2CBMA

Crystal structure of the apo-form of a neocarzinostatin mutant evolved to bind testosterone.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
112
structure length
112
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial
molecule keywords NEOCARZINOSTATIN
publication title Structures of in Vitro Evolved Binding Sites on Neocarzinostatin Scaffold Reveal Unanticipated Evolutionary Pathways.
pubmed doi rcsb
source organism Streptomyces carzinostaticus
total genus 16
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2cbmA00
2G0LA 1O5PA 1HZLA 2CBQA 1NCOA 1J5HA 1NOAA 2CBMA 2G0KA 1J5IA 2CBTA 1HZKA 1AKPA 1J48A 4JW3A 2CBOA 2MCMA 1ACXA
chains in the Genus database with same CATH superfamily
4MDJA 1I9JH 4F1SA 2ODHA 5KS9F 1DL7L 3QJFB 4FULA 2AERT 4W68A 1KN2L 1AHWC 4PMFA 2BNRE 4Y2LA 3ZIMA 3KGSA 2AAVA 4UQCA 5IB3B 4QRUB 5HHQA 5I2IA 2UXVA 3K7UA 4R97C 4KRLB 5AVRB 1O6SB 3O3EA 4KX9A 4PJ5B 1IGTB 4AQ8C 4ZMOA 4G8GB 1D5MB 3MXWH 4NCC1 4P5TA 4DGIL 2J72A 5HYJB 4L8BA 1JGVH 2GJRA 9CGTA 2J8UF 3LKPA 2F54A 3UEZA 5DJ6B 4MMZA 4EQ3A 2MPAL 4YDIL 1CPUA 3N91A 1Q1JH 3RY4A 2UY7A 4ZS6D 1YDPA 4KTEL 2A4ZA 5JXEA 1LWHA 2HFEA 4RZKA 1U6AH 4M8VA 4URTB 3VDBA 2GSMB 4D94A 2AK1H 4WCYH 5DK0B 3MROB 2ATKB 3I74A 3OX8B 4S1QH 5IGXH 5GGTL 1UD4A 4YHOH 4KKNA 1C7TA 3I9GH 2NQCA 2EVHA 3QIUC 2IXQB 3QNFA 4IW4C 2QSCL 2JFCA 5DQJA 3P54A 1H6FA 4NJ9H 2O6PA 1T6VN 1S9VA 4GAFB 4APQD 4N2EA 4PJ9A 4XN9A 5GGQH 3KDMA 4LDCA 1G0XA 5I71C 5BUAA 1NDGB 4MLSA 5D7LD 4P2OB 3WELA 3WGVB 1UTDA 4XVTL 5JHAA 3MCYA 3BRFA 2VXUL 2IFFH 2ILLA 1PAMA 3R0MA 4ZS7H 3JVGC 1LILA 3KS0H 3CK0H 4UINL 2R0ZH 2NQDA 3BQUC 1RAMA 4JK0D 1RZPA 4QRRD 1I1YA 1L9NA 1MCFA 2BCMA 3F6IA 1FAIH 3AXLB 4KZCA 4M43H 1CLVA 1DVUA 5DYOA 3V6BR 2CO4A 5GS3A 2O1AA 4NGHL 3ZRSA 3QJHB 4G7YH 4KX7A 3VXRA 1N64L 3T2LA 3UPAA 4AYFB 1A64A 3RX9A 4WI8A 4NNPL 2BY0A 4N86A 4Y16D 5JW4Q 3IDMA 1F3JA 1ZHNB 1GZHC 5I5RA 4WSJA 3RIAK 2CKBA 4UM8B 2XY2A 2O5NA 5K9JH 3BMVA 4N0YH 3O6KL 1EFQA 2PWHA 3KHQA 4D0BA 3G6DL 4Z23A 2VDNH 3NJFA 5AOKA 5TQ0H 4Z7QB 5SX4I 4UAOC 2XT1B 4AQEA 1ERNA 1J5HA 4BE5A 5CWSB 2NNFA 2I5YL 3WD5H 3H9HA 4OCYH 4U1NA 3IFPB 5G2NA 3G9VA 1A7QH 3JV4A 1EXHA 4HUWA 4GRWB 4A2MA 4FKEA 5C07E 1RZKC 3K2KA 4O4YL 4M6OH 2QMKA 3QH3A 4HT1H 2EDOA 1JDAA 1X7TA 3FQRB 1PIGA 4HS6B 3QE5A 3T08A 4G70B 4D0CA 1X4YA 2WKOF 3GT6A 1HNGA 1P4IH 5DHVB 4MS8D 3NIFB 2P42B 3NPSB 2EXYD 5BZZA 1E4KC 2NY4C 4EZKA 3DVFA 4J3BA 5E2UL 3TLRA 1F56A 2HT4D 4G7RB 4PW9A 1MQKH 1F58L 4J3OG 3INUL 1HYSD 1ZVNA 3T77A 4YFEA 3IT8D 3QJQB 2PTUA 4ZTOH 1SUHA 1QA9B 5LGJB 3TZVB 5CD5D 2Q7YA 1HFUA 3RILA 1MG3C 4FQLH 1YN6B 1FL3A 4OZ4A 5HXMA 1FPTL 2PO6A 5L2KE 2WBKA 4X8JB 3WLBA 4PSRA 4UDUA 4TSBL 3PQYD 2NX5A 3LNGA 1JOIA 1G9NH 1JPST 5D4JA 1EXUB 3N43F 5BOZG 3KJ4C 3WMQA 2Y6SD 2BPBA 3LH2L 1O9WA 2PPAA 4AMKH 1YEIL 2FO8A 4AYID 2IPKB 4GSDL 1L5GA 4PS4H 3DROB 4ZMTA 4XPAH 3GSWA 1UYWH 2FBRA 2B3IA 2VXVL 3WGUB 5HY9A 3FH5A 4OZGF 3MBEB 3X14A 4AYGA 4GAJL 4K3JH 3MUHL 2FHBA 3FBKA 3KYAA 5TDOB 4GMTH 2R29H 4GKSA 3ASOB 4XE0A 3E0GA 2XG4A 3GSVA 4DIXA 3CFBA 3HUJE 3II3A 2KL6A 4GRMA 2CCVA 1TO4A 2Q2LA 1WFUA 4OV5B 2EEAA 3QXWA 1KGUA 4LAQH 1RMFL 3HMXL 1QFWL 2F19H 1MHHB 2IAAC 5E08H 4LCCC 1EFXA 1OAXH 5DU7A 3NAAH 1ZK9A 3QDJB 1F4XL 5EHFA 5AB2A 3HZKB 2Y24A 4N2OA 2R59A 1NIFA 2EH7L 5TFSH 3V10A 1C5CL 3IMWA 5CHNA 1AO7A 2DEWX 2WBJA 3SKMA 1T5XA 3ARSA 3IXTB 4Q14A 4KKPA 4PTTB 4UU9B 4NQSB 3ULUF 5D1QC 2ICWJ 1IEAB 5TK4A 3EO1A 4G6AC 3RGVB 3G08B 2IGFL 3C5SA 3HC4L 4FXGB 4U6YB 1HQRB 1SXZA 3WHXB 4DWHA 1YEWA 2BERA 2O5ZL 3DOIA 4JAMA 3HE7C 4JZJC 5JO5B 3WNOA 2A73B 4DVBA 4N0CD 3EO9H 4H5SB 3TBVB 1KJ2H 3SDDC 4E9XA 3O9WB 4X4MA 1TMCB 5KYXA 4UYQA 1EHNA 1VFMA 2PYFB 4HJJL 2NY5L 5HTSA 4LHUD 5KAQF 3WXWL 3ZO0A 2GBAA 1A7BA 2OI9C 5LGYA 5DJYA 5IJVA 4W81A 5KUKA 1IKNA 5A7EA 2QKIA 2JB6B 3QISA 2UX7A 2WBXA 2CDFA 1E27B 4WWID 3W38A 3LSOB 4OLVL 4JB9H 3MJ8B 1JVLA 3A67L 3CFCL 4LSVL 5DFVC 4K3EL 4TPRH 5KBNC 1IFHL 3U79A 4ONGH 3X1EA 4F57L 2PWFA 3RZWA 3FFDB 1U2YA 3L8QA 5SV3A 3RAJH 1P2CB 1Z5HA 5DMKA 3QUZA 2XZQH 3BCDA 4P06A 1E0OB 2EDNA 2CXGA 3QPXH 4PRAB 1M05B 3WEXA 3MRKA 4JRFA 5D2LF 5FYKU 1JP5A 1IEBB 2AXJA 3CVHB 4PJIF 4X7SH 4GKNA 4OCLC 4AMWA 4PTUA 2FATL 1ITCA 4PJ5D 4I13B 4G8GD 1CFQB 3BVNA 5JR1L 2ICEB 4QYAA 4ZQTA 5HYJD 3BVDB 2F9BT 4K5OA 4R3SA 1N26A 4F7KA 2Y4SA 4FFZA 1BQKA 1OTSD 3UC2A 2Z9TA 3LN5A 2K7PA 4UNUA 2F53B 1J48A 1JRHL 2V2XB 2AGJH 3FRPG 4C55A 1KIUA 3MBXL 3UIYA 2M8XA 1X3DA 3DVNB 1VFAA 5HVFB 4M6MH 2P5WB 2ENSA 2DTML 1A9BA 3LV3A 4JQVA 5F7WC 2HFGH 3RY6A 3BOVA 3PABB 1W72H 4TNFA 2IMNA 4NKQB 3W0WA 3V9FA 1A02N 1HEJC 1OD9A 2APBA 4Z8FH 3WS3A 2YMTA 3ARQA 1JV2A 2VABA 3T6VA 3VI4A 5MI0B 1EMTH 2FR4B 1Q9OB 2AXFB 2XXFA 4PJBB 4A37A 5I30H 1CK0L 1G7HB 5E6IB 2V0AA 3VXUA 4DGWC 4P2QB 1RUKL 1JWSB 3HRPA 4J1UA 1XXFC 1N2RA 2AK4A 1PKQB 2APXA 3BX7C 4YLQT 1OAQL 4NZUH 4AEHL 3GSOA 3AT9A 1TTUA 2E7LA 4P2OD 3KLAA 4J8RA 1OAJA 3CVHL 2F8IA 3ZL2A 2YD2A 4QPEA 2F0CA 5FGRA 3H2PA 1DBBH 4XZUA 3WENA 2H2SC 2FNWA 3OR6A 4OCNC 2FT8A 1MHEA 3HZVA 5CZXD 3VFGL 4CADB 1JGDA 1UACL 3LXBA 3IMBA 1RIUH 2YSTA 3GO1H 1FZOA 1KB9K 1PNCA 4A2LA 2R1WB 4OQTL 1CDCA 1NUDA 4UOQA 4YO0B 