2JSFA

Solution structures of the envelope protein domain iii from the dengue-2 virus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
MDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and neutralizing antibody binding studies of domain III of the dengue-2 virus envelope protein.
pubmed doi rcsb
source organism Dengue virus
molecule tags Viral protein
molecule keywords domain III of ENVELOPE PROTEIN E
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jsfA00
3P54A 5KVGE 2JSFA 4UTCA 3J2PA 3UZVA 4BZ2A 5LCVA 5AAWC 2JV6A 4AL8C 3C5XA 1SVBA 2R69A 3N40F 4X42A 3UYPB 4FFZA 1OKEA 2JQMA 3N44F 4UT9A 4BZ1A 5KVEE 5GZOA 2H0PA 3UZQB 1ZTXE 4ALAC 5KVDE 4GSXA 4FG0A 1OANA 3C6EA 3N43F 4UT6A 3MUUA 5GZNA 5B1CA 5LBVA 1TG8A 1S6NA 2V33A 3G7TA 5AAMC 3UZEC 1Z3RA 4L5FE 5KVFE 5LBSA 3VTTA 5JHMA 3J27A 3N41F 3UAJA 4UTBA 2GG1A 4AM0Q 2P5PA 4GT0A 5IZ7A 5JHLA 1RERA 1OK8A 2I69A 3IRCA 4FFYA 4UTAA 3WE1A 1UZGA 3N42F 2ALAA 2R29A 2HG0A 1URZA 1PJWA 5H37A 5IREA 1Z66A
chains in the Genus database with same CATH superfamily
4WDIA 1IM9A 3H9ZA 5E5UB 3KWVA 3N6YA 1CFSA 1Q8MA 1RZKC 3AG4B 3VM5A 1MJUH 5F7LB 4Z7WB 3HUJB 1MH5A 2N56A 2IG2H 5I75C 4OGQC 2P80A 2OZNA 3CFDA 4PW4A 3DJRA 3HKFA 2DIEA 5E95B 4HCIA 4OUUB 1R34A 3U4BH 1A8ZA 2AXWA 1RURL 2WUCL 3HBZA 2JH2A 3BHBB 3QXWA 3QDJE 1ZSHA 1TPXC 2VXVH 5D1ZB 3GK8H 1TCRA 3U9UA 2VLKD 4WI4A 5DZNA 3CE1A 4OGZA 2JKRM 2HN7A 2NUTA 4XAWL 3RVWC 3GGWB 4ZMZA 1IM3B 4WHYH 3ROOB 1X5KA 4LSVH 4OZFH 3UTOA 5KS9A 2JWYA 3V9EA 1PIGA 4PJCE 3ZTNL 5CLZA 1P7HL 5EG6C 3VSUA 4Y5YB 1GOHA 4GKOA 3UG5A 4NKDB 1EO8H 1F4HA 1YUHB 2B3RA 3VUAA 4QCIA 3I6GB 3TYFA 1ILSA 4OCWL 2F7PA 4RFOH 1KTDA 4X7SH 2N0MA 3SE8H 4CN4A 2IDQA 3H9SB 1U4FA 3JVGA 3P3TA 4MA1C 4PRIA 5HGGS 3LVTA 4NZUH 4PJBA 3N85H 4KDWA 4OKVB 4E68A 1JF1A 1OPOA 4N2NA 3QCVH 3VFTB 1AH1A 1U8OA 3UJIL 1BEYL 1QWHA 2X4SB 3KWWA 5I2IA 3VXSB 1RFDL 1T21B 5JXAH 3VI3F 3D0VA 5D71H 3NZ8A 1CGVA 1YC8A 4YBLB 1NCDL 4ZMLA 1DVXA 3QHFL 4Q58C 3KPPA 5ENWB 4JFOA 4UT9H 3FQXA 4JKPL 2IWEA 4QOKB 1UH2A 4GMTH 4Z7OB 1H15B 5EU5A 4Y2DB 4FYTA 5MEOA 2V2WA 1KGCD 4V33A 1A1NA 1XSOA 1AOHA 1CZ8L 3G5YB 5TF1L 2A0LC 2QGBA 3RHWF 1OWRM 3NRQA 5A7EA 2Q3AA 2WWNA 2H5UA 4PGDB 3SE3A 1I8IB 1TO5A 4ZMOA 2CKBA 1VADB 3HE7A 3AACA 3QPQC 3FBQA 3QWRD 4NKMA 4U1SB 5EU3B 4F3FA 1ADQL 2JIXB 4NWTL 4UZUA 4FG2A 1YA5A 5F7FA 2Y1ZA 2VW4A 3D4YA 1MFVA 3RVTC 4K9JA 5I1DA 1ZVYA 1VFUA 2V9RA 4BA8A 2OAAA 3GSXB 4KUCD 5AENA 3NJMA 2YD4A 1A4JB 5HHMD 3LAFA 3WKML 3WKMH 5G5DA 5D5MB 3LVEA 4R7NA 5GSVA 4ZX3A 1KACB 2BMKB 2ZSWA 2WK2A 4M7ZC 5E5MB 1OGAA 3AMLA 2BVPA 1DL7H 5IIEA 2D3JA 1NCWH 1XH3A 3PG2A 1MG2C 4NWTH 2LU7A 3L3GB 4D7PA 1F6AB 1FQ9C 1NGXA 2YKLH 5IROA 1BXUA 4GIPD 4WAFA 3R1GH 2A6JB 5A43C 4HW6A 4Z7NB 4HFWB 3PDOA 4OJFH 5DZPA 5JO5A 1IEAA 1ILUA 4GSRA 4YPJA 2P80D 4FQ2H 5ITBH 1HH6B 4PS7A 2D4DA 1MAKA 5D6DC 2HH0L 1BD2A 3U0TB 2X4UA 1WIPA 4K9EH 2QPDB 3CUPB 3IGKA 5JTWA 3S37L 3LQAH 2NMSA 3GNML 4FI6A 4FYSA 1VKXA 5E4EC 1DLHA 3HE7D 1UM5L 5L9DH 4PS4H 3GXFA 1KBGL 1I7ZA 1B88A 1MREL 4Y16B 2Y07L 5EZOH 3FFCD 2BNQE 3B2MA 4NZTH 4Z18A 1E40A 1ADQH 1HXMB 4HGKC 3WSQH 1YG9A 5AEAA 3VYPA 3QZLA 4DP8X 1AOZA 4QRPD 2PP8A 3HEIB 1IGJB 5CZXC 6PAZA 3TA3B 1QFUH 1LDSA 4JVWA 1F6FB 3BLKA 5K9JH 1IGMH 2F5BH 3EO9L 4N2CA 4YSUA 1G7MA 3A5VA 4EZMA 2ITFA 2VDQH 3QDAA 5CCKL 2VLKE 3V4PA 3UO1L 3RIFK 2VDNB 1CDBA 2ERJB 1DO5A 3LXAA 3BAKA 4IBSA 1IILE 2IAND 2DW5A 3TONA 4OCSH 3BFQG 4HS6B 1Z0MA 4QRAA 5FIEA 1QLEH 3OQRA 3FRPG 1I8AA 3QWQB 3D51A 4NPYB 2Y06H 3ULSA 9CGTA 4KNTA 1S7VB 1KOAA 4NQXB 2WLJA 4M62L 3SBRA 1VGKA 1BBJB 4WNQB 2ZX6A 5C7XH 3KPSB 3OKMA 4RGNB 2ZKHL 1U21A 2DYPA 2BVUA 2P52A 4XN4A 2HRPL 4JFSA 4UDTA 1RLWA 3TWCH 4GG6F 4NP4H 1F2XK 1BQLL 3KR3L 4LSPH 1JRHI 1UM4H 3BOVA 3QS2A 4HKJA 1M2VB 4XNMA 3X3GL 1F4YH 2WIIA 2P44B 3ZL4H 1PX3A 4FXLA 3OLGA 4B97A 2RAMA 3QA3B 1SN0A 1EFXA 2N0KA 4DVBA 4PJAE 4Z78B 1NKGA 3JV0A 1D6EB 1TQTA 1ZEAH 2DICA 4DAGL 3JV4A 1FGNH 2YPLB 1ITBB 4PJBE 3DK0A 3QI9B 3Q0HA 5AOKA 4FQCL 2WCPA 2WQVA 3QW9A 1YPZE 3MRRA 3KS0J 1EAJA 4X0KB 4JMXA 2GTQA 5E1QA 2XJKA 4JFHD 5CR8A 3IFLL 5CWSA 1UCBH 3MRPA 1J8RA 3V0HA 1OCRB 2UX6A 2WXQA 3HCVB 4F8NA 4OD1H 4OQTH 4MZ2A 1UXWB 1U30A 1GGIH 4PTUA 3RX7A 4XO3A 4GG8B 4PCYA 3NIDB 5TDPA 2C3VA 1XMEB 1L9MA 4HCRA 2D0GA 1SHMA 1U8IB 4QRSB 2R0LH 1NFDA 2GYSA 4EPSA 4RA0C 1AZNA 1Y1UA 2EVJA 4N0UB 1T0OA 4F7MB 5AB9A 1QLFA 4JO4L 5D1QD 1MCWM 4KJYA 3HZVB 2VSMB 4GG6A 3NABH 2PPAA 2DQFA 2WLZA 3EG9A 4I89A 1QW8A 4YXHH 4QWWC 1QSEE 1FZJA 2AJZA 2CM6A 3F58H 4KI5C 3KHQA 4PJ9A 5IB5A 2FGZA 4OB5L 1JK8B 2R2EB 4Z7NF 2EYRA 1AR1B 2Q7AA 1OTSD 5I8CB 1OTTC 4AYGA 4MDJA 4FFZL 1QRNB 1AHWA 1CLYL 2OULB 4IU3A 3V6BR 2IDCA 3I3EA 1A3RH 4WHDA 4LGSB 3KPQA 3AREA 1JUFA 4LPUA 4NHUA 2YLHA 4S10A 3TEZA 1GZPA 4U1MB 3MGOA 1YNLH 3DYOA 4QKXB 2F9BT 1WWCA 5MENB 4U3XA 5FHAL 1JF5A 2ITDA 2V2XA 3KYKL 1X5ZA 4QRTB 3ZBMA 1BX2A 1EHNA 2XNAA 2OSXA 4JE4B 4AQEB 4PJFA 5E2TL 1TQCB 3NJXA 4B7LA 2C3GA 1UGNA 2VWEE 4W9KC 1SLXA 1YJDC 2JB6A 5J13C 3FB7B 4S1SL 3BX7C 5DT1L 1KELH 4FXGA 4Y9EA 1A22B 1FG2A 2P9RA 2XJLA 3IK2A 2BIIA 3M8OL 3RTLA 4NRXB 5BVPH 1W6WA 4X8GA 3BCDA 4DN4H 2SEBB 5EZLA 2WAHA 2ZYRA 3H1ZA 2EO7A 