2JSFA

Solution structures of the envelope protein domain iii from the dengue-2 virus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords domain III of ENVELOPE PROTEIN E
publication title Solution structure and neutralizing antibody binding studies of domain III of the dengue-2 virus envelope protein.
pubmed doi rcsb
source organism Dengue virus
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jsfA00
2HG0A 4BZ1A 5KVGE 3IRCA 5AAWC 4UTAA 5KVDE 4UTBA 2JQMA 2I69A 3WE1A 3N42F 4FG0A 3UZQB 1RERA 4FFYA 3G7TA 4UT6A 5H37A 5B1CA 4FFZA 1ZTXE 3UAJA 2JV6A 4AM0Q 5KVFE 1S6NA 3C5XA 3UZVA 3UYPB 2V33A 2ALAA 3N43F 5JHMA 3UZEC 3C6EA 1OANA 5GZOA 2GG1A 3N40F 1SVBA 4ALAC 5LBVA 3J27A 4AL8C 5LCVA 4BZ2A 5GZNA 1OK8A 5JHLA 5IZ7A 3MUUA 1PJWA 3N41F 1UZGA 1URZA 2R69A 5KVEE 2P5PA 4GSXA 4UTCA 1Z66A 4X42A 2H0PA 5IREA 1OKEA 5LBSA 2R29A 3VTTA 4L5FE 3P54A 1Z3RA 4GT0A 3N44F 2JSFA 5AAMC 1TG8A 3J2PA 4UT9A
chains in the Genus database with same CATH superfamily
3KWWA 4B9IA 5FYJD 4KUCF 4N6QA 4X7SH 2FWOA 5JHLL 3NP3A 3MX0B 4JZOA 1KJ2H 3C6LC 4TVPD 4AL8L 5CGTA 4ZPTA 3BJ91 4IRZA 4R4FL 1HIMH 4WFGD 4HG4J 5GGTA 4Z76B 3BUPA 2Z0BA 5FFLA 1IBYA 2XJKA 5EPMA 1S7XA 4XMKL 2Y1YA 5JZ7D 3MREB 4MMYA 3OZ9L 5C9JA 5I6LA 3K74B 5AW5B 1S5HA 5DEGB 1FWXA 2VDOB 3QZPA 2F08A 3PWPE 4RDQF 5I1LB 3B83A 4XOAA 5LKNA 3BH9A 1AO7E 4J4PC 1E4JA 2NUTA 4IGBB 2JB5L 1CT8A 1UB6A 3L81A 2VDRB 3EADA 1G9MC 3Q2CA 4NKIH 4PD4K 4P2AA 4ZO8A 5B4MD 1SJEA 4HQQL 4I3SL 4G7YH 4HWZA 5DS1A 3VCLA 1TQTA 5IFHH 2HPOA 4IRJD 1E90A 1NGXA 2UUDH 3T9WA 1SOKA 5EUKA 1DQLL 1YNKL 3WJLC 4ADGA 3DX7B 3KBHE 5J12B 4ODTL 1OARL 1UT9A 5LUMA 1B3JA 2BNRE 5I16A 1DDTA 3FRUA 5D8JL 3D6GA 1Z3GH 1MPAH 2VDOH 3RDTC 3FQ2A 4WGVB 4FXKB 3ZE2B 2BNQB 1MCFA 1KLUA 4Q52A 1AYOA 1OK8A 3HMXL 1INQA 4P5SA 2H2SC 1U2CA 1DUYA 2PP8A 1A7RH 3BUDA 5HHVL 4WHCA 3SY0B 5ERWB 4MDIA 2QDVA 1LJMA 2B77A 5A6IA 2ARJQ 5EOQH 4ZUTA 1BJ1H 2JH2A 1YYLH 1F3JB 2B5IC 5JDSA 1CZ8L 3PP4H 5F7UA 5KYNA 3WTWA 1OGSA 4NFBA 3SKMB 4RSVA 3ABMB 3LD8B 3QZNA 4MBRA 3S8WA 3BGMB 1N9PA 4NQEE 4PS3A 1FH5L 4PJHE 2Y2WA 4JL1A 1MI5E 2GUOB 2WHVA 4P5TD 3LZOA 2BOBA 4G43A 4MQSB 5K9OB 3WENA 4MAYA 2XICA 1NBQA 2KC0A 4WEEA 3UYRH 4PWEA 4NQCD 5EEVA 1G4MA 3D2UB 2NY4C 4HDIB 3UAJD 5DUJA 1QSVA 5DMIH 2TSBA 2R39A 5DJDA 3BDYH 1TQVA 1CVSC 4LPCA 4PY8J 3PAUA 5F7DB 4JZJC 4K55A 1IGFH 1A9BA 3FTVA 3MUY1 3STZB 1YN6A 1GGBL 3U46A 2K3HA 2Q76B 3LQAC 3S4SB 3QFDA 3QJOA 4Y19B 1EFXB 5F44A 5JIMA 1HHGB 2JQMA 2CNYA 3HCVA 4ODWA 3AXLB 4G6JH 3GSUB 3MGOA 3KVDD 2XVLA 1FNFA 3EO9L 4A2EA 4QHMA 4QGYA 3FOMA 1HEZA 1HL8A 4IMKC 4QR7A 3T2NH 1GZHA 3EOBA 4U1SB 4PJHF 4Q6IC 2R4SH 4G8IB 1IQDA 1KXVA 3RTQC 3VXUB 2B59B 1V05A 4FFZA 3WS3B 2HJLA 4JGUA 3QIWB 5I1KL 1CQKA 2H26B 5HVHB 1L4IA 3C2AL 1YUHA 3AABA 4ZUVA 3FW6A 4OVUA 3NJGA 4BCZA 2O5YH 3S2CA 3CFUA 4ZMZA 4JPWH 5EBLB 5LXVA 3B7TA 5I6PA 2ORBH 2X4TB 3MV7B 1A65A 1WAAE 2XCMC 5ESAB 5C0AE 5ICYB 4BFOA 3NFSL 1NJ9B 5AKTA 5D1XA 3V0FA 2EYSA 1I8UA 3ARED 4TVUA 2NLJA 5J56B 2NMSA 1ETZA 3MUGB 4YEFA 5IEHB 3H3BC 3TURA 2DMKA 4NGHH 4D0DB 3HZMB 2E7DA 1WEJH 1CXEA 1LXMA 2KHAA 4GLRI 3UMTA 1JZ8A 2LLGA 3PNRB 3Q8EA 2A74B 4LF3A 1W6WA 2XKUA 4DPAX 3CFMA 4HG4K 4LHUA 5GGVH 1DTUA 2DYSB 2IMMA 4Q2ZB 4J3UA 5DMKB 4TRPL 3RAJL 3D05A 5KYWB 2AI0L 3RWEA 5I2IA 3TA3D 1L9TA 2XZCH 4NC1C 1WJ3A 3OKYA 4NQSB 2X4UA 4UAOC 4EEEA 1SBBA 1Z9PA 2HB0A 4N90D 4ZX6A 3H0TA 1KCSH 3WGUB 1H15A 2IGFH 1ZY9A 3BEWB 2CHXA 3KPQA 4HKZA 4EQ2A 2GIXA 1B0IA 2G75B 5FF6B 5ID1B 3BUBA 5AYUH 4W9DC 5E4AA 3D3VE 3TJPA 1AHWC 3AADB 3IDGA 2WQVA 4X6BA 1WAAF 5I5RA 5L0QC 2H6UA 1X5GA 2WXFA 4X80L 1K85A 4I9WE 4HD9A 1YJDL 3BJLA 4ZFGH 5IREA 3WELA 4N1CA 4YXKH 1IBGL 4CMHC 2VAAB 5LGHL 3IGLA 5DYFA 4DK3A 5C0EA 3FSOA 5LBSA 2E59A 4HK3J 5AZUA 5GGVY 4N25A 5B8CC 5BRZA 2GVYA 4A39A 1XCXA 1QWHA 1GOHA 1MHEA 5CP7B 3MJ9H 4M1GL 5CFHA 12E8H 2DLHA 3CK0L 3T6QC 1JZJA 4NNPH 1CGUA 1A1NA 1W8EA 2Y3NA 1DLHA 1GY1A 1KOAA 5D96C 4JHVA 1M9WA 3EO0A 2YA0A 5IB3A 1WUZA 2VERN 3BYYA 3I02B 1A3LL 3FAWA 2VDQL 5IOPB 1J8HB 1RZQA 1IMHC 2EIKB 1ANUA 4B9YA 4U6YA 2I69A 1B2WH 3AQDA 4M03A 3K6SB 4DFIA 1Q9WB 4P9HL 1FFRA 2C1OB 4PLOB 1B4RA 1AGCB 1UJ3B 4AIEA 1A14H 2NUPA 4RAVB 5F0LB 3GJFK 4P59H 5ICUA 3OAUH 3EYUL 4I9XA 5EA0H 4DEPC 5F7AA 4QTIL 4XBPB 4DGVH 1RJYA 3LKNA 3LS4L 1QBLL 5I18L 1LEKB 1DEEB 4HIXL 4OT1H 5BO1L 5IUCA 1G0XA 3NJLA 1UWYA 4LK4A 4F7EA 5T1JA 4BFJA 4CKQA 3PWLB 1AG0A 1MRDL 3AB0C 2UV3A 2BZDA 1BF2A 4ZS7L 2DWXA 2Y06L 2BNQD 3DYOA 3I6KB 4TULL 3RFRA 4OFPA 3SPGA 2K0RA 1MFVA 3P1VA 5D7IB 5KSAC 3NCXA 3TFBA 4JRXB 3QWRA 2OFQA 1M71A 2VN4A 5E5RB 1J9SA 4AEFA 5LWYH 2BWQA 4X7DC 4ZDHB 2W0FA 2EE0A 5B39A 3RJOA 1YEJL 5JPNA 2XV2A 2XETA 3GMMA 2G9HA 1CGTA 4MMZB 3MCKB 3IETB 4L3EE 1XH3B 4BZYA 3MRGB 1HSAA 4JDEB 1E28A 4UTBL 3UMNA 5JXEC 1TKWB 1I1FA 2C4XA 3PCYA 3QEQA 4JMNA 4PJBB 2FQDA 5F6IC 5I6OA 3TIEA 5KJRL 3QHZH 3ILQD 4TNGA 5F1IB 1PSKL 3VFOA 4OR1A 2C9UA 3HZVA 4ODVL 4BA0A 3ML9A 1E6JL 1XX9C 1HDMB 4QRRB 4F7CB 5HPOA 3V6FB 5A2BA 1BFVL 4IOSD 5ACZA 1Y07A 3QISA 1WE5A 2X41A 1FVEA 4PMFA 3TT3H 4MX7A 4M3JA 3S5LB 4NEHB 4XBMA 1DQJA 2PYFA 1N59B 4FCAA 3D1MC 1QSEB 2LVCA 1H9VA 2YOCA 4XNQB 2ZXEB 