1HX0A 5CMAB 5F9WC 3UMTA 1HJCA 2X6VA 2VIRB 2ZP9A 2MNWA 1GGCL 4NNYB 3MRLA 1WBYB 2FIKA 2DQUH 3WL9A 2GSGA 3STBA 2QPEB 4IRJA 1QBMH 5TE7H 5D5MB 3SE4C 3FO9A 1HOEA 4TNWF 1YHPA 3IFLL 2J6EA 2MCAA 3OZKA 4XAKD 3X1FA 5I1KH 4OZIE 2GEQA 4HSCX 1E4XL 4KKLD 2KZBA 3L95A 3FQUA 1CU4H 3BZ4B 5KJRH 1B4JH 3OPZH 5F3HB 2HX8A 3DSNA 3QZWA 3O41A 3PG2A 4PBVC 2Q8AH 3TYFB 3L1OL 1I7TB 1PMYA 3BSZL 4GW1A 1A7RH 4HEMA 2PW2A 3MV8E 4KH9A 3VYPA 1LEGB 1ZWIB 1A6AB 1E5UI 5B1JC 4LBEB 2AJVL 1ESOA 3B43A 3CZGA 3QC6X 2KT6A 1FNSH 2B3RA 1N8ZA 2ZWYA 2OX5B 3NZHL 2OMWB 4XPGH 1Q0XL 4KJQC 2R7EA 2R9HC 1KXHA 1B0GB 3EOBA 4KMQA 1P4LB 4HK0B 5INDA 4DCQB 1QFHA 4ZX4A 4PIBA 1B6DA 1I9RH 1X5KA 2EO1A 2SODB 2VAAA 3FCSB 4X6BB 4TQPA 1Q9WA 4HF5H 4HMCA 5J5EA 4AKPA 1EJOL 3TZVD 5KTEL 3DX9A 3H6JA 1F86A 1AI1H 4IHOB 2HT3C 4LARH 4JPKL 4L1HA 5CLZA 2VXTH 3FSWA 5CGYD 1B2YA 2C3WA 4K9EL 3C09C 4ZO7A 1DQML 2W9DL 4IMKC 5E99H 4NUPA 4I5BA 4Y5XB 1MH5A 1BFTA 1E4WH 4LPYA 4X6CF 2MCPL 3VXQA 1WC7B 4JKLA 4GUPA 1PY4A 4J39A 4J4PC 1BVNT 5C1MB 2BOBB 2JKSA 4UMGA 3J7HA 2WN2A 3MBED 2XXGA 3ZKQD 2P8PB 5DJXA 1KJ3H 3FO2A 4PY7B 5IF0B 4MDIB 5SX5K 1SBBA 4XWOC 4WWKC 2YWYA 3FCTB 2VC2H 1S9WB 3K46A 4GXUM 1XIWB 4PWHA 3WNNA 5DJ2A 1MNNA 1MVUB 3P3RA 1DL7H 2MFNA 5CEYB 5DD6B 4H2CA 4BINA 1YY9C 2GTZA 2R0KL 4WK4B 4NUQA 4WFFE 5CAYB 3QDJD 2FZ3A 4XVSH 1DVYA 1ES0A 1A14L 1IGFL 3L45A 4JFDA 5E8OA 1UD2A 3M17A 4I3RH 5CP3A 5D4IA 2ZPKL 3CU7A 3OQ3B 1X9UA 2J73A 1CDHA 1XT5A 3H1ZA 3L54A 2J7LA 1RUMH 1KGIA 4X5LA 1YCSA 2BP0B 5CEZL 5JQ6L 4HUMB 3CLFL 1F45A 2F1EA 4KGLA 4E9RA 3RGVD 3P0YH 4FNLL 2DMGA 1I7ZB 2R51A 1JK8B 5F70A 3UTZB 3WAKA 3QXDB 1MZYA 2L7EA 1NFIB 3R1GL 1FN4A 4P4RA 3EJPA 4M6AA 2GBVA 1AD9B 3A4EA 2IBGA 5DD5H 5GGTH 3H53A 3JWOH 3O9WD 5IVXA 3ZSTA 2GK2A 2MTAA 1ACYH 4F7PA 2IH3B 1CG9B 1JYXA 3KD4A 2AHIA 1JNJA 2P1YA 1DLHA 4OD3L 5D7IA 4MJIE 3OZLA 4HS8L 3QEUA 1SGKA 4JW3A 2YUWA 2Z0UA 2OL3B 2Q6WA 1YYML 2X4PA 3MRQB 2W0PA 3OKNB 3UO8B 5BCAA 1G7IA 3V9EA 3A6OA 3WKML 4HIHB 1E2WA 2VXUH 1GY2A 1K4CB 3BPNC 3O2VL 3QA3A 2BSEA 1WH0A 3C75A 2ZUWA 3KWXA 3T65A 5JOEA 4X42A 2A5UA 3RUGA 2EIEA 4MASA 2PNDA 1IJ9A 1RIHH 1KNOB 3P30L 4QKTA 5IG7B 4C56A 3ZN6A 3LQZB 4JY4A 4MRCA 3O3BA 1MJJA 4RZCA 4AUJA 3QHZH 1JL8A 3Q3GB 3V4VB 4BFBD 5K39B 4DETA 3ILPA 4WUUB 2DBLL 2ZXWB 2F6AA 2A6DB 4NGHH 1HHHA 3MLTA 3VXSE 1KCRL 2VITA 3KPSB 5IQNA 4L8CB 4PJCA 2CJ3A 1ZLVH 3L3JA 4NNPH 2CA4A 4IKLA 3KYOB 3NQIA 4IBSA 1BQRA 2FBJH 2F53D 3O6KH 4Z76B 1KLFB 3U6RB 4WRLA 1FGNH 1JWMA 2SEBB 4LKCB 4KUCF 4I0KA 1BF2A 5CGMA 3RWHB 2JSFA 3BESR 4XP4L 2P5WD 5A2LH 2AW2A 5LAPA 5T1JA 2Z7WA 2I5YH 2KI6A 4PS8A 2Y9RT 3CFEA 4DGVL 4TTDD 3PIQA 5G4OA 3T8XA 1Q90A 1BFOB 4YSRA 4O4YH 5JHLL 4GG6A 5E6ID 3L1GA 4RMTA 2F7QA 1TQWA 4FYQA 4P2QD 2OCCB 3L5WB 2WGNB 3FHAA 4E41D 2NCEA 2I7OA 3TO2B 4DAGL 4HP5A 3V4VL 1J1OL 2WWMC 3U9WA 3WSQH 2YBRB 5CP7B 1INQA 1QWHA 4ZSOA 1FG9C 1JPFB 4XX5A 1FVEA 1R3LA 2NY2C 2Z8WC 4N2HA 4PGCA 1F2QA 1HSAA 2HLFC 3SPCA 4XP9L 4L29B 5AZ2L 1KTRL 4ZMPA 5B8CC 4XPFL 2QSQA 4HKBA 4HFUL 3AXIA 5FAAA 2BOLA 3HBPA 2H9GA 1KCVL 4HK3J 4R4FH 3V5HB 3WKYA 2AXGA 3ARYA 3B9KA 1NCDL 4GRWH 1AZCA 3L81A 3BEVB 3I84A 3Q9PA 4PI0A 4XPTL 3FRUB 5A2JH 3DTUB 5L9DH 1DVFB 1MSPA 1YEIH 4CILA 1G6RA 4RMSA 3QIWC 4PYHA 1L6XA 2X4SA 1VLXA 4L23A 4RDQG 1FNEB 3FZUD 5DK2B 4ODHL 3VGEA 4F7TA 3CDFA 5DHVH 4DP8X 5J9PA 2CJUL 2DAVA 5FIEA 5DQDL 2QR0A 3MU3A 2YEVB 4CJ1A 4KI5D 3KPOB 3WJJC 1U8PB 5FK9A 1TOXA 4QXGL 4J28A 4ZJ9A 2DI8A 3RDTC 3GMPA 1EHLL 3GXDA 4KC3B 1MIML 1B6UA 1M1SA 1M7DB 2GFBB 4XOBA 3TWCL 3OHXC 1V7ML 5EU4A 5KJ4A 1RMFH 4H1LG 2CM5A 3WY3A 2V2TB 1CFNA 2AP2A 2FCBA 5LUMA 3MGTA 4PRIB 3VVWA 1F4XH 1JYWA 3O4OC 1FCGA 1G9MC 4A2GA 4MBOA 1EO8L 1CDUA 4ZQKA 1MQ8A 4M93C 1C5CH 5HYSB 5E00B 4Y9EA 5TPWH 2XBZA 1TJGH 2Z31B 3HN3A 5AW7B 1DQQA 4P3DB 4JM0A 4IIZA 2FGWH 4G7SB 2BZCA 2EDXA 2IGFH 3KR3L 4U0QB 1CMOA 3LZOA 4ZNEA 1UOVA 4WK2B 3MRGB 3FU3A 5I1AB 2W92A 1MXGA 5F88B 4OR1A 3HAEG 1JVOA 3ZDXE 1MCWW 4ES9A 5IK3B 3TJEH 4IK7A 4AJYV 3B2VH 5CEZD 2OK0L 5J57B 1MJUL 2YPLA 2UZYB 4HJJH 4KHTL 1MY7A 4L4JA 2CD0A 1ZSDA 3D12B 1HZHH 1EZVY 3N6YA 3SKJL 3HUJF 1YMHA 1F8TL 1DVTA 2I85A 5JDSB 3D25B 4LNVA 2NR6C 1MXDA 1NCHA 2EXWC 3GSXA 3B2UC 3KL3A 3OKOB 4D9LH 4K3EH 4FLOA 4QTIH 3SYPA 1ZCRA 4M8RA 5EN2B 1XIWD 5KBMA 1E28B 2BZ7A 1P4UA 3CNKA 3UPRB 1A6UH 4KXZI 4RRPM 4LEOB 3PWVB 4LHUG 4JRYB 4UBDC 5D72L 4AK1A 4Q6IB 1UWYA 4JPVL 3D69B 5JPNA 2GJZB 4DPCX 5GSRA 4KJWD 4PD4J 4QTHB 3LPPA 1N18A 5C0GA 4J7RA 2YZ1A 2EINB 3FOLA 3OG4B 3TXAA 4QJ4B 1YEGL 2CO3A 3ASNB 3GMLA 3ZHFA 2VLRE 1ZHLA 4WHYG 1JNHB 3WEMA 3G5ZA 3CHRA 4HEPA 4FFVD 3OAYH 2EVIA 4IRSC 2D0FA 4K8RC 1QR1A 5FO8B 4M8QA 3VFSA 1PW3A 4AGQA 2FWLB 1D9KC 4U1IB 5I0XA 4MA1B 3WIHL 1QLEB 4NZRH 3ZL1A 3AS3A 2NUTA 4NPYB 2JK5B 3TJHD 4RDBA 3GZQA 4YHYB 5DMGD 1ZMYA 4KK5D 2VUYA 1QAWA 3WTYA 1IQDB 1CK0H 3WS6A 4DEPC 1I7RB 4LNRB 4NQCB 4KKCD 4YC2B 4U2ZA 2NXZB 3QYNA 1VENA 4AQ1A 2UYLB 3V5DB 3D5OF 3G9AB 5JHDE 3BAYA 3BD5A 5EFIB 2BW5A 3F2LA 5FA3A 3UEQA 3O0RL 1J9TA 1LWJA 4R96A 1EHAA 1LK2A 3IDUA 1H3XA 4G8IA 3PWLB 4GQ9H 3ZGHA 1MCDA 3U4KA 2EYSB 1XGYH 4MDJB 1ORQA 4N3UA 4TUKL 3NVQA 3UAJD 2RALA 4MHHG 2IWFA 3VFGH 1JE6A 4YDLC 2Q3AA 4CGTA 1YQ2A 5HHQB 4UT9H 