1JPTL 4N1EA 3NQKA 2LOEA 3WXWH 4KQ4H 4HFUH 1W9XA 2L7EA 1M7IB 5DC9B 1BAFH 3NT0A 3MLZH 1CL7L 1SXNA 4N3TA 4NN5B 5ESVA 4TSAH 3ARFB 1Q1JH 5I8KH 1W6LA 4GIAA 4RIRB 2W91A 5CUSH 5D93C 1QI5A 1U58B 2PR9A 3CFKB 1BPLB 3IXTB 1YEGH 3WDHA 3BAXA 4RRPA 3KPRA 5F21B 4WWID 1BX2B 3B9DA 2BY2A 4MNGB 4N5ED 4HZ1A 4X7DC 2I7OA 1FNAA 2DYPD 1E50A 3DHJA 3GBLA 3MR9A 4PJGB 3JWDC 3RPIB 3RWEB 4K5NA 4ZQTA 1T7ZA 4PGEA 4WGWB 3DSFH 3G6DL 4P2OB 4HVBA 2ZYHA 4R96B 4I3RH 2YHGA 4OZFG 1C5DB 2IBZY 1LQSR 1SUJA 3BXNB 1V8HA 4Z23A 2J6WA 3E1ZA 35C8L 1VIWA 4XC3H 1QEWA 1IAIL 1E4XL 1GS8A 4WHCA 2GIXA 1C8QA 4OH2A 5GS2H 4PIBA 5C07D 1ZT1A 3QUXB 1E8ZA 5EZLB 5ETUB 1CB4A 4C4KO 5DMIL 4U1SA 2FSDA 1AZRA 2ARWA 3LNFA 3FUMA 1QNZL 5AWNH 2BS9A 3LH9A 2HTLC 2YC1A 3QO1A 1KC5L 4EN3D 3QG6B 4S1SH 3OG6B 3GSXA 1IFRA 5HYQB 3BQUC 1QRKA 4AI7A 1KGCE 4MAUL 4N2BA 1ORQB 3FPXA 1BJ1H 1LLAA 1OAKH 1U6AL 1ZV5A 3Q2VA 4ACTA 3SYCA 1OCWL 2DH2A 2GC4C 3ATAA 1MXDA 4GYBA 4MXQC 4Q9BA 3T4YA 4PRAB 4K5LA 4ZNCD 2V2TB 2VDRH 1A6VL 4M7LH 3K0WA 2Z7YA 4JDVA 3APDA 4XOAA 1OAXH 2VABB 8CGTA 4MXQD 3EBGA 3ZKXB 3L3GA 2BHZA 2NSMA 3QAZC 2O5ZH 4UDUA 2ZUQC 5M95B 5I8OL 5FOBB 4OLXH 5IHWA 3GKWL 4JO3H 3LKOA 2XICA 3C5ZA 3WNNA 1U8NB 1FVCB 1H19A 1U8JB 2ITCB 3EH4B 1V5JA 3GUFA 1XSKA 1XZ0A 1NGQL 4TUJA 5IBTH 2AK4D 1A4JA 3G9VA 1RKRA 1T3FB 2VR6A 3WOVA 4P0DA 4FLHA 1TVBB 3M07A 2WMPB 5DO2D 4TSCH 3WBDA 2G75A 1S7UB 3IDMB 1XL6A 3MKKA 5FV1L 1E42A 1M42A 2PTUA 3CCHB 2EKSA 3H6AA 4UI2A 4I8DA 4JFZL 2HJFA 3BPNC 1BAWA 3ESNA 2OBGA 1LK2A 2NXZD 2OX5B 2OXGB 3QXAA 4MAZA 2OMTA 2NZ9D 4PUBH 4WK2B 2FWOA 5CIPB 3QHZL 3BWUC 2Y0SA 1RSFA 3TWCL 4X9FA 1BMZA 2WXLA 2Y6SC 2FHBA 2DBLH 3HG5A 4X9YA 3GMOB 3DYMA 1AI1L 2UY7A 3HJ0A 3UG3A 3T4AB 1ET7A 4R5VA 5EO0A 5T5NF 1A6TA 4NI3A 4NM4L 2DMCA 5FFOA 3QUMB 7TAAA 3CIAA 3FT3A 3D3VD 4C57C 4L3EE 3O6ML 4IK7A 2OR7A 3T0BA 3CGTA 4O51B 4PJXB 1P9MA 4PJ9D 1MFDL 2BIHA 2OMXA 2EDEA 2ZOWA 5FXCH 3ZGHA 4ZD3H 2E5EA 5IB2B 2JNZA 1HSBA 1BQHG 3O2DH 3M17B 1NJ9A 1A21A 5E6RB 4OZIE 4Z3FA 3LPOA 3A67L 4I0PA 2HT3D 4ODWA 1F0LA 1PJ9A 4XVTH 4NQCE 4IHOB 4NZTL 1C08B 1OP5K 1MHCB 3GS7A 1DQKA 4Y88A 5B8CC 3FU7B 1XCTA 2FZ3B 5KSAB 2A73B 2YN3A 4HWBA 4JRYE 1JSYA 1DN0B 1SMOA 4JANA 5EZIH 1DJZA 3L3HB 4K5MA 3SOBL 4HUXB 2QVIA 2VUYA 3OHXB 3SKJH 1CMOA 1EERB 2WSPA 4NKIH 1ZLVH 1U3YA 5ESQB 4D3CH 2DWDA 4R4ND 4ODTL 5E8NB 2DAVA 3SKOA 1OCZB 2X6CA 4YXKL 4YHIA 5LCVA 2MTAA 1RURH 2WUCH 1FORL 3A3YB 5IBTL 3UL4A 1RD6A 2GQHA 3BN9C 2R9HD 5MEND 1AZCA 4OCYL 2F8XC 4MD5B 5DA4A 5JW5B 2AGJL 5D7LA 3T71A 1MQKH 2EECA 5IOKA 3V4VL 2ZX5A 4I0PB 4OI7A 1Y0LB 2FX8L 2VR8A 3FHEA 1LE9B 4KRPB 1SDDA 3RWIA 4WUKL 4EKJA 2ZXQA 3N0AA 4HZLA 5CNHA 3FJTA 1YLBB 2FJFA 4ELDA 2QADB 5AW1B 1EZUA 2PCPA 4MMYB 3GI8H 5AZ2L 3MBWB 1RZKL 3W37A 4C47A 1TTUA 3DARA 1S7WB 3GMRA 5SWSD 3B3IA 2VL5B 3KM2A 4MSWB 4TPRH 4KKAC 2BW4A 2VC2L 3LKPA 5BW7A 1C8PA 3BKCL 4U3HA 3VFRB 5DI8A 1S7TA 2WXPA 3MLTB 4FZ8H 4QYOB 1N19A 4LIQL 4BK5A 2WZPA 2BP8B 1NIFA 3D25A 4XBGB 3WDIA 4C54A 1CBVH 3CQFA 3ZYIA 4ANUA 2DIAA 1CDJA 3VGGA 4HXAH 4FNTA 3I2CL 4G7QB 4JMNA 4QHUB 3E6HA 2R56H 3A21A 4LESA 1NCWL 5JIHA 1E7VA 3I9AA 1SEBA 4PS8A 1KGJA 2V37A 2VYRE 3EYFB 4QXGH 4YBLC 2P8LA 3ZKSD 1BAGA 1WGVA 35C8H 4WY7H 4GJTB 5FS5A 1WWWX 2CPCA 3IKKA 1LK3L 4GP8B 5E8EA 1A4CA 5CEXA 3O8XC 3QYMA 4OGXH 4F7EA 4NOBA 1PF3A 4EIBA 3VQ1C 5F6IB 2D31B 5G4MA 5IWLC 3QI9D 1KT2B 2EDYA 3SSGA 5GGVH 1CI5A 1EO5A 2G2RA 4MASA 5LBSH 1OAKL 1J9CT 2BY3A 2P5WA 3L54A 2AQSA 1KFAL 2KQNA 4POYA 2WXIA 5I1EL 4C4BA 1GL4B 5E8OA 1J12A 1V10A 1NGYB 3GXPA 3IETA 3UJIH 4BQ6A 2Y7LA 4W9IC 1PZBA 3N1FC 4YSQA 1HWHB 2OP4L 2XTJD 5C0EB 2OL3A 4GXUN 1QZNA 1KJVA 3CZNA 3X14A 3MLZL 3BGMA 2ZXDA 4NNYB 5F7DA 1IBYA 1X7QB 3D3VA 3MYJA 5KAQF 4PMEA 5CSZB 5IMKB 4U7SA 5DA0B 4A7GF 1EAPA 3U1SH 4ZTPL 1IT9L 2BOCA 2EH8H 1VEPA 2QKIB 3ZTCC 4I3SH 4MCYB 5AKVA 3GQFA 5I6PA 1ORSB 1LO0L 1XH0A 2R2BB 2WPGA 5EFIB 4DQOL 5DT1H 3J07A 5EBWA 5D9SA 1NMBL 1O7DE 3MR9B 5LAXB 5B39A 5CEXB 4LEXH 3HCVA 3O9WA 3GWJA 4WSJA 2AV7A 4A37A 2XC8A 4TKWA 2A6KB 1K2DA 2AABL 1A7QH 2CIKB 4LT7A 5DURB 4S1DC 2FD6L 2YXVA 3KWXA 1B0RB 2NX5A 3NTCH 2WINA 2VZOA 5D96B 1BAFL 3D06A 2R83A 4OD2A 1XCXA 5IEKA 2KZWA 3BKMH 4KQ3H 3VO0A 3C8DA 3K2IA 4I2XA 1A6AA 4ZXBC 2BSRB 3VXRD 3GO1H 1FNFA 5HGHA 1GIGH 2I25N 1J05A 2ZSVB 4S1QH 4MNGA 1CVRA 1D6VH 1PX4A 1RPKA 1NDGB 3TJEH 1MF2H 5IHHA 4Y7OC 3HPLA 1C7SA 1XGRA 4Y5YA 3D34A 1BZ9A 3ISRA 2DJMA 1EXUA 4JKLA 4G83A 4YN3A 3FQRB 3JWOC 4J3OC 4ELMB 3CXHJ 2DWSA 3HNSL 3FTUA 1N0XL 5CSBA 3DX6B 2IH3B 5BCAA 1THAA 2VLKB 1P69B 1UM6H 3TXAA 1V7NL 4HJUA 3FQ4A 1YEEL 2F58H 2DQ6A 5K69A 1EDQA 4PM1A 2JKTM 2RH0A 4UDUB 1HZLA 3WE6B 5L2KE 4EJ1C 3GK8L 5CHNA 3BUYB 2WTPA 4P4RB 1S9VB 2WXOA 5GS0L 2DTMH 1ZMYA 4YE4L 3GRWH 2H0FA 4GFXA 1E65A 3V4VH 3GRBA 2MNUA 2GJZB 4AM0Q 3VMOA 2KI6A 2B9AA 3AAZA 3DBSA 2XZAL 3MV7B 4ZPVA 4M7KL 1P4BH 3ZT6A 1P53A 3DOHA 2FIKA 1JZ5A 1AR2A 1ETA1 1MNNA 3BZFB 2K4WA 2OXHA 4P5SA 4E9LA 4YLCA 2EKSB 3UO8B 4X8XA 3IJ8A 2A77H 3VE0A 4FQCH 1QATA 3KXFA 2DWEB 4L18A 3QZWB 3B7RL 1T89C 1NUDA 2BCMA 4HHGA 3NTCL 4ZUWB 4PMFA 1C12B 1A14L 3KGRA 1AHKA 1BWWA 3FT2B 1EMTH 3LNEA 3KLLA 3X11B 4PCTA 1U8NA 1U8JA 3ZL4L 2EICA 1F4YL 4YDJB 2VDOB 