2JSFA

Solution structures of the envelope protein domain iii from the dengue-2 virus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords domain III of ENVELOPE PROTEIN E
publication title Solution structure and neutralizing antibody binding studies of domain III of the dengue-2 virus envelope protein.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jsfA00
4X42A 3UZEC 3N42F 4UT6A 4ALAC 5KVEE 3P54A 3MUUA 3WE1A 1Z3RA 2H0PA 1ZTXE 1OANA 3C5XA 4L5FE 2R69A 5AAWC 5GZNA 2P5PA 5KVGE 4AM0Q 3UZQB 4BZ1A 2JSFA 5JHLA 3UAJA 1OK8A 4BZ2A 1URZA 4UTBA 5B1CA 4FFZA 5LBSA 4UTAA 5JHMA 3N41F 5LBVA 1UZGA 2ALAA 5KVFE 3N40F 4FG0A 4GT0A 1RERA 3UYPB 3N44F 3IRCA 2JV6A 1Z66A 3N43F 2GG1A 5H37A 1SVBA 3C6EA 3VTTA 3UZVA 5IREA 4AL8C 5KVDE 4UT9A 5LCVA 3G7TA 2I69A 2R29A 5IZ7A 4UTCA 1OKEA 5GZOA 1S6NA 1TG8A 2JQMA 4FFYA 3J2PA 4GSXA 2V33A 5AAMC 2HG0A 1PJWA 3J27A
chains in the Genus database with same CATH superfamily
4P23C 5EBWA 5DWUL 5E9NA 4HJIA 1BMZA 1KXQE 2OMZA 2YRLA 4QGYA 3I3BA 4PGCA 4S1RH 1NPUA 2P5WA 3WLBA 3OF6D 2XA3A 5C07A 4HOZA 3MJGX 5D72H 4ZS7H 3GJFA 1BM3H 4HCIA 3RWEB 5HYFA 1JHKH 1MCRA 3MREA 5I8KL 4ZTPH 1K6QH 3AY4A 3TF7C 4D3CH 2R7EB 3L4VA 5F9WC 4A66A 4EN3D 1JBJA 5FYLE 3QBTB 2X4UB 1INQA 1EX0A 3GMRB 1PSKH 3LCYA 2O93L 3Q3GB 1BXXA 4KRMB 4JHVA 3U9PL 3RUGF 2FSEB 3CX5J 1MPAH 3FHEA 2P52A 5IKCB 3BQUC 2WSPA 2PO6A 3PE9A 1UVQB 3QUMB 4HFUH 3VB9A 2F0CA 1NLBL 2E6JA 3JYBA 1AXSB 2D7OA 1IAOA 1FNEB 3EOBB 4Y7OC 5PAZA 3GRWH 1SXSA 1ZLSL 4PSPA 2I5YH 3TYFB 5GGUB 4QRFA 4DVRL 2QMKA 4IHOB 4KY2A 1FJ1A 4JKMA 2VUOA 5DJ0B 4BJLA 4NNPL 1BFOA 1UENA 1NAMA 1S7QA 4TTGA 5MEQB 1MW2A 1O9ZA 2QQLH 2Z92B 4JZJA 3BJ91 4FI6A 2IOMA 4J3BA 3VGDA 5C8JA 3MRMA 5DEFB 3TBVA 3TF4A 4H7VA 3DETD 2KLTA 4F7TA 4CILA 2VDRH 1U4FA 4NT6A 1QO3A 2FYYA 3X12B 3GGWA 3FBKA 2IVFC 3CN1A 3TO2A 1DLHA 1LYQA 3B9EA 3SHSA 2KLRA 5CLZA 2X2YA 4PB0L 3ARBB 5GGQL 5AYTA 4NCC2 4ZK8A 4XP1H 3L5XH 5EEWA 3SGEI 4KVNH 6PAZA 4JREB 3CZFA 1GS6X 4MHHI 2MTPA 4L5FH 2F7QA 2VDMH 3VD1A 3JYCA 4YDMA 1U2YA 1CGTA 1UB6A 2KQMA 4YSPA 5ALCL 3A6CH 3VW3L 3F62A 2NYZA 4PJEA 3SGJC 2MQ3A 2ZUUA 3V4UH 3S35H 4PS3A 3IAGC 1AG0A 4HAFA 4WK2B 3IJEA 5FA3A 5E5UB 3U2SA 3L1EA 1A7RH 1INEL 1Q8MA 1W80A 5ID0A 4R5XA 1M9SA 2P44B 1QQDB 4BHUI 4QHNA 3RDTC 2OPCA 4WO4B 3BLBA 1TJXA 1VLXA 4XXWA 1HYRC 4OLUL 5DD5H 3D3VE 5FO7A 3TGXA 1G9NH 4JQXC 3GTNA 1S9VB 3S3PA 4XHJC 2QZQA 5ANME 3BRFA 2Z93B 2ZSVB 4NDMA 1I9IH 3UYPA 5L2KD 3RWFA 4Z3IA 3W11C 2CDEB 4U1HA 3GSVB 5IM7A 4JPVH 5HI3C 2UVEA 5SWSE 4OAWA 5DI8B 2HVJB 2J1ZA 1J8SA 3C87A 3QC5X 3IJHB 5JHDA 1JXKA 4NHCL 3ULAB 1YY8B 4LMQI 5EU6B 1ZD6A 4M6OH 4H44C 3OJDA 5AW7B 1YEEH 1GGCH 2IH9A 1F11A 1E43A 5A2BA 3SDCD 3QJXA 3DC0A 4HUCA 2WGNB 3GKZA 4N2CA 4H8PA 1J1OL 4X7TA 4OLVL 5J6HA 1JCKA 2VLRB 3KJ4B 4F9PC 4NBYB 4YLQT 1IEAB 2NDGA 1IEBB 1FIGH 2V5TA 5ICZB 4PCSA 2WD0A 2L8AA 3AWFA 4OGAC 3RVVC 2ESVA 4PTTA 1NIAA 1OGAD 4G8IA 1VACB 4G8GE 4HJJL 1YN6A 5HGDB 4GXVH 2EJ1A 3X13A 3HG5A 1J88A 4K3DH 4HK0A 1TJMA 3VWKB 1QX1A 4RDQG 2QELA 4I3SL 2BOBB 1YC8A 4KNUA 4UM8B 3ULSA 4X6EA 4XVOA 1JNJA 1MI5E 5I17B 4JKPH 1AHWA 2JJUA 4FFYL 5JXAH 2ITFA 5EORH 2WJ5A 1LEIB 1LQSR 2E5EA 2YMXH 3MV7D 2EYRB 5KN5A 4XO5A 3ALPA 4YH6A 1CXIA 3FB6B 2B9BA 4PHZA 4RGOH 3CN3A 3O11A 2ROYA 1P7QD 1SMAA 1RJZA 1U3HC 5FGBA 1B3IA 1S5HB 2AV7A 4JN1L 4CVZB 1MCHA 3VACA 4HFWB 1RY7B 4MS8D 5I0ZA 4OM0H 2E7DA 4MCMA 4Z7VE 5INCA 5KYNA 1F6FB 4K5MA 5IFHL 2UY6B 2R83A 3QUZD 3HBGA 4OF7A 1DFBH 5FKPB 4PJDB 3WN6A 3T3MB 4CSPA 3WTWA 1LILA 4F15B 2NY6D 1A6VH 1T7XA 3L17A 4Y4FA 1VEOA 3G6AA 4PRPD 2JKNA 3ZU8A 5GS3A 4XNQB 3F65A 2VZUA 4HCRH 3CHQA 1BCIA 4NQSB 4AEIL 2CM5A 4NPJA 2H0FA 4BGLA 1D5MA 1NCHA 1Q1PA 1XR8A 4RFNC 4TUUA 5E03A 2I7OA 2FJSA 2H26A 5HJBA 1CFQB 1OP9A 4L4TA 4PJ8D 1DBBL 3MXWL 1BVLA 3L54A 5GJTL 3ZTJG 4FS0A 1K4DB 4DESA 1E9OB 1H8OA 1JE6A 5ABAA 3SBQA 5ICYA 4JFZL 3WDHA 3V0VA 4GRLC 4TLUA 2OL3L 2XOTA 4O2EB 2BOCB 2PPAA 3QORA 2L7JA 3V6ZA 4XXCC 4AYFA 5KG9A 1E4XH 4QHMA 3LPFA 4Y2DA 3QISA 3UG3A 1M53A 4FC3E 4KK8D 1KJ2B 2NY1C 2BH0A 4L8SB 1J12A 5BQ7B 5MEOA 1CN4A 2ZCKL 5LHDA 4QRSB 1REIA 1BLNA 2R23A 1K72A 2WKLA 3S96B 2ZXDA 4E5XG 4MA8L 1AMYA 3STZA 1KY7A 3FSAA 4B9ZA 1B4JH 3MVSA 4LVEA 4Y2NA 1J5OH 4I4WA 4YWGH 3FFCA 3IDGB 4XMZA 4D9RD 4ENZA 1UWXH 5KWYC 2B2XH 4OV5A 4UQ2A 1Y18A 3GHEL 1Q90A 5JXEC 3BP4B 5AVXB 2DD8L 3AQDA 4OIIH 2DJMA 4UV7H 2VDKB 1AGBB 4GSUA 4GP4B 1BJ1H 3CTTA 3DRQB 2JJSC 4WI7A 3K6NA 3EJZC 3KM2A 1CDYA 5BRZA 3QJQB 1T5XB 4QTFA 4FQ2L 1TYEB 2B1HH 4JM4L 4G7YL 4DP8X 4BH7A 1ONQB 1JYNA 4MJ6A 4XNXL 4U1LA 3HC4H 5I71B 5ISZA 4O02H 1ZGLP 1DVQA 4JRXE 2IBZY 1G9EA 2YRPA 3C09B 2WKGA 5ENWB 1IUZA 5I1LA 3JVFC 1B3JA 1IQWL 2RAMA 1OSEA 4L8BA 3ZE1E 3NFNA 5H37A 2EVIA 5F88B 3EO0A 5CCKL 5CEZL 5IG7A 5CP3A 3MV01 1YPZE 3FT9A 4DSYA 5BV7B 1VESA 3QFGA 5A3ID 1T04B 1BVNP 1NBVH 4PWHA 4XPGH 2FEDD 2A7BA 3G08A 2EDFA 4PS8A 1NEZA 5HBBA 3HPJB 1S78C 1KTCA 3B43A 4UINL 2EECA 4NC1E 1GAFH 2QQKL 3MUZ1 1DUYA 3FULA 5AVQB 4PJHF 4P99A 3L5IA 4CC0A 3CSTA 3PP3K 4XMKH 4WU5B 3L45A 5CILL 4BKLB 3FCSA 4L3EE 3IVKA 4BRVA 2YA1A 3EZ8A 4AEFA 4NO2B 4F7PB 2AV1A 1UXSA 3C2AL 3NEOA 5I2IB 1MVYA 1C5CL 3F7QA 