5I2IB 4B3EA 4WUUD 2WYHA 2WXFA 5DZPA 1L0YA 3O3EB 2BHUA 4M8UA 1GGIH 3NCYP 3GKWH 2KDYA 4P5TB 4HJ0C 2WLZA 2DYRB 4U31A 5JORA 1LK3H 3KPSD 3MGOA 4L8BB 3SCMA 2DPKA 4GKZA 3LKPB 2F54B 3WN5C 4GG8A 2JELL 4MMZB 1NMCB 1UGKA 2J4WH 4X80L 1SVZA 2X3BA 2E9BA 2UY7B 4BIKA 2D7TL 5E2TH 1YDPB 5GS2D 2HFEB 3WFEL 2G9KA 4ZDHA 4W6XB 2AJUL 2QGEA 2PTTA 3X12A 3T0DA 1E4XH 3RFRA 2YQ3A 2DF3A 1JD7A 3TF4A 2CGYA 4MYPA 4G6FB 1CD9B 5DVPA 2BSDA 4JMNA 1HVXA 5DQJB 5GZND 3RVXD 2WUCL 1J0YA 1S9VB 1UURA 3EO0A 1NBVL 1EVTC 4J6RL 4PJ9B 3THMH 3KDMB 2AJVH 4LDOB 4FQXA 5IFHH 3M46A 1BQHG 1Q0YH 4BKLA 5T1LA 3NZHH 4FG0A 4IU2A 5EC2A 2K78A 4XN8A 2IJ0C 4R0LC 2ITCA 3FH8A 3T04D 3VG0L 2MEJB 4IOSD 5F7HA 3CQPA 2H26A 3L13A 3CJJA 5B3SB 5DZAA 5ACMA 3U4BH 4ZZKA 5AOJA 1I1YB 1NDMB 4YDKH 1MW0A 3MGAA 4P46A 5DYOB 5KTEH 3ULSA 3QZNA 1FWXA 2EE2A 4J3OC 4U1SA 3VXRB 3CDYA 2YGNA 2VWEE 3QQ3A 4HCFA 4QLRA 3WUWG 3GEWB 3B34A 3ETBF 1KC5L 1K8DA 4FQCH 3DX7A 1QSVA 4OZIF 4Y5VC 3HNVH 1F3JB 1SEBA 3IDMB 4HSQA 5EN3A 2PCXA 2W9DH 2CKBB 3SJVA 2J56A 3EOTH 3CQQA 3VSTA 4D0BB 3BYYA 5IWLC 4OJEH 2OJZL 3O6FA 1QRKA 2NZ1A 1E8XA 2MCPH 4QRAA 4AQEB 1U3HC 1DVFD 3FUIA 2F53E 4U1GC 2L3BA 4LK4A 3B37A 4F80A 5LNEA 3B1TA 3H9HB 4U1NB 3UPCA 1PLCA 3OSVA 2WZ6A 3JV4B 4NCDA 4HUWB 1ZTMA 4P2RD 1DO6A 1F3DJ 2MRYA 2P5WE 3H2QA 4PJHA 4CVZA 1E50A 2IBBA 3DNKA 4S1RL 5KSUA 3QH3B 3L5XL 4OF0A 4ANVA 4G7VL 3MACL 3V4UH 2GPZA 5EDXA 4N2FA 2RACA 1JXKA 3JUYA 4D0CB 2XYBA 1OIOA 4XMVA 4HXAL 3SE3C 3SYOA 5D1ZI 5FYJL 4XMWA 1NCBH 3QW9A 4L3FA 4P2QE 2A7BA 2KZWA 1S7XA 4PRID 5E0QA 4DHLA 1PKQE 1IGFH 4FZ8H 5GZOC 2CJSA 3V0EA 2OQJA 2UXFA 4M7ZC 4BV1A 2KDGA 2Z31D 1FV1B 3T77B 2PF6A 5DMJB 5K9KA 2R56H 4Y1AE 3UG4A 5KJ7E 2R4SH 5PAZA 3LRSA 3CHOA 1CICC 2VMCA 2B16A 3KYKL 3P11H 3ZW3A 5F7FA 2Q7YB 1T3FA 1FL3B 4OZ4B 3GRWL 2PO6B 3QJOA 3IYLW 3U36A 5E2JA 1OT4A 1LD9A 3DKHA 4IIQC 2WIIA 4PS3A 1VGKA 4UDUB 3WLBB 1ORSA 3KBFA 2NX5B 5HD8D 4K5MA 4DKEL 4HHWA 2I25N 4Z78A 1SMOA 3RL2A 1UJ3C 3CFKA 4FERA 1A5FH 4ZPVA 4AUYA 3D4GA 1L5GB 1FP5A 5D5ME 4JO4L 4A7GF 2C8NA 3DUSA 3GSWB 2BNQE 2XHNA 3WKMH 3NCJH 5HY9B 4KUZH 3ZHNA 2MOVA 1EERB 3X14B 1OSPL 2PPDA 4KXDA 4OLYH 2V9UA 3KMDA 5D2NC 2YZ8A 2P80A 3QRLA 4GKSB 3KWWA 5GSVA 3WNKA 2F7RA 2XG4B 3GSVB 4I4WA 1J87A 3CFBB 4LSRH 5BO0D 1N0XH 1WYJA 5K5YA 4GRMB 4WO4C 3UDWA 4POZD 3CX5K 4LSUL 1IAOA 4JRYD 4MMYA 5E6SB 1EFXB 1W2KT 3GJFK 1R5WA 2DIBA 2WVUA 4Y4KA 5AW8B 4ALAL 2K45A 1MLCA 1KCSL 4UNVA 4OFKA 2AZAA 4FXTA 1BLIA 1KCRH 2EIKB 1AO7B 4X6DF 2WBJB 5CHNB 3SKMB 4AV4A 1T5XB 4C4BA 5JA9A 3O8XA 1NSNL 5DR5L 4HJTA 3EO1B 4WY7H 3C5SB 3GNMH 3ARXA 1HKLL 2EDMA 4JAMB 1ANUA 2G3ZA 2X70A 3R4RA 3NSJA 2OL3H 1TYJA 1BV8A 2XKSA 3S88H 4KJPD 4DVBB 5FHBH 4LIQH 5EEZA 3I3BA 4TQHA 4XMZA 1PZSA 2IH9A 2RMNA 4G80A 4F37F 5KYXB 1WZKA 2VZTA 4CJ0A 4N8PA 3EYOA 3ZR6A 4YQXL 2Z92A 2GJ6A 4XMLH 1EA9C 3ZL4L 2F5AL 2OTWA 4NQCD 4I89A 1J5CA 5DJYB 2NXZD 1UUSA 5IJVB 2CG9X 2FT6A 2QKIB 2AMUA 2CRYA 1AACA 4ZMVA 2EO9A 3Q2VA 2CDFB 2BIOA 1E6OH 1PEWA 3CXDL 4APXA 1ILUA 5AYQA 2XKUA 3EW3B 3CHSA 4WWOA 1COBA 3S2AA 1ZANL 1WITA 4Y88A 1TF4A 4ZFOA 3TPUA 1NWPA 3QORD 5I73B 1YUHA 1R0AH 4M5ZL 3E3QE 2XQBL 5JUEL 1SJVA 5DMKB 3QUZB 4QHNA 3OB0H 3NSXA 3FTZA 4N20A 4G1MA 4QGTA 5D55A 2DQCL 3WEXB 3MRKB 2XTJC 2BX5A 1BXUA 5GS2H 4Y4FA 2E5EA 4HFUH 1ACZA 3LS4H 4GKNB 3GMQA 4PTUB 4J27A 1C7SA 4CSPA 5DEZA 2FWUA 2FSDA 5CXPA 2HTLD 5BO1L 4WJ5A 3BVNB 4P5TD 2OCJA 4UV7H 2XETA 4R3SB 5C2UB 2XN1A 1UWEL 5J6HA 2F54D 3IMSA 2Z64C 3LN5B 4BZ1H 1N6VA 5FUCE 3GMMA 1I1AA 1P69B 4DPBX 1CFVL 1C16B 1EGJL 1NIEA 1GGUA 3F85A 1UKQA 1KIUB 4HJIA 5JXED 1HIMH 1VFAB 4CKQA 4FQQA 1A9BB 5BUGA 3LV3B 2QBWA 2CBPA 3WDJA 4ODHH 3VH8A 3W0WB 1G4MA 4HS3A 3WS3B 5DQDH 1JV2B 3VI4B 3KDPB 3OG6B 3TBSA 3MCLL 1MG2C 4G6FD 3MZGB 4XPBL 1SY6H 4QXGH 5EZIH 3VXUB 3IDYB 4FNSA 3KJ6L 1OPGL 5ILTL 1EHLH 4J1UB 4GW5A 1MIMH 4JDTH 2AK4B 1N2RB 5F7LB 5C09A 2PP9A 5FM5M 3TWCH 4KZEL 1M2OA 4PJ9D 4XHJC 2CSPA 3DVGA 4Y5YA 3GSOB 4F15B 3QCTL 4H44C 4BZ2A 4WHTA 4LCWA 4G9FA 1R3IH 3KLAB 2EE3A 4J8RB 4K71C 4HCRH 4ZFZB 4LIQE 1BEYH 1OK0A 4LGPB 1IC7L 4Z0BL 2NW2A 5DEGA 4QJ5B 1OWWA 3LQMA 1KYAA 3SIKA 4N24A 4UTAA 4OM0L 3H42L 4YPGA 4HUVA 4XZUB 4Y2DC 4TMPA 3OR6B 5AVTB 1MHEB 3HZVB 1NOAA 1JGDB 3ULVL 1KZYA 4NCC2 2CAKA 1FZOB 3SQRA 1MCSA 4P48A 1L9SA 2DQTH 1NLBL 1T22A 4PP2B 3DX4A 3EZ8A 3N44F 4KFZC 2GYSA 1QVOA 3KVPA 4XNUH 4BQBA 4FQ1H 3EYFA 4Q52A 4FX5A 2V7HA 3WFDL 3VXRD 1I8MB 1QSEA 3MRLB 2FIKB 3TM6A 1IKOP 1UOWA 2IWEA 2W8CA 4JFZL 4HJGA 2OK0H 3LN9A 3WL9B 4LSPL 2GSGB 4IRJB 4FRWA 4HLEA 4D7BA 1MF2L 3KPSE 2NYZA 3FO9B 3VWKC 3OQRA 4NT6A 2R2EA 5DVKA 5CUSL 2Q8BL 3ML9A 4XMPL 3BI9X 4HIJA 1AQKH 3WY4A 1VGEL 3WN6A 3L95B 4H8QA 2VE6A 3FQUB 3GLEA 1BMGA 4BXVA 1CI3M 3DSNB 4W93A 3QZWB 3O41B 5BRPA 1WHPA 2Z35A 5B1KA 3RPKA 3AY2A 4GW1B 1QI5A 3PGFL 1HJBC 2PW2B 2LV4A 3H2WA 3MODL 2D4FA 4S2SA 5C0IA 4UYPA 1FNGA 2OMZA 3ZHDA 1N8ZB 4WFHE 3IEAA 1JVKA 4A68A 1ZVSA 2R7EB 2DM4A 5J8OA 4FDWA 4R5XA 2RD0A 3EOBB 1VJSA 1IVLA 5INDB 4WV1A 4JN1L 4PN6A 1XSKA 2VAAB 1Q9WB 1RU9L 4FI6A 5LXGH 1SFDA 3OF6D 5IVOA 3ZDXF 5IHUH 1JGLH 3IDGA 1T5WA 4YZWA 1IM3A 2DN7A 3DX9B 3AAZA 1RPQA 2P3YA 4HPOH 5I8CA 2J6EL 3QXVA 5FM5O 3MV9A 1QATA 1KLGA 1TT6A 