2JSFA

Solution structures of the envelope protein domain iii from the dengue-2 virus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and neutralizing antibody binding studies of domain III of the dengue-2 virus envelope protein.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
molecule keywords domain III of ENVELOPE PROTEIN E
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jsfA00
5B1CA 3C6EA 3UZVA 1UZGA 3UYPB 4UTCA 5JHLA 1SVBA 1RERA 1URZA 5IZ7A 1ZTXE 5GZOA 3N43F 4BZ1A 1TG8A 2JQMA 4L5FE 5KVGE 4FG0A 3VTTA 3IRCA 5KVFE 4AL8C 4BZ2A 3UAJA 1Z66A 5AAWC 3UZEC 1OK8A 5KVDE 4UTBA 3N40F 1Z3RA 5JHMA 1S6NA 4AM0Q 5AAMC 2P5PA 4FFZA 4X42A 2JV6A 2JSFA 2ALAA 3N41F 4ALAC 4GT0A 1OANA 4UT6A 2R69A 3UZQB 1PJWA 2V33A 4GSXA 5LBSA 3WE1A 2I69A 2GG1A 1OKEA 3N42F 3P54A 5H37A 2R29A 5IREA 3J27A 3J2PA 3N44F 4UT9A 5KVEE 4FFYA 3G7TA 2H0PA 3C5XA 3MUUA 2HG0A 5LCVA 5LBVA 4UTAA 5GZNA
chains in the Genus database with same CATH superfamily
4I8DA 5IESL 5DGQA 1NCDL 4I4WB 4ZS7H 4NQDA 3AXLA 4WI5A 2W0KA 2AJXH 1Q8MA 5DWPA 4NIKB 1ZANL 3T0VA 4XRCB 2Q9OA 1SLWA 4HKJA 2NDGA 4JX0A 3TEXA 4M7JH 1AAJA 2HLEB 4IOFD 2LFEA 1ZS8B 3IDUA 4QOKA 3RU8L 2QJDA 5JXAL 3IKCB 3RX7A 2XTJD 3GEFA 3SKJH 3MRDB 1P5UA 4FP8L 5FF6B 2Z93A 4HJGA 3ZW3A 1A7NH 2DM7A 2MIZA 5AYUL 5JXEC 4MQ7B 3AUWB 1EBAA 4NO0B 5J11C 1I1YB 2OR9H 2V5MA 3MBWA 4NPYB 2VNCA 3NGBC 4J8RA 1GJWA 4Z7QF 3WN5C 2DMCA 4FTVE 4I5BB 1YHPA 2BFVL 2AXGA 2VLKE 4TSCH 4WK4B 4KJPD 5ITBH 1DVUA 3VGBA 3DC0A 2XV3A 3KGUA 3RL1B 1BYNA 3E8VA 3ZDYF 1ACYH 4I5BA 3NN8A 5K39A 4ACTA 3N3EA 1E4KA 3IJEB 4BWTA 2ZUUA 4PJCE 4MQ7A 5IREA 1GGCL 4ZMNA 1R9FA 1GY1A 1V54B 4MMZC 4XBEL 4UF7C 1SRDA 2BNRB 3LS5L 2V2XB 1WRFA 1FL6B 4PJ7E 3HZYA 5HHXH 1AIFA 3SBWA 3LKNB 5DRXB 3RDJA 3BZEA 2ENJA 4MA8L 1WVZA 4XN4A 1ZS8A 4QOKB 1KYAA 1K8IB 4HX1A 5F71A 4C83B 4X5XB 2X6BA 3NEEA 3VI4E 2F1EA 4B0MB 1KDJA 3DX9A 1KTDB 3U9UB 5G5DB 2QR0B 2L4OA 4P46C 4L8CB 2XQYG 1LO5B 3QZWG 1PX3A 1MJJA 3KPOB 5IF0B 5ES4B 4P5SA 2RIKA 1WPCA 1XR8A 3L4WA 3CLWA 4JE4B 2Y7LA 4MJ4A 4AJWA 1U8CA 2AEPH 3APDA 2J8UA 1FO0L 3WU1A 3H55A 3U82B 1E3ZA 4Y8DC 3OQ3B 2OX5A 4TM9A 3DRTB 5FHBH 3OB8A 1GIGH 3GM0A 3TA3C 3CN3A 3VXSA 3PPSA 2Y1VA 1T04A 1T80A 4FMFA 4OGXH 4KV5E 3NZUA 4TUOB 3VWJA 2OMXB 4M8VA 2ZP9A 2NUTA 2PCFB 1YVLA 3MV7B 5KZCB 1H5BB 1XV8A 4P4KD 2Y6SC 3HW7A 1T83C 3MYJB 3R4RA 2FWUA 2KL6A 1AD0B 1S7TB 3APNA 1NGPH 4LARL 1RZ8A 3UIZA 5J13B 5GSRA 2B1AL 3UGEA 3PFUA 1VJSA 3HS0A 2WTRB 3Q6GL 2R1YA 4FEIA 1QACA 4NT6B 1T0NA 3O0RL 1SXZA 4R7VA 1P1VA 1P4BH 3NJLA 5FYJH 3VH8G 5H4ZA 2VDLL 4BFIA 2AQSA 4P3DB 4BWWA 3CZFB 1SEQH 4M8UA 4FQIL 4BSVA 2DQTH 4LEOB 1DQKA 5K9JL 3QEQA 3V4PL 1IX2A 3FT4A 4APXA 1FH2A 1QPXA 3MV7D 4JRFA 2D8KA 3EZJB 3OR7B 1DSWA 5LGHL 3EH5B 3MAWA 1A4JB 5GQBA 1JYWA 2EO7A 1AHMA 1C5BH 4Q6KA 1L9MA 5HI3D 5D93B 3PWPA 1P4IH 5E6UB 5GJSL 3DOIA 3GINA 1IRAY 1S4IA 3KPNA 4U7SA 4KWUA 2C7UA 3GKZA 1T0OA 4PJFA 4PRAA 4AGPA 3DPBB 5ICYA 1LP9E 4UQ3B 3CDYA 3KPTA 2HG0A 3MXWH 1CL7I 1NFDF 4WV1C 4HA1A 3UZVA 2F53E 2W38A 3BP7A 4HS6B 3TPUA 1R1CA 4CMHB 3SDXE 4ODHL 4ZW6A 3PGCB 3WE6B 2G4GA 2XUWA 1PLCA 5BRPA 1N64H 1P84K 2DQUL 4HJJL 2VLRE 1FFNA 1AO7A 4FG6D 2ED7A 5IT2H 2X4SB 2GSIB 4K5PA 3SKJL 1J0ZA 3V7AE 4HUUA 4YHIA 4B9PA 1P4UA 3FH5A 2NW3A 3U7WL 2FBOJ 1NCNA 2BOBA 3V0DA 4Y7OC 2YUWA 2ZJSL 3V0WL 1HI6B 2QPUA 5E4EB 4NRZA 4HK3N 4TOYH 3RJDA 2DZEA 2TSAA 1QTPA 2ZG3A 5KW9L 3MXVH 2XCMC 2BNQD 5I5JA 3BE1H 4M1GL 3C2AL 5L88H 3VB8A 3QXTA 2WLMA 5F7YC 4FF9A 2GCYA 1SOQA 4IKNA 4R4FH 5JIHA 5DMGD 3L95A 4YSPA 2LVEA 1QSFA 1G7PA 1P0SE 1U33A 2ZKHH 5AVZB 5LVEA 3ULVF 2YEQA 3RVTD 4JQXC 4K55A 1UYWH 1XBRA 2IADA 1P1ZA 1H8LA 2HRPH 3DDFA 5AFAA 1TXKA 3Q8BA 3AS1A 2VR7A 3CHOA 4UOW1 2I27N 1VEPA 1SMDA 4H8QA 1KXQA 2EXTA 4HT1L 4GAGH 2YAHA 1U8MA 2DLIA 5J0BA 1FG9C 3H9ZA 2EXYD 1BGXL 3IDJA 4A2MA 5BZZA 5FKAB 1RHFA 1ET7A 2YAMA 1WUNT 1E9QA 3LRMA 5DUBB 3IDGA 2CA3A 1U8PA 1CI5A 3O2DH 1UVQA 2BHFA 2FLMA 1YJDC 1HSBB 3DX7B 3O2DL 5B8CC 1KJVA 4RGNB 2GIYA 4M5TA 3MLZH 1BLIA 4WFFE 4I1NB 4PRHB 3CC5A 3MGOA 3MMEA 3NJGA 3CFIC 3PL6A 3F7KA 1IGTB 4KY1L 1KGUA 1I8AA 5A3IC 4WWKD 3BZFB 2P8LA 1BM7A 3ZLQC 1HC1A 1MELA 5DQJA 3P40A 3QUMA 1KCUL 1FDLL 1BZ8A 4AGMA 5CBEB 4M7KH 5SWZD 1MVFA 5EC1A 2J73A 1F90L 2FRGP 2WUCH 1OSZB 3ZHLA 1XGPB 1G6RB 4XAWL 4PLOB 3RURA 1CFNA 5GIRB 3Q6FB 2M83A 1KBKA 3AGWA 2D73A 5KVDH 2MHAB 1NC2B 3DSNA 4YXLL 3UROR 2KPWA 5I18H 4B9GA 1AC6A 4EI5C 4EBQH 2AABH 2P44B 3OLEA 3TU6A 2BRQA 3UTTE 4NCDA 1DQJB 1RULL 1KC5L 4E42A 4F7PB 4FRWA 4NN7B 3MZTA 1A25A 4QGTA 5DRNA 4MD0B 4PB9L 3HOGA 3FONB 1XCQB 5TDNA 5M7QA 2VDRH 3KJ4C 4YHPA 3KLHC 1NAMA 5AD0A 4HKJB 3WNIA 4K94H 1DL7L 1YDPB 1NIDA 4HIEB 3O2VL 4HIHB 4XN2A 3VNYA 5AW7B 3QARA 3AQYA 3D0LB 3MXVL 4X4XA 1N8ZA 3O6FC 4PJDE 5H94A 4CAGA 4JKNA 4HMEA 1KJ2B 2LVCA 2WLKA 1ZJAA 4KC3B 1N64L 4ETQB 3KYOA 4MCZA 3CHSA 4XCCH 3D69B 4KO6A 4PB0L 1AG6A 4HIIA 4JDVB 4ODUB 1ZLSH 3TH3T 3VFWA 3K1KC 3VFSB 3ZE1E 1SBBA 3AB0C 3KMDA 5IMKA 4E9XA 4C58B 4IK6A 1CTOA 3F7PC 3ARDD 5DD6A 4FQCH 1DUZB 1EHAA 4YE4L 2HG5A 2O6FA 1D9KD 4XPTH 3L48A 5HGDA 1JXJA 2B4CL 3WKMH 1DBJL 2C4XA 2YWZA 2X6MA 3TESA 2NXYC 1KELL 3MO1A 4HJIA 2XN1A 