQIM 4Z7NF 1S7XA 4MJ6A 3DV6A 1CXEA 2XIBA 1WCBB 2OTWA 3U2JA 5ITBL 1ZT1A 1QLEH 2AV1B 4M03A 5B7EA 5KYNA 4Y1AB 4H8VA 1IZKA 3EYVA 4NQCA 4OLVL 1I1FA 1OT4A 2PXYD 4XE0A 5FYJH 3UERA 5GZOD 1KELH 5SWQA 5J56B 1ND0B 4MMXC 2HH0H 4JJ5A 5AD0B 2G9HA 5BRZA 4K94C 4ENZA 5JW5A 4UT7L 2CNYA 3KPOB 3RWGA 4U1NA 3RFZC 4H25B 3ARXA 3UYOD 5DJXB 2Z9TA 1FNSL 1ETZB 1U8MA 4H1LH 4OLXL 4OZIE 4JGNA 1ANUA 1MLBA 5IJCC 4G8FA 4P4KA 3IJEB 4KOBA 1DQKA 4PMFA 4YO0A 5AKSA 2F8VA 4N1EA 5E6ZA 1MJ7H 2R69L 3GXPA 4NOFA 5MP6H 3NSXA 5ALBL 4AQOA 2D3VA 5KJ7E 4X9GA 3MRIB 4QTFA 1KLGB 2EVIA 4KVCL 1A6VH 1EHLH 4GKZB 4A6YL 4GEJA 5FKPB 3KL5A 4BDVA 4U1KA 3WN5B 1TCRB 3LNHA 3LZFH 1EUUA 1NFAA 4UV4L 1J05A 4Q2ZA 3IXAA 4ELKA 3SN6N 5D4QA 1UENA 3RDTB 4C56E 1HNYA 3DRQB 4UIKL 4WO4B 3HNSL 5DK3A 4IBYA 4ABVA 2D0HA 4L9LC 3MBWB 2WYTA 4JUSA 1WSST 1IC7H 4JS7A 1CC3A 4L8SA 4QOKE 1RUQL 2XQYA 3MUHL 1IGJA 1KPUB 4NDMA 2MMXA 4X99B 4X0KB 1SF5A 5JIIA 4HCIA 3KLSA 5C0JA 5ECGA 3KWWA 4PVNA 5D2NA 1CK0L 1GS6X 4L1BA 4HKBA 3HE6C 4TUUA 5B8CA 3NCYS 2YK1L 3MA9L 5CHNA 4FG6D 3K6OA 3KPRD 4GBXB 1HHJA 4L29A 2AS5M 5J1AA 4MXQC 3LV3A 1NUDA 4Q0XH 5D5MA 3S8FB 2OXHB 3O8XC 4LU5L 5DS8B 3SQOH 3WOVA 4DOHE 4UB0L 1YN7B 1Q72L 4QRPE 3OQ3B 1SEQH 4WTXA 2CLRA 3RPIB 1FIGH 3TWCL 2AEQL 4F9LA 3B6SB 1ZA3A 3K4ZA 4LPCA 3CN3A 5AVWB 3HE7B 4WEBH 2Q6WA 1T2XA 3D18B 4XCCL 5CBAB 2HTLC 2E9WA 1BVNT 4OKVA 4WCYH 4G3YL 1ZLWK 3KYKH 2MFNA 2XA8L 4ICXA 5FCSH 4CC4A 4P46C 1NAKL 1M2VB 2YPVL 4LBEA 3T4YB 4WK4B 2IG2L 1T66C 4XX5A 4BUGA 4DKAA 1YC8A 3LQAL 3MV7A 5D1XD 1MW3A 4RFEB 3VXTA 3TTYA 3T0AA 1IQWL 3KGRA 1ET8A 4LL9A 5FYLH 2BOCB 1YEIL 3S5LB 3GXUB 2WQVA 4BFGA 3LRGA 1V7MH 3JTBA 2J6EA 2W65A 1QSFE 3SDDC 2X4NA 3SOTA 3L54A 2X28A 3CLEH 3QUXA 4N26A 5AW7B 4P9ML 3SPCA 3SDCD 2HKFH 4KJYB 1QEWB 4DCQA 4F2MA 4B5EA 5LNEA 1IBZA 4U1MB 1CE1L 4K9EL 2VZ1A 2UZIH 1Q0YH 2B2XH 3Q48A 5DUPH 5EZIH 1RQ5A 3B5HA 5DURB 2Z1KA 4IBZA 1MDTA 5IBTH 5C0BE 4L1DA 5CGBA 1UXWB 3ML8A 4LOUC 1IAIM 2XYBA 3BUPA 4JQXC 4JR9L 2VDLH 4MMZC 3R0NA 1OAZL 2PPAA 2JKRM 3EZ8A 5KJ4A 3FQRA 4U1IB 2XG4A 5TE7H 1NEPA 2FT8A 1HHIA 1KT2B 3WFDL 1ZLUH 2F18A 1VPOH 1ZLWH 5AALA 1NJ9A 1KB5B 5J6HB 4C47A 4JANB 2JB6B 5GGSA 1JD7A 1MLCA 3KPLA 3ME0B 1GSKA 4P3WA 1DVFA 3DVFA 3DXAA 2R2BB 1JGDB 1GOFA 3ZSTA 1JHKL 5IW6B 3AQYA 4GG6B 5K59E 1GYUA 1NBQA 2D4FA 4OTXL 2HP4A 3ULVC 1OARH 2K4WA 5T3ZD 2ZOKA 3MRDB 2BP8B 2VR8A 1SVCP 3UO1L 2B3IA 3MLXL 5EOCJ 1RUMH 3VTMA 3V9EA 3I3BA 2ICCA 5CM1A 3JSSA 3PWPE 4XBGB 3AWGA 2P45B 4JN2B 3I9AA 4J3UA 1CDJA 2CO7B 2Q86B 