2JSFA

Solution structures of the envelope protein domain iii from the dengue-2 virus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords domain III of ENVELOPE PROTEIN E
publication title Solution structure and neutralizing antibody binding studies of domain III of the dengue-2 virus envelope protein.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jsfA00
5KVEE 5B1CA 5GZNA 2R29A 5AAWC 3UZQB 1OKEA 5KVGE 1RERA 4GT0A 3G7TA 1SVBA 5LBSA 1UZGA 2JV6A 1ZTXE 1Z66A 1Z3RA 2V33A 5IREA 1TG8A 1PJWA 2P5PA 3IRCA 3UAJA 4X42A 4UTCA 2JQMA 2ALAA 3J2PA 5H37A 3N43F 3N42F 3VTTA 4UT9A 5IZ7A 3P54A 3C6EA 5JHLA 3N44F 4UTAA 2H0PA 3WE1A 3N41F 2JSFA 4FG0A 5AAMC 4FFZA 1URZA 4BZ1A 3UZEC 2I69A 4UT6A 4AL8C 5KVFE 4GSXA 1OANA 4FFYA 5LCVA 4BZ2A 3J27A 4UTBA 3C5XA 4L5FE 1OK8A 1S6NA 5KVDE 3MUUA 3UZVA 5LBVA 4AM0Q 2R69A 2HG0A 4ALAC 2GG1A 5JHMA 3N40F 3UYPB 5GZOA
chains in the Genus database with same CATH superfamily
2UZXB 2R51A 2ESVB 4DEWA 2O5YH 3G5WA 3TZVB 2XFGB 5CJQH 4PB9L 2ZCKL 1HQRB 4ZUUB 4XC3H 4UTBL 1G0DA 1DVFA 2J3SA 2ZYHA 2FSEB 4AGMA 3VAEA 5JYMA 1C1EL 4ONFL 2Q9OA 2LAAA 1TF4A 1I1FA 3DSNB 5IW6A 3A47A 1MCIA 3IDYB 2FO8A 1CYGA 1J9SA 2I9TB 1X5HA 1H5BC 1HIML 3KNBA 4KVNH 4PR5A 1KTDA 2XHNA 4YGVA 3D18B 5DD3L 2AS5M 4QO1B 5LN4A 5JR1H 5ETUB 2VUKA 4ZOBA 4FQCH 5GSVA 3FQNA 2MTAA 2J2ZA 1XHHA 2I07B 3TJEH 5BW7C 1Z6JT 1FORH 4PCKA 4OGAD 5DVPA 3H3KA 1G4RA 4KX9A 4S10A 3D2UB 1R24B 4ZNCD 1YPZA 4G80B 4WNQA 3HHSB 1IM9A 2IAMD 3CSTA 4DZBA 4WQOA 1O75A 1THCA 2X9WA 4MKTA 2VDPB 3GSXA 5AZUA 3WKYA 5IY5B 3N42F 5J8OA 3V4VB 1MCQA 2MPAL 3UYRH 1JV5B 4B3VA 4EN2A 4POZC 4R26L 4MRBA 3SOBH 1UQSA 3CX5K 3UYPA 3DECA 1NTDA 4PS3A 5BZDA 1KN4H 2MQ3A 5MP6H 4XNZC 4YUEL 1ZRUA 2AMUA 4Z7WA 2YPVH 3N91A 3WV0A 3OKMA 4P4KB 3DVNA 5DHDA 4N5EC 4RMWA 2BIOA 2QSCH 2WB7A 5CUSL 4DPCX 2K7QA 4RGNE 2XJLA 5LKNA 3ZTDC 3LXAA 1OW0C 5GS1C 2J88L 4OZGE 3D48R 2D31A 4MAYA 1MFBH 5IJVA 3BFOA 5EBWA 3IFOB 4OFYD 4JY4B 1A9VA 3OHXC 1L0QA 4EI6A 4IW4C 1TCMA 3QFDB 4M7ZC 4WEBH 5EUOF 5A6LA 2IO5A 1GC1C 4QXWA 1DBMH 1SXBA 2YD5A 3HI5L 4DQOH 1M71A 2OR8A 4LSRH 5EO9B 2M26A 1XT5A 1BM7A 1BZ9B 2CRMA 1U8OA 4R7DA 4P5TA 3VH8A 1AO7A 4D8PB 1X6NA 4S1RH 5E8EA 4LHQB 4UV7L 2VXUL 3E7JA 3FFDA 1M7IA 1YEKL 4D3CL 1COBA 3VDAA 1RZIB 5DJ2B 3FJTA 4NKMA 4XCFH 5K69A 3BH4A 4EBQL 5ANMB 1YAIA 5CP3A 4NIKB 5J7CC 2BFGA 1GYWA 4WGWB 4Z3GA 5L2KE 5I6LA 2P5ED 1ZPUA 4RCAA 4H0HB 1N5YL 1CT8A 1NC4A 3VFWB 3K80A 2Z93B 4UQEA 4FQXC 4X7FC 4RZCB 1ZSDA 3IS1X 2Y06L 4AV5A 2ADFL 2WZ5A 1XSIA 1CDGA 4FQLL 5F7UA 1NINA 3L1OH 4O2EA 4J8RB 3RTQC 3QNZB 1CN4A 4FTVB 4LXFA 2PCPB 5KW9L 2VDRB 4WUUB 4GBXC 1E0OB 1CDJA 3O2WH 1JUFB 3BP6A 1R5VB 1CGSH 5CSGA 1YUHA 5DMKA 4QYOA 4Y9EA 2CJUH 3QQ3A 4JFFA 2Q3XA 2PP7A 1SBBA 4H0IA 3MGOA 3MI6A 1QNZH 1UFUA 4QXVA 4Y4FC 4PB0L 5KG9B 1K5WA 3LNGA 4V1DE 4JBSA 4TN9A 1N2RB 5TDOB 5I9QC 4U6YA 2DBLH 2WVTA 2BK8A 4ALAH 1KPUA 1G94A 2NY6B 1S7XB 1N64H 5I82A 3AT8A 3LNIA 3T0EA 2GJ6A 4MSWB 1MRDL 1IV8A 4GFXA 4P23B 3C75A 4UT9A 5IZ7A 1RPUA 1QA9B 2O5ZL 1WGOA 1O0VA 4IBSA 4Z7NB 2VQUA 5HHOB 3X11B 4K07A 1OTSC 2OCCB 4R2GC 2NOYA 5HJ3A 5EUOE 4LLMA 1UB6B 3T71A 1A7OH 1JGEB 3GEWB 5E8OA 1KGXA 2Z31A 4FA6A 3PHAA 2BLFA 5T1LB 5MENB 4D9LH 4HF5H 4R5TA 3P4MA 1Y18B 4O51B 4YR6B 3S2CA 3SGEI 3DTUB 3GI9L 3GIVA 1NDTA 1ONQA 4CBZA 2FBJH 2G75A 4XI5C 3SY6A 1MIML 1XGRA 1XIWD 2BWQA 2UZIL 1KB5A 2EKJA 2WMPA 3L5JA 2W38A 1UZ8A 3RPBA 3TV3H 5DSCA 5A3IC 1Q0YH 1IAOB 2VDQH 1NUNB 1OVZA 2DQFA 4P4RB 3BXNA 3AACA 3FB6B 4ZFQA 3LQAL 2J7LA 2OMYB 4APQB 1Z32X 4NWUH 1HXMB 5DK0A 3W9EB 1G9MH 3WIFB 1KBBA 5JHAA 2BZDA 2DOCA 1KYOJ 1T4KA 3MUGA 3RX9A 4OVUA 5TF0A 4TSAH 3HKFA 2B59B 4DGWC 2YOAA 2XVGA 4KRPC 4L2LA 5C0IA 3WIAA 3WFDL 3DVGA 1M05B 4RGOH 3GO1H 1NMCB 5TE4L 1L9PA 3ZDZB 5I0WA 5FYLH 4MHHI 4PJEA 5ESAA 1U3ZA 2GSIA 3R06B 3VWJB 3DXAE 1ET5A 4G70B 2VLMD 4CDGC 4L4TA 3VFOA 1I9JL 5E6ZA 1MI5A 4AJYV 4E41D 1TO5A 1XD0A 2HLFD 4NZUH 1T5WA 1A3RL 1DUYB 3NIDE 3U0WL 1IC7L 1F4YL 1KBGL 2IH3B 3C2SA 5GGVH 2IG2L 2XIBA 3V0VA 4G82A 1KFAL 2V3EA 3HC4H 4QRQA 4WO4C 4K15A 5DDHB 4LRIA 1WTGT 3C8KA 3SDDB 1E30A 5J6HA 2FJFA 1F11B 2ZX9A 4IRSD 4AYGA 5DZJA 4NO2B 2GEQA 3CFEB 2C4FT 4IBLT 1EGJH 4QRAA 3VRJA 1MRFL 2VLRE 4JE0A 3TX4A 3VVVA 2FB4L 3ECUA 2C9RA 3T65A 1BG9A 1KELH 4NP4H 4WJKB 4KI5C 4PG9A 5C09B 2X4PA 1LLAA 1FNEA 2ZKYA 1GMIA 4YHIB 3NT0A 2HLEB 4K5NA 4JFOB 3WKQA 4WSKA 5FYJU 5DUPL 2GTWB 2UVFA 4F2EA 2R2EA 3FOLA 1U8KB 4WCYL 4XCEA 2X4OA 2H32H 2E56A 2R0ZL 1IX2A 3TFBA 1GW6A 5IVZA 1ICTA 1FBIL 5FF6B 2GBTA 2VSKB 1S8DA 1T0MA 3WMQA 3MBED 3KBHE 4R90H 4APXB 1AGDA 4BSVA 1BFVH 5EU4A 5SWQB 3QULA 5D4HA 3F05A 2YD7A 2YS4A 1GYVA 3L4YA 5ITFB 2F54D 5DHXB 4N26A 2FX8L 1P7QB 1WFIA 4HKZB 3BWSA 1URZA 1I4FB 3L7EB 2DQ6A 1KGYE 2BCMA 2ISDA 1B0WA 4JQVA 2OJZH 3GTNA 1CF8L 1O5PA 4MA7H 4YHNB 5E5UB 1JGLL 2CDEA 3FTXA 3SJVB 3IMUA 3U0TB 4H2AA 4Y1SA 1UT9A 2E6JA 5HHMD 3W1ZA 5ISZB 3VI4F 1PD1A 4U0RC 2NPLX 1Q9OB 3ALPA 4KH9A 2BH0A 3O4LA 4URKA 3IDMB 1YN6B 1MCWM 1I8MB 1AC0A 5F6HI 5F88A 3VM7A 4X5WA 1JNNL 3N2JA 4PJGE 5D72L 5DGRA 4JPQA 3OMNB 3SE4A 1BX2B 2RD0A 4WK0B 5JHLL 2ZOUA 4JB9L 3IEAA 5D1XE 3D30A 1IEAB 4N0RA 2ZSWA 4LU5H 