1BAFL 2OW7A 4P2YA 3H6AA 5L4JA 4LGRB 2NX5D 1IE4A 3R7QA 3UTTA 1KGCD 5AVWB 1BZQK 1A7PL 3TBCA 2X1PA 4I5BB 1MH5B 3RJOA 2YA0A 1Y6MR 4AWJC 3UBXI 5H37G 3VXQB 2V8MA 4GUPB 2YA2A 4XCCL 5J1AA 1V5JA 4WW2C 5JA8B 2WUBL 2DYSB 5E7FA 3UGXA 1SOKA 3GTVA 1JYVA 1SNRA 4FFTA 2D3NA 4F7MA 1G5GA 3UBHA 5D93B 4JREC 5DJXB 3GS4A 3FO2B 4Q6KA 2I60L 1CIUA 3L7FA 3PE9A 5DJ2B 3D48R 3MLYH 3V2AR 4CC1A 1F90L 4TUKH 1ZV5A 2GTZB 3FO0L 2X4RA 5AW1B 2XJKA 1EFXD 3RGBA 3MLWL 2R0LL 2ZONA 2B14A 2FZ3B 1ES0B 4JFDB 4HOZA 4JUSA 4PVNA 3M17B 5E8OB 4Q58C 3CSBA 1LO3L 4QLWA 1AO7D 1QLEH 2WBJD 4RETB 3CSTA 4F7CA 4X8CA 4P04A 4APQC 4ENED 1U8QA 2NUPB 4XXDA 4UIKL 3UC0L 3SDCD 2TSAA 1QACA 5H4YA 4MJHA 1U42A 2D7TH 2VERA 2VDML 4N2DA 3H9SB 3EYQD 4Z7UA 1NGXA 2ZOLA 3WFEH 1Z1WA 5EZJA 5I18L 1FN4B 2AJUH 4M5YH 5GS0D 4P4RB 5DUPH 2JI1A 5D7HA 5D71L 1DBAH 1EEZA 1DBJH 3PHSA 2DDQL 4NOFA 1CGSH 1BZ9A 1VIWA 1VZIA 3N1FC 5IVXB 4F7PB 4GQRA 4ILDA 1DLHB 4JFYA 5D7IB 2EEFA 4G72B 3QEUB 3UZEC 2Q6WB 5AD0A 4PG2A 2X4PB 4LOEA 1H15A 1G7IB 3HNSH 4AGPA 3DV4A 3ZUCA 3AU0A 3KBEA 3BZEA 4Z9KB 1UM4L 4Y16C 1YNTA 1T66C 3QA3B 1PZCA 4OFYA 4QOKE 4R7XA 4DESA 4DN3H 2YUVA 3T65B 2K8QA 5JOPD 3VG9B 3RUGB 3V6OE 1HHGA 1TLMA 3JWNG 2J1ZA 4YSEA 3Q44A 2NNCA 2DH2A 4C56B 1U8KA 4BXSV 5F7DA 5IFAL 1U2CA 5HBBA 3REWA 4JY4B 3O3BB 1JCVA 1MJJB 4RZCB 1UZGA 4OZGA 3EADA 3IPFA 3IN2A 4W9FC 3GUTA 3C60C 3ILPB 1MCKA 1CR9L 3BH4A 4A7UA 1HHHB 3MLTB 2EIZA 4DZBA 5CJXA 3QAZB 2VITB 1MPAH 4HAKA 4AITA 4PJCB 3L3JB 4CRPA 2F7OA 1OPOA 4YJZL 1XD0A 1IV8A 4O02L 5HGBA 2WKGA 2VLLA 2P8LA 2Y3NA 5IESL 2EXSA 2J6WA 4PGBA 3VB9A 2JJUA 1JWMB 2HP4A 1KB5A 1T0PB 4LAJH 4FNQA 2LHAA 1JZDC 1VB9A 2XUWA 5KN5A 2HT4C 5F9DC 4IOFC 5DHMC 1QKZL 3CFEB 3ZSSA 1HYSC 4K23L 3PIQB 5EO0A 3T8XB 3TEXA 3I02A 2WV3A 3W0WD 4ZFGH 1AJ7H 4Q9BA 2D2OA 3WTUA 4NXKA 1UD6A 4LXFA 5F96H 3QPKA 4EMZA 1YYLL 3CC1A 4GG6B 3HG2A 1OTUD 4HIXL 2R8SL 3VXUD 4D3CH 2Y7QA 5CIPA 1E6JL 2AK4D 4HXAH 2XIBA 3ZT5A 4XBEL 2VUOA 5FX3A 1FBIL 2BSSA 1CXEA 3NACH 1FJ1A 3VFTA 3VFVA 1MCLA 5I8KL 3LEXA 1INQB 5L8KB 4JRXA 1CZ8L 4ZSOB 1NPNA 2Y6SC 1FVEB 1R3LB 4PGCB 1HSAB 1TJIH 4LSSL 4H8WL 1MHCA 5IJKA 4KAQH 4NWTL 1T83C 1DBKH 3EH2A 2EDQA 2CKBH 4PY8I 2W65A 3KS0J 4CAGA 5BRZA 4HKBB 2VN4A 4HOXA 2J5LB 1UD5A 2H9GB 2NNXA 1KCBA 4ELME 5FGCE 3U4AA 2AXGB 2WNKA 3B9KB 1SQMA 3D34A 4TULL 2XXCB 4HD5A 4HETA 2BH0A 4IRJD 3CZNA 3BW9A 1L9TA 3BJLA 4UTBL 4MZ2A 1WCBA 4R4BA 3RVVC 1G6RB 1XBDA 2IANA 3WOVA 5E9NA 3DO3A 4ZO9A 2X4SB 2DH3A 1ZGLP 4F7TB 4ERSL 1CURA 1TYRA 1HE8A 4BRJA 5J9PB 4PJBF 3VU2A 5HI5C 2BFVL 4U6XA 4LOVA 2KBGA 3KVQA 4NQDE 1MVYA 4HUNB 2OSYA 5FK9B 4OSUH 3GMPB 3VWJA 3OLGA 2X4NA 2EXTA 5HHOA 1E5ZA 2JI2A 5M7QA 5EU4B 4N1HB 1CFNB 1CGWA 4GRLC 3MGTB 4HWBA 3TESA 1XGTA 5A2IH 3TPKA 3G3LA 4D9QD 4EIUA 1AG0A 2CR6A 5AVYB 3D3VE 4ZQKB 2HCZX 4HPYH 3VO0A 4XXWC 3HLAA 1HEZA 1DQQB 4AGLA 4NKIL 2OS7A 2WOBA 3LKOA 2R4RL 3FT1A 5GJTH 3US9A 5I6PA 1QZNA 3H4FA 4N2NA 1OE2A 2EC8A 4KZDL 1K6QH 4NN7B 2O61A 1R3JA 2K6ZA 1KUMA 1WZLA 2DICA 2XBDA 5MEQA 4DERA 4X2UA 2AI0L 2ADFH 1K3IA 2X2HA 3OGOE 1OGTA 2VDQL 3QJTB 1NAML 4N2IA 2VNCA 5D5MF 1CXFA 4QRFA 2PR4H 1MNUL 2EJ1A 5CJ5A 2YPLB 2O26U 5CBAA 3V79C 1QSZA 1IILE 1S9KC 1X5GA 2F5AH 3P4OA 3LNFA 1ZSDB 2WY3B 5GXBB 1ZEAH 3AC0A 2ZG3A 2DMCA 1MFDH 1YMHB 3CU1A 1M9WA 2BVQA 2JKIS 1SVBA 2P7TA 3QRFM 4YDJA 3GSXB 3IU3A 2IDCA 3ZE2B 1OTSC 5KBLA 2X05A 2QFRA 1I3VA 3FXIC 2MJWA 5DC2A 4N8VA 5AL8A 2XQBH 4JFXA 2YIHA 3UCRA 1LM8V 3BKMH 2JJSC 3TH3T 5JPNB 1WWCA 1A7OL 4NN5B 1JXFA 3L4TA 3VGFA 5GSRB 3OWRA 4JFDD 5C0GB 3JYBA 1XB8A 1RK1A 5GS0H 4H0IA 5BO1H 1S7SA 2Y1YA 3FOLB 3HZYA 1N6QL 1NCNA 2EICA 4JMXA 5L88H 1UWEH 3GMLB 3RWDA 5AB9A 1EAPA 1ZHLB 2A83A 3G5ZB 4WFEE 1MCOH 1RLWA 5BW7A 1AAJA 4A1RA 1QR1B 3IPEA 3OXSA 1JZ5A 4MCYA 4M8QB 1IB5A 3H9SD 4K94H 3VFSB 2DQFA 5AOMA 5C0ND 1AGFA 3HR5A 2ZJSH 2GCYA 2KLTA 2NUTB 3S36H 1ZDSA 2XACC 4RMRA 2WHVA 2UZIH 3RIKA 3H9YA 5G5DA 5CZXC 3NFNA 5DVLA 4CSTA 2AVFA 4PM1A 4G6ML 2CMRL 1JZ6A 3WTSA 4DO5A 5ILTH 4NRZA 4AQ1B 3QAQA 2EIBA 3UYPA 2ITFA 3G5XA 2XZAL 1I8UA 5CR8A 3C2AH 5HVHC 5FA3B 5ALBH 1SF5A 25C8L 4ZW7A 4PQXA 4HIEA 4R96B 1LK2B 2BSED 4G8IB 1EHXA 3QP3A 5DRWA 3WTXA 2J2ZA 2N3JA 5D7JA 2DY2A 3MLRH 4YAQA 1XTMA 4E5XA 4C56D 4BKTC 2RQ8A 3NA9L 3SD5A 3UADA 3MLZL 4FFZH 3CVIH 1YLBB 4X99A 4KKLC 3NYKA 1Z6JT 4JM2A 1SJHA 1JG9A 3I50L 3IRPX 4RWYH 3C5JA 1GJWA 4PGJA 3WFDH 2YAEA 5JORB 3MGOB 3SCMB 4FQJH 4GKZB 5EIQA 1XDTT 4GG8B 2VZVA 4C54A 4LSPH 1T2XA 2C1PA 4NXSA 2ARWA 4R84A 3QEHA 3PWPA 2EC9U 1O7DE 2CK0H 3RJQB 2ATAA 1SMDA 3QCUH 1BFVL 4ZDHB 1F6AA 2Q8BH 4N0FA 2PTTB 1BGXL 1LQBC 4XMPH 3X12B 5JIQA 5MEPA 1G87A 4TLUA 3GI8H 1HHIA 2C3VA 3BWUF 1HK6A 3DRQA 1TEYA 5DEFA 4BHUA 1G7JA 1BG1A 3K8MA 1B3JA 4Y1TA 3ZDYE 3EO0B 4CU8A 2UUDH 4FQXB 5AEAA 5LVEA 1EAQA 4OZHE 1L6PA 5CJOH 5E51A 4BKLB 1SRDA 5T1LB 4IU2B 5EC2B 1L9MA 2KQNA 5CGYC 5ICXA 2ITCB 3U83A 4F3FA 5KANI 5SX5H 5D96C 3NIGE 3PDDA 2H26B 1MIEL 5CU9A 1MRFL 4GEJA 1N5AA 4LLQB 2FYYA 5I19L 1TFPA 4JN1H 3LRHA 1K85A 1GVIA 1URLA 4JUTA 1RU9H 5G4NA 2OYPA 3FTWA 4P46B 4NO2A 3T3ME 2B0SL 2BNRA 4XNBA 1CGTA 5GPRA 3ULSB 1GMIA 1JPEA 2VR7A 3DECA 1KB9J 3MBEC 5CGBA 4L9DA 1DDTA 3K74B 2HRLA 4U1SB 2BVOA 2XWCA 3QQ3B 