4ALAH 2IQ9L 3KM2A 3NN8B 4OFDA 2H32B 5SWSD 1JV5B 4G43A 4AGLA 2GQHA 5HHMD 3VDAA 1BF2A 2B7DT 5IIEB 1T0MA 1FYTE 2AVFA 4HZ1A 4PS8A 1T5WB 4FFVC 3CV5A 1IBYA 1IAOA 2F74B 5D7IE 1NCOA 2K6ZA 5JNYA 5CGYC 4K8RD 2NY0B 3A6CH 5LXGH 3S48A 3NA9L 4G2AA 2B1AH 3SPJA 3VH8G 1SY6H 1CT8A 2FEDC 3PAUA 5AVUB 3TBBA 2XX1A 3D6GA 5AB0A 1F42A 2SEBB 2GBVA 4AVHA 1ZOXA 4PJDF 5E08H 4OZIB 5JW3L 3ROLA 1F1DA 2Y7QB 4KPHH 5AAPA 4GW1B 4EUPB 1U2YA 4WFGD 1WFOA 3GO1H 2NNFA 4NQUA 3GRWA 1NICA 1RUAL 1L7TH 1IBGH 1XWVA 3EJSA 2JLLA 3BYYA 3VI3E 1YC7A 3FT3B 5GJTH 1GPOL 2X89D 2QMKA 3UZEA 5CZXD 3NZHH 3O9WD 3RNKA 5DHVB 1E6OH 3LS5L 2N0KA 1IGFL 3H53A 5L8JB 4TTDC 3V0VA 2HFGL 2WCPA 3AU1A 4YHIB 1PLBA 1TQTA 5DS2A 3NABH 1DQDH 3ORJA 4QOKB 4ZYKA 4AENA 3FTVA 4KUCD 1MZYA 1JNLL 2CE6A 3H0TB 3INOA 5I1LB 3WCYA 3VXME 3ZGHA 1HNGA 5MEPA 3H55A 2WMPB 1ET7A 2FWUA 4O2CB 4R84A 5EBWA 4RMRA 1CZ8H 3CXFA 4Y4KB 3P3RA 3K2UL 1V55B 2NSXA 4GQQA 1XMEB 5I1EH 3IJHB 1C5BL 4KK9D 4J8RA 1DYZA 3CVHH 5AB1A 4JNXA 3VDCA 3UXFA 3VFWA 2FYYA 2ZUQC 2CJTA 4XBMA 3S5YA 3O4OB 2WLJA 5CWSB 5B39G 2WN2A 4DOHB 4QRPB 5IESL 2FBRA 4U4IA 4WW1A 1QSED 3CIAA 2E59A 4HPHA 1CFTA 1MXDA 1QFWL 2H1PH 4N86A 1KGCD 1SJEA 3WDJA 1A3QA 2GIYA 5T1KA 3ZL4H 3LD8B 4AQ1B 3J2PA 2VAJA 2ZCHH 2V7HB 4I0PD 1H8LA 4JQIA 3UBHA 5JYLA 4QTHB 1BAWA 3BC9A 2JK5A 2JJTC 1R3JA 3QQDB 5B4MD 3IJSA 1A7BA 2PPDA 3TBSA 4KTYA 4MBOA 3M1BB 1JXFA 4PLOB 3SDXA 3FO9B 3MRJB 3MLVL 1QFWM 3FMGH 3QCTL 1I8IA 5F70A 2MNWA 3FQ2A 4GAJH 1E5CA 4KRPB 1MWOA 1S9XA 5DJCA 3MODH 2IDTA 1A3ZA 1MCOL 1TUPA 3EFFB 1X6NA 2PTTB 3CDFA 1WAEA 3PNWA 2N7BA 3D3VD 4XP5L 4DKFL 5C86A 5J6GB 4ZS7L 2CHDA 3ZJAA 1FP5A 1XF2B 1PAMA 1KBGL 1CTNA 1OAQL 2EDKA 4M5ZL 8FABA 4MS6A 1QSFB 1FZKA 4NWTL 2PPFA 3TVMB 3BO8A 4APXA 3AM8A 4BH8B 2JB5L 1ITBB 3T0XA 1SN5A 1HN1A 4JO4H 1CDGA 1NGXB 3NFSL 3QQ4A 4YXHH 4Z7QF 1M05B 2Y07H 4K7PY 4OQTL 2Q7NA 3LQZB 5EF0A 4PHXA 5F1NB 2V17H 4PJBF 3W9EB 3GBLA 3RA7H 3KPNB 3RL1B 4R7VA 5C0BB 3DV4A 4HH9A 4YDIL 3RL2A 4ORGA 3LB6C 1N6QL 4OW6A 1NOFA 2R0ZH 3P0VL 4KQ3H 5B1AB 5LQBH 2GSGB 2DLGA 3LN9A 4YK4B 2N56A 3Q5YA 4Z9KB 2NYYD 3K91A 5A6IA 3GGWA 3HUJF 1A6WH 4LAQL 4BH7B 1EZLA 1XF1A 1IO4C 3RNQB 4F1SA 3UGEA 5DD1H 3H3KA 5DMKB 3MVSA 3MLSL 1G9HA 2AKRA 3L2MA 5TDOB 3PWJA 3LHPH 4ZO8A 4Y4HC 3MLWL 4DNLA 2NCEA 3FU5A 4PRBA 2EYRB 3JV4B 5FIEA 3N43B 2AEPL 1YEKL 2J43A 4JDVB 4OD1H 1DBBH 3HI5L 1S7VA 3SJVE 2HFEB 3W37A 2NR6C 3GSVB 3TBTA 2ADIB 3SDAB 3VUAA 4XMLL 1JS4A 4NN6B 4PMEA 5F9OL 2H45A 3QUYA 1BAFL 4RFNC 1QA9A 1S3RA 4AM0Q 1JZHA 