3K8KA 1H8NA 1DQVA 1L7IH 3VXSB 4XI5D 1Z6JT 4G80A 4LL9A 5FCSH 3V4VA 1GL4B 4JO4H 5FHBH 2YA0A 5KVDL 2Y1YA 3N0AA 1L6ZA 5H35A 1AS8A 3MCLH 4ZSOB 1LXMA 3JWDH 4XVTH 5IB5A 2VZSA 3KPNB 3MHZA 1T1WA 3KYKL 4YXKH 3DTUB 1YJDH 4FXKB 3NCJL 5E9DA 2DQFB 1WZLA 1KBPA 1YLBB 3MLWH 2IOOA 2OMWB 4ADGA 1N0LB 5CCHE 3AT8A 5DJZB 3ARFC 4P2OB 5LBSH 4X8XA 1A7OH 4N0UE 4P4KB 3T2OA 4EIGB 4UOZA 3WUZA 1E7VA 1IGML 2BK8A 3OAYK 3PWPE 3WIIL 3WTTA 1Z5HA 5FO9B 4D8OA 4N0YL 5KVFE 4ENED 5MHSD 3GIZH 4M8UA 4M3HA 4X6DB 2BNRD 1E27B 4HJGB 5J6GB 4KJWC 1CGUA 2GC7C 1DUZB 5D1QB 1QWNA 5ETUA 4CNIA 4R7NB 1KCKA 1BMGA 2VR3A 4E9RA 2DMHA 4EIUA 1MF2L 3H0TB 2NMSA 4FQJH 1CTMA 3N44F 1I1YB 2WOBA 1OAYH 1MCPH 1S7VB 3P4MB 1RJLA 3GHBH 1EFQA 2QVIA 4FMKA 3H9HB 5HVHB 1Q0XH 3DOSB 2JI2A 4NUJB 1I8KB 1AOHA 2VXVL 2XFGB 2G4EA 2OJZH 1NM9A 2CGZA 2R2BA 1BQLL 2MPAL 1MLCA 1L9QA 2J8UE 5D5MF 5EO1B 2AEPH 2V7HA 3QZOA 1DLFH 2YKLH 2BZ7A 5FUCE 2Q1EA 4BZ2L 1ZGLA 1OGTA 1SY6A 3HZKA 5E1AA 5I73B 3CVBA 5GJSL 3HUJF 1BV8A 3GRGA 2G3NA 5IVXF 3RX9A 4ANXA 3AAZA 1QUNB 5C0BB 3RWDA 4JFWA 4GKSB 1RMFH 3QWQB 2ARJQ 3WKML 2X09A 1JP5A 2EXWC 5DD0H 1T0NB 1JWSA 4HUWA 4MNGA 3K6OA 4EQ2A 4F93B 3P2BA 1KYDA 3CH1B 4V1DD 3IU4H 3QFDA 4AG4H 3SKOB 4W6YB 4W9HC 1HIML 5DZVA 2ROXA 1SXNA 2PCXA 2X3AA 3ZE2E 2CO7A 2YPLE 2LABA 4WEBH 2JKLA 4G2AA 4MA7L 3WY4A 4BSJA 1J8KA 1IC0A 1GR7A 4HKBA 4PJAB 1X9RA 5DFVD 2F53E 1WIPA 1T4KB 1N0XH 1HAUA 4U3CA 1VGEH 5A16A 3T1WA 2PR4H 1HH6B 3B5GA 3BKYH 1MJ8L 4XNYL 5T5FA 1AHKA 2DLFL 2NY5C 4JFTA 5D2NC 5D7IF 1FVDA 5L6YL 3QI9C 1YO4A 1I8MA 4LEOB 4CGUB 4CU8A 3VXUB 3V7AG 3SYCA 1OF0A 2Y7QA 1HHHB 4HXBH 3TBSA 3QJFB 3BE1H 3LIZL 4Z7IA 2DLGA 3CUPB 4M00A 4Z3JA 2K45A 5I1IH 1F00I 4GO9A 4UTAA 3RGBA 2ZOLA 3NCCB 2UYLA 1N67A 4HZAA 1MLBB 1N70A 1XZ0A 2UXGA 2XTJB 3NSJA 2NUPA 4OFVA 5EWIH 3WKNA 4XBMA 3SODB 2XY1A 1X3DA 4PGDB 1AKJA 1N8OE 4HETA 1JDAA 4JY6A 2YPKA 3DSFH 3L95B 3MOAL 1S9YA 3L1OL 4X5QA 3NZSA 4G5ZH 5ALBH 3ZHFA 4ABQA 5IB2B 3HVNA 5JIDA 5TQ0H 4OJEH 4XO4A 4TUKH 1FG9C 1I3GL 3KR3L 1E5AA 1T3FA 4U33A 5EC1B 5BZDB 3PY9A 3L3HA 4QF1A 4QXTA 3QNYB 3UZVA 3VTTA 3CSBA 1Z3GL 5C0CA 1ZLWH 4E41B 3HHSB 2PN5A 3ARBD 5GPRA 3BVTA 5E1IA 4FGMA 3D9AH 1MFEH 2WP3O 1AR1C 1EEZA 1UYWH 2ATKA 3T8MA 2BVQA 1JNHB 3CNKA 3NOIA 2LW3A 2R1XA 5FV2A 1LEKB 3MRJB 3FMGL 3VRLF 3X1GA 1AI1L 1P5VA 2AJ3B 3CCHA 4NRXA 5BZXA 3I75A 1SXAA 4DH2A 4LCWA 1R3JB 2AAVA 3B2UD 5FYJL 1BDYA 4JGNA 3NFSH 4TNWF 2XPGA 1Q72L 1Z32X 4U6HA 4E0RA 4RSYA 3V55A 3WFEL 4EXPX 1BQRA 4G3YH 3FTGA 2JB5H 3F3HA 2AGJL 4PY8J 1JHLL 2LOEA 4WO4D 5CIPH 5KSVA 4WWOA 2HVBA 2ILLA 4PJCA 2E7CA 4W81A 1SJHA 4YE4H 5AB9A 5IWLA 4R7DA 1GGUA 2EEXA 2UXTA 5CMAA 3WS3B 1MCIA 3RTQC 3HHRB 2O5ZL 1YRKA 2HJKA 2G30A 2QJDA 3NIDB 2J12B 3ZKSD 2F8IA 4OZIF 5E8NB 4O2FA 2OL3B 2R4SH 1PIGA 2W9EL 2NY4C 2PWGA 4G5AA 4G1MA 5FUOH 3TV3L 1EHLL 5HPMA 4L9LB 3E0GA 1JZEA 5ERWB 4Y9GA 3VXPB 3C08H 1ZHNA 5HI5C 3BIKA 3N85L 5DMIL 5I5MA 4R4ND 2IV9A 2XV2A 4GW1B 3PUUA 4GY4A 5EU6D 1QSEB 2V17L 1HNFA 4CW1A 4L3FA 4TSAL 4GEJA 1UB5B 3DTXA 4NIYE 3H7BB 1KYOK 4QRUB 3WJJA 5DURD 2ZWYA 1XGZA 1Q9WB 2VSKB 4OM1L 2WNKA 3UAJC 2HYMA 2HJFA 3NUKA 3PL6D 4Q9RL 4P46A 5TK2A 4TVSa 1KTBA 2IANB 3X1NA 4ZMOA 3H2WA 5ADPL 1HESA 2Z8RA 3QW9A 4BFNA 4J3XA 1J5HA 4A68A 1OM3H 4IRSB 2H1LM 5EF1A 4P59L 3VFMA 3CC5B 2GC4C 2Q76A 1VGKA 3REVA 1BA9A 3B83A 2IAMA 3CBJB 1MIEH 3OKOB 1XH1A 1XF5A 3PGFL 4X5XA 5D8JL 4FRWA 4GMTH 5TE4L 4F24A 3P11L 1P6WA 3RWHA 3VWKD 1ZIBA 4BEIA 1A14L 4GO6B 4ELME 4H26A 1ZA3A 4OD2A 3TTYA 1CFNB 1F3DJ 3FCUB 3T0EB 3S4SA 5D1ZA 4NQDA 1B0GA 4LDOB 2XZQL 4XP6H 4YR6A 1JGUL 4XO8A 4PJGA 2L7UA 2OSLB 2KC0A 1WC7B 3RHWK 2VLLB 5HY9B 3GM0A 4AK1A 3O3EB 2VSCA 1QLRA 1CU4L 4GPVA 5K9OB 1SRDA 4ZQKB 5BOZG 2B1OA 4I18B 1J48A 5CSZB 1MNUL 1AQ8A 3WFCH 1NKGA 4P07A 4BFJA 4S2SA 3DRTB 3KPRB 4JHUA 3B7YA 2NSXA 3UGEA 4RQQB 2AMUA 1YEWA 1JZ4A 2FJHB 1MWOA 1DBJH 2X5PA 3EUUA 4KNTA 4Y2LA 1RIHL 2KHAA 1S4IA 2DZEA 2KKQA 3BFWA 4MQSB 3UADA 3GS7A 3EG9A 4KVCL 5SWZE 2JXMA 1XMEB 4JPIA 3WEAA 3ZHNA 3D2TA 4R8WL 4FCAA 1OSPL 4RISL 2ZKHL 1MCOL 3X14A 4Y89A 3NEXA 4PJXA 1SLXA 1YUHA 2OCJA 3HPLB 5EDXA 5K39B 4OZHE 2XWEA 1QFUL 3LN5B 4JM2B 3FB8B 4DO6A 5FR3A 2JCCB 3O9WA 3QJVB 4GKZB 2PUQT 3BYYA 2A9DA 4WCYL 1RURH 4G9FE 4MMXA 3K7UA 2J1YA 1YHPA 4UNTA 3GYRA 2R8SL 1U8LB 1T21B 2R69H 1E65A 1ETZA 1MRFL 3IFNL 4KHXL 3PGDB 3MRKA 2NX5B 4GUPA 4H20H 4XB3A 1UXLA 2F7OA 1JOIA 4A7SA 2Z31D 3C5SA 1TZHA 4JFYA 3RDJA 3QRLA 3CN2A 1PL3A 1WO2A 3NA4A 5H37G 5IOKA 1YN7B 3STBA 1XF4B 2DQUL 2W9DH 2WN3A 4RMVA 4PJBF 2YXFA 4JM0A 4ZI8A 1WTGT 4CN4A 1CTOA 2QKIC 3BUYB 4FFZA 3D39A 1IM9B 4JJHA 4EZJA 5I6LA 5D96C 2EKSA 5IW6A 5HI4C 1KGJA 1HK6A 5AAWA 1MELA 4BDVA 1NEZG 3LMJL 4XMUA 3BPOB 3N1PC 4CGTA 1D6VL 3KJ6H 3CE1A 4ORZC 1U95A 4WW2A 2OAAA 3INUL 4N6QA 3GI8H 4B95C 3ULVL 3ATAA 5AAPA 1FCGA 2NCMA 4J4PC 1ZS8A 4J1UB 4DKFH 1ECZA 2J88L 1TZOA 4K9EC 4DZBA 1WISA 4YPJA 3LQAL 4DN4H 3CZEA 1NGWA 1TDQA 4X0NA 4B27A 5B1JC 3WHXA 1N5AA 3CFCL 3T1FB 2H1XA 4ELDA 1JF1A 1NDGA 2UWEE 4HGKC 2WBKA 2Y5QA 2Q9OA 1ASPA 3I9GH 4NXSA 1IQDA 4TKWA 4J3OD 1NCJA 2WINA 1FL6A 3B3IB 3WGVB 1KN4L 1JTPA 3EJRA 3VI4A 5ILTH 1NCTA 1RULH 2M8XA 5LAPA 1EO5A 3RZCB 2YAHA 