4IHBA 4N26A 4YWGL 3ZKND 2NY5C 3CH8A 1K8DB 4WI7A 3DX7B 1UT1A 4FL4C 3NABH 3B9KD 3BD4A 1SEBB 2B4CH 2R0WL 2WQXA 1KTLA 1P1ZA 3SJVB 2ZUVA 3N41B 4WVRA 1OAYL 2WKLA 2WSPA 4ONHA 5CF3A 5JYLA 4JM4L 3O6FB 2ZOWA 5F1NA 4D8PA 1T5KA 5HDBB 4TTGA 3IPBA 1ZKAA 2B1OA 2WUBH 3O2DA 3KLLA 1TCMA 3V8OA 1KOAA 2JLPA 2WVTA 1UWGH 1P6AB 3TF7C 1DTUA 1VEPA 2WLMA 3OXRA 4KY1H 4PREA 4F2MA 3DO7A 4CVZB 1NWOA 4PJHB 3ESMA 4LKXA 5EORL 3I6KA 5KSUB 4UV4L 1JNLL 5EZLA 3RGVC 3WIIL 1FVCA 3W0WE 3GZOA 1HSBA 3LKSA 3GRGA 5KSAD 5FO2A 1JPSH 3DTXA 2YEZA 1HYRC 5AYUH 3SPIA 4X5WA 4LLAA 3DX2A 3FO0H 5DMIH 3VXUE 1T7ZA 3MOAL 1S7XB 4GFXA 3MLWH 2R0LH 4LSTL 4X98A 4NM4L 1CXKA 4KH2A 5C6PB 1LO3H 1RK0A 2OQJB 4W9HC 1NGYA 3PY9A 4O9HH 1S7UA 5D1XA 2ENYA 5K9KB 3KLHC 2Y72A 4JFEE 1F5WA 2V5SA 3VGHA 3KGUA 2XICA 3LRSB 1CLYH 1Q9LA 3A47A 1GKEA 2KH2B 1PG7H 2ICCA 4XVOA 1T3FB 1UA7A 3ABZA 1NMAL 3SBPA 2ZX5A 2XQ0A 5I18H 1BBDL 1VPOL 4LRIC 3U36B 1RZKL 1LD9B 5CU5A 2Q76A 2WIIB 1VGKB 4M3KB 1ORSB 1RSYA 2NXYB 5I17A 2B7DT 6TAAA 4BQ8A 2WQSA 1ONQA 2ZWZA 3MOBL 3EJQA 4OF5A 4LLYA 3ZYOA 2Z4QA 4Z78B 2E74C 4FJ6A 2R2CA 2YPLD 3NCYS 2C9AA 1T4KA 4OJYA 5JQHC 1A4KB 3RL2B 3CLEL 2C4FU 3LX9A 3AS2A 3CFKB 4YHIA 3NCBB 4ANKA 4ZPVB 1X9LA 2X0VA 3RZCA 2VR9A 5JXAL 2VQ4A 3DUSB 1UWFA 1V55B 4OD1H 1E30A 4RMUA 4TN9A 1UM4H 4F9LC 1A0QL 2PUQT 3SGEI 5GSVB 3KWWB 5CP3H 2IIJA 4I4WB 4PHZA 4BFKA 3DURB 1XZWA 5C07A 4P59L 4YE0A 3OLIA 4W9DC 5IFAH 2LTQC 3QRBA 3V0WH 3X1BA 3B7RL 3NTCH 1IAOB 1S3RA 1S46A 4MMYB 4HEME 4QJ3B 1UUNA 2F61A 1R5WB 4B53A 1WT5A 4Y4KB 4TTDC 2IPUK 1MLCB 5C0FA 4OT1H 1EBAA 1YEKH 3GHPA 4M48L 5T3XL 2HVJA 5E6IC 3L1EA 2C7UA 1TIUA 3O8XB 2QVTA 2WLIA 3Q5TA 2FX7H 1OAKL 4RBPK 3RIFF 1CDYA 1M53A 2X70B 3GBNL 1NCJA 2E56A 3GSNA 4WNSA 5FF6A 4HG4J 2ZKYA 3KM1A 1R33A 5L2KA 3QUMA 1KEGH 1NQBA 4K23H 4G80B 4Z1PA 2XV2A 3EYOB 1NEPA 2A9NH 2Z92B 2GJ6B 5TH2A 1FZMA 1BZ7A 2OYKA 1YYLH 3FQXA 2O5YH 4KDVA 1AYOA 4EDXA 2OTWB 5CLWA 5HI4D 4AM0Q 1QBLL 2MOGA 1Z9LA 1E6JH 1F0LA 3GXTA 3HC2A 3N2JA 1NUNB 4XO5A 3ARFC 2VL4A 3HHSA 4APXB 4YSTA 1HKFA 4JG0L 1YUKB 2VMEA 4GAAA 5GRJL 4EUPA 3GDCA 4HGWA 2ICWA 4KO7A 5I8KH 3EJJX 1CF8L 4XZ4A 2OZNA 1JPTL 1CZ8H 4ZFOB 2R69L 3HG4A 3TPUB 3VRLE 5AFAA 3AQDA 3QYMA 1YUHB 4LLWA 3HUJA 2WB1A 4K0OA 4X5QA 1ZIBA 4LSSH 1CGYA 1JGUH 1IRAY 4XVJL 3T1FA 4MNQE 2XOTA 4QHNB 1KCUL 4G1MB 3L48A 3LS5H 3L3GA 1B90A 1LE5A 4ZMQA 3IMTA 4Y4FB 4CMMA 4YHPA 3GMQB 2NCMA 3DV6A 4E9YA 1YEEH 3JWDH 4KI5C 3S8WA 3MFFA 4WJ5B 1AH1A 3L4UA 4QRBA 5DK3A 1JZ7A 2G2RA 3EJCA 4JFDE 3SCMD 1BF8A 3X13A 4AG4L 4MMXA 3MLPA 4DP4X 2UWEE 3GMMB 1I1AB 1I3GL 3BP4A 1H8NA 5LCVL 2V3FA 1Z2KA 5FCSH 2CIKA 5DD3L 2IFGA 4FQQB 5KVFL 2OSWA 4P3CL 3U6XA 3VCLA 4JPWL 4IBQA 1T7XA 3RHWF 3EH3B 5FW6A 3MCKA 3VH8B 2J71A 4XTRD 2HKFH 5CEXA 4HS3B 1FZKA 2BFVH 3O6LL 1ODAA 5LXVA 3TBSB 1XCQA 4YXKH 1GIGL 3HHMA 1KB3A 3S9DB 5FR3A 2VLKE 2CGZA 4IGBA 2F58L 4F8QA 4LP5A 4GW5B 2NYYD 1FRGL 5C09B 4KJYA 4IJ3B 4YSDA 2ED6A 3DVGB 3T9WA 4Y5YB 3RIAF 3NUKA 4FQXD 4WHTB 4LCWB 2IMMA 1B2WL 5LGHL 5T1LD 4G9FB 1FUNA 2I7SA 3AY4C 2AKRA 4LVHB 1QABA 1R5IA 1J8KA 5DZLA 3MKKA 4W9EC 1MCRA 2NW2B 5DEGB 1YQVH 4NI3A 1FFOA 3QZPA 4JO2H 4YPGB 1J9RA 4OFPA 4HUVB 4NKIH 3LKNA 2R83A 4MTMA 1HDMA 4ORGA 3RUGE 3HN8A 3AREA 3IXAA 1ED3B 1PLBA 2FBOJ 3OSKA 3FT3A 4P46D 4KZDH 1KZQA 3QR1A 1T22B 4I7ZC 4DGYH 4PJDE 1A9VA 1QVOB 3ASWA 4YHML 3EYFB 1JFHA 1G6RH 2V7HB 3HVDA 3LZQA 1U4EA 1QSEB 4B9YA 1RK7A 4AV0A 4TRPH 1XIWC 3ARVA 4HJGB 2V17H 3PGDA 3HC0A 4YGAB 5AAWC 3SJVD 1U95A 4NT6B 2R2EB 4S0TD 1S7RA 2FT7A 4JGNA 3O6FD 4WHDA 1B0RA 2F5BL 1N70A 4TNGA 5KZCB 4HIJB 3S35H 1DJZA 3E7JA 5FHAL 1F4AA 2VE6B 5DJCA 5GRVL 2Z35B 1OP3K 3RVTD 5HP5A 2H2PD 4AYMC 4FFVC 4CC4A 3EUUA 1IBYA 3WFCL 1DVXA 3HCVA 1F6FB 3CBRA 4S2SB 5C0IB 5B3NA 1FNGB 4Y9CA 5HGGS 2OMZB 3ISWA 3L4CA 1ZVSB 1DQDL 5I0VA 1FNLA 3ISYA 3NZUA 4GIAA 3TJHC 3G5WA 4AT6A 1JI2A 1DJSA 4B97A 5DMGC 4M1DL 1CQYA 1RI8A 4KK5C 3AADB 1N6QH 1AHWA 5FECA 2ZCLL 4L1LA 4WV1B 1OB1A 4R26H 1KFAL 3QQDA 4EDWH 3GBML 5I9QB 4Y2OA 4ZSOE 4HX1A 5H35A 4MX7A 4A2EA 3IDGB 1T5WB 1ECYA 3DIVA 1IM3B 1A1MA 3AAZB 2R1YA 5A2BA 1E5CA 4D7PA 5I8CB 3MV9B 1L3NA 4EN2A 1UEMA 1KLGB 5T3XD 4E0RA 4CKVX 4GUQA 4HA1A 2NXYD 1ZS8A 1J1XL 3UTTB 4OAWA 3UAJC 1NA8A 4R7DA 3TIDA 5C6TH 4H8PA 2E9JA 1QI4A 5SWZB 4NENA 2LGNA 5J06A 4WJG3 1IC4H 3QJXA 1OQXA 5J1AB 2E4FA 5LB1A 4FG6D 5T1KA 4ESKA 4OZIA 3RJDA 4F7MB 4NKDA 1GOGA 3LQAL 25C8H 3ARBA 1L7IL 2P80D 3L7FB 2QV4A 2E8YA 4XE5B 2X0WA 3TFKD 1QUPA 4LSQH 2EDDA 1IL1A 5HI3D 3N42F 1FIGL 2NT1A 3Q8EA 3MLZH 2XQYA 2X4RB 3HHRB 3MKGA 1GYWA 2L04A 5AW4B 3S4SG 1E8WA 2QKSA 4Y4KD 5KWYC 3JWNC 4JN2A 3BQUA 1X6LA 3D51A 3LZFL 5LBGA 4GOSA 5AAMC 4UT6A 4CMHB 4EBQL 1W72A 5BZXA 3RVXC 5JPMA 2GJJA 2XA8H 4F7CB 3O8XD 3IKKA 4W4OC 1U8QB 4XXDB 4J3TA 3KL5A 4TVSa 3HG5A 1FLRL 3NG5A 1XCXA 4C4KO 3OAUL 4Z7UB 1BFVH 1NGXB 2ZOLB 5EZJB 4D9RE 4X5PA 1BGXH 5D4HA 1SN5A 4JDVA 2FQDA 1TZGL 1JNNL 1EEZB 2YKLH 4L9LC 4Y7MA 4EJ1C 2OW6A 3MI6A 1BZ9B 1W8EA 1SXSA 4ZK8A 2FGZA 3MUY1 4JFYB 1HTYA 2EYRA 2GJ6D 1R3KA 1TVDA 4XNXH 3D0AA 5AD0B 3Q06A 1P6FA 2AABH 3FUFA 5GRXG 1H15B 1WIOA 2BWDA 3RDJA 3K4DA 3DV4B 4N4YB 3BGFC 1IUZA 5EC1A 3WE6B 2BY3A 4YZFE 3PJSA 3G04A 1NCTA 3N43B 4DO4A 