1ZHNA 3PWPB 2IANA 4M1DH 4G9DB 5E51A 1MQ8A 2GSMB 5E5MB 2EC8A 1PKOA 3VWKB 1YUHB 1YRKA 4GAFB 5C70A 5J1SC 5KTEL 4BSVA 1FDLL 2IQAA 4PG9A 3P9LB 4X9BA 5LCVA 4AJWA 3SY0B 4UUJA 3WHXB 5EEUA 1LK3L 1UKQA 2PWGA 2X4SB 2XZQH 3NZUA 3V6OC 1GCFA 1FYTB 1P5VB 3HAEB 5ILTH 2BP0A 4KJWD 1U3HB 4EIBA 4ELMF 1TKWB 2NY4D 3NJVA 3OKKA 3UYPA 5D6DC 2GKIA 1QX1A 4LF3B 5D7IB 3T4AC 5HHXH 3MCLH 2EXSA 3A4FA 3Q6FB 4KMLB 4TVPE 1NBYA 1KCSH 1UB6A 4JE0A 5HVFB 3K71B 3H9HB 3TO4B 3DUUB 2DQMA 4LK4A 5FO8A 4R8WH 3Q7JA 5JOFB 1KEGH 2P24A 1ED3A 4M1CC 1G7QA 3C60B 4CSPA 1FSKB 2F1EA 4YXLH 1AD9A 3VI4F 3T77A 2VB5A 4URTB 5I5RA 5C08D 2OTUA 1S8DB 4ZTPL 4LHQB 4AT6B 2Y2WA 1A4BA 2NY1B 4F5CE 3ARYA 2XN9D 2ADGA 1BFOB 4F58H 1LP9A 3QJFA 3EJTA 4XAWH 1E28B 1TZHA 5JW4N 5F21B 4PJCE 1HH9B 2X09A 4M93C 4J3VA 1ZLDA 3CLFL 3R8BB 3GZKA 2ILLA 1QWHA 3QFJD 4ONHB 2Y2TA 5GS0L 2PKDA 3VI3B 1B0GB 4J6RH 5E0FA 4XR8C 3UABA 5TJWK 4WI5A 1OM9A 4ZZKA 1I8KB 1U42A 2IO5A 4QPEA 4K71C 4EI5C 5J3HC 4Y8AA 5D1QA 1HKLL 2CDGB 4P59H 1N7ML 5C0AE 5B3SB 1QI5A 1WBXA 4PJ5D 1Z9LA 3DK2A 3UROR 3D33A 2VXUL 2P5WD 4L8DB 1S7TB 4TNVK 3GHEH 1JNHA 3VXNB 3V0EA 3HRZB 4U1LB 4HWUA 2X2HA 3NYKA 3ZRCC 3O3DA 1GTNA 4GRLA 3VXMB 4FCHA 3ZDZE 1O7DC 2OXGA 4H20L 2J21A 3PQYD 4K5PA 4ODTH 3IGLA 5GGUA 3OG4B 4N6RB 3ZY7A 1IM3B 2RB8A 2X4RB 2Z7UA 2PR9A 1M1SA 1P0SE 1PNDA 4CA4A 4X6CF 5ABAA 1JUFB 5C0IA 5IMKB 1L9SA 4XPAL 4RNRB 6PCYA 3GJFB 4ETYA 3IE4A 3RJDA 3QJSB 4NJ9L 4WHYH 2VABB 2C9PA 4UZSA 2QPUA 2DN7A 1I1YA 3A67H 4NXKA 5KVEE 1OXYA 2ZXCA 3ZMNA 2R27A 4KJPC 1BZ7A 3NJKA 5A2LH 1T21A 4FA8A 3DI3B 4G7VH 3CQPA 1RJZA 2Z4QA 1OD7A 1HSAB 3Q6GH 5JHAA 1KCRH 4GQ9H 1RIUL 5F7FA 4HKJB 5JZ7C 2ID5A 2VDNB 1ZANL 4NC2B 4R7LA 3ZHNA 1AQDB 3ULUH 4LLMB 3TEWA 1C16B 1RZIB 2G5RA 4ZFZA 4OD3H 4QF1A 1LEIB 3MBEA 4LLDA 4JKLA 5I1CL 5LO7A 1HJBC 5ACZA 4NWUL 1KCVH 3MRPA 4G5ZH 4CILA 3FB6A 3DHUA 4X5PA 1PG7H 4UIMB 4ALAC 3NIGF 1TDQA 4B0MB 4F9PC 3V7MA 1HWGB 3HZVB 1E4HA 2E8ZA 2VSDA 4JFXA 4ZFFA 5T5FH 5C07A 2PETA 4B96A 4Y2OA 4OGAD 3AROA 4WJKB 1G9NH 1OLLA 3BFQG 1XCTB 3SO5A 9PCYA 3LRLA 4PLJC 5EIIB 2O6EA 3OPZH 2BLFA 3WTTA 4MVBC 1L0QA 3PAZA 5DD3L 4CKQA 3FT4B 2ISDA 3S4SA 4NO3A 1UJ3B 4MA3B 1C08B 1WIPA 1U3NA 4BKTC 2ICWB 1SXSA 2R29H 4RRPG 4PRAA 4GW4B 4XP9L 4NHUA 3VRJA 4XMPH 4HS8L 4OM1H 1DQJA 4NUGL 2YQ2A 1RKRA 3N9GH 2FGWL 5DD0H 3GDBA 1VHPA 1Z5YD 2EKSA 5E2WL 1OM3L 4GOSA 2PW2B 5DFWH 4UBDD 4YFDB 4AQEB 1KBPA 5KVDE 4MD5B 3TJEL 3AT9A 3S2AA 4PJ7E 3SJVB 1JRHH 4DKDC 1A21A 2B1HH 4XP4L 4YVUA 25C8H 5LNGA 3W82A 4KZDH 