4UZUA 1TG8A 2J21A 3C60C 1CE1H 5DHXB 1NMAL 3BN9C 1YEIH 2N3JA 4X5PA 2C5DC 4QOKD 5KS9B 2VLJD 5A2LH 1NC4A 3BDYH 4MJIB 2JMRA 2PPCA 2W07A 3PWNA 5DVPA 5FUZL 3ABMB 5LGHH 5GXBB 3GHPA 3HC3L 5EV7A 4HPOH 5DZLA 2ZUQC 4JG9A 1ZHKB 3KD4A 4KK9D 1NUGA 2Q0ZX 3PNRB 1MQ8A 3IJ7A 3TJHD 1AJ7L 4RSVA 1N6UA 4HIHA 4QRTA 1DBAL 2IMNA 4H1LA 5CUSL 3VXSD 4L4VA 1P4LB 4YHYC 3UC0L 4K07A 2ADJA 3MOBL 5TDOA 5CAYB 2GSGA 4YLCA 5L4FA 1G6RH 5MI0B 4DGVH 4ZNCD 3T4AB 4X6CB 1OZTG 2GFBA 3LNDA 5GZNA 3T4AA 2NYKA 1K5NA 1YNLH 2BSEA 3F01A 4WEUD 3RUGE 1DDTA 3KLLA 2DPKA 5ESAA 5JZ7C 1AZRA 5HP5A 1NIEA 4QGTA 2ADFH 1BAFH 2CZNA 2J2ZB 1NJ9A 2DY2A 2DYPA 1GSMA 3QYMA 3UBXB 1HINL 2FZ3A 4XCNB 1YJDC 1CUOA 1MFCH 1PMYA 1VIWA 3EF4A 2ZXBA 3H1ZA 3EJJX 2DRUA 3QHFL 4N8VB 4J3WA 4AL8L 4TVPH 4P4KD 4JDTL 4Z0XB 2R59A 2DTML 2RTTA 4YBQC 4OGXH 3QXUA 4N28A 3EH1A 4JFQA 2VT0A 2IDCA 3UFIA 1J8RA 1ES0B 5DK2B 1A9EB 1PZ2A 3QWRD 4LL4A 1KLUB 1BSIA 4FE9A 4JKNA 5ACZA 1DL7L 3DSNA 2OCFD 1IKOP 5D1QD 3X11A 2LLNA 2X3CA 5E4AA 4J3UA 2YMTA 2P24B 2Y1ZA 1U0QA 4MBRA 2ATPB 1KYFA 1HE8A 1KXQA 2YD8A 3BH8B 1ETA1 1WS8A 4G6MH 4WI0A 4EN2A 2X6VA 3QQ4B 2Q7AA 5DUMH 4PLJD 4QDGA 2R0WL 2RALA 3O81A 4LP4A 1GRWA 1K2DB 1XGTB 4HGWB 3ARRA 4FFWD 3GSWA 5EBWB 4KWUA 1QWUA 3WN5A 3UO8B 2AJXH 3QDGA 2OMZB 4GRWB 4JPWL 4K0OA 3V4VL 4I1PA 2OSYA 2P5WB 1ZS2A 1BZDA 2DF3A 2YLKA 4MAYA 4XVUC 1WTLA 5C07B 3N40P 4FTVE 3WLBB 4S0SD 4N1CA 1HL8A 3GJFB 5FGCE 3G3LA 1WFUA 2NT0A 5I0DA 1P7HL 2C3WA 1PS3A 3V0IA 3L3KA 3GMQA 4J3TA 1OPGH 3AS1A 5C9JA 1PY4A 2VXTH 5DR5H 1OLZA 5DC9B 3DJZA 3ABKB 5C0BD 2WYZA 2FGWL 2W92A 3J27A 3QZWG 2OSWA 4X50A 2AJZA 3UTZA 5JDSA 1KMGA 2VR6A 1PD1A 2PO6B 4YFDB 3LEXA 3OXRA 4LSPH 4EZKA 3IRPX 4PW4A 2W80C 3ZN6A 2ZUVA 4Q9CA 3FOMA 1KXVA 2DQIH 3S88L 5IQ9A 5GS1C 1CGVA 2X4SA 1IAOB 1Z3RA 2P3YA 1RPUA 4XN1A 3GXIA 2G60L 1U3NA 3WEOA 3DBXA 1HKFA 2YIHA 3U1QA 4HJUA 1H6TA 5EG6C 3WNPA 5AW0B 4NPYB 1BFOB 1S7QB 1AANA 3WKYA 1ULVA 4M93C 3QRFM 3WXWH 4BCZA 1U8KA 2Y22A 1F18A 2MCPH 2X70A 1CICA 3HN3A 4GJTB 3VFUA 2ED6A 4KJPD 2HB0A 3PIQA 5C8JB 3MRMB 5I1HH 3TBVB 4NQEB 3LHPH 1H3GA 1W6WA 3KW8A 4DGYH 2J3SA 3BZDA 3W56A 3BSZH 3C12A 2IGTA 2RQ8A 3VXUD 1VZHA 4KNSA 3KVDD 4NT6B 1QO3B 2FYYB 1DQML 3VYNA 4GAGH 3GGWB 3LH2H 3TO2B 2BVEA 1DLHB 1R9FA 3WE6B 4I3RL 3ABGA 5F3HA 4Z3GA 4F3FB 4UUJA 3IMWA 2VN4A 1CD0A 3CFMA 5FOBA 1XF2A 1SN2A 3L3OC 2BWDA 1UB6B 3NCFB 2C9VA 2VXSL 3OR6A 4EMZA 1FE8H 3CU7A 5D2NE 3GO1H 1SY6L 1XB6A 4PJEB 4TPRL 4AIEA 5JOPE 3EYQD 1NQBA 2UY7A 2OR8A 5ANMA 1MG2C 3DVNA 5FA3B 3U2SB 3BPNC 4Z7WF 5JA9A 3ZE0F 1SVBA 5ID0B 3IDUA 2CLRB 4TF4A 4CADA 4MCYA 4B9CA 2QHRH 4QHNB 1HQ4A 4JPKL 5IREA 4NBXB 5SWSA 2H0JA 2ORBH 2VR8A 4OCWL 3V52L 3IGUA 4Y9BA 1PQZA 2BFVH 5CHNB 4NQUA 4IRZH 2WPGA 4E41D 2YXVA 3Q43A 1XB8A 4P5KA 1BYOA 3D7PA 3DXAB 4JO2H 1PD6A 4MWFA 2XICA 2XXMB 4NDMB 3VFNA 5KYXA 3RWFB 4MB4A 1T0MA 5IM7B 1BWWA 1PZUB 1LVEA 1WFOA 2WK2A 5IESL 3DMMC 1QRNA 2YWZA 2AITA 3CG8A 2P48B 4W9KC 1MJ7H 1OAZL 2W0PA 1KBWA 4LHUA 2QQNL 2HH0L 4Q56A 5T5FL 3LVEA 1QVOA 3ZO9A 1DSFH 1AG6A 1EMTL 2WLYA 2K9FB 3K6IA 1SOQA 3KNBA 4YBLB 3O6LH 2WZPD 1DQQA 2Y23A 4Z5RA 2APFA 3QYNA 2H6PA 4M7LT 1KJMA 2P43B 2X2IA 4W4OA 2FIKA 4WAFA 5CLTA 4E36A 4X7TB 3RPBA 4KKQA 1Q9OA 3I6KB 5TFSL 2EVJA 2Y6SD 1JYXA 2VLKB 4C59B 2FWOB 4WO0A 3ZTJH 3JVGC 2GSMB 5FK9A 5CGYC 4Q6IC 3QIUC 5DZNA 4OFKA 4OKDA 2AI0L 4XPTL 5I8CA 3TXAA 3L4WA 1BGXH 2WQAA 1J9SA 4UTAL 1OCWH 2ESVB 4PMFA 1A8JH 1NCBH 3L48A 3FT2A 4L5FE 2EE3A 2W65A 5AD0A 3UZEA 2WWKO 4K7PX 1E4HA 4E2OA 1OSZA 3VWJD 3CZSA 3S4SG 4PVMA 1OQXA 3MLYL 4LCUA 4J7RA 4Z7NF 3K72A 2YD5A 3L1FA 3NGBC 3EH4B 5FW6A 4CSSA 2NY0C 4LARH 5C3TA 1XBDA 4FQHB 1F8TL 1UM6L 4X6EB 3ULSB 5DCCA 3L2NA 1KJ3H 1FNGA 1T66C 1V54B 3ZOAA 3D07A 1KCVL 3T8XA 2PW2B 1OW0A 3SEPA 3AS0A 3QCUL 3UXFA 1D5BA 1LP9B 4JG5A 5AW2B 5EZJB 2BWIA 1JVLA 2FL5B 2R4RL 3X3FL 5E8EB 3VD2A 2IAND 1OWWA 3FTWA 4AJVA 3C8KB 4FZ8H 2X9WA 1TITA 2DI9A 2WQXA 5BPPA 4Z77B 1QPKA 3R19A 4IRSD 3KWXA 2AV7B 4UOJA 2CUMA 1B0RA 2YA2A 3GBDA 1HZHH 1T1ZA 3R06A 3TFKD 2A0LD 2V37A 2XHNA 5INCB 4OV6F 1W6LA 3VQLA 2YK1H 4Z7QF 2FX8L 2XZCL 3BUDA 3ILPA 3ZKNC 4N0CD 3KXFB 1JPFA 4YEFA 2A73A 1T83A 4LRIC 5DZAA 5F7WC 3TA4D 1QNZL 2OQJB 1MCKA 2GCYA 4Y4FB 3T0ED 1NL0L 5EC2B 3NRFA 3MAWA 5FAAA 3SYPA 3P1VA 1HYSC 2UXFA 4GH7B 1UM4H 4LLUA 4WEMB 3UJIL 3H3PH 1W0YT 2QL1A 2CU9A 5E2TL 4R2GC 1XR8B 3TT3H 3LKPA 5FO8A 5C97A 1JAEA 4PJ9B 4DK6A 3GI9L 1KPVA 5E5MA 1IBHA 4IJ3C 1YCSA 4MVBC 5TPWL 3VMPA 4AQEB 5TF1H 4F9LC 3SDYL 3Q5TA 3PFUA 5DA4A 2R9HC 1QI5A 1IU1A 2LHAA 4YHIB 4IK6A 1FG2B 3MV9D 1A2YB 1TNNA 4PJHE 2H3XC 5AAMA 3KPRD 4PWFA 2GHWB 5TE7H 5DHVA 3OHXB 3V6ZB 4AYFB 2JKRM 3CLFH 3D2UA 4Z8FL 4Y2DB 4WK0B 1K9TA 4JHAL 3E6HA 2Y5EA 2FBRA 4RDQF 4CUCA 4JG1H 4HIXL 5KSBB 2UUDK 4ODTH 3G6DL 2JI1A 5GGSY 1S8DA 2W88A 1BLNB 2EIKB 3OJVC 2R23B 1WBYB 4M7LH 1O7SA 3NPZB 4JM2D 3RNQA 3STZB 2CHZA 1RPKA 4NERA 4I4WB 3N04A 3O4OC 4NZ8A 2JH2A 4KMTH 3GLEA 4CU7A 2V9TA 3BP6A 3OLEA 5IQ7L 1C5BH 3AB0B 4AQ1B 4EDWL 3FJTA 1F1DA 4M6NL 5EFIA 4OV5B 4UQ2B 1Y18B 2DWEB 3IN2A 4JRXA 2XQYK 4H8WH 4PAZA 1NKRA 4HCGA 4GBXA 2EXYC 5D55A 5BRZB 4XVJH 2NX5D 1AYOA 1MVUB 2FX7L 3IBOA 4IIQC 1KENH 3NAAL 