3BZEB 1FQ9C 1YNTB 3MC0A 1V27A 4K5NA 3EYUL 1HHGB 1LO2L 4ZD3H 1UXLA 3DHMA 1U8KB 3A6CL 2PWEA 4X6EA 5F7DB 5FC9A 5T3ZD 3REWB 2ROYA 3ZE2E 2I69A 4OZGB 4R7LA 3TO4A 1M3IA 4KXAA 3GUTB 2NTSP 2BCKA 3PUCA 1UJTA 4Y4FD 3A23A 1WAAE 2EIZB 2LABA 3F05A 4DZBB 5A3ID 1X7QA 3BSHA 1EJFA 1S8DA 2H3NA 3FBQA 3ATEA 3MYJA 4DVRL 2EABA 4PYGA 1XTLA 1RZ7L 1GKOA 3P0VH 4NOBA 5EU3A 2XU9A 1TZIA 5HGBB 3NJNA 1NOLA 4LL4A 2VLLB 2JKXA 2P8LB 1I1AD 2ESVE 3L08A 5EO9A 1L9PA 4PGBB 1ETJA 1OANA 3C8KA 1YEHH 1KB5B 5LBSH 1TQVA 3TT3L 2Y23A 1AY1L 1RUQH 4H25A 4PJFE 3VD7A 3DGGA 4IK6A 2H4EA 5KN5B 1I3UA 3ZDYF 4MQXD 5HDRA 2Z31C 5EO0B 3I02B 5L4IA 1NL0L 3IGUA 4OZHF 5I1HH 5C0EA 2X38A 1XBRA 4K7PL 4KKQA 4FYTA 1NAKL 4TVPD 1M9SA 3HE6A 4C59B 2EVJA 5BQ7A 2Y7QB 4YSSA 5CIPB 1T7WA 3NIGF 4AI7A 5C09D 3ZTNH 1N5YH 8PAZA 3TP4A 4GSXA 4LCWD 2BSSB 5ADPH 1JHLH 1FJ1B 1NEUA 4G9FD 3VFTB 3VFVB 4AV5A 1JF6A 4NERA 5KYUA 5HD8C 4EI5A 4HOWA 3RP1A 3LEXB 5HPMA 1FO0A 4JRXB 3T3MF 5EEUA 4ODTH 1AGEA 3IJYA 1PL3A 1XH1A 3LNIA 5T8IA 1R47A 1UT2A 3BMWA 1BZEA 3P3TA 4LCCA 4FYSA 1MHCB 3N06B 3U1SL 1AD0A 2CRZA 2OR9L 1F41A 2W65B 2R2BA 3TX4A 5BRZB 4L4VB 1AMYA 1F02I 5EU7E 1BBDH 3VXOA 4WEBH 2ZX9A 2ARJQ 3L16A 1VDGA 3EDFA 5D1QA 4OI7A 3VXSA 4EE2A 1QSED 3PP4L 3MJ9L 3UGEA 4JQIL 4GLRH 3ABMB 1X7SA 1N8OE 4WNQA 3BAEL 1IZKA 1S5IH 4ETYA 2Y5TA 3BW9B 3HE7A 3QHFL 4LU5H 2DQJL 4Q6IC 3CLEH 2PXYC 2WNGA 1WCBB 4R4BB 3WEBA 4IBZA 2HFFA 2VR6A 1NTDA 1YVLA 4QDGA 3HZ3A 2IANB 4AM0A 4F91B 2CWRA 1R17A 2CBTA 5KZCD 4XGZA 3EYSH 2YK1H 4R4NC 1OAZH 1HH6A 4QRPE 4U6XB 2IEPA 1CL7H 3JV5A 2HUEA 2HVKA 2DWDA 5KSBA 2ZG1A 3VWJB 3ZMEA 4XC3L 1L7TH 1CN4A 1ASPA 2X4NB 4IQHA 3KL0A 1WA2X 4KJPC 4MA1C 3L9RA 4I0PA 4OZFA 4TF4A 1OGSA 1Z66A 1XGTB 1FI8C 4OUUA 2GTWA 1ZPUA 2X5PA 4NP4L 4KKBD 4M48H 1ZT1A 3FQ1A 3HLAB 1HEZB 5T3XH 3IM1A 3RWEA 1DLFH 5HYQA 3FB6A 4TM9A 4KK8D 4YC2C 3LKOB 3M1CA 3PREA 1NCAL 4BQ9A 2E6QA 1OAKH 4YN3A 3UERA 2O61B 1R3JB 3BDBA 5F0MB 1TO5A 1IM3D 5C2BL 4RNRA 4GFTB 3C5XA 5MEQB 4Y9FA 1UWXK 5EWIH 3BPOB 1OGTB 3BAKA 2JH2A 3RB5A 2Y5QA 3QORC 5I0WA 4AKQA 3MNWA 3LRMA 4XMKL 1VCAA 1MWAH 4HFWA 2X2JA 1FNAA 2OSLA 4LSDA 5CBAB 3OBAA 1NEZG 1IIKA 3P4OB 4BFGA 5SWZD 1H3UA 1BQSA 4Y4HA 4XN5A 2YR3A 2BVQB 2G75A 2P7TB 2HTLC 3HB3D 1I9IH 1P7KA 2D03L 2A9BA 4P5TC 5GRJH 1KY7A 3IU3B 2FL5A 5HDBE 2OMUA 3MNDA 5AB1A 2GY7B 3V0GA 4MMZC 1NMCC 1OCOB 1MREH 1UCBH 4LCYA 1BM7A 5FV1L 5F8RC 4E9LA 4N8VB 4YHNA 4N0RA 3ESOA 4JFXB 5JXEC 5JW4N 5HHVH 5LJYH 2CGRH 4KK6D 1RJLA 1KBPA 2DM7A 3WE1A 1OM3L 2X87A 5I74B 3OKYA 3CX5J 5KYNA 1FHGA 1AKJA 4K7PY 4K7PX 4X7EC 1UADC 3MHZA 3U25A 4MD0A 4M5SA 1RK1B 1S7SB 3HZYB 1CVSC 3MRNA 4WEEA 2G4EA 5AZEH 4QHLA 1URZA 3RWDB 4TL5A 5DS2A 1EAPB 2A83B 4U4BA 3ARTA 3HVNA 3K80A 4PJ9C 4CA4A 3UJJH 4B95C 3K6DA 5IHHA 5D6CA 3OXSB 3U9PH 2NY7L 4MCYB 3RWCA 3WDIA 1IZJA 2OP4H 1U0QA 2DQFB 4JY5H 5DD3H 4AZUA 5KVFH 1YNLH 4P3CH 1AGFB 3HR5B 2OZ4A 2GCYB 4O2CA 4DP0X 3FQWA 5JIMA 2WXJA 2Z7YA 3Q13A 3PLYA 3SE4A 4WTWA 1OP9A 1P84K 2Y5EA 5G5DB 3NFNB 1GS6X 4NFBA 1MWOA 4NRZB 4Z18A 5T3ZH 5D4QA 1T2QL 1FRGH 2B2XH 1AQMA 1GJUA 3RKPA 3UYPB 4AL8H 3G5XB 5IMLA 4QGYA 3SQBA 1T0MA 3VRLF 5C7XL 4XNQA 5IB4A 1CYXA 2E27H 2JCCA 3UBXG 2V5RA 4HIEB 4DN4L 2OYMA 4OFYD 1IBZA 4A6YL 5DRWB 3BEWA 5EBWA 4A38A 1NPJA 2DD8H 2J2ZB 4GP4B 5D7JB 4ZTPH 5B1JA 4URKA 4YAQB 2HJFA 4E5XB 4BH8A 3SSGA 4OLUL 1OCZB 1LXMA 5SV4A 3PJNA 3O3DA 3UO1L 2FQGA 1OOWA 5EEWA 3VMNA 4X99B 1OY3B 4JM2B 1SJHB 3NQKA 4KXBA 3E1ZA 4YHMH 3V0JA 3C5JB 5DJZA 3QFDA 4H2AA 4OIBA 1NGPL 3HC3H 2G2NA 2G5RA 1Z9MA 4KBPA 7CGTA 5JW3H 1YMMA 2C1PB 3CVBA 5FW8A 3QEHB 3PWPB 1R24A 5HHNA 1J8SA 2VLRA 3QDME 3DO4A 4TVPH 3V7AG 5DQ9A 5DWUL 1CLOL 5DD0L 1PZ2A 4L0YA 1F6AB 5EV7A 4N0FB 1DQVA 3B9VA 1UA6L 3OKDA 3ULUD 4E0RB 1C1EL 4L1SA 5MEPB 3WNJA 5D7SL 4BZ2H 1HT6A 1HHIB 5PCYA 2C3VB 1CFTA 5F7KC 5D7IF 2CRIA 2WMPA 1L4IA 2YO3A 3D39A 5DJDA 3ZIYA 5K1JA 4QRSA 5HSFA 3DRQB 4YFLF 5DEFB 1G7JB 2QQNH 5AW3B 5EIIA 4UTAH 4J4PA 4ALAC 4NKOA 4JJHA 1LMKA 3DSFH 4HBQA 3HI5L 4YLBA 3TA4D 3D9AH 1FVDA 5EA0H 1A7NH 5JHDA 3MCG1 2X6MA 4WIQA 4A55A 5C08E 1DQDH 3ESUF 5ICXB 2G9HA 4MXQD 4F3FB 5CR1A 1AXIB 3RUGF 4WWKA 3BKJH 2G0KA 5IM7A 1AQDA 4G6JL 4JRXD 4KDTA 2E0PA 5F0LB 1QEXA 3S3SA 3O2WL 4PJDF 4X7DC 1N5AB 5J6SA 2FYYB 4KKZA 5J56B 3SKOA 4PWGA 1L0PA 2A9CA 3S5LA 4NZTL 4NNXA 3TN0A 3AJ7A 1T89C 3BDYL 4NO2B 4WU5A 2BNRB 1FA4A 3OC8A 4YBHA 4B9JA 5BRZD 1CDJA 4AJVA 4L4VD 2OAAA 3CMOL 2C4XA 2B1HL 1RCYA 2ZE0A 3AG3B 2BVOB 1G1OA 2A77H 1FDLH 1RURL 4PD4K 5EOQH 4XWGH 2GSIA 5J7CC 3FT9A 1BEXA 1IBGL 2COVD 3DHUA 3VFNA 4AVIA 1WGVA 1KTLB 1P1ZB 1MVFA 4MNHA 4V1DA 3CBKB 3FTYA 3ZDZB 1CBJA 4ONHB 4TUOA 1LNUA 3K6NA 3LZNA 4E9VA 1MEXL 1KGYE 2IBZY 4JHWH 3G5YA 5F1NB 3L4YA 2B1AL 2XXMB 3ZBMA 4D8PB 5KBPA 2B5IB 5EZOL 2IAND 4M03A 4WK0B 4UQ2A 4PLOB 2WXHA 2CNYA 3V0AC 5I1EH 2ZYSA 2WBJC 4NB7A 1C12A 3DO7B 3LQAH 4MZ3A 3OXRB 3F00A 3GZKA 3HLKA 4PREB 4F2MB 5I6XB 4GG6F 4Q9RL 4FKHA 1OM9A 1IFRA 3VNYA 2CK2A 1L7IH 1D5RA 2UY6A 1QNZL 3I6KB 4G71B 4LKXB 4PJ6A 5EZLB 4FE9A 3SDCC 1FVCB 1H6EA 1BQLH 1HSBB 2ICES 3LKSB 3VWJD 1MCJA 3DTXB 2QQKH 3JQOB 4YSPA 2YEZB 1ADQA 4X5WB 3KPPA 1XGUA 5E4AA 3VGGA 5ADOH 6FABL 1XMEB 4MQ7A 4NP9A 2HT2D 2X42A 3G6JA 