3BP5B 2YC1B 3KGUA 4HFUL 5FUOL 2PR4H 2AXJA 1QACA 3CFTA 1BD2A 4Q6IC 2CWRA 5DVKA 4FQXD 4X6EB 5CUSL 4K2UH 4YBQC 5IFAL 2K45A 5I8KL 3ZZLA 3KLHC 1KFAH 1UCTA 3U9WA 1KENL 1WWBX 4YAQA 4KMTH 2ENYA 3FFCB 2WLLB 3X17A 3BI9X 3W11D 3CBRA 1PZBA 4E42B 4A7QA 2PWFA 5IVOA 3B9EA 3CFJA 5K39B 4IRSD 5A1AA 2ATAA 4LXFA 2CCLA 4XZUA 3U2SB 1ZLVK 2WAQA 2Q2EB 2X7LA 4RWYH 4XBEL 2ED8A 2X4PB 2I9TB 1KXQA 1BEYL 1JL8A 2GPZA 3DYMA 1MW0A 2YJQA 3O2DA 1HXYA 4DW2H 4LPVA 4WI8A 2E56A 3BDYL 1FFPB 3T0VA 4Z3EA 1CD0A 4Z76A 5HYJA 1LMKA 3QCUL 3TCLB 5EFIA 3F7RA 1ZPLA 1QRNE 1NCBL 1INQB 4Q9BA 3L16A 2GB2A 2CLZA 1UGKA 4LCYA 5JO5B 4YGAB 1EEYA 4OJFL 2RQ8A 3PS6A 4HK3J 2Q8AL 3SBWA 5GRUH 1CU4L 4N8PA 3GSOB 2O5XL 2V7NB 2HJFA 4GUOA 3NCEB 4HETA 1WFTA 5DJAB 2FGZA 4M8RA 1KYOK 5MHSE 3DX9B 4PJCB 4WV1A 1G43A 4MD0A 3ARZA 5I19L 4H5SA 2FZ3A 4NP4L 5E9NA 4K3DL 3KVQA 4YPGB 4WTZA 5EU3A 5CILH 2KT6A 1QWNA 4FQLH 2IV9A 1NCAH 4JB9H 5F7HA 2XBZA 2ADJA 4YEEA 4PJIA 2VDMB 5A7BA 1P4BL 2OL3A 3MRQB 2IIJA 2QADD 1ZLVH 5C0AB 1TTGA 5ACMA 2YRPA 2JWYA 4HUNB 1CYWA 3IKCB 3TF7C 4ZUUB 2R1XA 4OCXL 1DSFL 3U46A 4DP1X 1A6PA 5KSBE 2FO1A 2CHNA 5JORA 2XC8A 5CD3B 5EDSA 1OP4A 4GUQA 3C6SA 1HH6B 3NCBB 3S3CB 4WKXA 3DO4A 4Y1AD 5E1HB 3ZDZB 2OP4H 5AAWC 1N0LB 4IKKA 4BD4A 2O1AA 1EXUB 2LT9A 2HRGA 3TIDB 3Q2LA 4Z6AT 4FKKA 2IPTH 5DK0B 1ID2A 3B1TA 1IM9A 1H8NA 2HVBA 4JZJC 3NEOA 5HSFA 4JDZB 4NNXA 3MR9A 1ADQA 2AGJL 1HIML 3HPJA 5AB9A 4OFPA 1HEJC 2V5RA 4D9LH 4PYHA 1U8OB 1Z2KA 3DSNB 3FCTA 2XUWA 2EEAA 3FN0H 4HKZB 5E8DL 2DQEH 1OF2A 4HPYH 4ODWA 5EU5A 4F93B 2V0AA 3CSYA 1P69B 2IWGA 2MNJB 3P77A 5EC2A 5FM5M 5I8EA 5HDBF 3MCKB 4I1PA 3QPXH 3F6JA 5IJVA 5MERA 1IC4L 3K81A 1CG9B 3HNVL 1NCDL 3MYJB 2KC0A 1TOXA 2DL2A 4RDQF 1SMAA 1P84K 2H6OA 3KXFE 4P2OC 4RDQG 4HLZG 5DVNA 2WBKA 5T1MB 3RDTD 4JFFE 4GAGH 4LPTA 2LW3A 3ZW3A 4WO4D 4R97C 4WWKA 3F2LA 2Y7SA 4HSQA 1FLRL 5D7KE 1FC1A 2NY6C 4IIQA 4G72B 4L05A 2DQFB 2FSEA 1XAKA 4MQTB 2A99A 5I30H 2PXYC 1FCCA 2GIMA 5JQIB 4FYRA 1HFUA 1PCSA 1RZFH 2X12A 4FFWC 4KHXL 2J6EL 5FB8B 5KBKA 4ZQTA 1SLWA 3D06A 4R5TA 3CZSA 1IGIH 4NNYA 1SVZA 2I07B 4XMZA 5DWUH 3TA3B 3VNZA 5JIMA 2D3LA 3O45B 4C83B 2PYEA 4UQ3A 1AIZA 1BMGA 1YSOA 4FEMA 1LE9A 3SPVB 1ADWA 4GBXD 2NQDA 4PSPA 3T8VA 4CBZA 1GC1L 4N24A 3C5SA 2CXKA 2OX5B 3RVTD 2GJ6E 5HI4D 4B3EA 1L0YA 3BIKA 2FECI 4ZXBB 2M1KA 3SQRA 1MVYA 4PJXA 2X70A 4XB8A 1BVZA 5KYWB 1SOSA 3CJJA 4FNUA 3TO2A 2Z92B 5E99L 5I8CA 1MRDH 4NPJA 5INDB 2QFPA 5ICXB 1X3DA 2MOQA 3E9UA 3HE7D 4N0UA 3UTQA 3SE3C 4PJ8A 4XCNB 4XTRC 