5E4AA 3X3GH 1WIUA 1R3HB 1EPFA 4HIXL 4UB0L 5IKCA 5ICYB 2C3HA 3DTXA 3ZKXB 1FL3B 4YGVB 2CBTA 3NJNA 2Q8AL 5GZOA 2YFNA 2M83A 3MVSA 4R4ND 4KJQC 5B1CA 1BFOA 2B4CC 3ILQD 1IC5H 5GSVB 1KEGL 4TVPE 2A74A 1FRGL 5EEZA 1WCBA 1H19A 3UTOA 3LNHA 2VWEC 4TUOA 1E4JA 2RB8A 1A4KB 1YPZB 1R3LA 3Q8AA 4KXCA 1AZCA 4QT5B 4U1SB 2WLMA 2VLLB 5T5FL 1JPGB 3PRZA 3TEWA 3SDYL 5C0RL 3CMOH 5KBLA 4DAGL 1BF2A 4KROB 4NQDA 2HT2D 2OI9B 4XC1H 2LTQB 4L3EA 3ZIYA 4LCVA 1Z66A 1YDPB 5I1GH 3ZE2F 5AZEH 4Y16C 3PXLA 2ENQA 1I1YA 4DN4H 2DLGA 3QCUL 4P3DA 3UAJA 3WEMA 5BZDB 3BC9A 4L5FL 2P80D 4OJAA 1GZQA 1URLA 2I5YL 3GD1C 3LYRA 4Z7WB 4YDNA 5F6IC 3I3DA 1C08A 5CN3A 5KTEH 1WIPA 2HFTA 3IMWA 1A7QL 1DBBL 2QDWA 3KGTA 3D5OF 2R69H 4K8RD 4OGAC 3CQFA 4QGYA 2IADB 2CR3A 1OSYA 3UTSD 3LV3A 2XI9A 1TQCC 3B7RL 2IAMC 4WHCA 1NBYA 3ARGC 3ECQA 4MZRA 3VI4E 4HCRL 4NZRH 4G9DA 2JWYA 3Q7JA 3QIWA 2AVFA 4PY7A 2V37A 4PV9B 3TN0B 3MNMA 1XCWA 3AUWB 1A65A 3PV7A 1NGWB 2EDFA 3L2NA 2KLSA 2CKBA 3BWAA 3TO2B 1ES0A 3H3PL 2R9HD 4ODVL 3VH8B 4LEXL 4ZMOA 2VABB 3FFDB 3T0VA 4HVBA 1HDMA 2C4FU 5D1QB 3F58H 2ZKHL 3G04B 5D7JD 5SV3A 1U8QB 3O6FA 2O93L 2YPKA 1L6ZA 2BX5A 4NZFA 4ZOEA 3GZOA 2AJSH 1QTSA 1Y0LA 1E43A 5DTFB 2CLZB 2GIYA 2VXQL 4ZTPL 5KSVB 1CTOA 1CT8B 2LLGA 3PWPA 1J86A 4OZIB 4XVJL 5IHZA 1U4EA 1KBVA 4LRNH 1QFOA 1OIOA 4XCYA 4J3UA 1JGDB 4F37K 1KGWA 1G6RH 1KCUL 3UFIA 5L2JB 4JMXA 3B9DA 1AYRA 2X9YA 1PF3A 2BP3A 1GGUA 1T1WB 2XKNB 5A2BA 3VG0L 1UCTA 2BVUA 2ZCHL 3DV4B 3PJNA 5B38A 5T1KD 4QYOB 2A4CA 3EH3B 3HN8A 4HDIB 1NFDA 1U93B 4NM4L 2R0WH 3HS0C 3ZE2E 3MGOB 4LCYB 1EO5A 2PWFA 4FFTA 4F2MA 3LN9A 2ZXEB 1IGFL 3CSFA 1KEMH 1QRNE 3H1ZA 4WEEA 3AG3B 4LCCA 4BH7B 1FNAA 1HH9B 2O6DA 1VGEH 4F57H 3O11B 3ZL4L 2DICA 3Q2LA 1CLZH 2ZXAA 2VMCA 4QKXB 5CCKH 1WSST 1ORSA 4WI4A 3DMMA 2OSLA 3BUBA 1THAA 4KZDL 3Q5TA 5H35A 2NUTB 3KL3A 4L37A 3V6OC 3IJSA 5H4YA 4HJ1A 4X42A 4ZFOA 1MXDA 1PS3A 1Q94A 2XFXA 3AT0A 3KLKA 1E3FA 4U1HA 4MMXC 1T5XB 1XL6A 5E8OB 1H3TA 2B20A 1MELA 2V7HA 3CSGA 1QPXA 3V0EA 3W57A 2OKMA 1GR7A 3PNWA 2DQJL 3O2VH 4MJIA 2CPCA 4YLBA 1DDHB 1D5XA 3G3LA 2NY4B 2ATPB 4FYSA 4ODXB 5C0BB 3HPJB 3P0VL 1KB9J 3TBTA 3EUUA 4C4UA 3PGDA 3E0GA 1JYWA 1XGRB 3DETC 4TUJB 4YMPA 1KCVL 7TAAA 2VDML 3GJFB 5E2VL 2GTZA 4OTXH 5CEXB 5DSCB 1CYWA 5FO7B 4KVCH 4EI0A 1CGYA 4UM9A 3TEXA 3DWTA 4FHBD 3TVMB 3RY5A 2JKIS 2VJXA 1GGCH 2HN7A 4UT6A 3ES6A 2Q3AA 5E4EB 5IB3A 3BPOB 5AEAA 1GS7A 1WEJH 2CRIA 2NRDA 2P8PA 4WENB 4XAWL 1KIRB 3G6DL 2CUAA 2OULB 3BZ4A 2HX8A 2DLTA 5E4IA 5GXBB 5C0IB 3CZUB 1IBYA 3W0WA 3O0LA 1MH5A 3DVGB 3F64A 4HLZG 1I1AA 5SWZB 1J48A 1EZSA 2XWTA 4LL9A 2OR9H 1XIWC 4EN3B 1PMYA 4L4TB 5E6ID 4PYHA 1UWGH 3D33A 4X6DB 1UXWB 3CVIL 1T5WB 1CTNA 1BECA 3KPSD 1BQLL 4DCQA 5HI4D 3L3JB 2EO7A 2H1PL 4KK8D 2KDYA 4JFQA 2B0SH 4JFEB 3C8KB 2BMKA 1J5OL 5EU6B 4NB7A 3WTUA 4UT7H 3FCGA 3QT2A 3UTPD 2WOYA 1FDLL 3EDFA 4KTEH 1NCBH 1RJYA 4B53A 2VITA 5FV1L 2AVGA 2QQNL 4XPHL 1R6VA 1J0KA 4U4BA 3STZB 4FCAA 4DO4A 4MCYA 4WI3A 4UMSA 1UJ3C 4PG9B 5B7FA 3F7QA 3L9RB 4X98B 3VXUD 1P9MC 3WDIA 2MPVA 4PJAA 4AQZA 3ZU8A 2BP8B 1QLEL 2E9BA 2R2EB 3IGUA 5TDPB 4HUVB 5I1KL 3RL1B 3S3JA 3BFWA 2HLFC 3HN3A 3TCTA 2KZ1B 1MY7A 2OJ1A 1Q8MA 1HILB 5IVNA 1CE6A 3BVTA 3Q44A 5D7EA 3RGVD 5JXED 1S7WA 4MJ2A 3QULB 2OL3H 2DQDH 3RA7L 1QSFD 1AGCA 3IMBA 4JDZB 5GHWH 4IRSC 2R2HB 4MD0B 4NUPA 4EF3A 4PREA 4ZMTA 3OSKA 3TT1L 3HMWH 1X5GA 5D2NA 3WFCH 12E8H 4H1LB 1MFNA 1PYWA 3PPSA 3PQYA 5GIRB 2W0FB 4NGHH 2WV3A 5BXFA 5LGJB 3R1GH 4BBWA 3JWOL 3DGDA 5I16A 1WIOA 2FJGB 4UV4H 2IIJA 4QOKE 4JO5A 2FWUA 5D6DA 3O4LB 1KFGA 3KLSA 2XC8A 1PY4A 3GUTA 4L23A 1MCOL 1JRHI 4LSVL 1NAMH 4OLWL 4Y4KA 3VJ6A 2IGTA 3VFUB 4L9DA 1UC6A 2EEAA 1FL5A 3STBA 5E1GA 4ZMPA 2DWYA 4K71B 3GZKA 4XP4H 3MBEC 2P28B 1MPAL 4EI5B 5J0BA 3RIAK 1DJYA 1IFGA 4TVPH 3EO9L 3S3SA 1WAEA 1BLIA 2YJQA 1F8TH 3AS2A 2H0EA 2GIMA 4JJHA 4WV1C 3U4BH 5ESQB 4XXWC 4MS8D 2ZIDA 1BCIA 1KC5L 2LFGA 3KBPA 2H0JA 3O9WA 3MUY1 2BINA 1VRSA 4LSUH 4MNQD 3LX9A 2XQYG 2OZ4A 1KV3A 5EZJA 2P8LA 2HJFB 2Y1YA 1UKTA 4FLSA 3HG3A 1G7QA 1JXKA 2E7BA 4IQHA 3VD5A 3MA7A 2WQXA 4TQ8A 1R3LB 1N59B 5KBPA 4PRIE 3V9FA 2HAZA 1A5FL 2EDNA 1M1SA 5IM7B 5IQNA 4WDIB 3ZVVA 1O6VA 4OFPA 7PAZA 2HYMA 4PW9A 5F1NB 2WJ5A 4RDBA 3COOA 1EUUA 5G55A 3FU8A 5KEZA 1IFRA 2Q76A 4MZ2A 3MCLL 4MA8H 3T1WA 4XXCC 3IPEA 4ZTOL 5IVXB 4PJ5A 4P3DB 5D7SL 4OI8A 3IN0A 5DJDB 3SBQA 4ADGA 4AZUA 4HD5A 4XRCA 4ETYA 4XHJD 1P1VA 1TT6A 3KLAA 4NUMA 5JA8B 2C1OA 1U8HB 2JKXA 2WLKA 3EF4A 3EJPA 3LQZA 4R4NC 3FC8A 1RHFA 3NJVA 3O6MH 3RWHB 1UFGA 2WQ8A 5JPMB 3CVHA 1X7TA 1KTRL 1GXEA 3U82B 1TFHA 3TJPA 1ILUA 3EOAB 4ERSL 3S37X 5K9JH 3C08L 3C5JB 4JZJA 3RDTA 4G9DB 3X1EA 2Y36L 2A9BA 2HT2C 5I15H 3LVEA 4XO8A 2CQVA 5LG6A 5E1AB 1MF2L 3BWAB 3C5SB 3WN6A 3I02B 4Z7QF 1TKWB 5E03A 4X5RA 2ADGB 1ERNA 4MAUL 1PL3A 2NX5B 4R7VA 4N4YB 2X4SA 3RURA 4A68A 4X5LA 4H20H 4TQIA 1TJXA 3KGUA 3MRKB 3FDWA 2Q7AA 1QBLL 3O6LH 2XZQH 2Y23A 3ZL2A 5CLYA 2YPKB 3G5YA 4QTIL 4WTWA 4D0CB 1A6PA 1KOAA 5HDWA 3D3VA 3ZT6A 4WIQA 1HOCA 1SNRA 3W3BA 4I48A 3O3UN 3E6FA 4OZFG 5IHZB 1TTUA 5D5MA 3WELA 3NK4A 1OQXA 4N2EA 1L9TA 4XVUD 4WU7A 4FEMA 5K59F 4B9IA 2A73A 1DQQA 3OPUA 4MA3A 4WF7A 3KH3A 3LZLA 