3SO5A 2OPCA 4X98B 1MFEL 2QHRL 5LG1A 3SDYL 4FQ2L 2VN3A 2NY0B 3LZFH 1OF2A 1SDDA 5EBLA 1RK0B 5HVGB 3JTSA 4G9FE 1J05A 1NGYB 3M45A 3ARDC 1RXLA 4ZTEA 5D1XB 1S7UB 1XB6A 3C5ZD 3U2SA 2DQGH 2UZPA 3FB5A 3GDBA 1Y7VA 1IC5H 1IKNC 2HYMA 2QKIC 1Q9LB 4IBYA 3LYRA 1TR7A 4G82A 1BA9A 1INEL 4PLNC 3MRIA 2AJ3A 4FG4A 3MRCA 4RFNB 2Q76B 1DUZA 4FHBD 1TZGH 3QEGL 1J88A 1OEZW 2RGSA 5FPIA 3DC0A 5I17B 3BFOA 5I73C 4HH9A 1ONQB 5F1IA 2XN2A 3FCGA 4KHXL 4LLYB 3OKEA 2Z4QB 3DI3B 3IBEA 1QSEE 3F58H 3ABGA 3GF8A 5DZOA 1T4KB 4JG1L 4WKZA 3EZJB 2VXQL 4NUGL 4W70A 4YHIB 1TENA 1NCCL 2A1WH 3LRLA 3RZCB 3CDGA 2OR7A 3QWRA 1JMZA 4EI0A 1ASQA 4DOHB 3L3OA 3DPDA 4F24A 4GIOA 3F62A 3CX2A 4FZEL 3L4XA 3NFSH 1WAPA 4NM8L 4UQIM 5L7XL 1FE8L 2LFEA 1BLNA 1N7MH 1LO2H 2FJSA 3ML8A 3QG7H 5C07B 2RHEA 5IOKA 3JZYA 4B7LA 3A6CH 4UDTA 3BO8A 1RZFL 4Q56A 2ZF9A 4K2UL 4LVEA 3GTNA 2WQWA 1NMBL 4PEEA 1RHFA 1QSFE 1ACXA 3HFFA 1WEJH 3MSPA 3MO1A 4LCIL 1OP5H 4I9WD 3W9DA 5C0FB 2PPCA 4W9JC 2HVJB 2ARJA 3FUNA 1LMIA 2C7UB 4FQIL 4GB9A 2WIMA 3IDYC 2WLIB 3D07A 4JL2A 5JIKA 3W56A 5KYYA 2JKJA 3CLWA 2PW1A 1W6WA 4Y1AA 4TOYH 4I2XE 3V52H 4E9SA 3WFZA 2VM4A 5C92A 5F7UA 2E7LC 1I9JL 3GK8H 3GSNB 1BW8A 1OT1A 1Z0NA 2FUQA 1FH2A 4XP5H 5FF6B 2EDYA 2VGLM 1HWHB 4MA7H 2FQFA 2BNUA 4B6ZA 3QUMB 5L2KB 4PJXE 3U82B 4FLRA 2XWDA 4NAMA 2X6BA 3MV9E 4GP8B 4YZFF 4IDJL 2Y07H 1FZMB 1BZ7B 1HNFA 5TH2B 2IPTH 1NAKH 3FQXB 4YE4H 2VDKB 4EDXB 4LOUD 4WU7B 1DCLA 3UTTE 1IGJA 3N55A 4F5CE 1YAIA 2ODIA 2K9UA 1S7QA 3HHSB 5IUCA 1Q1JL 3WJJA 3ZE2F 4EUPB 3ULAB 2BNQA 3BXNA 3KLKA 3T4YA 2E76C 2ICWB 4HGWB 4JFVA 3NDYE 5EBGA 1U6AL 3MLUL 1BECA 5F7BA 4WI4A 2AK1L 4WCYL 3UJTL 5D7JD 2V5MA 4LLWB 3HUJB 1WAAF 3AUWB 4DP1X 5IGXL 4YHOL 3I9GL 5DRZA 4JKPH 1LEKA 3T1FB 4HWZA 1N4XH 1UASA 4QTFA 2MQ3A 3DYMA 2X1QA 1EDHA 3L3GB 2YD3A 4HKXA 2Y36H 4NJ9L 1LE5B 4YLCA 4FS0A 3W3BA 4CMMB 4YHPB 5IJBC 5IHZA 1BWWA 1BMZA 2L7QA 4AW7A 1KB5H 1CE1H 3DV6B 5GGQL 4LLUA 3LEVH 3MFFB 3ULUH 3PP4H 5FYLD 2G2RB 2YAOA 1UQSA 1OE3A 1XAKA 5B22A 2I27N 2IFFL 4PJFF 1CCZA 3FUMA 2C9SA 4MMXB 3X13B 3K5SA 1GHFH 3PWPD 4NQTA 3RNKA 3BP4B 2R0ZL 1ZV9A 1EHKB 4EVNA 2NZIA 5H8DA 1TU2A 3WTTA 5GGRA 4F33A 1OHZA 2G3NA 2CIKB 5CIPH 3VCLB 1G1KA 2MIZA 7TAAA 1NUFA 1R3HA 1FAIL 5FYJE 1WV7T 3MCKB 4M43L 4Z7UE 5CEXB 1FZKB 1PY0A 3ILDA 2HJLA 4UOZA 5FM4A 1XCQB 2FJHA 4G7YL 1TSRA 1U8HA 4N3TA 1PNDA 4IGBB 1IGCH 3EAKA 3K4ZA 4KJYB 4UQAA 1HL8A 1I82A 2EQDA 3ORJA 5K9JL 4N0YL 1AZBA 2AKRB 3BUDA 5TQ0L 1R5IB 3PWUA 1Y1UA 4B9FA 2QVIA 5CFAA 3P73A 3QDHA 1FFOB 1P9MA 5HJGA 3WD5L 4OCYL 5KVGH 2WAQA 5MP6L 3HIZA 2VR4A 3LKNB 1HDMB 1NCAH 3WU1A 4ORGB 5TF0A 2X6AA 3AREB 3IXAB 1LDSA 4I77H 3FT3B 5F3BA 4HT1L 4Z0XA 2BNRD 5HHPA 2N7AA 9PCYA 1NANH 3IGLA 1T20A 5D93C 7PCYA 4M6NH 4ZT1A 4KVCL 4OCRH 3PAZA 4KWUA 4P07A 2ZTBA 4U1MA 5JLZA 1J0KA 3PGDB 3HC0B 4M02A 3T2PA 1U95B 4J3UA 2VMFA 1D9KA 1MQKL 3S0PA 4NQXA 5IP4A 1S7RB 4Y19A 2WQ8A 1SHXA 1TETH 4ZTOL 1B0RB 3M07A 2HLAA 4FADA 3SPVA 2GUOB 4NS0A 4FQLL 4G5ZH 1WP6A 4HWBH 5DJCB 5J89A 4YSCA 4OLWH 2UVEA 1IGIH 2ENQA 4JHZA 4JFQA 3MREA 3M6DA 4KUCD 5GQBA 3ISRA 2MCG1 3FMGL 4H0LC 2I24N 5ISZA 1G9NL 1O7SA 3HCVB 5E8EA 5IQ9A 1OM3H 3N0PB 1AHMA 3WFBH 4F8OA 4JPSA 1BAGA 2EKJA 1B9ZA 2WXPA 4AMKL 4AT6B 4MAZA 3MAWA 2N56A 2NY0D 3L5IA 4ORZC 4PS4L 3WO4B 4ZO8A 1ET5A 1QBBA 1MAMH 4XPAL 5J3HD 1P7QA 1UYWL 1AHWB 4JKKA 5FECB 5ID1A 1OB1B 4GXVH 5D1XD 4AC2A 5KANG 1FNHA 3QQDB 1AMXA 4K3JL 1P5VA 2FX9H 3ZMRA 1MRDH 4Y2OB 3KZ8A 4HX1B 5CN2A 5H35B 1HQ4A 4ZMAT 4MX7B 4R97B 2EDLA 2XVKA 4G2AA 4XMTA 1CBVH 1I3RA 1A1MB 1YRKA 2R1YB 1H6UA 1VEOA 1H19A 1O5PA 4WKXA 4MXWH 4LAQL 4RMBA 1IGMH 1XVSA 1S7WA 2F19L 3TV3H 3BUPA 3AFLA 4P0DA 3UX9B 4BBWA 5E08L 3TNMA 1OAXL 3NAAL 1EV2E 5FUOH 4BFIB 1ZS8B 4Q8BA 4IRZA 2AQSA 4OAWB 3QRGH 5TFSL 4AIOA 1M4KA 1AGDA 2IDFA 4UUJA 4R7DB 2VQUA 3N9GH 3TIDB 4P99A 5KYWA 3FC8A 2X28A 4I1RA 4NENB 5HDBF 2Y7NA 1J0IA 2ZXEB 5BUPA 3OL2A 1DJGA 3RZCD 5DLMH 1E43A 2HUHA 4TNWK 5ACLA 2XV6B 1SLUA 5T1KB 5GGUA 2WZPA 4OZIB 3PL6C 2EVGA 3M86A 3QAZC 4YDNA 2P9RA 4NKDB 1ZJBA 3ARBB 3PJLA 1TYEB 3NK4A 2GK0A 1KPUA 1ZLWK 3U7YH 1CLZL 3MJ7A 5C07D 4LVNC 1KJ2L 1IL1B 4B27A 5INCA 2H5UA 1YNKH 3B2PA 4GIPD 4G83A 2FHCA 3VFPA 2EAEA 3JWDC 3UO1H 1XSOA 3BN9D 2GVYA 2OMNA 2X40A 5HHOE 5J0BA 5AENA 4JN2B 2EUVA 4RGNC 5TF1H 3HBGA 5FYJU 5MHSD 3D87B 2HRHA 2DWSA 1W72B 1QO3A 5JPMB 4TNEA 2EUZA 1GGBH 2PMZA 3FOMA 4HGKC 1ICTA 4YHZL 2X4UA 43C9A 2W0FA 5KVDH 1SY6A 4TPRL 4ONGL 5L0QC 1DVQA 3VSVA 1CYGA 3C12A 3RAJL 1S7VA 1E2VA 1FG2A 2XZQL 1EBPA 3B83A 3CPUA 2W07A 3ZLQC 3QPXL 4JDVB 3DMMA 1UA6H 2W9LA 1J18A 4N8CH 1C1EH 4A2DA 5M94B 3W5MA 5L2KD 2LLNA 4FN0A 4X7SL 3CSGA 1A6ZA 3ARGC 4U05A 3ZTEA 1XGPA 3CVCA 4UAOB 2EYRB 2WO3B 1R3KB 5IQ7L 1ZT7A 3X2QB 1W80A 3B9EA 3EJYD 3A24A 3JBG7 5IEHA 3FSAA 2X2UA 1TCRA 5EC1B 4NSKA 3SKUD 3ULVE 3PJSB 3AU1A 2AGJL 3G04B 1SYVA 2HA1A 2IQAA 2CM6A 4AYDC 3B9KC 3FCBA 2GAZA 4ICXA 1BD2A 4M6ML 2ED7A 4UT6L 3ZTJG 4MBRA 4I87A 1A6WL 3TASA 2HFGL 3QZOA 2OYLA 3SE3A 1W72L 5FYLH 2RQEA 2PPEA 4X6EB 4F9PA 3Q6FA 4K4KA 4FFWD 1EO7A 1A6TA 5JW4R 3UOAB 4YXHH 2NY4B 3TO4B 2DV6A 4QIRA 3A5VA 4QWWD 3JTTA 5GZOA 2AJYH 2BCKB 1BBJA 1GW6A 4UF7C 3NP4A 5CINH 1J9CT 3BP7A 2K3TA 1X7QB 