1FVDB

X-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
223
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTLYLQMNSLRAEDTAVYYCSRWGGDGFYAMDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA 4D5 FAB (LIGHT CHAIN)
publication title X-ray structures of the antigen-binding domains from three variants of humanized anti-p185HER2 antibody 4D5 and comparison with molecular modeling.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 223
sequence length 223
chains with identical sequence D
ec nomenclature
pdb deposition date 1992-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fvdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fvdB01
2YBRB 4ZDHB 2AV7A 2XACC 3DMMA 3W9EA 4XH2B 3UTZB 3ZE0F 3P4OB 2V5YA 1J8HD 3P11H 2R4RH 3LZFL 5IFAH 2DQUH 1D6EB 3MREA 2FSEB 3EJYC 4NPYB 3PWUB 3D85D 2APWA 2P5ED 5DI8A 5E6IB 1PZ5A 1S7TB 1OGAE 1BREA 3KS0H 1R5WA 2I60H 1MCOL 2VLRB 3F6IA 4WI4A 2IH1A 4HS8H 1RIVL 2OR9H 4HIIB 5CMAB 5JUEL 2ATKA 4FFZH 1DCLA 1C8PA 3GB7A 4MAUH 2B5IC 3SKJL 4YWGH 3E1F1 4WHTB 5E99L 2WWKT 5EU6D 3B5GA 4HWBH 1ORSB 4TVPH 2VABB 1MEXH 1T1ZB 1VFBA 3BGFB 2IGFL 2ORBH 4GS7B 5EU4B 5LAXA 4AEIH 2AAVA 2UWEE 2VZ3A 1YDPA 2AI0L 3EZJB 1I8LA 5B39G 1A1NB 3D39D 1ZT1A 2AJSL 3IXAA 4TQEL 2UZIH 1FORL 2HVKA 3MRPA 3U48A 3QDGB 5C0BD 3VXTA 5ISZB 3PIQA 4ZOAA 1UWGH 2H3NB 4DAGL 3ARDA 1BQSA 1MRCH 1G9NL 5D7IF 2YC1A 3GZKA 2C4XA 4G7YH 3ULUH 3BP6A 1A21A 4ZFGH 4OM0H 2IC2A 3T0AA 3T2QA 2VC2L 2YWZA 3WIFA 4NN6B 1J5OL 5AAWA 4R0LB 3D0LA 5M94B 3PWJA 1TQCB 3VGHA 5IROA 4JM4L 5AD0B 4L29B 3RHWK 1FVCA 4JRYE 2C1PB 4MD4A 1T0MB 1OAQH 5GSVA 4NWUL 3OKEA 1P1ZB 3ZDXF 1ORQB 3DV6A 4EN3D 1TZGL 3BAEH 4RAVB 3L1OH 4ZYKB 4L9LA 4QXTA 5D7JD 4GW5B 1BF2A 3V4VH 2DBLH 3F7PC 3L9RA 4IRSC 1A7QL 1NAMA 5F1NA 3UJIL 3V52H 1QKZH 1RJYA 4M5YH 5C0NC 1UZ6F 5T1LD 1U41A 1MCLA 2HT2C 3HC4L 3ULVC 4GAJL 1GH7A 3MV7E 5DI8B 3CFIC 3LQAH 1FZJA 4R26L 1L0XA 2A9MH 4WV1A 5IW3A 3H42H 3EYQC 2IH1B 1TMCB 2BNQE 5B3JF 4MXVE 4OUOA 2ATKB 3SDDA 5LGHL 1KGCD 1VSCA 4NQXA 3VWKD 4I3SH 5I71B 4XNYL 1ND0B 1ETZA 3BKMH 4BK5A 1K8DB 1J0ZA 4NKOB 1VFBB 3VI4F 2VH5L 4WIQA 5E94A 1N5AA 3SY0A 5E6IC 4XI5C 3Q1SL 2E7BA 5F89A 1CU4H 5BV7L 5CGYD 4D9RD 3T65A 3LMJL 4ONHA 4QRRB 5T5NG 4DKEH 4KKAC 2HVKB 4X99B 1D5XA 3MRPB 3OMZA 5LCVH 3WMSA 4HWZA 2R0ZH 1CL7H 3BGFC 5C3TA 4ODTH 3RZWA 4AYFA 4GS7C 4N1EA 5IFHH 4XBPA 3LSOA 5KJRL 5MEPA 3O4LA 1CD1A 5DQ9A 4Y1AD 4XPTH 2DQGH 2FIRT 3GMOB 3RWJB 2ATPA 1CLOL 4LRNH 3UZEA 3VFWB 4NZDA 5J1TC 5C0AA 5CKAA 3D0LB 3MROA 3PWJB 4ZD3H 5IKCB 3QXAA 5DYOA 3UTQA 4XHJD 3O41A 3EOBB 1YEFH 1FVCB 3T0EE 4ZODA 1HDMB 5GSVB 4PB0L 3RNQA 2YN5A 1QSED 3OKEB 3MRMA 1HQ4A 4LIQE 3DV6B 2BVQB 1A5FH 4CDHA 5ICYA 2OMNA 2BY2A 4Z18A 2VDNH 3NIGE 1G7JA 3C5ZA 1OAXH 4HK3J 4Z7VB 3EHBD 4NN6C 1W8OA 3UBXG 4R0LC 3TO4B 1NAMB 5GZOD 4EOWL 1NGZA 2F9BT 1RJYB 1TQCC 3QCVL 5T5NF 1DBBH 1MREH 3MLVH 5CKGA 1JFQH 2D9QB 4KAQL 4U6VL 1DBMH 5DJ6A 2D0GA 4RRPA 4WV1B 4GBXD 3MRLB 1X5AA 5J12B 2NY7H 2NMSA 4PJXA 3SDDB 1A9BA 5L8LB 4LVHB 4G80B 3DSNA 4FP8L 5GGUB 3JSSA 4O2EB 4UB0H 1AGEB 1L7IH 3TYGH 4EVNA 4C56A 4UDUA 4PG9B 2YD1A 3KJ4B 3SBWA 4QYOB 2NYYC 1J0JA 2HFEA 3HMXH 3IS1X 4S1RL 3V6OA 1HIML 4GAYB 4RA0C 4GSDL 5DEFA 3T65B 4HIJB 4PRHB 2ADIA 5DD6A 3OSKA 1UC6A 2EDWA 3KYOB 4YZFE 3VI3E 5I71C 3S4SA 5EUOF 4WEBH 4LIQL 5IBTL 1ONQB 1KPRB 4YBHA 1UVQB 4X6FB 2FCBA 3MRGA 4KXZH 5DK2A 3UJJL 3LSOB 1N6QH 5ADOL 3QG7H 5MEPB 5JOPD 4EBQH 1CD1B 2DQCL 1XH3A 5GGRB 8FABA 1DFBL 4PY8J 5TE6H 2YKLL 3LPWA 4P5MA 4NKMA 2EDJA 2X4TB 3H2WA 3MROB 4J3UA 3GHEH 2FZ3A 4L4JA 1KJMA 3HG1D 5DYOB 2VRAA 3N1FC 3O41B 5J06A 5EBMA 4JFHD 5B3NA 3FQNA 4P2QA 4YNYB 5GGSY 4R7DA 2R2BA 4CVZA 1HQ4B 3QDME 1G7IA 3AS3A 1JK8A 1NL0L 5DTFB 2P8MA 3C5ZB 2DQHH 1M05B 2PO6A 4G6FD 5J3HD 4HS6A 4OBRA 3HUJE 2M1KA 4GRLA 4OLWL 3S34L 3R06A 1NGZB 3MRHB 4X6DE 1T7ZA 2ERJB 3DI3B 1D6VL 1A6VH 1VPOL 4J6RH 5J7CC 3CFJB 3DTXB 1P84J 3GO1H 1FCCA 4K7FA 4XX1G 3EYOB 5CFHA 3RL2A 5DJ6B 3LKPB 2LVCA 1BFOA 4UAOB 1QBLL 1SY6H 3IFPB 2ED7A 2FLBT 4HPYH 3BPNC 4HUXA 4XP6L 4D0BA 1KIPA 4PJ8D 3U0PA 1FG2A 3VXSD 3TO4C 3EGSA 3MJ9A 4NT6A 4EUPG 4U7SA 3QEUB 5DFTA 2XTJD 3WKML 4HGWB 4AMKL 1XMWA 3DO7A 4FG6D 4EVNB 4NDMA 5LGKA 1CTNA 5TE7L 5CUSH 1C5BL 2R1XA 5EC2A 4WV1C 4LLWA 1GPOL 1JZ5A 1AXSB 3VFRA 2ADIB 5DD6B 2X1QA 5J12C 3ZYIA 3ARYA 4IOFC 3HE6D 3SDDC 4XMKH 4LVHC 1WFUA 3QIUA 3AFLA 2XY2A 3S4SB 1NGXA 4JY5H 2QSCH 2BOCA 1KTDB 4PS4H 4H88L 1RULL 3MRGB 5DK2B 1PQZA 4XGZA 2JJUA 2XYCA 3KJ4C 2CRIA 3TN0A 1OW0C 5MENE 4DKDC 5ERWA 1XH3B 3KPRD 5DJDB 2B1AH 4OD2A 1F6LL 2NX5E 1SQ2N 2DIAA 4NOFA 2AJVH 1YC7A 2VLKB 5JMOC 2XN9A 2FWOA 1G6RA 3STZA 4YDKH 2ZG3A 5C08A 5DHXB 4P2QB 3BESR 2R2BB 4CVZB 1GOFA 2A77H 3MA9L 2NZ9D 2X9XA 4PY7B 1G7IB 1U42A 5TQ0L 4U1MA 1YY8A 4OLXH 3MJ8A 1GZQA 1OARH 4DTGL 1QLEH 1EVTC 1Y18B 1F90L 1Q9OA 3OKNA 3R06B 5I1EH 3SJVA 4GG6B 1UJTA 4I48A 1OB1A 4PJCA 4M61A 1Q1JL 1I1FA 4JLRB 1RIUL 3MBXL 1MHPL 3RL2B 2O26U 2DICA 1KLUA 3OAUH 4H26A 3KAAA 5EDXA 3W2DL 5L9DL 3FMGL 3BDBA 1BFOB 4WW2F 1V3KA 4WJ5A 2VR4A 1JZ7A 3ZSTA 1H8OA 3C5ZC 4OF0A 4D0BB 4NQDA 1UJ3A 3V0VA 1KIPB 2XFXA 3SKUD 1FG2B 5DZLA 4C4KT 3EGSB 4NT6B 2ERJC 4QRPA 5EU7E 1I1AD 4M9PA 