1BF8A 1QACA 3RUGA 2FD6H 1XCXA 4Z6AT 2FBOJ 2XRAH 2QFPA 2R9HC 4QRPA 3WFBL 2DQIL 4G8EA 1JK8A 2AKRA 5SWSE 4OKDA 3CTTA 1EMTL 1I9IL 2GHZA 4YE0A 1NCDL 4KY2A 3S4SG 4HHWA 5D7JC 2JI1A 4F2MB 4PMFA 2Z8RA 4NPJA 2FX7H 2ICWB 1KCKA 1A66A 2APVA 2QGDA 1KYUA 1GZPA 1SJEB 2XN9E 3BJLA 4YLQT 2FSDA 3FH7A 4FQQA 3QUMA 1KJMB 4Q9QH 4FD0A 4MKMA 1BLNA 3ULUC 3GPSA 5B4MD 3WEAA 4N3UA 4DVRH 3T3MF 3I9GH 1A0QL 4PRHA 1K9TA 2H2SC 5EIQA 5IJBC 1DCEA 3FTZA 2VH5L 4JO2H 1PSKH 3V5DA 4P57B 2YZ1A 4PJFF 2R2CA 4XC3L 2XTJB 3TA3A 3MLTA 3TOPA 4P5MB 3N50A 1JWMB 3E6HA 3QARA 2F8VA 3MFGB 4KK9D 2IANA 3U1PA 1NCJA 2G9HB 4IBVA 3FB7A 3U9WA 1YEEH 4UMGA 4ELMF 4KVNL 2K7PA 3MRFA 1RZGA 3FTUA 3X1NA 5LBSA 4MJIB 4Z7QE 3GMRA 5JR1L 1BREA 1ETZA 4YDLB 3TBTB 1XH2A 2B1HH 1MCPH 1NSNH 1I9RH 3G5VA 5HDQL 1PG7W 3LB6D 1FVDA 5HVFB 1A6TA 4X4MA 3ARRA 3QFJD 2X05A 5HDBB 4PQXA 3QQXA 4FP8H 3IMRA 1TCRA 4KK5D 4AT6B 4XVSL 3Q2CA 1A7RH 4MJ5A 2DV6A 2Q86A 1KYAA 5JIKA 2XT1B 3FHQA 2ICEA 5E0QA 3MMEA 4UM9B 2MWCA 2NY3B 5EU7C 5E5MA 5LGYA 3UYRL 1WA0X 3L3GB 5EBGA 1RUPH 1K8DA 2PCFA 4KI5E 1ZT7A 3BUIA 4XTRD 3L9EA 2P47B 2X6BA 3ES6B 2EIDA 3PIQB 3SOBL 1ZT4A 1FN4B 2EVFA 3EOBB 2EP6A 3NACH 3S5LG 1TVBA 2MHAB 2BY1A 5MP6L 3BZ4B 3ROOA 5I8EA 2R2BA 3AREC 1AKPA 2YPVL 2M8XA 3B56A 3O41B 4BFJA 1IGMH 3OKEB 2PP9A 3W0WB 3LNEA 1UWEL 4U1IA 4N0CD 5DS1A 3WYRA 5J1AB 3ILDA 4Z76A 3P77B 3FUFA 2WQRA 4Y89A 4R6UA 5GRJH 4M6OH 3LZQA 3MC0A 2BNQE 3MV7E 4AK2A 1IKOP 1MFBL 3BD4A 3CUPA 3KVQA 2OW7A 2WZ0A 1B6UA 4I18B 4WEBL 4DCQB 4PYGA 2DI8A 3BVWA 2V7NA 3EKCA 4OGZA 3S98A 2AEQH 2HVKB 1Q1JL 4XPTL 3SO3C 5IQOA 4HKBB 1DBML 4CA4A 4WUKH 2BMKB 2XXGA 1PVHA 2BHUA 3RGHA 4LSRL 4X4YB 4HT1H 1EANA 2GK0B 4XMVA 1CE1H 3O8XA 5GS0C 3CXFA 3SZ6A 4G9FE 1RJYB 4POUB 1NANH 4NPKA 4S1RL 5I6OA 4JX0A 1QEXA 2MOVA 4LCWA 3OLEA 4PJFE 2BSBA 5C3LD 1DVFD 2VQTA 4IOFD 1ZTMA 4L4VA 3CFTA 3L3HA 2V2WA 3UTTB 3WIHA 3TBWA 4XCFL 4L1LA 4FKHA 2ZJSH 2XQBH 2VAAA 2YXWA 5EIIA 3SBWA 2NYYC 2UWEB 2W94A 2X28A 4KMTH 2B15A 4ELME 5E6IC 4UINH 2P7TB 2J72A 3ZL1A 2ITCB 4QHMB 4O00A 5JHMA 2YZ8A 4N25A 5HI4C 1SXZA 2RBLA 5F9OL 1GGIH 2APSA 3QW9A 3DKHA 3QG7H 1XR8A 3RFZA 1AGCB 2IPKB 3IAQA 4NN5C 4J6RH 1IM9D 3P9LA 5HJGA 2WYZA 4PREB 3VNZA 3QJFA 3FSWA 1CGSL 4MD4B 5CEZD 4URTB 4X6CF 1Q4NX 1WBZB 1QFHA 3O4OB 4NDMA 5C0JB 2J5LC 5IEKA 5KS9F 3DK2A 1MVUA 3BCDA 3B3BA 4IKJA 4KXZH 3U7YL 4BZ2H 4R3SA 4MD5B 1QNZL 2HP4A 4QJ5B 4CVXB 4K3GA 5C7ZA 3BIKA 4IOSA 3ZR5A 5I16B 3NBNA 4WNSA 3LCYA 2GTQA 2P52A 4ALAL 4OSUH 5IROD 3VJ6B 2APXA 1N64L 4G6AC 3QEGH 1FL5B 5JHDD 4OJFL 1OSEA 1PG7H 3JQOB 1L6PA 1HZHH 4QD2E 5GRXG 3RGVC 5JXEC 5BZXA 3L5XH 4CU7A 4HLZH 4ZW3A 4Z7VF 2J8OA 5FHBL 3QJUB 1VENA 1GC1H 4HP5A 4DP2X 15C8H 1I7TA 2P5WE 2WXMA 4KV5F 4OD1H 4EKJA 5I17A 3MLWH 4M6MH 5F0JB 1F18A 3WY3A 3QUXA 4MX7B 1RLWA 3NRPA 3DV6A 4I0KA 4OLZL 1G5AA 2GJRA 4P46A 4S1DD 4XWGL 4ZUWA 4ZXBA 2Z92A 3LQMA 2HKHH 2ZPKH 3RE0A 4D9LL 3M1BB 3BDXA 4P59H 4Z7UF 2Z64C 3MACH 5IQMA 2FO4B 1AO7D 2RIKA 3HVNA 4ADIA 4HMEA 1QNIA 5EZJB 1SJHA 4U3SA 4CW1B 2NY1B 5EBLA 1B3IA 2VDMB 3S88H 3A22A 2DLHA 3MYJB 1HX0A 4NWTH 4XO9A 3C87A 1XF3A 2WLJA 1IARB 3LKSB 1Q0YL 2VDQL 3HC0B 4KKQA 5EA0H 1C8PA 2K8MA 1IFHH 1LO0H 2JJTA 4XBMA 3LJ3A 4AIZA 2OJEB 1ULVA 5ADOL 5JW5B 2EYRA 1OEZW 3N1GC 2AXJA 1T4WA 4NWUL 2R27A 4JRXA 1CFTA 2N4IA 4Y19E 3UIZA 1FYTD 2AQSA 2OQJB 3L95A 3O45A 3FS9A 3ME0A 4P04A 3F7PC 3TM6A 4XRCB 1A4CA 1ITCA 4MS8C 1H3VA 2B7DT 3KLAB 5D71H 4RDQG 3VDCA 3BP7A 4YIQA 5IBTH 1H3PH 3GLEA 3LQZB 5DQDH 4DVBA 1N4XH 5ADPH 4TNEA 4OGQC 4X6CE 5JA9A 5FYLL 1D6VL 4MB4A 1QZNA 2VN4A 2Y6SD 4WK2B 1YNLH 5GJTL 5KS9E 3MNDA 4OY9A 1PZAA 5FFLA 1HCZA 4X7TB 5CN1A 3JBG7 4KKLD 1A4JB 4NZUL 2Q6WA 4PJ9A 4QRRE 3RDTB 4BFKA 4ZFFB 1P2CA 1KCWA 1PFCA 5J12B 5GGVL 3UBXG 3VFVB 1ZLWH 4AEHL 4QRTB 1KIUA 5KVGE 5HHXH 5IMMA 4HAFA 3D4YA 5TQ0H 3W39A 3ARDA 2EDBA 2CO7A 2FLMA 4F8OA 1EGJL 1WYJA 3E8VA 4OF5A 2X4SB 3KS0J 5DUJA 4XHJC 3DPDA 3CC5A 1X4ZA 1I8KA 2M1KA 4PRPD 1KELL 3G5ZA 1P1ZB 4OCSH 4KV5E 4NP4L 2CXKA 3RFRA 3MRJB 4RMRA 3WU1A 3HCVB 4GP5B 2IQAA 3GMNB 4G8FB 5J13B 5BMFH 1JWSA 1T83A 2JQMA 3WD5L 4A6YB 4AZ8B 1YYLL 3V6OE 2DJSA 4J3TA 1ZS8A 5A16B 3E6FB 1KUMA 4K7PH 4MB1A 4Z7UE 3NCYP 3QZWA 5D5MB 4PJHA 4NENA 2JJSC 2P8MA 4PD4K 4R90L 3FSVA 1BFVL 5F1OB 2AJ3B 1EX0A 3JVGC 4JFDD 4L9LB 3I50L 1SN0A 2W60B 5TPWH 5HYJD 4XR8C 1NEZA 3QIUB 5DMYA 4ESKA 4A7SA 1CMOA 5KSBB 4P9HC 4Y4HD 2OJZL 3I75A 2CWRA 3JYBA 3V5KA 4MA7L 1J9CT 2PW2B 3U6XS 3ZRCC 5BQ7A 3HFML 1E9QB 5LXVA 1NCCH 4G5ZL 4JPSA 5CU9A 3TJHD 3HS9A 1GZPB 4HFWA 1KPRA 3QUMB 1BYOA 2WN2A 4DQAA 5AWNH 1BBJA 4A66A 2DEWX 3DGGB 4FNUA 4MQTB 3AWGA 2ZYSA 3EIFA 1OE2A 1Y1DA 4XVUC 3MJGX 3WFHA 4HPOH 2C7UA 3ZOAA 4KNTA 4LNRB 5AB9A 2C9VA 3KL5A 3RWJA 5EEWA 2NXYD 3X3FH 4XN4A 3E6HB 2XTSA 4EZKA 4EAEA 3JTTA 1YEWA 5DD5L 1RZ8A 1TVHB 3VB9A 5KZCB 2KS0A 4LU5L 1ZVYA 4ICWA 3X3GL 1KIQA 2H3KA 3FB7B 5JPNC 4FJYA 4UDUB 1CTMA 5J11B 3KH4A 2PXYD 3MRFB 1RZGB 4MA1C 2VZ3A 3L3OA 4K3EH 4PLNC 5IF0A 1IC5L 5L8JB 1TVDA 1MCJA 4NEHB 1M7DB 1DR9A 4JY6A 1CD1B 5CNHA 1MUJB 4YNYB 4WZ9A 3QZNA 4R97B 2IF7A 3EDDA 2EYSA 5GGVY 5B4MC 4KWUA 4MMYB 4PJIB 1E4WL 4W9KC 2Q86B 5E6SB 1LP9F 1U3HB 3GQFA 1RZ7L 3CMOL 