5INDB 3TBWB 1P9MC 2WKOF 3FB6A 2MMXA 1NUGA 2E46A 4H8WC 3QZMA 2DQCL 1JNHA 2ERJC 3G9AB 1NC2D 1SF3A 1FVDB 3MLRH 4TMPA 1BEYH 1MH5B 1QKZH 3JTSA 2LLLA 4OIBA 1AAJA 4PW4A 4OKVB 2NXZD 2VJ8A 5D93B 1L9MA 2H0JA 5AW8B 1OAYL 2R9HD 4AT6A 1D2OA 1KPRA 1IBZA 5D7SH 5DZJA 1FBIH 3P3TA 1N6UA 2WCSA 3QP3A 3UBXI 3A24A 4NLAA 3L1FA 3BZ5A 5IMLB 4HXAH 3DKHA 4Y9CA 5FYLD 1TQBB 5TE6H 1QSFB 4UDTA 4E0RA 1AXSB 4ZFOA 5LO7A 2OTWB 4YDJB 4HJEA 3HG1D 1QTYT 4BQ8A 4M8VA 4TOYL 3VXMD 2DWEA 3VX1A 4JFQB 2WXIA 3OKNB 1XXFC 3VMNA 2DF3A 3HFML 3IRPX 1I82A 4XVSL 3WL9A 2WLKA 1N2RB 3SO5A 3JZ7A 1AS7A 4S1SH 1W0VA 4NS0A 2YSTA 3LS5H 5DEFB 1UG9A 1TZHB 3SDAA 4AYDC 5KZCD 3C8KB 5T3XL 1VIWA 2Y3AA 4JFHD 3D08A 2CLRA 1I1AA 1A6UL 1DJYA 4OFKA 4PS4H 3U83A 3VFGH 1ID2A 3ARFD 4KKNA 2V9TA 4H1LG 4A7QA 4ZZKA 3NAAL 2GSIA 4QRSB 3VXRE 3H56A 3EOTH 3O3AB 4X6FA 5L2JA 4FHBD 1ZHBA 4I85A 4OZGE 5MERB 1K8IA 4MQXC 3GHBL 4I5BB 3HC4H 3MXWH 1Q0XL 4M61A 6PAZA 3RBSA 1E27B 7FABH 2DQFA 2CRMA 3BWZA 3G6DL 2C34A 4MAZA 5GGQL 4DJMA 4HWEL 1QA9B 4HJJL 3BWUC 4A68A 1ZPUA 1JXKA 2HAZA 1QI5A 3KYOB 4A7UA 4C55A 2XXGA 2YRLA 3BN9D 2Z31D 3QNYA 1KFAL 2CO6B 2XRAH 1P5VA 2YSSB 5DEJA 4H8HA 3BVNA 4JCWA 4DPRA 3B2VL 5HYSB 4R9HA 3NSCA 4RRPG 2CRZA 2X87A 1LILA 4JHZA 1W15A 1OT2A 4JVUA 3NK3A 3QQNA 4M93B 2WXOA 4G59C 4HUXA 1S9XB 2WXGA 1JNNL 3P3YA 3UZVB 1FNEA 3F7VB 3MSPA 1JZ3A 3PQYB 4F37K 3C2SA 2L7EA 3QR1A 4DVRL 3PHOA 5DD5L 2R0KL 4Z0XA 4OZGF 3QIBB 5L8KB 32C2B 4PB9L 5FUCE 3UP6A 2KLSA 4WI3A 2XTJB 3LMJL 3MOBH 4KDTC 3QQ9D 4XMZA 2IAMB 2UZPA 3C5JB 3PV6A 1GGIL 1SF5A 5AD0B 4JO8A 4KRNA 1DVFC 4MNGA 3DO7B 1GTNA 4V1DA 1BREA 1SXBA 2WXHA 4ZAKC 1CBJA 3TZVC 4ANUA 1U8KA 5J3HD 3EYFB 1RUKL 4NQUA 1DZ0A 2JCCE 1FLRH 4GSDL 3CC5A 3WJJC 2O6CA 5I8OH 1BX2B 3MBWB 5J8OA 1RVFH 2OMNA 1V10A 4O51A 4C59B 3ZN6A 1A6VH 1NFDA 3UG5A 2DD8L 5C0RH 5GSVA 4DWHA 3SBWA 1I1YA 3PWUB 2J8UE 2HLAB 3UZQA 3H3KA 4TS6A 1FIEA 1J48A 2OJEA 2GSGB 1C5DB 1F58L 4UU9B 3V4VH 3B7SA 1CQYA 2OX5A 1CLVA 3RWIB 1T5KA 2BX5A 4WHDA 3BO8A 3TBYA 3LPGA 4POYA 5E6IC 2ODHA 2WINA 4N0CD 4APQD 4E2OA 5DD3L 3RHWF 4F7PA 4G1EA 4R7DA 1JWMA 5KBNC 3MOQA 4JKPL 3WBDA 3N1FC 2FAUA 4LHUD 5DS2A 2HPTA 4QAWA 1JMZA 2CAKA 3F7LA 4YXHH 5KOMC 1P6WA 4QRRD 3ASOB 1CTOA 1P0SE 1MCQA 2R2CA 1A4CA 1CICD 2YD7A 2JCCF 3R06B 5HDBE 1MCNA 5IY5B 5BS0B 5JQ6H 3EH1A 3W5MA 3G08B 4YDVB 1RURL 1I9IL 3ARGD 1PQZB 3QT2A 5BW7A 2XWZA 1GYVA 2A9BA 3SQRA 3ZE1E 1FUNA 1NPJA 1QSED 2J8UF 2Q0ZX 5H4YA 2GK0B 5B1JA 4DUXA 2XJLA 2ZKMX 5D1QC 4UQAA 1EV2E 3IDYB 1WA0X 4DUVA 3QRFM 1HZKA 1GZPB 2VMCA 4HMCA 3KD4A 1RJLA 4OGQC 4GYBA 4RMTA 4PJCA 4YR6B 3V52L 1QFWM 1X4ZA 2Z1PA 2WZPA 4TUOB 4I77H 2ZCHH 2XFGB 3G5VB 4I13B 5KSUA 2X2HA 2WWMC 4QUOA 1KBVA 1HKLH 1RIHL 1TZIB 3TO2B 1T1ZB 1SYVA 2OR9L 3FUIA 5IVOA 5DJYB 1U93B 2ZSVA 1ET7A 3F3HA 5HDBF 1EUUA 2K8MA 2X4NB 3S8GB 3EJJX 3BFWA 1MAMH 2FE0A 1QSFD 1JRHH 4IKLA 4L1BA 4QWWC 4LHQB 3P3UA 4GRWE 3T09A 3NSXA 3X1NA 4WI5A 4Z7OE 3UJJH 4LAQH 4NJ9L 1O6VA 3GI8L 3KVPA 3ZE1F 1R1CA 1CO1A 5TPWL 5DFWH 1EHXA 2ZPKL 4PWGA 3C6LB 4HH9A 2WO2B 2BK8A 4YX2H 1R4XA 1H5BC 5ALBH 4NB7A 1P7KB 3WEMA 2VLME 3RPIB 1E9PB 4HF5L 1INEL 2NNFA 4FG6C 3I50L 4DN3L 3WLBA 4PJ5E 2X4SB 4O2CA 5ESQB 5GS0L 1BF8A 2AQNA 4MKMA 5I0YA 3THMH 1GCYA 1OQXA 2YZ1A 1MJ7L 3GSQB 3QUXD 2OSLB 2V33A 1HYSC 2JTDA 4AQAA 1KIQB 4FYSA 4KNSA 4OQTH 3QHFL 1CIUA 3MRQB 1FFOA 4GRWF 4KKPA 1N5AA 4Z7OF 2J1XA 4GFXA 1TTCA 4LSQH 4M7LL 4ALAH 4ATTA 1IAKA 3CFNA 3AS0A 2NW3A 4M7ZC 1KZQA 3ROOA 2Y7QB 2CHNA 4XPFH 2XZZA 2VM3A 5FM8A 1F3DJ 4QRQB 2X4QA 3RDTB 1H3TA 4HJ0C 5KTEH 1D6EA 1DBML 4DETA 2E9JA 1MAJA 5TE7L 1M6UA 4H8PA 4HIPA 3CLWA 1R19A 1G9MH 4ACTA 3MLTB 3CIAA 1B4TA 4FNSA 3WFHA 1N12A 2XX0A 4M9PA 4KI5E 5D4JA 1H3WM 1NFDE 3BW9B 2E6QA 3T0EC 4M3KB 5D9SB 1I3GH 2B5IB 2ED6A 1BDYA 5C2BH 2IDTA 1LHZA 2IH1B 4MVBC 1B9KA 2O5XH 2P48B 4CVZB 2DQIL 1N7MH 4I0PD 1RZJL 3DECA 3V0VA 1FC2D 4KMLB 2CO1A 4OUOA 4ELDA 1C8QA 3LQZA 1Y1DA 2IQAB 3SDCC 5GGSA 2XY2A 3RVXC 4U49A 1G6RB 3TN0C 1CDJA 2KLRA 3CVIL 2NY4B 4WUKH 4PJGB 1AZZC 3RPBA 4GBXA 5I23A 3EDEA 4QT5A 3FN0H 1M57B 4NT6A 5BZWB 2F8OA 1TQUA 1JDDA 4G5ZL 3VGBA 3B3IA 4U1MB 2D3LA 4JZJB 2ZNWA 3U36B 2BIOA 4FEMA 3DJRA 2GI0A 4U6VL 1HXKA 1URLA 4GG8B 4ZTOL 4J3TA 2V3EA 1M2OA 2QGDA 4KI5F 5H2BB 5HDQL 2VITA 1NFDF 4JDVA 3FMGH 1CFQA 4PTTA 3TJEH 3VH8B 5KBMA 2O5ZL 2QKIA 2GTZB 2H32A 4UT6H 4B3EA 3IJSB 4X7EC 2ZXAA 1E3FA 4LRIC 4WDIA 3RP1A 3US0A 3PE9A 4P3WA 9PCYA 1H3UA 1Q9KB 4Q6IB 3ZGIA 2Z8RA 4EO5A 3RTQB 2AJUH 3TH4T 3MO1A 3O9WC 3WUWG 2ETWA 2R59A 3GD1C 1BMZA 3RB7A 1ZHKA 4Z23A 3I75B 1FF5A 2J71A 3FO0L 5IESL 4JPIB 2IXQA 3HUJE 5I75C 1CBVL 1NIAA 3NH7H 1HJBC 3L3OA 1IAII 1GGTA 2YD1A 2XLLA 3B9EA 5BXFB 5AOKA 3SDAD 2BVPA 4AQ1C 5GJSH 4CKVX 1R5VB 4HJGB 2VQTA 4YZWA 2WTRA 2QQLL 2X38A 5BS0D 1KNOB 4IBUA 1OCWH 3KPRB 5F6HI 4A55A 5F72S 4DP2X 4RIRA 2VAJA 1U8LB 4Y8AA 4AJ0A 3TONA 5KVEL 1X9LA 3BPCA 4BFGA 1NLBH 5DURD 3WKPA 5IQ9A 4JO1L 2HT4D 5HGDA 5IB5B 2VC2B 1HYRC 4ZUWB 2JNZA 3RX9A 3LN4A 2KZKA 1X6LA 3QULB 2CR6A 3SQBA 2ILLA 2VSDA 2YWZA 4J7RA 4PRDA 1DSYA 3TBSB 4JRYE 2OXGB 3HUJF 1CTNA 1FAIL 1A7OH 4GAGH 1AHWB 4NO2B 1N19A 1F4XH 3QO0B 2PWGA 4KVCL 5F9JB 1PIFA 5L0QB 2GK2A 2I5YH 5M7QA 