4CMHC 1A7NH 4ISVB 4YHMH 4NDMB 1X5HA 4F2MA 3WYRA 2R1XB 1UEMA 5EC2B 4LLWB 4UAOC 1XGRA 1P6AB 4LHJB 4OZHA 3VFRB 1TENA 4GKNA 5GS2H 3GBNL 2CKBA 1GAFH 3NFNA 4Y4KA 4KV5F 4PBXA 4FHBD 3GHBH 3CPLB 1MCNA 1P7QB 5GRVK 3LY6A 2BOCB 3DIFB 4L4TA 1GL4B 2AERT 1F3JB 4JM2B 2YD3A 4LCCA 1PQZB 4YHLH 2D03L 1ZA3A 2R0KL 1MFBL 3NTCL 5AAMA 2XY1A 3SBWC 1A6AB 4RGND 4MNHA 3VH8A 3VGGA 4OD2B 1U8QA 2DD8L 4HJ0D 1TIUA 3QHZL 2HRLA 1RZJL 1MIML 1NAMH 3JWDC 5IJVB 1I7ZA 4O2FA 4PJHF 2XN9B 2FWOB 1FGNH 3G6JE 3GSOB 1XIWA 15C8L 1UM5H 5TFSH 2XWBA 5C2BL 1JWMA 1YEEH 2CDEA 3CK0L 2EDKA 4JZJA 5HGAB 4KRMB 2V2TA 1NFDA 1QD0A 5I76A 2BRQA 5SWSE 3NZHL 3KPOB 4U1MB 1MF2H 2GCYB 1I3GL 1GZQB 3KYKH 4FXGA 5EU3B 5LQBL 4MAYA 3W0WD 2HG5B 3HC0B 1Q9OB 3SJVB 4EUPB 5EBLB 2PW2A 1OB1B 3AM8A 4PJCB 1I1FB 1U3YA 4JPIA 3OR6B 4G8GD 2JJSC 3ZTJG 1KULA 4KVNH 4W6WB 1AQDA 1S7QA 4X6EA 3ZYZA 1KLUB 4R96A 3ARVA 4AH2A 1MHHA 1XGTA 3RUGE 3H9HB 3QULA 1OP9A 3KNBA 3U4EB 3PWPE 1LO0L 3L3GB 4QWWC 3MRJA 4UDTA 5HVWA 2P24A 5GRUH 3V0VB 5LBSH 2XFXB 4XC3L 2EXWC 4R2GD 3DNKA 3ZKMD 3BFOA 3VXRE 1NMAL 2C26A 2ZPKH 1QUNA 5F9WB 4NHCH 3D0VB 5IFJA 1DQDH 4LCUA 5HGHA 1WWWX 5HJ3B 3I6GB 3O9WA 1AH1A 4L9DA 1F58H 2BVTA 1XGRB 3BVNB 4OZHB 3KPSA 5GRXG 4PJFB 4PJEA 3QSKB 4JRXA 4EI6B 3NFNB 4Y4KB 4JY4B 2HRPL 4JFOB 1ZHKA 5E4EB 4L4TB 4JFFA 1VDGA 5TE4L 4H8WC 3OF6D 4LCCB 2EDYA 5C07E 3SE8L 2EE6A 4QRQA 1CL7I 5EB9A 4EDWH 1L0YA 3BH8B 2M8XA 3L3KB 3QUKA 4PLNC 1DQQA 3FQTA 1FNGA 1CVSC 2A6JB 4JN2B 1I7ZB 3CH8A 4YK4B 4QKXB 5I1DA 2X10A 4JM2C 5DQDH 5FYJE 2XWBB 3LDBB 4NGHH 1JWMB 3RVUD 1X4YA 1PJ9A 3K2MC 5I76B 3QI9A 1S7UB 5IVNA 3BJ91 4CNIA 2NW3A 3C6SB 4XWGL 5D7KD 4MAYB 5F96L 3DX8A 4HBCH 3CU1A 4WNQB 1EHLH 3NGBB 5DS8B 3FT4A 1L4IA 4HKJB 1LDPH 2F58H 4PP2A 5C6TL 1S7QB 1EMTH 5M95B 4R96B 4P2OD 4AH2B 1MHHB 1XGTB 4JN1L 3QULB 4M7LH 3KNBB 3RKDC 2ZJSL 3DWTA 3T1FA 3WFDL 3HI6L 3JWDH 3ZT7A 1T3FB 4QXUH 2CPCA 4XRCB 5F70A 2VXTL 5JTWA 1UGNA 2PTTA 1CXIA 1A6UL 2QQKH 4JFEE 5IFJB 1PW3A 1WZMA 2EC9T 4LCUB 5HGHB 5E2JA 1GGIH 2GY5A 1WBXB 4FFVD 1KTLA 4FQ1H 3I6LE 4GXUN 3W11C 3TZVA 4Z77A 3JWOC 4JRXB 5FYJL 3N9GH 5EO1B 1NCAL 5CJ8A 4JDZB 3WCYA 1HOCA 1ZHKB 4TOYL 4CKVX 1P4BH 1AQKL 4LU5H 4FQXA 4JO2L 3E6HA 3WJJA 5F9WC 4BQ6A 4WO4D 1UB5A 3QO0A 1HWHB 1PVHA 4NRXB 1HYSC 4RQQA 4KXZI 1FBIL 2AS5M 1J8HE 3UYRH 1DQQB 1U8IB 5KSAD 4XCCL 3FQTB 1FNGB 1CGYA 5ETUA 5C8JA 4FQLH 4PGDA 5F9OH 4Y4KC 3JWNC 2P5EE 3DX7B 3BZ4B 4BH7B 1ZA6B 3BT2H 3T0DA 5E4EC 1ZHNA 4DZ8A 1U6AL 1JZ4A 4XVSH 5FOBA 1MAJA 3O0RL 4LCCC 1H3VA 1UXWA 1T20A 3P77B 4YAQA 4IM8A 1I3VA 3ZLQC 3P0GB 4MWFA 5EZJA 2D7OA 5F7MC 1BIHA 3F7YA 3ULUF 1FGVH 2XQBH 5EU6E 4JG0H 3G5VB 3MJ9H 4WTWA 4NC2B 4QTHB 4YK4C 2BP3A 4J3WA 1MRDL 4Y2DD 1N7MH 4H8WH 5FGRA 4PP2B 2EDXA 2JELH 5DUPH 5MERA 3LDBC 4NCC1 3RWHB 1KCLA 3B9VA 3D39E 4HCRL 3UAJD 2E7MA 5DLML 5D7IE 4PJ5B 4PLJC 4K9EH 2R4SL 5C0BE 3TPUA 3KHQA 4QGYA 4MAYC 5DC0A 2EXYD 4X9IA 4E41A 3T1WA 3HCVA 3NGBC 3AM8C 4PPTA 1F4WL 4WTXA 2JB5H 2RGSA 4XP4L 3QUYD 1F8TH 3GK8L 2P45B 1AE6H 3CXDH 2L7UA 4HIXH 3FB8A 2ZNWA 4X7TA 1M7IA 2QADB 1OD9A 2HVJA 2J4WH 4Z77B 2JJWA 2EICA 3ARBD 4CADA 1QLRA 3PHQA 1ZSDA 4YXLH 5A43C 1EJ6A 4HGMA 1KC5L 4J1UB 1KFAL 5CBEB 1X5YA 2JB6A 3QO0B 1T66D 3S9DB 3HZVB 2ZOKA 4RQQB 3CH1A 2WNGA 4JPWL 4X80L 3DXAD 4K8RC 1JF6A 5HTSA 3CIQA 3EJYD 5C8JB 4PGDB 2I26N 4LSTL 3P9LB 1VADB 4EUPH 1MVUB 2BJMH 4X0KA 2VDOL 1DLHA 3NCBB 1RSFA 4M5ZH 1JUFA 3P4NA 5HGBA 4XP5L 5FCUL 1MFDH 4FZ8H 1SBSL 2GW5A 4PTUA 1U8NA 4QXWA 2MHAB 4OIIL 4U05A 1HKLL 4YAQB 4G7VH 3C87A 1S9VA 2WM0A 4L3AA 2X70A 2YD7A 4MWFB 2DMBA 4QXGL 3UDWA 1KGCE 4RMVA 3TBYA 4GQ9L 4O5LH 5HHMD 4YHNB 3ULSA 1QYGH 3MYJA 1FNAA 3SGDH 1CE1L 3U30B 2ADFL 2OJZH 4NQED 1TVHA 5HYJD 5JQ6L 1T7VA 4RBPK 4Z0BH 4D9RE 4AZ8A 1SEQH 3RAJL 1RHFA 2YN3A 1QSFA 2EKSB 2Z4QB 3B9KB 1CWVA 2DAVA 1ZGLA 5IW1A 3TPUB 1EFXA 1Z2KA 3QDHA 2Q8AH 4P4KA 2CKBH 1EA9C 4OGYL 4MCYB 3O8XD 3V7MA 3CZFA 4CU7A 1CK0H 4JG1H 1EGJA 1TETL 5C9KA 4HUWB 1A2YA 1HCVA 1IKNC 1JTOA 4Y1AE 3SGKC 2X4QB 2ZOLB 4JFZL 4P48A 3IB4A 2LAGB 2J6EL 4OZIF 4G9DB 1M7IB 3D25A 4NQVB 3BN9D 3T77B 3NCYS 4RWYL 2Z35B 2QQQA 1FIGL 2QL1A 1WTLA 1S7RA 2HVJB 5FDWA 2A0LC 5ALCH 2VDMH 5F7EH 3OPZL 3JUZA 4MJIB 4LLDA 2IPUG 1Y0LA 1FNSL 3K3QA 4CADB 2P5WB 4HXAL 3MO1A 3O2VL 3PHQB 1S5HB 3QEHB 2AK1H 1GJIA 1QSEE 5C1MB 3N1QC 3CLEH 4OZGE 3ZDZF 4K94C 1IBGL 3QIWA 4ZAKB 1LE5B 2Y07L 5ABDE 3E3QE 4LHUA 4B41A 1EXUB 4J2XA 2RFXB 3KPPB 1S9WA 1T1WA 1XGUA 3VA6A 3CH1B 3BWUC 2QADC 3LRGA 2IMMA 1IARB 2LAAA 3TFKC 4LGRB 1LO5B 4X8JB 4ZUTB 3TBVA 5IMMA 3KR3L 3MUGA 5C0ND 5C70A 5TQ2H 4ZQKA 3TGXA 2HT2D 2KH2B 4BSVA 1ED3A 3ULVD 1P4IL 2B4CL 1IRAY 4X0KB 5CILL 1DLHB 4OD3L 4W70A 1JUFB 4MYWB 4PTUB 5I1IL 5E8DL 3WJJC 4I18A 3EYQD 5IB3A 3EO9H 3BRGC 1WGOA 3GSQA 4X4ME 3RVWC 1W2KT 4XBEH 1JWUA 4NO0D 3TBYB 1T80A 2K7QA 3ULSB 1CLYL 3MYJB 5IHLB 4G5ZH 2EYRA 1V5JA 2R56L 4M8QA 5IT2H 12E8L 3CFBA 3IDMB 4N0YH 1CQYA 5FHBL 1ZHBB 2F5AL 1QFWM 2HTKD 2BCKB 1QSFB 1HI6B 4K8RH 1GGBH 5I9QB 1RFDH 3STBA 1A6PA 1A1OA 3TVMA 4P4KB 3NA4A 1JNLL 3BP7A 3H7BA 3U30C 3HR5A 1NCBH 1IM9B 4MNGB 3Q48A 1A2YB 3MLYL 1C08A 5JOPE 2W9EH 3FN0H 1GXEA 4F9PA 4O58L 3REWA 2EDOA 4LVEA 1IQDA 3TIDA 4JGMA 3D25B 4QHNB 5EO9A 3B9KC 