2E9IA 4AE1A 1HWGB 1GMEA 1OXYA 3US9A 2WIIA 4BH7B 3AJ7A 4MJ6B 3H6AA 2B15A 4POUB 4OCLC 5ISZB 4RMTA 1FRGL 3FB5B 2XN2A 2ZCHH 3EBAA 1MRCH 4UTBA 1M57B 1ROCA 4PP2A 1H3TA 3DECA 5I9QC 2WQUA 5HDBB 2WM0A 1K8DA 3NFNB 4EOWH 4KUCF 2ICCA 1ZY9A 2IDQA 4F8OA 2IWKA 1IM9D 5IG7B 3D25B 4XMPL 4X2UA 1G9HA 1EXHA 2JJWA 2X4PA 3JTBA 3NIGB 3GSOA 5GS2H 2YRBA 3HNVH 1RZIB 3G08B 3S36L 4FL4C 2FQFA 4Y5VC 5EULV 3WUWA 4R83A 1DYZA 4FXGC 3ZK0A 3ZR6A 1WE5A 1WWAX 3RPIB 5J9PA 1J87A 1FH5H 3IJYB 1TVBA 3IRZA 2MNUA 3FCSB 1XVSA 3QUXB 4AKPA 3SCMD 4P9ML 3OKLA 4B7LA 2ZOUA 1UXSB 3NJHA 4M5YH 5B3JF 2EDKA 2JKXA 3BEVB 2A77H 1HL9A 1Q1JH 5BO1L 1DE4A 5D5ME 2WUBH 3DO3A 4OLEA 2VH5L 4G80B 3PABA 5D9SA 2BHUA 1M56B 3V4VB 4FA7B 4NZJA 3RP1A 1CLCA 2ZUYA 5J3HC 3RVXD 4HZLA 4NJAL 1OAJA 3HUJE 1WZ1L 4GSXA 1TZIB 1RSFA 3DYPA 4FHJA 4QO1A 1K3ZA 3P69A 3QJTB 4X98A 5IB5B 3LYRA 3RZCD 1XCQA 5MEPA 4YX2H 1FC1A 4OZFH 2F2HA 4UDTA 1W9XA 2DEYX 3MACL 1SYSA 4HPYH 1HHGB 5T33H 4IGBA 1H9VA 5F7EL 4GAYA 4OUUA 2BP5M 2YHGA 2AJYL 2ZXWB 3HE7C 1BIHA 1G87A 1MCCA 2YN3A 1U8JA 4MCNA 4X6FB 4F33A 2H0PA 4X6BB 3KPLB 3TPUA 4YSUA 4KAQH 4FFZL 4JPQA 3RU8L 5JUEL 1L9NA 3RLSA 4N90D 1GZQA 4OJYA 3CV5A 3TCLB 3U79A 3OKYA 1KPRA 2AK1H 4LSUH 2A6IA 5D7IE 1J86A 3CFKA 4GI9A 3UC2A 1DVFC 3ES6A 3ML9A 2V7NA 2EDNA 5E6ZA 2WQRA 4PY8I 3D87B 3HFFA 5ETUB 4CNIB 2EZ0C 5DMKA 1ICTA 4Y9EA 3GTTA 2J8UA 5IGXH 1N59A 3R0MA 3VM7A 2VITA 3BAEH 2BY1A 3IS0X 1ZPLA 2HA1A 4M6AA 1S3KL 2VERA 1ZAGA 2J5WA 3STLA 1JZ5A 4QHUA 2X4TB 1RZGA 3NJJA 3MNWB 5C0RL 2CHDA 4LVNB 3LSOB 2F7PA 4XBGA 5E51A 2R2BB 1MLCB 1P5UC 5D1XA 2V7HB 3M86A 4WHYH 4EF3A 5F9DC 4WV1A 1ZGLB 1OGTB 3PU7A 1EZVX 3HZKB 4HH9A 3SQOL 5KVEH 2COVD 2VMCA 3ABZA 5K93A 3IWVA 5FB8A 4FQIH 5JIQA 3QDJE 3NCXA 4KK6C 2WWOA 3N43F 1CFBA 2VAAB 2YPLA 3AAZB 3K81A 2YOAA 1G5AA 1P0SE 3QDMD 5C2BL 4NKDB 5F7LB 1JWSB 2FE0A 4HUWB 2D4DA 4A7QA 3QFDB 2CHWA 3AQZA 2Z4TA 3FU3A 3HBQA 4XCEA 3IDNA 2WUCH 1CXEA 3L4TA 4OH2A 1AIZA 2CO7B 3EW3B 1QPXA 4MXVF 3VRLE 3L6FB 2BZCA 2IADA 3DJTA 4IBZA 2X88A 4P2RA 4Y16A 1Z1WA 2P5WD 1YYMH 4UQ3A 3AG3B 5C07D 5CKGA 3MA7B 1SJVA 5D4IA 3A67L 3UBGA 4LB8A 1HXKA 2E27L 3UYRL 1CWVA 4P23A 2BP0A 5A16B 3II2A 2FR4B 1WA2X 5DS8B 1HT6A 4M1GH 1FVDB 2F5BL 2BC4A 5FYJD 4U1MA 3G5YB 4NZTH 5KANI 1J1PL 3D1MC 3P9MA 5K69A 2VR9A 1KULA 4NC2B 2ZG3A 1YEJL 2Y7QB 5FYKL 1WWCA 3A4EA 3T77B 4RMBA 1RUAH 1QI4A 4WI5A 3O6FC 3BT2L 3KM1A 1R24A 3QPXL 4Y5XC 2PO6D 1RUMH 3DHJA 1NEUA 2BNUA 2Z9TA 1IAKA 4XODA 4DP2X 2QVKA 1F86A 4OZIE 2EDXA 2LVCA 1OT1A 2AQNA 4OZGA 2EXSA 4MQXC 3LEVL 2ZOLB 2HX9A 2A6JA 3ZZSA 2UYLB 1JJUA 1EA9C 3BQUA 2DQDL 2L0DA 1NMCC 1XZ0B 4AZ8B 5F7BA 2MCG1 2Y72A 1YEHL 4YXLH 2HN7A 4X7DC 3L08A 1FC2D 5AVYB 5ACMA 2CJUL 1PX3A 4I0PC 3OAZK 4JY6B 1S9YB 5IEHB 4NQED 2UZIH 5KUMA 5BUPA 1F6AA 2Z7UA 2HX8A 4RH4A 2HPOA 4OJCA 3L4ZA 4QRPE 2LAGB 3CGTA 3OKKB 1T3FB 1KJVA 5GZOD 4QF1B 3UTPD 3UZVB 5C0CB 4K3JH 3RTLA 3O4LE 1J8HA 2VQ4A 4HISA 3L9YA 4I3GA 3HFMH 1IVLA 1EEZB 4FG4A 4EE2A 3GLDA 3P9LA 3MR9A 4L8DA 2PABA 4LRNL 1HNYA 4LVHB 4WTZA 5FYLL 3TURA 2R1XB 4LHUG 1BVOA 4DP6X 1GYWA 3QXTA 3VFPA 2XZAL 4Y88A 3D18A 4NRXB 1VPOL 1CGSH 3OPZH 4BFGA 3I75B 3VXME 3MRRA 4PWKA 4XTRC 3H55A 5AVVB 4RMQA 3AWEA 1MFAL 4C8XA 5ID1A 1T7WA 4U6HB 2VLRE 3HI5L 5E2JA 1NFDF 1LNUA 1JL8A 2I69A 2WJ7A 4H13C 3SGJA 5E0FA 5KSVB 1U8CA 2QT6A 3OZLA 2R1YB 4CKQA 1F56A 2ZJSH 4X8JA 3WJLC 3UTTB 2DKUA 1EBPA 2IJ0C 2IPUK 3ECWA 5CMAB 3DXAD 1Z5LB 3WEMA 2B0SH 5I75C 2YOCA 3MDJA 2HJKB 1KN2L 3DV6A 3RDTA 3AQXA 1GC1H 2F5AH 2TSAA 1LEGB 5HPMB 4GQPH 4JQXA 1WWBX 1ZHNB 2G3XA 3ILQD 5H4ZA 4LSSL 3Q0HA 5T1JA 3RYMA 4IDJH 3A6BH 1L9OA 4ZS6C 4MAUH 1W72H 1YECH 2EDQA 2WVVB 3WFZA 5J11B 4M62H 3DTXB 1PLCA 3LB6C 4NO0A 1BD2E 1E6OL 3GBEA 3UIZA 4KKBC 4OCMC 3WO4B 2VLKD 1EWHA 4XP4L 3JT2A 2HJFB 1NCDL 3DPDA 4P46B 3NMEA 3I3EA 3RJQB 1D6EA 4ELMA 2ODIA 1KTJA 3R1GL 5DMGD 1XIWC 5J13B 4NN6B 2ESVD 2EUXA 3RKPA 2Q76B 5AVUB 1VGKB 2CMRH 1MKFA 5C0AB 3MRDB 1F4YL 1PZCA 2IAMB 3JZ7A 4OCRH 3UBXI 4F9PA 4X5XB 1XF5B 3CQFA 5JPNC 1MAKA 3SBRA 3FTUA 4BKTC 3TH4T 4H2AA 1J10A 5IROC 5AZEL 4RMRA 5CBEA 4GW5A 4OB5L 1ZA3B 4BBWA 4KKZA 1TLKA 4PJBE 3VA2C 3QUYC 5CFAA 2DIAA 4NBZB 3S4SB 3VX0A 1JPTL 5D1ZB 2VDNL 4NQDB 4YR6B 3UP6A 1USQA 3SDXA 3ML8A 2R2EA 4PJGB 3RVTC 3VGBA 5CD3B 1NC2A 4X9FA 5ITFB 3QCTL 2QLYA 2X7LA 4M8VA 2P8PB 1X44A 2E46A 4N25A 4PWIA 1KUMA 5F6HJ 5KUKA 5SWZA 2PF6A 1KZQA 3ULVD 2VKXA 2LQRA 1FVCB 3GSNH 4FD0A 4ELKA 43CAA 2MCMA 3EYSL 3WSQL 4OZHA 5IHUL 1QEWA 1T5WA 2WWMC 3P0VH 1L0XA 3L5HA 4FNPA 3KXFD 3ARDC 4L1BA 2JXMB 2OR9H 2H3KA 1I1FA 4G9FA 4JPIB 2BS9A 2G3ZA 3ARUA 4Y4FD 2EXTA 3QUMH 4TV3A 5K59F 4G1EB 4WJ5A 3S37L 4KOBA 1YUHB 1M05B 1LK3L 1OT4A 3T0VA 1Y6NR 1T20A 3WL9A 4OKVA 4MNQA 4YK4C 2ICEA 4PTUA 3K4AA 5EUOF 1FDLL 4XCYA 4ZFZA 3O9WB 5JR1L 4PJ9D 4YSQA 1CXKA 1RUQH 1TTGA 4V11A 4MMXB 2YQ3A 3X1EA 2AXFB 2DMCA 4FEMA 3MSPA 1JZIA 5E6IC 4HVBA 5IJKC 3AT0A 1IC4L 2WANA 1JZGA 1ETZB 1TU2A 4M9PA 4TNEA 2G5BA 4LASH 3RFZC 3MRKB 5FA4A 2WZAA 1GS7A 3E38A 4GUPB 4RGMB 4MJ5A 3L2MA 3JXAA 2XETA 5DRWB 3C5SB 4JFYB 1TZHB 4TM9A 2HT2D 4Y2DD 4WZ9A 4YHOL 4LEXL 4XAKE 2B4CH 3DETC 4LKXA 4MRCA 4PJ5E 1WD8A 3QS3A 4GRLA 3H3KA 4YQXH 2VR5A 