4D9QE 4NXKA 5E5LA 3MRCA 4MA3B 5L4JA 1KUMA 2BNUA 1CXLA 1FHNA 1CURA 4NUQA 1E5CA 4RRPM 3FS9A 3QIBC 4DEUA 1C9SA 2ZUYA 1T1WB 3ZN6A 4AL8L 4BUHA 5CHNB 1IZKA 1UJ3B 5JOFB 1HT6A 4G5ZH 1MW1A 2JJUA 3HLAB 5AZUA 4HU8A 4KNSA 3HAEB 4FXGC 2OMXB 2ADYA 5GRYA 3CFDB 5SWSA 3DVIA 1CIUA 1Q72L 1JXDA 1L5GA 4XN7A 2NY1D 4ADGA 1XIWA 4DERA 2RCSH 3CNKA 4HC1L 4XBPA 4DP5X 4BHUA 4PSPA 1LWRA 4UNTA 4PLJC 3FCGA 4B60A 3UP1A 4TS6A 1GPOL 3SZKC 5CZXD 4J3UA 4YAQB 5HGBB 1GH7A 1SLVA 2IDSA 4XMPL 4YFEA 1CL7I 4WFGD 4FZ8L 5DUPH 2G60H 1EJFA 5KANG 3SDAC 1FYTB 1I1AC 3SPIA 1N67A 3W0WE 1KYFA 1MJJA 3AXLA 5DJXA 1ZK5A 3VNZA 4MQXC 4PG2C 5CEYA 5C0RL 1RPQA 3MV11 5FF6B 3WS3A 5A7BA 2XKNB 1QUNA 4WUUE 1FNSH 4JPSA 3BLBA 3RWGB 3UTTE 4AQOA 1ZXKA 2FYVA 3O9WD 2Q8AH 4ELKB 3S98A 2AQNA 4GT0A 3EJJX 2Z4QB 5F93C 2G3XA 3B6SA 5GGQH 3EGDA 1U92B 4BZ2A 3RL1B 3S3DB 3SPVB 1NEZA 1RUQH 1YNTA 4L05A 3RVVD 1A7RL 2KC0A 3VWJD 4B27A 2ZOLB 4N0YL 4G7VH 4CNIA 1RIVH 2RFXA 1JHLH 1RK1B 2V2WB 3BN3B 4LASH 5B1AB 2CDEA 1XT5A 4HJTA 2HJLA 4C4KT 5IQNA 4D0BB 5I26A 5A40E 3TO2B 5BOZG 5I76A 3VWJC 5KYWB 3GHEL 3GHEH 2FAUA 5C8JB 3U0WL 2YS4A 2FR4A 4YSOA 3HS0A 4QNPE 3M7FB 3QDHA 3S5LA 3A6BL 5F1NA 1AY1L 3EXJA 4PBVC 1KBGH 2Y6TE 3SBWA 1FYTA 5EEUA 1QTYT 2CALA 4IJTA 2D7TH 3F7VA 3DIDA 1Y07A 3CCHA 2BSEA 2J71A 5IW6B 5EORH 1IE4A 2ICWI 3QJQB 4BH7A 1Y6KR 2ESVD 1SM3L 3MJ8B 1DVFA 1IGCH 3L1OH 5D7EA 3RUGF 4K7FA 1X5LA 1U8LB 3X3FL 1NEUA 3OPZL 5EWIH 3VFRA 2FL5A 2JELL 2FE0A 3AS2A 3L5WB 3G5YA 3EADA 3VX0A 4P5RA 4JUTA 3TS8A 2CJUH 3BAEL 4NYLB 5D70H 4MNGE 4YIQB 2X40A 4PVNA 5EU6A 4HKBA 3LEYL 2NX5D 3VA2C 3GMOA 1CGSL 4R97C 1UB5A 4WJKB 5HHVH 5I6XB 2YEZA 3JZ7A 5HHQA 3R1GL 4LU5H 4NQUA 4LAJH 1FFTB 3T2LA 1N7ML 5DFVC 4UWQB 1DEEA 3MV9D 4F37K 4P5TA 2DKUA 1FVDB 4AJVA 4D8OA 5DFAA 1OSZA 1RZ7H 5EPMA 5IFHL 4X5QA 2KLSA 3SYAA 4E41A 2E7HA 2QR0B 1DANT 1AO7D 4G5AA 5LG1A 3W39A 5M94B 1BD2B 3V6FA 3SDDB 4X6CF 1TZIB 2ZXAA 4AEIH 1J0YA 1XBRA 4KDTC 1WFJA 4P2OC 5J6GB 1PQZA 2O4EA 2E9BA 2NQDA 1ACCA 2FT8A 3ECVA 4QO1B 3CZSA 4DEPC 2I26N 3D9AL 4NQDD 5DSCA 4QYAA 1JNNH 5E2VL 4YEEA 4TNWK 3BH9B 3VGDA 2HX9A 2ZTBA 1GZHC 3P73A 4HS8L 1JPST 3W1ZA 3IN0A 5D2LF 4FKEA 2BIMA 5BXFA 1LEKB 3MLVH 1RUMH 1Q9LB 1U9KA 2AKRA 3HI6H 3INUH 4N0RA 4R6UA 2HZHA 1HSAA 5AOIA 4OLZL 1MFEH 2LFEA 2VR9A 2YGQA 3O6FC 2YD6A 1E2WA 4MDRA 5K9QG 2VDPB 3H3BC 4L1TA 1WPCA 2AQ2A 1T5XA 2UXFA 5K9JL 4AEHL 4WENB 2V17L 3EG9B 2E4FA 4LOUC 1ECZA 1RMFL 1M71A 4DW2H 5FO2A 1DEDA 1ZHBA 4PJDF 1KPRA 2EDXA 1N5AA 1DDTA 3OWRA 4LMQI 5EH1A 3AVEA 5BVPL 2XN9E 3I50H 4L8DA 3PGDA 1I7TA 3ZQ9A 3VD4A 1G9MC 4AG4L 2H6PA 3BAEH 3E9UA 1P7KA 5D70L 1LD9A 1W15A 3NESA 3EFDH 5TK4A 3U6XA 3Q9QA 4AEFA 4V11A 5ISZB 4PQXA 2DM4A 2VXQH 4F2FA 1UD5A 3AM8A 3IS0X 2QSQA 3N41F 4PJAA 3VD0A 4Y4KA 4M5YL 3O3DA 1FV1B 1P9MC 3RU8L 1MZZA 4MB3A 5EC2B 4U1HB 4UAHA 1OM3H 4ZMTA 5IFHH 4RMWA 3BRFA 1A6UH 4KWUA 4Z5RB 3S7GA 1YEKL 3BEWA 5BZDB 3PHOA 4FG4A 3CX5K 3HHRB 5HI5D 4N1HB 4GSXA 1SYSB 4LU5L 5EF2A 3F8UB 4IJ3C 1A6WH 1UVQA 1XIWD 3PXLA 2WWKT 5HDRA 3NJGA 2X4TB 4PLKC 4M8VA 4DP0X 4EZJA 1CLOH 2R0KH 2R51A 2VLKA 3CFUA 2B08A 4N2IA 1FC2D 1MRCL 2AJSH 4JAMB 4DVRL 1E4XH 2A0LD 3SQBB 3UTSD 3WUWB 2HKHH 3HN8A 3P54A 3TNNA 4J23A 4B5EA 4Z7AA 3QQ9C 3JV6B 5IHLB 4X4XA 3UPRB 4GG6E 3L8QA 4PTUB 3BQUD 4LEOB 1G87A 1I8LA 1E4HA 1ZA3B 3MXWH 3ARGD 5E99L 1Z5LB 3AU0A 3AT8A 2A4CA 4AJYV 4NO5B 4CL7A 1MJ7H 1FV1A 4YDZA 5DMKB 1N0XH 3T3PB 4KK8C 5KUKA 1XD1A 2PYFA 1FL3B 3KG5A 4WO4B 5DUPL 3VI4F 3TX4A 3N42F 3NCWA 3NEXA 4J4PA 2EO1A 1TETH 4AG4H 1FNEA 1GA2A 4FX5A 4OZFA 3QZNA 2AJZB 3KLAA 3MRBA 1I8UA 2DWXA 2RB8A 4M7JL 3CFIC 3N40F 2Z3FA 3WFDL 2VM9A 4Q9QL 1YQVL 1FO0H 4LSQH 1VB9A 3EAKA 1RIVL 2OJEB 3GXTA 3C6SA 3VFGL 1AGBA 4AM0B 4U1JA 2N7AA 3DX9A 4F2EA 1KXTB 3ULUL 1FAKT 4Z0XB 5I71C 1GYWA 3UEZA 1XEDA 2UY6A 4GAGL 4XHQA 4FQPA 4JRYA 1ZWIA 4JPQA 1J5DA 1I1AB 4NENA 1S7XB 2I24N 3T9WA 2XWBB 4N8CL 2ZNWA 2BRQA 4TLKA 1OOWA 4J3SA 4TVPH 4JREB 4QHPA 3BFOA 3QJZA 4Y2OA 2GJ6A 2IANB 2OMBA 1FIEA 2M83A 4XGZA 2P24A 3CZJA 3BSHA 3ILPB 4M62H 4S1RL 2CNZA 5E9DD 4L5FE 3HUJF 4O02A 1DVYA 2UX7A 3HZKA 1DP0A 5DD0H 3P0YL 4X6FB 4BXVA 1S7RB 3P0YH 3PUUA 4LGPB 4NQSA 3ZDYB 2SEBA 4EN3C 5LXVA 4YSSA 2N1KA 3BH8A 4XCFH 1A6AB 5E1HB 4HXAL 3RUGB 4FNSA 5DZVA 1PD0A 3SDCB 1EUUA 4KJWD 1T2QH 3ZKQD 3B34A 5FECA 2P45B 4H25A 3WS3B 4E41D 4ZDHB 3QDJB 3TZVD 3VI3B 1J0KA 3FF8A 4XBPB 4WFFD 2HMID 4N20A 3WTSA 3ULUE 4JHUA 1U8OB 2IH3A 1S7UA 3IDMA 2WM0A 4G6FD 4BSWB 2Q6WB 4FADA 2XFXB 3BI9X 3GPEA 3MO1B 4NGHL 4WLCA 4F7CA 2B5IC 1XDTT 2E0PA 3OB8A 2JKWA 2P47B 4XNZB 3MSPA 4GOSA 4EEEA 3MUY1 4U31A 3MX0B 5FA3B 2AJUH 4JPKL 1XZWA 3F7KA 1IL1B 3B2UD 2VM3A 3IJYA 2R15A 2HT4C 4NZJA 1X9QA 3QULA 4E9VA 3NFSL 3GBEA 2XRAH 4ANKA 1D5XB 1NGZA 2NRDA 2WZ0A 4JPVH 4JFEA 4YPGA 1FN4B 3QIUB 3PY9A 4MZRA 5G5DB 3QYCA 4H20H 4L5FL 4MD4A 1I3GL 2NTSP 4N6RA 3EUDA 3PWVA 2VDMB 5G55A 4X50A 3BIAX 2L4OA 4IGBD 4ELME 1HQRA 3GTTA 4BFIB 1N2RB 2LVCA 1HWGB 1ORQA 5KSBB 4EZLA 4AW4A 1I75A 2WXJA 1E5BA 2MMXA 4IGBC 4L2YA 4HA1A 3QIBB 4GSDL 3WMSA 1KMGA 4HFWA 3KM1A 2Q3ZA 2A74A 4B9IA 3ARGA 1T1ZB 5AKTA 4ZX4A 3H9SA 1CLVA 5HI3D 5T1MB 5BV7C 2R29A 5I1IH 1FL5B 1KCRH 1MHCA 1JDCA 2Z0UA 4TSBH 