1UM6L 5J11B 4Y7MA 3LOWA 3SDXA 4MDJB 3CDFA 4KGJA 3SGEH 5ISZD 2DWDB 4JFDB 5FDWB 3HG1E 1OGAA 4LLDB 4KKBD 1Y0LB 5DVMA 4JFHE 5EOQH 4LDOB 4BSJA 1I4FA 4ZO7A 2FD6L 2FHFA 3B8SA 3PWLA 4L3EA 3ZL4L 4LHUB 5DUBB 3IDUA 4CVXA 1KACB 1I7RB 2EYSB 4JGUA 3WE6A 3ARFC 5DD0H 5JW4Q 3R1GH 3BIBX 3UJTH 1KJ2A 1QA9B 1MIEH 2ESVD 1R3IL 4Y2OA 3MUGB 2HKHL 2Y23A 2UWEA 2XI9A 3HN3A 4Y8DC 3EYFA 2EDQA 1ED3B 5E56A 2XA8L 4DUWA 5ESQB 5CGMA 1AO7B 3O6KL 1I85A 3DARA 2JJVA 4ZAKC 1I9IL 2XXCB 1N8ZB 3JUYA 3LB6C 1HINH 5KANG 1TJIH 4XNXL 2D4FA 5H2BB 4A2MA 3VXSE 1IMHC 1QBBA 3IJYB 5BRZD 4BQCA 2XTJE 3FO2A 2JTDA 4F57H 2MKLC 2AABH 4OF6A 5CBAB 3QRGL 3ZDYE 2AGJH 2EYRB 4M8QB 4ZTOL 3OHXA 4K94H 3G08B 3QH3A 5BCAA 5JW4N 3QA3A 4QHLA 3UPRB 1U92A 3T4AA 4JQXA 4ZTPL 3NIDF 3V4UL 5ENWB 3RNKB 3UDWC 1HHJB 3TVMB 2V17H 4JRYA 4TSAH 1FCGA 2XZCL 1HH9B 5TGBA 5ESVA 3H7BB 3HR5B 4X6CA 3KYAA 4BZ1H 3L3HA 5JXAL 4F7EA 3N1PC 3OKKB 2WSKA 1E28B 1LVEA 3DUSA 5CAYB 1ZV5A 5A16B 1OTUC 1PLGH 3KPRE 3V5DB 2HMIC 3F7VB 4NUGH 4OFDA 1BQLL 4BKLB 2DRUA 5F1KC 1IQDB 2YPLA 3TIDB 4QRRD 3GJFA 3IFNH 1IC7H 3SDXB 5I9QC 4F3FA 4P4KC 5AWNH 1FVEA 2DLTA 2GITA 2R69L 3KYNA 1OGAB 4H5SB 1MPAH 2G9HA 2YEZB 3V6FA 2BNQA 1CR9L 1HH6A 1PGRB 2J1KA 3PWLB 4L3EB 1IGJA 2I5YL 5C0GA 4O00A 1G7QA 1BLNA 3WE6B 5DJ2A 2IAMA 5J11C 1MHCA 1DVFA 3HAEG 2C3VA 1A3QA 2EDLA 5I8OL 1NBYA 1H3PH 2YUXA 4U1JA 5DSCB 3HFML 5JHLL 2B0SL 4P59L 1S9KC 1NCCL 2G75A 4LGSB 4FABL 4OBSA 1MRFL 4NQTA 3RWDA 2ADJA 3ZO0A 7CGTA 2PTVA 4G6MH 4NRYB 2YXMA 4FMFA 4NZRH 1R24B 4NBYB 1E4KC 1S8DA 5JIIA 4XVUC 2NCMA 5AYUL 5KVGH 1Z3GH 3TNMA 3INUL 3WXVH 3MV9E 5D5ME 3WFBH 1M1SA 3TO4D 1BGXL 4YC2B 1YEGL 3GM0A 4X6BA 4IDJL 3FO2B 4X5XA 1JP5A 3O6LL 1DE4A 1U91A 5CJXA 2M2DA 2J8UB 2V9TA 4B53A 3M45A 1FE8L 2GTZA 2Q6WA 2W1NA 3QH3B 4HXBL 3ZHKA 2NY3B 3EFDL 5E24E 4F8QA 4KMLB 5BV7B 3QDAA 1U92B 3KLDA 5F7DA 3LS5H 3T4AB 3OKYA 4MJ5B 4IS6A 4IOFD 4KHXH 4KTEH 5FYKD 3T0EA 4JRYB 3RY6A 4HFUL 5INCB 3QJFA 1AR2A 3MRNB 4X6CB 3U7WL 4WI7A 5DDHA 4HKXA 1FDLH 4M1GL 4F7EB 2VIRA 4M4PA 4YX2H 1RUML 4RGNE 9CGTA 4NQCD 3JZ7A 3K8LA 1IQWH 3MLWL 4PP1C 3NCJH 3CDGA 4PRHD 3FQRA 2YPLB 1ZHLA 3TBWA 3BE1H 3DSFL 3CDCA 1K2DB 1KEMH 5T1DH 1FVEB 4M1DH 3KYNB 3U9UA 3U6RB 5CEZH 2PR4H 2NY4B 1B6DA 2BNQB 3NACH 2DQEL 3TYFA 3CX2A 3QAZB 1IGJB 1NGQH 5E9DD 1RIHH 4TUJA 3IDGB 5E2UH 1G7QB 3BRFA 3B2UC 1OD7A 5DJ2B 5BMFH 2D7MA 1GIGL 2IAMB 4Y16D 1QFUL 4RX4D 1MHCB 5F1OB 5AZEH 1KB5L 1URLA 2C3VB 1WLHA 1NBYB 4U1JB 4NHUA 2BVUA 3SGJA 3D3VD 4XCFL 1LEGA 2G75B 5DT1L 4G8GE 3LPGA 2CO6B 3RWDB 4I13B 5CZVH 2IFFL 4NZTL 1H3TA 1JPSH 5IBUG 5F8QC 1KEGL 4D9QE 1NCDH 2FJHB 5CINL 1OAUH 1WEJH 4JY6A 5EPMB 3TNMB 1W0YT 4GW4A 1IZJA 1MOEA 1UT9A 1M7DA 4PJBB 3NCCB 4X6BB 4X5XB 2CLRA 3ES6A 1Q72H 1K4DB 2UY7A 1DE4B 5T3ZH 4FQQB 4I4WB 1NUFA 5I18L 4Z76B 3SGDI 2Q6WB 3U0WL 1FIEA 1O7VA 5BZDA 3CZJA 3DHJA 4M6NL 3VDBA 2K1MA 4S11A 2UVEA 1QBAA 3EYUL 5F71A 5F7DB 4ZXBA 5K9QG 4IS6B 1H15A 2G2RA 4OCSH 1NGPL 4HWEH 1XF1A 4YC2C 3FQUA 3CX5J 3H3KA 5DZOA 2VDQL 3LVEA 3QDMA 3G04A 5I1KL 4PJXF 4KK6C 5DDHB 4HKXB 2WUBH 2V7NA 2VIRB 2D9CA 2ARJQ 3NAAH 5IVZA 2NY3C 4MX7A 3HUJA 2ZUXA 4MS8C 5KG9B 5BV7C 3CDGB 4H20L 5L2JB 4X6DA 1EHXA 5CSGA 4QT5A 4J23A 2ITDA 3EYVA 3LZFH 1W0WA 4NUJB 3HAEB 3BXNA 3ME0A 3PGFL 4KJQC 1AHWA 3K4ZA 3X13A 4LCIL 3VFVA 1RU9L 4PJAE 3QHFL 3TYFB 2ZSVA 1MCOH 2OL3L 3EDJA 1U8HB 1RIVH 5JUEH 5EOCJ 4I0PA 5D7KE 5HDOA 4OCNC 3BW9A 3K0WA 3V6ZB 3WIHA 4B0MM 3VG9B 1Z0MA 3PP3H 3SKJH 3V7AE 5J9PB 4Z7UB 5E99H 2VLKD 1JF1B 3BZFA 4LPVA 4DOHE 2X7LA 1QRKA 2IGFH 2AXGB 3HC3L 2GK0B 4ZUSB 1FRGL 2AI0H 2Z31D 5SX4H 3GIVA 3QAZC 4CMMB 1ZVSA 4JFQB 4ODUA 5IB5A 1X7QA 3DETD 2AJSH 4U1GB 4QWWD 2NXYB 4JY6B 4TQEH 4X9HA 1FORH 2IAMC 3AMKA 3PXHA 5TF1L 4DAGH 2Q86A 4WWKA 1CDYA 1MJ8L 3ES6B 4LNRA 1BZ7B 1G9NH 5KS9E 1A6ZA 2ED9A 4OJFL 1LP9E 1WISA 4IMLA 5AZ2L 3E6FA 1BEYL 3I02B 1UACL 3TCXA 1J5OH 1OQOA 1NLDL 3U46A 1U9KA 2G2RB 2XKNB 4O2CA 2IADB 3MLRL 2EDRA 3EIFA 5CLWA 2ZUQB 5MEQA 5T33L 4JM4H 3G04B 3MZTA 5J1AB 4UQ2A 4HJGB 5CJXC 3VXME 3FTGA 1CXFA 4MB4A 4NWUH 1EEZA 4GXVL 4ZG1A 2SEBA 1YYLL 1DN2A 3ARXA 3MLSL 1KPUA 1AP2B 2MQ0A 5FGBA 4NM8L 4X6DB 1R0AL 2DQDL 2O93L 4QT5B 4Q6YA 3EYVB 2EDDA 2H1PH 1A7QH 1W0WB 3UJIH 3B2VL 3BXNB 4Q58C 1A7OL 5DMIL 1P7QD 3FQWB 4BFGA 4PRPD 5IHZB 3HC4H 2UY6A 4JM2D 5EA0L 4GAJH 3SGEI 32C2B 4RDQG 5FB8A 4R26H 4QNPF 2FGWL 4YQXL 1NDGA 3SE3A 1IC4L 2E6PA 3LKQA 1KTRL 3O6ML 2ED8A 4LCYA 1WFOA 1S7WB 3BW9B 5LGHH 4AEFA 3PDGA 1JV5B 1BJ8A 4XNYH 3HS0A 1FO0L 1CG9A 1CLZL 3S8WA 3STLB 3DI2B 3I6KB 1E6JL 5DHVB 4MMXC 2VH5H 4L5FL 2AEPH 5TH2A 1JPFA 3Q1SH 1BAFL 3KLHD 4MAUL 2H2PC 1NC4B 2BSSA 3BH9B 5FUCE 4JRWA 5BV7H 3FFDB 4Y88A 2OQJA 3GIVB 1ZVSB 3LMJH 1EO7A 4YFEA 1C5DB 1G84A 4ODUB 5F7LB 4HH8A 5E1AA 1X44A 4L4VD 1BBJB 1FAIL 2VAAA 1P9MA 1TZIB 3VG9C 4R4NC 5AG9A 4APQA 4WRLA 4LNRB 3IDIA 5IP4A 3MJ6A 3C08L 1A6ZB 5FO7A 2QJDA 1RZ7L 2VLMD 1SJHA 4ZS6C 3TT3L 3E6FB 4WI2A 2DL9A 1JN6A 3U83A 5KJRH 3GSRA 4PJCF 2E6JA 4RDQF 1CLOH 2YRPA 2AJXL 5F9JB 1JYVA 3W11D 3G6JA 4U1GC 3VH8G 4ZMAT 2NXYC 3QXTA 5DVOA 3LAFA 3R0MA 5ACLA 3B3IA 2VXUL 3MOBL 5B4MC 3R4DA 5H37H 2KBGA 5FECA 4D0CA 4UQ2B 3MXWL 1MH5B 3FTGB 1SJVA 4I8DA 4OD1L 2Z8RA 2SEBB 1HYSD 