3GMMB 2BVQB 4NSKB 3VYNA 1YMHB 4TLUA 1UJ3C 3II1A 4HMCA 3IXAA 3JXAA 5HPOA 5EUOA 4EIUA 4OTXL 2FE0A 1YUHA 4PJIB 3EFDL 2XVGA 4Z78B 2ZWLT 2YAQA 5ID1B 2X1OA 1KBPA 1FFPA 2CO7A 4OM1L 4DOHE 2EVFA 1RY7B 3WXWL 4X5RA 4YGAB 4GBXD 2FD6L 2ZAIA 3KBFA 1UXWA 3WHXB 2UV3A 5CD3A 3CFTA 4ZAKD 1KCWA 3G5WA 2YS4A 1V3LA 1F86A 2PR9A 2XDHA 3ETBF 5ADPH 2VLRD 2D9CA 3QI9D 3RILA 3RJQB 1YC8A 2CDGA 1I3GH 4PS4H 4BUGA 1S3KL 5K9KA 1ZANH 3MGTB 1IKNC 3S34H 5KEZA 3NCBB 5IB1A 3FF7A 4GQ9L 4FHJA 1O9VA 4MMXB 4QRUA 1E67A 4OGXL 5DYFA 1GVIA 3IDMB 2ICCA 4HC1H 4P57A 3DGCR 4FQ2H 3HG1D 5J8OA 4QY8B 1FGVH 1TCRB 3V0AC 1UWEL 1GHFL 4X83A 5BV7L 5T1KA 1XAKA 1GW0A 2VDQL 2YUVA 4MS6A 1ORQB 2FX9L 3ZN6A 1DSYA 4KVCL 4KXBA 4EQ2A 4WEMB 2Z9TA 2AXWA 2MFNA 4KHXH 2J43A 1A7RL 1DVQA 1FZOB 1PIFA 3RX8A 3UTTD 5EOQL 3B43A 4NQSB 4UAOC 1U8NB 1YMMA 1IFHL 2WINA 1SBSL 1B2WH 4ONOA 3GBDA 4MXVF 3L3HB 2KT6A 1CK0L 5D1QB 2UZXA 2JIXA 3F3HA 1P9MC 1QI5A 4J3OD 4YXHH 3X3FL 4FYSA 4HKZB 4MMXC 3FH7A 4CILA 5F3BB 1VEOA 4LPVA 5C0AE 4MRBA 3L9EA 3FTVA 5C2BH 3PHOA 4KKRA 4XOCA 3F58H 1DZBA 5I8EB 1RPUA 1Y0LB 5IOKA 4ERSH 2FSEA 3PWUA 4MVBC 1QSEA 1TZOA 1LK3H 2ORBH 4OLEA 5DO8A 4EI5B 3OKEA 3LIUA 2ATPB 2R29H 5IVZB 2ZUWA 4OZFA 4ABWA 2CJTA 4CSZA 4N5UA 3IN2A 1Y18A 1EDHA 3AABA 4QXUH 5E00B 5GS1A 1F6AB 1NMBL 4LLWA 1IC4L 1EEQA 5CGYC 5ICYB 5E7FA 1JPSH 1BZ9A 5KS9F 3T65A 1F4XH 4ELMA 3ZKMC 5EU7E 1CD1A 3LNFA 3QQ4B 3GMLA 3MUJA 3FT3A 1MHPH 4WWPA 3WXVH 4R0LB 5DYOB 1PPIA 4XMLH 5A7EA 2OJZH 1H19A 5T3XE 1HJBC 5F7LB 2ZUYA 3DUSA 2BP0A 1M3JA 4H8PA 2R39A 3O6ML 5C0EA 1CL7L 3A4FA 2AQ2A 2EXSA 1OGTB 4JGUA 4RGNC 1IM3B 2ZUXA 3LYRA 1C5DB 1NPNA 2G3ZA 4C56D 3SD5A 4CBZA 1INQB 4UNIA 5CEYB 1H8OA 2DQ6A 1TSHA 1OGTA 3FSVA 2D3VA 1LO2H 3IMTA 1U8IB 1EEUA 3EDFA 3ARFD 3P11L 2A0LD 2VO8A 2LR4A 5TFSH 3KCPB 2YO3A 1RZJH 4ZOBA 1P5VB 5IBLD 1M7IB 4H26B 5C6TL 2WZPA 1ZXQA 2QPDB 5IB4A 3E6HA 1TZGH 2VSCA 2I7OA 2MCMA 5D7LA 2BNRA 1XZ0B 2J3SA 3BCFA 2VDKH 4Y4FD 3RBSA 4CN4A 4M61A 2J7LA 3UJTH 3QIWC 4OLXH 5IQ7H 3C5ZA 5F6IC 2IG2H 3AWEA 4ZFGL 2WB1A 5T1DH 2X4TA 1CF8L 2OCFD 3GBNH 2AZUA 2EO1A 5ADOL 4Z7NF 4DGWC 3F01A 4XPBH 2WQWA 3LSOB 5C08A 2WCGA 5CJBA 4AVIA 3UPRB 4U6YB 1MCWW 2V7HA 4HGWA 5F0JB 2JKWA 4HPOL 3TBVB 4PJAB 3MV8A 4Z0BL 4ZSOB 43C9B 2I5YH 4YUEH 3G08A 2OM5A 3O0RH 3NCEB 4UQBA 4JJOA 4RDQF 1ICTA 2X9ZA 2Y22A 5I0YA 4MCZB 3C5ZD 1P5UB 2M26A 4F1ZA 2J72A 3GMNA 5FYKL 1R3IH 1M56B 1J8HD 3ZL2A 5AENA 2O30A 5J89A 2J88L 5DFAA 1F3JA 1CGUA 3OKLB 1ID5I 1PEWA 3L2LA 1V10A 4XNXL 4Z7QE 2X10A 1P7KB 4HD9A 1INDH 1CZ8H 3FO9A 2YPKB 3A67H 5K9QG 1ROWA 2Z1KA 1LO0H 2AEIT 2G0LA 3UMTA 1WIOA 2C3WA 4JLRA 2NY5C 4X5XA 2KERA 3MR9A 4R90L 5ISZD 4PTUB 5I2IB 1GS7A 5GHWH 2E7LC 5LNGA 4KRPD 1FL3B 2WKGA 3Q2CA 5KBNC 3V0HA 4GXVH 3CBKB 4HXBL 1SEBA 3VFPA 4HEME 4MFHA 4XC1L 3DTUB 1A14L 5TDOB 1BVOA 1DHKA 1F6LL 3IJSA 1PBYA 2WUBL 4ONHA 1J88A 3M7OA 1S7XB 4RA0C 1CE6A 3DVGB 5DI8A 1QQDB 2W07A 2ENYA 3VDCA 3QRGH 1CGTA 1UZ8A 2H7WA 3MC0A 3EZ8A 3WNKA 1KB5B 3RWEB 2F5BH 4NO2B 1FYTD 4BFEA 1OW0A 3HUJA 5EN2A 3RX9A 3O6KL 3WTUA 5H2BA 5BXFB 4GIPD 3KPRD 5KVDE 2RGSA 5DJCB 4L1BA 4P3DA 2GJZA 5IR1B 1H3GA 3QFDB 3OHXA 2C9AA 2MOGA 4KDTA 1D5XB 1QFUL 1TO4A 3T2LA 1CUOA 2O1AA 4P2RB 5EEWA 4KKNA 1S9XA 3P9WB 1GOHA 2QHRL 3VD2A 5DA4A 1QFOA 4L9LC 3HS0B 1MAJA 1ZGLM 3QC5X 2UZPA 2VWEC 5EF2A 2ODIA 4D9LL 2IV9A 4HZLB 4X4XB 1AYOA 4GRWB 2ZQKA 4RWYH 3RX5A 3ABMB 4LSTH 4OH2A 2HXAA 4TNGA 1KIPB 3EYQC 4JFWA 4QTHB 4WJG3 4KV5F 1FBIH 5LXVA 4G9DB 1K4DA 3HZVA 4X9BA 2VR8A 4ZBJA 3EOYG 4ODHH 1Q9KB 1R3HB 1YECH 4NFCA 1ZLVK 1EO8L 1OW0C 2EYSB 3JVGC 1SYVB 1NLBH 1A1NA 3VACA 4NUMA 2K3HA 3DVGA 2R69A 1M05A 2C9UA 5J6GB 1ET8A 3GIVB 2OKMA 3BPCB 4MA1C 4OD2B 4X7EC 2WUBH 4BSWA 4GW1A 4LOEA 4HPOH 4JDZA 4TUKH 1AY1H 2A83B 3VXPA 4GG6F 3IJHA 1HH6B 1KB9K 2JQZA 3D52A 2EDMA 5J6GA 1C08A 1JUFA 5GGSY 3QYNA 3TA3B 2WAHA 5DK3A 1RPKA 2RFXB 3H2PA 6PAZA 3M8OL 5CD5D 4P5TB 4UTBA 2OS7A 3QQ9C 5B3JF 2YD5A 1EEZA 5JUEL 4R96B 2X3BA 4DN3L 1OCOB 1U9KA 3QVAA 4ZXBC 5I0XA 1TT6A 3U46A 4NKIL 2BY3A 3PUCA 1CF8H 1MLBA 1MZZA 2P5WA 3BSZL 3GBNL 4R4NC 3WJJC 4B9FA 5C71A 3O6LH 1JZGA 4XHQA 2CO3A 5DHVH 1OSEA 8FABB 5ESQA 5LCVA 2MNWA 1VADB 1C8PA 1VFAA 1O6TA 3HIZA 2YIHA 3SO3C 1G9EA 2G9KA 1OOAA 3MRCB 5I73B 4PJ7A 4Z76A 5EOTB 5L2KD 2Q10A 4P99A 3QQNA 2XZQL 4FTVD 3KYAA 3P0YH 2G3NA 2Y36L 3FQNB 4YSOA 1VGKB 5I16B 1G9NL 2H6UA 3JSSA 4K8RD 1G7PB 1U93A 3ALPA 1UFGA 1U8KB 4MMZB 1J05A 2B59B 4JFDA 3BQVA 3R0MA 4RMRA 3ZDWA 1MIMH 2UZYA 4NRYA 4Y19E 5CEZE 3CFJB 2CUMA 4YDZA 2QQNL 3U48A 2BWQA 4NKMB 5AW2B 5CCKL 1A5FL 3DGDA 1JP5A 3E7JA 2BWDA 4LASL 5KANI 2GY7B 2GT9B 5I15L 1OP9A 1JE6A 1KXTB 3HN8A 3U1SL 2VDPL 2P8MA 5DEGA 2OP4H 2FTAA 2NPLX 2JJSA 2J8UF 2NY2D 4EUPG 2EACA 3MRDA 3DETD 3MMEB 1TTUA 1I8LC 3KWXA 5C0ND 1N6QH 1VACB 3OC5A 1P5VA 4MDIA 4ZUUB 1EMTL 1ZHNA 3LXUX 2YGVA 4L2YA 3VVVA 1HQRA 5IHLB 5E6IA 4NOBA 5ITFA 1TENA 4FNUA 2ZCKH 1MJ8H 3NIGE 4X6EB 2B5IC 2QQQA 1YEDB 3QQ3A 5E24E 1JYVA 1XL4A 2JB6B 1BMGA 3FB6A 4X4MA 2CHDA 1Q9WB 3TTSA 5GRUH 3W39A 2EJ1A 4UOW0 5F2FA 3EJYC 3QIWB 1MHEB 1FPTL 1GAFL 3P9MB 4WO4A 4FXKC 1A6ZA 1KC5H 2CGRH 3B9KA 3VI3A 3V6FA 3LH2H 2ICWB 3V55A 3BIBX 4GLRI 4C4UA 3F6JA 