1V54B 2FJFB 3D30A 3UX9B 5L0QB 1PEWA 1EZUA 1JTTA 4WSJA 4DGIH 4CC1A 1WTGT 1SQMA 1Q9LB 4PJ7B 2OW6A 4MAYA 2DQHL 4MKTA 2VXQH 2IWFA 1T4KA 1UGNA 4FXKA 4LRIC 5DEGB 3SYOA 1CE6B 4JPWH 5F9AC 3JV0A 1F58L 3L1OH 5I16A 4UINL 1YQVH 2QVTA 5C09E 1KTDA 3QIWA 3C6LC 1RZ7L 4Y9BA 3BUIA 3OHXB 4HJ1A 2W07A 4PP1C 4AH2A 2NY7L 3T08A 1QEXA 4Y19E 2QPDB 3E80A 4FDWA 4H8WL 4ZNCD 4YDMA 4FLQA 4YL9A 5DVLA 3FONB 3QQ3A 2EXYD 4U7MA 4V11A 4L5FE 1PZSA 1VFAB 4K5LA 4GO9A 3GJEA 4DFIA 2WZPD 1MHCA 3ERXA 4PJFA 3EO0A 5K1JA 2ENQA 4IU3B 3QXTA 3B2VH 2VMDA 3UG4A 3NJHA 4LZKA 1R5VB 5DURD 4ZUVA 2AXFA 3V8CA 2VDOL 4PBVC 1F3RB 2PO6D 4A39A 4B50A 2WVVB 1BV8A 1CLOL 5D4JA 4Q14A 1PZ5B 5T3XE 5CN3A 1TZGH 2MH4A 1AIFA 3KYNA 1D5IH 1OGPA 3LDBC 5C0RL 1CGSL 2YGNA 4CMHC 3L3JB 3RFZA 2R83A 1JK9B 3FTSA 3MFFB 1JYNA 4CNIB 4XPFH 5H8DA 5A6LA 1WG3A 1TSRA 2UY7A 5IR1A 5FDWB 1QRNB 1RK7A 5IEKA 3T2QA 3NPSB 3MJ9H 1UWFA 2EE0A 2ITDB 2COQA 4ODHL 3HZMA 3WIIL 3OR7B 4CJ0A 4EMZA 3QYMA 2WTRA 2WPGA 1M1XB 4G6JL 1OHQA 2E75C 3OAZK 3OZ9H 3L3DB 4RDBA 4XH2B 2B4CH 4H0GA 4R7NB 1YECH 4HFWA 2BCKB 4KO9A 4AM0A 1TJIL 3TEYA 4IGBB 1PPIA 1G7LB 5DHYA 4HS3B 4HCFA 5I1AA 2UVEA 4IMLA 3GRWL 3ULUC 4ONGL 3QDGE 3PJSB 1AVAA 3ROOB 3H9SE 2CRYA 4G59C 1FYHB 5IOKA 1D5ZA 1R3LB 3HBQA 3V9CA 5A3ID 1FGVL 1IIKA 4L9LA 2FNBA 3EGSB 3ENEA 1NMAH 1U33A 4G7SB 1L3WA 5KSBB 2ZKHH 4PBXA 1H6FA 4MA8H 1OSPH 5TQ0L 2IH1B 4Z0BL 3WEMA 1E5BA 2CO3A 2BS71 2DIJA 3FBQA 5FM4A 3WHE0 1D5XA 4N5EC 5I23A 2VO5A 3HC4L 3QZWB 3C5ZC 4J3TA 4NENB 2W9EL 1RAMA 4RVBA 4L0ZA 2ITFA 5EN3A 2ZUXA 2ZP9A 3HE6A 2H26B 4OLZH 1G9NC 2NY0D 4TULH 3MLTB 2Z31C 4RZKA 1S7RB 3QR1A 2XRAL 4MD4B 3S34L 1I9JH 3AAZA 3HI6L 3ULSA 1D5MA 1N4XH 2X4TA 4YFLI 3HI1B 1F5WA 3O8XA 1A6TB 3NJNA 4S0HA 3TZVB 3REWB 2DTSA 3MNVA 4I48B 1CLYH 2ARWA 3IDJA 2DQUL 3SHSA 1EO8L 4UYPA 4RBPK 1ETA1 1QASA 4BCXA 2ZX9A 1OAXL 2YD0A 3WL9A 4LOEA 3WY3A 4U6XA 1MFEL 1NIDA 3WLBA 1B2WH 2W0KA 1KSRA 1C7TA 4Z77A 1JJUA 1J0IA 2DYSB 3FOMA 4QYOA 1SLUA 2XWXA 3NG5A 4ZBJA 5GHWH 1OPGH 3DROB 1MIMH 2LLGA 1KJ2B 3EBHA 3K6FA 3I2CL 2BZ7A 4JQIL 4KNSA 3BUTA 2DTML 3DSFL 1I53A 3KXFB 2R1YA 1GAFH 5TQ2L 4N90E 5I75C 5I6XC 3BXNA 3V5KA 1MCPL 1EAPA 5IB2A 4HWEL 2YA2A 1KBWA 5C2BL 1F4WH 3M1OA 5BZDA 4QOKD 1MNUH 1XBRA 1I4FA 1CO1A 4Z3TA 1BZ9A 3U9UA 1ZDQA 1BQHB 3IJ7A 2JJUA 4S0SD 3FAXA 2VSCA 3Q8AA 4X7TA 5EORH 1NGYB 3SDDA 4KAQL 4NFBA 5FLVA 3OF6A 5DQJB 3R06B 4MJ2A 3NIDE 3QP3A 1NBVH 4JJHA 1DLFL 3W5MA 3WN6A 3U83A 2J88H 2PWHA 4GPVA 2FX9L 4LGRB 1RSYA 3ZKXC 1ECZA 5F7YC 4HIEB 4HIXL 