3C8KB 1OAZL 3DXAE 1F4AA 1ES0A 3V5HB 5JOFA 4EOWH 3A6CL 4QHKI 2ZUQC 3QFJE 4UT6L 3QCVH 4OZHF 5JDJA 4F7TB 4YO0A 3RUGA 3WKNA 3IXTA 4F15B 4F7PA 3ESUF 5GGTL 3V79C 4KAQH 4G42A 2JKXA 4NFBA 4U6VH 1I3UA 2JIXD 1KELL 1NDGB 4XCYA 2V9QA 3SKNA 4CW1A 2APXA 4LLQB 3VXRA 5F72S 4FP8H 3VG0L 2A9ML 3HS0B 43CAA 3L3DA 4PJ7B 1RJZB 3ZHLA 4E42A 4U4BA 2JF1A 5HI5C 2ZWLT 2OTWA 1AY1L 4O51A 2PYFA 4S1RH 5BVPL 4P23D 3QBTB 1D5IL 1R5IA 4GSDH 2FO4B 4PLJD 2X4PA 4JDVB 5E1AB 4WI3A 4QF1A 2VAAB 5BXFA 3BDYL 1NFDF 3T8XA 3HZKB 3BRDA 2CIKA 4J7RA 4XWOD 5C07A 4APQB 3KDMB 4LIQH 3S3PA 1JI2A 2E7CA 3S35X 4PGCB 3IDIB 3HKFA 3IS0X 3QWQB 4PTTA 5FO7B 3UJJH 1JNJA 5ADOH 4NJ9L 4XNUL 4BZ2L 3BQUA 3OB0H 4HDIB 1X6NA 2DQCH 1JN6B 1ZTXH 3RX5A 1DFBH 1INQB 2YKLH 5D2LB 5INDB 5IFHL 1YY9C 1MWAL 1GGYA 3HAEH 3FCTA 1JZ2A 2DQGL 4WDIA 3KLAA 5I16A 4D0CB 2AV1B 3IFOA 2VZOA 2BSRB 4LEXL 4LFHG 5JHDB 1LD9A 4MQ7B 3ZE2E 4EQ3A 3T0VA 1F6AA 5HI4C 1ES0B 2NNAB 4DKAA 4X7EC 4P4RA 4UIMA 2WV3A 4OLWH 3WS3B 1XZ0A 2ICES 2EIBA 1LK3H 2Y5TA 1A5FL 3ULVE 2I9TB 4ZUUB 3BDXA 4BFEA 1D6VH 3FN9A 3QIBB 3TC9A 1VPOH 1GHFL 5ESAA 3GMMB 4PJEF 2NY1B 1WBYA 1HK6A 3FT3B 4HSQA 4G42B 4ONFL 2NLJA 3VWJA 4XCYB 1QBLH 3QO1B 5FGBC 4CW1B 4XP6H 4MXQC 2DYPB 2D2OA 1RZJC 4U0RB 1JIBA 4H1LG 43CAB 3RWGB 3L3DB 4JFEA 5ITBL 1IKFL 3WKMH 5FUZL 4AMKH 1LO2L 1F13A 1NBZA 4F15C 2VB5A 1KLGA 2VLRE 4KK9C 2PYFB 3ZKNC 1C5BH 4HCRA 3RBGA 1GGTA 1GPOH 2CDFA 1S7XA 1IM3B 4KKNA 1EZVY 3SE3C 4JJ5A 4KMTH 4XPHL 4JHWL 5EZIL 3T8XB 3OKOA 4ZO9A 3S7GA 2GAZA 5C07B 5D2NB 1KB9J 2WLYA 4KJWC 4JANB 3OXSA 4H88H 3OJDA 1RULH 4GRMB 1J8HA 5FKPA 3QZWB 3BQUB 1Z0NA 2AP2A 2E6QA 3D85A 3MA7B 3JV4A 4KUCF 2YD8A 4R4FL 5GJSL 2P5EA 4PJ5D 3ULVL 2CXKA 2H6PA 3QDGE 5CSBA 5ISZE 2FO1A 4PJGB 1Q9WB 1ZLUH 1Y6MR 3NZ8A 1WWAX 1P9MC 2JJTA 5ECJE 1U58B 3FB5A 4Z7NF 4DK3A 4APQC 4WDIB 3KLAB 2F19L 5I16B 3BGMB 2VTFA 1J0IA 4LLYB 3IFOB 2BMKB 2VYRE 2ZCKL 2VITA 3BGAA 3MA9H 5EU6A 2UUDK 5TQ0H 3V8OA 5M7QA 5I17A 4DTGH 4AK1A 4KVCL 4JE4B 4P4RB 1BOGA 2HP4A 4UIMB 1GSMA 1F90H 4Z5RA 1XZ0B 4H0IA 1MLCB 2Y5TB 3MUZ1 5BW7A 3D39A 3DVNA 3OGOE 5DHVH 1Q1JH 3MBXH 4LSQH 4CU8A 5C0BA 2Q7NA 2VE6A 2YD9A 1CDGA 3VWJB 3TCLA 4YPGB 3W2DH 2EKJA 3FMGH 5JA9A 5L9DH 4ORGB 3HNVL 5IEKB 5BRZE 1DEDA 3RGHA 2DJ4A 5HHNB 3DGGA 1S9XA 1VGEL 4AQ1B 3UC0L 4YFLI 1BQHB 4HPYL 3NIDE 3QIBC 3VGFA 2V2WA 1M71A 2NY1C 1KLGB 1QNZL 4ZO6A 4YDIL 3OKMA 1XF2A 2CDFB 1FYTB 3RFZC 5SX5H 4XPBL 3G6DH 4GRWF 5JORA 2P8PB 5SX4I 3PF2A 2YR3A 1VCAA 4AENA 2HA1A 4EN3A 4U0RC 4KI5C 2GAZB 4M9OA 3VFPA 1EAJA 2CXGA 4CU6A 2DIJA 5D7JA 2H2SD 3P9WB 4LAJH 2EZ0C 1S9YA 3CSPA 3OJDB 2D03H 2R0KH 3NTCH 1MFBH 4ZSOB 1VGKA 4QRRE 4GG8A 5T1LA 1Z5LA 2MQ3A 1V8HA 3B9KD 3JV4B 2P5EB 2DI9A 2H6PB 2DD8H 4PRIB 3A67L 3QHZH 4LKXB 1RZJH 1MIMH 2WP3O 2PTUA 2VO5A 5D6DC 3FB5B 1RHHB 4HWUA 4M6OL 4JPVL 5D2NC 1F2XK 4MMZC 7FABL 4FN0A 15C8H 2CIIB 5F6IB 5C2BH 3CK0H 2C3WA 4J3OC 1EDQA 2VITB 4OFKA 3VWKA 2VDKL 3BQUC 3DRTB 3ARFD 1RZGA 4WHYG 2O5XL 3HI1A 1I3GH 2K3TA 4DZBA 4F9LC 5LQBH 1CGVA 1UB6A 1HSBA 4MJID 4Z5RB 3ZZ1A 4N8CL 2P5WD 4H1LB 5E8NA 1R3KA 3PQYB 3D39B 4OLXL 4DN3L 5GIRA 4IRJB 4ZAKD 4PJIE 5IB1A 5IVXB 3TCLB 3LB6D 5I1EL 4Z7VE 3UPCA 4X4YA 2MPAH 2CR3A 1JMZA 1LO0H 4ODBD 4XC3H 2WWKO 1DLFL 4Y1AA 2MOVA 2YWYA 3ZKXB 4BSWA 3CSYB 1NMAH 4PG2C 1HILA 2V2WB 1M71B 1BM3L 3ALWA 4WENB 3EFFA 3S96B 1U8OB 2FBJL 3VXNA 1XCTB 3HPJB 3OKMB 3VWJC 4OGZA 2X1WL 1NANH 1JHKL 5FYKE 2DM4A 4YGVB 1JJUA 2Y36L 3LH2L 5JORB 3BZEA 1QSEA 4AENB 4OZGA 1GGCL 4I2XB 1BF8A 3QQ9C 4MA3A 2HRPH 3VFPB 4L8CA 3WJLA 5D7JB 1OGTA 1Q94B 3T3ME 4V2BA 1S9YB 4TUKL 5TE4H 1UM4L 2E7LA 2P42B 2HMID 4ALAL 3BP5B 4XB8A 4PRHE 3SE8H 2CK0L 2IFGA 5DD1L 5T1LB 1IEBB 1Z5LB 3VRLE 3ILQC 4QCIA 3VJ6B 4JHBA 4YHLL 1BVKA 1A9EA 3MOQA 2DKMA 5KVEL 4GBXA 1IM9D 5CZKA 5HYSG 2FL5A 4X4MA 3L7FA 5E7FA 2FJGA 5T3XD 3U9PL 5E9DE 5IB2B 3VWKB 1JGDA 4HH9B 3BEWB 4RZCA 4I9WE 4LSRL 5EO0B 3JTTB 3QQ3B 1WT5A 3K8KA 2BRRL 4UUJA 3HI1B 1UM5L 4XWGH 4JFDD 5F96H 1UB6B 5FM5O 3RKPA 5T1MA 4U1KB 1R3KB 1MFAL 4IJ3B 3RX8A 5FYKL 5F6IC 5C6TH 1QQDB 2ARJA 5IB1B 1EIBA 3W82A 4U6XB 2X44D 4JN1H 4XVUD 4F33A 2ZJSH 4X4YB 5FIEA 1JPGB 3QDJB 1WIOA 1SYSA 3R0NA 3WFDH 1G9ML 5AYQA 4XMPL 2QHLA 3HI6H 1PYWA 5I0DA 2NW2B 1NCTA 3BI9X 3H3PH 4NM4L 3SE4C 4BSWB 5BW7C 2VXTH 3PV7A 4K7PL 1QSVA 1HILB 1AO7D 1DSFL 4DGVL 3NCEB 5GRUL 3ZMRA 3LKOA 1A6UH 4IRJC 3EFFB 2IALB 2VKWA 2X41A 3HG1A 1RUKH 5I66A 1CF8L 4I77H 5GGQL 1LEIB 3SO3B 5D1ZB 3VXOA 5I1LA 5FKAB 2GIYA 5FYJH 1QSEB 4ZUWB 1NCAH 4MA3B 1X5LA 1KB9K 4YHZL 1R3HB 4TULL 1PEWA 4TOYH 1OGTB 3ARRA 3ZKXC 5C6PB 1YUHB 1MFCL 1AQKH 4HG4J 5HYIA 4JO2H 1OQXA 4HK3N 2RHEA 3PL6D 1FBIH 2IBZY 1JMXA 3UTPD 3X14A 1D5MB 4XCCH 3QEQD 2XPGA 4UOW0 1HE7A 1YJDL 1A9EB 5KAQG 4YJZL 1XF5A 2OM5A 4U1IA 5DJXB 1I7TA 4QHUA 5D7JC 5HDLA 5GSRA 1U6AH 3O0RH 1YECL 4PJ8A 3VXSA 1K5NA 4RZCB 3X11A 2ICWA 2DQTL 3B2UD 4NSKA 4TSCH 2Q7YA 2ZUWA 5H35B 3LKRA 2LU3A 5KSBB 3IVKA 4NGHL 3MFFA 1EEYA 2VLKE 5ILTL 5MEOA 5BS0B 1NFIA 4MQXD 1SJEA 1MRDH 5BOZG 4ORZC 4BELD 4LPTA 5IV2A 2FDBP 3HE6A 5CIPA 1F4XL 5I1AA 3MR9A 3VWKC 1KPVB 3MNZA 4U7KA 4HCRH 1HHGA 5GGVY 4F33B 5DLMH 3OG4B 2R4SH 3VFUB 2OR8A 1SYSB 2F58L 2AXFB 2Z92A 4GG6E 2X4RB 1VHPA 3TH3T 4OCRL 