1YEJL 3VA2C 2I32A 4UYQA 5I9QB 3AROA 4XNYH 2CRZA 1SMOA 2EDQA 2XI9A 1OTUD 3F64A 3VFRB 1P6AB 4P46B 1O6VA 1U8HA 4PCSA 2R2HA 1TJHL 5TK2A 2EEFA 2B14A 1CLYL 5FUZL 1ZLWK 5E08L 4JFQA 4KK6C 2APXA 1UM4H 1SJVA 4AJYV 1SN5A 2UUDH 2XN9B 3ECBB 5CGMA 4J4PA 4JFXA 3AACA 4AQ1A 1CU4L 3MRRB 3MLRH 3WNLA 3VXRD 1PYWA 4LLAA 4MYPA 4ODSH 4QRTB 1B4JH 2XV0A 2D7TH 1IM9D 4P2QA 5DD1L 4N8VB 3UH8A 3DHUA 1JGDB 3PV6A 1GOFA 1UOWA 2P1YA 4JRYA 2Z34A 4PI0A 5GSRB 4NLAA 2V17L 4O2EA 2EDDA 3MRGA 5ESAA 4HIEA 2W9EL 3VGAC 3HHRB 2EDJA 2BHUA 3SDDB 4NS0A 5DZPA 4Z7VF 3WTTA 4LGPB 1LMKA 4JQIH 4EEEA 5KJ7E 1X6LA 5FOBB 4OM0H 1A7OL 1WD8A 1FZMB 1AXSB 1TZGL 5TF1L 3FQRB 3TH2T 3C6SB 3RRQA 1UCBH 3HLAA 2ZF9A 1JERA 4J3UA 5J9PA 3RWCB 3NIDE 4IRSC 1XGYL 1RZJC 3SIKA 1WA1X 2FQGA 3MBEB 4HT1H 3WLWC 1RU9L 2UX7A 3EO9H 2VM3A 2ZOWA 1JPFB 4FKEA 1OAQH 2E4FA 4OZIF 4CSPA 3U4BL 3LV3A 2QELA 3O2WH 4MCYA 1FVDB 4IRSB 1UWXH 3WG7B 4C55A 1A7QH 5KSUB 2BXYA 2JCCE 1YEKL 4U33A 1AKJB 1NEZA 1W91A 3C9NB 1PZ5B 4X4ME 4JQVA 2DV6A 5FM5O 3SE8L 3KZ8A 2A74B 1SHMA 3NIFE 3EDDA 4PV9A 1QP1A 3LIZH 1SVZA 2DIBA 3QDGE 2FWLB 3CXDH 3QORC 3TNNB 3V0GA 2MQ0A 2WIMA 5I74B 1A64A 4N2HA 3VRJB 5F7UA 1MFCH 2NY3B 2IXQB 1MQKH 1OEZW 4K9EL 4U7MA 5E99H 3D2TA 3FO1A 4MXVE 5EU6E 3N42B 2Y07L 3F5WB 4K4KA 3ZZQA 1PG7X 3HRZA 3E9TA 5A2AA 4MXQC 1JNHA 5T1LA 4QKXB 1FV1A 4PJGA 4OLYL 5AW3B 2ZXQA 1M6OB 2EXWD 2R0ZL 4P5TA 1ZSDB 4JO4H 1CR9H 2HFTA 2VLLB 5I76A 2WNGA 4PG2C 3CFMA 4LDCA 4L8BA 5KTEL 1QBLH 1B3JA 3RB5A 2BC4A 1RULH 2H8PA 2JIXD 2VSMB 4L8SB 3ZSTA 3C12A 3T0EA 2B1HH 5HJDA 1NC4B 3IFLH 3RNKA 2ADFL 1F45A 2OMZB 2D4FA 4HIJA 1NIFA 4G43B 2VXVH 5J6SA 3GFUA 5AVWB 3D39A 4CSTA 1M6OA 4W1TA 3WTWA 2NYZA 4UIKH 4NO5B 2P5EB 3LXCA 2YMOA 1DL7H 4PJFF 3CSFA 1KCRH 4NZRH 4JY4B 2D7MA 3T09A 1JOIA 4WTZA 1FYTE 2JELH 3NZHH 3K0WA 4FD0A 4FZ8H 5HGGS 2MCAA 4YEFA 5LWYH 3AWFA 4K07A 1HL5A 3EYUL 2IXQA 1A3LH 5D7IF 3LPFA 4Y4HC 2X1XR 3SDAA 2XJLA 2E9JA 5LJYH 4N8UA 2Y7NA 1CIUA 3PLYA 2VMCA 4FQJL 4U0QB 5I8KL 2C9VA 4ECNA 5I82A 3GXNA 3F6IA 3GSWB 2B0SH 5CJ5A 1GYWA 3EO0A 4WW2A 1FG2A 2FX7H 4O4YL 1I7RA 4WSKA 2ZX8A 5D1ZA 4DSYA 1YYML 5IBUG 2CLVB 4CVUA 1YLBB 2WXMA 4UIMB 1CD9B 1PF3A 1EBPA 2YPLA 3OMZA 3IDGB 4CVXA 3SGKC 4D0CB 2WQRA 3DXAA 3VXNA 4RESB 4MNQB 2OQJB 4U2ZA 3ZKXB 2AJUL 1Y07A 4HU8A 2I25N 3O11A 3DUSB 1K72A 2A6IA 1IGIH 1XSJA 3OL2A 1I3VA 4XMKL 1JYXA 2EICA 1HHHB 4X80H 4NXKA 4RFNC 4ZOEA 5C8JB 1XGRA 3B2UD 3QUXD 3SYPA 4B27A 3OM3B 4OSUH 4PYGA 4NZ8A 1CU4H 1CYGA 5F6HJ 1EA9C 5F1KC 4AVJA 4PRHA 4AY0A 3FH8A 4YHMH 1JRHI 3TA4D 4DVBB 3PL6B 1VDGA 2O61A 1SJHB 5JIDA 2FJFB 2YGPA 2A74C 1NBYA 2BCKA 1MWAH 4MS8D 3U7AA 2XVKA 3Q5OA 3L1GA 4WW2C 3BFWA 2YD0A 2X2JA 1R46A 4QNPF 1DQQB 4WHTA 3WO3B 1MFDH 1ZT1A 2O5YH 3ETBJ 4AENA 1CWVA 1SYSB 2CBPA 3MV11 2AMGA 2BS9A 2BM3A 5IJDC 1NCWL 3MLVH 3GQFA 1N4XH 3D2UB 1B3IA 1F97A 1C9SA 2WD0A 5IROA 3NCYP 1WV7T 2ZSWA 2EYRA 4KXAA 1E0OB 3D2UD 3I2CL 3BKCL 4ZSOA 4MA8H 4BGDA 1J10A 4PTTB 4NN7C 5MHSE 3RVUC 1I8KB 1JVKA 1CD1B 2XN9A 4WGWB 2FYYB 4XXDA 2VXVL 1UCTA 1VGEL 2N7SA 3HHSB 4HUCA 2OL3A 1ACYL 4GXFA 1R5IB 5B1AB 2WVVA 3WIFA 1PNCA 2Q8BH 4G3YH 3ZQ9A 5CEZD 1D5MB 5FHAH 1H9DA 3FPXA 4J3SA 3HHSA 5EORH 2J21A 4N68A 1XX9C 3LKSA 5E2TH 1Z9NA 1TU2A 1XSKA 1A3LL 3GZQA 4PG2A 5F9JB 4FYTA 2VRQA 1CT8B 2PMZA 4WSJA 2WLZA 3CUPA 4HXBH 2K6WA 4BK5A 1F18A 5E5UB 1QLRA 4MLSA 3AC0A 5DRZB 4CL7A 5JORA 3CAFA 4NZUH 4XVUC 4NLHA 5DMJB 1R24B 4CMMB 1B4LA 3VRLF 1DJYA 5IW1B 2YPLE 2RALA 1E7UA 4URTB 3THML 3VG9C 4NC1E 4JO8A 4R4BA 4W4NA 1A66A 3LZPA 3VFGL 5CD3B 4IBSA 5LGHH 5C07E 15C8H 5ICXB 3NSXA 5AOJA 1FZKA 3CDGB 2GBUA 4B97A 1S7UB 35C8L 1MCLA 5EULV 4KQ3L 5IJVB 3ILDA 4HUNB 2YAEA 3V8CA 2NY4B 4DAGL 3SBQA 3QDGD 3DTXA 5AVRB 3ARGA 4Q9RL 1I75A 5HJ3A 1EXUA 1FNGB 4JZJB 3TBBA 1EHNA 4NNYA 4XXWC 5J6HA 4PJBE 1DBKH 4PMEA 4WVRA 4YHML 2DMGA 2MTAA 3ZTNL 4W9ZA 1GPOL 4NJAH 3D39D 2OR7A 3CFNA 3L3KA 5BCAA 3UBXI 2N4IA 2OMXA 4B9KC 1T66C 3QDMB 2IMMA 3MV9D 3OKEB 4JMXA 3UFIA 2E9BA 1I1AD 4DN3H 1UWGL 2QTEA 1RZFH 2DQFA 3OPZH 2JJUA 1RV6X 2XVLA 1G7MA 5EWIL 3VXQB 5EN3A 3GD1C 2WBWB 2VDLH 2EVHA 1U8CB 3MRBB 4BZ2H 4D8PA 1DCLA 4IEFA 3KYKL 1OM3L 2JIXB 3IF1B 5C0GB 2XQBL 2VLLA 5I76B 2DM4A 1FL3A 3T0XA 1U30A 1A1NB 1K9TA 5ABDE 2G5UA 5JIQA 3IPFA 5EA0H 4EQ3A 3KLSA 4D8OA 5T3ZH 1QYGL 3BN9C 2IGFL 4A2GA 3EUDA 3WE6A 4PJEB 2GK0B 4O2FA 5BUAA 2AHIA 1ECYA 1J86A 3BPNB 3RGVB 1TCRA 3UZEA 1QO3B 1OSYA 1Q1PA 5IMMA 1W0WA 4ZNCD 5DGRA 3L16A 2VQTA 4Y0GA 1E6JL 2BDNL 5GPRA 1BG1A 4XNMB 3B2XA 5KVGL 5F1NB 1BQUA 5FECB 5MERA 2DLHA 2ZYRA 4PJCB 5EUOF 1WAEA 2FAUA 1OB0A 4FULA 5SWSD 5I1EL 3QUMH 4Y4KC 3LXBA 1PG7H 3S6CA 4PSPA 3Q3GB 1JZEA 4RMVA 3BKYH 3UC2A 1AE6L 3QULB 4YPGB 4X98A 5LBSA 5K9OA 2DM2A 3LH2L 2OSLB 4B3VA 1FE8H 3MJ6A 4U1IB 4L37A 4WHYG 1U93B 4APXB 1OCWH 1ECZA 1HINL 4GRLC 5EO0B 4AVKA 3ZDYE 4ERSL 3QW9A 1PSKL 4KUZL 1DLFL 3LDBB 1MJ7H 4B9CA 4IDJH 5HYJB 3BC9A 1CFBA 1NOLA 4BZ1A 3QUXB 1N5AB 2R4SL 4XNQA 1LILA 4GXVL 3FB8B 1V3JA 5DQDL 5C0CA 4HWBA 2GSGB 1U21A 1ETA1 4NQCD 8FABA 3GMQB 4JG1L 3G5YB 5AW0B 5SWQA 4NB7A 5HYJD 1MNUH 2XKNA 2HT2C 5EO0A 5FYLD 4MWFA 2KQNA 3FB5A 1VZIA 1N6QL 1D5ZB 3O81A 3OHMB 4JFFB 2EZ0D 3KPLB 3MSPA 1BBDL 2H6PB 