1CK0H 4XO9A 5INDA 3VB8A 4TOYH 1NAMA 4X5XB 1QLEL 1XVSA 2EZ0C 4XCNB 1IT9H 1DDHB 1IC1A 3DBXA 4OFPA 3UACA 1RVFL 3ESVF 2UZPA 1CGYA 2AVFA 2MQ3A 3BDYL 5KS9F 4Z3IA 3FQTB 1QBML 2WD0A 1T3FA 2E7DA 3CH1B 5IHUH 4YXLH 3SDDD 3VXME 4H1LG 1ONQB 3GINA 4MJ2A 4WI3A 3ESUF 2PW2A 4HKXA 4AVHA 3C5SA 4BUQA 4YHYC 5I6NA 1C1EL 1UZ6E 2Z1PA 4LCCB 2D3VA 4RMRA 2YD9A 4NCC2 3OMZA 1MG3C 2HJFB 4WSGA 3TN0B 5MEPA 3ZE2F 5JHBA 1EHAA 3PNWB 3VFNB 4F91B 2BY1A 4AL8H 4Z7VE 2HRPH 1WEJL 1NMAL 4UT9A 3S6CA 4FJYA 2B9BA 4IRZH 2PWDA 3PHQA 5JZ7D 3FTVA 3EZJB 4ZPTA 4XVTL 4PUBL 4TNVF 3H53A 3RZWA 5JW3H 1OT1A 2CO2A 2QGCA 4FQIL 2GJ6D 4LB8A 3QQ4A 3ZDYF 3PWLB 1B4RA 4RQQB 3FAXA 1HEHC 4BFBD 1NAKH 3DX7A 4BDVA 2R4RH 2WLYA 3DRQB 5EDXA 2LU3A 4KKPA 4YHOL 4K71C 4KKRA 2DYPB 4L4VE 4LLMA 1LWJA 2R7EB 4P2AA 4N0CD 1JGVH 3NIFB 1C5CL 3TJPA 1RK1A 4LAQH 1FAIL 1CGSH 1ZLUH 2OXGA 4AEEA 1TZGH 3HJEA 1W72A 4E41E 4GO9A 2QVTA 4XAKE 4Y1AE 5FYKD 2ZCLH 2IPTH 4XP9H 1KGIA 2NLJB 4KK5D 5G4OA 3FU8A 2VW6A 1JGEB 4PREB 3HS0B 2ZP0T 1FNGB 2YPLA 2J1YA 1P5UB 1R3IL 2ZCZA 3D39E 4P2RB 5AW0B 4WWOA 4GW4B 4XH2A 3JWNE 1XCTB 3SIKA 5IQ9A 3SY0A 1XQ4A 2OKMA 1GOFA 1N4XL 1FFNA 3SYOA 5JDSB 1T6BX 2FNWA 5JQIB 5EEXA 2ZWNA 2CO7B 3X1FA 5DFVD 2FRGP 1U2YA 4MWFA 5IJKC 3ALXA 1Z32X 5GIRA 1CWVA 1NJ9B 4PRNB 3OHMB 5F1SA 1MHHA 3C60D 3JWOL 5DK0B 3WJMB 3KYOA 4ECNA 3QPKA 5DMIH 3UTSB 4P5MB 2B8OT 1JHLL 1QLFB 1JE6A 5I71B 5I8OH 2JJTC 3DKHA 5JPNB 5DJ0B 1G6RB 2HT4D 3BP4A 2DEYX 4XXWA 3VXQB 1DN0A 2XV3A 1IGCL 1PW3A 4FG6C 2A9CA 5GS0C 4ODXA 3MRHA 4GRWH 2BSSB 5ECJE 3VD9A 1P5UA 2AK4B 2ZX9A 4GRWE 2NCEA 3WJLC 4Z7UF 4BV1A 2FJHA 3AREB 4ZSOA 1I9RH 4KPHH 1NSNH 4RGOH 1G7HB 2YXMA 1U8MA 3GBML 1RZ8A 1JGDB 1L9QA 2NT0A 4FNLL 3OLEA 3ZDZF 1KJ2L 1RZJH 2DQJL 5HVHC 5IFJA 2RALA 1PBYA 1W72L 3MZTA 2WQWA 3A24A 2VAJA 4F8OA 2PP9A 3LX9A 4G70B 3O3UN 4Q2ZB 3EO0A 4Z0XA 4NO0A 1GYUA 1KDIA 3MUGA 3NA4A 3ZRFC 2CMRL 3DX4A 2K3TA 2Q20A 4OD3H 3QDJD 1YECL 3VD5A 4X6CE 4NNXB 3W2DL 1U42A 4ES9A 4KROC 4X4MA 4LF3A 1RIUL 4U1NB 3B7YA 4TN9A 3OMNB 3KPRD 3QXVA 3KYNA 4G6AD 4MBRA 4HKZA 5HGAA 3LRGA 1QSED 5E4AA 3T6VA 1ND0B 3K4AA 5F71A 4ZFFA 3V6ZA 4NDMA 1JS4A 1L0PA 2H0PA 4YX2L 4KVCL 3L2NA 2NSQA 2YZ1A 1MRFL 3DPBA 3KDMA 2ZAIA 2VO5A 4UOQA 1JVLA 1OL0A 3C5JA 5LHDA 3OL2A 2JJSA 2QVFB 5A2BA 1EEZA 1PVHA 1BZ7A 3US0A 4GKNA 4TUOB 2WUBL 3DROA 2OYLA 1OHQA 4E9TA 4Z3GA 4U6XA 4O4YL 3N85L 1OQOA 2XPYA 5TDOB 1JN6A 4W6YB 5KVMC 3HPJB 3U7AA 1DUZB 3FONB 1S78D 1P2CB 3LN5B 2CBPA 4JFHE 3RBSA 3TOPA 4KTEL 2VKWA 3OZKA 4WEBL 2YWZA 1JRHL 1RJZA 4OTXL 3VDBA 3U7WL 4LVNC 2O5NA 1CDUA 2ROYA 4P04A 3APMA 2L7JA 4OCXL 4KH9A 4MDIA 1BGXH 3VNYA 4A1RA 4PJ9C 1RIHL 2IPUG 2H32H 3BKCH 2AEOA 3FCSA 2C3HA 3IGAB 1JVKA 5IBLD 2TRHA 3WIIL 3L4ZA 1FSKC 4JN2A 3EO1B 4G80B 4JCWA 1KTDB 3MNVB 4X5WB 3DRTB 2VZVA 3BT2L 5DRXB 5BW7C 1BDYA 1I82A 2QLVB 4PRPA 3Q6GL 4NUPA 3F7PC 1BQSA 2Z92B 3ARSA 4LOVA 1RV6X 4L9LA 1OAUL 3BIKB 2CBOA 5HHOE 3SDCD 4AX3A 3QO1B 2VSDA 1N18A 4WUKH 4F57L 3IDGA 1G1CA 5JYLA 4U1LB 4U1MA 1D5XA 2CDGA 3MACL 2G3MA 5EOTB 1J8HA 3LB6C 4YFLI 4HAGA 4HS3B 4EZKA 5IMLB 2MIZA 2QPFA 5HGHB 1JAEA 3F01A 4I18B 2VZTA 4OM1H 4AVIA 3QZPA 4G71B 5EU5B 2DLTA 1G6VK 5LAXA 3RHWK 3GEWB 1INDH 5B39B 5FX3A 3D39A 5GGRA 3W11D 3EYSH 2K9FB 1BZ9B 1O5DT 3OMAB 4X4ME 4XODA 3MBXH 4ZFZA 4NKOA 3CHXA 5JHDE 3FW6A 5IFAH 1ZLSL 1BJ1J 1TF4A 4R7DB 2NDGA 5HJDA 3TN0C 3TT3L 3UZEC 4NM8L 5JW4Q 2OMNA 1L7IL 2FO4A 3QT2A 3FFCE 4WJ5B 2AABH 3EYVB 2XN9B 3SDXB 1AQDA 3ZHNA 3PPSA 1N6UA 2Y36H 3UH8A 2CKBB 3IMRA 4A38A 4G43B 3GI9H 3V0VA 1XCWA 2AF2A 4MJ4A 5TE7H 5KTEH 5EBLA 1IAOA 5SWZE 1SQMA 2WKOA 1ID5I 2WJ5A 1PZSA 4KKLC 1NM9A 1S3RA 2APSA 1BHGA 4M6MH 4X7TA 1U41A 1XSIA 3F6IA 1KXQA 4KMTH 5GHWL 4BFIA 5SWQB 4HWEH 1IGTA 3EYOB 3NFNB 3UADA 1LP9F 5D5MA 1K5NA 4LCWE 1J0HA 1K9TA 3X1NA 4DN4L 2HKFH 1XF4A 3KXFB 4LLAA 2NQCA 1HQ4A 1S5IL 5C3TA 1GRWA 4LVHC 1YEJL 3LV3A 4P57B 3U25A 3RA7L 2MRYA 1NBZA 4MJIE 4TVPL 3X3GH 3HS0C 3W57A 3Q7JA 4LNVA 5EN2B 2IPUK 4K0OA 5I0WA 5JXEC 2ZCKL 3S9DB 3K71A 1QQDB 3O4LD 1A6PA 2UZIL 4HIHA 3ZTEA 1JCVA 2E75C 4PYGA 3X13A 4DEPB 4I48A 1NQBA 4AKPA 1TTCA 2A5UA 3S5ZA 1TZHB 1V7MH 4M43H 4HBQA 3TYFB 1AHWC 3IVKB 4G6ML 1XCQB 2LVEA 3ZDZB 3L5JA 3DOSB 3F7YA 1H5BC 2P5WE 3SO5A 2CHXA 2H9GB 5I75B 2E9GA 2GTZA 4TXVB 4ESKA 3VXUE 4B50A 4KK6C 1UYWL 3NIGB 3AXHA 3UBHA 4H7VA 5IJDC 5H4ZA 3F84A 3FAWA 5EO9B 5T5FL 1ZDSA 1U91A 1JD9A 4HIEB 4LLDA 1YEKH 1GAFH 4JLRB 5GRJH 4Y4HB 1KFAH 5I1EH 3MJ7B 1BIIB 4YSCA 2ZJSH 5H4YA 4F2MB 3BVTA 4G7YH 2VM4A 2XQ0A 1O6TA 4LP8A 1J5OH 2CHWA 4K7PH 5AD0A 1JZ7A 3W38A 3IJEA 2PYEA 4DJMA 1E8XA 4YLQT 1VZGA 4XCEB 3ZK0A 2D0HA 3AREC 4KU1A 2VDRL 4L8BB 1BFSA 1QUNB 4KTGA 4QRBA 4NUJB 2C4FU 2P7TA 3EF4A 1TKWA 2AXHA 3NFPA 1S7VA 2G9KA 3K8MA 2J88L 1H5BA 1PSKH 4YHML 3QQ3B 3CLEL 3QFDA 2HFTA 5F0JB 5ANMA 2R4SH 3RGBA 3T5WA 3CHPA 1RZFH 2EJ1A 1NCBL 2B3IA 5D2NB 1E9QB 4JDEA 4J1UA 2DZEA 3OKEB 2W65B 3NCXA 2Y69B 4ZX5A 1G1KA 1G6RA 2CCWA 2Y2WA 4XP5H 4PI2A 5FYKH 1PNCA 4M6OH 1FGNL 2B1HH 4DK6A 3L4YA 1OAUH 1KXVA 3DX1A 4IKLA 4UIMB 1ZLUK 4MSWA 3QUML 2WXFA 1JGUL 3LKQB 3T8MA 4GKZA 3U46B 1YEDB 4OZGB 3W0WB 3L4TA 1OLLA 4NI6A 5F70A 1W2KT 2GIMA 2R27A 1YJDL 2HVKB 4W68A 3FXIC 3IE9A 