4OBSA 1PLAA 2BNRE 4M8VA 5E5MB 1NCOA 4JM2F 1F6AB 4XC1L 1K8DB 3BAEH 3JUZA 5I1GL 1U41A 2WVVA 3BH9A 3EO0A 4DN4L 1ZT4B 3WJJA 3CHQA 4KK9C 1A14L 2VQ4A 4Y5VB 1S7VB 1DTUA 2DIEA 4I0PB 2F7QA 4OLXH 4OQ1A 1RULH 4KUCD 1WFOA 1OO2A 5I8KL 2IPTL 4E41E 1RPKA 1S9XA 1KJVA 2AF2A 5MEPB 4CL7A 5KTEL 2GABA 4X50A 5JIMA 1LWJA 2FBRA 3GJFK 2Q2EB 5EMYA 3OAWA 2JKRM 3CBJB 3MUJA 3QJSB 5AZ2L 3QI9C 3LB6C 2R69L 4EDWH 4RH4A 3TPKA 1YMMA 3VXME 1NH6A 2NY2D 4UUJA 5D6CA 5EBMA 4KK5C 1SOXA 4F7PA 4YJZL 1QATA 5FYJD 2BSRA 4GG6A 1WICA 1PDKA 5C0AD 3KDPB 1AY1H 4GMSL 5T5NG 4XTRC 3K71B 5B1JC 1QSEA 5BS0D 1BJ8A 1FC1A 5ICUA 1JERA 2HLAA 3WHXA 4W9DC 1G7LA 1T1ZA 4LBAA 3QZBA 1W2KT 1JFQL 3F58L 3V6FA 4ONHA 1FNHA 4N87A 3TBWB 5AUMB 3H7BA 3S3PA 4N0CC 5I1IL 5EIIB 1YNTB 1OP4A 3B2XA 3CH1B 4WEUD 4F91B 1ADQL 4N8UA 5IB1A 3J27A 4F7MB 3S48A 4FZEH 3TURA 1VZGA 2Q20A 2X4NA 1MCFA 4LRNL 2YXVA 4PUBL 3VSUA 1YQ2A 2E9IA 4LB8A 3FRPG 4OLYL 3VFSB 1DP0A 5FPIA 4I1PA 3QDGA 1AHWC 1G6RL 1XR8B 5TJWK 5GS3A 1LP9E 4FNLH 1LGVA 1P84K 4GRLA 2JQAA 3QAZB 3KR3H 1QBAA 1VCBC 4YSOA 1T04A 1DVFC 1O6SA 1RHHB 3L3DA 4IOFC 4L8BA 1MVUB 4YHOH 2FECL 2VLJB 2B1OA 3WE6A 5JIDA 3ILEA 5E8NA 1KEML 4JO1H 1V7MH 5DEFA 3RVWD 4NX0A 3CHRA 1KULA 2XVBA 3ZZLA 2C9AA 4AYEC 3FF8A 3CVBA 1YN7A 3CDFA 3CZKA 3EZ8A 3MLZH 3HBGA 5CCKL 3TNMB 3MREA 4HEMA 2E9JA 4HPYH 2XBTA 4OCNC 5F6HJ 4F3FA 5DRZA 5EH1A 1SF3A 3MJ9H 4GAFB 4QY8A 3ULUF 5IESH 2L3BA 1FLRL 3RPKA 5F9JB 4NYLA 1BZEA 4LF3A 5I17B 2ATAA 4DKDC 5FGBA 1K85A 3ESVF 4P46B 1D2PA 3U0PB 1CLYH 5IFAH 5BUGA 3IRCA 4C55A 2ENYA 2K45A 3EYOA 3LKRA 3DARA 4NFDA 3ROLB 5SX4I 2WYTA 2Y7QA 3O2VL 5BZWA 3U36A 3WS3B 1JZ5A 4DP1X 4OIAA 2YQGA 2Q3ZA 3W11D 3GB7A 4ATTA 4OFVA 4PJCA 2JJVA 5CD3B 4W68A 1M1XA 1E67A 2GFBA 2X3AA 5IROC 5HTSA 1T22B 3B3IB 3VGAC 4GQ9H 2BOBA 5DFWH 1O6TA 5D8JH 2IPUG 4CC4C 1SQ2N 3F00A 1KSRA 3VFGL 2DQHH 3PAYA 1TQWA 1KDJA 4RFNB 5BOJA 5BRZA 2ALWA 1BFSA 4MAYC 4ODTH 4Z8FH 1GGCL 4M29A 1CFTB 1S2EA 3KXFA 1EBPA 2E4FA 2ADIA 1WEJL 3DUHA 4DIXA 4S1DC 4OKVB 1M3JA 1IAIH 4AENB 1N12A 3BQUA 2J8UF 1CDHA 2QKSA 3FQRB 1CF1A 3K2MC 1Q0XH 4P5TC 2KKQA 1OZTG 1RH8A 1UH2A 1RK1B 2XDHA 2Y2WA 2YD1A 3MV8B 4G6FB 1CICD 4PLKD 4S1SH 2JIXD 3OR6B 4PCTA 3GBNH 1XZ0B 1PX8A 3FL7A 1RJLA 4YDIH 4QRUA 1G87A 3UTQA 5KVGH 1V8HA 1OAZH 1RVFH 3FO9B 5E51A 4UAHA 1XGUB 4P5KA 1PZBA 3MRRA 1WZMA 5GRUH 5D4QA 2B5IC 4AQ1C 4BFIA 3ARFA 4Q9CA 4HS3A 1D5IL 4WFHD 5FWRA 4C83B 2CA4A 2RA1A 4IRJD 5DA0B 4EUPG 2B0SL 1KG0A 2AJZB 4L0ZA 1SEBA 3UC2A 5HP5A 4UT7L 3B4NA 1CUOA 3I74A 5TE7L 3ARDB 3W39B 1MSPA 2AJXL 4OB5L 4KTEL 5JW3H 3DMMD 3EG9B 4PJ8A 2WPGA 4H8VA 4M48H 2NQDA 2GITB 2YBRA 2EVGA 3UTZB 3Q43A 5D1ZA 2DMCA 3ULUE 2B39A 3DSFL 3G5ZB 4OZHA 1VESA 1UD5A 1YMHA 3ZE1B 5E6YA 4RMUA 4F9PA 4YL9A 1HSAA 1NOLA 5INDB 2J43A 2DF3A 3SKNB 1A6WH 4U7SA 2Y6SC 1IGJB 1TEGA 5DU7A 4ZPVA 3CFKB 2X5PA 3C5ZD 2W0PA 2X42A 1ZWIA 4KKLC 3FF7A 3BPLC 2MKLC 5CGYD 3S5ZA 3RPIA 3D1MC 4NENB 2P8MB 4KUZH 2YWYA 4P07A 3WAJA 4HOMA 4WFFD 2ITFA 2OL3L 1QOKA 1MHPH 4ZSOE 3KWXA 4FG6D 1LO5B 1PKQA 3ARXA 1YEIH 1EZUA 1PJWA 2EC9T 2Y07H 1NA8A 4A7VA 1UEMA 2KLRA 5DT1H 1UA6H 1IKNC 4GYBA 4FLOA 4LBEB 2Y3AA 1MREL 3V7MA 4PRBB 2AK4D 2PTTB 2VMJA 1WC7A 5JO5B 3R1GL 4JK0D 5EU7E 2Z31C 2E0PA 5B8CB 3BKCH 1EJOH 1KPRB 2B16A 4EO5A 2PTVA 2MCPH 2J8UE 3SDXA 2QGCA 5L7XH 3INOA 4Z78B 2DDQL 1W15A 3DA0A 3ZQWA 3JWNG 5D4IA 2HVJB 4W6WB 2D2CC 4XP4L 1OAKL 4P2QB 1L3WA 2NR6A 3E3QC 1DVUA 4J3OC 2X1QA 2ZXBA 3BGMA 2EEBA 1PZUB 1MRCH 1FC2D 4K3JH 3KWWB 3LHPH 2HRHA 2VRAA 3S36H 3JXAA 5C0CD 2Z4QA 1BD2A 3JTTB 1SOSA 1F8TL 3RWEB 3L1EA 3FT4B 4G2AA 3U4BL 4Y4HC 1JE6A 3VXPA 4NQCB 3STLA 4ONGL 4AEIH 4ONOA 4B5EA 1T3FB 1JXJA 4RAVA 4S0SD 2HFFB 4ANKA 5F7WC 4ZO7A 1TENA 1QBML 1MAML 4I8DA 2YGQA 3KS0H 3GTVA 3TJHC 3WY4A 4OFQA 2EAEA 1G4MA 1VEPA 1S5IH 5DUBA 1OK8A 4B9FA 2EYSB 4K2UL 1U8MA 2VDQB 4NKIL 4N90E 3V8OA 4IIQB 2C9XA 4Y8AA 2BRRH 2APTA 4CSTA 4HS6B 2WWNA 4HC1A 4PBXA 5AB0A 5IB4B 3GSWB 3AABA 4KKCD 1UATA 2NXYC 2V3DA 4MA8L 1A02N 2OYMA 4Q0XH 5CGBA 4UM8B 4XCNA 4HUUB 1DSWA 3ASOB 1PZ5A 2PKDA 3IWUA 2PXYC 1KJVB 3OC8A 4OV5B 3BP4A 1JNJA 1QEWB 2K70A 1SRDA 3WNIA 2G5UA 3NK3A 4M7LH 3D85A 4P2RE 4FXKA 3O3BB 4I2XB 3HE7B 3WGVB 2Z8WC 4GIPD 5EBMB 1T66D 3IKCB 2ENSA 3RWFA 5F9WC 4F7PB 1S7TB 3V0WH 3J7HA 3BVVA 4RWHA 1DBKL 1WV7T 3B7UX 4NOBA 4GG6B 3RNKA 1MNUL 2WIIA 1CFQA 5I15L 5F93C 5MHSE 1DQJA 5E5LA 1TEYA 5I74C 1QSEB 1QVOA 2P5PA 2OM5A 1T6VN 3IF1B 3EH5B 3AY2A 4WKZA 1MFDH 2HLAB 2W07B 1RZPA 3P3YA 3SBRA 2J6EL 3LZFL 4HWZA 3VD2A 1M42A 4U1GB 1W72L 3TCLB 5K9KA 4FJ6A 1EJFA 1S9VA 4GS7C 1S9WB 3H7BB 5K93A 3NJKA 2HFEA 1IBBA 3QNYA 3U9PL 3O81A 1O9ZA 5C07E 4X99B 1DLHB 4KKAD 4JQVC 3OAUL 4NNPH 1I3RB 2NY2C 4PV8A 2H32B 5D2LB 3VXRE 2VLKB 5HGHA 4KAQH 4XMTA 3UMNA 2X2JA 3MYZA 3TT3H 2Z91A 3DBXB 3QZOA 5D7LE 3OLIA 4UAOB 1XSJA 1KIPA 1ZD6A 2LV4A 3R4RA 2HTLD 3K6NA 1U33A 2DN7A 4PJDE 4ORGB 1CO1A 1A1NA 5ICZB 4DHLA 2XRAL 1VZHA 2WXNA 3FO2A 4AL8C 2LU3A 3KPRD 1HEZA 4KDTA 3FOMB 1BAFL 5B39B 1O6SB 4NQQA 1WJ3A 2EC9U 3L3DB 3NZ8A 3VFMB 1RZJL 2R39A 5LCVA 4O4YL 3A6CL 3CLWA 3SPCA 4G8GD 1CXEA 4FKEA 3QEQD 4RIRB 4I5BB 3GGWB 3FNKA 5DEGA 4DKAA 5DJYA 1I1RA 1PTZA 1YZZA 4GKSB 4X7DC 