5HI5D 4P3WA 1UA7A 4AGLA 1QPPA 3DSFH 2O5NA 4X4YB 3WUWG 2DQMA 2VO5A 4JUTA 5E9DB 2W9EH 4ZNEA 3HFMH 5GRJH 3MBWB 2VDKB 3VU1A 4PVBA 4ZMOA 5DZAA 3FMGH 2LU5A 4KO9A 1GGBH 1JXKA 5FF6A 1UJ3B 3D48R 2WJ7A 1G87A 5I1GH 1ZVSB 4UINH 5BZDB 4FE9A 1YN6B 1AQKH 1NGYB 2P80D 4FERA 1IC7L 3L3GA 1JWSB 1MH5B 3CFQA 1IBGL 3QNZB 5GGSB 1XGYH 2Z4TA 4WJ5B 3E80A 4AYSA 5IESH 2VDQB 5GZOC 2R8SH 3BQUD 1BLNB 4Y7MA 3BDYH 3HG0A 3LNDA 5CU9A 2XACC 3S2AA 3SGJC 4YHYC 4JRXE 4MNHB 1HYSD 1XIWC 2YPKA 4OF5A 5GGQL 1BM3H 2BERA 3C08H 3EYSH 4JM2B 1F1AA 3D30A 3N41B 3QIBD 3HG5A 5DDHA 3HZYB 1PGRB 1OL0A 3D5OF 1I8LA 2N56A 1ZTMA 2VXTH 1T5KA 2NLJB 5C7ZA 4FHKA 4PI2A 4XTRD 3P3TA 1MCFA 3W39B 4ZUSB 4A6YH 3CSTA 4Y4HD 4XPGL 1I9IL 4ZFOL 4JFXB 1G9ML 1UCBL 4CU6A 3G08B 2Y6TE 5IW6B 4MA3A 3NRQA 2DPKA 3SQRA 3M8OH 1HL9A 4RQQB 2VLKA 3SEPA 1E4XI 5CLWA 1Q0YL 4F9LA 4Q9QL 3CVIL 3AY2A 3Q1SH 3QDMD 4A38A 2PCYA 3JTBA 5DZOA 2YPVL 4MDIB 4N2CA 1R24A 1X9LA 4ZXBD 1I1AA 5F9OL 2AJSL 2A9DA 4IU3A 5PAZA 4NNXB 2C3XA 2QHRH 1WZKA 3HJ0A 4OLWH 3NGBB 3NK4A 3S48A 2Q20A 9CGTA 2KC0A 2HFEA 1JK8B 1SF3A 3FYEB 3K2KA 3DX6B 4BZ1L 2OMUB 2QSVA 4E9YA 1XZWA 4GQRA 2BXZA 3ARVA 4E5XG 2QTVA 4KFMA 4NKOA 2V5RA 4NQCA 3DI3B 1KGWA 2HJKB 3L5IA 4PJEF 4QHKJ 4DW2H 4N2LA 2VUYA 1PG7L 1UKQA 2GHWB 2Q8AH 4M93B 5HVHC 4KKAC 1WFTA 3VFOB 1IT9H 3P02A 1U95A 4G2AA 4OFQA 4XB7A 2VYRE 1KCRL 2KLRA 4NZRL 2PNDA 1FJ1A 1RHHA 1AHWB 1LP9B 1PSKH 4KUZH 3SPIA 3M1BA 4X8XA 3PIQB 4L3AA 2VQ1B 3L81A 3Q44A 1YEGL 5AAWC 1EFXB 4WQOA 3H8NA 2ZYIA 3EH2A 1DQDH 1IVLA 3LQAH 2IPKA 2XBZA 2PW2B 3RWCA 4QRRA 2JWYA 1UM5L 2NOYA 5E70A 1HKLL 3GXTA 4UILL 5CINH 5DJZA 5MENB 2EH8L 1XCTA 2ARJQ 3GRWH 1BQHA 2N1KA 1GR7A 2DYPA 3TN0B 2R29A 3HHMA 3MUY1 3MUGA 2IANB 2AMUA 4L1SA 3B6SA 5T1LD 5TGBB 3O41A 4ELKA 4NRYB 1SHSA 4BXVA 5IMLB 1AZNA 4PS8A 5HGDB 1B9ZA 1UZGA 1NWOA 2Z8WC 2P42B 3MRQB 4ANKA 3P4NA 2G5BA 3I74A 3D12B 3GTNA 4Q6IB 2A83A 4QEGA 1FVEB 1IAKB 2G2RB 3KPNB 1VCAA 4H0HB 3H7BA 3R8BB 3L3OA 2OMWB 4JFOA 1FNLA 1FLRL 2J6WA 3BPCA 3UBHA 4S1SL 2K7QA 1SM3H 5J57B 2EE2A 1UZ6E 4AI7A 4F37K 4XCEB 1A8JH 3B2DC 4FQIH 2VIRA 1AQKL 1XD0A 1FIGL 1YY9C 5I66A 1ESOA 2GIMA 1MCJA 2YQ2A 1HAUA 1H3PH 2F18A 4GI6A 1TSRA 4DGVL 1UM6L 4JJ5B 1WF5A 4WI4A 4K71C 4XPAH 3CE1A 1JL8A 2VLKD 4H2CA 5D7KD 1EEZB 4NZJA 3BUQA 1OK8A 3MNWB 3CNKA 5FGCE 2X40A 4NYLA 5ETUA 5IY5B 3CFBA 2VRKA 3FUNA 1XCTB 2UY7A 3K80A 2Q7YB 3T0AA 5JMOC 1C16B 4UT7L 1KEGL 3ML9A 4KJQC 3IXAB 4BGLA 3D0AA 3MNZA 2ZG2A 1X4XA 3T0EB 1S2EA 1U6AL 2KDGA 4NCC2 4ES8A 4O58H 1WIUA 1JWUA 1U8JA 4GS7B 2H41A 4AQEA 2EDEA 2QGEA 1RZIA 5JPNB 5GZOA 1INEL 4MZRA 4BEIA 1EAPA 1HWWA 2AXJA 32C2A 2PCPA 5BVPH 4DCQA 4H88H 2IAND 1E4WH 5LGJB 4ZW7A 4EI6B 1FVCA 3VFTA 1I7RB 2BVPB 3OB0H 2JJWA 3PXLA 3O9WC 3MLXL 3Q5YA 4LL4A 2J56A 5D4HA 4WGVB 4HX1B 4C83A 4BKSC 2BJMH 3L7FA 4ZMQA 4HCIA 4M4RB 1MHPL 4DIXA 2IIJA 3Q2LA 3ZE0F 4U7KA 1K2DB 3T77B 4YDKH 1N19A 2JQAA 2DBLL 3LHAA 1JV2A 1MY5A 1UD2A 3SDAB 5DS8A 1BXAA 3ZIYA 3FCSA 1U42A 4P2QE 3OMIB 3IVKB 4LRIC 2YRBA 3EHBC 4CU7A 5DK0B 4WGKA 5IG7A 2DWEB 1BD2E 2AQPA 4LCCA 2W1NA 1IGCL 5MP6H 3G3LA 1E5ZA 5F7MC 2MQCA 2ZP8A 3WSQL 3ULVE 3FRPG 2H2PD 1OD9A 4F3FB 1DZ0A 2J6EL 4N2BA 5JLZA 2Q76B 1HNYA 3LZQA 1MH5A 4E41D 3DVFA 4DVBA 2CU9A 4LAQH 1JV2B 1AS8A 3A6BL 3D3VE 3O3AB 2VLJE 3HR5A 2O5YL 2AVFA 2IGTA 3Q3GA 1HEZB 1W16A 2LLGA 1SLVA 3N55A 1YMMD 3QXUA 1JTOA 4HGKC 2ESVD 4KAQL 5DHVA 4PRBB 2ZSVB 4HLEA 4O51B 2DQHL 3ATEA 1KZQA 3QXAB 1BOGB 4PHXA 2X09A 4X2UA 5SWSE 2TRHA 2W9LA 2JSFA 2MCPH 4OCYH 1TJIH 2B77A 3DSNB 1V3KA 3D4YA 4FNSA 4GBXC 2NY5L 3VJ6B 1E40A 3RA7H 5MEQA 1OOWA 5J06A 3MLSH 5J3HD 2ZPKH 3K74B 4E41A 2Z7YA 1MCRA 4ORGA 3TA3D 4QRQB 4OVVA 4Y1AA 2X2UA 3FCSB 4IU2B 3AT8A 3VFUA 1QKZH 2XPGB 4OAWB 3G5YA 4ZUTB 2KLTA 3K6SB 3U30C 1T22B 3FQRA 4BRJA 3KCPA 5D7IB 5I1KH 5D72H 4DEUA 3AXHA 1VERA 4NRXA 3RL2B 4H20L 5GS3A 4DTGL 3ULVC 4AQ1B 3BP4A 1MCOL 2ISDA 1U8LA 3PRZA 1IKFH 1V5JA 4CKVX 2ZWNA 1OD7A 4MHHG 1WWCA 3Q2VA 4ABQA 2MNJB 3NRFA 2CDEA 3ABLB 4J3OG 4TF4A 3VWKB 5IBUB 4G8EB 2NY7L 2EEAA 1T83A 2IANA 2IGFH 3S34L 1LGVA 3C6LC 1IBYA 5IMKB 4KH9A 3UTTA 1LEIB 4DZBA 2GK2A 1SDDB 3EADA 3LEVH 2DQEH 4LLYB 4ZQKB 3DGGA 3EOTL 3GGWA 4M48L 1FZMA 4GQZA 5FYKH 4ZFOB 3UG5A 4WW1A 4W9EC 1TVHA 1ZV9A 1FGVL 1ED3B 3ARGB 3TCXA 2YD4A 4AJVA 4I87A 4W9FC 5D1ZD 1H3WM 4A2LA 4AZ8A 3G6AA 2XRAH 2TSBA 5HGHA 1BD2A 1CFSB 1YNTA 1CLVA 1WE5A 1DFXA 5EZLA 3PG2A 1RJCA 1S7QB 1G5GA 1UM6H 3MV9A 3C08L 3EYSL 3TP4A 4GSUA 1F3JB 1USQA 4KBPA 5H4YA 4PY7B 1E4XH 5FLVA 4GUPB 3IFOB 5IJCC 5IW1A 4N6RB 5CMAA 5I26A 2ZD0A 5KANG 5AZUA 5IGXL 2ADJA 3GTVA 5GGUB 4NZTL 1IB5A 2O72A 1DSFH 3P0VL 4RA3A 1NFDB 3COOA 3SKMB 2NZ1A 4PJAF 1IC1A 2BIOA 3ISYA 2HFFB 5F7DA 3P4NB 1FO0A 5CGYD 2AK4A 2H32B 1BZ7A 1JGUH 2I26N 5CGTA 5ANMA 1NTDA 3AT9A 4YE4H 3MN8A 2X2IA 1QSFB 4OI9A 5EPMA 2YWYA 5LNEA 5L8KB 4KVNL 3I6LD 1XAUA 2XOTA 3HRZC 1XH3B 2CK0H 3GMRB 4MDRA 3T04D 4LPYA 4YDIL 2BNQA 3MLPA 4NBXB 1H5BA 1QLFA 4EKJA 3F7YB 4EN3D 4GSXA 4YSRA 3X14A 3BD4A 5FOJA 5D70H 4O2FB 4EUPH 4RIRA 3NSDA 2FT7A 2OMUA 3LRSB 4LLQB 1YMME 3FTUA 5CP3A 1BIHA 3L6FB 2GB2A 4Z7VE 2DQJH 2VZUA 3QEUA 1OXYA 1QFWI 1XMWA 1ORSA 3O6MH 3OAZK 2L7EA 2VZVA 2PYEB 