3KPRA 2B4CC 4IJ3C 3PNWA 2DTML 5AEAA 3GK8H 4LKCA 5KAQF 2VN4A 2UWEF 5DFWH 4YHPA 1KCUL 3I75A 4OZFG 4HJJL 5A2JH 2GJZA 1ZLVK 1WCBA 4U1SA 3P73A 3VXOB 5I1LB 2Z91B 2Y25A 2EC9U 4JR9L 5I1JL 1INEL 4KK6D 4QHKJ 1OAYL 5HYSB 4X98A 1KC5H 1KFAH 4G6FB 2NY3D 2VMFA 1NEZG 4MS8D 4N0UB 5HD8C 4CVUA 4LLMA 5DMKA 4I5BB 2HT3D 2AJUH 4JPWH 4X80H 1MCCA 4XHJC 2NY0B 4X4XA 3QISA 4OCYL 4OCWL 3SO3C 3FZUD 5D1ZC 2F8XC 4YBLC 1FL6B 2F53B 1H0DB 2ADGB 4KJQD 4LSTH 1KXTB 4AEHL 4PRPE 3D2UD 5CZXD 4POUB 4LPXA 3E3QC 2PW1A 3ROOA 2VDOH 4CAGA 1CT8A 4NO3A 5GSRB 2AW2A 3FOMA 3QCUL 5FCUH 1B88A 4OIIH 3WLBA 5D5MA 1K5NB 1HKLH 4NSKB 3CFKB 3HB3D 4QXGH 2HTLC 1I1AA 3IJSB 4RAUA 4GQ9H 4WHDA 3MFFB 1EEYB 4LPYA 1NAKL 2XWTA 1CE1H 2ADFH 3FRPA 1BZ9A 3MLUL 3VD9A 5C0EA 3GEWB 3LEVL 4O4YL 2A1WL 1U8KA 2EIEA 5JQ6H 1A7BA 3X3FL 1CDHA 5IV2B 3HE6B 5CIPB 3WUWG 5I8EA 3BHBA 4U33A 3MNZB 3RAJH 1IEHA 3SCMB 4MXVF 1UQSB 4RMTA 4HZLA 5DUPL 4OGYH 2Z92B 5GXBB 3HPLB 3VRIA 3KPRB 1TETH 1WIUA 4W6XB 1GC1L 1AGCB 5IW6B 2ID5A 2VLME 3PNWB 2UVFA 4N8VA 3MV8B 5ACZA 4P2RD 4JFZH 5DR5L 3OGCB 3I75B 2N56A 2J6EH 2GJZB 3OKLA 4RWYH 5EFIA 3S5LA 5F1IA 1FIGH 4YXHL 4QRTA 4R8WL 2BFVH 4Q6IA 3OPZH 4KDTC 5DJAA 1CGWA 1FNSH 5JNYB 4HXAH 5DQJA 5MHSD 5EC1A 3O2VH 5GHWL 5ICXA 3S88L 4V2CB 4NWTH 1NCNA 4X98B 5EUKB 4QRUA 1IBGH 2Y07H 4N0FA 2E9BA 3W0WA 1ZANL 1SMOA 2IEPA 2LU4A 3QJHB 1EZVX 3QEGL 4OZHE 3CSBA 4PJFE 4UU9A 1A0QL 4X4XB 1LK2B 4G8GA 4N9GB 3AY4A 3IAGC 2FIKB 3KR3H 3C5SA 1IGCL 4FXKA 1P4IH 2B4CH 2PW1B 4HF5H 3ROOB 3FO9A 5CILH 4OD3H 1CT8B 4NO3B 5B22A 5J3HC 3DGCR 1IC1A 3JXAA 4ZOCA 5E8DH 2OL3A 3BYYA 3WLBB 5I1IH 4M4RA 3M17A 5FA3B 4BJLA 4U3XA 3NIGF 1I3RA 2NY0C 1I1AB 4TTDC 3GMLA 1KB5B 1WSST 3DYOA 2FH6A 1CLYH 3B9EA 2XWTB 4GMTL 4G7VL 4F7CA 1DUYA 2O5YL 3FFCD 4R6UA 1DDHA 2R56H 4M7JL 4NFDA 4WHCA 4HMDA 3JWOL 3MTRA 4F58L 1LEKB 2VQ1A 4NQSA 1IT9L 5FHBH 5I8EB 2F5AH 4GKSA 3VGDA 4WFGD 1JWSB 4K3GA 3K8MA 5JDSA 1P53A 3RWCB 3U0TA 3SKMA 5IIEA 4FG6C 3OF6A 1KT2B 4U0QB 4C4KO 1OAKL 5I19L 4R4ND 1FPTL 4OKVA 2GUOA 4RGNB 1PY9A 4RFOL 2E9IA 4OSUL 3MLYH 1N59A 1K3ZA 3HE6C 5ACZB 1ZWIA 2X2YA 4O58H 2AJ3B 3WHXB 3S97C 4PJDB 5HDQL 3G5ZA 4OUUA 1CZ8L 1UM6H 3SCMC 2NXYD 5EFIB 3S5LB 4C83A 1T1XA 2W60A 2MCPL 4QRTB 4J4PD 2X1PA 1G7LA 4Q6IB 4YZFF 3VI3F 1NANI 4PJAA 2D3VA 4TRPL 4DUXA 4QOKB 4ETQA 2GSGB 2IPKA 5EOTB 5ICXB 1D5BA 2FD6H 3ORJA 4QRUB 3AROA 3ZL4H 1DBAL 1TFHA 3W0WB 3O3BA 4WFHE 3U82B 2B2XL 2PN5A 5DFVD 5ID1A 2P4AB 5DXWA 3ARSA 5IUSA 2AK1L 4JRXE 1O7SA 4G8GB 1F4YL 1MJUL 1R3IH 1KCVL 2HKHH 4P2OA 5E7BA 2NZ9C 4XAWL 3P9MB 1WWBX 4R3SB 2XA8H 3FO9B 2H41A 1A7RL 3O6KH 1NDMA 2Q8BL 4X83A 4XCNB 3GJEA 3IDJB 2WQ8A 4LOUC 3MRRB 4XNXH 1I3RB 3HUJF 1LP9A 4ZNCD 4PV9B 3EO9L 2B7DT 4X6DF 3QRGH 3EUUA 4P2CG 1JGLL 3MCKA 4ZTOH 3ZTNL 5D1QD 5EIIB 4HEME 4F7MA 4NQUA 4JDTL 4YDJB 2VQ1B 3WN5A 4N90D 1PZUB 4ZTPH 3QUXD 3V4UH 2HT4C 3KVQA 1I1AC 3HZMB 1DQTA 2XZCH 5B8CC 1P7HL 4WO4A 4LP5A 4OKVB 3IF1A 5C0FA 5HYQA 1V3MA 5JXAH 3TWCL 5KSAA 1N59B 5E00A 2YUVA 1NC4D 5CP3A 3THML 1ZWIB 4HW6A 4XXCA 4Z7NE 4PJ5E 5D7SL 1OWRM 1BQLH 5JOEA 1CGSL 4C83B 1ERNA 2BY1A 5IMOB 3KJ6L 2PXYD 1YY9D 2QSVA 3RJDA 3K1KC 3CFCL 4S1SL 5CJOL 4YHKL 1G7LB 3WNOA 1JBJA 2R69H 4HWNA 4ETQB 4OCMC 4JO4L 4RGNC 3WNPA 1MJJA 3HRZB 1NUGA 2IPKB 4DGIH 4AEEA 2HFFA 1CR9H 4HJ0C 1I8MB 1KNOA 4HIEA 2I5YH 3DBXB 3IDNA 4FQJL 4ONOA 5EIQA 4ERSL 4Z7WA 5ID1B 3HI5L 5HI4D 4Y2DA 5HY9A 3W5MA 5C0RL 4Y5YB 2W0PA 5E2WH 1F45A 5I8OH 5HHPA 1Q9KA 5JHLH 2I9LB 2B0SH 4P59H 4Q6IC 4P2OB 1NCCH 4LF3A 5D6CA 4YDVA 4FABH 3O3UN 1PKQB 4M1CC 3I2CL 2R1YA 2R0LL 4U31A 1NDMB 5CIPH 2P7TA 5LJYH 2DLEA 3GJEB 1QEWA 3T4YA 5EZLA 3V0AC 3L5HA 5AYUH 1K8IA 3IGAB 3INUH 4G9FD 3QUYA 1ADQL 1C5CL 4X5WB 4D0DB 1BGXH 2ZNXA 3FO0L 1LP9B 1YEGH 4IDJH 1FO0B 5F6HJ 2OYPA 5BJTA 3O6LH 2XV6B 2VLJB 3ARGB 1FE8H 3MRCB 4E5XA 4HXBH 4KK9D 3ZKND 4F7MB 3EFDH 1ZLWH 3LN5A 3PWVA 3ARBA 4WU7B 3ZKMC 4Z7QE 2FJFB 4OF7A 1W0VA 3EAKA 4HLJA 3EDDA 3RA7L 2FYYA 1A4JA 4OI7A 4HFUH 4WO4B 1K4CB 3U7WH 5LKNA 4NCDA 3H9SB 3DXAA 4PBWD 4M1GH 4OTXL 5KSAB 5IMKB 3UO1L 5E00B 3TESA 4JCMA 1RUMH 1TVBA 4OIAA 4MXWL 2BHZA 5J6GA 4H25A 3MLWH 4HKBA 3ZT5A 1WC7B 1ZT4B 5GS0L 3GSVA 3DSFH 5E1HB 4NP4L 1B0GB 4X4ZA 3T2NL 1T03L 3GUTA 4JFPA 3IFNL 2MNUA 1M6OB 2YMXL 1RUAL 2DQEH 3M1BB 3JV5A 1WQVT 2WBKA 1LQSR 1YQVL 4HIEB 4BYHA 3IDNB 4NQEA 2IBGA 4Z7WB 5HYJA 1FQ9C 1GIGH 4QTIL 4PLOB 5HY9B 1QFUH 3W39A 4MJIE 1KB5H 4WFEE 1EVUA 2NPLX 4KWUA 2P5WE 3UYOD 2LFGA 4G8FA 4XCFH 3G6JF 5D6CB 5DT1H 4YDVB 5E0QA 3B6SA 5JHDD 4GMSL 2IFFH 3FAXA 4NZTH 1EERB 3O8XA 4QHMB 4MHHG 1KEGH 1DQJA 1QEWB 5E5MA 2G5BA 1K8IB 1TZHA 2ZSWB 3OR7B 3MFGB 3QUYB 2JCCA 4Y5YC 3B5HA 4JQIL 4LNVA 2WQRA 2W0LA 4Y89A 3OKDB 5BJTB 4P2OC 3QIBD 2W91A 4MA7L 4MJ4A 1MCHA 5CP7B 5I18H 2GSIB 3WXVL 3U0WH 4AT6A 3JTSB 2OJEB 1N5YL 4M6NH 3LN5B 2X4SB 1OM3L 2HLAA 3ARBB 3EYUH 3RUGF 1CGTA 3TJEL 5IGXL 4ACPA 4XPGL 2DYPD 1NGPH 1U8LB 1XFPA 4ELME 1A4JB 4J8RA 4KI5D 5J13B 3HMXA 1U0QA 1X4ZA 4K3HA 2VDQH 3W9DB 1DQML 1T4KA 1FZKA 4FFVC 4Q2ZA 3DXAB 3TBSA 3IDYB 3ARGC 4KROB 4KDVA 4W4OC 5J6GB 1QSFE 1JCKA 4V1DD 4HKBB 5J6HA 2AKRA 4H20H 4XZUA 3DURA 5CD3A 1HHHA 3ZE1F 3VFGL 1MWAB 2W0FA 3PGCA 4PRBA 4MNGE 1C12A 4WO4C 2YBRA 4LCIH 