4Z7NF 1OSZA 3EO1A 3MLSL 4YHKH 3RB5A 5I23A 4Q9QL 4FNQA 5GZOC 1IGYB 3VXQA 3GMLB 1JZIA 2GUOA 1FHGA 2BVTA 3MREB 4ZAKB 4ODWB 4JO2L 4L4JA 4OIIL 4AC2A 5DZNA 5HGDA 2HTKD 4NHCL 5LNDA 1A6AB 5LLIC 3OZ9H 4QF1B 1ZT1A 1QR4A 3B5GA 4K23H 4YC2C 3VX1A 4BSWA 4DEPB 1UT2A 1YC8A 2QPEB 4KRNA 5I18H 1YEEL 2Y69B 3HZKB 4JN2B 1WAAE 4G43A 3LKNB 3S35X 3VFPA 1XGTA 5BZWB 5HHPA 1JMXA 2QHRL 1R3KB 3LY6A 2P44B 3BKYH 3RVWC 3H0TB 3FB5B 5F7MC 2B1HL 3ABKB 1NSNL 3US9A 1X5JA 3NABH 3OKKB 4HZ1A 1M1XB 2UYLB 4R7NA 3SGJA 4YXHH 1JHLH 2ODHA 4I77L 4LKCB 2BOBB 5L8KB 1IRAY 1TTBA 3HHMA 1RUQL 1TUPA 3ARYA 5CEYA 1SUJA 3D3VD 3H4FA 4FTVE 3DNKA 5IBLD 1U58B 3ZYIA 1CK0H 1F0LA 2PMZA 2Z8SA 4KJYA 4RGNB 4ZRGA 4YEEA 1JWUA 1TNNA 4GAJH 1HINH 5DS2A 3TYFA 2YQ3A 4OZGB 2ADIB 3NACL 3OXSA 3QIWC 5I0ZA 5ALBL 1AS7A 3PWVA 3GMOB 5AKTA 3HC3L 3BQUB 4I9XA 5FDYA 2P3YA 3IFNH 1TQBC 1IGML 4H88L 3SO5A 2X1WL 3W11C 1HHGA 5HVHC 1FJ1A 2JCWA 4C59B 3BWUF 1RJLB 2J1XA 4Z0XA 3BESR 1I8LA 1E9PB 4LAQL 2Z0UA 1JFHA 4M61A 2G2RB 1NCAL 3O6FC 1PAZA 3AT9A 1AI1H 4MNGE 4P5KB 4Q9RH 3SYAA 2QTEA 4DP9X 3CVCA 3FSAA 4BFIB 1D9KD 3OAYK 3ULUH 1PNDA 1OP3H 2AEQL 3BAIA 4AUYA 4O02A 2OYLA 3L9BA 3VXSD 5L2KB 3PE9A 3GXFA 4HT1L 2VQ1A 3SSGA 2IOIA 3BUYA 2B14A 1FH5H 5E2UL 4PJ8B 4KY1H 4OCRL 4N85A 2WUCL 3J8F7 2YC1A 1SGKA 1F3DJ 3ZYJA 2G3ZA 5HJDA 3AAZA 4JKNA 2D8KA 4ODHH 2ZJSL 1WBYA 4JG9A 1KCRH 4PLKC 1CICC 2D0GA 2ZP8A 4JFYA 1FNFA 5JXAH 2SEBA 1UGNA 4KMTL 3WJMA 3D25A 4LLYA 3N42B 2MMXA 1E4XI 2DY2A 5JHBA 3HKZA 1KLGA 3V0DA 2XWRA 3QORD 3KPOB 1GGIL 4ETQB 1G6RB 4IRJC 2CBPA 1LQBC 2IDTA 3U79A 3LPGA 3QG7L 5IR1B 3SCMA 4V1DB 3UDWA 1U92B 1J9RA 4GSQA 3WN5B 3B2VH 5T5FA 3DMMC 4BZ1H 4F33B 3PAVA 2VAJA 1ZXKA 5L6YH 1XWVA 1FFPA 5FA4A 3MTRA 3KYNB 4BZ2L 2MNUA 4N8PA 5DD6A 3ARBB 1SPDA 3P69A 3T6ZA 3QWQB 5F71A 2XG5A 3BDYL 4HJEA 3L3IB 4O5LL 2D0FA 5KANG 4JGUA 1CFSB 2OBGA 3FT3B 4JHAL 4OSUL 3C5ZC 3FQTB 2ERJC 3KD4A 4V2CB 5CGYC 1RFDH 4LCUA 4UTAH 1M6OB 1ND0A 1Z3RA 3QEGL 3BVNA 1LE5B 3ATBA 1JV2A 3D7PA 4Z3JA 5LAXB 1HZHL 4N0UA 3TNNA 3L5XL 3BGMB 5DQJA 4JDTH 5EFIA 3OWRA 4FG6C 4ABUA 15C8L 3U2JA 2G30A 1GSKA 2Z4QB 1SVZA 3FQ2A 3HG5A 4CKVX 3CC1A 4FYRA 2PO6D 4PFEA 2F7PA 3QFJE 4G7VH 4J3BA 3QDJD 2E47A 3V0HA 1MCRA 1SN2A 1JDDA 5GS0H 1MVFA 1YPZF 4OF0A 3STLB 3ZN6A 2XPZA 3MBXH 2ZPKL 3GEFA 4RAVB 4BKLB 2OA9A 4P59L 2W0LA 1T2XA 4U1NA 3O8XD 5C0DA 1MHCB 2EADA 2VIRA 4N20A 3K5SA 3D4CA 2ESVD 2DWEA 2WWMC 4FQHB 3MOBH 4GRMA 3S88L 4XH2B 3K4AA 2WY3B 3NAAH 5CS7A 3TBBA 5DZLA 1EV2E 4J4PD 2EDYA 2I7OA 3JV4B 3I2CL 2HH0H 4Z7WF 1XD1A 2GCYB 3IDNA 1LO0L 4NBXB 1XBRA 2YAMA 5EC1A 3BGFC 2JELH 2XKUA 3EDJA 3HS8A 1F45A 3VH8G 2ZP0T 2AXGA 2VXQA 1PIGA 4FG4A 4YFDB 3DXAB 3L4TA 4TOYH 5DJ0A 4ZBJA 4LGSB 2V2TA 5CSBA 1OPGH 2JH2A 2V5MA 2ZXCA 1P5UA 3NIDB 5H94A 4AGPA 4H8WH 1H3PL 1TJGL 2VN5A 1NOFA 5ADPL 3D2UD 5DS8B 1GW0A 3DJ9A 5IHUL 2PR4H 4Q6IC 3ZTJG 1QHPA 1XQ4A 1YNLL 1DL7H 4AE1A 3I3EA 3K74B 5GS2D 5DZ9A 1P5VA 5CWSB 2VLRB 5H2BA 2VYRE 4PWFA 5CFHA 3QISA 2WIIB 3AQZA 4O9HH 2B77A 4KKCC 3BEWB 4YXLH 1G9EA 5PCYA 4GXVL 4P4KD 2E46A 3WXVH 4YDMA 5TQ0L 5E08H 1NDMB 4YZWA 3AC0A 3IFPA 1KJ2L 3ILPA 2ITDB 4Y9GA 4LK4A 3KPQA 4YHYB 4XMKH 3DIFB 1S9VB 1H3XA 3TCXA 4OCSL 2OPCA 5ECGA 1H5BA 2HFEB 3QNYB 3CCHB 3IE9A 1IKFH 5KYWA 4Z95L 2YEQA 2BZCA 4LSTL 5BMFL 4Y5YA 1QG3A 3Q01A 4ZXBD 4E9TA 5FOBA 1HI6A 4ZQKB 4IYKA 4LARH 1XCTA 4U2ZA 5CBEB 5HGHB 1REIA 1JI2A 1T66C 2PYFA 4XXDA 1FZKB 5ERWA 1G9NL 2W81C 5CEZE 1OF2B 5FUZL 2Z91B 3DI2B 1Q9LA 4J3VA 1NJ9A 3BFQG 1HHIA 5D6DC 4PCSA 3WY1A 2OL3B 1RPQA 4Y4KC 1RIUL 4HWBA 1DQLH 2A0LD 7FABL 5TPWL 4N0FA 4LL1A 3HNTH 3VACA 4U49A 5BJTB 3QXAB 1KBKA 4HCGA 3NZ8B 1CD9B 5TQ2L 1LL1A 2KDGA 4JRXD 4PJGB 1KTBA 4LLDA 4HW6A 4XE0A 2XWBA 4J8QA 4DKFH 4OGYL 4HIPA 4LVNC 1B3JA 3ASWA 3NCYS 2R1YB 1F97A 3EO1B 1DO5A 1R33A 3APDA 2NLJA 1OW0A 5F9AC 5GS1A 1NAMB 5AWNL 4GUPB 3QUYD 5CAYB 3NH7H 4JPKH 3QR2A 4LKXB 3IJHB 4JL2A 4KO9A 2VXVH 3OHXA 4WUUD 5F0MB 1B4JH 2V0AA 2ZXGA 1MJ7H 1WGVA 4LPTA 4M1GH 4DNLA 4BJLA 5CCJA 5HGDB 1OAXH 1NUFA 2G3MA 1AO7E 3GSVA 3X3FL 2CDGB 4QHPA 1QFWM 5AOZA 3CN0A 4NQEA 5CM1A 4J3OF 4NP9A 5DWUH 3FO0H 1UACH 1UWXK 1FZOB 6TAAA 5DRNA 1OZUA 4K3EL 3QYNA 2Y9RT 5KVDE 1L9QA 1NLBL 2NY6D 3NUKA 4WU5A 1U8NA 4UILH 3GJEA 1D6EA 3NJMA 1SJMA 4P23D 1J8RA 1EFXD 1LD9B 2GVYA 2C3XA 1FYTE 1TETL 2XBDA 2WXGA 3QWRD 4H4NA 1PCSA 4JPVH 4W9HC 2JCCA 4YN3A 1UURA 4DOHE 1BMZA 5FGCE 1MWAH 2ZG3A 4FQXA 5EZPA 1G1OA 5AYTA 4ANXA 4KRLB 2FYYB 4FERA 3BAEL 2HTKC 4PVMA 5DJ6A 1WZKA 3OJ2C 4JZJC 4YK4B 3PXHA 4PJEF 4DGUA 5MEND 1MFCH 4JFFE 3OXSB 1NLDH 2WIMA 1IUZA 4OLXL 4G42A 3IXTB 1UYWH 4HX1B 4J27A 4Y1AA 3IJ9A 4B6ZA 4P9HH 4LHUA 5HI3C 1CGVA 3VX0A 2ZTBA 3PDDA 3F85A 2CK2A 3DHPA 2ENJA 3O0RL 4K7PY 4Z0XB 2ROXA 4FF9A 4ZD3L 43C9A 2Q2LA 3D69A 1H6TA 3T0EE 3TL5A 2ZG1A 2GJ6E 2PYEA 1MLCA 3CZSA 1AXTL 1MJUH 3EADA 1WZ1H 4YHLH 2VISA 4W9ZA 3T4YA 5CIPH 3MRCA 2K3HA 4PRPE 5IBLC 1GL4B 4WHTB 4N6RB 4QRBA 5CILL 1CFBA 1BQKA 2AQRA 3CQPA 5L88H 4NNYA 3RWIB 4I3RH 1U8LB 1AYOA 3CHXA 1JRHH 4GSDL 4H1LG 4XNDA 3KVPA 1RZFH 4FEIA 4OGXH 4UQAA 4GQZA 5DJAA 1EJ8A 4XN7A 1DEEA 2PW1A 3BAJA 4OUOA 4JRFA 2EC8A 4M5SA 2DQEL 3INUH 1WBYB 2FAUA 5GGRY 3QJVB 2W9EH 