3L2MA 2AJXL 3ARFC 5F0LB 1XGQB 2L7QA 3TFKC 2YWYA 1G9MH 3DC0A 1UURA 1CPUA 3SOTA 4G6JH 5E2UH 4RRPG 1SDDB 4UQCA 3RWIB 3KPNB 1IBHA 2WXNA 4GQRA 3EYUL 3PNWA 5AYUH 3QDGB 1GHFL 3RGVA 1P7QA 4MAYB 4ODSH 5D1ZC 4DTGH 3ISWA 3NJFA 4OQ1A 3N9GL 3QDMA 4UANA 3PAUA 4NO0B 5F9AC 2ADGB 4ZPTB 4YHLL 3WU1A 4K71B 1CGWA 3RDTB 2FIRT 4HJJL 1M6OB 3FO0L 4HJJH 1ZXQA 1LO5A 3K81A 1A9BB 3FCTA 4S0TD 3UTSE 4K15A 4DO5A 3D05A 5DYOA 1DJGA 2R29H 5T3XD 2C9UA 4AJ0A 5T3ZE 4FI7A 4LSUL 4XNUH 4WWPA 3ARDB 4ETQB 3WN6A 5CLXA 3I84A 3RFRA 3JWDL 3BDBA 4HEME 3T77A 1DLHB 5A3ID 5K1VA 1AO7B 2GFBA 4X6EA 5H94B 2HWZL 4JRLA 1B90A 5CBAA 4EO5A 1HJBC 2F8OA 3HG3A 1HHIB 2DM2A 2BHFA 2E27H 2K70A 3HFMH 3S35L 4EOWL 5JHDB 4N2OA 4WWKB 5D7SL 2UZYA 5HHPA 1SUHA 2CJSA 2J3SA 4DO4A 4LDEB 2VW7A 1USZA 2D9QB 2PO6D 4KRNA 4ZMYA 2GI0A 3L4VA 4PJ5B 3GXDA 1DSWA 3QZBA 2P48B 3ZYOA 5IV2B 4OV5A 1FZJB 3QK0A 1ND0A 2FEEL 2X4OA 2HB0A 4OIFA 5TJWK 4MVBC 1T03H 3CN0A 5C2BL 5I6LA 3LZFH 1U3HB 4JO5A 4L4TD 4A7QA 2VLJA 4G8EA 5LCVL 4OLWH 2VAAA 4E9XA 3CK0H 4PJEA 2P5PA 4TLSA 4UQ2A 1KTRL 1NBYA 2XWRA 4G80A 5ALCL 4NRXA 3RIKA 2BXYA 2E8YA 4UDTB 3UZVA 4FXKA 4UYQA 1OGTA 3AT9A 2BIPA 2PTTA 4HIQA 4F7TA 1HL8A 1LEGA 2H2PD 4JKWA 1S7TB 5I24A 2RHEA 2DMKA 4WV1B 2R1WA 3WEBA 4N1CA 3HMXH 2AHIA 3KPOB 3OLIA 3B9AA 2H1PL 1KCUH 1OV8A 1W16A 4U4BA 5AQ0A 4ZAKB 3TEYA 1H0DA 1KJMA 3S5YA 1EHXA 4U4IA 1UM6L 2AQTA 3TVMA 2HMIC 5IGXH 1HNYA 4WWKA 3OXSB 1AY1H 4K94H 3U83A 3ARXA 1BOYA 1OSEA 4G6KH 2G0KA 2XTJE 2Y22A 4ZO6A 4XWGL 5AG9A 3RDJA 1B0GB 3GMMA 4XMPH 4KV5E 4L3EA 3RY5A 3TA3C 5CSGA 3SQOL 2WBJC 1EX0A 4KX7A 2OK0H 2ESVB 3VWJB 2W0LA 1GOGA 1WE5A 3Q8CA 4J6RH 5LGKA 4Y2LA 2VLJB 4G1MB 2VDOL 2G2RB 4JFFD 3ZUCA 5IVNA 4Z7WA 4Z8FH 1V7ML 2WANA 4M43L 3GHBL 3NH7H 4LP5A 1CR9L 4NQED 3TO4A 4DAGH 2G5BB 4AVKA 2EYSA 1JTTA 5D1QC 5C0JB 5DUML 2CRYA 1F8TH 3AWEA 1RZGB 2YEVB 1UXLA 2H41A 3APNA 4PW9A 2VLME 4Z7UE 4XO8A 3OQ3B 2JKXA 2EVIA 3GGWA 4JG1H 5CS7A 4XPGL 1HNFA 2HX7A 1JHTA 4QT5A 1QSEB 3G5VA 4JW3A 5ANME 1AGFB 3ALPA 5FYJL 4IOIA 3SDXF 4P2OD 1HEZB 1OAQH 4WFHE 3D39B 3GS0A 3SCMA 1RK0A 3X2QB 2VT0A 3RILA 1N8OE 1CFQB 2YPKB 3I6GA 5GQBA 2MCG1 3MGTB 4NC1C 3MRKB 4L8SC 1HCFX 3QUXD 4PLJD 2WP3T 4YLBA 4PR5A 3DLQR 2O26U 1OCOB 3AWFA 3Q3GA 1CD9B 1FFPA 1P2CA 1IQDB 1P5UC 2AEWA 4AJWA 3TZVC 3UCQA 4RWYL 5ICXB 4UM9D 2ZWSA 3TV3L 2DH3A 4PB0L 5GRVL 4R5XA 4P8QA 3LJ3A 3GFUA 4LPVA 4UQIM 3GS4A 3QEQE 4LSTH 5TE7L 4YE4H 3SO3C 3CSYB 1IBZA 2HUEA 1CLCA 3WFCH 4C8XA 5HYJE 3OAUH 3AG1B 1T80A 1MI5D 4UOW0 1MWAL 1ZT7B 1D7BA 4J5VA 4CGUB 1QFPA 5FYLE 2BSRA 4R26L 3QJTB 2NR6C 3PWVB 1DJIA 1S5IH 1ZLSH 4WHTB 2XZCL 4F9LC 3DUUB 5D7JC 4FL4C 3WNIA 5HGBA 2CCLA 1Q1PA 2CLRB 5FHAH 3NH7L 3EJSA 1YNKL 2Q7YA 5LJYH 4Z8FL 4HOWA 2OMTB 4MQSB 5E56A 1YEIH 1YVLA 2XFGB 2CLZB 4FN0A 4JJ5A 2DBJA 4JM2C 4U2ZA 3V5DA 3ZE1E 1T83A 4AQ1A 3WFHA 3W11C 3T2QA 3HAEA 1JPGA 2D3NA 5T1MA 4NENB 1KELL 3HRZC 3EDJA 4A55A 4X5RA 3FU9A 2Z4QA 3MCKA 4ZUUB 3DECA 4DH2A 5HI5C 5JPMB 4AQ8C 4QXUL 1FZMB 2NXYC 3JYBA 4KK9C 4F7PB 5I1AB 4ONHB 1QUPA 2QJDA 5T33L 1OPGH 1M05A 1X9LA 2ZUUA 4OFVA 2YAPA 3P2DA 4ONFL 3WI9A 4ZRGA 4APXB 3FQ1A 3GLAA 4JY4B 1XR8B 3VI3A 4KK5C 1VADA 2EIDA 3HE7B 3QCUL 2IPKA 4GS7C 4L23A 1TKWB 3FO1B 1BCIA 3N44B 2EACA 3I3DA 5HYSB 1S7SA 2JB5H 3T0XA 3TBYB 3MRLA 5TE4L 2E7LC 3Q8EA 2NNFA 2Q76A 4C4UA 4P9HL 2C9SA 2W9DL 3REVA 5T3ZH 5C92A 2CHDA 1CXFA 4WWKD 3G6JB 2EQDA 2NUTB 1ZTMA 3GSNB 4BEIA 4NZRH 3CZFB 5K9KA 5FUZH 4TQPA 3PWPE 3NJIA 3WEAA 2G4EA 1DCLA 3FBKA 1OGPA 4MS6A 1OE3A 1F41A 4HZAA 3LRSB 1TJMA 4GUOA 4MXWH 4HUMB 3NEOA 3VVVA 3BLPX 1Z7JA 5CD3A 1JPSH 4WUUA 4YXHL 1R0AH 1JNJA 1DJYA 3NSFA 3LEVL 2B4CH 2WKLA 2YFOA 4G8GB 1K5NB 3M6DA 1GR7A 1KF9B 1AR1C 4GINA 4C58B 1W0WB 1VJSA 3BWAB 3RNQA 2DJ4A 3F7QA 4M56A 4QHKI 4MMZA 1RJYB 5IB3B 1WFUA 2AQ1A 3KR3H 1Z3GL 4LSPL 2F53A 2FEEI 4Z1PA 4JY5H 4MA7L 5E4IA 2PO6B 5GS2D 5A2IH 1R3KB 2X1QA 2E6JA 4V1DE 4JHAH 1D5RA 3IS1X 4GLRH 2MOGA 2ADGA 2OCCB 1P1ZA 5KJ4A 4FI8A 2GJPA 5L88H 1KG0B 5DJCA 3LRHA 4WEBH 2ENQA 1AMXA 1PG7L 3BWZA 4U0RB 5INDB 1E8WA 1ZE3H 3L95B 3P9LA 5AALA 1I7ZB 3HAEG 3PWJA 4N6RB 4NPJA 3L3DB 5GRUH 1BG1A 2XTSA 2C9QA 1C5BH 1NZRA 1HTYA 2ZUWA 4H88L 2Y1AA 4YBQD 4HLZG 3C2AL 3WNMA 1ZHLA 4AZUA 1ZTXE 1UC6A 1QRNE 1BOGB 5KSBA 4DZBA 5E9DB 1RZIA 2EIJB 3WIFB 1BFOB 3DJ9A 2BSDA 5D7LB 1MELA 1KJ2A 4R7NB 4XRCA 1ITCA 1W0WA 5CEZH 3RL1A 3JXAA 1DBJH 3DVNB 5DMGC 3GRWA 4G6AC 4GSDH 2K3HA 1FL5A 3AQZA 2XUWA 4LO9A 4JREC 1GMIA 1SGKA 1M7DB 5F96L 3LKSA 2ATPA 4LSUH 4XNUL 3AGVA 4N2LA 1HOCA 1TQVA 4Y1SA 4GKSA 4OCSL 1UACL 5ITFA 1KULA 4JFDD 1SZNA 1UD8A 1R5IA 2K8QA 4WI9A 2AK1L 2XV0A 3OM3B 3P73B 1KB5L 4A6YL 3X17A 3SCMD 3CH1A 4ANWA 3TYGL 5CBAB 5ID1A 1EO7A 5C7ZA 5B38B 1U2CA 1S78C 1TJIL 4UQ3B 2D7MA 8FABB 1N68A 4WRLA 4X5PA 2O30A 5C9JB 5CWSB 5DD3H 5DJ6B 3MRPB 3TFBA 5T1JA 5I1JH 2Y07H 4DZBB 4UUJA 3EJZD 3P77A 4FNRA 4D3CL 3IT8D 5J6HA 1I1RA 4Y16D 4PB9L 4QJ3B 1AZUA 4WQOA 1GCFA 3UP6A 3VJ6A 1A1OB 4P48A 5IW1B 3AY4C 2WQRA 2X70B 3KCWA 4WFEE 1P7KB 4G11A 4R83A 4X80H 1GYVA 4N9GA 3HZVA 1FSKB 4EQ3A 4MCYA 2RMNA 4AIZB 2X4TA 2J57A 3WFEH 1UZ8A 4P99A 3CIQA 1D5BA 2UUDK 2WKOF 4N9OB 5SWZD 2X12A 4ZSOE 3SODB 4LPTA 1K4DB 4G82A 4LDLB 3BP6A 