4OSUL 4Y4KD 8PAZA 1YCSA 3NSCA 2B39A 2YUZA 4JDEB 5JIQA 1WZ1L 1GKEA 2NLJA 3DX8B 3PWUB 1KYUA 3JWDL 4RBPH 2WLHA 3AG1B 1MRCH 4XMKL 3RU8L 1FQ9C 1NLBH 2GJ6B 2X4QB 3KNBA 4JQXA 4MMZA 4R0LB 4E5XB 3MRHB 1NCJA 3GMQA 4Z7IA 1X9UA 4DK3A 2CCWA 3BH9A 3OL2A 2PWEA 3GSWB 4QRPD 4MJHA 3TNNB 1JVOA 3GIVA 3NJIA 5CMAA 2CDEA 3IETB 1DBKH 5B38G 3K6SB 1RPKA 2XACC 3SGDH 1QOKA 1U8JB 4XVOA 3W39B 4UMGA 5TPWH 4S1SH 4H0IA 2XSKA 2C9QA 5DJ6A 4FQ1L 3U7YL 4LSPL 5A7EA 3PP3K 2QQNH 4R96A 1FG9C 2YD2A 3QB7C 3PWVA 4JFHE 5DFVD 2B08A 4DP9X 2R15A 5ETUA 2A4CA 1TR7A 1JCKA 4GKNB 3EDEA 4IOFD 5IUSA 1FA4A 3FH5A 1XEDA 1JDAA 3T3MF 1H3GA 1OTTD 2J8UF 5CJQL 4KK5C 3PDOA 3SSGA 3UJIL 1D5RA 3IFLH 5I0ZA 3W38A 4KTGA 4W68A 4M5YL 5C09B 2C34A 1RZGB 5FF6B 1BX2B 2C1PA 5C7XL 4C59B 2ZG1A 5HGAA 1QI4A 4Y19B 3NRPA 2BSSB 1KBBA 1MW2A 3GSUB 4FXGC 5KBMA 3EBGA 1OTSD 1RMFL 1XTMA 2ZT9C 4HH8A 1WVZA 3TBWA 3CPLB 3UOAB 4Q56A 4X6BA 5M7QA 1O5PA 3KL0A 3ARTA 1MDAA 3H1ZA 1ASOA 3DPBB 1TZOA 3EOBB 3ARBB 1D7BA 3I02A 1RJYB 1E4KC 3N06B 2NXYB 4FFYH 5F7UA 5JMRA 1LO2H 1AI1H 1KB3A 2IDUA 5LCVL 2EIJB 3RUGF 4UILH 3X12B 1LDPL 1KXTB 4QRTB 3D85B 4KK6D 1Q4NX 1B4JL 3X1FA 3L2NA 2F54A 5HHOE 1SDDA 4JFYA 4MNHA 5TDNA 3ZE1F 5FV2A 4D8PA 4KDTC 3LPOA 5IHUH 4YR6B 2FQDA 3H85A 1P2CB 2R0WH 1J1PL 2BSRA 4FQHB 3PNRB 4I1RA 5D7JC 1UG9A 1NIAA 2DAVA 1OSZB 2G75B 5EN2B 1H3WM 1A22B 1FC2D 4RGOL 4X2UA 2VDRB 1VFBA 1Y6KR 3MRFB 1UEMA 4UTAA 1YDPA 3CFDB 1QLRB 2P1YA 4GINA 3UMTA 2WTPA 1A6ZB 3MRBB 2VR4A 1F8TL 1IC5L 2CKNA 4M8VA 3GTVA 4PN6A 2LVCA 2ZXBA 4PRPA 2WANA 4PGDB 1SYSA 3FU7A 1YPZE 1WO2A 3QUZB 4E41A 3VXOA 4JFDA 2VUOA 3P11L 4XVUC 5HYQA 3QWOA 3QDGB 4RLDA 3QIUD 4XN4A 3PWPD 3H9SB 3ZTDC 2PCFA 3NJJA 3C5JB 2K6WA 1CDIA 4YHKL 4YDZA 2IWEA 2N1KA 5FO7B 2GT9A 1M71A 2F15A 4X8CA 5DQ9A 3F85A 2ZXDA 4L37B 4PY8J 2C4XA 4I2XA 4KXCA 5ICZA 2BPBA 1NOLA 5HHPA 5DC4B 4IBUA 2Y2YA 1RIHH 1XF3B 4M3JA 2V3EA 4OH2A 4JM4L 5LN8A 4LNRB 1U3HD 1L5GB 3FRUB 1E5AA 3QJVB 5ITBH 2D7NA 5H35A 1ZVSA 4WWOA 2XIDA 5KOVC 4A67A 4MZ3A 4Y9GA 4ODSL 4OLVH 1VZHA 5F3HA 1L4IA 3P4NA 3TO4D 5J8OA 1YZZA 1MIEL 2IBBA 3S36X 1YJDC 4X6FA 4BCZA 5CCKH 4UT7H 1BG9A 3L6FA 4RMVA 4D9RD 4U1SB 3UTZB 3F5WA 4KGJA 3ECBA 4AGPA 1FNSH 5JPMC 1YEDA 4OLXH 4WHTA 1BXUA 2YQGA 2NY1D 4RESB 1AQHA 4FMKA 3QDHA 1OW0A 3MLUL 3ESUF 2QGDA 1I8UA 3WKQA 4KI1A 3SE9L 2R69H 1V3LA 5A2BA 5F9JB 3CG8A 4EBQL 5EZPA 2JJTA 3AB0B 3I74A 1T7ZA 2DLTA 5D72H 1JXDA 1I3RB 1AHWB 3CVCA 5IHZA 1FFNB 1J5OL 1DEEA 4QGYA 3SZ6A 1EERB 3C12A 2LQRA 2HX7A 1CDCA 2QKIC 1TG8A 