1NCAH 4LCCA 4WRLA 1DJXA 3I6LD 2BP5M 4XH2A 4BGDA 5AVUB 2GAZB 4YSQA 4Q6YA 1IFHH 2Z92A 4CMHB 1GYUA 1HXYA 2HRLA 2VJ0A 3RHWK 3K72A 4LPVA 3IVKA 2K8QA 2VC2H 2X9XA 5DD6B 4G7QB 1UZ6E 5B8CB 4BV1A 3E8UH 3EGSA 4NKDB 3S5YA 2LVEA 2J5LC 1KYFA 3OWEA 4UV7H 1UCBL 1OF2A 4HEMA 4HS3B 3M46A 4LSUL 4JFDD 3WTUA 1W72A 4OCXH 4FFWC 5FHAL 3VG9B 3VMOA 1JK8B 5D96B 2BO0A 3DARA 4HVBA 2WQWA 3MA9L 4XGZA 3AG3B 2NR6C 3D51A 2XN9D 3INUL 2EH7H 1MKFA 1WTGT 2DBLL 3Q2LA 3U9UA 1MCDA 1XH2A 4DGIH 3HRZB 1NH6A 3AT9A 3FB5B 1AD0B 2XTSA 4B60A 2PR4H 2XU9A 2ZSWB 3WFZA 4DEPB 2VN3A 4G3YL 4GW4B 1LE5B 4Q9QH 1IE4A 2H3KA 3RY6A 4FQLL 3LXCA 1CWVA 2VKWA 4KXBA 2WXLA 1UZ6F 1YYCA 3TYGH 4KFZC 3D85A 2QADD 4LKCB 3GHEL 2LFEA 4DW2H 2UWEE 1UM6H 5HGBA 5IV2A 2AJVL 3AB0B 1O5PA 4QEGA 4U0RB 3SE3C 3WDIA 1U8PA 1TF4A 4JFZL 2FRGP 3LKQA 1OT4A 2H1XA 5KSAB 1XIWD 2VZOA 4DNLA 1A4BA 2X6AA 3L3DA 5I1EH 4M62H 2J6EH 2NYYC 3F7YB 3N85L 3TVMC 4LARL 1WD9A 4GKZB 4Y2DA 3H9HB 4WWKD 5AYQA 3WFBL 3Q0HA 4XPHL 1J88A 3BC9A 2YPVA 3KH3A 1OLLA 3RURA 4IBYA 5T1MA 4TSCL 4GO6B 3ES6B 1TZGL 4BSVB 1K3IA 3M07A 4PLJC 5MP6H 4UINH 2MRYA 3EHBD 3FB7B 2F1AA 4KQ0A 1P4IL 2BSED 4QKXB 5D6DA 1ORQA 1E50A 4JKWA 2ICEA 5F6IB 1YDPB 2IFFH 4AQZA 2HT3D 3ZKXC 5LB1A 1XB8A 5CCKL 2AS5M 1K5WA 3MDJA 4MAUL 2UWEF 5ILTL 2PNDA 4OH2A 2DQHH 2C3VA 3QFJA 2DQGL 1KN4L 2N7AA 5C3LD 3FQRA 4LNRA 1OB1B 1Y0LB 3LHAA 1NFAA 2XHNA 5CBEA 3ULVD 4JY5L 5FGSA 3LIZA 5EBMA 3HEIB 3E1ZA 3U0TA 3TIDB 4M7KL 1RXLA 4L4TE 5F96H 4HSCX 2R7EA 3V5DB 8FABB 4JZNA 4D2NA 4J2XA 4GSQA 1E2VA 4ISVA 4M6MH 4P2QA 4HT1L 5JOPD 1ZWIA 4WU7A 4NOBA 3WFCH 1HEJC 4HGMA 2R2EA 2XNAA 4JKKA 3LHPH 3W0WB 1PZ5B 1V3JA 2ERJB 3KPTA 4L3CA 5DGRA 3GUTA 4JNXA 4MA7H 4WCYH 3RWJB 3BUTA 4X9YA 1E0OB 5F1OB 3L5WB 2RJMA 1NGZA 3PL6A 4IS6B 1YEIL 5C08B 1C5CH 4P5KB 1EZUA 2D3NA 1FE8L 5SWZE 3ZT5A 2BCMA 3PRZA 4RX4A 4YL9A 5HGAB 3EBGA 1B2YA 4I4WA 3O6MH 1Z5LA 2Q7YA 2X4PB 3MRPA 3PIQB 2HVJB 4LPYA 4RISH 2C4FU 1B0RB 3MNZB 3RNQB 1YEGH 5AAWC 4FA8A 1GR7A 1TEYA 3NZHL 4CADB 2OL3A 1FG2B 4JCMA 3HS8A 2PP9A 1FIGH 4YHZH 1HNFA 1LO0L 2XA3A 3TC9A 4AEHH 2WLYA 2DH3A 2Z34A 5T3ZL 1SHWA 2M2DA 3K2MC 4H8WH 1XCTB 3EJRA 1ZTXE 4BGLA 5CEZL 4GQQA 5DQ9B 3ULSB 4XCYA 4POUB 3QEGL 5K9JL 3DK2A 1R5WA 4OF7A 3DX4A 5MHSD 4RFOL 4JFXB 3ZUNC 1FG9C 1HINL 2R0WL 2G5UA 4JLRA 2UY7A 3US9A 1F56A 1Y18A 3HBZA 5EORH 3CU1A 5HHNB 1NAKL 5IHZB 1L6ZA 3NK4A 4OB5L 4QXTB 1DDHA 3MRLA 5AVQB 5AOMA 4DOHE 1IKFH 2FIKA 1JZIA 3V4UH 5DRZA 2YO3A 3KNBA 3N41B 1R47A 4NCC1 2O61B 2FBJH 1ZGLA 4PRIE 5BRQA 4EDWL 2JKWA 3MJ6A 5DXWA 1UUNA 5E8OA 3ROLB 4CILA 4X7CC 4H26B 1YQ2A 5IWLA 1M42A 2CIIB 5ECGA 5EU6D 3KS0J 2OMTB 4QY8A 3T1FB 3TPKA 3UYOD 2Q7AA 3PWVA 4NKMA 3W9EA 4FABL 3OZLA 4XX1G 5GIRA 2F8IA 4MA3A 3X3GH 3OG6B 5B3NA 5D7JC 4G7VH 1OWRM 2NSXA 4ICXA 4Y89A 4ZX4A 3BGFC 3SE8L 2CGZA 3AT8A 1PG7W 3GRWA 4GUPB 1T0NA 2YOAA 2N59A 1VFMA 3B9DA 2H8PA 1MEXL 2UXFA 3DRQB 3GJEB 3FT2A 4JJOA 4QXGH 4XN8A 2HRPL 3CIQA 1VRSA 2ISDA 3J7HA 5JIIA 2PYED 5A43C 1D5BB 3NEXA 3STBA 1IGJA 3QR0A 2QGBA 5E4IA 3PHSA 2JTYA 3QQDB 4FTDA 4GBXD 2VNCA 3BPNC 4M02A 4RWYH 3U6XA 4S1RL 1WT5A 2OZ4H 2D7TH 2R56L 4RAUA 2QGCA 3SDDC 1SEBB 2A73B 4ELME 3G6JB 1P1ZB 5LAXB 5T1DH 1PZCA 4UYPA 1XL6A 3FC8A 1QLFA 4OZHB 5FKPB 5GRJL 3BPOB 3GQFA 4NQVA 4O9HL 1WBXA 3RA7H 3BD3A 4K23L 3APDA 3ECWA 1IT9L 3QJSB 3OKLA 1GC1L 1ZHLB 2X28A 4LLWA 5TFSH 4NCC2 4ZAKB 2D31A 2DMBA 3MV9D 1JV5A 3ETBJ 5E51A 5EC2B 2ZICA 4KH9A 3D0VB 4PRAB 4E68A 1A6AA 4OLUH 5SV4A 4F1SA 4Y5VC 1KPVA 4TVPE 5L2KA 1OB0A 4WNQB 5CJ5A 1BVNP 4HSQA 5C8JB 4KNTA 2IIJA 2ZWNA 1KJ2A 2H2PC 4LPTA 4WFGE 5KSAD 5JNYA 4ZJ9A 3KLAB 4D8OA 1DBAL 2AP2A 1WQVT 1MREL 3IDUA 1A0QL 4WWOA 3IT8D 3ARUA 1RZ7H 3LZRA 5D7HA 3H9SA 2ALAA 1U6AH 3EOAB 4ELMF 2GY7B 1JZ2A 1TVBB 1UB5A 2IH9A 2GIMA 1SLVA 5E6IB 1M53A 2P8PA 4N9GB 3QUYC 4RMVA 3LYRA 4Z7AA 2AXJA 3QCVL 4HX1B 2DICA 2HFEA 2EDEA 3MRRA 4PQXA 3UJTL 2E7LA 2K1MA 2M1KA 3MV8B 4RGND 1XSKA 3EBIA 3P4MB 1KXTA 4A6YB 4BK5C 2V8LA 4F91B 4B3VA 4XX1E 5I1IL 1TJGL 1U3NA 1IJ9A 3EJQA 4AL8C 2D4DA 1AGFB 3VXQB 2OTUA 4AGLA 2OJZH 2I9TB 5DEGA 3QC6X 4HYTB 4UAHA 3SDXB 3F62A 2FGWL 3BKCL 3QWQB 2X6BA 4TL4A 4X6CB 2MHAB 2C7UB 1IFGA 5EUOB 2BXZA 3QXDB 5F9WC 2Y5QA 4IGBA 3IRZA 4Y4HC 4PI2A 5D1QB 4MJ4A 4DKTA 1WA1X 5F7EH 4AYID 1OCRB 2B15A 1OPGL 3W0WD 1E5ZA 4UCFA 4ZOAA 4FX5A 2QQNH 3NOIA 3Q2NA 4NSKA 3LRHA 2KKQA 4WJ5A 2UYLA 3CH1B 5FW7A 3VI3B 1BZ8A 1HH6A 1T5XA 4U2ZA 2V6HA 2ZCLL 3E38A 4ONGH 5EZPA 3VFSB 3OMAB 3SIKA 1BWMA 3IGAA 1AOZA 2ZUVA 3OAZH 1ZDQA 3BI9X 3GLAA 4NQCE 5I15L 2PW2B 4FXKA 4XP6H 3OB0K 1CE6B 3C08H 5K1NA 4XXCA 1VADB 5T5NG 2D7PA 3VQ1C 1R3IL 1F11B 4O2EB 2RR3A 2EIDA 3SY0A 4BRVA 2DOCA 5LGYA 3L4ZA 4ONHB 2OP4L 4MCMA 2FBOJ 3WIIH 3KLHD 4NZRH 4LOVA 1U95B 4HPOH 1MJJB 1F3JA 5AZ2L 1MFDL 4ZK8A 1H5BB 1J1XL 2DQJH 5FHBL 1F4AA 3BGMA 3L5XL 5FUZH 1CR9L 4XOCA 2BRRL 1LQBC 4UQDA 5JUEH 4DKFH 4K3JL 4W1TA 2W88A 1FHNA 4NNXB 4BZ1H 3FCBA 4JFFB 1E6OH 1J05B 3UADA 3PJSA 2DKSA 3D2UA 3H8NA 4HDIA 4IBVA 1E5CA 4XHQA 1FYTB 3CVHL 3SGEH 4F7TB 4PJDE 1G1OA 2X1XR 3F6IA 3EIFA 1SJHB 1UOLA 2PTVA 5DC9B 3SE4A 2Y23A 2ATPB 2ZE0A 3STZA 1U8JB 3N40F 4K2UL 2LAAA 4K7PL 3QUZD 2VR3A 1GY2A 3BZFB 3CFQA 5FGCB 4M7ZB 