5DTFB 5E1AA 1ZGLA 4KJQD 1KULA 3QXDB 3QI9B 4A39A 3WEBA 2NYYC 4G82A 2X05A 1KG0B 4YZFE 2Q8AL 3SPCA 3CZUB 2FZ3A 4NQSA 2PPFA 4UM8B 1MPAL 3WL9B 3QHZH 1QASA 3BSZA 4F9PC 2WWMD 5CEZL 4UOZA 2J5WA 4CDHA 2H9GA 2O5ZL 1NDGB 4J6RH 1VFMA 3NSCA 5FA4B 2RTTA 2IAMD 5TE4H 3MJ7A 4LVOC 5C08D 5FO7A 1OTUC 4LCWA 4FKHA 4GMTH 4JY6B 1RI8A 1S7VB 3V9CA 3M1OA 2C7UB 1N0XL 2DKMA 1FHGA 1NGQH 3AAZB 3JYCA 1N5AA 4ZUWB 5AAMC 5KYYA 4E68A 4OKVB 4NBZB 5TQ0L 1CYWA 3VXPB 1ID2A 4P2YA 3JTTB 5CILH 2OJ1A 4WCYL 1ILSA 2WHVA 1MCEA 1G7JB 2J25A 3NA9H 2H3XC 4YSTA 5D1XD 3I75A 3UJIH 4EI5A 3RZCD 4KROB 4WHCA 1V27A 4X98B 3FCTB 2QKIC 4YO0B 4D0CA 4UT6L 1HKFA 2EABA 4IBUA 3ME0A 4JCMA 3LQMA 4PS3A 1U92B 2PTTB 3KVDD 1KBBA 1P7QA 1TVBA 4OZGE 4W9GC 4ZRGA 3WAKA 2NXZB 4EXPX 4BE6A 4JUSA 2AKRA 3CK0H 1V55B 3RE0A 3S98A 2F58H 5CWSB 5FPIA 5E9DA 5LUMA 1YPZA 1EV2E 1P7BA 4JKLA 5I1KL 1T22A 3ARGD 3OX8B 3GYRA 2R0KH 4H20H 4DTGH 1GRWA 4OSUL 3OLDA 3ECUA 3LJ3A 1JWMB 1QRNE 1QWNA 4JKKA 1D9KC 4CJ1A 2CCLA 4NQDE 2C4FT 3MCLH 3QJHA 5FW7A 5LN4A 1GTNA 4G72B 4GQPH 5D7SL 5HHME 1JZIA 3GKWH 2DI9A 4MXQD 1KPUB 1RK0B 4TQIA 1N12A 2XNAB 2JV6A 3L5XH 3OF6A 3T4AB 5DD6B 4DO6A 4EVNA 3BHBB 4EF3A 3APFA 1X4ZA 2V2XA 5FCUH 2WYIA 3QUZC 2NX5E 3OKOB 4W81A 1A47A 4QGYA 3S4SG 4YS4A 5HYJA 4X4YA 3Q5TA 3SDCA 4F1SA 3A4AA 1TNMA 5C08B 4JL1A 3BZ4A 2XNAA 1IGML 5FYKD 3V0WH 1MRCH 3HG1B 5E8PA 4O5LH 1AR1C 2CKBH 5IF0A 4KVNH 1L9NA 1LEKA 3TX4A 2WWKO 5F7BA 1MRCL 1TO5A 2VUOA 2OFQA 2Y5QA 1S7QA 3CSGA 3FU5A 4AIZB 4ZI8A 1D5BB 3T0EC 2X0UA 2DQDL 4PJIE 5DK2A 2R0LH 3MGOB 4NUQA 3VXRA 1R75A 2Z7WA 4ODBD 3S97C 2R0LL 3ZTEA 2OJZL 3ULSB 3UBGA 1HZKA 4U6VH 2HRGA 2GJRA 3N5AA 5DHYA 4YQXH 2ZOLA 2EILB 1NDTA 3MLTB 2VDMH 3QUZA 3V5KB 3UBXA 4NAQA 2X2HA 5ICXA 2J5LB 3IJEA 4JRYB 5C09D 2X70A 4ZW5A 3QIBC 1KB5A 5C9JB 4UU9B 2VN3A 1REIA 5FWRA 1HAWA 3ZTDC 1HXMA 3ULVD 3KS0J 1MWAB 2GC4C 5C08E 1E9PA 1IJNA 4JQIL 1F3DJ 5HD8D 2BY2A 5IVOA 3IJSB 3PXJA 4EXKA 4P5TC 1DQTA 1U58B 4GW1B 2NY0B 3R7RA 1CE6B 3SOTA 2EDOA 1L4IA 3MLTA 1SQ2N 3VG9B 3ZKNC 3B34A 1YPZE 1KFGA 3OR6B 1NCAH 4EPSA 2O6DA 1ES0B 1U3HD 4LHUG 2MPAL 3KM2A 4PJ5A 4RH4A 1MJJB 3KPOA 5EU7C 4RAVB 5HHMB 4FTVA 2DQTL 3QDMA 2OBGA 5DK2B 2DQCL 2JI1A 3FO9B 5EIQA 1DN2A 1RZQA 2ICEC 4XP4H 1NAML 2G2PA 4N0CD 1JD7A 1L9TA 5HYSB 5LBSL 3KPSB 2HKFH 5FFGA 5KVDL 1G0YR 4QRAA 3HN5A 5FDWB 3IF1A 4V33A 4BZYA 1VFBA 5D6DA 1HE7A 2WVTA 4GG8A 4PJ7F 2BSRB 3EO9L 2YXMA 4KY1H 4YHLL 1MXGA 1H3VA 1F58H 2FEDD 3GSNL 4FNLH 4XP5H 3EJCA 1SM3L 3OXRA 5BUPA 5J1TC 3UGUA 3S37X 1WBZB 3QWNA 5CLZA 3EKCA 1A1OB 1EANA 3MRNB 3S5YA 2DWYA 5HBBA 1SVBA 3RNQB 3ECWA 3L9BA 3PWNB 3DK0A 3U25A 1MLCA 1B90A 3B6SB 2YMXH 4BSJA 2DYPB 3TN0A 4WW1B 3NIDB 4A68A 1GSMA 5E6YA 2VXSL 4WU5A 1DBAH 1XF2B 5IP4A 4BKLA 1DJWA 2YD8A 3ENEA 1RH8A 3TYGH 1VPOH 4Y5XC 3VXOA 1GGCH 1K4CB 5F8RC 3KLDA 1DFBH 1LP9A 4LCWB 5FYKE 3MNWA 2F1BA 3BT2H 3AREC 3DURB 3H7BB 3LQZB 5DSCB 4GKZB 4LCUA 4NEHB 1G4RA 4WTWA 3SN6N 1TZIA 4JO4L 1UG9A 1UWYA 4OZHF 5KZCD 1IMHC 2CKBB 1B0RA 4JHAH 3IKKA 2GIXA 2R59A 4FNRA 4PBVC 4BV1A 1JF6A 3BUDA 4J1UA 4NZTH 1IJ9A 5KYNA 3NCYS 2HRHA 1L6ZA 2B1HL 2B8OT 2YA1A 1CC3A 2KDYA 2A5UA 3QUMB 1HHKB 2ATKB 2VZOA 2D03L 3EF7A 2W91A 5D2LF 4BJLA 5I19L 5I1CL 2NY1B 3LCYA 3UAAA 3GO1L 4YSEA 1CF1A 3O8XA 4OCWL 3NZ8B 3OZ9H 1UGNA 4M56A 2K7PA 4NCC1 5GRZA 4YQXL 1UZ6F 3SOBL 2YKLH 4YFLF 4CC0A 3U30B 4RFNB 1O6SB 2OTPA 4XVOA 1KJ2L 2FR4A 2P5EA 3QEHB 2RMNA 5CEXB 5IEHA 3ULUL 4HKXB 3PWPE 3O6LL 3ASNB 1NBQA 5DQ9A 2EDXA 2M2DA 3BUYB 2VDMB 4JDEA 1LVEA 5J1AA 1LE5A 2GJ6D 3FU7A 3TJPA 3PJSB 2QVIA 2FO4B 4TPRH 3EIFA 4PJHB 4X9IA 1KF9B 2D31A 3K3QA 4AYID 5HHPA 5JMRA 3D4GA 3O3EA 8PAZA 3HR5B 1LP9F 1Z7JA 4ZFZA 4DP4X 4FI8A 1T1WB 4L1DA 1GGTA 4ZO7A 5I5IA 4JREB 4NT6A 3WS3B 2MTPA 3AGVA 5FYJL 3SDXA 1MWAL 2X4NA 1T20B 1J0HA 4WUUB 3MRIB 4HKXA 3ZZ1A 4HULB 4N8CL 5BJTA 3SE4A 4PN6A 1CDIA 4UIMA 3C5ZC 3DV6A 1WJ3A 2J4WH 3RI5K 1MCSA 3NEOA 3CBRA 1G7HA 2WO3B 4LSSL 1ZLWH 3REVB 2DM3A 1TKWB 3LKNA 5DRXA 5DMKB 2EVJA 5JW4N 5ABAA 3ZE2E 5KBPA 5DT1L 4NX0A 1UD6A 3V6OE 3JV6B 5I1IH 5LGKA 1VFUA 1NOFA 4Z7WF 1KB9J 3HBZA 3W3BA 1AQ8A 4G6JL 1XTMA 2BNRD 1JF5A 2DQEL 3INUH 4WTZG 2MPVA 3O0LA 4NHUB 2A4CA 4WCYH 4YJZL 3ZX1A 5AVYB 3JV4A 4X9HA 2QSCH 4JRXB 2SODB 2B20A 3ILQC 4CVXB 3UDWC 1EJOH 2NTFB 2VLKB 4Y5YC 2FNBA 2A7BA 3SY0B 6CGTA 1RIVL 4LEXL 2OL3L 2L0DA 4HS3A 3K5SA 4B5ZA 4QXTB 5I30L 1WLHA 1RIHH 4YNYB 2X41A 4RAUA 1LWRA 5HI4C 3ESOA 3S36H 2YD1A 1RFDH 1HILA 1JGEB 3I6GB 3N91A 2HX8A 4WDIA 3QAQA 5FDYA 3T8XA 2APFA 2DH2A 4HU2A 2IMNA 4X7TB 3MLRL 1GY2A 3VFUB 1UXSA 2F2HA 2H2SC 4XCYA 4UZUA 2QDWA 3ZKQD 1NGWA 3IJYB 4U05A 4D9RE 3S5ZA 4HS3B 2HH0H 4HWZB 1MFVA 4TQEH 1EO5A 4JGMA 1SPDA 5IVXB 3MO1B 1D5RA 1F2QA 4IS6A 2YGNA 3FTYA 5IJBC 3DO7A 4PRNA 1XF4A 4NENB 3BW9A 3U2JA 2IBZY 2W60A 4CBPA 4MJIE 4N3UA 2FHBA 2X89A 2AV7A 2D7NA 2GTWB 2KZBA 2WQAA 3KPPB 3IMVA 4QRUB 1XGTB 1DUZA 4I1PA 3KWWB 4PIRF 4I2XE 5FM8A 3MV8B 2VN6A 3Q8EA 4FJ6A 4FFYL 3LB6C 3AMKA 4JKPH 2DBJA 3GI8H 4QXWA 4AEIL 3K2MC 4JZNA 2CGRL 2KZ1B 4G8IB 5IV2B 1SOKA 5ECJE 4UTAA 5H35B 4G7YL 2LAGB 4IRSD 3ZE0B 5BPPA 3WGVB 3E2HC 5ERWB 1ZOXA 4LKCA 4PGCB 5F93C 3IRZA 1G7QB 5FFLA 3TFBA 4MKMA 4W9CC 