1E4XL 3RWEB 3BVXA 3O2WL 2EDDA 2QV4A 5CP3A 2AEIT 1K8DB 1ZT4B 4ONFH 4ZS6C 5CJOL 3IDMB 2EDYA 5GGQL 2EINB 3BE1H 2C7FA 4MA1B 1VERA 3HNSH 4MZ2A 5AL0A 2JI2A 1OSYA 2F9BT 3DDGA 3LKRA 4Y5XC 5I6PA 3WXVL 3EJUA 4F7MA 3GBEA 5L2KE 3NIDB 1DL7L 3VXMD 1AOZA 1Z9NA 3CN2A 3D25A 2RR3A 4OCWL 2RJMA 5E1AA 2HKHH 4JHAL 1MY7A 1UB5B 4F7TB 4YSUA 3HBGA 1IM3D 3LEXA 2LLLA 2BHUA 3UC0H 1TZAA 2DJSA 1NH6A 1CK0H 2A0LD 2VAAB 3RURA 5LNDA 5FUCC 2DQCL 4WIQA 2EACA 4HUVB 5D96C 3SO3B 5C0CE 5AW5B 2X6MA 2F1BA 4C4BA 1NCCH 2F08A 3KYMB 1HHHB 3I3EA 2E6JA 2Y3NA 3DTUB 5EOQH 3VGBA 1I8AA 3UTSE 4QRSB 3WFEH 4N2IA 3DX4A 4FABH 5B3JE 4HXBL 2VSKB 4AKQA 1JK8A 3BZEA 2ZOLA 1XSJA 1JWUA 4UB0H 1Y1DA 4Y8DC 4NQXB 2P4AB 4NJAL 4LVHC 1MI5D 4LKCB 4Y4HA 3TWCH 3WE6B 3KPPA 5DU7A 5EF3A 4QUOA 4LSVL 4F7PA 2DH3A 3VU2A 4LLQA 1WBZB 2B4CC 1OCWL 2CCVA 2A9AA 2XG5A 1NCTA 2Z35B 2NDGA 3FB7A 3DECA 4NO5A 4XCCH 2Y06L 4JFUA 4AE1A 4BQ6A 4X4ZA 1A7OH 15C8H 3C08L 3MRKB 3IJ9A 5E2UL 3RKDC 1NAKH 1KYOJ 2YPVH 3LEYH 3MJ7A 3RWFA 2DWEB 1XIWB 2C3HA 2IG2H 2FWLB 3P02A 4KY2A 5IB1A 3U4AA 2WQSA 3E6FB 2WBXA 4JHUA 4GG6F 5JYMA 4L18A 2BP5M 1YYMH 1YUKB 2J55A 4B60A 1BCIA 1YEIH 4I89A 2A9DA 2VO8A 3HG4A 1ETB1 2GCYB 2AV7A 1NFDE 5IVXE 4ZMVA 3KHQA 4CUCA 3CHRA 5ISZD 4FTVE 1P5UB 2GJZA 4PP2B 3MACL 1NGPL 2DS4A 3V6OA 4ZJ9A 5CEZH 5MEQA 1GOGA 1PNCA 1EAQA 4ATWA 1SNRA 4JRXD 1Y6MR 2VLKE 2VLJA 3EYQC 4K9EH 3L9EA 2XFXB 3ZE2F 5HHOB 1BOGB 4G6ML 3O2DL 3NZ8B 3FF8A 3BRFA 4I5BB 1T0OA 2NY2C 4XHJC 4C54A 3UZVB 1L6PA 5EBMA 2FSDA 4WI9A 1SVBA 4RRPM 4V33A 3WFDH 3IXTA 2BFVH 4AV4A 4O02H 4OT1L 2NQ3A 3BIBX 3M17A 3IDYB 3QIBC 5AUMA 1XX9C 1A02N 4XRCA 3B9DA 3SJVD 2XTSA 2ZCLH 3DVIA 1UURA 5FYJU 4PJ9B 3HLKA 4OZIF 4M4RB 2A83B 5IJBC 4HHAA 1YPZB 1JHKH 2FIKB 5AZEH 1UT2A 1UA6H 3CFMA 1AO7E 4OD2A 1KIRB 2ED7A 4L3FA 3VW3H 4U6HA 4P4RB 3V6ZA 4EI5A 3FFCD 5DR5L 1VZGA 4M7LL 3UO1H 3QORB 4YN3A 4EUPG 1KTJA 2EIZB 4FE9A 2OL3L 1P84J 3B9KB 4NAQA 4Y5YC 3VD7A 4KUZH 3MRGA 1HCFX 3FT2B 3S6CA 1WDAA 4PB0L 2GJRA 3CH1B 2IQ9H 5IOPB 1PX3A 3BN3B 4JFQA 4Z3FA 5HGDA 1MFDL 5AQ0A 4CC0A 4YDKL 4YSTA 4TKWA 4HKXA 4LIQL 3SPIA 3BZ4A 4E9YA 1U91B 3JWOL 2E27H 3L5JA 5D71L 3N0PB 1R3HA 4PJGE 4TVPD 4FYTA 4WI3A 3BKYH 5AAMC 2VMEA 2P8LB 2Q3ZA 4X80L 3MU3A 1ADQL 3QZLA 1ZEAL 3S5ZA 1DVYA 3WSQL 4FNPA 3F84A 3F62A 3IWUA 2YPKB 3DC0A 2AEOA 2W81C 5G55A 2FUQA 4NT6A 1U93A 2UZPA 4XI5D 1FJ1B 3VFTA 4GKSB 4F37K 4Y4FC 3RGVC 1AS6A 2VJ0A 4QY8B 5FW8A 4FHBD 2FLRT 5EOTA 5KBPA 3FQWA 4ZUTB 2GBUA 3ZGIA 2AFNA 3PJNA 4OUUA 3E3QC 4FZ8H 4BZ2H 3ZIYA 