3TH2T 3S4SA 4JQIL 1WP6A 4BZ2H 5D70H 5GHWH 4Y19A 3CTTA 3WKMH 3QORD 1EFXA 1BOGB 2WAQA 2NSQA 1I7ZB 3GSUA 3QI9A 5IW1B 3QFGA 3SODB 3VSTA 2BSCA 5LNGA 1G43A 3GMQB 3VJ6B 5DQDL 1OD7A 4G8IA 3D09A 2B59A 1VFAB 3ZQWA 2W65B 1QYGH 2AJXL 2H26A 4BH8B 1Y6KR 3JXAA 2VL4A 4Z3FA 1KIUB 4PV9B 1H0DB 2EXWD 5EBLA 3LEVL 1NA8A 4MNQB 3MLUL 3VYOA 5ICYA 1KWKA 5EF1A 4PJDF 1AS8A 1J1OL 5I8KL 3WEXA 4MTMA 1XZ0B 2HKFH 3PNWB 4JO2H 2JKSA 1BYPA 5D1ZA 5EO0B 4Z7IA 5C7XL 1OE3A 3SDCB 3MRMB 2VN7A 3MUGA 4S1DD 4X6DB 1RAMA 4ZBJA 3TN0B 5IEHA 1CS6A 5K9KB 1WICA 2F54B 4D0DA 3HZMA 3QJRB 2H9GB 2X2YA 2Y7MA 4P9ML 4UB0L 1I4FB 1T1XB 2YUVA 4Y5XC 2VXUL 3CVDA 1QNZH 2FX9H 4PVLA 2BSDA 1LEGA 2ZTBA 4YUEH 2X4RA 2CKBB 1UXMA 2Q10A 4UT7L 3NTCL 1DLFL 1TTRA 1AFVL 5I1AB 2EEXA 2H1PH 5I30L 1DVXA 3T2OA 3BLKA 3GNMH 3S4SG 2OSWA 3MJ9A 2CDGA 3S35X 5TK2A 5AW4B 4HAFA 5FF6A 2G75A 4Q97A 3KYNA 5DVMA 3S34L 2NXYC 3RWCB 2BP8B 4X4YB 3S36H 4JFYB 2ZOKB 3O4LA 4OLEA 4N2IA 3O9WB 3BVUA 3RIFK 3G7TA 5E6ID 1YJDC 4V2CB 4PG9B 2VAAA 3H9ZA 3HA0A 3LN9A 5FA3A 2CKBH 4GIOA 1LM8V 1RJCA 5DJ8B 5I75B 1EH9A 3DX8B 5AVSB 2J73A 5T5NF 3CFEA 3BWAA 1XAUA 5GZOC 5SWSD 2JJTA 3O81A 4AQ1B 3U0PA 4NI3A 4XO5A 3IMWA 5DT1L 1URIA 4JO3H 3RI5F 2WSPA 3ZE2E 1NCDL 3U1SH 2BNQE 2AQ3A 2VR6A 1BQHB 3UTSA 5DK0B 2G4EA 5C3TA 1AMYA 3I02A 5KOVC 3OGCB 5H35A 2AJSH 4GW5B 1P7QB 3NQKA 3U4AA 5JYLA 5JHDB 2JVUA 5CEXB 3WJMB 5EB9A 2B0SL 3OV6A 4F80A 1Q9WA 2VT0A 3HNTL 3L9YA 5E23A 9CGTA 2PTTB 5JLZB 1FORL 1GGUA 3MKKA 3GSNA 1UH4A 4P9HC 4JGNA 3F7PC 4L4VA 4RAVA 1YC7A 3T0VA 5I6XC 4C57C 4DPCX 1FL3B 2EDXA 3WE6B 3D52A 3ZZLA 4PCTA 3HG2A 4TN9A 1L9PA 2FD6L 2WWMD 2FEDD 1LEKA 3UBHA 5CD5C 2AHIA 1H3GA 3ASWA 1F97A 2XIBA 1MJUH 1U91B 5D2LA 2G30A 3GKZA 2IANA 1A6PA 4A7SA 3NCCB 2PXYC 4ZXBA 4GI6A 2WQ8A 4L1SA 4JN2B 3CXHK 3I6KA 2ICWJ 5GRYA 4DF9A 3AS1A 4IKJA 3ZE2F 2Q87A 5D7IA 4QWWD 4EZLA 1GL4B 1T7WA 2JI3A 4JRXA 3GMLA 1OAKL 4K4KA 4RETB 2Y72A 4FS0A 1E8XA 1LD9B 3PWJA 4APXB 5KVDL 2J5LB 1YNLH 3IE4A 4KY1L 2MNWA 1A2YA 1GW0A 5C97A 5BQDA 4D7PA 4JN1H 4CMMA 1Z5YD 4JFTA 1X5XA 3NVQA 4LNVA 4MMZA 5INCA 2AXFA 3FT0A 2Y7LA 3IETA 3T3ME 2OMVA 3OXRA 1CPUA 3MRRB 2J21A 2G2PA 1TG8A 4HZLB 1JPTL 5F1SA 1DE4B 4P4RB 2Q2LA 5H37G 3DI2B 1FZJA 3U7YH 5C0IB 3VXUE 4FQQA 4JFSA 2BHYA 4NZUH 3HRPA 4PJEA 5F1IA 4GQ9L 3IKCA 5HYQB 3FTSA 2EDMA 2WXRA 3FO2B 2QPUA 3CLEH 4MJIB 1HYSD 1HDMA 4OZFH 1A9EB 1NCUA 1GZQB 2BFVL 2VXVL 2Y24A 2JI1A 3AY2A 4X8CA 4Y4KC 1ICTA 4PJIB 3MV7E 3R0NA 4R0LC 5L88H 4L23A 4PY7A 1OGAB 5CLTA 2BSSA 2P7TB 2WWOA 3FF7A 1RUQH 4J3BA 4Z7WE 4NNYB 4K3GA 2J1WA 3HG1E 2R4RH 3H9SD 3WTXA 2OSYA 1BBDH 1CE1L 2ZG1A 1EDHA 3CHXA 4U2YA 1WCBB 3TBWA 3VXME 4N85A 4HJ0D 2Y7OA 3I3DA 5IBTL 3FUHA 1K6QL 3QG6B 1CDYA 4W9LC 4XI5D 3T3MF 5GS1A 1JYWA 1TJHH 1CLOL 3T0AA 1RMFL 1MH5A 1YEDA 2FSEB 4NX0A 3VA2C 4OKVA 3RIAK 4K5LA 4N1HB 2XYCA 3AGWA 4WFFE 3TVMB 2ATKB 1UFGA 4NUGH 5FO8B 5HBBA 2YMXH 3VRJB 1T7VA 4JFHE 1FLTX 3L9BA 1BQUA 2EKSB 1CI5A 1DJHA 1NBVH 5EIIB 2VR8A 1MQKH 3V0WL 5BVPH 4UYQA 4MVBD 3MBXH 1YAZA 3HC2A 1KENH 1KSRA 3K6OA 5CZRA 1OHQA 4N2DA 4M6NH 1HI6A 3HG0A 2OTWA 3HZKB 5EU7E 1QPXA 2N56A 4FQHB 3L4YA 2PO6A 3O2VL 4Z7WF 1YLBB 2P1YA 1IM3B 2DQUH 3RVXD 3UC0H 1NLDH 4LVHC 3ZKXB 2VXSH 4JFQA 4DN4H 2P80A 2ZUQC 4WW2A 5CCHE 1BJ1J 3ZVVA 1U0QA 4KJWC 3Q8BA 1X9UA 2NY3C 2XXMB 3ZL4L 3V5KA 1FFQA 3GBNL 1S3KL 4TF4A 5E2WH 5MEPA 3Q1SL 5CD3A 2NZ9C 4P2RA 5DEFA 3S5LG 3NCYS 5BCAA 1JVKA 4QHNB 4Q7DA 1EAPB 5F7WC 1KV3A 2LLNA 3ME0B 5CUSH 4L5FE 4L1DA 3VDBA 2HFTA 3KL5A 1CURA 3KHQA 4DHLA 1QR1A 4QRSA 5ELIA 3X1GA 2EYTA 1J8HE 4ZRGA 4MMXC 3O3AA 4XVJL 4EKXA 1UTDA 2DTML 2ARJB 4I88A 4R4NC 1RUPL 2FCBA 1E2ZA 5DR5H 2W0LA 4ECNA 1VPOH 4I5BA 1WRFA 2OCCB 1GSMA 3FO1B 4ODHH 4PG2C 4KU1A 1HN1A 4F2MB 4XMWA 3IN0A 1EDQA 1JZGA 2I9LA 2YGOA 7PAZA 1ZLEA 2DMGA 2GJRA 1B9ZA 5KAQG 3NYKA 4UILL 5EWIL 3FU6A 3CFJB 4OF0A 3WHXB 2EO7A 1EAQA 1RHHA 2PTUA 3MZGB 4M5ZH 2A0LC 1X7QB 1ZVYA 2BSRB 5IBLC 3RVVD 4YDIL 4G1MA 2BVOA 1S8DB 5DUPL 4HIEB 2CPUA 3FTGB 4S2SB 3SB3A 4BIKA 2V5SA 1HCVA 1WZLA 3BUIA 4FXTA 3UZVA 2FHCA 1EZSA 3ZKMC 3PQYA 4HKXB 1P7QD 2EDQA 3DSNB 5FOBB 2VR4A 5MENB 1RV6X 3L8QA 4ZS6D 4G6ML 4GMSL 1EJ6A 2VXQA 2L4OA 3C5JA 4XAWH 3V4VA 2F8XC 5HP5A 3OX8B 3U82B 2FZ3A 4H2CA 4QYOB 1YPZE 2ESVB 3UABA 2A9MH 4PJBE 3S48A 3DO7A 3P0VH 1LO3L 3J27A 3OM3B 1DQQB 3EYFA 1OPOA 2N01B 4P07A 2PP7A 4OJFL 1S7TA 4W4NA 3CCHB 3VFUA 2R23B 4QRRE 1BX2A 3MBWA 3O4OC 2BIQA 1BQ5A 1ZT1B 2VLRA 3B9KC 4HUWA 3FT4B 1O5DT 2WUBH 2AITA 3O45A 2Q9OA 3Q7JA 3D07A 5TGBB 4IRZL 2RD0A 3QJXA 4N8PA 4OJEH 3AY4C 5D7JB 4UMSA 1NEZA 5GGTL 4N87A 3BGFB 2HLAA 4TYUA 3TCLB 2AC0A 2X89A 2I32A 1QSEE 4E9QA 4HJTA 3RWIA 4B9FA 1WGVA 2ZOWA 5HYSG 2UUDK 4OQ1A 2P5PA 4Z95L 3BRDA 2CH8A 4HFWB 4P23C 3RI5K 2EUVA 3SKJL 4YH6A 5EEZA 4BEIA 1N6VA 1S2EA 4ZQKB 2A6DA 3IDXH 4XMXA 3S37L 4YE0A 5PAZA 1KJVB 4IKKA 1YPZF 1NL0H 1EHLL 3L1OL 4PJBF 3BPNB 2DLFH 1T1YA 3II3A 3ARTA 6PCYA 5EEUA 1SN0A 3SDDB 3UO1L 1M1XA 1D9KC 3BIBX 3OMIB 3R06A 1G7MB 1VACB 2Q20A 3ZW3A 5AAPA 2FWLB 5DWUH 4YDVA 3O3UN 3QJHA 15C8L 1PQZA 4MYPA 2NY2C 1SNRA 1QSFE 3N1QC 5KYUB 2DRUA 5ADOH 3DXAB 3L5IA 3JT2A 2WIIB 3SGJA 1V3MA 3FFOA 1VCBC 5IFAL 1KBGL 3O4LD 4LCWD 