3E3QE 4Y2DB 5IK3A 4OAWB 3WMSA 4MDIB 3EYSL 4AIEA 4JFYB 4JFDE 5DJCB 4AK1A 4D0BA 3P0GB 4P2YA 3HC2A 4MCMA 5SWSA 4J1UB 3CPLB 2XIDA 3PDOA 4M8QA 4YAQB 1JZ8A 4OF8A 4FZEL 4WI2A 3SDDD 4ZMAT 1D9KC 1FNLA 3ZE2B 3GMPB 3CMGA 4GAYB 4W9JC 3I6GA 3L7FA 4L05A 3KL0A 4K55A 1HXKA 1QRNB 2F53D 4XMZA 1EEZA 3ZTEA 3DPBB 4QRSA 4XCCH 5ENWA 1NICA 1NM4A 1O7DC 3ZHNA 2R29H 5ILTL 4FNLL 3T0DA 4PRAB 5C09D 1P6WA 2QGBA 4K7FA 5CGMA 3NIGF 5EZIL 1U8CB 2MNWA 5F1KC 2I26N 1WUNT 1CD0A 3FT1A 3MRHB 1L3NA 4PJEE 5IGXH 3GHBH 1AGBA 3O3AA 1KB3A 3ABZA 4BCZA 1V7ML 1KY7A 3FYEB 4JQIH 4G6KH 1MI5E 2NSMA 2GSMB 3D09A 3ZHKA 5JLZA 4X0KA 5KYNA 4LCUB 1TO4A 3BVNB 4AIOA 2CO2A 3MLZL 2NW2A 3MFFB 2YD4A 1P7QD 3RRQA 5GZNA 4HPYL 3EBIA 3EDEA 4UQ2B 3ZDWA 3V52H 3APFA 2ODIA 3TNNB 4HIJB 3MJ9L 4WO4A 5DVKA 5I75B 5C08A 3K8KA 3CN1A 2C1PA 2Q0ZX 3SJVD 4AYFA 4K9EH 1R0AH 3LDBB 3IETA 2QELA 3LS4L 3B5HA 1CBVH 5ISZD 2K6YA 4F7CB 3ULVD 2VIRB 3CGTA 1FZJB 2KH2B 1N6QH 1FIGL 1WFUA 2DWEB 3EFFA 4H8PA 1TYRA 1F3DH 4WFEE 4CMHB 1AZZC 3ZDYE 5AKSA 1DVXA 2AEWA 1EAPA 3OGOE 1N7ML 1JYXA 5D8JL 2DYPB 3IFLH 2VE6A 3IDNB 4JW3A 5LG1A 4DZ8A 5HPMA 5IEHA 3ARTA 4YQXH 2P42B 5IQ7H 3VGDA 2AJYH 3P3RA 3P9MB 3VE0A 1FNGA 1N0XL 2AXGB 4MCNA 5DURD 1T2QH 5DJ0B 4Y2NA 2BNQA 2PO6C 4Q56A 1SHWA 3PWUA 4UI2A 2BVEA 5D1ZI 3OZLA 4RA0C 1IAIL 4JJ5A 1D7DA 4M5YL 3CXHK 2WLIB 1TJHH 3HPLB 5I1DB 5FYJE 2HG5A 3O8XC 1M7UA 3SYOA 4DK3A 1EERB 4S1SL 2KMWA 4WWOA 3G5XA 3PABA 3GBNL 3NIGE 5BS0E 5E9AA 2PABA 5J6GA 4PJ7A 3OF6A 4J4PC 1I8IA 1A25A 4JKPH 5EOCL 2WC7A 4FGMA 5GRUL 3NIFF 4LP4A 2W80C 1QD0A 3E8UL 4YFLF 5G4OA 3MRPA 3WL9B 3QQ4A 3T04D 2NNAA 9PCYA 2ZCLH 1DJZA 2WKOA 2QSVA 4FFYL 4X80L 1IB5A 3HOGA 5JW3L 4HHAB 1NC2B 2YOCA 3IDGA 2VZ1A 4M48L 1C12B 1E5UI 2F2HA 4DKEL 4PBWD 4WWKB 3WBDA 4GRWF 5CEZH 3U46A 1A6VH 2D73A 1D5BB 2AQNA 2PLTA 3MV9A 1SYVB 4WEMB 4F7TA 5EOQH 4RVBA 1FCGA 2IAAC 4YHPA 2DD8H 3HG1A 1G7PA 4L0PB 2P24A 2FQDA 5TD4A 1EAJA 2WLLB 3B37A 3EXLA 3DRQB 1XH3A 4LQ1A 2DWDA 4NQDE 5FFGA 3Q1EA 1Q9LB 4LQFH 2EEDA 1NJ9B 4L3EE 1IQDA 2Z1KA 4ZFGH 2YGNA 3IU4H 4N2MA 3U4AA 4D9QE 5ID0B 1OM9A 1X9QA 3WUWB 3L17A 4E9VA 3EAKA 1MHPL 3K2UL 4QOKB 5D1QD 1YEIL 3AADB 3Q8CA 4NQUA 5F0LB 3WJLA 4EXKA 2Y07L 1IU1A 1YEHH 4YHZH 1OTUC 2FL5B 5DT1L 1RP9A 4KXBA 1UA6L 2Y2YA 4JCWA 5CCHE 4LPYA 4XNZB 2Y0SA 5AQ0A 5I1CL 4PGEA 4WI6A 4NBZB 1GGBH 4ODBD 1H0DA 4LLDB 4NO0B 4HUWB 3FN0H 2VUOA 1ZK5A 3D4GA 3BKCL 1EJOL 2ILLA 4KK6D 4ZXBC 3SKOB 3U48A 3LPPA 3WAKA 4YBLC 3PV6B 1W0WA 1BZ7B 2MCPL 3MRNA 3CD4A 2YAHA 1RL1A 4JGJA 3QJZA 4PJBA 1V3JA 3GSUA 3HFFA 1Y7VA 3AXIA 3HZMB 4A38A 3N85L 5FW6A 1UWFA 5B3SB 5CP3H 3Q06A 4AG4L 5CU5A 2WSDA 4M7ZB 5F89B 4ELKB 4ZT1A 5F2FA 2E75C 2AZAA 1W80A 4ZUTA 5KVDH 2HVBA 1MRCL 4FL4B 4K3JL 4ZUVB 2XN1A 1KGCE 3LHPL 3NIFE 3QRGH 2HKFH 2X4UA 3PHOA 3V4UH 4G5AA 3BT0A 2C34A 3JVFC 3VI3A 2WGNB 3P4LA 2ZXQA 4PRIB 4M56A 4HMCA 4WTQA 4AEIL 5DZVA 4AJWA 5IHHA 4O2FA 2ZWYA 5LB1A 2ZSVB 1BJMA 2CMRL 2I27N 1M9SA 3ISWA 3Q5YA 4JHVA 3B9KB 1NGPH 5FYKE 4J23A 3FONA 3PWPE 4JZNA 4QHUB 1FG9C 5D1ZD 4GRWE 3ZKQD 5FA3B 5C7XL 3KPLA 3QUYC 5FEBA 4FQ2H 5DF0A 2MRYA 4AC4A 4OFYA 2DQCH 3GLAA 3AG1B 3U7WL 3MKGA 2OYKA 2J1KA 3IJ7A 1MEXH 4HCFA 4F9LC 2VDNH 25C8L 3RTQB 1VACB 3L3KA 4PJ9C 2J6WA 4Z77B 4ZX6A 5G2NA 4XGZB 1NFDE 1NPJA 35C8H 4GBXB 2ZX8A 5C0BD 2NY4D 5ICXA 4LEOB 4UT9H 1MJJB 4JVPA 4C56A 4DETA 5CLZA 4YDJB 3HRPA 2PNDA 3DTDA 1FV1A 1YSOA 3BT2H 4NM8H 4GIOA 1VB9A 2NY6C 4HGWB 1T1XA 4Y4FB 4M7LL 4E5XA 3BISA 2YK1H 1FQ9C 3WKNA 4P23C 1A7NH 4G3YL 5KAQF 3C60D 3FMGL 4DERA 3MRBA 1UD4A 2P5EA 4TULL 4XMPH 1MJ8H 4MZIA 4GOSA 3TVMD 2GUYA 3KE0A 3A4DA 4WJ5A 1EWHA 3V0WL 2YFOA 4M4RA 3MRCB 4G1MA 2YQBA 4JKMA 3HR5B 4G1EB 2OMNA 3TIEB 2YUZA 2XN2A 3D08A 2L7JA 4J3OH 4LVOC 5EU5B 4N2IA 3CE1A 1KB5H 4PJAF 1KJ2B 4R2GB 4PW3A 1VEMA 1AZNA 1K72A 1NCGA 4U3CA 1IEBA 3GSOB 1UXSB 1VSCA 3HBPA 3TH4T 3UH8A 2VXTH 1N6VA 5DZAA 3F3HA 4IBUA 4A04A 4EJ1C 1JS4A 3C8DA 4CSSA 4EN3D 1BD2D 3NJGA 1IQWH 1Z9LA 4NXKA 4PSPA 2CGZA 4D0BB 3RWDB 3QUZD 4JUTA 4OJEH 5I1HL 4L8SA 5M95B 5SWSB 3MXWL 3PDOB 4AXWB 4JFED 3HUJE 4WI9A 5BOZG 3TT3L 4PIBA 5EU6D 1N67A 1BEXA 3GKWH 2A9NH 5J57B 5DJXB 3L7FB 3NFSL 3QHFH 4KKBD 1XX9C 1VJSA 2NT0A 5ENWB 1W0VB 2XN9B 1SYSB 5IB5B 3MNWB 2VMDA 3EGXA 4CADB 5BVJA 5CINL 4JAMB 4WY7H 5KWYC 1S7UA 4RAUB 4NRXA 2D7MA 2FEDD 3QXUA 4LPVA 5GSRA 3SQOL 2CJ3A 1MAJA 4GSXA 5ESVA 4K9JA 4KRPB 2ZOOA 4BM7A 1WWWX 3BAYA 1S3KH 5GGRB 5HHNB 3VSVA 5CR1A 4YHKL 5JLZB 3L3OC 1U2CA 1N6UA 1XIWA 1FVCB 1JG9A 3PAUA 3SDDC 2X70B 2NW2B 1IC4H 3ZRFC 43CAA 4Z7QB 2JXMB 3GBDA 5HXMA 4FG2A 2I24N 2Z7WA 1RIVH 1SLUA 4XX5A 2N1TE 4K23L 1DDTA 4QHLB 2DLIA 3X12A 4ZW8A 1QO3B 5I18L 1KNOA 4CBPA 4RMBA 3P11L 4UIKH 1ZA6A 3D87B 2VN3A 1LWRA 4PJAE 2IXQA 5D7IE 2AXFB 4NUGH 4OLEA 3T6VA 3BKYL 3CLEL 3FQWA 3S2AA 1ZV9A 3NABL 1P9MA 3GMMA 5HVGB 1XBDA 4LLWA 4DP6X 1JHLL 4FZ8H 4EI5D 3VD7A 1YEGH 3EHBD 5LJYH 3BH8B 5HDOA 2QKIA 3UPRA 5JMOC 3SE9L 4FI8A 2EUXA 1BQ5A 1OP9A 5DZOA 2ICWI 2V9RA 1WDAA 4PV1C 2ZX5A 5FYJH 1ZHBB 2W92A 2ZG2A 4BYHA 5BO1H 3U2SB 4M5ZH 3HW7A 4HBQA 5D2NE 3TLRA 1HINL 1LE9A 3DRTA 3W5MA 1BQSA 3S34H 2BNQB 3MV7B 4UOW1 4IRSA 4WGKA 5I2IA 2X87A 3PQYE 2X4RB 3BE1L 4AL8H 