1AACA 3AQDA 3KEDA 2GJ6B 5FV1L 2QFRA 3SDDA 5IHHA 1WEJH 3CLFH 3S8GB 2VXQH 1Y6NR 3MBED 4LO9A 4S2SB 4H8VA 1XGZA 2AQRA 3RU8H 3VSQA 1L3NA 4NRZB 5HYIA 1HYSC 4GRMA 4LKXA 4BQCA 3EOAA 2OR8A 3ZMEA 3CLEH 3IDJB 2OI9B 4L3EA 4UT9L 3GDCA 3TZVC 4PGEA 2IWFA 3N44B 3F8UB 1MEXL 3NTCH 7CGTA 4PV9B 4XCEA 5E03A 2BSTA 2FEEL 2XZQH 1N10A 2UXGA 1CDHA 4UQAA 4OIBA 5JW3H 3L3OB 3VCLB 2E74C 3QEUB 3G9AB 3OD3A 5I0ZA 1FFNB 2IADB 3BYTA 4JN1L 2QPFA 5F3FA 4FQ2L 1WAAA 3OGOE 3FOMA 5F7KC 2CPCA 2V37A 2JCCF 5DFTA 4UT6A 4MJ2A 2PCPB 1FVDA 4NO2A 4WUKH 1DDHA 4UB0H 2NXYB 4F8PA 1INDL 4H25B 3C5SB 4U6XA 5I23A 3LN9A 4NN5C 5ADOH 1H8NA 4XNXH 3T3ME 5FGSA 3RIFK 2D2OA 2Z8VC 4YBQD 5IUCA 1NCDH 2Y6SD 1NLDH 1Y1UA 1OAZH 2PF6A 2UWEE 2VLJA 3CMGA 4LGRB 4XNMA 5GGRA 2VZ3A 2F61A 1CDJA 1YJDL 4NAMA 4OKDA 3FQWA 4XBGB 4P48A 2W0LA 5AWNL 1KJVB 2YRPA 3F00A 3FUFA 1XF3A 1B6UA 2RACA 3L1FA 1MCOH 3ESMA 2FX8L 4IBZA 5FO7B 1WG3A 2ZP0T 4HIXL 5JHAA 3IBOA 4H40A 2OCCB 4QXGH 1BAFH 1DLHA 3WN5B 3ZHKA 4E41E 1F8TH 1BFVH 2GEEA 3QHFH 5KSAA 3SE6A 4OGYH 4OZHE 4HH9A 3BH9A 4B9ZA 3RFZC 3POCA 3MFFA 2A1WH 4UQDA 3V6FB 4GG6A 3ALWA 2WKLA 1P7HL 3NFPB 5HVHB 5DT1H 1T7WA 2VMFA 5TE6H 3FU9A 3H56A 4F80A 4RBPK 4P07A 3N06B 4AYGA 3KWVA 4HMDA 3T0EE 5D7JA 1KENH 4ZFFA 1M7XA 1G7MB 5FO9A 4JG1H 1RUPH 3BD3A 1QLEH 1A0QL 3B2VH 3OLGA 3BUPA 4NWUH 4YE0A 2Q6WA 1HOEA 3PDGA 1LWHA 1TIUA 5INCA 2R2HB 2FQDA 1S7VA 3KW8A 4Z7WE 3NT0A 5E8DH 3HKFA 4UTAL 1GC1C 3LZOA 3FFCE 1AFVH 2BSSB 4YEEA 5FHAL 3FQTB 1UEYA 3SGDI 4D2NA 1IGYB 2OMYA 1KCVH 4YHNA 5IK3B 3MROB 4F7KA 5HGBA 1CBVH 4MXWL 2GK0A 1W80A 1A6TB 2ICEA 3V4PA 4MZIA 3FQ1A 1KBVA 2ADGA 5I30H 4JANB 5DZLA 4DZ8A 1D7DA 3BPOB 4L1TA 2J6EH 4X6DA 1E6OH 2ADIB 2X7LA 5AALA 3MJ7B 4MGXA 5CWSA 3P4MA 4AEIH 1TZAA 2WZ5A 4X6DB 4GO9A 4L18A 4OCXH 3ULUC 1DDTA 3CSYB 4PJIF 5D4QA 1LWJA 1NCCL 1KBGH 2NY0C 2B59A 4JFDB 2FUQA 1O9WA 4YL4A 4BKTC 1DO5A 1IAIL 3HMXH 3ULVH 5DHEA 4PU2A 5T3ZL 2EDLA 1PY4A 4HAGA 1I1AC 3IK2A 4FJYA 1N2RB 4I89A 4LU5L 1KNOA 4KQ0A 2MQ3A 2FH6A 4R7DA 4YGVB 4A55A 3C60A 2CRYA 4FQXB 1A9VA 4N2MA 4KVCH 4LNRB 2IBGA 5C09B 1O7DC 4Z7UE 4GFTB 3LNEA 5I8CB 4JQIA 4A6YL 1YNLL 2JI3A 3QUXA 5FUOL 1A1MB 4FFWD 3U1SH 2CHZA 2IPUK 4LPTA 1YEIH 3JTSB 1KGJA 4GQ9H 1KTJA 1RK7A 1RZKH 2F8XC 1AP2A 2NZ9D 3LKPB 1OLLA 2WIIB 2QVKA 2X42A 1KNOB 1YUKB 4FMKA 3FNKA 4FNLL 4XP5L 1R5IA 4P9HC 4L0ZA 1PEZA 1MI5E 2Q86B 4ZMZA 4WHTB 1BAFL 3MHZA 3V4VA 1OPGL 2VSKB 5BV7H 3IJ8A 4MAYB 5DRWB 4QYAA 5JTWA 3VXSB 3WKPA 1F1DA 3ABKB 2OSXA 4XPGH 1OT1A 1PZBA 3RVWC 4ZODA 2YZ1A 3OXSA 3QSKB 4G6KL 4PRPA 43CAB 2F7PA 1ED3A 1FN4B 1OTTC 1AXIB 1S5HA 4WFFD 4J5VA 3GHPA 1F11A 5AWNH 4YR6A 2WINB 4OU3A 3I6LE 2ED8A 2NQCA 3F6LA 3EGDB 3H3PH 2BP3A 3TLRA 5IOPA 1AD0A 4F58H 4PBXA 5FO8B 5T1DL 1SGKA 1G6RH 3QJFB 3GSNA 2FJGB 4JHWH 1D5MA 4KZ0A 4WUKL 2G2NA 2P5WD 3F84A 3GLDA 2YARA 3F7YA 4XPBL 3DECA 3WDIA 3CDZA 2Y69B 2NUTB 1AR1B 3RVVD 1KEMH 5EZPA 3IMBA 1MQ8A 3PWUB 3VWJB 4ZZFA 5D1QC 1HIML 2BVOB 2HJLB 1RP8A 4M6ML 5GS0H 4KRMB 4XODA 4MBOA 4JG0L 3TZVD 3RWHA 4OB5H 1BF5A 4LIQL 3HFML 5GRJL 1HL4A 2BNRE 4YX2L 3QG6A 1A6UH 1U58A 2BW4A 4RGOH 5ILTL 1PJ9A 3CXFA 5C6TH 5EEUA 1T6WA 2DYPD 5DJXB 2CBMA 3OR7A 3CFCH 1H0DA 2R23B 1LEGB 4PJ8A 2LU7A 3QDAA 1FP5A 4KDWA 4KKCD 4PTUA 3QK0A 1N5YH 4YZWA 3WNPA 3BVUA 1Z5LA 4I48B 1X7QB 2JI2A 4C56E 3HMXL 1KTLA 1AGDB 2MNUA 3AG4B 2CHNA 3JWNC 1JDDA 4ZX4A 2R29L 3ROOB 5TDOA 3FT2A 2LGNA 4YH6A 1QFUH 2AV1A 5C0CB 3GBML 5D1XB 3S9DB 1KIQB 1IEAB 2IFFH 5C9KA 4AM0B 2WBJA 2WQSA 2XG4B 1ET5A 1F4XL 1YPZB 5JA8B 4DEWA 4LPCA 2DAVA 1UQSB 1FH5H 3S8FB 1DFBL 2CJUH 3LEYH 5JDSA 3H4FA 4YPJA 1QRNA 3CH1B 2K0RA 1PS3A 3QO1A 3IE4A 1J8HB 1HU8A 2DLFH 3EBIA 3QJQB 5J13C 4RMQA 2FZ3B 1BQLL 4L37B 1MCBA 5E2JA 2CCWA 4D9QD 4FN0A 4XMWA 5C0EB 1S78D 3U83A 4XBPA 3LZLA 3S4SA 4ELKB 2OZ4A 3K71B 1G1YA 4CW1B 2BVYA 1EAJA 3VMOA 5F6IB 3SE9H 4Y88A 5FW6A 1TZHA 1UKTA 2ERJC 4HWNA 4OY9A 2VDRL 1R5WB 4QKTA 2R9HD 4M1CD 2LU3A 2PCXA 4BBWA 3NA4A 7PCYA 3PCYA 1I9RH 3BKYL 3HPJA 3H3PL 5HPMA 3FT1A 4NN6C 3BEVB 4G6ML 4QRRD 4W6YB 3X13A 3NACH 2A38A 4CVZA 2I60L 3FUDA 3STZB 5KOVC 2V17H 2F8VA 2X28A 1O0VA 4L4JA 4RGMB 4X9YA 4YK4C 4PM1A 3F85A 1PD6A 1T5XA 5IROC 3MRHB 2A73A 5JDJA 3VQ1C 5TE7L 2AEPL 1E6JH 1N3NB 2BDNH 2GQHA 5FKAA 2LLLA 3T2QA 3FN0L 4F7MB 1EJ8A 4M5YL 4AEHH 1CG9A 3KYKH 2WQVA 3PAVA 1PZCA 1OM3H 4ETYA 1YAZA 2VDPB 3C6LD 1NC4A 3RNKB 2AKRB 2EO9A 2CJUL 4PJHE 4GAJH 4ELDA 1A1MA 2ZUQC 3WNJA 1JBJA 5F72S 1IE4A 1A2YA 3BUYA 4JDEB 4XXCC 1U8HB 3E6FB 2AXGB 2I69A 2OW7A 2R0KL 4ISVA 2VDNL 1RK0A 3ULUD 1WT5C 3B8SA 1ASQA 1IARB 1NAMH 4ZPVB 3JUYA 2GJJA 3CSPA 4AW7A 4JN2B 2J4WL 3DHJA 1AGCB 2J8OA 5A16A 2AAVA 4R97C 5MEOB 2X4NB 3C6LA 3GBEA 4MAUH 2J6EA 4G9FB 2WTPA 1FFOA 4ENED 1A4AA 2UXVA 3O8XD 4ZOCA 2VN7A 5EBLB 1K2DA 3O3EB 4LCIH 5LG1A 3LEXB 3FQUB 1VA9A 2CO6A 3GJFK 2R7EA 2WBJD 1GMIA 2BO0A 2FO4A 3VGEA 3LRHA 4DNLA 5C0IA 1A6UL 3QEQE 1G6VK 4YXKL 4A7VA 4AXWB 4PHZA 4D7PA 4EE2A 4GG6B 2EECA 3HC0B 4L4VA 5HI3C 5I0VA 4LEOA 3UXFA 2MSPA 2BNUA 3BCDA 3OAWA 3MZGB 3T6WA 2VZTA 1J9CT 5CXPA 1ADQA 2Y72A 5GSVB 4RZCB 1MCQA 4DESA 3JV4B 5HHVL 1T7YA 2JKNA 4X9GA 5EC1B 3CN1A 5TH2A 2CO6B 3BKCH 4M03A 2XWCA 3F2LA 3U36B 4GKSA 1AZUA 