3NFPB 4XH2A 3UTZA 3P4OA 4O9HL 2EIDA 4NO0A 3PDOB 1RU9H 2IMNA 3ROLA 2G5RA 3QHFH 5HHMB 2GHWB 1D6EA 2XQYK 2OL3H 5F88B 2FSEA 4M1DL 4NPYA 3PWUA 4XXCC 1VENA 2OK0L 3U79A 4NQEB 4FS0A 5FK9B 5HYJB 4JFDE 3WHE1 5TF0A 5FDYA 1A47A 3GBLA 3RY5A 2ITCB 2A6IA 1BJ1J 3LRHA 4HIIA 3HC3H 3B6SB 1FRGH 5GRWA 2X05A 4NOBA 1RVFL 4WHTA 3MQIA 3O8XB 1ORSA 3AS1A 4UNVA 1BD2B 1DQJB 1JTPA 5EU4A 1F02I 5DRXB 1F3RB 2JCCB 2UYLA 5TF1H 5IVOA 2IQ9L 4KHTL 5E2VL 1MJ8H 1KSRA 1SY6A 5FUCC 2AXHA 3UAJC 1AO7E 1A8JH 4OJFH 3SOBL 1ZOXA 3AXLA 3L95B 5ISZA 2H3NA 3P3YA 1BEYH 3OQ3B 3FT2B 4LL9A 4ZFFB 2HLAB 1UACH 3DUUA 2C4FT 1NLBL 1HNGA 1NLDH 5KW9L 5T3XL 3QUYC 2AK4B 2BNUA 3MLRH 2GQHA 3QYCA 1MI5B 5T33H 1T4KB 2FX8L 1FZKB 4Q2ZB 1WZKA 3TBSB 3K7UA 2ESVA 4GXVH 4YIQB 5JXED 3MLSH 5AD0A 1FYTD 1HHIB 3ARBC 4L29A 4NM8H 4XZUB 1R0AH 2DQDH 3KPLA 2C1PA 5CD3B 1HHHB 1OPGL 4WTZG 1UH3A 3B2VH 2W0FB 5DK0B 3RP1A 4ZYKA 5J13C 1A7OH 4OKDA 5DMIH 1T66C 3MXVL 3QNXB 4GW5A 3KWWA 4B5EA 4B7IA 5HPOA 5EA0H 1DJSA 1JGVL 4NO0B 3ROLB 4PRNB 3IDYC 1AD0B 2FEEL 3BKJL 4KROC 2FGWH 4LFHD 4YQXH 5BRZA 1IC4H 2GT9A 2PCPB 3O6MH 2GJJA 4YGAB 3H7LA 3LRSA 3SDXE 1CXEA 3VFNB 4PRID 5E6ZA 1U8MA 4R4BB 2DM2A 1FO0H 3GSNL 2A6IB 1CLZH 1E6JH 3RL1B 1QSZA 5CSZA 4L5FH 5HXMA 4YBQD 4L3EE 1BAFH 4WWID 1J0HA 1ND0A 3RQ3A 1K8DA 4NKOA 5F3BA 1PY4A 1WK0A 3ALPA 43C9B 1T22B 1FAIH 3ESVF 4TUOA 3K4AA 2UYLB 3N0PB 2WZPD 5F7UA 4X7FC 3PQYD 4QRRA 5C0IA 3C08H 1MCIA 1RZ7H 3AXLB 4IRJD 4X99A 4Y4FB 4FQCL 2YK1L 3TT3H 2BY3A 5CP3H 4JO1L 2HN7A 3O8XC 5C0DB 3T04D 5E6YA 3FONB 1FFOB 3C5JB 2AJXH 3DUUB 2F54B 5HYFA 4PR5B 2VXVL 2BNUB 5JW4R 2VXUH 3MOBH 4UV4L 5EU5A 3L5WB 2J8UE 3GMOA 5DJYB 3RWJA 3GJFK 3VFWA 4K23L 5KTEL 1JTTA 2RJMA 3EO0A 4U1NB 4Z7OF 3BN9C 3MXWH 1KJ3H 4XC1L 4U6HA 5IKCA 2BNRD 2ESVB 4OD1H 1JF5A 1OAZH 5LVEA 3EOBA 1V3LA 1MCPL 3KPLB 1HDMA 1QR1A 2HH0L 5IBLC 1H3GA 5EOCL 1F3DH 1BQUA 5IEHB 1NC2D 3X12B 3A6CH 2BVQA 4X6CE 4W6YB 4UT6H 3NH7L 1TJHL 4PJIA 3CC5B 4CN6A 3KWWB 3L5XL 4Z7VA 3MGTB 1L6ZA 5DJZA 5GGTH 3QP3A 5K9JL 2BX5A 1KG0A 2H1PL 3TO4A 4ODXA 2D31A 5BRZB 1KELH 5DRZA 2YPLE 2C3GA 2I07A 2GT9B 2GTWB 3RWEB 3LRSB 1P7KB 3RIFF 1U8MB 4LRIC 2ICWI 3OJVC 3VG0H 1K85A 3D6GA 4P5KA 3MRLA 1PAMA 1MFNA 4FQ2L 2WBJB 5DUML 1A02N 5CSZB 4G80A 1AY1H 5GGUA 2YS4A 2MFNA 4A6YL 5BVPH 1D5IH 5HGDA 3RJQB 4O2EA 2EDHA 1AGEA 5HHQB 5F3BB 1S78C 1VACA 2AEPL 3EJZD 4PG9A 3BDYH 4TUOB 2HLFC 1OW0A 4QYOA 4NQCA 4GAYA 3LQMA 4BQ8A 5D4QA 4HIJA 4PRHA 3IJHA 2HTKC 4RFEA 3WBDA 5C0IB 4NJ9H 3KYOA 4LLUB 4XNUH 2NY5L 3RX7A 4BZ2H 2HN7B 4NBXB 1HCFX 1ONQA 2ZCLL 1KPRA 3DYMA 4OF8A 3QDJD 1UVQA 4X6FA 1FJ1A 5L6YL 1Z9SA 1QHOA 4PJBE 2CLVA 3OB0K 4ODVL 3QQ4A 1MWAH 4JO3L 4Y19B 2VISB 3QQNA 5MHSE 2IF7A 4MJ2A 5E9DA 5EU5B 5GGRA 4GW1B 4N0RA 3BKYL 3EO0B 2R15A 2UZYB 4Y16A 4LEXH 4RX4A 2X4TA 4Y4FC 1LE9B 4U6HB 5HD8D 1N3NB 1FLRL 3D3VA 4KKBC 3BZDA 1KJVA 5D1ZD 4YNYA 1NCWL 2WANA 1BMGA 4HT1L 1QR1B 4H0GA 3P4MB 5EN2B 4Q9QL 4ZPVA 4PRAB 4XTRC 4PJIB 3BPNB 2YPKA 4IHOA 1X3DA 1GHFH 5DTFA 5L7XL 1WFNA 1M05A 5DJZB 2BOBB 2WAHA 3MYZA 1KG0B 3H0TB 4ONFH 4OZGF 4ODXB 2D31B 1KYOK 1VEOA 5DRZB 3MRHA 1KOAA 1P5UA 2I07B 2R1WB 2OXGA 1RUQL 2HTLD 4K3JL 1JNNL 3CFJA 3DTXA 3V0WL 3NCFB 3UZQA 3EYOA 5EORL 1A14L 4P5KB 3LKPA 1NKOA 3MGAA 4MLSA 5ITBH 4YEFA 1IKFH 3IFPA 2A38A 5B39B 5FUZH 1LO2H 5FA4B 3GRWL 4PGBB 5FV2A 3P30L 1IGTB 4FTVD 5ACMA 4WFGE 2K7PA 3QEUA 5HGDB 3HTLX 2OSLB 4HGWA 1VERA 4XPHH 1QFOA 3QXDB 1Q9LA 1VACB 5BZWA 4Z7UE 4N5ED 4JHWH 5EZIH 1EO8H 4NQCB 5FXCH 1J0KA 2D7QA 3GSXB 5BS0D 1AXSA 3IJHB 4RFEB 3KPQA 2WBJC 5T1KD 3BMVA 3IRZA 4HUKB 5E70A 2ZG1A 3UYPA 4OFYD 4R4FH 1KTDA 5GJSH 3ULVH 4QRSA 1JRHL 3VGBA 1FJ1B 1XGPB 1FNEA 2CLVB 2YOCA 3QQ4B 4AL8H 4LCWD 1CFBA 3CFEA 2B1HL 1A3LH 1UKTA 4YFDB 5E9DB 1DQLH 1ZTXL 5DJDA 2F19H 3OZ9L 3MCG1 4OM1L 4D8PB 4S2SB 1P2CB 3UTOA 4Y16B 1UKQA 3BPCB 2ZCKH 3UBXA 2Q76B 2VLKA 3MODL 5FHAL 3D3VB 2D0HA 1KJVB 1MAML 2JJSA 5L8KB 4FQIL 4KVCH 5I1HH 3X3GL 1H8NA 1L7TL 4PY7A 1BFSA 2Z31A 4ZPVB 4ODSH 4LMQI 4CJ0A 5CHNB 5MP6L 2YPKB 4IHOB 4RGOL 1U3HB 3V5KB 1QFWL 3I85A 3D18A 1Y18A 1FC2D 1LK3L 4GG6A 1UXSA 4YE4L 1GRWA 1SM3L 3NN8A 4CRPA 3LV3B 3Q5TA 2NY0D 3HNVH 4JLRA 4CMHB 4TTDD 1QACA 3RDTD 2F53D 2XXMB 4Z95L 4R90L 4FRWA 4M62L 1VGEH 3UC0H 3BPOB 5D8JL 1OF2A 3T3PE 3O6FD 3CFDA 1MCBA 4N1HB 1KCSL 2A6KA 1QNZH 3MV11 4YDIH 1CDIA 4N90E 4DWHA 3AMLA 3Q6FA 1FL5B 1F97A 1MQ8A 4HUUB 4XPBH 4GUPB 5BO1L 1Q9LB 3LCYA 4ISVA 5BZWB 1NH6A 3DHMA 1MHEA 5AG8A 1FNFA 5IHUL 1F4HA 3ZDYF 2B39A 4KMTL 3KPQB 2X9WA 5L2KB 2J88H 1OP5K 3QPXL 1UWXK 5IB4B 4S0SD 4ESKA 3DPBA 3CPLA 1P7QA 5HVFB 3DIFA 4K7PX 3SCMD 4PRPA 1F3JA 4JM2A 4KMQA 4QRSB 3A67H 5HDBE 1G9MC 2BXZA 1FNEB 4KPHL 3EO1B 1A6AA 3CFEB 4XXDB 3BSZL 4M6OH 2EIZB 4JPVH 4BH8A 7FABH 2Y6SC 1HEZB 4U1LA 3MV8D 1NJ9A 1AXTL 4HX1B 3UBXB 5IJVA 2VDKH 4LQFL 1IGML 1RMFL 3FQXB 2P8LB 2RBLA 1X5KA 5FGSA 3GSOA 3P2TA 2O5XH 1KENL 3HHRB 4Q9CA 5HGAA 3UTSB 5FO8A 1AI1L 2Z31B 4N8CH 4FFYL 3KPOA 2LQRA 4LARL 1VESA 3SDCB 4ELKA 2GCYA 3MNWB 4L4VA 1IAMA 4DN3H 5EU3A 2X4OB 4Y16C 3D18B 4G8IA 2HG5A 3HC0A 4K07A 2OXHA 1UXSB 1NGYB 4LOUD 5EBLA 4EUPA 3F12A 5DO2C 3NN8B 1NUDA 3OR6A 4LSQL 4AM0A 4OV6F 3DO3A 5T5FL 1MQKL 1DLFH 1W72L 3DX9A 3GKZA 2V2XB 1YJDC 