3ARSA 3OTTA 4HIIA 1FWXA 4G8FB 5T1KA 4URKA 4JFDA 3KLDA 3FUJA 5DA0B 3VG9C 4OI7A 4XXCA 1RVFL 1G1YA 3D39B 3JT0A 5GRJL 2EKSB 4MA1C 3GZKA 4DN3L 1JZHA 3P0YH 4MFHA 2DIEA 4YDLC 1CXFA 3WUWG 2CR0A 2AQQA 4N2BA 3VTMA 3OKEA 4WW2B 1YMME 5SX5K 4I13B 4AGNA 2UWEA 3CK0L 3UAFA 1IAIL 3SJVB 4H8WC 3HLAA 2Y69B 4ADIA 4DZBB 2RACA 3OLGA 4WTWA 4KGJA 1OOAA 1FSKC 5F6IB 4YIQA 5I1EL 5JXEA 1NGWB 4OQ1A 5D2LF 5JPMC 5ISZD 3WHXB 2KQNA 1N5AB 4F5CE 2JJSA 2PWDA 5I82A 3ULUL 4D0DA 1JF1B 1NDGB 4KXZH 5HYSB 3ZDZF 4U6XA 4PREA 1TETL 4CVWA 5B39A 4BSVA 2HTKC 2H6OA 4XO3A 4LOUD 3V0WL 3O3AB 1IQDB 4AJ0A 1H5BB 2VRAA 2FATH 2GTQA 3NK3A 3QUKA 1SVCP 1FL6B 4HBCL 2BZDA 1XGUA 3VI4B 1F02I 4L3CA 1NAKH 3OB0H 1SXBA 1IGIL 4NJ9H 4P3DB 12E8L 1UASA 5GSVB 1LWJA 2DKSA 4NO5B 1SYVA 1PYWA 2IPTH 3QSKB 1CT8A 5FDYA 5AZ2H 1BFTA 3MODL 2W07B 2N7BA 3PWNB 2NY2C 3QUXD 4UT9A 4AYBA 3HEIB 4N2DA 4MCZA 5DRXA 2W59A 2QKSA 2B1AH 5JW4Q 4HIHB 1V05A 2JTDA 1ZVSA 1RUKL 1RU9L 4QRTB 5E94A 3WCYA 4H1LB 2H0EA 2VZVA 3BX7C 1M9WA 4KX7A 5IT2L 2OZ4H 5EU5A 3QWOB 5I30L 5CJQL 2ADJB 1T2QL 5ES4B 4KDWA 3V5KA 5TDOB 1LDPH 2GSGB 1E4KC 2R1WB 3T2PA 2BCKB 4OD3H 1G84A 5EN2B 3DK2A 4FNRA 5TE6L 2GFBB 1QACA 3SE4C 3SKJL 1K5NB 2DYSB 1TZ8A 4BUGA 2ZWSA 3BMWA 2CKBA 3MXVH 5ESAB 3UTQB 1BW8A 4GQZA 2G3MA 4PG9A 1NICA 3CVCA 1ORQB 1NJ9B 3LV3A 5DHEA 5F1KC 3ZRFC 3TNNA 3S8GB 2BIPA 1XEUA 3QXWA 4G82A 4UTBL 5DRNA 1CMOA 4L1LA 4M6MH 1QP1A 3DWTA 3TFBA 3JV4A 2Q2LA 1FORL 4RA3A 1T22A 3MJ9H 4NZRH 2Z7ZA 4Y0GA 4GP5B 3DX7A 4XVSH 5AYUH 4Q97A 5KJ4A 4JZJC 3V79C 3ARFA 2WVUA 2CGYA 4I89A 5ACZB 3FTSA 3UTSA 5LO7A 3ZT6A 1F42A 1E3FA 4FFVC 3QUZC 5HHMD 2IPKA 2CCWA 3MRHA 4OFQA 1JF5A 1WGOA 5D71L 3KAAA 2F58H 4JQIH 4WI0B 1OOWA 2Y07H 3EDFA 2E86A 4OLXL 1R5IB 4YSEA 1IGTB 1FZOA 5EBLA 4F7EA 1U4EA 4KO6A 1CDJA 5JIIA 1VCAA 2EH7H 3MBWB 3FFDA 1MWAH 3MV11 3O2DA 3ETBJ 1L9SA 3GSWB 2IDSA 2XV0A 2YD3A 1I9RH 3F83A 1JZ2A 1UJ3B 4S1DC 4WFHE 4ONOA 4MAYB 1YNKL 3H6JA 5DJDA 2VR4A 3KWWA 2CRIA 3AABA 4QR7A 1D3CA 2B3IA 4XZUA 1FAIL 1ETB1 2X44D 2ZPKL 4TRPH 4GNKB 5GISH 3L3KB 5IBTL 3GMQB 4Q9QL 2J4WH 4FYRA 4Z7WE 5EZIL 5BXFA 5C9JB 1ZCRA 3IE4A 3ZE0E 5IJBC 1IKFH 4GQRA 3D6GA 2X1OA 3OJ2C 4HUUB 4U05A 3BPCB 4JFEE 2P8LA 2AJZB 1JUFA 2HLFD 5C71A 2LLGA 1O7DC 2B08A 4AVHA 3IMTA 1JWMB 1P1ZB 5KVFL 3EGDA 1LE5B 3LEXB 4O4YH 3S8FB 2ED7A 3BVVA 4XE5B 5DMYA 5K1VA 4XAWL 1PG7W 3FOMB 5IQ9B 4YDIH 2XTJE 3UOAB 4TVPE 2I25N 4N2NA 4OCXH 3BKJL 3LZLA 3T0WA 1A7NH 4G70B 4DP1X 4WI2A 1NCAH 4B3EA 3ATBA 2C9SA 1FO0H 1S5IH 1U8KB 4F7MA 3BSGA 2GJ6E 3OVUB 3LXAA 3NCYP 5IBUB 3KG5A 3RIKA 3U2IA 3DVGA 4OF5A 1C5DA 1NCNA 3PIQB 3QE5A 1TO4A 1MHEA 4JY5L 4G6JL 2DQHH 2IH3A 2HMIC 2CPUA 1RHHA 4GIOA 1HI6A 2FIRT 3VD7A 3FH5A 2FWUA 1PLGL 5D2NA 3RY5A 2DQGL 4J3OH 4QJ4B 4K2UL 2ZX5A 1B4RA 1CGWA 4WTZG 1O6SA 4BZ1H 3HNTL 4JO5A 3K5SA 4KFZC 1RD6A 4JAMA 4FQ1L 5FOBB 3PPSA 3S5LA 1FLTX 1JV2A 3FQXA 4NP4H 4CVXA 3NN8B 5I1JH 2JKIS 3KYNA 2R56H 1AACA 2Q86A 5FWRA 4Z7NE 4NGHH 4LHJB 1QFWH 4TQIA 3EZJB 2KH2B 3DV4A 2ZKMX 2UY7B 5TJWK 5ANMB 5B1CA 3DVNB 1AHWC 3MBXL 4XZ4A 3GRWA 1UH4A 2IWFA 4QAWA 4X80H 2HCZX 4O51B 3UYOD 4AJYV 5E5LA 2CK0L 2WC7A 4KDVA 5TGBA 4MCYB 3GMOA 5E8PA 5CCJA 1HQ4B 3BGMA 4A2EA 5SWSB 3FQWB 1EBAA 1PQZB 5C0CD 4YEEA 2JIXA 3RIAK 2KS0A 1G7JA 2R2HA 1ZE3H 4P5KB 3D0LA 4MWFB 1IGYA 1QMUA 1TNMA 5FGBC 3VFNB 5GRXG 4U1KA 2XX0A 2XA8L 5I8KH 3IFPA 4EQ3A 5E4EB 3SD5A 4Z7QE 1FZMA 5L7XL 2WVSA 3BEWA 2O5YL 1DQJA 1QRNB 4C55A 1UH2A 1QSEE 4FZEH 3H9YA 2Z3FA 1KTLA 4XBEH 3J7HA 3FQ2A 1M7DB 5F1SA 2K6YA 4J12A 5DJYA 2BP8A 5I74C 2APBA 3ZHKA 4HMDA 4ZZKA 4QKTA 5JO5A 5CXPA 5DQDH 3KNBB 43C9A 5IQLA 1QSFE 4Z5RB 5C86A 2H6PB 2FIKB 1A0QL 3LZOA 4G8GB 1Q9KB 5D4QA 2VQTA 4WWID 3BAYA 1RLWA 4NUGH 3KVQA 3BVDB 1T89C 3IMUA 5FK9B 1KBKA 1UGNA 2LTQC 4A63A 3UTTD 4CMHB 3A0OA 2LV4A 2QSVA 4OCSL 5I8CB 1N6QL 2TRHA 3KWVA 5EZOH 3P4OA 4PLKD 1ACZA 1MI5B 1Z9NA 3FT2B 3HG4A 1XTMA 2W65B 3IFOA 3LN9A 2VDOL 4JHBA 4LSRH 1U8NA 4LAJH 4M7ZC 4MDIB 5FW7A 1E2WA 5A2JH 3HMWL 1QSZA 4WWKC 4BFFA 1A6UL 1OSZB 2W94A 4N9OB 3I85A 3LKRA 3CFDA 1GC1C 4X4ZA 3RTQA 2MHAA 1PX4A 4LLYA 3EJSA 1KACB 5DJXB 3K72B 1M71A 1A7PH 2HTLD 3IJSB 1PKQA 4LQFL 3THMH 5CEZE 2XC8A 4JUTA 4YMPA 4RFOL 5DK0A 5GGQH 1FNGB 4AYEC 3HI6L 3T8XB 4Z7VB 1IL1B 4U4BA 1D5BB 1DJHA 4PJCF 3OKDB 3GZPA 2IDFA 4P46D 3MLRH 2BNQE 5LGJB 3UEQA 5ALCH 1RKRA 1ZT4A 3VW3H 3F7LA 3DLQR 4CMMA 4JANB 4WFEE 1MCEA 1NH6A 2EICA 1B0RB 2OI9C 3QJSB 4W9ZA 5EOQL 3RY4A 1F1GA 4YXHL 1T1ZB 3ZKXB 5C0AD 3UAJA 2UZPA 2IAMD 5M94B 3FH8A 1R34A 4MA3B 2CR3A 3NJMA 4ACTA 3ILPB 3U30B 3U36B 4CKVX 3RL2A 1NCOA 2UVFA 3MFGB 2A73B 4YL9A 4HDIA 3EDKA 1A3ZA 4GKLA 4B53A 3KDMA 4HV8A 3V5HA 5D1ZD 5FIEA 2NW2B 4N22A 4NQDD 4IIZA 1SFHA 4PJHA 4QRRE 1CBVL 1EV2E 1M4KA 2V3EA 2VZOA 1IGFL 4YDKL 1PF3A 3GK8H 2Q20A 4Z7UA 4FDWA 5HGHA 5L2JA 5FO8B 2WXIA 2K0RA 1KPVB 3NK4A 5E5MB 4BK5C 3F7YB 3ZTCC 4JPSA 5DYOB 3QDAA 4U7MA 2XKNA 2BIHA 1PNCA 4UZGA 2ZNWA 1AGCA 4WHTA 5L4JA 5HPOA 3D0VA 3PS6A 1E42A 2NNXA 4KO9A 5HHVL 3V6FA 2HZHA 5DHVB 3FQUA 1P84K 4ZMNA 1JPEA 1F4XL 4BE5A 4G59C 5B3JE 1I8LC 2PMZA 4OLVH 2NPLX 3E6HB 5EEVA 3UACA 4H88H 1R3IH 5DDHB 3I50H 5F7UA 1MCDA 3SDAB 2GHZA 4GMSH 2GTWA 1S8DB 4LCIL 