1KMGA 4F3FB 4X5WB 4Y5VB 4KKZA 4JFPB 1NZRA 3HHSB 4JDZB 4U1IB 4OIAA 4Y9FA 4XNYH 3FCGA 1QWNA 4TUOA 1HHIB 1NANH 4B53A 3TVMD 3NA4A 4OIIH 3ECVA 3F7KA 2FBRA 1AANA 3QAQA 3TO2A 3L17A 4LIQL 43CAB 4OM1H 1XFPA 3VD7A 2XZQH 4UM8B 2HJFA 4BHUI 1AE6H 2X4NA 4NN5C 3IFNL 2EVJA 4KY2A 2FJFB 3VXPB 3BIKA 3X12A 1I7UB 3QWNA 1A02N 3C60D 3QUYB 4Y16D 4GXFA 4W9CC 5KAQF 3GEFA 3DGDA 2DI9A 2E3VA 4HWBH 4NENB 3QPKA 1T4KB 5KVFH 5DUBB 5E6UB 1XVSA 1ZIAA 3BDBA 4OQTA 4RZKA 2C5DC 2CK0H 2YEQA 2VERA 1NCOA 3CZLA 3QZBA 4HUUB 1ULVA 3D4CA 3MZTA 1KN2L 1VKXA 1U58B 3CPUA 4LEXH 4OCLC 1ZLSL 4E9RA 1JI2A 3IJYB 1NGPL 1P7KA 2IC2A 3IU4L 3KCPA 1ED3A 4FLRA 3RPIA 3DETD 3OKMB 4NO5B 5C6PB 3OF6A 4TSBH 4OW6A 3F65A 1BM7A 1MRFH 4PHXA 2X4SA 3AQYA 5ESQA 5ACMA 4GLRH 1M3JA 3TLRA 1NIEA 4A2DA 3KGRA 5F9WB 3MLXH 3WG7B 1BP3B 5E0QA 5GS0C 4W6YB 3F7QA 4LQFH 3VYPA 4Y4HB 3GSQA 1DUZB 2Z91B 1EJOL 2NYKA 3L95B 1P4BL 2OSLA 3KPOB 4LEBA 5DHVB 2W9DH 4FFZL 4TXVB 1C08B 3QDGB 4WTQA 2HKHH 3FH8A 5HTSA 1N3NA 4GAJH 3T4YA 2VLKB 3DROB 3OKOB 4A2LA 3JWDL 3QJQB 2DI8A 4OGYL 3VNZA 3WJLA 4PSPA 4URTB 1XF5A 2ZP8A 1J18A 3P73B 4K9EL 5DJCB 5I17B 4XWGL 1EDYA 1TVHB 3AU0A 4PYHA 2D0FA 1C7SA 2Y7QA 3BAJA 3SGKC 3FUFA 3L2MA 5BMFH 5G5DB 4ANWA 5FUCC 4E9LA 4DVBB 3RDTA 4QRQA 4E5XA 1E3ZA 4JGMA 1QLEL 1TYRA 3Q3GB 2YPLD 3OZ9H 5HXMA 3PHAA 3LXAA 2NY5C 4UT9H 5F7BA 5FYKH 2JJSC 2HWZH 4G2AA 1JCKA 4MSWB 1QATA 5DHVH 1UD2A 1V5JA 1CVRA 2GTWB 5KW9L 3GKWH 5AVZB 4CBZA 3NSFA 2LTQC 1UM5H 3FU8A 1F2XK 1BWWA 3HE6D 4RLDA 1XCQB 5D9SA 5CJQH 4G8FA 4YHML 2ZP0T 2JKTM 3B2UD 2IH1A 4LASH 2HP4A 4N2CA 4ILDA 3O6KH 1WZAA 4GMTH 4LPWA 4WJG3 4TPRL 1ZKAA 1AXTH 1P5UC 4XBEH 4UT6A 4A7VA 3ISYA 3O0RL 5TK4A 5JW4Q 3IFLL 1NICA 2VH5L 4HBCL 4KHTL 4TLTA 2P52A 3JTTB 7TAAA 4WIQA 4OD3H 4PJGA 1MF2L 5LBSL 5HHVH 3M45A 3NQIA 1S7UB 4WK2B 5BZWA 5D7LB 4U1MA 3U36A 4JZJA 4U31A 3VWJC 1HSBA 4PRHB 3RVUC 5BS0E 5C86A 4QRPB 1CFTB 4ZFFB 4GG8A 5LDUA 1CZ8H 1G7LB 1BVZA 2B1HH 3C5SB 2D3VA 1UXWB 3FFDA 1TETL 2JKJA 3VTAA 3K2IA 2GTZA 1A1OB 2HFGH 4WJKB 3IJSA 5DK2A 2Z93A 3ULUL 2AABL 3RNKB 1EBAA 4IMKA 1K2DB 3TTYA 4BFNA 5T1KA 4Q6IA 2PO6D 4CSTA 5IMMB 1ZT7A 3RTQA 5CKAA 5G55A 2DLTA 3VWKD 2AAAA 1P6FA 5KG9B 1NFIA 3T1WA 3I75A 1EQWA 3BMVA 1MY7A 3F05A 3LNGA 5JPMC 2W0KA 3L1EA 2WOBA 4PVBA 5I0DA 1GYCA 2ZWLT 3S8FB 1CK0H 2HT2D 1X4YA 5DLLA 3TYFA 4NQDB 4YBHA 3SDYL 1JYNA 1RZIB 4K3EL 3M8OL 3WAJA 1KNOA 3BKJH 3I6LE 4KQ4L 1S9YB 3HJEA 3KPRA 3E3QE 1KB5H 3OLDA 3HB3D 1NFKA 1LL1A 2H5UA 3MGAA 3GSOB 1G6VK 1AZBA 1F8TL 2Y5TB 4QHLB 1J5OH 4XVTH 1H8LA 3D06A 5GRXG 4BRJA 4AE1A 4Y5XB 1L9OA 4KXDA 3TT1H 4GQPH 2H1LM 3W11C 2DIBA 2E6JA 3GDCA 3TJHD 1HNYA 4U1HA 4DTGH 2F5BH 2ADGA 4JFDE 4JGJA 3FO9A 4M4RB 1WS7A 2H2PD 1G7QA 3CX2A 5KYYA 2FEEI 3KXFB 4CSPA 2EP6A 3ZDXB 1SEQH 1JUFA 2SEBB 3VH8G 3TBSA 3NFSH 2OXGA 3T04D 5EDXA 1AI1L 3RGVA 2NXYB 1AHWA 1N5YH 3QO0A 5F9JA 2XN9E 4N2BA 4XC1H 1UA6L 1U8OB 3QDAA 5FUOL 1PL3A 3FUNA 5J13C 5F1NA 3NRPA 3QCUL 3B1UA 1AO7B 4H5SB 5AB1A 4NI6A 3QSKB 5DD6A 1A3QA 4ODUA 3IFPA 5B8CA 3CGTA 1KEGH 2C8NA 1MCRA 3OHMB 4TQEH 1A4JA 4AGOA 1F00I 4HS3A 1YO4A 3MLSL 3CQQA 1EXUB 3W39B 1PZ2A 3DA0A 4G9DB 2Q8AH 5C09B 2VN6A 2X3AA 4IHBA 3LNDA 4RGMC 4X80H 4PJ9A 4O5LL 1NCCH 5TDNB 3L08A 4J3VA 2FB4H 2Y07H 3GGWA 4AV0A 3KMDA 5JW5A 2VDQB 2VXTL 1EERB 3O2DH 4GIPD 4R90L 4WKZA 2IADB 3VW3H 2QPFA 3B2XA 4FJZA 3APMA 3KJ6L 4LCIL 2VLRD 4JFWA 4HUMB 3FB5A 4OZIA 1AD0A 1G5GA 5AKSA 1MIEL 2ZSWA 2XY1A 4GW4A 1G1KA 2C9RA 3ZDWA 3WI9A 4F20A 2YRBA 4JJHA 2A6IB 1VENA 3OG4B 4LFHD 1VFOA 2YFNA 2X89D 3JUYA 4FKHA 4PJXA 1GYAA 5D4IA 4OCWH 4ZFOL 4RAHA 4RMQA 1QWUA 1URZA 2BXYA 2XPGA 1SBSL 3BRFA 2PXYB 4HKBB 2EACA 1OM9A 5FO9B 4EN3C 2HJKB 3ZQXA 4MD5B 3MJ8B 2JLLA 3FT3A 4ZD3H 4GS7C 2GJPA 5EU3B 3CMOH 1AYRA 4IYKA 4K94L 1YECL 4BKLA 2VISB 4HC1A 4GKZA 5C2UB 2PCPB 3DBSA 4XB7A 3VTTA 5IGXL 2B20A 3FU7A 3U9PH 5E6RB 1ZSHA 1E4WH 1CFMA 4OD2B 2X1QA 1WC7B 4UOJA 4OLYH 1JGUH 4HGKC 4L9LA 4QDGA 3Q6GL 4ICWA 3VU1A 4ZOBA 2NYZA 5JXEA 3MR9B 2UZYB 3L3GB 2APVA 4MCYA 4JG0L 2Y2YA 5E2VL 1X5AA 4N3UA 3ARDC 1D7DA 3VFNB 1MRDH 4G6AC 5AW9B 1OM3H 1XR9B 4ACPA 4I18A 3U1PA 2CMRL 2VDML 4M8UA 2RH0A 5HI5D 3EFOB 5L4JA 2Z7ZA 4Y4KB 5B38A 1HKFA 1K4DB 4R7XA 5E6SB 3IDIB 3O8XA 1OB1A 1JFQH 4AW7A 1ORSA 1LLAA 3ARSA 3Q9PA 4KK8D 4R0LB 1HVXA 5E1AB 3BCDA 5D7LD 1MELA 5IEKB 2DQDL 4L37B 4IBLT 1G0DA 3TIDA 4XO9A 3ZZ1A 4IDLA 5C0AB 5IP4A 3KPRE 2LU7A 1JMXA 4XNUL 3V5DA 2KLTA 4AM0Q 8FABA 3QYNA 3EO1B 3LPWA 2BDNH 2O93L 2BVYA 3X1EA 2QGEA 3QIUC 2HN7B 3ZZQA 3HR5B 1NCBH 5EOCH 4DT2A 2V5YA 5MHSE 3UO8B 1PZ5A 3ATDA 5KN5B 1QVOB 4LQ1A 1CMOA 3MJ7A 1XMWA 1U3YA 3L5WA 5CBAB 4YHKL 5C08A 4UQ3B 2AXGB 4G71B 1FQ9C 1BVKB 5HGAA 4NC1E 3RX7A 5C0GB 2WKGA 4GKSB 2X4PA 2G5BA 2SODB 4M48L 2Z4TA 4B41A 2F74B 4K7PX 4PCSA 3VG0L 5CSZB 4CADA 2N0KA 1AQKL 4YLBA 3LZPA 1WBYA 5E5LA 4CVXB 3H7LA 3PPSA 3MN8A 1CFVH 3P0YH 3SJVA 3C09B 3K5SA 5EU6E 1JPFB 5DHYB 1MNUL 4L4JA 4JAMB 4HV8B 1A9VA 4IRJC 5DQ9A 2VO5A 3SE9H 3GSVB 1P7HL 2CO7B 2ZUQB 4Z3JA 3DOSB 4JFXA 2YKLH 3F7RA 4HFUL 2W60B 1QHQA 3MV01 2VQ1A 1ZLDA 1QBMH 4YWGH 4P3DB 5BUGA 1OE2A 3PGFH 2Z4QB 2ZG2A 4MWFB 2G2RB 1TDQA 4GAFB 3QRGL 1IIIA 4XNDA 3DIVA 3EH4B 2K7QA 4RH4A 2EUWA 