1BF5A 1NDGA 4RAHA 1MQKH 4UQDA 3KL3A 2MSPA 4YUEH 2VXVL 3FFDA 4UAHA 5GGTA 3PU7A 1NANI 3D4CA 4QCIB 1FV1A 5G5DA 1MCLA 3P0YL 1NAMA 5I5JA 3SE8L 4KO6A 1W6WA 3I9GL 2GUYA 4OCYH 2OV0A 3ARDC 2XVBA 2DJUA 1OV8A 4NC1C 1UZ6E 1YEHL 2JXMA 1TJHL 5JHMA 3ETBF 4H26B 3VWJA 1E4WL 2VH5L 3RI5K 1XGZA 3PPSA 1JPFA 4XN2A 3WJMA 1WQVT 2NY3D 3OKMA 5EU6A 4HF5H 1RCYA 4F9PA 1T4WA 3SKJH 2I25N 2YFNA 3RHWK 2BDNH 2BMKA 1I8MB 3FCSB 3MXWH 3PLYA 5AZUA 4BXVA 5I17A 4NGHL 1XZWA 2CGRH 1HHKB 3VFSB 4PREB 5AVZB 3CN4A 4WU7A 2YOAA 2XXFA 2IDFA 2BIHA 4Z5RB 5ALCH 3RTQD 4N8CL 5F3FA 3MC0A 4CBPA 3K2UH 1IRAY 5C0CB 1I7TA 1ERNA 3VFNA 4NQDE 4ZX3A 1IV8A 1JHTB 2YD8A 2W0FB 4NRZA 1BYPA 3CAFA 1SY6A 4HJ0D 4AJYV 3UTSB 3T6QC 1L6ZA 1X7TA 3AXLA 5IMLB 3OG6B 4M4PA 1PG7W 4L2YA 4NN5B 1A2YB 4S10A 5CZKA 5IESH 3H7LA 3NSYA 3DO7B 5HHQA 4JCLA 5CZRA 3WS3A 4RAVB 4FG2A 1UM6L 1ITCA 3VGAC 2ZYRA 3IN0A 4WFEE 3CFCL 3GNML 1SBBA 1R5IA 1WAAE 4GP8B 4LSQL 3EXJA 5INCB 3VMOA 4Z7VA 3M8OL 4D0DB 4LGSB 5DZLA 1BGXL 3CSPA 1NFIA 3MLVH 2DIEA 5DJYA 5CEYA 2LAAA 1UA7A 2IADA 3L3OB 4I9XA 1X4XA 1U8CB 5KVMC 4YWGL 1KEMH 5A16B 1TVDA 5HBBA 1B6UA 5KG9B 4XN5A 2FT6A 2PCYA 3SZKC 2QHLA 4LVNC 4DKFH 3Q3GA 5K59F 4ZS7H 3QNXA 4PRHE 4LESA 1QVOA 1KG0A 2DDQL 1OAQH 3IJYA 4M5ZH 1FWXA 1NFDB 3DURB 4NWTH 5IVXB 4MSWB 1NUNB 2CO4A 4MCYB 4Z78B 2JB5H 2BVQB 2V2WB 3UG5A 4FTVB 2PUQT 3QYCA 3NFSH 1PBYA 4D8OA 4NI3A 3VXSD 2FHCA 4MJ5B 1QABA 2FATL 4QJ4B 1CXKA 3HJEA 4OQTH 3IU4L 1XD1A 4RMBA 1VRSA 2VLKB 4AQAB 4ZXBD 3ZO9A 2YGQA 2YBGA 3CVHA 1H3UA 5D7SL 5DRNA 4Y88A 3TT1L 1EH9A 1Z9MA 2DKSA 4CRPA 3KLAA 4NYLA 2NNRA 2IMNA 3WN5C 1N6QH 2FB4L 5IMMA 4K94L 1Q9OB 1TZIB 4OZHA 3CZFA 2BP3A 3GFUA 3MNMA 4UM9B 4TS6A 3BAKA 5EOCL 3HAEG 4K3JH 5ADPL 1UYWL 4LAQH 3FZUC 5D7IF 3PPEA 2YAPA 1IE5A 4KQ4L 3DPDA 4ACPA 3BUYA 3ABLB 3CFBB 4GUPA 3DJSA 4ZD3L 4LDOB 1FNGA 1LTXA 1OB1B 1ZTXL 4R4NC 1NCGA 5F1SA 5FDYA 2QLYA 1L0XA 2EKJA 3KBPA 5SX4H 1BF8A 5GZNC 3MPCA 1AO7B 1BZEA 4KJQC 1MCHA 4KKPA 2OQJA 3II3A 4OIIL 1PKQA 4XMLH 3ZT7A 3JWNE 1BAFH 2H1LM 3MLZH 3SGEI 4AC2A 1B6DA 4KKRA 1G9EA 3A47A 3S3SA 5LBGA 2DEYX 3RVTC 1BZOA 5IB5A 1D5BA 2DM3A 3UBXG 4R4BB 2OCFD 12E8H 1EO7A 3V4VH 1SMOA 1G7HA 4JO2L 1CDBA 1RIVH 4CGUB 2HZHA 2AJUL 3Q1SL 1AQKL 5AAWA 3JV6B 5IG7A 3CC5A 4ZO7A 5E23A 2Z7ZA 2AHIA 1V7NL 5F96L 5SWZA 1NMCB 1Z9SA 2O5NA 3T8XA 3MJ6A 3VQ1C 3GJFK 1EEUA 5FHBL 3SGKC 2BM3A 4LBAA 4PJGB 1FH2A 3N5AA 3FQXB 1NM9A 3DIVA 2CGYA 4G80B 2R23A 2D73A 1REIA 1QRND 2LOEA 4MDIB 3VXPB 5EEVA 4X6DA 4R90H 3V0IA 3ARGB 1Z5HA 4P3DB