3RNQB 4ONFH 1E8ZA 4AW4A 5KVGL 1XH3A 3FUDA 4MMYA 3FRPA 3P3TA 2DQEH 3U6XA 3CAFA 4OIBA 3O9WD 2VJ8A 4HJJH 3BP6B 2AJVL 4ZFFA 4G7VL 4NI6A 5IMOB 4JRXB 4LCCC 2EH8L 3FUHA 2ED8A 3AROA 4GBXB 5CJBA 3SE3A 3WIHH 1Y7VA 3ZE1B 1ERNA 2FH6A 4PGBB 2YR3A 3U46B 4HX1A 4HCRA 3BP5A 4DP7X 25C8L 1SXCA 1DN2A 3VMNA 1YPZB 3E6FA 3TIEA 4E9WA 2APVA 4LU5L 1ND0B 4PRIA 4G7QB 3L4XA 2AQRA 1IGCL 2PWEA 3QXAA 2YD7A 4XPAL 5B39G 3PHQA 5T1DL 4JQVA 5I6PA 2WQWA 5GGTH 4PJXF 3GXTA 5C6TL 3CXHJ 1G4RA 4LSQL 1EGJH 1MJUL 4MGXA 4BFBD 4FLSA 3N1GC 2B4CC 2GBAA 1K8DB 2IFGA 4WW1B 1R46A 1QWHA 3G6JF 4Z3TA 4HF5L 3D39D 3ZZQA 2FO4A 3ARBC 4HIEA 4QY8A 3RNKA 4L3EB 3RI5K 3O2VL 2VSMB 5IFHH 2R0LL 4JREC 1KZYA 1NDMA 3OKNA 4EEEA 1MREL 2OTPA 1A1OA 3PWLA 4MJIE 5A2FA 4RWYH 1WT5C 1XX9C 4JZOA 2DDQH 3SJVD 5J9PB 1V7NL 1JGDA 1TVBB 3U1SL 1QPPA 4N8UA 4BM7A 4G43A 1U93A 4AEIH 3OKLB 4HJTA 2LU3A 5A7BA 4NPKA 3HUJA 3IFLL 1TQSA 4J4PA 5CD5C 5IVXA 3LRMA 4N87A 1G4MA 1OGSA 3CDGA 3E2HC 3LXUX 1DE4B 3LZQA 4K23L 4QXGH 4QTIL 1UCBH 4GS7C 4WSKA 2F19L 4HWZA 3JWNG 1AZUA 5D9SB 3PABB 2J1KA 5B1JA 2BW4A 1OY3B 7PCYA 4XX1G 2NXYC 2A99A 1OD9A 4HZLB 2WB1A 4K71C 5J57B 1ZGLM 4AYGA 4LO9A 4O02A 5IIEB 5DQ9B 4FNLL 3HB3C 2YLHA 3ZSTA 4ZMQA 1XCQB 5MEPB 4EI0A 3F6IA 3ZVVA 4UILL 3T5WA 2YSTA 3IDYB 3PWPB 5LXGL 1SYSB 1AY1L 3E8UH 1A6WH 1A9VA 4MA8H 1QLFA 3K1KC 2PETA 4GAYB 5JW5A 3C60A 4PRHA 1FYTE 4IDLA 4OUUB 1RK0B 4BIKA 3QEQA 2YXMA 2XXFA 4WUKL 1MFDL 4MXVE 1I7UA 4F33B 2NOYA 3GHEH 3D06A 2ZD0A 3TPUB 1H19A 1XDTT 3DO4A 2PWFA 3HKZA 3PL6C 2VN3A 2XNAA 5IFAL 1GZQB 2FD6L 4HWEL 5ABDE 2RA1A 2A6IB 4KQ4H 1E8YA 1MFBL 1IT9H 1RPQA 1SLVA 2KLSA 1SJEB 3CFKB 3Q6FA 1P69B 1PTZA 1X4YA 2V7NB 2A2QT 3DI3B 4XNMA 3CVDA 3GBNL 3GLAA 1L9PA 1X7QB 3CZGA 5DMKB 2X87A 1IQWH 5MEND 3I6GA 2XIIA 4TXVB 4XNUL 5BMFL 5FYKD 2J8UB 1TPXB 5I16A 4J5VA 2VITB 3VFSA 4HUKB 2WVTA 2DQJH 5GS0H 1FLRH 4G7SB 1C7SA 1GKEA 4QHUB 1RZGB 1XXDC 2OMXB 3DX4A 2GK0A 2X05A 3H9SA 4BQ6A 3UCRA 1ZANL 3UGXA 1RH8A 3I84A 5D1XB 4MJJA 2QQKH 1GCFA 4WU7B 1RI8A 4JDEA 3DUHA 1H3UA 3I2CH 4DJMA 1NEPA 5D1ZI 1PZ3A 1CE6B 2WLHA 4HH9B 1NGPH 5L4MA 3ARWA 1VEPA 2EADA 3W9DA 5FB8B 1DP0A 2IH8A 5G4NA 2R15A 3E8VA 5EO9A 1F3DH 2YPLB 3MFFA 5LBSA 3ZE2B 4ZFGH 5T5NG 1NFAA 1P2CA 5HGGS 4IEFA 4PBVC 3U0WH 1N3NA 4HMCA 2F53B 2K8MA 4LPVA 3S3CB 3CDFA 2AAAA 2WTOA 3KBPA 5LJYH 3FQ4A 4XCEB 5KVDH 4KY1L 3IDNB 2ZCLL 2VM9A 5E23A 5AFAA 3SE9L 1WITA 3F7RA 2ODHA 1WFIA 2WQVA 4TSBH 1D5RA 1RZKH 3O6ML 5FYLD 5IHHA 1KCSL 2IADB 1B2WL 2X9XA 3AY2A 5FO2A 3KYKH 1SMOA 6FABL 2CO2A 4MX7B 4W70A 5HD8C 4ODXA 3NCJH 4K5PA 1IBFA 5DEGA 2H2PD 5HYIA 4P23B 2BP0B 2AXGA 1VHPA 2HT4D 2O6DA 1CI5A 1QNIA 4WI4A 2ZZUT 2BC4B 2W8CA 3F6JA 4U1MB 4OZIA 5I5IA 5K9KB 4M5ZL 1V55B 1MVFA 2Z31C 1TZGH 3P9MB 3V7AE 5F6HI 2CKBL 1BQHA 1HXYA 3KYMA 3NH7H 4QHKI 5LQBL 4OR1A 1TVHA 3MJ8A 1ZV5A 1OARH 1R24B 3BWUF 3HG0A 3ZKQD 4BFIA 4CSTA 4DQOL 1PX8A 5DJCA 5F9WB 4IKLA 2CO4A 4ZPVA 1IAKB 1LJMA 5KBMA 4R96A 4KO7A 4DGIL 2WMPA 4OZGB 4FG6C 1TTBA 4ODVH 4AT6A 4HHGA 4NZFA 3FL7A 5JLZB 3IBEA 2ZKWA 3BVXA 4PJEE 3CVHH 2VDOB 1KLGA 1KEMH 1ZMYA 3A22A 3ECBA 1GZHC 1OTSC 3II3A 3S5ZA 5IB3A 1IKNA 3N42F 1IIKA 3NT0A 4KZEL 2HN7B 3KS0J 3DKHA 2VWEC 3NJXA 3O4LA 1S7WA 4LE8A 5KVEE 3RGVC 3UG5A 4JHWL 2NQCA 4OGZA 3Q05A 1J05B 5IVXB 1RZ8A 4D2NA 4D7PA 4WF7A 7FABH 3BXNA 1O7DE 1NCWH 5B1KA 3IXTA 1UA6L 5G4MA 1UJTA 1RJYA 3ZDYF 2E75C 5EU4A 1KJVB 4YSRA 4HJ0C 3C09C 2EUVA 1SEBA 1YQ2A 1BQLH 3F58H 4KXAA 4POZD 1Z0NA 2C3XA 3VXMA 1M1SA 5DWPA 4Z0BH 4IBYA 4BZ2H 4I0KA 4G6KH 3O2DL 4ZW7A 4BH8A 1FGNL 4BWUA 3JUYA 1G7PA 4ZPTB 2CLZA 1FNSL 3P9LB 4J3OC 3MR9B 5EOTA 3T3PF 5GJSH 5JHDE 5SWQA 2BVUA 3CSFA 4GYBA 4G42A 1L7TL 2AZUA 3WENA 3MGAA 4K5NA 4IW4C 4JG0L 3D18B 3BKCL 4WKXA 3MRRB 3D3VD 1FFTB 2OTWA 3VUAA 3AG1B 1SLWA 3BN3B 5DD6A 1EANA 3TA3C 1G94A 2B7DT 2L7EA 4A2DA 2J56A 1NUNB 5ID1B 5D70H 3L3OA 4R4FL 1BG1A 4OJFH 5DFTA 1HIMH 2PP7A 1LNUB 2HKAA 2WBWB 2ZAHA 1MIMH 3NQKA 4HKJA 2PCPA 4MA7H 2MPVA 4KK9C 5SWSD 2CO6B 3VJ6A 3TX4A 1U8CB 3MRFA 2IAAC 3EYUH 4M4RA 1E90A 1SHSA 2HT3D 3Q06A 2CD0A 4YZFF 3QQ9D 1NIDA 4IKKA 9PCYA 2WAHA 2O6PA 5EU7E 3FT0A 5AB0A 4N4YB 2Q3ZA 4XMLH 5BVPL 4ODHH 3DV6B 3RDTB 1MJ8H 3ZDXF 2XI9A 1MRDH 1ZE3C 4U1SA 2WLKA 1OHZA 2MMXA 2GW5A 4HUXA 1J1XL 1U41A 3CMOL 3DIFA 5K59E 1N6VA 3BQVA 3PRZA 2LGNA 5ESQA 3LIZH 4A7UA 1OE1A 3DMMA 4JRWA 5BCAA 1IM3A 2VO8A 5I19H 5EUOE 2RR3A 4S1RL 4G8GD 4P4RA 1E67A 2AEQH 3MROA 2WQ8A 2Y3NA 1IAMA 4TNWK 1I1AA 2NY5L 4N86A 5D72L 4CL7A 1BM3L 2JCWA 3F84A 1AZBA 3CX5K 4CN6A 3MA9H 4ELMB 5J5EA 3WFDH 4PJBA 4WKZB 4ZTPL 1HCYA 1K6QL 3IGFA 4D3CL 3MRLA 3OMNB 1JTOA 4KX9A 4IRJC 1MI5D 2Z6FA 1AE6H 3TM6A 4D0CA 1FHNA 1PSKL 2VE6A 3C5ZD 3G5VA 3JVGA 3L1OH 2ENSA 4MKTA 3A23A 4LLWB 4PBWD 3QIUA 4HS3A 1RSYA 1MPAL 5CIPA 1ZJBA 4Y19A 1UM5L 1DR9A 4GW5B 4L05A 5AZUA 3QZMA 4HFUL 4KOCA 1U8HA 3F12A 5C3IA 3UBHA 1XCXA 1RP9A 4WY7H 3BLPX 3O3DA 4L4TE 2I5YL 2R2EB 1HOCA 1RFDH 1NC2B 5AAWC 4R6UA 3KPPA 2Z35A 2WBJC 2GY7B 4JFFA 5FS5A 5FFOA 4W9LC 5SWZB 1ACYH 4IOIA 3CD4A 4ADJA 4HJSA 4TLKA 3GSQA 4ELKB 1OTTC 2IC2A 43CAB 5FYJH 1DN0B 2C3VB 2VDRL 4OZHB 1OCZB 1RZFL 1QEWB 2XYBA 1T5WB 1G7LA 5D2LE 5GRYA 2IDUA 4UAOC 4PW9A 