3CU7A 3H9HA 3LKNB 1OF2B 2P1YA 3U4EA 2MQCA 3S35L 2XTLA 5JW5A 3L3GA 4L8SB 3WD5L 3CFDB 2GJ6B 1YNLL 1U3HC 1BM3H 2A6KB 4N8VG 2COQA 2A83A 2FBJH 4RMUA 5A3IC 2IJ0C 2AEIT 2WLZA 2VNCA 1JHKH 5BOPA 1FN4B 3Q6FB 2HT4D 4HLZH 5IQ9A 2Y36H 3LH2H 5D9SB 3GKWL 1F5WA 5D5MF 3D0VA 4PJ7E 1GGCH 5HJ3A 1MHEB 3I6GA 4HQQL 3MRBA 3BPOC 3BVNA 3G6DL 3O2WL 4TUKH 2GKIA 4PJFA 2I25N 1UM4H 4EI6A 1BBDL 4ALAH 2GEEA 3CVHL 2EH7L 2CK0H 5HVHB 4JY4A 5DD1H 4JFOA 4XPFL 4PRPB 4OI9A 3WFCL 2AEQL 3TLRA 5TPWL 2OCFD 1T21A 2JIXA 3MOAL 3VMPA 3IAQA 5DJCA 4BFIB 5KVEH 3MV7D 3KXFB 2VL4A 3OAZH 2CR6A 3BH8A 3L3KA 4BH8B 2VLLA 4ENED 5DD5L 3MACL 4U1LB 1NJ9B 3WEXA 3U9PH 3FHAA 2A6JA 4LSRH 1NKRA 4JN2A 1BZQK 4GAGL 5D2LE 2BRRH 2M26A 4CVWA 4JVWA 3BD3A 5HHXL 1IEAB 5FO8B 1E0OB 3AC0A 4LPCA 4P23A 4QOKD 3VE0A 1S7UA 1AGFB 2XICA 1OSPL 3SEPA 1MFAH 2FX7L 2EYTA 4M1CD 4ELKB 5JHDE 3C6SA 4L4VB 5FYKH 5SWQB 3QUZB 3T0BA 4G8IB 4WU5A 4UBDC 4WNQA 4HGKC 5DS8A 3L3IB 3WFHB 3F12B 4P46B 3MJ7A 4HKJA 4J3XA 4C59B 2OR7A 1G9MH 4CBPA 4XMPH 3DUHA 4AM0B 4MJ6A 1AXIB 2DM3A 3DX9B 2Z31C 4NM4H 2FEDC 4UMGA 2MPAL 3DETC 1ZVYA 4K7PH 3SDCC 5JW5B 1KCRL 1A22B 2P43B 4WY7H 4AQOA 1DSFH 4DGVH 1T3FA 4BUHA 5KSVB 4XRCA 2A83B 1R5VB 1GCFA 1CF8H 4P5TB 5GGQH 5DJ0A 2DQFA 5IQ9B 1G6RL 2A9NL 1FFPA 4KI5E 4WW2B 2LABA 4LEOA 2YA1A 5IWLC 1OCWL 3MRBB 4YHZH 4IMKC 4TULH 1WBXA 1E4XL 2YSSA 1MFCH 1YA5A 1T2JA 2VOTA 2PYEB 4L8SC 3ZE1E 1IFHL 5EO1A 4JDZA 4U7MA 1R3JA 4WUUD 4LSPL 1X5ZA 1XCQB 2R9HD 3V7AG 1EFQA 1G1CA 4UZGA 2ZUSA 3BEVB 5GISL 5C0JB 2YUWA 5D2NE 6FABH 2D7PA 3C8DA 1T21B 2JIXB 1YJDH 5DJCB 3SN6N 3CCHA 4NRXA 1GC1C 2VLLB 1U8IA 2VDPL 5TDOB 4UNTA 3WEXB 1QR4A 1YECH 3HZYA 4S0TD 2DQTH 3DX7A 3BZ4A 4RBPH 5HVHC 4BH7A 1N4XL 1ZA6A 4PJGE 3TEUA 3GGWB 3BIKB 2R0WL 2DL2A 2LTQB 1K6QL 5ILTH 1HXMA 2R29L 3P77A 4K2UL 4P23B 3VE0B 2YRZA 2FHCA 4X7CC 3SO5A 1J1OL 3MRKA 2EYTB 4Y4HB 3VGEA 3G5XB 3NFSL 3QRFM 1F4XH 4PJAF 5F8RC 3G5VA 4WU5B 2OBGA 3O3DB 1IKNA 4QTHA 3MJ7B 1ADQA 4ZFOL 1B4RA 3SGKA 3FRUA 4KK8D 5F97E 3KLHC 3RWHA 4MJ6B 2CKNA 4OCRH 4XMLL 2IPTL 4PJ5A 1WIPA 3RVTD 1H8SA 2DTMH 4OLVL 3QUZC 1CFVL 2FATL 1KCUH 5H94A 4HJJH 3H3PL 1AKJD 4KQ3L 5DJ0B 4YHIA 4P46C 4OFPA 2DQFB 2DF3A 1FFPB 4ZOEA 1IZKA 4JR9H 2VQUA 3PJSA 4LEOB 1HWGB 3U7YL 3CJJA 5I1JH 1INEH 1RUKL 4PD4J 1D9KB 3MBEB 4I77L 2VLJD 2YSSB 5KS9F 1OAYH 3ARGD 1LP9F 1A3RL 1HZHL 1SYVA 3SQOL 1NBQA 1FYTE 1R3JB 5JZ7C 1RV6X 4P5TC 1NBVL 1WZ1L 2VDLL 4OCYH 4OCWH 4J1UA 5DHYA 1N2RA 1E27A 4WW2C 5CBEA 5E8EA 1YN7B 2ICWJ 3B9DA 4AEHH 3HZVA 2HAZA 3CCHB 2WINB 3NCYP 3NOIA 3H9SD 4D9LL 3LEYL 3QCUH 2QLVB 4M6ML 4WCYL 4ZSOE 2CQVA 3HZYB 1QBML 2NQCA 3P9LA 1VADA 1MVUA 5EBGA 1FZMA 4PRIE 4CL7A 3O3AA 3IT8D 1ACYL 4W68A 1AGBB 4OF3A 2MHAA 1NAKH 1HXMB 2HJLB 1PSKH 3JVGC 4QY8B 3IU4L 5IR1B 4TSCL 3MLUH 2WWMC 5CCKL 3LEVH 3MRKB 4O4YH 2A1WH 1OTTC 3X3FH 6CGTA 4GAFB 4YHNA 5GGSB 5K9KB 2H9GA 1CVRA 2XRAL 2OTPA 2LTQC 3C60B 4OLUL 3FRUB 3PQYE 4P23C 1GC1H 2EKSA 2Z4QA 3B9KA 3LHPH 4Z6AT 2E7HA 4FMKA 1FAKT 4Y4HC 5MEND 5IVXE 1QLFA 4MCYA 4D94A 2XZAL 5DR5H 5SWZB 2NX5D 4XWOC 5H94B 3SKOB 4HUWA 5A2IH 1EJOL 5JW3L 4YHIB 4Z7OE 2IANB 4PV8A 2OI9B 4YXHH 3TA3B 4R8WH 3RIFK 3E8UH 2DMKA 3DV4B 3PJSB 4GH7B 2X4QA 2ZOLA 2FX9L 3ARFA 4G9DA 4NQVA 5GHWH 3S88H 2WW8A 3T77A 2WK2A 4PY8I 2Z35A 1N6UA 4P9HC 2Y1VA 2BNRE 4KKLC 5F7WC 4BUGA 5I0ZA 4DQOL 4R7NA 3I84A 4MJIA 1SYVB 1ZANH 3EJJX 4PGZA 5D7LB 3QEGH 5JO5B 3TBTA 2P5WA 3NA9L 4JZNB 1S5HA 1A0QH 3QEHA 5E8PA 4IRZL 3KYMA 5DHYB 4WUKL 1N2RB 4I2XE 4ZAKA 1LE5A 1E27B 5E8EB 1EXUA 1TTFA 3GNML 5KVMC 1IGCH 2RFXA 3KPPA 2AJUL 1D9KC 3MBEC 2CRYA 3SE9L 3ETBF 4LDEB 4L8BB 4A2LA 5HI3C 2R2CA 3RI5F 3BIAX 4KROD 4ETYA 1LO5A 4X8JA 4ZUTA 1IILE 4XBGA 3AB0C 3U4AA 4AIXA 5ITFA 1FZMB 5DK3A 3O3AB 4KU1A 4MQSB 3F58L 1EAPB 1OLLA 4GMTH 1YEIL 3S98A 1GZPA 2O5YH 1T2XA 4LLVB 2WIIA 4M7JH 3JWOH 2ENYA 3RGVD 4F58H 3AAZA 1IT9H 1T7XA 2H9GB 4ELMA 1J8KA 4X5LA 2VL5B 5C09B 5A2FA 2KZWA 3PGDB 5I15H 1QRNB 2BC4A 2FH8A 4UTBL 5I19H 1OAKH 3IDMA 1FPTH 1ZHBA 4RFOH 1BIIB 2BCKA 5DEZA 4OSUH 4M3JA 1HI6A 4Y0GA 1RQ5A 3NBNA 1YEJH 5CGTA 3BUTA 3VCLB 1QLFB 3H8NA 1TCRB 1JGUL 1YMMB 3QDJE 1IM9A 1BD2D 4MNGA 2HWZL 5HDQH 3O11B 1CZ8H 3OL2A 4ODHL 2MCPH 4PV8B 1N26A 1AJ7L 2APBA 3C60C 1NSNL 4TRPH 2BVEA 1FP5A 3DYPA 3ARFB 4QHNA 4TSBL 1XF3B 4MDJA 5SWSD 2E5EA 3DRQA 1XR9A 1WBZA 2D7TL 2DWDA 4JFDA 2BFVL 1NFKA 1DBAH 1MVFA 2NTFB 4R7NB 3OJMB 2B2XH 3TBTB 3MRFB 1PFCA 2C5DC 4G3YL 4NWTL 5E8PB 5IBLD 3KYMB 4M7KL 4OFIA 2OI9C 1F4YH 1MJUH 2AK4D 3TA3C 2CRMA 4G6AC 1KCVH 4NO5A 3RZCB 1MJ7L 1MI5D 5DUBA 1E4KA 1G7HB 1YPZA 3RWIA 4XAWH 1I7RA 2EYSA 1XGQA 5HHOB 1A7RH 1QA9A 4M6AA 5F7KC 3U36B 2Q8BH 3B43A 1I8KB 1A6TA 4XBGB 3PWPD 3C6LD 5C6WH 1TJGL 5ITFB 5GGRY 5GS0C 1ZS8A 4HF5L 3ZE2F 3PG2A 5ESQA 1JGEB 1LNUA 1AO7A 1DEEB 1KBGL 2FGZA 3Q5OA 3ULVF 1N8ZA 2QV2A 3MLXL 3GSNA 1GZPB 2NTSP 1S7SA 1JGLH 2WIIB 3FO1B 5ADPL 5H2BA 3ZTNH 4Z0XA 3IJYA 4JDTH 4KDWA 3AAZB 5HGGS 3S37L 4ELMB 1IGFL 3DROB 3WNNA 5CBAA 3MRQB 4KJPC 3PE9A 1S78D 5KSBE 4YHOL 5B38G 2UV3A 1HQRA 3G08A 1DBJL 2BC4B 2HLFD 2DS4A 3S36X 3UPRA 1RPQA 5BS0E 4XAKD 3PL6A 1KIQB 5ENWA 3LKSB 3RNKA 2GYSA 1HHJA 3TWCH 3U4BL 3QEQA 1HH9A 3THMH 2Y4SA 2CSPA 5D7SH 1IAKA 3F6LA 4HS3A 