3MYJB 1S8DB 2H3NB 4NZUL 3P2BA 4OD2A 4ODSH 4N1EA 1RURH 4XO4A 4XRCA 5KSAC 1UB6A 5KAQG 1CICA 3FS9A 5EU3B 2AQNA 2RCSH 1TZIB 3JT0A 4NHCH 1AZRA 4EF3A 2JKNA 1WBZA 3S37H 3U1PA 4DP5X 4NUMA 5EO9B 4BFRA 3ARZA 2X53A 3D2TA 5EF3A 1DBBL 4X7FC 2QMJA 3C8KB 3LRKA 5F6IC 4M7JH 4WLCA 3BZFA 4YHKH 3STZA 3I9PA 4H25B 2DZEA 3DGGB 4IU3A 1RIUL 3GO1L 2QGDA 1CXIA 4PRHE 3D85A 3Q9QA 4KGJA 5C0EB 3NRQA 1MFBH 1ODUA 1QNZH 3SZ6A 3HE6B 4L0ZA 1F4WH 4IGBD 4NN7C 5KVDE 2DQEL 5BQ7B 4LMQE 5CLXA 1DN2A 3BVWA 4NUJA 5C86A 2DQUL 1H6TA 2DQMA 3H55A 3S97C 3UMNA 2ADYA 2ISDA 5TE7L 1KTBA 6FABH 4I85A 3WXVL 1PLAA 1IVTA 1CF1A 4HKJA 5BS0E 1BSIA 5KYUB 1TQSA 4EI5B 5HPMB 5I1KL 1FO0B 5EO1A 4QOKA 1AGEB 3IJYB 2AS5M 1QYGH 3U0WH 2MQGA 3GM8A 3V6OA 4FXKC 1XR9A 1CU4L 1PX3A 5KJRL 4I48A 1B4JL 1K5NA 2PYEE 3OPZL 4LCCB 1AD0B 5DC9B 2Q8AL 2GBTA 3ARED 3Q6GH 1JZ4A 2R2BB 3EGSA 1A7RL 3MLXH 2YJQA 1INEH 1JHKH 5I0DA 4NC1C 3VXOB 4DUWA 5DXWA 4FABH 3BZ5A 3RA7L 1EDQA 5D1QB 5CCGE 3VXSB 3SGJA 3O2DH 1FNSL 2ZKXA 4KTYA 4WNQB 3EBHA 2VAJA 1JSYA 3W81A 2J1XA 2Y5TB 3HE7B 5FYLE 3ZGIA 1IQWL 4B60A 5ICZA 5J1SC 5JPNC 1M2VA 5I0YA 1I9RL 1O9ZA 2JB5H 4NN5C 1NCCH 1ULVA 2HFFB 4JR9H 5IQOA 1DQLH 4AM0B 2XPGA 5GGVH 4HF5L 1GRWA 5CN3A 3VD9A 1JGEA 5BVPH 2EDHA 4XGZB 3FK3A 2ZOOA 3FRPA 3ZTCC 3L9YA 1N6UA 3O6ML 1HH6B 1AI1L 2DL9A 4WI3A 2VZ3A 4L3CA 5L7XH 2JLLA 2HVKB 2DWDB 2OI9B 3EH1A 3S3BB 5KSBB 2VJ0A 4YDZA 4LARL 1D2PA 1CFSA 4XC1H 2VXTL 4AGMA 4G5AA 5DCCA 2BIHA 2XN9A 2YGVA 3L9RB 4I0PB 2BSTA 4OZFB 4XMUA 2AQ3A 2NTFA 2EIDA 4GT7A 4PWJA 3V7MA 4R5TA 2DKUA 4OUUB 2GTWB 3JZ7A 2JKWA 4LESA 5FM8A 2X2IA 3BWAA 5D7KE 3QO1A 5B21A 1ZT1B 4M1CD 3LTVA 1PF3A 3RWEB 3WS6C 5HYQB 1TXKA 3FB6B 4Q9QL 2VXSH 5HI4C 5DA0B 3SODB 1JMXA 3FTVA 3CXHK 3RVUD 1KJ3L 1J86A 4ODUA 2VC2L 4RNRB 1BIIA 4ODVH 2ZNXA 4M1GH 2HAZA 1OQOA 1I85A 5FYKH 3VUAA 4ELMA 1AC0A 1ZT4A 3MNWB 3GI9H 4XVSL 1UHVA 2W9EH 4I3RL 1S5HA 4HFWB 3SOBL 1MCNA 4I9XA 2OSLB 3N44B 4IDJH 5IBLD 1DBMH 2ZXCA 4AQZA 2ZG2A 4FGMA 4Y4HB 1RUML 5A7BA 2G75B 2C1OA 3ZDZE 2WOYA 4ZUSA 1E2ZA 3P0YL 4F2FA 1KGJA 4XNYH 1P7KB 2BLFA 3BYTA 2QZ5A 3H85A 3SCMC 3FO1A 2FL5B 4O2FA 2OMUB 3ARBD 3FU9A 4MJ5A 4XCYA 4LO9A 3L5HA 4LCYB 1TMQA 1HOCA 3MLUH 2ERJB 4NQDA 3FFCE 3UJTH 3QNXA 2B08A 5DD5L 4F2ME 3I2CH 4YHNB 3MRPA 1A4AA 3JWOL 3K0YA 2PKDA 3MV8D 4B7IA 1RJLB 1ACYL 5FKPA 3VSUA 2VERN 4XO3A 1NLDH 3SQOH 4OGXH 5GGSA 1AKJB 3ZQWA 4XTRC 4JFHD 4DP7X 1F4YH 3GSNH 4MD0B 5FB8A 2RAMA 4PJAE 3IMVA 3WLWC 3D3VA 3MRNB 4E9TA 2YKKA 1JAEA 5CGTA 3N40P 3LRGA 3Q1SH 3QUMH 2J55A 4QHLB 2AQPA 2O6EA 2NYYC 1IT9H 4NBYB 4E9WA 4Y9BA 1Y0LA 1RFDH 3GHEL 4TLSA 3H0TA 1I8LA 4FQXC 4PJXF 5D1XE 1DZ0A 2OCFD 1SUJA 1RIHL 5D6CB 2DQIH 2VDKH 5TE4H 3RWCB 3PHAA 4ELDA 1G5AA 1X44A 2AZUA 4OCSH 3RPIA 3EGDA 2LLLA 3QHZL 1AS6A 1A3LH 3MV01 3BPCA 2FWOA 4B9IA 3NJLA 1A21A 1HXYA 4O2CB 3ZDXB 3FQWB 4PJ8D 5F9OH 4EUPH 1W16A 5ACZA 1ROWA 2K1MA 3WO3B 4JPQA 4P46C 3T0XA 3S3CB 4G8FA 5IMLB 5ITBH 2FBJL 1T0MB 4RRPG 4XNQB 5IB4B 2E4TA 2V7NA 2DQDH 2JCCB 1H5BC 1FGNL 3MPCA 1OP3H 5A40E 5A43C 5FYKE 3T2NH 4DOHE 3BEWB 2XI9A 5EBWB 5IEKB 1SF3A 3KXFA 1ZA3A 4GO9A 2OA9A 3H7BA 5BV7B 2HJFB 3VD5A 5MP6H 4BH8B 4R2GB 2DJMA 3LVEA 1MW3A 3O6FC 4GXUN 4IS6A 5AVQB 5JMRA 3O3DB 2VH5H 2VDLB 1PY9A 2IOOA 2YFOA 4RGNE 1FH5H 2NY4D 3TO4D 2GUYA 2FD6H 1E9OA 1NOFA 2GW5A 4WFFD 5DJZB 3QFDB 3RVTC 1AGBA 1CD1A 2H2PC 3QQNA 1W8NA 1FCCA 2A3TA 4KVCH 4M4RA 4YK4B 4PWFA 3FTUA 3S8FB 3WSQL 3NH7L 5MHSE 2CBMA 1AYRA 1YMMB 1R46A 1R24B 5HHNB 2VLRB 4Z7UF 1AFVH 1EX0A 4W9IC 2BS9A 3GQFA 3HG3A 1WFJA 4WGKA 5DQ9B 4U3CA 2YN5A 1RJYA 2WO2B 1ZLSH 2C26A 2P44B 4JE0A 4ICWA 3Q8AA 3C09B 3L6FA 3OKDB 3S34L 2D3VA 2ZXAA 4XNMA 3QZMA 4BE6A 1AZNA 4MB3A 4OLZL 1CFTB 3NCFB 2WMPB 3D39B 5DJDB 4QRSB 4C57C 3C08H 3W37A 2QEJA 3LEYL 4R4FL 3HE6D 3M8OL 2BS71 4PW3A 4WW2A 5IY5B 4NKOB 5L8JB 3EYVA 4MJID 3FMGH 2F68X 3BIAX 2BVPA 5C8JA 1HXMA 3ZKMC 4U49A 1FVDB 5JHDB 1YNTF 1QD0A 4DSYA 1JZGA 3NDZE 1UB5B 2G9HB 5L9DL 2NXYC 4WWKB 4IMLA 2HRGA 3NRPA 1AQDB 5IM7B 4EI5D 2D0HA 2HWZL 3IVKA 5D6DA 3BP6A 3SKOB 4HIQA 3S5LB 1H9DA 4NDMA 4NNXB 3TN0B 3B1UA 4NQEA 3NEOA 4FG6C 4WU5B 2FRGP 4YGVA 3IGFA 2DEXX 2HKHL 3MRMA 4UB0L 4ZMLA 3PRZA 2B8OT 5D1QD 4APQA 3MMEA 4X5XA 3VXSD 2ZKWA 4G6AD 3QIBC 1NGWA 2LT9A 2GSIB 4U3XA 5HI3C 3PPEA 3QHTC 5T1MB 1P6WA 2A9DA 3UDWC 1RUAH 4MNHB 4V1DB 1AR2A 4J8QA 3HE7D 4TUOB 1LNUB 4WI0A 5TPWL 1TJGL 5JZ7D 3NCMA 6PCYA 3QS3A 3TVMC 3HS9A 4Y4KC 3G5YB 1E42A 3TWYA 2FGWL 1OHQA 2Y06H 3ETTA 4V11A 1D5IH 3KW8A 3ILQC 3FJTA 3O45A 2XX1A 4UQ2B 4V2BA 1C12B 3VD2A 1FFNA 3ZKXB 3T3PB 4U4IA 5F89A 3W11C 2J43A 2UY6B 2O6CA 4PP1C 3WCYA 1GPOL 5E6RB 1X9QA 1CLZH 2VZOA 1GYAA 2CCWA 1PSKH 4XCFH 1HC1A 2CR0A 3TJEL 3O11A 4NFCA 4HUXA 4NX0A 1V05A 3B2VL 5FGSA 1WIPA 5CILH 3KPPB 2XVLA 1XGUB 1MDTA 4B9KC 3BRDA 4I0PD 2XG5A 4MQ7B 1EQWA 4OZHA 3FU8A 1WZ1H 3G6JB 3QQ9C 5J13C 5DFVD 5IT2H 3OJ2C 4FTVA 3O3AA 1HZHL 3B8YA 1N59A 3DJ9A 1M6UA 1OF2B 1SDDB 2QADB 2E59A 5EBLB 3QSKB 3JTSB 1TG8A 3LN4A 1J05B 4N8UA 3U2SB 1DEEA 2WXOA 1Q72L 3CQFA 3FB5B 3ROOB 4YHZH 2WXIA 2AV1A 3C60A 3U9UA 3RWIA 4D9LL 4QTIL 3UYOD 5LN4A 1L9RA 4AEEA 5ES4B 1THCA 1EEUA 3MRIB 5DUJA 2MCMA 1A6UL 2AJ3B 3MRCB 3VXME 4UZSA 2X3CA 2EP6A 3ZYJA 1WA1X