3L2LA 4LOFA 1U3HB 3VRJA 3ZYOA 2H47C 1JHLH 5C0JB 3ZDZE 4G9FB 4M8QA 5DJ2A 4YPGA 4HOMA 5EEZA 4XP1L 3L5XL 4WJ5B 3FFCE 2E4TA 2B5IC 1AD0A 4L5FL 2C1PA 4MNQB 2I24N 1X6LA 5BUAA 1Z0MA 4PTUB 2H32H 4LRIA 4XCYB 2W9EH 3RAJH 3GPEA 4ZMXA 3B9KC 3A6CL 4TMPA 3NCWA 2EAEA 4AGMA 5BRZE 4L29A 4PJ5A 2EEAA 5GSRB 3V4UL 3IN0A 3N85H 1KG0A 1TU2B 1I53A 1QTYT 2CDFA 2DM3A 2EIDA 2G5BB 2OFQA 4J6RH 5FA4B 3MI6A 1A7RL 1YAIA 4MJ5B 3EGSA 2M1KA 3G7TA 5CINL 1SDDA 4F9LA 1M42A 2Z8VC 1KGIA 2I07A 1JZFA 1S9WB 4DHLA 3GZQA 5DD5L 3D85A 4LKXB 2K70A 1FL5B 1J5CA 1SEQH 4GRLB 3CHRA 4DUWA 1BJMA 5T1KB 3WHE1 2XRAH 3MO1A 1YMMA 5AVRB 5DEJA 1BZQK 2QSQA 3SDAD 1S6NA 1I9IL 3VI3A 3HNSH 1E9PA 4K73A 1GJWA 4J8QA 3GMPB 5F7FA 1JK9A 4WHDA 4KKLD 5F1OB 1A6AA 4GFTB 4W9EC 4JVUA 2VO5A 4F5CA 1F97A 4JRXD 3OKEB 4JVWA 4G83A 1E6JL 4YHKH 4YHML 1ZK5A 4M6OL 4YZWA 2UWEB 1MCQA 2D7PA 1YEEL 1GGCL 3S6CA 5BJTA 2DV6A 3HLAB 4KTDH 4UQEA 3EYQC 3TEUA 4LEEA 4YIQB 4D7BA 4WDIA 3AVEA 3H56A 4IBLT 1EUUA 5DS1A 4ES9A 2NUTA 1FIGL 4KPHH 4N8CH 1CU4H 4GP8B 3RB5A 4R26H 3PJSA 5D7JC 4BCXA 4D0DB 4IIQA 3GWJA 4U6XB 4LESA 4PREB 2XVBA 2R69A 2VZ3A 3SIKA 4BSVB 3DROA 3A47A 4A2LA 5AG8A 5LN8A 1L9TA 4GXVL 2LAAA 4K3EH 2JSFA 4YOKA 5FFGA 4L3ED 5HHOE 2NQ3A 3GJEB 4HMEA 4U0RB 3BD5A 4U49A 3KBFA 1RIHH 4K15A 4LKCA 4L3CB 1JXGA 4N5ED 5E9DE 1SDAB 4JRYA 3KWUA 1THCA 3MYZA 4DERA 1PYWB 1ETJA 1MCOH 5JXAL 1CT8B 5EORL 1ZV9A 4ZUUB 2YMXL 4FQXA 4LVOC 2YUZA 1OCOB 4BRJA 1I1CA 1GGYA 4S0HA 4HXAH 3BWUC 4HS8H 5DRXB 4MCZB 1EERB 1GYUA 4NWUH 4G6AD 5IEKA 5DJAB 3WN5C 3MNZA 3IK2A 5E94B 5GGRA 4OM0L 3IFNH 3RUGB 2R8SH 5D6DC 1GY2A 4OUOA 5JTWA 3U7AA 1AYRA 1KC5H 4FN0A 1ZIAA 4UNUA 3V5KB 1U8QA 4NQVA 1L9MA 1ZVHA 5AB2A 5ADOH 1A6VL 1QR4A 3DX2A 3PP3H 1OF2A 4WFGE 1QOKA 2ITCA 4KV5F 4EI5C 3OMZA 3VWJC 1HKLH 2YQGA 5I76B 4M03A 1NIBA 2E6PA 3GIVA 1BG9A 4HCRL 2CKBB 1JIBA 2Q7NA 4NKIH 3PWPD 1ZEAL 5B8CA 2JJVA 1XH2A 2O6EA 3KEHA 2RHEA 3TNNB 1A66A 1AQDA 2J55A 2Q8BH 4DPBX 4KMQA 2UV3A 1I9JH 3IJ9A 5I0XA 5I1GH 5DRNB 1I7ZB 4Z78A 2WXKA 2X0VA 3ATEA 5F9OL 1ZTXH 4Z7OF 3ZL4L 3JV4B 4ZUSA 2Q6WA 1RK7A 7PAZA 3PDDA 1DANU 1T22B 1IFRA 2K7PA 3FU7A 5K1NA 3ULVH 4LSTH 3U9WA 2FEEL 1NCCL 5T3ZH 2EO1A 2A6DA 3LKOA 3MLTA 2J88H 3ZZLA 3MNVA 3ARFB 1CICC 3HE7A 3LQAH 1H6EA 5AW5B 2VR7A 1VKXA 1UD8A 2CJTA 2A0LC 4FG2A 3W3BA 3WEBA 3VXTA 4M3JA 4R90L 4MNGE 4IOSD 3MRHB 4OLYH 3VX1A 2XJLA 4N0CC 4KKCD 3TIDA 1B4JL 2DICA 1J5OL 4J27A 1DVFA 2I60H 4ONHA 4YWGL 3T0EC 1JPST 4FTVB 1FZOB 2J5LC 3Q8FA 2DI7A 5EBLB 5FGCB 4JR9L 4U1JA 2B2XL 3IAPA 3O3BA 1G6RA 1IAII 2F54E 2FK9A 3IJ8A 3FFDB 1YDPA 3OAYH 4K9EL 4Z7WA 4OIIL 1KN4H 4ERSL 5FX3A 4AIOA 3HKFA 1MW1A 5GS0C 1GJIA 3RWJB 2I9LA 1ZLUK 4B9YA 4ICWA 1CXHA 4JFEA 1NMAH 4GXUN 4ODUB 4XBPA 5DJDB 1GW6A 1G0YR 2EACA 3S3DB 2QZ5A 1GYCA 3HC4L 4O02L 3FF7A 2XN1A 1B90A 4XWOD 2QMJA 3HC3H 3TV8A 4Z18A 5CJOL 3CFQA 3A5VA 5BXFB 1BQHG 4O2CA 4HUVA 2DBLH 2E59A 1P5UA 3EBIA 2YPLD 1E4JA 1USZA 1YEGH 5FM5O 4A7VA 5CZVL 2ICWA 1AJ7H 3PV6A 2P8LB 2F53D 2CJ3A 1DBAH 5GGRY 4N2FA 3KH3A 1PAZA 1ZK9A 4RIRA 1X9UA 1X5HA 3B7SA 3ILEA 4I2XA 3KWTA 2J71A 2QADC 1XAUA 4XPGL 4QYAA 3E3QC 2EE2A 3IDJA 4KITB 5DUPH 3COOA 2XDHA 5HHNA 3WNJA 1GAFL 4LK4A 3CDYA 4PBXA 2VERN 2XXCB 2K8QA 2A5UA 3S36X 2YBRA 4FJ6A 4XMKL 1RZKC 4F7MB 1CBJA 3WDJA 4P23D 1P84J 4O58H 1O0VA 1C5DB 1HINH 4HGMA 5E56A 5EA0H 2IH3B 4ABWA 1DFXA 1RHHB 1L7IL 3FTXA 2JKJA 3NCMA 2DWSA 3L5JA 4AL8H 3ARYA 3FQYA 3IXAA 4ZX5A 5HYJA 1UKTA 3EYVA 5FHBL 4ZXBC 1AD9A 3F2LA 3II1A 3FU0A 1T0OA 5D2NB 4EUPG 4TNVK 2DLEA 4DT2A 3QI9B 3MCLL 3JTTA 4XVTL 1O6SB 4P3WA 4X7EC 4UT6H 4XMXA 1DL7H 3BDXA 4JAMB 2KZ1B 4JL2A 3UZEC 1TQUA 3O6FA 1U36A 3FKUS 1CD9B 4Y5XA 4HUNB 4YXKL 1JV2B 3S5LB 4LCWE 3UERA 1YJDL 4CVXB 2ZONA 5IUCA 2WXPA 2CK2A 1K8IB 5CSBA 3F5WA 3KYNB 2Q86B 5F1IA 3K2UH 3QZBA 4OBRA 4M1CD 3SGKC 1KT2A 3FYEB 1MOEA 1MFVA 1UWEH 3VFWA 2FBOJ 4KH9A 5I18H 1N64H 3MKKA 3T0DA 4Y4HC 1A7OL 4KKRA 1OAUL 1T7YA 3TO4C 4WEEA 3ETSA 4PJCE 3SCMC 1F5WA 5DFWH 1EXUA 5TGBB 4NNYA 5E8PB 1H9DA 3UJTH 2OMTA 1TUPA 1JPSH 3I6LE 4EKJA 4GLRI 4AYSA 4I0PA 1DHKA 4IBUA 4DKDC 4GI8A 1Z5YD 1G7JB 4NZUL 1KB5H 2R2HB 2Y24A 1P7KB 4PRAB 4U1KB 2XBTA 3DOHA 5JA8B 3IFPB 4PB9H 2WNXA 4PV9A 1QSFA 1FZMB 4FQJL 2NSQA 4NIKB 2VDRB 3BEWB 3BSZA 2AXHA 2VWEE 4HT1L 1OAQH 3L3GA 3DYOA 1OAYL 5DHMC 4F8TA 2D7NA 5J89A 1T83C 3EO1A 3JUZA 4NZDA 3RURA 2JQAA 1AR1B 5DJYB 3LXBA 5F3FA 5INDA 3GHBL 4FLOA 4ETQA 5JO5B 2HRLA 1FPTL 43C9B 4C56E 2BRRH 1S7RA 1Q0XL 4WK4B 3VGAC 4Y1AE 1JZ3A 3S88H 3LH8A 2H9GA 1BQSA 2G60H 2AEPL 4FYTA 4C4BA 2ZWNA 2YKLL 4GKNA 1E40A 4FMFA 4WUUA 2GIYA 1NFIA 4P5TD 1JNLH 3PPEA 3CFEB 3SPJA 2D2OA 3L3JB 2Q8AH 2QV4A 3P4OB 3RDTD 4ANWA 3VD4A 4XGZA 2EIEA 2HX7A 3IFOB 2DQTH 1RMFL 2OJEA 1U8NB 1KV7A 5DD0L 2K7QA 4XPBL 2C9QA 4R97C 3GUTA 1FGVH 3CFDB 4XHJD 3TLRA 2X2JA 5KOMC 2MHAB 4ZYKB 2F8VA 1KSRA 2EIZA 4LLYB 3IU4L 2XIBA 4AG4L 2PYFA 4IRZA 4B7IA 1PLAA 1M71B 2FJFA 3W11D 4UV4H 1MDAA 2NY4B 4OTXH 1WZAA 4TNFA 5HI3D 5DK0B 3DNKA 1R33A 4WEBL 1UOVA 3P73A 1E5UI 3B9AA 1AFVH 5I0VA 3OX8A 4AQ8C 4X8GA 4NQCA 4YLBA 2GT9B 2CQVA 4MZ3A 3AADB 5F44A 5IHZB 3D08A 1N0XL 1OL0A 4AW7A 3X17A 4E9XA 1VGEL 2VXSH 5H94A 2PR4L 3BKYL 4G9DA 32C2A 