3WD5L 1BBJA 4XC3H 1IGFH 5D96B 4Q97A 4U0RC 2R1YB 1YN6A 3IDIA 3WY2A 1JZ2A 3UADA 3J07A 4PR5B 1B0WA 2E7HA 4IGBD 1AGCA 2HUHA 4LRNL 4FFYA 5ILTH 3OKDB 4FQHB 3MNVA 1R3KA 5T5FH 3TBSA 5AVTB 4MAZA 2RCSH 5F44A 3UTSE 2OXGB 4G3YL 2Z0UA 3FO0L 2PCFA 3MV7E 1I8MA 3P2DA 4XNBA 1E4KC 2J5LC 4P5RA 3T3PF 3UAJD 2LOEA 3VJ6A 1RMFH 1Y6KR 2HPTA 1U95B 3C5JA 4WEUD 3SE3A 3TT3H 1C5BL 1XCXA 4J3OC 2JK5A 4UU9A 4JHZA 4FFZL 5H37G 1E90A 4HOXA 3D9AH 3S3PA 4U3SB 2D0GA 5TQ2L 3G6DH 4EDWH 2CIKA 2I9LB 2VLRA 3K6DA 1WO2A 3EOTH 3ZE2F 4XMKH 4LDEB 3H54A 2FB4H 3QDJB 4WTXA 4BUHA 1YNTF 4JHBA 4PRHD 2VLRB 4HHAB 4F5CA 2PP7A 5ESQB 3ZQXA 1WSST 4RFEA 5IBTH 3AUVA 4LL9A 4Y19B 4L8SC 3LPWA 3W0WA 1GZPA 4M1DH 3T5WA 5FO2A 1KN4H 4Z77B 2J44A 2OPCA 3A5VA 4HJTA 4PGDB 2EDRA 4M02A 1SY6H 4XZ4A 1D6EA 3N9GL 5TGBA 1WIPA 4E41B 1E8YA 5JUEH 3UZVB 2RBLA 3TGXA 1XCQA 2F5AH 4Y2OB 1QHOA 3HJEA 4C8XA 4L8DB 2IPUG 1K8DB 3C5XA 2DIEA 4YLBA 4P23D 2WXRA 3WUWA 2C1PA 4H2AA 5JIMA 2AW2A 1ZVHA 3LKOB 4PRDB 2HFFA 5F7DB 1BJ8A 5CCGE 3WFBH 1R0AH 4F7TA 1KXVC 3N40F 2H4EA 4U1MB 2IDUA 3MA9H 3WKQA 3T1WA 5D6CA 4APQD 3GIVA 5BNXD 3NK3A 4JO2H 4P23C 1TJIL 3FRUA 3SQOL 5K59E 4QDGA 5DUPH 3LNIA 4XI5D 3P54A 3F7LA 3W9DB 1NFIB 2OTUB 4LRIA 2XY2A 5DEZA 4P23A 3OAYK 4N24A 3VI3F 2Y5TA 3PNWB 2AJ3A 1FG2B 5EU6B 5A3ID 5BOPA 2ZNWA 2FWOA 1SQMA 4YSCA 1H6EA 3QA3A 1CICC 2Y3AA 5TPWH 2XQYA 3OZLA 3PV7A 3J8F7 3B56A 2IH9A 4XC3L 4R5XA 1W0VB 3MBEC 4L3EB 2AJ3B 4KY2A 1UTDA 1OGAE 3MBXL 1SDAB 1T03L 2ENPA 2F08A 2WNWA 3ARBB 5E6ZA 4AOFA 4EUPB 1W72A 3BVDB 1AZCA 3NN8B 5K39B 5IVXF 4JRYE 3SB3A 1OAXH 1THCA 5I1HH 5ID0B 1DDHB 4L3FA 1BCIA 1MREH 1XB3A 2OTWB 2F8IA 1Q9OB 1WAPA 4F7CA 5AOZA 1J5OL 2EKJA 5TQ2H 4EDWL 1IL1A 3PQYE 5D7HA 1KBWA 1KZYA 2NXZD 2W95A 2VQ4A 3EDKA 4BK5C 2EUWA 3QJUB 1ZLSL 3SCMC 4R26H 4FA7B 4HCRL 1UWFA 3PREA 4HKBB 1FRGH 4R84A 2DWTA 1FV1B 4PJGB 1S78C 3NIFB 3QDHA 4BQ9A 5AVUB 5E99L 4LFHG 3KPMA 4HP5A 4LP5A 3AM8A 1VIWA 4HZ1A 4LZKA 4OD1H 4K8RL 4JVUA 3MLUH 4Q6IC 1S5IL 2ZAGA 3DV6B 4K3HA 1L0QA 1U8PB 5GHWL 1HYRC 1YDPA 5I6XB 4J3XA 1IBFA 4KU1A 4QAWA 5B38G 2OZ4H 3G04B 4FAAB 1RSYA 5KTEH 4C4KO 4PG9B 3RDTC 1MW2A 2X6VA 1BA9A 3M6DA 3QWOB 3CC5B 3VRIB 5KN5A 1UB5B 2HX9A 3ZPDA 2GTZA 3ZE2B 2ZWKA 2ADIA 2X7LB 3RY4A 4A6YA 2EDFA 4PFEA 5I71C 1WFNA 3CVHH 3QEQD 3WJMB 4AV5A 1URZA 2Y4SA 4HLZH 1XXFC 2NMSA 1AHWC 2OSLA 4N2IA 4UAHA 1MVUB 2CAKA 3BO8B 5GIRA 3RWIA 2QLVB 5DMKA 5AB9A 4FXGB 4XH2B 3S37L 2XWEA 4NKIH 4NENA 4P2OD 5KUKA 4ZJ9A 2XV2A 3D0VA 4M7JL 4KDVA 2OMTB 4MJIA 4OJAA 2YFOA 5DZNA 3NCWA 4DP8X 4ODXA 1MFDL 3RTQA 7PAZA 5DFVD 5K33A 2PYFA 4QF1A 1RL1A 2IH8A 4X5WA 3D51A 3T3PE 1ACCA 1YEKH 4KFZC 1KMGA 4I0PC 4RNRB 1FC1A 3W5MA 2VDLB 1I8KA 2P80A 1QWUA 4Y8AA 4YHKL 1HE8A 2ICWJ 3CPUA 1ZT7A 2C1OB 3FUHA 1DEDA 43C9A 2JVUA 3BDBA 2WXHA 3NACL 2GUOA 4H0IA 1U2HA 3ZOAA 3DX3A 4IJTA 1Z3GL 3I3EA 1EAOA 1F41A 4GBXA 3HKZA 1ZMYA 5KVMC 3IFOA 3W0WB 4FGMA 4KKZA 3BGFB 1QBML 2Q1EA 4HEPG 1OZTG 3LTVA 4XNUH 5CJQL 4RSVA 1BYOA 2GBTA 3A6CL 5LWYL 3HMWH 4FABL 3QUHA 4NQEE 5C0CD 3QR0A 1QLRB 1NBZA 1YY8B 4L0PB 2CDFA 3HVNA 5D72L 4D7BA 1JXGA 5C09A 1ETZB 1E9OB 5KW9H 2ZAHA 3PJLA 3UO1H 4JN2A 4A2DA 4YWGL 3PDOB 3PP4H 1QI3A 4V2CB 3C60C 5EOCJ 1L9PA 2HAZA 2IH3A 1OF0A 5KSAD 2CDEB 3QUYC 2ORBL 4JM2D 2A9BA 4W4OC 4JZJC 4W6XB 5EFIB 5J6HB 4M61B 4MJHA 1ADQH 4Z7WB 1GZPB 2D3LA 2WJ5A 4NQTA 2WXOA 2H1XA 3EGDA 5IOPB 1F4HA 3D05A 2JCWA 3T0WA 5E0FA 4KZEL 4M6NH 5C0IB 3S96A 3F62A 3DROB 4NUJB 3HB3C 1CTNA 1RD6A 4HJEA 5C2BL 3AY4A 4OCYL 2MCPL 2AK4E 4YXKH 5IQNA 1S8DB 3FJTA 4KTYA 4U6YA 3BX7C 3GRWA 5DJ6B 4DUXA 2P7TA 1GJUA 5CMAB 1B0GA 1VFOA 1VZHA 5L4IA 5A6IA 1JNLL 4UI2A 4MA1B 1RAMA 3CC1A 4U1LA 3WFHA 4ZG1A 4P05A 5KSAB 1H9VA 4Z7OB 2K9UA 3WV0A 3HG3A 1AS7A 2DIAA 1R3LB 1OCRB 4ODVH 2ATPA 3ZZSA 3EJQA 4JFEE 2CALA 3HE7C 3RWIB 3CVDA 1YRKA 2H26A 3CX5K 1SXSA 4FQHA 3FU0A 3N04A 1OO2A 2QQKH 4H8UA 3H6AA 5HY9B 1EEYA 5AYUH 3QJOA 4R9HA 3X1FA 3GTTA 5GJTH 2Q6WB 1HCYA 1AQHA 1QZ1A 4P4KB 2P28B 4UBDC 3L3HA 4KTDL 3T71A 3RY6A 2NNRA 3PWVB 3QJTB 3VQMA 2DWSA 3L7EA 4L8BB 1KTKE 1FNAA 1OAKH 4ZS7L 4AGOA 4KTDH 2G30A 2Y7MA 3UAJA 3DHPA 4GUPA 3BPLB 4IKKA 4MD5A 5E8EA 6FABH 4MNQD 2H9GB 3QNXB 1J8HA 3S37H 1G9NH 3PHOB 3VMPA 3AG1B 4OCNC 1S7XA 1OCCB 5KJRL 2OXHB 4B5EA 3LPGA 4PJ9C 1UUNA 4A04A 3BESR 3QXDA 4KJPC 5F1NA 3RPBA 2AJSH 5SWQB 2SEBA 3FTGB 3D4CA 1I8IB 4LF3B 2XYBA 3SGEI 4FYQA 1QG3A 3BMWA 3FAXA 1JZ7A 1VFBB 1KIQA 4GRLD 4RFOL 1HZHL 2ESVE 3HC2A 5ANME 4ATWA 4WI6A 4LL1A 4JO3L 4DKDC 2AV1B 1VADA 4NNPL 4ZQTA 2QQLH 1KACB 1E27A 2VDOB 4F33A 2PO6B 4ELMB 2A77H 2VJXA 3OHXB 1TMCB 3WI9A 4JDTH 2VRAA 2R4RL 4LDLB 2CUAA 2A77L 1UXMA 3SKOB 4TSBH 2W5PA 2E76C 4QTIH 1OWRM 5CZRA 3ZDYB 3EG9B 3RBGA 2ZYHA 3NJVA 1IAMA 2Y9RT 5JQIB 2FSEB 1F4YH 4LVEA 5BRQA 2RFXA 4YC2B 2WLIB 4XGZA 3GMPA 1CFVH 1WTGT 2CBOA 2WZAA 4B7IA 4TXVB 3TTYA 3ETTA 2IH1A 2F9BT 3X11B 5EC2A 2IPTL 3JBG7 1TF4A 1OB1A 1NGQL 1NBVH 2W65B 1P5UC 3MV8E 5IHUL 5FFOA 3GMPB 3KH4A 2BSRA 1FLRH 4IIQB 3NFNB 1TEGA 1LK2A 2JB5H 1M05B 1UM5H 1VCBC 1MJUH 4I0KA 3U6XS 2WSKA 3LQAL 4X6CF 1R34A 5JPMA 2VAAA 2Y7QB 3L08A 4Y9FA 1Z9OA 4BCZA 4XB3A 3KPLA 3UO1L 2IJ0C 3F7QA 5C07D 4AIZA 1MF2H 3B1UA 4WWNA 4CSSA 