4LK4A 2V9QA 4PRNA 4DP4X 5BNXD 3FB5A 4YHPA 4WTXA 2EDQA 2OLDA 1CFNB 1CXHA 3H85A 5F8RC 3NMEA 5D1XB 1Q4NX 2IFFH 1HDMA 1L6ZA 3KYAA 4K3EL 2ZOTA 5J0BA 4NO5A 3AG2B 5DJ6A 2FVNA 4AYEC 5IEHB 4YZFE 2GUOA 3L3KA 2EUVA 4ZW3A 3QVAA 4RMBA 4EDXB 1DUZA 3FONA 1Z0NA 1YHPA 4GMTL 4UM9B 5ACMA 4NRZB 1B0GA 3EGSB 3OGCB 2NZIA 1L6XA 2M2DA 4LMQE 2VLRA 4N8PA 1XBDA 4Q14A 1AGFA 5D6DA 1VCAA 4KZCA 2NY4C 2C4XA 2OJEA 2QEJA 1VPOL 1PTZA 5D4QA 4B7IA 2XVLA 4DGUA 2OV0A 4P3WA 2QV4A 1KEMH 4E5XB 4H0LC 1MCSA 1JV2B 3O45A 1I1AA 3HZMB 1IIIA 2FT7A 4PLKD 1J87A 3PABB 3ZU8A 5I18L 3ELAT 4GRMB 5KJRL 2F1EA 4OLEA 3DUHA 2E86A 4N2KA 1VCBC 2DYSB 4FF9A 1R3LB 3KLQA 1G4RA 1NGQH 3HC0B 1E6OH 5DJ0A 4CSZA 1Y6MR 3E6FB 3HVDA 5H35A 3QXDA 4UV4H 3LKRB 3QRLA 3PHAA 2Y72A 4BKLA 5BRPA 4NC1E 2D31A 2QV2A 4OM0L 2F61A 4C55A 3RIAK 3ZE2B 1QR1B 1KLGB 2H3KA 2R2HA 3G6JF 5FOJA 4Z5RA 4Q8BA 1S3KL 1MNUL 2H0EA 4PP2A 4N2EA 2BVYA 4LOEA 5F7BA 3IWUA 4Q6YA 3QDGE 1UVQB 1I8MB 1V7NH 4Y5VB 3OD3A 1H8LA 1QBLH 3IMWA 3BXNA 2VERN 2CKNA 4FE9A 1RHFA 3A4DA 5IF0B 5LN8A 1N9PA 4URTB 3SE8L 2X7LA 2DJSA 1H3PL 4ODUB 3MRCB 1SF5A 3QSKB 4MA3A 5CN2A 3IFNL 2QHLA 2NY5L 2E9JA 1J5IA 1G4MA 4JZOB 1TYJA 2WWKO 4IQHA 3RWFA 1HE8A 2YK1H 4POZC 3MRMA 1Z66A 1ZIAA 1F1GA 3AY4A 4UTCA 1E30A 4HMEA 4M4RB 1KTCA 5T3XE 3THML 2MH4A 4KNQA 5IQ7H 4YMPA 3BUTA 5D7KD 2I9LA 3ILEA 3L1OL 2IALA 2BCKA 1MCJA 3FO1A 1HI6A 2X05A 1QKZH 2ZQKA 4RBPK 1MEXH 1VZIA 3KL5A 3HG1E 2AITA 5BUPA 3B2XA 3BT2H 2MPAH 3AROA 4H26A 4L3ED 4MD0B 4PHXA 2P42B 4Y4HC 1LMIA 2R69H 4WTZG 1JFQL 1MY7A 3MXVH 4P4KA 1P0SE 1S9XA 2BINA 4I2XB 3T04D 1Q0YH 1REIA 4GFTB 2VISB 1T1YA 5AYQA 3FQXB 2YPLE 3TNMB 3FZUD 2OJZL 3FQYA 4JDVB 2JLLA 1N64L 1J1OL 2ITCA 4R2GC 4PJ6A 1DN2A 4Z3EA 5DU7A 1EAQA 4APXA 2YD5A 1VEOA 1L5GB 3N2JA 4EUPB 2DL9A 4FFTA 4HBCL 4A6YH 5C97A 1OHZA 1SY6A 2WV3A 5F7EH 3S2CA 1NOLA 3P2BA 3BZ4B 4N87A 2CBQA 1RUPL 3SCMC 4NXSA 1KBWA 3GPSA 3MREA 3P0VL 3SGDI 1QBLL 1OF2A 1DJWA 2YFNA 4MJIB 3PWPA 4BFNA 4NZFA 3BVUA 4KDTA 2F53B 4P2OA 3WY3A 4A04A 4X42A 3LPFA 4PN6A 1MWAH 1UD4A 1DJXA 4YJZL 3K2UL 1MCKA 3K2UH 4B0MB 3PGCB 1MFCH 2CDFA 1JNNL 1U91B 3ARFD 1HILB 2C9VA 1FNHA 1YEJH 5J56B 3MV8B 4OF6A 2PWEA 3S97C 4WUUB 2CNYA 3OX8A 3D0AA 1DFBH 3ES6B 3H2WA 4U1KA 2FIKB 3ZZ1A 3ARRA 4KHXH 3W9DA 4BKTC 3K72B 2BZDA 2NYYD 4LCCA 3K2KA 1OGAB 3TO4C 1F3DJ 2HLFD 1ETZA 1YEFL 2G0LA 2CR0A 2EDHA 5EUOA 5F9WC 3T4AA 5C1MB 1S9WA 3O3BA 4BE5A 5I66B 4R8WH 1XD0A 2HG5B 3FCBA 1QSZA 4FQ1L 1AKJD 2A6JA 1A7PH 5KYWA 4ES8A 4QGTA 2HAZA 2AS5M 1EDYA 1LDPH 1HINH 4F33B 2AXJA 1MVUB 4IBUA 2GBUA 2PXYD 1UB5B 2ZE0A 15C8H 1ZT1B 3IU4H 4WGKA 1WP6A 3AWGA 4ZFGH 3LH2H 2FLBT 5I16B 5FM4A 2PR4H 2MPAL 3MX0A 2QMKA 4BSVB 4ODVL 5HJBA 2WHVA 1ZJBA 4UNVA 1DQLH 2NW2A 2DQEL 4AQ8A 4MZIA 1DVFB 3MRQB 1RUPH 3C6EA 4R84A 4TUJB 1V3JA 4XVUC 1TZIA 3MCYA 4WI7A 1EJOH 2CUIA 2BFVL 2GJ6E 4FXKC 4U7MA 5EBMA 3STZB 3PIQA 1T7WA 1CICC 2QKSA 3STBA 3L9EA 4JZJA 5JIDA 1OTUD 4R0LB 4TTDC 1IEAB 5D7IF 2XZAH 3REVB 4L8CB 3KPNA 1F4WH 4IRJB 3EJRA 3VI4B 1BVNP 4NP9A 5D1QB 5ESAB 2IF7A 1F58H 3QO0A 3MV7D 2YKLL 1YY9C 1FJ1A 1HL5A 5CIPA 1NC4B 1VENA 4JN1L 1XAUA 1HK6A 4UTBL 1KB5H 3RTQA 5KSVB 3QEQB 1QLEB 1A2YA 4MS8D 3UBXB 5JW4M 1T5WA 5ICYA 1LM8V 3QDME 4PJIE 3U2IA 4XX5A 2E59A 5JZ7C 3VXMD 1EBAA 5ID1B 2P49B 4MA1B 3KH4A 3VXOB 3KD4A 4ZMVA 1PFOA 4YH6A 2ZF9A 3RWDB 3C6LD 2DTSA 5EOQH 4J2QA 2AQRA 5I8EB 4XCYB 4C83A 2J43A 2VB5A 3C5XA 1D3CA 4CGTA 1UA7A 2IGTA 4N2MA 3MC0A 4EI5C 4JNXA 2ETWA 1FI8C 5C0AD 5KYNA 2Y1VA 4KXZH 2R29L 3T3MB 2A9DA 1CG9B 1CFNA 3DJTA 4YDKL 2H8PA 1T20B 2NZ1A 3IWVA 2XBZA 3WFBH 1IIKA 3N91A 3T0EE 3X1BA 5D55A 4B3VA 5JHAA 4UB0L 1C5BL 3DX3A 3O41B 5TDNA 1WCBB 2QQKH 1CTMA 2B59B 3A6OA 3MRJA 3VD1A 2VUOA 1P5VA 5ESAA 1T4KB 2W0FA 2F53D 5D2NE 3FZUC 4F8LA 4NPYA 1QFUL 2J73A 5C09E 4AY0A 5EU7E 5JORA 2IXQA 1XFPA 4Q74A 4PV8A 1RK7A 5C0ND 4KTDH 2EIMB 2RIKA 3UTSA 4RSVA 4NUGL 2VXQL 1FL6B 1H8OA 4BWUA 4AQAB 4PGBA 3FT0A 3GLZA 5E6UB 3VMNA 1YSOA 3MRIB 5C0DB 2EH7L 5EEZA 1SMDA 2XYBA 3WHE1 2WLNA 2YXFA 4GW1A 5C7XL 5KN5B 3QHZH 3QBTB 1QACA 4DVBB 4FCAA 4AQZA 1C16B 5FUOL 3U0PA 4XXCC 6CGTA 4ZT1A 1KPVA 3WIHH 4QY8B 4L1HA 2Z31C 3UBFA 3V4VB 4ZUSB 1BXAA 2BP0B 5D1QE 3CFQA 3PL6D 4YHNA 4Y4FD 2BNRD 2M26A 3X14B 3DV4B 4UM8B 2Y2YA 4TSCL 1HE7A 4WU5B 1EA9C 5FDWA 2XXCB 2R4RL 3JZYA 3O41A 3QIWB 5CZRA 2DPKA 2NT1A 4HMCA 2FH6A 5DVPA 2OZ4H 1EAOA 4OV6F 4YSTA 1HU8A 2BY0A 3V6FB 2VLJE 3QFJB 1FRGH 2DDQH 3GIZH 5EO1A 4FA6A 5IQMA 3I6LE 3V55A 3BIBX 1Z5YD 3V0JA 4CILA 4FQLH 4WW1A 1JCKA 3IN2A 1SJEA 3KNBA 3KLAB 3P2TA 3NP4A 3KJ4C 3MRBB 4IRZL 4LPXA 2R8SH 4PS4L 1A5FH 1JV2A 3DXAA 3O45B 3G5ZA 4MJHA 4QTIH 5DHYA 4MWFB 3DVGA 4XPTH 4U1NA 1X5GA 4HAFA 4QXTB 3WS6C 3QNZB 3MLXH 3D69A 3R06B 4JQXA 1U6AH 5DZAA 4KVNH 3ULVC 1UFUA 1Q9WA 3TJHD 2P5EB 4KXCA 1OE2A 3C08L 1OAYH 2CO1A 1ETJA 2N4IA 2Q3XA 1PNDA 2ZWLT 5D7IE 3WELA 4BHUI 4FLQA 4EVNB 1V05A 4HMDA 1A9BA 1N7MH 2R56L 2WSKA 5IVXF 5TPWH 3V0IA 3WFBL 4G72B 3HZ3A 5EUOE 1IFHH 4PRDA 3K5SA 3SE4C 5F9OH 1U0QA 4XE0A 1BBDH 1U2HA 2BWDA 2GSIA 3EH2A 2APVA 4G6KL 1IAMA 1WSST 2PKDA 2NNCA 1XXFC 5T3ZL 1CVSC 1E5ZA 4AGLA 2CO6B 4BFKA 4YHPB 3LZRA 1K85A 4O2EB 1CFQA 5E6YA 3HMXA 5E6IA 4H8QA 3K1KC 2FJGB 