5F1NA 2B59A 2XN9A 1BOYA 4FNSA 1DQKA 2ID5A 3Q1SL 1NCUA 2PTTA 4PJFA 1A7BA 5C1MB 3EFFB 4ZDHB 1NBZA 2ZP0T 1JK8B 2DMGA 5FC9A 4HXBL 3BO8A 4PYHA 3FUEA 3WTUA 4K5LA 2QVMA 1EUTA 4LAQH 1HSAB 3BE1L 2C34A 3RL2B 4PJXE 3RVVD 4JPKH 1XIWA 3QAZC 1YNTF 4HDIB 3VAEA 5HGBB 4OCWH 2CGRL 3IMSA 3KCPA 4W6WB 3KDMB 1CIUA 5GIRB 3G6JE 5FM5M 3QIWC 3V5HB 5I1IL 5I1DA 5JPNA 4PJHB 2VQ1A 3P2DA 2P5PA 1Q9LA 4R5TA 5CJXC 3KL5A 2ZAIA 4AGLA 4Z7UB 5HGHB 5L2JB 1KIPA 3FPYA 5CEXA 3QUYA 1OAKH 2I27N 5F89B 4AVKA 5EWIL 4X7SH 3B2XA 4MD4A 5SV3A 5SWZD 4YAQA 4N9GA 4IMLA 2XKNB 2W0KA 4AMWA 2OMVA 4MDJA 1AGCB 4X4ME 2J44A 2QQNH 1S7TA 2HH0H 3DSFL 4WHTB 3D0VB 5ALBL 5D7LA 3T6ZA 1M1XB 3UO1H 4ORGA 3HE6C 4FEIA 4E5XA 3V6FB 1NBQA 3TBWA 4TUKL 3OL2A 3FQUB 3RFRA 3U1PA 2WCPA 2OYMA 5EF0A 1EK3A 1UKQA 1U3HD 3QPQD 4ZFOA 4UIMA 4JDZA 3D30A 4XNZC 1XL6A 3SDXF 3D9AL 2Y5TA 1MFEL 1KB9J 1NMBH 3ZLQC 1UYWL 2GTWB 5D7EA 2DAVA 2ZOTA 1DDHA 2IBBA 3ARDA 4KZDL 3VG0H 2HWZH 3FRPB 2V9QA 2V5RA 1BZ8A 3SGDH 5L0QC 4KRNA 4ZFFB 2UX6A 1X4XA 5IMMB 3FZUD 2X6CA 3TH2T 2WIMA 4JE4B 3DVFA 3AXLB 3MLYH 4DZ8A 4BQCA 3QEUA 4HX1B 3BP5B 2VZ1A 1TJHH 4G3YL 5LAXB 3NYKA 4M7JL 3WYRA 4E9VA 5E6YA 5CJ8A 1KCVH 2DN7A 5E6IA 4IGBC 5B1BB 1R75A 4RAVA 4YE4L 2DM2A 1FA4A 3QXAB 3CC1A 3RFZA 4GRLD 3PHQB 4IU2B 3BSHA 2CO1A 5T1KD 2HFEA 2N7SA 3X3FH 3MUGB 1NGYB 5IHBA 1YAZA 1CCZA 2Y9RT 4LLVA 3IF1A 3N44B 5TTRA 4CC1A 1BJ1J 3ROOA 2AABL 3CPLA 4OI9A 1KGXA 2V8MA 2FO4B 1X9LA 1A4JA 3GC3A 5CF3A 5EPMA 3C08L 4QY8B 3RNKB 4QWWC 3TJPA 4WI6A 2FX8H 1NDMB 3CXDH 5I28A 3OKNB 3PAUA 1ASOA 3MOQA 4HU8A 2QKIB 4M7KL 5LBGA 5BUGA 3OM3B 2G75A 1FZJA 5D5MB 4JZOB 3VRIA 3D48R 2YSSA 4EVNB 1NL0H 2EC9U 4PFEA 5CZRA 2DWDA 2VMEA 1QBBA 2O26U 1HAWA 5DMJB 1HVXA 5AB1A 2H8PA 3FU9A 3HUJB 3Q2CA 4L4VE 3EJZD 2AHIA 2DM7A 1IX2A 4JVPA 2EYSA 2XYCA 3RA7H 3UPCA 3CDGB 3WY2A 2HFTA 3K5RA 2D2CC 4U6YB 1E8XA 1A7QL 1I3VA 3FT3A 3SDYH 3SPGA 1G6VK 1ADQH 1X5AA 1MIEL 2VL4A 5JPMA 2D0FA 3PQYE 4GMTL 2EIBA 3O41A 3RWIA 2QHLA 5GGVH 4YNYA 5G2NA 3PNWA 5HDWA 1WCBA 4O02B 2WSKA 2RCSH 3LVTA 1FYTA 4UBDC 1MCLA 5B7EA 4PGJA 2GEEA 3ZL1A 3ILQC 4XB8A 1ITCA 3HC0A 3EHBC 2AFNA 1J18A 1KTRL 1SF5A 4B50A 1QLFB 3LKSA 3C60B 5D7IB 3HAEH 4M5SA 3WFCL 2OKMA 2PKDA 1I7UB 1C8PA 5C0GB 4ILDA 2XNAB 2HKFH 4Y16C 5C0EA 5K5YA 4OT1H 2IH1A 4JEGB 2ZUQB 1G9MC 4KJQC 5EIVA 2R29H 2FX7H 3QO0A 4XRCA 5AL8A 3Q7JA 5DMGC 2YD0A 4IBVA 3SOBH 1WA0X 3GXNA 1LHZA 5DHYA 5DZJA 1CK0H 4YHYB 1QHQA 1LD9A 1FRGH 4LNVA 5IZ7A 5G4OA 4YDZA 3WXVL 3I6GB 1D2OA 2JLPA 15C8H 1DVUA 3H3BC 1E4KA 3MRIB 5BQDA 2ZKYA 3VD0A 1PAMA 4XMPH 3QDGE 1RURL 3ZMEA 3NCYS 1SOSA 3SE4A 4PVNA 1CLZH 3KLHC 3FT4A 4MZ2A 4OFIA 2R69L 1YA5A 3CWGA 2DBJA 2GK0B 3IAQA 3QDJB 4O9HH 3QH3A 3RHWF 3SO3C 1SBBA 5BNXD 4H20L 4M4PA 1NKOA 3NZHL 4OZFA 4UOW1 1UG9A 2VDLH 1XSJA 2V9UA 2E9BA 4G7RB 3EOAA 3ARFD 1LM8V 1R3KB 3C5JB 3W9DB 2W9DL 4QT5A 3DIDA 5EO9B 3ZDYE 3EJYD 4MTMA 1P2CB 3TTSA 1P7QA 4OZ4B 1F4WL 1U8PA 1DSWA 1N3NB 3ABLB 3CHPA 3NA9H 1FP5A 3DOIA 2C9UA 4KJWD 1VJSA 4FTVD 2VH5H 4KRPC 3BVNA 1P6AB 3Q2VA 1OLLA 2JB6A 3VM5A 2WY3B 3KJ6L 3QUZA 3T3PE 5EZLA 3DHMA 1OSYA 1NFDA 4QI3A 3GI8L 2EINB 4ZAKC 1DZ0A 2GBUA 1H3PL 2NRDA 4KTEH 4PJ9C 1Q94A 4XT1C 4PRPA 3KHOA 3KL3A 4DN4L 4XMTA 5JHMA 2V2WA 3F8UB 4ODXB 1OK0A 1BOGB 2DIJA 1AQHA 1N5YH 2A83A 4MMZC 5BO0D 1AGFA 3O0LA 1T6VN 4PJ8A 2VC2L 3OHXC 5F7EH 1ZLVK 4DP9X 4OZIB 2ZSWA 1HZKA 3GD1C 3T4YB 4DEPB 3MLVH 4U7SA 3L3DA 2ZWKA 4HHAB 3RL1B 3SKNA 1R3HA 1H0DA 1BQHB 1HXYB 3G5XB 3KYMB 3I9GL 4LPCA 1TVHB 3MJ8B 3U6XS 2OULB 3FHQA 4YZFE 4BFIB 4ZPVB 1KGUA 5EEXA 3MZGB 2CLVB 4R96B 1JNNH 3BKML 5ILTL 1IZKA 3ZDXE 1RULL 2GUYA 2WMPB 5A40E 2EXWD 4AT6B 3WJMA 2KL6A 1CS6A 2ADYA 4L1DA 1JVOA 1HE7A 3RILA 1YEIL 1P4UA 1SNRA 3NJGA 4L8CB 1MNNA 4QRPB 3U9UA 3EO9H 4F57H 3BDYL 3ECBB 2CIIA 5IB3B 4W9JC 2XWBA 5GS1B 3O4LB 1S7WB 4IOFC 3V4PH 4OFPA 1VERA 1RZ8B 2MKWA 2ALWA 2G2PA 4Y7MA 4WSGA 1DVZA 3BXNB 2J72A 3BCDA 3IXTB 3ZMNA 4M93B 8FABA 5T5NF 1RJYB 2CM6A 3V10A 4HALA 2ITDA 3FAXA 2YGQA 5EU4B 1DJWA 2Y36H 5D7KE 3E3QE 3LD8B 4MHHG 1I7RB 1SEBB 1FFNA 3TZVC 4JCLA 3VXMB 1K4CA 3QI9D 1G6RL 1ZT7B 5JOPD 5JOEA 4DGVL 4UQBA 4BH8B 1QRNE 2O6FA 1CC3A 3SQOH 2CLZB 4LFHD 5EOTB 4JY4A 3SQBA 5SWQB 1QTSA 1YNLL 3MUUA 3WE1A 3LRSA 3SE8H 5IHWA 3D69B 2ADFL 3WOVA 1G0DA 3N2JA 4ISVA 3D05A 4P05A 5BW7C 3V5DA 5C2BH 4UDUA 3ZKMC 2OTWB 3LS5H 4NRZA 2ZF9A 5DD6B 5AW3B 5JORB 1THAA 4YFEA 1V3KA 3GJFK 3L3OB 3P4NA 4P9HC 4TVPL 3QUXC 2AKRB 2KMWA 4ZUTA 4AEHH 1TIUA 2BFGA 2HFFA 3L8QA 4AXWB 3D52A 5C0DA 4OGXL 3RVUC 2ZG2A 2A1WH 5DD1H 3EJCA 5DUJA 1LO0H 3FO1A 4FULA 4JE0A 1IC1A 1KCUH 1X5MA 4PP1C 4QLRA 3VJ6B 4M4RB 2QQQA 3RB7A 2EEDA 2QR0A 1CR9H 2ED9A 3BPNB 2PP9A 5IJVA 3UYRH 1BFVH 4I9WE 1IGJA 4ZNEE 3H42H 4IBWA 3IDMA 1SZNA 2F5BH 5J12C 1EO8H 3BWAB 5EUOA 1BD2B 3P0GB 4HD9A 3KLKA 4N1EA 4G6ML 1T5KA 1X6NA 3LAFA 1J1PH 1XCWA 5E99H 5DT1H 3H2PA 3VXOB 2WLIB 4HUXB 3G5ZB 3NIFF 3CHOA 4FNQA 3DIFB 1AR1D 2OTUA 2XVKA 6CGTA 5I5RA 1JWUA 2G2RB 4GT0A 4OJDH 5ESQB 3FCGA 4XMVA 2CNZA 3GXPA 1FUNA 3DMMB 3AU1A 1IM3B 3O2WH 2AJXL 2ICEC 3HZMA 4P4RB 1N8ZB 3MROB 5KVMC 1AMXA 3HRZC 4ZMWA 2ZTBA 1FVEA 4HK3N 4XOCA 1R6VA 2QDVA 5BZWB 3IDIA 5HHQB 5A1AA 4LEBA 2OJ1A