1IM3D 1QMUA 1N59B 1VF5C 3QPKA 5L0QC 3BEVA 5ANHA 4ZK8A 3N43F 5EBMB 2MWCA 5IB3B 2NZIA 4P5KA 4PJ9D 3G5XB 1E3XA 3ARDB 3QG7L 6PCYA 1Z0NA 1RPQA 1QBAA 1XHHA 2DKSA 3DJZA 3O3UN 5DVLA 1QABA 5EB9A 4JAMB 3WIHL 2F7OA 5IFHH 3VVWA 2BX5A 3E9UA 4BINA 2EE0A 3WIHH 3QQ9D 1AIZA 2J88H 1NA8A 3CX5J 3LNGA 2NSQA 2XWTA 4JFYB 4MDJA 4OLUL 3UDWA 2E7CA 4I4WA 1CJYA 1JFQL 3EHBD 2R2BA 2Z35B 1E9PB 5HGAA 1QQDA 2W07B 1X5XA 3E8UH 2OL3H 4NHCH 4NPJA 1U4FA 1BXVA 4N28A 1DCEA 3MCYA 4ZAKC 4PP2B 1DANT 1B2YA 3HZMB 4RMBA 4XO5A 4WFGE 2DRUA 4RRPG 5D96C 3VSUA 3BGAA 3LPPA 4LE8A 4ZNEE 3N41F 3UTPE 4IBYA 1ETB1 3QJRB 4F2ME 5ID1A 1HCFX 4XXCA 1KT2B 2F0CA 2PP8A 2RH0A 3MR9B 3ZY7A 3SQBB 5C0BD 3IE9A 3Q1EA 1NGZA 3QIWA 2X9XA 3QRGL 2CWRA 4AZUA 1EAQA 4YVNA 2H1PH 5I24A 3QZNA 5BV7B 5JHBA 2IDSA 4G9FD 2FJGA 4HW6A 1SHXA 3MRIA 1I31A 2EE9A 4GKOA 3V6ZA 4NJAL 2KUTA 5ICZB 1K5NB 1TETH 4HWUA 1KOAA 4R8WL 3BKMH 4DVRL 3ARUA 3HUJB 5EN2B 5F9OH 4P4RB 1ZHKB 1OSZA 1ZGLP 4APQB 3RVXD 4KMTL 1MCPH 1NL0L 2X88A 2Z64C 4FX5A 5DVKA 3B4NA 1Q1JH 3CZGA 3FU7B 4PRBA 2E75C 4IBVA 4IHBA 4I3RH 4JFQB 1DP0A 1WFIA 4LPUA 5INDB 1M1XA 1IC7H 2HT3D 2WLJA 3LRSA 2A9MH 2R9HC 1SEBB 2D9QB 2XIIA 1MFMA 3DX8A 1IM9A 1BVLA 1BVKA 3SYAA 1NANH 5D2LE 3CCHB 4P5MB 1Q94B 2EIJB 1KDIA 3TO2B 4GUQA 1OAUH 3SPHA 5C0FA 1J9SA 5F9AC 2AGJL 4OZFH 3KJ6H 4HUVA 1ZPLA 3QRLA 5AKTA 3ZMNA 1JGDA 1L9QA 1OV8A 1BBDH 2E27H 2LHAA 3MODL 4GKLA 4UM8A 3MV8D 3TBTA 2YR3A 1A6VH 4WF7A 3RDTA 2J8UE 3F7VA 4QO1A 1T5WA 5B1CA 3RHWF 2HCZX 2YAOA 4CC4A 2HKAA 4B41A 2YOAA 3KR3L 5KVGE 4LOUD 4U1GB 1DQJA 1PCSA 3H2WA 4QHKI 5JOFB 4APQA 1U36A 4Q6IA 2ALAA 1NSNH 1B0RB 4QHMA 2PXYD 4X8GA 5FYLL 4Y2NA 2ALWA 2X4OA 4FG6C 2QT6A 4MA7L 5BO1H 2JFCA 2CD0A 3MJ8B 3U46B 2W8CA 2YRZA 1BYPA 4HS8H 3NTCL 2R69L 2F54A 5ENWA 4AIEA 5IFJB 5AG8A 1SBSH 2DJUA 5KS9E 4GUOA 1E9OA 4L29A 2NW2B 3UG4A 4E9QA 5JPNC 3NZ8A 4AE1A 3IU3A 1J9TA 5IFJA 1Z0MA 5DQDH 1A6WL 4FXKA 2Z92A 1ZWIA 5BMFH 2V33A 1NINA 1ZLVH 1I8IA 1RJLA 3MJ8A 4LF3A 4P3CH 1NQBA 2ZXWB 2FWSA 3VG0H 3ZBMA 5C86A 1MRFH 2GITB 4KPHH 1LK3L 1GHFH 3RNQA 2BSDA 1J05B 4EI0A 3OJDB 1T4KA 1E42A 2X0WA 3NCMA 1VGKA 3TCLA 2X1PA 5I16A 3GNMH 1AGEA 1U8KA 1D5ZA 2OSWA 3MLWL 4OJFH 2R56L 3WEMA 3QFJE 2W0FA 5D1XC 4CNIB 1V3MA 2JKTM 4GKZA 5E9DD 3CQPA 4AMKH 3V0JA 3GB7B 1KWKA 2ZUVA 1PDKA 4LOFA 1OANA 5AYQA 4A1RA 3MRCA 1RUMH 2ETWA 4YHLH 5EBLA 4IKLA 4HPHA 3RGHA 4G9FE 3L3DB 5JIKA 2NNXA 1KXTA 5E0QA 1MCNA 1X9QA 3RY5A 3WNMA 1A4KA 3BVTA 3F58L 4RWHA 1A02N 3HAEA 5CJOL 3OKNB 1E4WL 1KXVA 2PWEA 2YXFA 5LBSH 2NR6D 3X13B 5CR8A 1WT5A 2OLDA 1AGBB 3FF8A 2I60H 4WJ5A 4BH7B 1GTFA 3U7YH 4LLDA 4QUOA 1Y1DA 2PXYB 1X5HA 3E3QE 1UJTA 1W6WA 4IBQA 3U7YL 4RDBA 2GY5A 1BFSA 4RVBA 5K1VA 1BF8A 3M45A 2NW3B 4DP1X 2VXTL 3ESUF 3LRLA 3V0VB 3JZ7A 4UM9B 1HHHA 4HBCH 3BISA 5K9KB 4YDVA 4NWTH 3AB0B 4G7VL 3CPLA 5IMOA 4MB1A 4QLWA 3QIUA 3G5XA 3RPKA 3VUAA 1UGKA 1CFNB 3BAKA 5DS2A 1AD9A 4Y16B 2CKBA 3S88L 1DBJH 1JDAA 4BH8A 4N5ED 4WEEA 4XPFL 2E3VA 5TJWK 4V1DB 3R1GH 2V2WB 2VSDA 1K3IA 3BE1L 3O9WD 3QH3B 1TQWA 4JM0A 4KQ3H 2O5ZH 2W88A 4M1GH 3RAJH 4BYHA 2BSCA 3T6ZA 5IWLC 5HP5A 3TWYA 1LO2L 3POHA 5JW4Q 4PB0H 1FPTH 4PMFA 4DEPC 4F33B 2P9RA 1NMCB 4KNSA 4M93C 4GS7C 5E5MA 3ZIMA 3LQAC 3HVDA 4PLNC 4U1GC 3RFRA 1GZHC 5B39A 2WGXA 3VFVA 5DEFA 5ACMA 1N0XH 4P2RD 2FYVA 4F5CE 4IU2A 5JOPD 1EQWA 5FKPB 4N0UB 3VFTB 5C8JA 1BFTA 3W37A 1CI3M 2HYMA 4HF5H 1MQKL 3VD0A 2P5EE 5F3HA 4DERA 4XOBA 1BVKB 4YO0A 1FYTB 1LXMA 3VFMA 4P2QB 2HLFC 4XP1H 1LYQA 4HSCX 3G6JF 1FNSL 2DQGH 4TPRL 1ZVYA 1M1SA 4NQUA 4HWBH 3QYCA 2YK1H 4M6AA 5CP3H 3CXDL 3DJRA 5I19H 4LLVA 4N0UA 2NY4C 3RL2A 5GS0D 3I50H 1PAMA 1SMAA 1BXUA 4BFOA 3C6SA 1T7ZA 1NCOA 2CZNA 1N8OE 3BP6B 3L54A 2Z93B 3ZHDA 2WYHA 4GAYB 5TTRA 2R0WL 4K5MA 1SUJA 4KI5E 5AW1B 5E5MB 1I3RB 3GSQA 1YQVH 5LDSA 5IVXA 4UQ9A 1Z9SB 1ZLUK 3ZL1A 3MRGB 2VH5L 3JWDC 3MUZ1 4JW3A 1OAXL 5HHNB 1DVFA 1PZ3A 2RB8A 4B9JA 4X5PA 4NGHL 1IFHH 4PV1C 3HA0A 3TV3L 1WCQA 2AJXL 4PRPD 1GL4B 1QUNA 3JV0A 4M43H 4GAYA 1AGFA 4NDMA 2AABL 4Z6AT 2XHNA 2AJZB 4YSAA 2VR4A 4XO3A 1X7TA 3CK0L 2A74A 2DL9A 4I88A 4ILDA 1J7VR 4HFUL 2JCCB 1JXFA 3TZVB 1H3XA 1ZLDA 4N4YB 3CZSA 4PJAA 4O9HL 1TCMA 3HTLX 4FQ1H 5E2UH 5E95B 4DKFL 4LCCC 5FGRA 3TBYA 2QGDA 2NTFA 3KPPA 1HH9B 2X4PA 4KNTA 4UDUA 1OQXA 3WENA 4I0CC 4MNGB 3L4TA 3GRBA 4OBRA 2JF1A 1M71B 5CKGA 2YD3A 4XOEA 3CDZB 2AK1L 1KLFB 1KTDA 4R7LA 5EA0L 3U9UA 1BG9A 3L3KB 4QJ4B 3OKLA 4UQEA 2HLFD 4G8FA 4NP4L 2WKOF 2AJUH 3SCMB 2UWEF 4IMLA 4GT0A 1HQ4A 3VD7A 2X4UA 3C60D 4UNUA 1FO0B 4M7LT 2VKWA 1ND0B 1YA5A 3ASWA 5I2IA 1RUML 3IGUA 4P04A 4PY8J 3FT9A 4JE0A 4X0KA 1YYMH 2W9DH 4P2QD 3C8HA 3EUUA 5C0BE 4HBCL 1WAAE 3VXSD 4DGYH 1UUSA 3OAZH 4F8LA 1AI1L 1HOCA 4HCRA 4JRYD 1MFUA 4TUJA 1FBIL 4WO4C 5D8JH 1PLGH 5DHXB 1E30A 1NCCH 1Q90A 2WQXA 3CLFL 2WO2B 3DJSA 4I77H 4PUBH 1IGIL 2CBQA 1F1GA 1IC5L 2Y3NA 2ZPKL 3K72B 3QP3A 4P4KA 3FFDB 1WBXA 4PJBB 4Y1AE 2GITA 4ZW3A 2QGBA 4HFUH 3VXTA 4DO5A 2XWBA 3RUGA 4XNZC 2XWJA 2HRPL 4GKNB 4O9HH 4DKFH 2EDYA 3KLLA 5F70A 5L9DH 2WOBA 3WIIH 4X6DF 4KI5F 4UV7H 1EZUA 3QZWA 1B4TA 5A2KH 5L2KB 3VO0A 5T5NG 2BOLA 3MRFA 3MX0A 1IBZA 3TS8A 3ZKXC 3E38A 5IJVA 2N0KA 2X4RA 3BXNB 1CBVL 4MBRA 4KXZ