4HHGA 2FT8A 1LDPH 3JTSB 3NSXA 1YLBB 4OCWH 5E4OA 1UB5B 2C9QA 1WFNA 3ULVC 1N19A 1HWHB 4NC2B 1T0NB 1B0RB 3SD5A 4RNRA 3G5XB 3QUGA 4NBYB 3S3BB 1B2YA 3MBWA 4UQ9A 4DPAX 1F3RB 2H26A 4GSUA 4MXQD 3L5WA 2AQ2A 1WISA 4U0RB 5J6GB 3ZKND 5EUKA 4G9FB 1H3WM 1A1MA 2QBWA 3B34A 1C7TA 1ZLSH 4PJFB 4Q9RL 1PU0A 3S4SB 3O6KH 4MQ7A 3HBZA 5DYOB 5E5RB 3MBEA 2NY5H 3QQ4B 5JDJA 4LVEA 3H8NA 4R0LB 3QCVL 1Q72H 2NNAB 5E1QA 1UVQA 2F54A 3ZKXC 4ELMB 1DSYA 3KW7A 1T20B 2D03H 3NZHH 3UZEC 1XR9A 1HHJB 2AI0H 3ESUF 1E65A 2DM3A 3MRIA 4WV1A 3GI8H 3EFOA 1MNNA 4XXWA 3VWKB 5C6TL 3CQQA 1JN6A 3VW3L 5D5MF 5MERA 4PEEA 4XNMA 2B9AA 2XWZA 2KT6A 4JHUA 1OSPH 4X5XB 4M03A 2E3VA 1KCRL 2K1MA 1ZIAA 3IGAB 4KC3B 3DX9A 3BZDA 1B4LA 5JXAL 4HV8B 2VCOA 2X0UA 1K2DB 3FCTA 3LH9A 2FIRT 3KWVA 2OI9C 4PGBA 2DWDB 1MHHA 1NEUA 2NYKA 4B9JA 3MU3A 3OR7A 4GY4A 4LSQH 4PJXA 3TYGH 3TWCH 1CU4H 4FC3E 5KSAB 1A3LH 4U6XB 1A6UL 3DX2A 1MCEA 3Q6GH 3QEQE 2NX5D 4PJ5E 1AHKA 1GPOL 3SDCD 1HWGB 3ZKSD 1H8NA 3T09A 2V2XB 5HY9A 4Y16B 4XXCA 2EYTB 3N1QC 4RWYH 4ZTEA 2FCBA 4PTTA 3N9GH 4BZ1L 2VDKL 2XXFA 4FABL 5FFOA 1FVEB 3NESA 5AOLA 5L6YL 3DOSA 4GKZA 2EVHA 5DC4B 1X4XA 2FQFA 4OVVA 2XKSA 2CKBH 3QA3A 4JFPB 1KJ3H 5KOVC 1XXFC 1EZVY 2P5WB 1BAWA 5C71A 1OARH 1PAMA 1W0WB 1CFNA 2CK0H 4S0TD 2BNUA 1BG1A 1M2VA 2PUQT 1WVZA 3CN4A 3KYMB 2HJLA 3MRLB 4BFEA 5E6UB 1F3JB 2IAMB 2VR7A 3BSZL 2VMFA 3ARGB 4HK0B 2FQEA 2PWEA 3V7AE 1A47A 4LGPB 3FXIC 3ZYZA 5IG7A 1AP2A 2IBZX 4ZUTB 1SY6L 2OMWB 4YDKH 1EHXA 1WFMA 5D1QC 5FYKH 2EZ0C 2NUPA 2X4UB 4N9GA 3PHOB 5EU3B 2IC2A 1QR1B 4GRWH 3FULA 4ORZC 3IE4A 5LXGH 4IBQA 3ZW3A 1KYOK 2NTSP 3T2OA 2P80A 5AYUH 3TBYA 1CBJA 2Y7OA 3CBKB 2MNJB 3QQ9D 3D3VE 4OFDA 4I3SH 3C6SB 3R8BB 2Z65C 3GSQB 2EXYD 4KK6C 3FONB 4U4IA 4Y19B 4I9WE 2W0KA 2VW6A 2H6PB 1IO4C 2OMVB 1G7JA 2YLHA 3K7UA 3NAAL 4GW4B 3C9NA 1HNFA 4HU8A 2W1NA 3UTSA 2XTJD 2QPFA 2ED7A 5CGTA 4F80A 4M5TA 2HH0L 4MAZA 1O7SA 2JLLA 4YO0A 5D7KE 3RUGE 4F8QA 1SXNA 5A2KH 3UC0L 5BUAA 3GFUA 4QRPE 1ADQA 4X6CB 3QRLA 3MXVL 4IMLB 4TOYL 5KS9B 1B0IA 5T3ZE 1TQTA 2X0WA 5IFJA 4ZMVA 1H15A 1GAFH 4XNQA 5ITBH 3U2IA 5MEOA 1OPGL 3ASNB 4QRRB 3BPNC 1FV1B 3SCMD 2RAMA 2ZOKB 4H8WL 3K81A 4UNTA 3GRWL 3VFRA 2J55A 1V10A 3HS0B 5EIIG 3SKMB 5D96C 1WBXB 3V5HB 2CLVB 4IOIA 4CSPA 1VADA 5D1ZC 4B9PA 4XOEA 3MRBB 4PRHE 1NIDA 1SOKA 4MWFA 2WWOA 2XOTA 4OLVH 4WJ5B 3C8HA 4XPAH 1HKFA 3A6OA 4Z23A 2JLPA 1G1KA 1L9SA 5C1MB 2GI0A 4CU8A 2X4TA 3BW9A 5IV2B 1JTTA 4O9HL 4W9GC 5H37G 2JB5H 4YSSA 3Q48A 2IANE 5EZOL 2O6EA 1UENA 3VA2C 3WXVL 1SF5A 3VXNA 1S78D 3R0MA 1F4XH 2NY4C 4Z7UB 1J1OL 3X13B 4HUMB 3N40F 4MMXB 2A1WH 1Y6MR 5T1KA 5I66A 4XMKL 4A55A 2XNAA 4V11A 3LSOB 5FECB 4M6AA 1OGSA 3K8LA 4X4ME 1IKFL 4UT6H 1MIEL 3FU7B 4BELD 5HYQB 1BF5A 1LEIB 4LLQA 5AW8B 1E5CA 2IFFH 3BPCA 5G5DA 4FS0A 2Z7YA 3C60C 2ROYA 3BWZA 1KBPA 4JFHD 3SPGA 3X14B 1AH1A 4M6NH 2E59A 1TZGL 5SX4H 4LLAA 3CDZB 4XOAA 1VERA 5AL8A 1IC0A 5E4EC 3SZKC 4IU3A 1Z2KA 2WO2B 1UKQA 1EH9A 4PGDA 1NEPA 1Q9KA 2E76C 4GO8A 5HI5D 1DQLL 3OZKA 2GJJA 1U8PA 4JRLA 4Y8DC 3WEXA 2TAAA 3UTTD 3HNTL 3ZQ9A 2ZF8A 1HFUA 5KBMA 1BWWA 2IH1B 2KZKA 4EN3C 4HOWA 4LIQH 3OAZH 3HRZA 3T0BA 1X5KA 3HBQA 3FQXB 1U36A 2AK1H 3QUZC 2BVYA 3NCCB 1QKZH 4OD2A 4FHKA 4Q58C 5CZKA 4UTAA 2H0PA 4JDEB 2ZUUA 3NH7L 3D05A 3POCA 4WHYH 3WKMH 3GYRA 3THML 2XLLA 2VDLH 3B8YA 2VXVL 4GQPH 4I4WB 4U3XA 1B4JL 3CK0H 2A3TA 4HH9B 2J25A 5TFSH 3CLFH 3Q1SH 3VA6A 1INEL 4F58L 4KKBC 2LLNA 1OAXL 2F15A 4ECNA 1X5XA 5KJRH 1FNSH 4LCWE 2ARJQ 1AQKH 1I7UA 3U6RA 4QLRA 4L4VE 4FFZL 3X12B 1SUHA 5DWUL 5KN5A 2VL4A 4H5SA 1UACL 5ACMA 1ZA6B 2YARA 2ENPA 1G9HA 2FEDC 2OMXB 3Q8EA 2BNRB 2BVPB 4DSYA 4MXWH 1UJ3B 5MEQB 4N3TA 4UILL 1TJMA 5EORL 4AW7A 4BA0A 3ZTNH 3F62A 3ARWA 3SPVB 3HLAB 4FQ1H 5I1LA 1L7IL 4ZDHA 3KLHD 3FUDA 3WUZA 4XNUH 4E41B 3UPRB 3VFNA 1DE4A 1MWAL 5J5EA 3L2LA 4M1CD 4PLOB 1GMEA 3KPSA 4X4XA 1KENL 2DTSA 5HHVH 4AM0Q 1ASQA 2XTLA 1TOXA 1PZSA 4FXGB 2NMSA 1X5YA 2J71A 3HI1A 3VXMB 3BZEB 3PL6B 3F5WA 2TRHA 1LMKA 5FK9B 5DGQA 4KHTL 3W37A 3RBGA 2YQ2A 1GGYA 1C7SA 1QW8A 2NTFA 1I7ZA 2XICA 2NY1D 1UYWL 1G7MA 3UZQB 4P9HL 4MNHA 3MJ6A 3TA4D 4N0YL 4JDVB 3RKDD 1IL1B 4E42B 3VXUA 2ZX7A 3F84A 4U7MA 1YY8B 1QTPA 3H6JA 4K71C 1JK9A 5IMLB 2X6CA 5EUKB 3FU0A 3U9UA 3HG0A 2R1XB 2UXGA 3EHBC 4B7IA 1WZ1L 4EDXA 4YHLL 5HYSA 2AJVH 5JNYB 5KVMC 4PM1A 5JXEA 1OV8A 4D2NA 2IDUA 2VSDA 4DW2L 4QDGA 1ZANL 2KBGA 4HS8H 1QYGL 5L88L 1PFOA 4Q14A 1QSFA 2PP8A 1JRHL 4M93C 2HCZX 3KPPB 4NJAL 4HQQL 1XR9B 4QI3A 4OGXL 4FFVD 2YAEA 2D4DA 5FCSH 3P2BA 4MQXD 5IOPB 1BVKB 1SFHA 4PJHF 4U1MA 4XNMB 1T6BX 3PCYA 1OM3H 2J5WA 4KTDL 4PJDA 2W9EL 4TTDD 4MXQC 3ZYOA 2R8SH 2CD0A 1MLBA 1DQVA 1LP9B 4LASH 4NI3A 3ZKNC 4YSQA 3LQAC 3S6CA 1IT9H 1QI4A 3REWB 5T3XL 2BW5A 4JM2B 1U91A 3OKLA 2NQ3A 3K91A 4JPWL 5E2WL 1D7BA 2IH9A 4XBEH 3SEPA 4M7KH 3RX8A 1CVRA 4JRXE 3A4AA 4DTGH 3V79C 4QTFA 3CVHH 3QIBB 3EJJX 1NIBA 4XCCL 5HY9B 3Q6FB 1AOHA 4PTTB 1FE8L 1K8IA 4AWJC 4BQCA 3DO7A 5FS5A 1ROWA 5IQ9A 2YGOA 1XB8A 3TEZA 1Q1PA 3DOSB 3GIZL 3QXDA 4ODUB 5JPMC 4FTDA 2YD9A 4KBPA 5I19H 4TNWF 3VD0A 3GHBL 3IMVA 3KVDD 1RJCA 4MNQA 1KB9K 5D55A 2ED8A 4OM0L 5IUSA 3CFUA 4XBPB 5DQ9A 4KZEH 1CFNB 3NJFA 1YCSA 2XYCA 