2DQGH 2NXYD 3B56A 3RUGE 3SDAA 2ILLA 4QAMB 5BV7L 2FO1A 3O0LA 2F53E 4AYMC 3L3KB 4G7YL 2DQDL 3AG3B 3CWGA 4YSEA 4OCLC 3EYFA 2PTVA 3J8F7 2BNQD 2QADC 1RFDH 3GDCA 4D9RE 2PLTA 1BYNA 4B9KC 1FDLL 3MN8A 1EXGA 1COBA 1BREA 5JHLH 1QD0A 2EEFA 4G8IA 3TLRA 5J12B 4L9LB 4HOXA 4HIJB 5KYXA 4ZTPH 4QMEA 2K0RA 4BSWA 1AKPA 5E6SB 2J1XA 5T1KB 5EIVA 3TCLB 3UROR 1UGKA 4TNGA 4X6FA 4F2ME 1O9VA 5C08E 2ICEA 2XDHA 4L37A 3K8KA 2A9AA 4Y4KC 3ZE0F 4M8UA 3BZEB 4EXPX 4ZMPA 3MODH 2ZX7A 2UZXA 5C0BB 1HYRC 2Y7OA 1PGRB 5EZIL 3CBJB 3ET9F 5IP4A 1MLCA 3FOLA 5DJDA 4OAWB 3HRPA 4LLQB 1B0RA 5B7EA 1MOEA 2WXHA 3QULB 4ISVB 1WZMA 3LH2L 1JZJA 1I1AD 2ED7A 4IKNA 1MI5B 3DX8B 4PJ8A 3BJLA 1JGLL 1IGTB 2J8HA 2OCJA 4YQXL 3CFNA 2Y24A 4Y19D 3FQWA 3O2DA 4HV8A 4OJCA 5I1AA 5FB8A 3COOA 4GW5B 3BAWA 4N6QA 3IFPB 3FSAA 5D9SB 1S8DB 3GMNB 3I9PA 3LIUA 4P46D 5T3XH 1XGRB 5C0CA 3HOGA 3RY4A 5J1TC 1QFWI 3BKJL 2GHZA 4XCCL 1HVXA 2GEEA 4H0GA 4LLVA 2ICEC 5J3HD 1GYAA 2C9PA 1B4JH 4X6CB 3UBXG 3LKOB 1TG8A 2BNQA 3H7LA 3L16A 4XAKD 1PDKB 1HN1A 4YDVA 4M9OA 4KRPD 4WW2F 2VQ1A 3ZDXF 1AIZA 1WS7A 3PS6A 1NGPH 1UOWA 2OMZB 4RGMB 4DGVL 3HS8A 4I48B 1UOLA 3L9YA 5F0PB 3LN4A 5C0BA 1IM3D 2X4PB 3O6FB 1YMME 1M57B 5ILTL 4XPGH 4RBPH 6FABH 4HWZB 2PP7A 1ZCRA 3KGSA 5MEOB 5I1CL 5CGYD 4DUVA 4RMUA 1OANA 2A1WH 5EOTA 1N5YH 1MFAL 1T66C 5T1LB 2MOQA 4F8PA 3SGDH 2YZ8A 1FE8H 1QZ1A 3RX8A 4HISA 3D7PA 1KENL 3IFPA 3L1GA 1HHGA 2OTUB 3VH8G 3BISA 2KPNA 1H6FA 4PR5B 2OA9A 4O2FA 3NSXA 5E4OA 5I16A 4RESB 2WZ5A 1WIUA 1OGAE 4H4NA 5D96C 4M1CC 2Z31D 4HH9B 5EC1A 4ICWA 2CIIA 4R7DA 4X6CA 3MACH 1TZHA 4KO6A 1GW0A 3CLEH 4LPYA 4KX8A 5EB9A 3GMQB 2K9UA 2V0AA 4XCEA 1JL8A 3D4ZA 1E5YA 2E7CA 5FPIA 4NCDA 5AVSB 4NSKA 4D0BA 2DQEH 5KW9H 3ECUA 2DOCA 3PWJB 4AGOA 5GRZA 4QCIB 3DO7A 4PD4J 3FRPA 3R18A 4ODWB 1JZGA 2QFRA 1CN4A 2Z6FA 4HK0B 3DXAD 2BSTA 1NFAA 4ZW5A 3PQYE 5KAQG 1X9UA 3GHPA 5GS0D 4RGNC 4Y4FB 1I53A 2D2OA 1O0VA 1FIGL 4DVRH 5EF3A 3EDKA 1A7NL 5BO1H 2X5PA 4W9CC 5H37H 1GGCL 2DQUH 2H8PB 3KL3A 3B7TA 3NCJL 3PGCA 4B41A 1ZJAA 4J12A 2IDFA 4XMVA 1NCJA 2DLGA 4HKBB 4I3SL 4RZCA 5DHVA 2ZD0A 1YEDA 1TTRA 1A8JH 4B96A 2WZAA 1AS6A 1AHMA 1E27B 4B9FA 2V17H 1UA6L 5DS8B 5IQ9B 3C9NB 5JPMA 4G6MH 3FO0H 1M3IA 3ZHKA 4LHQB 4P5TB 5EA0L 2BLFA 4JO2L 1UWFA 5DQDH 1NCAH 2ADIA 2XZCH 4L29A 5DVMA 2W9EH 2D7PA 3AM8C 2VQUA 1Y6NR 3BQVA 4N8VB 5G4NA 2RQEA 3W39B 4MYPA 3RWJA 4H2AA 3WNPA 1MFCL 4I9XA 5HI3C 3CSPA 3FRPB 3NSDA 4NP4L 2Y5EA 2DBLL 4GRLD 3L3HA 1T1ZA 2IGLA 2YJLA 4F33A 3RA7H 4N0FA 3T2PA 1YEHL 3OTTA 3SDAD 3WEOA 1KB9K 4H0HB 1T4KA 4DKAA 2PO6A 4I2XE 4RWYH 3RPKA 1BFVH 1KV3A 3SGKC 4GAGH 1FYTD 1WICA 2V5RA 3DV4A 1I3UA 1DDHA 1E4JA 4ZYKA 1YMHB 5CJXA 3T1FB 2Y5TA 4MNQD 1BYOA 3TIDA 4RZCB 4WTQA 3V6OC 1X5MA 2VDQL 3AS1A 3ZHFA 4YS4A 4DKTA 2Q2EB 1QSFD 4HJ0D 1TYRA 3UPCA 4G8GD 3TH4T 5C0DA 2VDRB 2CWRA 3CMOL 3IPFA 4DKFL 3JWNC 5AD0B 3T1WA 3U2JA 3ZKXC 2WNKA 1RUML 1D5BB 4JPWL 3HC4L 5MEPB 2ZONA 5IG7B 2CO3A 3M86A 3TN0A 2KDYA 3ZHDA 4MCMA 2XWCA 4IBZA 1SDYA 3L5WA 5FV2A 3QNFA 1EBPA 1M71B 3D9AH 4IK6A 3NK3A 4KVPA 5TDPB 2CXKA 2AZAA 3PDOB 4FKKA 3QEQD 4JO1L 1FGVH 4NJ9L 4ZAKD 5IFAL 5KG9B 1FGVL 2NY6D 3FHQA 2MHAB 4I1PA 3A6CH 3CDFA 2ENSA 3E8VA 4HPOH 4NQQA 1FLRL 2YR3A 3F6JA 4U1HA 5CZKA 3SB3A 3CC5B 3S3PA 1NOAA 2YUWA 1MY5A 3LOWA 5BVJA 1T0MB 4IDJL 4GT7A 3RWCB 1HHHA 2DD8L 2JV6A 4KK8D 1OP9A 1J18A 1F58L 1EUTA 1KLUA 1FFOB 1IM9B 1LEGB 1KCLA 5L4IA 4G59C 3MNWA 4GQZA 4LIQH 4Z0BH 3M1BA 3BVVA 1UD2A 3FT4B 4FTVE 4Q7DA 3KYMB 4XR8C 1LP9A 4O2EA 4WFHD 4AUUA 5I6OA 4PJDE 4KHTH 4S2SB 5ES4B 3R06A 4ODBD 5FYJU 3L3IB 3NABL 4TV3A 5B4MC 1RUAH 5IG7A 2E6QA 3QDGA 3RGVB 3ERXA 1U3HA 1TVDA 4GRMA 4ZUVB 2R0LL 1NEPA 1XGTA 3GIVB 4RZKA 3O11A 1DEEB 3IDYB 5IUSA 2DI8A 4HKZB 1A1MB 2VC2B 4GS7B 5CO1A 1DLFH 2EDTA 4XPAH 2Z1KA 4KK9D 3O3EB 1MCIA 2FBOJ 1NGYA 5HHNA 2R8SL 2GSGB 3NIDE 4APQC 2A74C 4HS6A 4WU7B 4JRXD 4J3TA 3SKMB 3L7FB 4TUKH 2A6KA 3LZPA 4JPWH 5F1IA 1TJGH 3CN2A 3FQ2A 1JOIA 2AMGA 2YRPA 2X1XR 4XP1H 1NL0H 2P5EE 3MRFA 1KPRB 4YVNA 4M48L 3NGBB 3QCVL 1X6LA 1BVNT 4AIEA 2C3WA 2DLFL 5EA0H 3ME0A 1FFOA 5BMFH 3JTBA 5BRZE 3ZT5A 4Y5VA 4R97B 3HLKA 4TQEH 5BZXA 1FWXA 3O6MH 4R2GB 4WTZA 1X9RA 4JG5A 4AQEA 2G2NA 4IRSA 5D1XA 1MWAB 4Z7QB 3LS5H 4DGWC 4QHLB 1ZPLA 3PPEA 1U8KB 1K8IB 3CDGB 1NPNA 3LD8C 4V2BA 4BGDA 4GRWB 2ZNXA 2EH7H 4KVCH 4KAQL 5CGMA 4KQ0A 4GKLA 1NPUA 1N10A 1XGTB 3GIVA 4G9FB 4WI2A 5L8KB 4PJ5A 4WKZB 3I02B 4X8CA 2FNBA 2VJ0A 3GM8A 4WKXA 1YAIA 4GRLA 2NY7L 3FN0H 1KTLB 2ZPKL 4ZO9A 4A2GA 3LEXA 1Y7VA 4R0LC 5JNYA 3UERA 3L7FA 4OF3A 3DVGB 3ZZLA 2YSTA 4U3CA 1HHKB 1JPEA 2VJ8A 4O02B 1L9TA 4YZWA 4UT6A 5C0GB 3DGGA 4O9HL 7FABL 2F8VA 1SJMA 3MLYH 4PJEF 4YWGL 2XKUA 3LQAC 3U9PL 2BJMH 1I1FA 1UWEH 3HPLB 2XRAL 2FB4H 1Q72H 4OFYD 4XMTA 1GW6A 1A1NB 3LZNA 4P05A 4ZPVB 1IRAY 4YZFF 4K3HA 4NQCA 4KFMA 1GGCH 2DQUL 4HSQA 1TCRB 3U9UB 4JHWH 2QLYA 4PS3A 1MPAL 5EWIL 2A3TA 3APCA 3S35X 5I8CA 5KVGH 1JXKA 1SNRA 1QRND 3QZWA 4DETA 1ZVSA 4LSVL 3BH8B 2W07A 1MIMH 1P4IH 3OKYA 2F7QA 5C09B 2CO6A 5TGBA 1IQDA 4BXSV 5J4MA 3K6SB 4CDHA 4DIXA 4KJQC 5HYJA 2FGWL 3V0AC 5I1DB 5ADOH 4YNYB 4Q6IA 5AW8B 5T3ZD 2XPGA 4KZ0A 3EYVA 1WZAA 4FTVA 1BWMA 3IMVA 4YDIL 4UQBA 15C8L 1TVHB 