3IDJB 2Y1ZA 4OAWB 2O61A 1EMTL 2PYEE 3GZPA 1CD0A 3U48A 5FKAB 4B9ZA 2NXYD 4XN1A 1F90H 3SN6N 1G7PB 3B5TA 1ROCA 4MMXB 2DDQL 4H26A 3DX9A 2W95A 2CIIA 1I8KA 2OMTA 3T1FA 5T33L 1XGTA 3WTSA 4IU3B 5DRWB 5DZLA 3G5WA 4TOYH 1T03H 2DWTA 5D71H 3WNKA 2OZ4A 1MCIA 1IL1B 1GKOA 1U8MA 2QPEB 3X14B 1NGWA 5CEYA 4AMXA 2QMKA 3FN3A 5E8EB 4DCQB 3VU2A 4LLMA 1DCEA 3BE1H 3ZIMA 1FJ1B 3MXVH 4CVWA 4LKXA 5GZOD 4GUPA 1M7DA 2NY7L 3MV9E 2WVVA 3EDKA 3AQXA 5JDJA 1BCIA 3DRQA 4ZPVB 3U30B 3GJEA 2V8MA 5C9KA 4ES8A 2ENQA 3L9RB 4QTFA 4KUZL 2YARA 3L3IB 4FNLL 5E9NA 4BBWA 2BM3A 3L5HA 5JW3H 5GZNC 5CAYB 25C8L 2XV0A 5F7MC 3EAKA 5IF0B 2WY3B 4CVUA 4F57H 5BPPA 1PNCA 1DP0A 1GJWA 3ULVL 1TOXA 2QZ5A 2WWKO 1SEBA 1IM9B 2MPAL 3FBKA 4IRSC 3U0WL 1LK2B 5D7KD 3G6JA 5LJYH 5CGYC 3JWOC 3OHXA 4KDTA 1AD9A 2H3NB 2V3DA 5FKPA 5JMRA 1SJXA 1FFTB 1TU2B 2E9BA 3HI6L 4QHKI 4WO4C 3ZYOA 4JPQA 1U92B 1FFNB 2MQ0A 1SXCA 4XOBA 5IJKC 2D7QA 5GGRY 1DVFA 1NSNL 1ZHLA 4MD4A 5I8EA 1TTBA 3UCQA 2CM5A 4OBSA 1QEWB 4ZAKA 3NACH 5LCVH 1YUKB 3TZVA 4L3EB 2DM3A 2W1NA 1JE6A 3D0VA 4PRAA 5F7KC 4DO6A 4PUBL 5T1KD 2AZAA 1DJIA 2AMGA 3HNSL 5H8DA 4WNQA 2HX9A 2JIXB 3WJJA 3O4OB 3B9KB 2XI9A 3S97C 1A47A 5C8JA 4N5EC 3VD3A 1ZJBA 4TNWK 3MYJB 2J2ZA 3JVGC 2F58L 3KLAA 4LPUA 4DVRH 1SLUA 2HFFA 3P77B 1A21A 4IBTA 4FTVD 2R51A 4M6OH 3D18B 3S35H 2QZQA 3QEUB 4PGZA 2EXYC 2DQEH 4U1KB 2QT6A 2OKMA 4MDJB 4ANKA 4P23B 2ZONA 3H85A 1TVBA 5FCUL 2BVQB 4X5XB 3W0WE 4ODXB 1CLZH 3VB9A 5AZEH 5JOEA 3LZLA 1FYHB 2OLDA 4HX1A 3WXVH 3I2CH 1RUKH 3MRJA 4XO3A 1ONQA 4WI8A 5C08E 4HBQA 4MFHA 1NOAA 4L0YA 3TV3L 1AR2A 2BCKA 2Z7WA 1D9KB 4RBPH 2H0EA 3U7AA 4OM0L 4NFDA 3ZJAA 1K9TA 1QABA 2DD8H 5E94B 1Q94B 1AGFA 1DQDL 5FECB 2F1BA 2VMDA 1BAFL 1MVYA 2VN5A 3ARWA 1T7YA 2WBJD 2NY2B 2NZ1A 4JVPA 1JHTA 2I9TA 4PJFA 3RGVD 1A66A 2XWJA 4MXQD 4PREA 2MHAA 2EVFA 1FL5B 3QXDA 1ZIBA 3P3SA 1QFUL 5D1QA 4XHJC 1SPDA 4ORZC 4U6XA 5DD3H 4K5NA 3DGCR 5LNEA 5SWQA 4C56B 3CZFB 4Q9CA 2N1KA 5T1LB 5CSBA 3CH1A 3K6NA 1X7TA 3QWOB 3ILPB 3V55A 2RFXB 4OFYA 3VFSA 4KHXL 1JF5A 1F4WL 5IQNA 2O6EA 5K39B 2A83A 3N3EA 4NJAH 2QQKL 1YEEH 5IBUG 2NCEA 4EMZA 4NN5B 3GMOB 2A9AA 2ZXDA 1CE6A 4KTDL 2GPZA 1MVUA 5F9DC 4P4KA 3TBTB 4PJ9D 5I19H 5ANMB 2VQ4A 3A6BL 3PXJA 1KCUH 3RFZA 4JG1L 4LBEA 3B2MA 3VXRB 1PDKB 4MB3A 1SVBA 3KBFA 2I60H 4MNHB 3GTNA 4QRUB 4JRWA 3R4RA 4KXCA 4OZGB 5HVWA 1HHKA 3WO4C 2FWSA 4YMPA 4ZMPA 4C83A 2R8SL 1H5BA 1P4UA 3G6AA 1UADC 1C5BH 3QK0A 4BZ2A 1AKPA 5DDHA 5DD1H 5L6YL 1KJMB 2WQXA 3H6AA 3PDOA 2A77L 1TSHA 5CU9A 3I9GL 2J25A 1MFBH 4XPTL 3DUSB 3EZJB 3VFVA 3MUUA 4JFFA 2VM4A 2Z8VC 5T3XD 3KR3L 2Y0SA 1J05A 3N41F 1E9QB 4YGAB 5AOJA 3WGVB 1KPUB 2AEPH 4K07A 3SYQA 5KSVB 2GBTA 1FYTA 3UJIH 1CDBA 3HPJB 2V2WB 5F2FA 4PVMA 3CZJA 3NJJA 1SJHA 4LZKA 2AEWA 2ZXBA 4IOFC 1XGRA 2NNAB 1MHPL 2WLJA 3G6JE 5ECJE 5EZOL 4JHWL 4OZHE 3ZUCA 1EWHA 4BDVA 1L7TH 3BZFA 1XXDC 3VXTB 4AENB 5JO5A 4FMKA 35C8H 3BWUF 1I7ZA 3ELQA 2WLIB 5IW1A 3FU0A 1MFUA 1JPSH 2CGRL 2F15A 2WJ5A 1ACCA 4BUHA 3VJ6A 1SJMA 1X5MA 2JE8A 4NAMA 5ABZA 2XG4A 1VFAA 4QRAA 3NZUA 3ARBD 3AAZB 3D2TA 3PP3H 2H0FA 4XCFL 2GJZA 4BH8A 2LTQB 3RU8L 2UY6B 3T0EA 1BZQK 1QASA 5AVWB 2JCCB 1FNAA 1KIUA 4LGSB 3QCTL 3RJQB 1FGVH 3O8XD 4YHPA 5AVRB 3W38A 4OBRA 5K5YA 1YC8A 3MLVH 2J8OA 1E4XI 4EI0A 1P5UB 3WFEL 2ZYRA 4GI8A 5JZ7C 3PNWA 1R3JB 3G6JF 4LCVA 4AEIH 4OZHF 1BSIA 4X5LA 3MRMA 2NY5H 4NPKA 4XOEA 3SDCA 3TN0A 5K9KA 5TH2B 5C6TL 2F54A 2H9GA 3VGAC 1LWHA 1RUAL 3MV8E 1NTDA 3WN5C 4G5AA 4H1LB 2FT7A 4W81A 4UM9B 5B4MC 3DX1A 2EDHA 2APBA 1JGVL 2XDHA 1N64H 1A7NL 3RWDA 1QRND 2CKBA 2IBBA 4IHOB 1AY1L 3WAKA 2JIXD 2IEPA 1Z0MA 2E75C 4JM2B 4KAQH 4QF1B 3HI1A 4D9LH 3DMMA 4WW1B 5HHPA 3JSSA 4NQXB 4PEEA 5I1DB 4X6EB 4F5CE 4NRZA 5G4NA 2FTAA 3KDPB 4Z7VB 3DYMA 1A1MA 1S46A 1W72L 3P11H 3RIKA 1BJ8A 3WY3A 3HPLA 3NCJH 4OZ4B 3SDXE 2DAVA 4X6CE 3VXNB 2BP8A 1TENA 5EUOE 4X4YA 4JFYA 5DD0H 3JWNG 4NBYB 2ZOKA 1UATA 2VL5A 4P23D 4ZUUA 2VWEC 1GAFL 4LSPL 3DV6B 3O9WA 2RBLA 4Y4FD 2F53B 3BSHA 4PG9A 1AGEA 1WZ1H 2AK1L 4H1LH 3SCMD 2DLIA 4TLUA 3VI3E 3N0AA 3VFWA 5JPMB 5C0CB 3DX8A 4KMQA 4FQ1H 1MFCL 2Q86B 3GSRB 5DTFB 4ESKA 1Z9SB 4QOKA 1D9KD 4L8BB 4BELD 5AVTB 5CHNB 3O2WL 2DM2A 4W68A 3WS6A 3LX9A 4JR9L 4IBSA 1CFNB 4P5TC 1N10A 2KYIA 3HZYB 1HWHB 4RVBA 1R3LA 1EAOA 1AZUA 1NBCA 4FQCL 4I1NB 3SDXF 3ZHLA 4X6CF 4PV1C 4GAYB 3V9EA 4LEEA 1V54B 1IQWL 3W2DL 5JHDA 5EUOF 2MWCA 5C0BB 3B37A 1T7ZA 3S37X 4JB9H 3WJMA 2E27L 5BZDB 1Z32X 3O6LL 5LN8A 4Z7OB 2XQ0A 1Q9LA 4N0UA 4NYLB 5J89A 2YPVL 5T1LD 5IESH 2FH8A 1E67A 1FL3A 4F9PC 1VZGA 2V9UA 5E08H 4LSTL 4J23A 3VI3F 3CFCL 2NCMA 3S6CA 3MVSA 4XP9H 3V6ZB 2V2XB 3OJDA 4QO1B 4ZMOA 1U91A 1AC0A 3B3BA 4JFFE 2XOTA 1TYJA 2GFBB 4NFCA 3ZMEA 5CMAB 1EJ8A 4D3CL 4X2UA 1DN0B 2KQMA 4AIZB 1L0PA 1VFBB 2YEZA 4JN2A 4Y88A 1QX1A 4NM8L 4PJ5B 3WSQL 2M8XA 5J13B 1SMAA 3REWB 3GF8A 3TGXA 4FERA 1P6AB 3MI6A 4U6TA 3K5RA 3ZO0A 1SHMA 4OZFA 4Q89A 3GXPA 4OCRH 4G80B 1T4WA 2ENJA 2Y4SA 4EI5A 2QBWA 1ZXQA 3LIZL 3WLWD 1CGSL 2RIKA 4YQXL 5FGCE 5I0VA 1PAMA 4NPYB 5CGMA 4KQ3H 1IAIM 1YEKL 3V95A 3MLYL 3UZEC 4XCCH 3AREC 2VLJA 2QMJA 2NOYA 1JNLH 1MFAL 3POHA 4K5PA 3DV4B 1BQHG 1KV7A 4HZLA 5E2UL 3JWNE 4KVCH 4OI7A 2ZJSH 4RGMB 