1AD9B 3MODH 2HJLB 3JSSA 2EIBA 3MLUH 1WAAA 3QS3A 5FO8A 3EJZD 4X4ZA 1E28A 2DWSA 4WO0A 5IG7B 3QIUD 4NHUA 4XMXA 2PYED 3KPMB 3SDCC 4G8IA 3VQLA 2VC2H 1FG2A 1MFAH 1EHLH 2DQUH 3KYKH 4M7JH 1FCCA 1AR1D 1QFUH 3DIVA 4LOUD 1XAKA 2VZOA 3DK0A 1ODAA 3QQDA 4K9EL 4X5PA 1R0AL 4BXVA 4RWYL 3QO1B 4LOVA 3QB7C 3QVAA 4WSJA 5B1AB 4NRZB 3WO4C 4ZS6D 1N6QL 4Z5RB 1BGXH 3VXOA 4RZKA 4DN3H 3NCWA 1G7JB 1NZRA 1F56A 4P3WA 4PJHE 1SJVA 1QQDB 4GO9A 5E2TH 5T3ZH 3EGSA 3K6IA 2D7TL 3GC3A 3IFLL 3SB3A 4LVHB 2I9LA 1C5CL 4YO0B 1I8LC 1PY9A 2WSKA 4LEEA 3W38A 4YQXL 2BJMH 3E38A 1MHEB 2AJYL 1X5LA 2X1OA 4IS6B 4HSQA 3UBXI 5HDLA 1E3ZA 3JVGA 4OZ4A 4POYA 2OSYA 3QBTB 2FGWL 4B95C 1H15B 4LL4A 3J07A 3P9WB 2V5TA 1ETA1 1JZ2A 2D3VA 4EOWL 3QPKA 3MCKB 2UX7A 3QEUA 4KXDA 3IN2A 3VFRB 2FHFA 1TJHL 3QQ9C 4QXTB 3RDJA 5D7JB 3CFDB 3GDCA 4NT6A 1LEKA 4GG6F 2G5BB 2OTWA 4G83A 2EXYC 3QNFA 5E70A 2H1XA 1U3HD 2ICCA 2IVFC 3N1FC 4PWEA 1MFEL 4W9LC 3LEXA 4MQSB 3ARSA 3MDJA 2XTJC 4KFZC 3M6DA 5CIPA 1OGAD 4R4FH 5AYQA 5CP7B 5JOEA 3BN9D 5KVFE 2A6KA 1AFVH 3FRUB 3QUHA 4I0CC 5F7EH 1V3LA 3GHEH 4I0PD 4TLUA 4OI9A 2WKLA 2YPLA 3MO1B 2QADD 2XA8H 5FLVA 2C3VA 5GZND 2XWXA 5AVWB 5B39G 5D2LF 3OX8A 3MRQA 1KN2H 1H6UA 3IGKA 3SCMC 4CDHA 1BOGB 2XNAB 2R0KL 1LNUA 5JOFA 4YSDA 4K0OA 1R5IA 3KEDA 5EOQL 3NRFA 3AWFA 2O5XL 5DMIH 1VA9A 4F8PA 2DD8L 1N5AB 3D0AA 2F53E 4QIRA 2BERA 3UGXA 5EC2A 5EF3A 1SM3L 2Y7LA 5SX5H 1CL7L 2F74B 1QX1A 1ZLWK 4DKTA 2E7CA 2LOEA 4LQFL 2OXGB 4ZUSA 1RKRA 1FO0A 4E68A 3SKJL 5JUEL 4PGDB 3U1SH 3IU4L 1Q9KB 1FAKT 3UAFA 2QQKH 2IQ9L 2XBZA 4PG2C 5TF1H 1O5DT 4FE9A 2R29A 1CS6A 2A6JA 5DMGD 3WEXB 2J8UB 4JLRB 1S78C 1BZOA 1XGYH 3MROA 2EDDA 1F4WH 2FYVA 1ZVSA 1NKOA 4WTXA 1GGTA 3AGVA 2HPOA 3AREB 2COVD 2RR3A 5CKGA 5DI8B 3TBCA 3C2AH 4TYUA 3A6BL 1YMME 4DP4X 4JG0L 4JQIA 2CSPA 2YMTA 3SQRA 4OD2B 3QFJA 3FU3A 4EPSA 1XGPA 3L4XA 4CVUA 3UJIH 4YPGA 5M94B 3MPCA 1SN5A 2DZEA 4QCIB 3WIHH 1RK7A 4IKNA 5I76A 1F4AA 2CRZA 1G7IA 3H42L 1WTLA 4IU2A 4J3XA 3HG4A 5HI5C 4U0QB 2IALB 1J05A 2AJUL 2WCSA 3QRGL 4PJCF 3V9EA 2XWEA 4TSBH 3AXLA 2VLJD 3V4UL 5GGQH 4NPYA 4JO4H 4OI7A 5KN5B 2NW3A 2AQ1A 3KYOA 3I6KA 2YMXH 4H5SB 4LO9A 1I9EA 1ASOA 3QJHB 4FULA 1CIUA 2FWOB 1B9ZA 2ZAHA 4AV0A 1CXKA 1OAQL 5E00A 2GT9A 5D9SA 5LAPA 2A9ML 1NGPL 3ALXA 2DTMH 5JOPD 3HNVL 4Y2OA 1BEYH 5I8CA 1RIHH 4ZDHB 3IYLW 1ZGLP 1BA9A 3CZFB 3PWNA 5E6IB 5C8JB 4XNXH 3QDGE 3OKOB 2AV7B 1N68A 3GXDA 2TSBA 4GG8A 1QABA 3B2UC 1CZ8L 4JEGB 3RG1C 3UZVB 3ZKMD 3O4OC 3MJ8B 5FCUH 1ROCA 1AHWA 1MEXL 2BSTA 3F7VB 2WBJB 3PP3H 4ISVA 4NN5B 1E4XH 4P2RB 1MWOA 1B4RA 3QCTH 4W70A 1L5GA 3SYQA 4TLTA 4Z0BL 3TGXA 5IW1A 4J3SA 2JJUA 4UT9L 1I7ZB 5F3HB 3T4AA 3RBSA 2J5LB 3D52A 3DURA 4MNHB 3ATFA 5CMAA 2WO3B 4X8CA 1E8ZA 5C9JA 2HZHA 1X7QA 1XF4A 1JK9B 5SV4A 1PLGL 3U9UB 3DDFA 3V4LA 4HEME 5CD5C 4ADJA 4C4BA 2CA3A 1FUNA 1AG6A 2BVQA 1E27A 5HYSB 4Y5YC 1S5HB 3TBVA 4DH2A 5HYEA 2E9WA 4OZHF 1XCQB 5BNXD 5FKPB 3RGVB 2BVOA 5C07B 1AMXA 1H6FA 3LKPB 3TO4B 3VXRB 3FCSA 3M17A 5A40E 3G7TA 4I85A 4YE4L 1QLRB 4ZPTA 1A2YA 1EO8H 4G6FD 3GMQB 4HIEB 5CJOH 3UEZA 4FJZA 1LEGA 2VXTL 4G11A 2JB6A 2J12B 5D7LB 1FL6A 1NGXB 4PJCE 4TLKA 2FEJA 1HU8A 4PJDB 1IQWL 2J1YA 3RKDC 3U25A 1GOHA 1M7XA 2IFGA 4RETB 2EE6A 3NFNB 1SMOA 3OPZL 4O2CA 2W91A 4RBPH 4RRPM 5IROA 4ZMNA 3PJSA 4TMPA 1U91B 2WVSA 4RX4D 1SBSH 3IDXH 3DUSA 3TIDA 4KITB 5BRZE 4CC4A 4JM0A 5JHDA 3GKWL 5B21A 3SY0A 3S7GA 5FDWA 4W4OC 3QHFL 3KXFE 2F6AA 3HE6D 5FX3A 4UANA 5B7MA 2H3XC 2GC7C 3PU7A 3QWNA 4EMZA 4CVZA 5AFAA 4M43L 1IGCL 4FFVC 1ORQA 5EF0A 4WY7L 4MQXC 3OGCA 3QXDB 1U8JA 3GK8H 3MN8A 5KBDA 1V7NH 1KT2B 2UUDH 4TTDC 4YDVB 1UASA 3QH3A 4J6IA 1S3KL 4BK5C 3DX8B 1OLZA 4TSCL 1MKFA 4C56D 4LPCA 3MQIA 4ABWA 1ACXA 1HJCA 5F7HA 3UXFA 3QWOA 1NGQL 4XP1H 5AW5B 5EDSA 2BS71 2BSSA 3RAJH 4AQ1A 5FGRA 3MRMA 1R46A 3C6LB 1YJDL 5IW3A 3RP1A 1UADC 2XPYA 2QVIA 5F7DA 4WI0B 1TSRA 4P9ML 3CSYB 3EGDA 4D0DB 1DN0B 2ZYRA 4XN8A 1FYTA 3UX9B 4FADA 1IGTB 3ESNA 4OZHE 3QQDB 4U1JA 2RQEA 3RL2A 5LO7A 4MBRA 3DROA 4UIKL 2Y24A 3T2NL 1LHZA 5IFHH 1R3JB 2A4EA 2VXSH 4JS7A 2EDRA 2SODB 2Z7UA 1MG2C 2BFVL 5KJ7E 1YO4A 2FHBA 1BXAA 1K4CA 3KM1A 3QS2A 4X9FA 5IMOB 1E5AA 3K4ZA 3MRDA 1N3NB 2WBKA 2CLRB 3OLGA 4H0GA 1JP5A 32C2B 4P2QD 4R96A 5CJ8A 5KBNC 4GAGH 5E94A 4GW5B 3RILA 2YGVA 1YEGL 5IMKA 1MWAB 3QJRB 1Z0NA 4MYWB 1E7UA 1MCBA 2AQPA 2I9LB 3ERXA 2L7UA 3EJZC 4X9IA 4YXKH 2NSQA 3NIDF 3QIUC 2PPFA 5CSZA 1PKQE 2JKNA 4C4KT 5I1AB 4H8UA 1ZHLA 4M5ZL 1ANUA 2ZONA 4NQCD 3PUCA 2WWKT 4OZ4B 3VD3A 3S34L 4F7EB 1AR1C 2XWDA 1E7VA 1E5YA 2CO6A 1IZKA 5K9QI 3JWOC 4MNGB 2EE2A 2GYSA 2DM2A 1LK2B 2CH8A 1GOFA 4AL8L 1XTLA 3AM8A 2LR4A 3QEUB 4N86A 3ZGHA 1IKNA 4OCWL 2XQYA 2YA2A 1SMDA 2WINA 4PRPA 1VPOH 4NT6B 5KVFH 1AHMA 2BS8A 4ZS6C 3SDXE 2X1XR 3MJWA 4IK6A 4AH2A 3RZCA 3QG6A 3Q9QA 2JK5B 3PF2A 1ZAGA 5LGHL 1G7HA 1ZLSL 1PCXA 2ATKB 3O3EB 5DFVD 3LZPA 5CIPB 4JR9H 1CD8A 5K9OA 4BXSV 2A6KB 3FQ4A 3QNXA 4U33A 4E0RA 4Z3EA 1T0OA 3VTTA 2NY5L 4UBDD 4X6FA 1BD2E 4HOZA 3DGCR 4GPVA 3UL4A 1U4FA 1JZ7A 1MCDA 5J11C 1KLUB 4JFDA 2YA1A 3T2QA 5HYJA 1AD0A 3RX7A 3OX8B 3MRQB 5FYLD 2QJDA 4JE4B 3VG9B 1HQ4B 3IRZA 3W2DH 5JPNB 1EQWA 1SEQH 3GI8L 4Y4HA 3EYFA 2UZYA 4L1HA