2UXGA 2YMXH 3HC4H 1GGIL 2XWTB 3BAIA 2XKSA 3O8XB 2CRMA 1X7TA 2DIJA 3WO3B 2Q6WA 1SBBA 3MI6A 4Q9RL 3GMQA 5I15H 2A9BA 3Q2CA 4TL5A 1N3NB 3ZE1B 1QI3A 4CC0A 1MJUL 2YSSA 1AO7E 4M5TA 2XQBL 5HHMB 3QZMA 1V55B 5T1LD 4OZHE 3BKJH 3GSWB 1S9KC 1MCOL 3QUYC 5KYXB 4JL2A 4U1KB 4AH2A 2YRLA 5C6TL 4PY8J 3TBYA 1KZYA 2HFFA 3VGAB 4U3SA 3WAKA 3Q8BA 2H3NB 4M1DH 1KXHA 3TF4A 3D0LB 4P2QD 1CO1A 2JKLA 2BSTB 3S88H 1NUGA 4Q6IC 2BOBA 3NSJA 3BZEA 1WGOA 1VF5C 2IGFH 2Z31B 3ABGA 1EHKB 2WTOA 4HHAA 3RY6A 1AE6L 2AI0H 5KSUA 1BQLH 2OYKA 5HYJB 3PF2A 2OTWA 4NO0D 5E5RB 1DE4B 4LLQA 3JUYA 2R39A 4G8AC 4N25A 5IHZB 3EDEA 4PGDA 5J3HC 2FYYA 4GQPH 4UAOC 2E8ZA 3NOIA 1VACB 3QRGL 1ODUA 3F5WB 1VHPA 2WQAA 3TJEL 2ESVE 1AXTL 4M61A 4M3HA 1P4LB 1H6EA 1TFHA 1UATA 2E9WA 2BRRH 4HV8B 5MP6L 2J2ZB 1KBKA 2R0WH 4M3JA 3EYQD 1OQXA 4CNIB 1JPTH 3ZE0E 2EDNA 3ARDD 1LTXA 3WY4A 4N8VA 1IGIH 1PEWA 3M17A 2IAAC 2HFEA 1KEGL 4XNYH 4Z77B 3WG7B 4TNWF 4JS7A 4I13B 4QF1A 4FHJA 3FFCB 3H3PH 2JF1A 3AY2A 4UT9L 1MCRA 4AV4A 4J2XA 3ZZQA 5CEYB 1YEWA 5C2UB 5ADPL 4N2FA 2ZCKH 3VD7A 4UTAA 3QWOB 1XGYL 3AQXA 2VXUL 4RDBA 4QRPB 1B4LA 1A6TB 1DBKL 1AD9B 2YGOA 1XF2B 3BQUB 4XXDB 4J3OG 4LSTL 1LEIA 3KZ8A 2QSTA 4UTAL 1LO0H 4LFHG 4RMQA 8PAZA 5IWLA 2R1XB 3EFFB 1OK0A 4P9MH 3RWHA 4RDQG 4UOW1 4UZSA 1M1SA 3L5HA 5C6TH 1JPSL 4BQ8A 1NGZB 4FLSA 2UV3A 1CDGA 3F12B 3VFWB 5H37G 2X87A 2BC4A 2VXQA 4FP8H 4Q9QH 1A3RL 1J8SA 4LL4A 3H8NA 3OZLA 3LYRA 5I8EA 4C83B 1XF4B 3CG8A 1IM9D 2BOLA 4WFGE 3V0EA 1B3JA 4YSAA 4OKVA 4ENZA 3V7MA 4LPWA 4JDEB 4OFYA 3ZMNA 2CUHA 3QYNA 2FZ3A 2OQJA 4Z77A 3QUZC 1SLUA 5CU9A 1AQKL 1D2PA 2GITB 2DV6A 1R5IB 5FK9A 1NGWA 2EXTA 1D5IL 3I6KA 3TESA 3ULVL 4KRLB 3TT3H 1CFMA 1JZDC 5AVYB 1P6WA 2P3YA 2PCPB 4MMYA 4CJ1A 1OPGL 4MD4B 1PPIA 1XGQA 2VXVL 4BQBA 1PCXA 1J1PH 4RMSA 5JDJA 1I3GH 5I28A 2CRIA 4Y2DD 2IMNA 3QG7H 5IQLA 4N2DA 2AZUA 4LCWD 2VXTL 3GKZA 3LKPB 4RFNC 3TURA 2KUTA 3FT9A 1CDCA 3EGXB 1JXFA 1THCA 1OAZL 2APXA 5BZZA 3SY0B 3TBBA 3IDJA 2ZXCA 2VXSH 3IDIA 1MFBH 2AP2A 1QOKA 2AJUL 2KL6A 5MERB 4JVPA 4NJAL 4FXTA 4P5TC 4AOFA 1FVEB 4E9SA 1I8IA 1HWWA 1OAYL 1TLMA 2EZ0D 2WLIA 3II3A 2WBJD 3V5KB 1JPFA 3BEVB 1A66A 1O5PA 5GGSB 5EOCH 4R2GD 2CJ3A 4ZZKA 3I85A 1UACH 1NC4D 2OMVB 4NQEE 5JW3L 3KL0A 3RPBA 5CP3A 1VFBB 5AZ2H 4DN3L 1P1ZB 3ULUF 1UWGL 2ADIB 4MGXA 5C9JA 3TZVB 1MRFH 3TEWA 4CJ0A 2FLMA 3K0YA 2HJKA 4RX4A 1B0IA 2RQ8A 4MX7A 4LCUB 2WTRA 4FS0A 5ALCH 4ANVA 5LGJB 3VXQA 2AVGA 1EFXB 1MQKL 1ZVNA 4XB3A 2QQLL 2ZUSA 3ULVF 1I7UA 2PCXA 5DFTA 3L1EA 1YAZA 1T22B 2DMBA 1YY9D 3QEHA 3MOBH 4GAAA 1AXIB 5C0CE 4TQEL 1MKFA 1T7YA 3ZSSA 1F2QA 1M53A 2GAZB 2G30A 1BLIA 1T04B 1TMQA 7FABH 4OGYH 5B39G 5I18H 3D3VB 5LUMA 4CU8A 3NSYA 3B7SA 1A47A 1YN7A 3QJHA 4P23C 1YPZB 3DO4A 4FA7B 2ZXBA 4YDKH 5AOLA 2P5EA 4W9ZA 3RZCD 1JMXA 4R7LA 4FNLH 3AT0A 5JORB 4ZNEA 1KXQE 1AKJB 5MI0B 1BLNB 5E23A 3WKNA 3NG5A 1GKOA 4AYFB 3REWA 5AL0A 1JF6A 1DUYB 4Y4KB 2JELH 2YXWA 1JZEA 2BIQA 5DS1A 3HZMA 4M6AA 4L4TE 2CJTA 2H0JA 1L9SA 2F54E 4Z7VB 5E6IC 4PGBB 1OZTG 2ZG3A 1FPTL 3B5HA 2VDPL 5DZLA 2EE3A 2ZWKA 3V0FA 5HPMB 2A83B 3QJFB 4LARL 3U48A 4D8PB 4ERSL 2WB1A 2CGRL 3FN3A 2J56A 4UQAA 4Q89A 3PREA 1AG0A 3QUHA 2WYZA 1ODAA 2A38A 5F72S 5AUMB 2OK0L 2ROXA 4AE1A 4G9FA 4Q56A 3PFQA 4KKAD 3RX9A 3GXNA 3PRZA 3H55A 1IGYB 1NL0L 5D4IA 1G7LA 3WKPA 4N85A 3QC5X 1U8QA 4NN6C 4ODSL 4QLWA 2HRGA 5HDBF 1EEYA 2XZZA 4G9DA 4Z3HA 4JPKH 3DJZA 3R0NA 3D33A 3OF6D 2IDTA 4N5EC 2ADJA 1CFVL 2F8IA 5DWUL 3HMWH 4GSQA 4BE6A 3KYMA 3C60B 2NYKA 3IAPA 3DX6A 4GW1B 3KPSA 5D1ZD 3KYOB 1GSKA 2GK2A 1UKQA 2XX1A 4JFYA 5C0FB 1IC0A 5ISZE 3JTSB 4J28A 5IFJB 4P9HC 2CG9X 1TOXA 3V7AG 2PR4L 1SEQH 2JSFA 2XHNA 3IM1A 5E70A 5F6IC 3L81A 3NRFA 1S9YB 1SN2A 1V54B 2IJ0C 1J0JA 4PGCB 4QUOA 5GRJL 1HNGA 4Y5XB 3MNVA 2XLLA 1OO2A 3QIWA 3H0TB 5HHNB 1NCGA 4MQ7A 2WKGA 3O81A 2V8MA 4IHBA 2W60B 4PBDA 2VDNH 3UTTA 2OMWB 3C6LC 3NDYE 5AUMA 3N50A 5FW7A 2IVFC 1KXTA 1M7IA 4N2AA 5I30H 4QEGA 1OE1A 3PDDA 5DK2A 4H26B 1DL7L 4MD0A 2J88H 1I1YA 4KC3B 1LNUA 3BP5A 3HNTL 1HS6A 1P6AB 4XMXA 5GSRA 2CDGB 5DK3A 3ISYA 5DQJA 5GRVK 2VDPH 3RAJL 1Z6JT 1KJVB 4WV1A 2EILB 5F2FA 5KYYA 2EADA 3UIYA 2YAMA 1TVBA 2RJMA 4QRQA 1HYSD 4JHAL 1A4AA 1MW3A 2PETA 4PJGA 3RPIA 3WENA 1JPGB 2C9XA 5CEZL 1X5AA 2C9AA 2FSEA 4NUGH 2BOCB 5ETUA 1WD9A 1BP3B 3E9TA 5JIIA 5INCB 3AUWB 1ROWA 3SDYH 5SWSE 2NDFA 4Q6KA 2PPEA 4WKZA 3O6FA 3KPSD 4RGND 5D1ZA 4Z95L 4PRDB 3JWNG 4KK6D 3HLAA 3F62A 4D2NA 3V6ZB 1IGIL 3K8LA 1OGAD 3OKDA 1R5VA 3PWNB 2HVJB 5GGRY 1TNMA 1R0AL 4MDIB 2H3XC 1I7RB 5FM5O 5PAZA 3S2AA 1GPOH 2APWA 4BSJA 2A77L 2IPKB 4PY8I 1HHKA 2YAEA 5HVHB 3T4YB 1NICA 2MNJB 1CF1A 1IL1A 1EFXD 2DLIA 5EUKB 4RA3A 5IB4A 4YHKH 4F9PC 4PJDB 1C7TA 3WIHL 4HOZA 3ABMB 4LSRL 5HYQA 5LDSA 4ZK8A 2FYYB 3BWUF 5MENE 4CU6A 2JK5A 1AP2B 3OX8B 3AGWA 4IBQA 3KPPB 3MFFA 4GEJA 4XX1G 1WC7A 1DBBL 2IH9A 3MBEA 5E2JA 4YK4C 2AJXH 3DK2A 4XAWH 2W95A 3VFOB 3S8WA 4Z3JA 4N24A 2XTLA 5AL8A 4KJPC 5I0YA 3VFWA 5TQ2H 1QYGL 4NNPL 4A39A 2WAQA 4PFEA 2VLJD 2PPCA 1IBBA 3BESR 5I1GL 1Z9SA 3BWSA 4PRHA 1PLAA 1Q0EA 4LHUD 2X38A 2G75B 4IOFC 1I85C 3OKOB 2XG4A 1ACYH 1JYWA 1GXEA 1QQDA 2Z7ZA 1YZZA 5J9PA 5D6CA 5F88B 1RI8A 2CU9A 2RFXB 2WBJB 1QI4A 4PY7