1DE4A 4P4RA 2NR6A 2Y6TE 4GSUA 5L4FA 2EVHA 5GS0D 4Z6AT 2NT1A 4FD0A 1WYJA 3FO2A 1I7TB 5FGBC 1AIFA 1UEYA 2QHRL 3WTVA 3FUKA 4KZEH 2P42B 3G5YB 4K8RH 1V3KA 3TA3C 1QACA 3B34A 3DO4A 4MNQE 3J07A 1MJ8H 1OGAA 2XWXA 2P7TA 3MBED 4GXVH 1CGWA 3OPZL 1GGCH 1SDDB 2OL3L 2YXMA 3G9VA 2GJ6B 4U3CA 1UHVA 3DGGA 3M1BB 5J3HC 5TE4H 3UP1A 4EXKA 1V8HA 4QXUH 4OFVA 3FUJA 4NO0A 3SD2A 1KEML 2CLZB 4X6DE 4AITA 2WZ6A 3N1PC 1WCBA 3CN0A 4TM9A 5EZIH 1XF4B 2FX8L 1F1AA 1L6PA 2OMZA 3QXVA 3WIFB 4EN3B 3QG6A 1NCJA 3HMWH 4GRLC 4GOSA 4NAQA 4X4XB 5IROD 2YBRA 4GS7B 4EI6A 2H6PB 5AB0A 5DRXB 4F15C 4AIXA 1E7VA 2ZWZA 2I27N 2J12B 3P4OB 5L9DH 2EKSA 1GW6A 1O6SB 2KPWA 3FB8A 5LXGL 3ISRA 2AJ3B 2IG2H 3P54A 3TS8A 1XH1A 1REIA 4FQJH 1G1YA 2CCLA 4M1DH 5DLML 1TJIH 5ALCL 1YSOA 3HLAB 3HZKA 3L2NA 4WNSA 3ARDB 4U1JB 3GMPB 4YHYC 1JYVA 1IM3A 4G6FD 3D39B 4OI9A 5EH1A 3W3BA 1KCRH 4X6DF 3LNFA 4TVSa 3IDMB 4G70B 1RK1B 3TFKD 3T77A 1AKJA 3AFLA 2AJYH 3CDGB 5GS2H 2IPTL 5JIDA 5CSGA 1UWXH 2ZYIA 3P9MB 1KGCD 3GBEA 4JO4L 3PV7A 3BKYH 3MNWA 3ET9F 3NABH 4R97C 5E99H 1YQVL 4UNVA 4BXSV 3AVEA 4JM2D 4OU3A 2KT6A 4KXAA 3GRWL 3HUJB 1ESOA 4WI0B 4TSCH 5GS3A 2ZUXA 5C07A 1EAPA 3ME0A 4PGCB 5D72H 4YGVB 4NZJA 4FYQA 4KKLD 1ITCA 1FRGH 3QIUB 3GB7B 4FQXD 1SXZA 4XN2A 1P4IH 4HOZA 5E00B 4HCIA 1KC5L 2P8LA 3CFKA 4R7VA 1ODAA 4J39A 2ZX5A 3MRDB 4P4KD 2ARJA 2XN1A 1B4JL 3RWFB 1A5FL 2I7SA 3B4NA 1UASA 1JHKH 1KBWA 2PMZA 4XNXL 1IEAB 3QS3A 5DVOA 2F53D 1CYGA 3CBRA 5DS8B 4KK9C 4F7MB 3FO1A 4OTXL 5ILTH 2BSTB 4LSDA 5EIIG 3ZKQD 7PCYA 1CD1A 4PJ7A 3RVTD 5I76A 2MFNA 4EKJA 2DEWX 4YHNB 5KS9E 1VDGA 4W9EC 3APFA 1WK0A 4UDUB 1PIGA 2MOGA 5TDPB 2G5RA 3SPVB 3CFJA 1INDL 4P0DA 5H94B 1X7SA 4JRYB 2ZX8A 4LE8A 4HCGA 3L5JA 5DJZB 4CU8A 4FQIH 4AVKA 2OAAA 1I9RH 1IC4H 3K2UH 2BSRA 3LOWA 4CNIB 3I84A 1AQ8A 3V7MA 1S8DA 3ILQC 3FTGA 2AVGA 2Y69B 1Z9NA 4GB9A 1Q1PA 2MOVA 1PTZA 5BOJA 1J5IA 4TV3A 5FOJA 4HKXA 4P2OC 1KJ2L 3FQTA 2VZTA 3DSNA 1JGEB 5FOBA 3W11D 2AV7B 5TJWK 1BYOA 1FE8H 3BAEH 1UFUA 4RRPM 1HIML 3FRPG 5MENA 3RJDA 4WHTA 1BD2D 4G82A 1MLBB 2XFXB 2YRZA 5FV2A 1PLCA 2K7PA 4L8SC 3TM6A 4L3FA 3FFCB 3OX8A 4HUNB 3HNVH 2ESVA 1D5ZA 4KMTH 4PGEB 2GT9A 5CLYA 3KLLA 3WO3B 2W5PA 4YAQB 5KS9F 5TF1H 4ABUA 1DQQA 2CIKB 5T3ZH 2RHEA 4HUVA 4NKIL 3U6RA 4XO8A 5KSBB 4AGMA 1WGOA 3CCHA 4G7YL 4MJIE 5AW2B 2ICES 3JV4B 4JQXA 4ZMXA 4OY9A 5IFHL 3B7UX 1ZT1A 3N55A 2NXZC 3L6FB 3FT4A 1OD9A 2R9HC 4PJIE 2F61A 1ADWA 2WP3T 4Z9KB 4JPSA 1OGAE 5D7JA 1NMAH 3VFPB 2APXA 4UV4H 4POZD 4ZT1A 3FKUS 3KPSA 1LWJA 1QRKA 4KPHH 3E6HA 1FSKC 3AG4B 2BERA 4AGQA 1Z3GL 1MPAL 2VDOL 3A21A 4LLUB 5E56A 4AUUA 1THCA 4LCWE 1JZ4A 4TNVF 2FLRT 4P48A 5ESVA 1VGEH 2UZXB 4KFMA 3ZR6A 4Q6KA 1ZLVH 4EDWH 4PRPD 1A7RL 4ZQKA 1G7JB 2R1YB 4KO5A 5ISZB 5C1MB 2JK5B 5E2TH 5IMOB 4KK6D 3AUVA 3OLEA 3OAZK 1QG3A 5EOQL 2K4WA 5EO9B 1UOKA 5DZNA 3SDDA 1YYLL 1MFMA 3VACA 3W1ZA 3PP4L 2Q6WB 4IRSB 1AQDA 1KTRL 4XNMB 1G7MA 1VACA 3TBCA 4R7NA 3DMMD 4F33B 5HGHB 4PBDA 4KX8A 3WXWH 3B56A 4WO4B 4XXDB 5C0FB 4PJIF 3SBRA 3MLZH 3DXAA 5HYJA 2GJ6D 1ZPLA 2P5ED 4KZ0A 5ENWB 3ARFC 1MEXH 1PW3A 2WYHA 2DB8A 3BLBA 3EYOA 3UYRL 3Q6FB 3EJZD 3ZO9A 4X5WA 2ZX9A 1WPCA 5DMIL 3WFDH 4JFPA 3PREA 4OJCA 4EN3D 2ROYA 3BDYL 4HWBA 2ITDA 1HH9B 2LQRA 3BVVA 2XBZA 3HHSA 4R96B 4Z7QB 5F70A 5FS5A 1IGFL 1AZRA 1HHIA 4YPGA 5DZOA 3BZEA 4NBZB 2DJUA 3E8VA 3JWOH 1UACH 4S1QH 1RZ8A 2C3WA 4AXWB 1ZV9A 3PUUA 3BN9C 2Z31C 4B0MB 4WI9A 1DYZA 4G6JL 4GW1B 3OC5A 4K23H 4JFED 4I0CC 4L4TB 1MDAA 4XZ4A 5IHUH 3T2NL 1ZK9A 3DUUB 2R4SL 4TUJB 4GEJA 5F7LB 5ICXB 3AC0A 3DX2A 3OZKA 4G6AD 4MCZA 2YXWA 4JK0D 1KYUA 2D0HA 4XMLH 4BFIB 1NUDA 4Y1AB 1X9QA 2O5YL 3KPMB 2ZAHA 4JJ5A 1X5IA 5A2JH 3QUMA 2NX5A 4HUUA 4JPWL 5KBKA 3DTXB 2AEIT 2ORBL 4DGWC 4F2ME 3LKSB 2VDLH 3UIYA 4MZ2A 5CCGE 1X5JA 1DBAH 4F7KA 3NIFE 3P02A 1BPVA 4PCYA 2YPLE 3IJYA 3A6CH 2BIMA 3V0AC 1U9KA 3DHJA 2HZHA 2Z6FA 5E24E 3WY4A 2VW7A 1KCBA 3ZSTA 1EZLA 4PRNB 4DEWA 3UTTB 2EEFA 3I9AA 4EDXA 1MHCB 4J5VA 1D7CA 4UT9A 4YHOH 4NGHL 3NESA 3BD5A 1Q1JH 1WEJL 4Y4HA 3L95A 1KB3A 4OD1H 4TSAH 4X9HA 5E1GA 2FO8A 3KPOA 5KVGE 1VEMA 5EN2A 5GGVL 1Y7VA 1BYNA 2VLKA 3DROA 3IJEB 3OKOA 4D9QD 4PIRF 2EIZB 2D2OA 3F6JA 2XZCL 2A6KB 1WVZA 4O2FA 3JWDC 4XZUB 4N3TA 4LLAA 3P73A 1KCSL 5DJCA 5I1IH 1XB6A 2IGFL 2YA2A 5E70A 5AWNH 1TVHA 3VXOB 4Z8FH 2JV6A 3NEOA 3CN2A 5AYUL 1ROWA 2V7HB 1ND0B 2F5AH 3EDJA 4NRYB 2JB6A 2YD3A 1ZEAH 4D0BB 3ALWA 3BVTA 3HN8A 3NIFF 4E9VA 4GUOA 1HNGA 4HCFA 4LXFA 4ZFGL 5EU4A 4N0CC 4APQC 4MSWA 4PRIB 4YXKL 4PJAB 1HCYA 2IWKA 5JIHA 3OVUB 4DQOH 3MNVB 3GSXA 1ZTXH 2ATAA 5CEZD 3FT1A 3WO4B 2IPUG 1WZKA 2P5WB 2G60H 1F1GA 4GPVA 1ML0A 3EXJA 1CICC 3PHQB 1UGKA 3P9LA 3MJ9L 3VX0A 4NZTH 4WEBH 2V0AA 5A2FA 2PCFA 12E8L 2GC4C 1G7IA 3TTSA 3ARGC 3K46A 4NNPL 4EZMA 4HKJB 4G6KH 4YE4H 5CCJA 2ZF8A 4NO0D 5BUPA 3QNZB 1LE9A 5EU5B 3T8VA 2F68X 1OAUH 2JKXA 1GPOH 1F86A 3JTTA 3MA7B 4HU2A 1B2WL 2CUAA 4AYEC 1QSZA 5DI8B 2QSCH 3Q01A 3CVHB 1RZFH 4XN4A 1A14L 2VDKB 4ODBD 2IGLA 1NC4A 4KOBA 4LFHG 1S3RA 4LLVB 4P59L 3H2WA 3OAUL 2AGJH 2R0LH 4N9OB 4PRHA 5EA0L 4QRPA 5A2LH 4BFEA 4DGVL 4ZFFA 1G7LA 1FNHA 4HIHA 4JMXA 2AK4B 1BQLH 4FGMA 3VXSD 4Q9BA 2APWA 1UXWA 4OT1L 3AUWB 5CN2A 1XF1A 