2VQTA 1CGSH 2H2SC 3KJ6H 4RISL 4P9MH 1WTGT 3MX0A 3OKKA 4LCWE 3O45A 1E28A 3CFCH 4S1SH 5CJOH 4YHKH 5A16A 3V5DA 2KQMA 3F7VA 4PD4K 4BKLA 4JO4H 2C3XA 1TPXB 2BZDA 3REVB 2W65B 5EIVA 4OT1L 4IOIA 4Y4FD 3DRQB 1XR9B 1WBZB 4RFNB 25C8L 4L1HA 2V5RA 4H5SA 4FQJH 4ERSH 2F54D 3HI5H 2YEZA 3BWAB 4Z9KB 4OF5A 5C0RH 3ZTJH 4NO5B 4XTRD 1YPZB 3RWIB 5I30L 1CN4A 1XGQB 3O3EB 4KZEH 3IDXL 3MLTA 4GO6B 3I2CH 4N0UE 3ARUA 2R0LH 5DWUL 3KS0J 2DI8A 5DSCA 1T1YA 5GRYA 1A6TB 3GSWA 1RK0A 4OLYL 1ZS8B 3MGOA 1EGJL 2F53E 1LNUB 1ADQH 1C5CH 4NRYA 1FYHB 4DFIA 3FO0H 5FGCB 3RZCC 1BFTA 3UTTB 1R24A 1SVZA 3GSNB 4BK4A 2LVEA 1S7SB 5J57B 4CN4A 3RY4A 4X8XA 4N68A 4Z0XB 4A6YA 2R8SL 4I3RL 5DZNA 2JLLA 3TO2B 2J8UA 1J86A 3P40A 1EEUA 4Y5XB 3I3BA 1FFQA 1HQRB 3RA7H 1ZLWK 1NMBH 2VAJA 3ARED 1U2CA 1X5GA 2WBJD 4LAQL 4F80A 3PL6B 1AGDB 3O2DL 4MJ5A 4I1NB 4OTXH 3CDYA 3UO1H 1CFQB 3OJ2C 3QEQB 2EE2A 4MXWH 5INCA 2HFTA 1MCKA 1TTGA 3D2UA 2C7UB 1IAKB 3MRNA 4OZ4B 4HS3B 4HEPG 5GS0H 1YNKL 3QR2A 5JPNB 4NP4H 3O45B 2F8OA 4JCLA 3T2NH 4LGPB 1E4WL 4IDLA 4WI6A 1T03H 2F8VA 4XB7A 3MV8E 2IWGA 1OOAA 2YMXH 1RUAH 1NPUA 1K2DA 4IOIB 5IM7A 1F3DJ 2P44B 3SDYL 4UOJA 2AJZB 1YQVH 4NKIL 4HD9A 3HE7D 3U6RA 4DGIL 4QTIH 4KJYB 3UBXI 1ZLSH 1FVDB 1KLFA 1RK1B 4Y19D 3FJTA 3IDGA 3OV6A 1TITA 5D70L 1NCUA 1TPXC 1MCEA 3MLTB 2WUCL 4GMSH 4M02A 4AIZA 5E2WL 4RFNC 1T1YB 3QNZA 2YD4A 1OP3K 3GSWB 3PV6A 5HBBA 1KXQE 3S36H 3QWOA 1RK0B 3VD3A 3VD5A 1OLZA 3MGOB 1CD9B 1QO3B 5B38B 4JQIH 1D7FA 2PUQT 4P2RA 1CTOA 1MY5A 4U1HB 5D1XB 3UPAA 2RB8A 1G7PB 2XOTA 3L6FB 4E0RA 3W5NA 2FJHA 4OAWA 3GRWA 3BUYB 4MA7H 5EPMA 3LD8B 3EKCA 1BVZA 2XNAB 2CH8A 1N5YH 4PJIF 4PJBA 4A6YB 1OM3H 4CDGC 1K4DA 2X4UB 2E8ZA 4Z7VF 3TJEH 4FQQA 4I4WA 3AS0A 5IGXH 4XPGH 4LQ1A 4Z76A 3TJHC 3AVEA 5IOPA 5CD5C 1I7UA 4N1CA 1Z6JT 3OXRA 1DQMH 4GLRH 4DVRL 2Q3AA 2KDGA 5F93C 4Q0XL 1CS6A 3GSUB 3TF7C 2AV7B 3DMMB 3W9EB 1SJXA 4HUVA 1KJ2L 4QO1A 3D2UB 4MB5A 1B4JL 3MREB 1J10A 2XZZA 4HZAA 4WVRA 3HRPA 1EK3A 4Y5XC 1AC6A 3VFGH 1T89C 1RAMA 1PZ5B 1S5IL 3MLZL 1OHQA 5KG9A 1R5WB 5IK3A 5L2JA 2Y6SD 3PL6C 1YC8A 1Z9OA 3T3MF 4O9HH 5KVDL 5HHVL 3O4OB 5IM7B 1B6UA 4NUJA 1Y6KR 3HAEA 4WEMB 1R6VA 4G6JL 4PJDE 3MRDA 5D72L 4MGXA 3CLFL 3GB7B 2OK0H 2E9JA 3FFCA 1G0XA 4P57A 4TNVF 3CUPA 3VRLF 3KGRA 5HSFA 4KRLB 2XWJA 4QOKE 5LAXB 5IHBA 4RRPG 1J1PH 1U8HA 1YDPB 3GBML 2X1XR 1WZLA 3V6ZA 1ZT1B 4OGAC 2CD0A 1UKSA 2FLRT 3W0WE 3IXAB 4JKLA 4AIZB 5J9PA 1RVFH 4Z7UA 1WAAE 2RAMA 1JF1A 3QNZB 3VXTB 3PV6B 5DO2D 4LMQE 3PIQB 2XZQL 3QWOB 3ARDB 3PP4H 2AXGA 5K59E 3D69A 3PDDA 3K4DA 2GK0A 4MQXC 2YUZA 3TIEA 4ZUSA 1V7ML 2YC1B 4P2RB 2IQ9H 4KHTH 5E2VH 1KUMA 4CMMA 6FABL 4JFQA 2CUHA 3BP6B 4E0RB 3QG6A 4OAWB 1HN1A 2OLDA 1DP0A 3SOBH 1U3HD 5CJQL 3WIFB 3R8QA 3VU2A 4J4PA 5A3ID 2X5PA 1BZ7A 3S4SG 2IG2H 4RCAA 5GRJH 3VMNA 4Z8FL 2DQIL 3IFLL 1NLBH 5KW9H 4NZUL 5T3XH 5IOPB 1LO4L 4MD4B 1I7UB 3I02A 4W81A 1QP1A 3OXRB 5D1XC 2FX8H 1FNLA 2VXSL 1MNUL 4ZS7H 4L9LB 4QXTB 4Y8AA 4GJTB 2XKNA 3LD8C 3RU8L 5D96B 2F15A 3VFSA 2ZZUT 4WUUE 2IADA 1FFNA 3Q5YA 3I50H 4HUVB 3L9RB 2L4OA 5F1NB 3T0WA 4UI2A 4XPAL 5J1AA 4HJGA 3QUML 1GOHA 1OPGH 1ZK9A 2QQNL 1PX3A 1JZ3A 2NY2B 4YPJA 1FZJB 3C2AL 3QT2A 1AP2A 3MXVH 5IK3B 2HT3C 4MVBD 5L2KD 4K3DL 1JGVH 2VXQL 1XT5A 3ZSSA 1N0LA 3FZUC 3MJGX 3DMMC 3BKJH 5EZOL 2NY5C 3MRDB 5DMGC 1DBKL 4NQXB 3FQWA 4M43L 5CZXC 5IHZA 3FFCB 4NJAL 1ETZB 32C2A 4P57B 4YXKL 3CUPB 1RURL 1CIDA 5D1QA 2XWJB 1FC1A 5E94B 1N5AB 3MC0A 3SY0B 2OZ4L 3GSNH 4HUMB 5F89B 1IAIL 3QUXA 3HB3C 1S7WA 2QSTA 4ONHB 1JV5A 3O4OC 3ZHDA 1N64L 4UBDD 1Q38A 3P0YL 3U1SL 1D5XB 4TNWF 1H3XA 3STLA 1WWCA 3I6KA 5DHVA 1G6VK 4HWZB 5F9DC 3D69B 3WNKA 3TIEB 5HYEA 3UTSD 1NC4A 3BH9A 4XBPB 3FFDA 1W72A 4YLQT 5LGJA 2Q1EA 2FEDD 3O4LB 1C5DA 1PKQE 2NXZD 5DQ9B 3QG6B 3SDCD 1I8LC 2ATPB 4H0HB 1BBJA 1PD6A 2PXYA 5F7YC 2IH3A 4FQCH 4JAMA 5C0AB 1TZIA 2YK1H 3PABA 3HLAA 4JO1H 4PLKC 3QXAB 1C7SA 2W9DL 3ARDC 3UTQB 4JHZA 3N85L 2VXVH 3RVVD 4GG6F 4UV4H 3RNQB 2VLJE 3MRMB 2C4FU 1J05A 4K23H 5F9JA 5ICYB 5KTEH 4UT7H 4M7LT 2GJ6D 4PGJA 4XC1H 4HPOL 1G7JB 3IU3A 2W92A 3VFSB 5F44A 2V6HA 2ZCHL 1FFNB 3CVHA 2MMXA 1QPPA 4N9OB 3RVXC 5IESL 1MCPH 2AQ2A 5C7XL 2OTUA 5IROC 1G0YR 3LS4L 1MH5A 2HH0H 4LSUL 5EOCH 5JR1L 3C8KA 3NH7H 1TJHH 3H9SE 4HV8A 1I9JL 1M7XA 3L5XH 3LPFA 4G9FA 4L9LC 5K9JH 3WS6A 3V5HA 5D96C 4PJXB 2DB8A 1A9BB 2XT1B 5FYJU 1RD6A 4F7TA 2X6MA 3FOLA 1J9CT 5D1QB 3VXUD 4C56B 4HBQA 4UDUB 3CGTA 5IF0A 5EULV 3KXFD 1DL7L 2NY2C 3QXWA 4DJMA 4JM2F 4FQ2H 2HFEB 5IBUB 3F65A 5A2KH 3QUXB 5DUMH 5DEFB 4LLQA 3ARZA 1MSPA 4A6YH 4EKXA 2VSDA 4PJ7A 1RJZA 4Z7WE 1A4KA 5KOVC 2PETA 1W72B 5LGJB 1UFUA 2FO4A 1I9EA 4JDVA 3QUZD 3RI5K 8FABB 2PXYB 2IH3B 4LVOB 4JAMB 3HZKA 3PABB 4P5MB 2AJYL 2NY5H 4NKMB 3HLAB 3KDMA 3EYSL 4L1DA 4PGCA 2ZCLH 4P46D 2FZ3B 5GGVL 1KJMB 2FB4L 5L6YH 2UUDH 5EBMB 1MCDA 4ODVH 3FQNB 2X89D 4JO3H 4HDIA 4R7DB 2KPNA 1CICD 3BKYH 1J05B 1INQA 2DMCA 5D2LA 5INDA 5J56B 1JK8B 3HNTL 1JHLL 2P8MB 3IU3B 1CYGA 2PO6B 4J4PC 2YPVL 3CVHB 4HS6B 3WIHL 5JZ7D 1FLRH 3UX9B 4P5TD 4GRLB 5FYLH 2AV1A 4OQTL 3HR6A 2BSRA 3T09A 3WDHA 2OTUB 1NCWH 4HT1H 1UEYA 1KJ3L 1FH5L 5JHDA 4K7FB 4MA8L 4Q9QH 4KH2A 3L5IA 3JV6A 4HV8B 4MQ7A 5DFVC 5L7XH 4KZDL 2PYED 2NNAA 4G9FB