1CR9H 3KL3A 4XP5H 3ECBB 3EBHA 1MHHB 5HHOB 1KB5A 3K4ZA 3T8XB 3N2JA 1JN6B 4IDJH 3RNKA 1C16B 2GCYA 2YMTA 2COVD 4N8VG 5IQLA 1TQBC 4G8AC 3HZ3A 3C8HA 5IMMA 2KZBA 2B4CL 2VIRA 3BQUA 3EH2A 4N28A 2ZKYA 2YIHA 5AW6B 5ISZD 4P3CH 1M3IA 3CVHH 5LWYL 3GSNL 2A6JB 2VDKH 3NMEA 4UQIM 5DMGC 4MA1C 2W07B 3EJYD 2MKWA 2OMBA 1RK0A 2WAHA 1PX3A 3HE7D 1QO3A 3GC3A 4NQDA 1H6TA 2A38A 1RZIA 1TQCC 1UD4A 3FQ1A 2ZUYA 4HCRH 4CC1A 1YMMB 1ZA3B 1S9YA 2FATH 3VSUA 2JF1A 4E41A 4WVRA 1JV2B 1ZSDA 4GO9A 2FJHB 1JF6A 4HHGA 3QHZL 2Y5TA 3FQNB 3VGAB 3QUXC 4R8WH 4Y5XA 5DQDH 5HVGB 3WN5B 1BLNB 5KEZA 5FYJH 3AGVA 1TZOA 1YA5A 4KJQD 3IPFA 3FCTB 4RWHA 2AQPA 4TVPH 3UBXA 1UXSB 1UVQB 4N5ED 2JJVA 3ZIYA 2X2UA 1NAMB 3LEVH 2D4FA 1BG9A 5JPNC 1SVCP 3E6FB 3MRIB 1HFUA 2J44A 4KDVA 1XL4A 3T0XA 4ADJA 2DWDB 1GSKA 2VYRE 3EOYG 4I1RA 2WK2A 2EXYD 3GZOA 4QTHB 4YO0A 1XGQB 4J3WA 1KLGA 1TFPA 1XD0A 1U8OA 1LP9E 4PB0H 5FB8A 2APFA 3V10A 3QDGE 3MLRL 3PWPA 2HVKB 1QKZL 3ZU8A 4EIBA 2NTFB 2O6PA 1U3HD 3HLKA 1AO7A 1SN2A 3O2DA 4H5SA 2KDGA 1SFHA 1T0OA 2DI7A 4F8NA 1XF3B 3LZQA 4M93C 5CWSB 5D7SL 2QVFB 1FBIL 3QDJB 3LY6A 4UT7H 3WN6A 5IR1A 2VJXA 1AFVH 2D7NA 1RQ5A 1NAMH 2EIMB 2L7JA 5JR1H 1KJ3H 2EC9T 4HXAL 4I0PC 3Q5YA 4YEEA 4UIMB 5TE6L 4G9DA 4P5TB 2CXGA 4WWPA 2OK0H 1FZMB 4Y5YA 2FR4B 2BNRA 4XPAH 3EUDA 3PWNB 4R26H 2BHFA 2BFGA 4FQ2H 1QMUA 2XA8H 5TDNA 3MNDA 1IBHA 3HS0B 1CDGA 3DX3A 3GJFB 5I74C 1SDYA 4BQBA 4QLWA 1ZLUH 3QZWA 2HG5A 5EO1A 2YRPA 3OMNB 5I1GH 3UXFA 3RDJA 4ZYKA 2ZUUA 1GS6X 1LP9F 4YZFE 3SBQA 2CHDA 4S1SL 1S7QB 3N44F 3LS5L 5E7BA 3PABB 2YUZA 4EVNB 2E9IA 2A6IA 2WV3A 3EGDB 2LR4A 3GPEA 4PS4L 1YEFH 3MV11 3SOBH 3W9DB 2GEEA 4JPKH 4NQEA 1NEPA 1SGKA 4PJHA 3KPLA 1F13A 3QO1B 3D8MA 4HKBA 3UPAA 1MI5A 3EOTL 5E9DB 3WNLA 4GIAA 5FO9A 3X1BA 4MD5A 3MJ8A 5MEOB 4CAGA 1FN4B 5EU3A 5B7FA 2V7NA 3HC4L 3MXWL 5D7LE 3IU3B 1ASPA 4ETQB 4Q0XH 5IKCB 1KXQE 2VISA 7FABL 2PCPA 4PRHE 1CF1A 4QRPE 4K0OA 3WEBA 1IC7H 2P5WD 3LH2L 3QQ4A 3TEUA 4IU2B 1KG0B 3SDAC 4OD2A 1WC7A 4FZEH 2XRAL 3MFFB 3AREB 3O11A 4YZFF 2GIYA 4N2NA 4F8LA 4YSOA 3FCUB 5IHWA 5C0DB 1J0IA 3F2LA 3DX6B 3DC0A 3VQMA 1N8ZB 4N2HA 2VW6A 5D6CA 3A4DA 3ZDYB 4RZCB 4ELKB 4FADA 2CGYA 2HT4C 2PLTA 5J5EA 2GEQA 2O26U 1T22B 2PCXA 4KGJA 3IDIA 3TA3B 1D5IH 3CXDH 5IMKA 4R0LA 1DSFH 1JPST 5E1AA 4O4YH 5J6HB 4RA0C 3MOBL 4NQDE 5IEKA 1SJVA 4L37A 3QDMB 4Q9RH 1F6AB 4P2YA 4B95C 3DBXB 4Y9EA 3UTOA 5C0AA 4WEMB 1AZNA 2AK4D 5I66A 1F4YH 3ZTJH 4GG6E 4ABVA 1NDMB 1A4AA 4MXVE 2HN7A 3KZ8A 5HHOD 5F0JB 1F0LA 4GRLB 4KNQA 4HEPG 1I8MA 1QVOA 1FLRL 4UTCA 5AFAA 4PLKD 5I8OL 1Z66A 1RVFL 4PGDB 5CBAA 2BNUB 4P99A 4F15B 1J11A 3ESVF 4KTEH 4UQ3A 1A6VL 1BVKA 2WM0A 3QXAB 1FNSH 3LKRB 5C0GA 5C0RL 4GKSA 5IOKA 1R24B 1I8AA 5E0FA 2ZWSA 3KXFE 4JHUA 3ZDXE 3GIVA 3A4FA 2X53A 1P2CB 2ZX6A 3KG5A 4GI9A 4M8RA 4I8DA 4LHJB 2VXQL 3V4VL 5EBWB 3FSVA 5E4EC 5ICZA 2CZNA 2WVUA 4TQHA 4NUJB 4CVXA 3L4CA 3IPEA 1YMMD 2CRIA 3O3EB 1JPFA 1SYSA 3D3VA 1Z9MA 3NFPA 4YHYB 2VZ3A 3HAEG 4HV8A 1SY6H 1JXGA 1XHHA 5KYXB 3GSVA 1NCGA 2X70B 3FUEA 4W9IC 2QQQA 4GG6F 5DC0A 3S3JA 1CLOH 3TL5A 4MXVF 3U4BH 1U41A 4MCNA 2WGXA 3B8SA 2W60A 3CBJB 2MIZA 3FDWA 5HJ3B 4YXHL 4F8QA 4J6RH 4KTGA 4X99B 4R97B 3K71A 1TCRB 5JQ6L 1AC6A 4WV1C 1QR4A 2BPBA 4PGBA 4B5ZA 4P3DA 1QBAA 2Z4QA 3SBWC 5GGRA 3KYMB 1WWAX 3IDJA 4CSSA 1P69B 4HA1A 2NT0A 5FK9B 5BRPA 2MCPH 5BQ7A 1EBPA 5C09E 2WO4A 2QADC 4PTUA 5FKAA 2ADJB 3TNNA 3ZDXF 2YWYA 4AYFB 2F7QA 3Q2WA 5J11C 1G7PA 4I48A 4XBGA 5EMYA 4MMXA 3FTWA 3SPCA 4HLZG 1XIWC 4IU3A 2VDRH 5LVEA 3CFDB 1NDGB 3HI5H 1IL1A 1OANA 2V3FA 4I77L 2ZCHL 3RL2A 4PG2A 4WWKC 5I6KA 4L1TA 3L7FB 3IB4A 4LGPB 4DCQA 1HKLL 3NG5A 4L3AA 1S3KH 3QDJD 5I1HH 1FJ1A 3FYIB 2DJSA 3RKDC 1ETA1 3WDHA 3R7QA 2BMKB 1T1WB 1R0AH 1N4XH 1ZS8B 4Y2OB 5BW7C 3AACA 4MXWL 2WLZA 3C5ZD 3EHBC 3GTTA 5LCVA 5IVXB 2YD8A 1IGTB 1JRHL 3EXLA 1HWGB 2OTPA 3OTTA 3RUGE 4G8GB 3BFOA 2VZUA 5B1JC 2H4EA 3ORJA 3ZPDA 3UJJL 1KXHA 2HT3C 4LAQL 3ALPA 4OLZH 1UJTA 3GLEA 8PAZA 5IF0A 1CJYA 3LN5B 4P2OB 2FO4B 4GQRA 4EOWL 4FTVE 1RPKA 4NZ8A 4H88H 4A66A 1IM9A 2EXSA 4HHAB 4YX2L 3ULVC 1LK2A 5DJAA 3VSVA 5CIPB 3ENEA 5CO1A 3LVTA 1NCTA 2H3NA 4H13C 1SXAA 1T6WA 4CA4A 4FNQA 5JOFB 5FA4B 4L8SB 1NANI 4RMUA 1U92A 2CO4A 2WKOA 4NWUL 3TU6A 3QPQD 4ZG1A 1EVTC 1QEWA 4DGUA 3THML 1PD1A 2K45A 3T3MB 4L3EA 2BOCB 2WB1A 2YC1B 1OSZA 2B1OA 3U9WA 1NC2B 2CLVA 4P46D 1ZVSB 3MGTB 4M43H 5E9DD 5HY9B 5DUPH 1JZ5A 2YK1H 1ZGLM 2IH3A 3BQUD 3KWWB 3B9KA 2NXZB 5FAAA 3C6SB 4L1LA 1BZ9B 1IGCH 4OQTL 4QXWA 3RUGF 2X7LA 1JGDB 1DL7H 1D5MB 3BP6B 3MYJA 4JZOB 4BUQA 1QUPA 3ALXA 4CJ1A 4ALAL 3P4NA 5CIPH 1SMOA 3P77A 1FSKB 1EO5A 3D18A 4XPFL 4OUUB 1S7XB 3QEUA 4U1KA 5KTEL 3Q5OA 1S5HB 2CHZA 1ZS2A 3N42F 1PYWA 4K3HA 4PWHA 1MCJA 4Z7WB 3IFOA 2BVQA 4WUUD 4X5XA 3HG1B 5DUMH 1KIRB 2NUTB 1G9ML 1LO3H 1YY9D 5IVZA 1CT8B 4XP4H 4CDGC 1LK3H 3VXMB 4YIQA 4BJLA 1IC5H 4X4ME 1SJEB 4XWOD 4BSWA 1LO4L 4HWZB 4PGJA 1BG1A 2AJZA 3JV5A 1EXHA 1F4HA 1I3GL 1LDPH 5C2BL 4WK0B 3KBEA 1XDTT 5K69A 2O5XL 1Q94A 1N7ML 5KZCB 4DK6A 3IJ9A 3QW9A 1TEGA 2Z0UA 5FYLH 5I16B 3FRUB 3QDMD 4CN4A 5IHLB 1A4KA 1KCLA 3ARPA 3FH5A 3L7EB 5E2JA 3ARFB 4JY4A 1FL5A 3E0GA 3NIDB 3FOLA 2YUXA 3TPUA 1KLUB 3V6OE 4WUKL