2CBMA

Crystal structure of the apo-form of a neocarzinostatin mutant evolved to bind testosterone.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
112
structure length
112
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEOCARZINOSTATIN
publication title Structures of in Vitro Evolved Binding Sites on Neocarzinostatin Scaffold Reveal Unanticipated Evolutionary Pathways.
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antimicrobial
total genus 16
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2cbmA00
2G0LA 1HZLA 2CBMA 1NOAA 4JW3A 2MCMA 1J48A 1J5HA 1O5PA 2CBTA 1ACXA 1AKPA 1HZKA 2CBQA 1NCOA 2G0KA 2CBOA 1J5IA
chains in the Genus database with same CATH superfamily
4RZCB 1JV2A 35C8L 3O0LA 1BVKA 2X1PA 3S88L 2VNCA 1KBGL 5CZRA 3T65A 4BV1A 5DVOA 1RIHL 2KI6A 2NY3C 1A4KA 4APQA 2ED7A 5SWSD 2OYPA 1SF5A 2C3GA 3U1SH 1LM8V 1U91B 2R83A 4IK6A 2DEYX 3A6OA 4QRAA 1Q1JH 3ZIYA 4M8QA 4QOKE 3KPMB 4DVRH 3S9DB 5IB1B 1FCGA 1HHHB 4PCKA 5KZCB 4PJ9D 1CYXA 1R3KA 3CPLA 1T1XB 1S7SA 2BP0B 2MPVA 2VUKA 3W9DB 4FHKA 2DF3A 3QAZB 2C1OA 3OTTA 3D39B 4WDIA 3ZYIA 4QOKB 1UWGL 2AJXH 3MGOA 4MAYB 4GRMA 4EN3C 3SDCB 3DGDA 1EGJA 2NUTA 3QT2A 3WHXA 5I8OL 4Y9GA 3G6JB 5GGSB 4KY1L 2AABH 3TYGH 3FCTB 4NQDA 4RMVA 3FFDA 3MBED 2HKAA 2DYPD 4L4VD 1AGDB 4X4YB 2AEPL 2WCPA 3BWUC 4GOSA 1BQLH 2APBA 4W6YB 1A6ZB 1LE5A 2OLDA 3D34A 4HWBA 3L54A 3B83A 3PV6A 4YDJA 3BPLC 4O2EA 3OAZH 3O6FC 4ZS7L 3WFCL 1G6RL 4Z3FA 2AVGA 4F58H 2EE9A 4NO5B 3VGHA 5KEZA 1T22B 2DBLL 5A43C 1HZKA 1NUFA 2Y5TA 4R2GD 2ZE0A 3GNMH 3RWHB 4EZMA 1HIMH 5DFTA 5T1MA 3WEXA 4KHXL 1NDMB 3N50A 4OY9A 2FK9A 4PG2C 4GH7B 3QDJB 3K6SA 1GOGA 2IPKA 2H6UA 2XQBH 2APXA 5D6DA 1Z3GH 5HJBA 4EI5A 1KLGB 4W93A 1MCWM 3CBJB 3S97C 3TM6A 2C3VA 2HVKA 3QRGL 5E0QA 1IAIL 3V0DA 1EJ8A 2K9UA 1DANT 3TFKD 5HHOE 4R97B 3NTCH 4QXUH 4YDVB 3MRFB 4J2XA 5GISH 4AGOA 5DK2A 4HLEA 2DICA 5IWLC 3H8NA 4J8QA 4A6YA 1ZT1B 1BEYL 1A0QH 2QVMA 4BK5C 2Z4QB 3DK0A 5AOMA 3ETBF 3L3JB 1R3LA 2EDDA 3KPSA 3OKOB 4I18C 5EC2A 2CH8A 1MCIA 4R96A 4IHOB 1NAMA 3MCKB 4G1EB 5IK3B 1NEZG 2OXHA 4DIXA 5HHOB 5JTWA 4E68A 1KT2B 4JDVA 2BVOB 5I75B 5TDPB 1KCVH 3WXVH 3OR6A 1N2RA 4IS6A 5L8KB 5GRVL 1N9PA 3M8OH 4FQ2H 4P4RB 1BWMA 4P2AA 3CFDB 4JG1L 1XF1A 4X8CA 4N0FA 1F97A 2FYYB 2ZYIA 1S3KL 2VDMB 2RGSA 1GZHC 4NUJB 2EXWD 3LQMA 1V3KA 4HEMA 5GS0C 3SPJA 2QPSA 4W68A 2XXMB 4JE0A 3KYMB 1QTPA 3TJEL 4OCYL 4I3RL 2VZ1A 3GMLA 3BKYH 1SJEA 2O6EA 4LNVA 2EAEA 4HUXA 3PP4L 3ZKQD 4Y1AD 5LGYA 4MS8D 1BF8A 4XNQB 1R3IH 3QUZC 1Y0LB 5E1GA 4ZFFB 5JXAH 1OB1A 4A7UA 2HPOA 3H2QA 4UI2A 2JELL 2NXYB 2VLLB 2I85A 3CFCL 4W9GC 3B1TA 5C08A 1OQOA 2IAMC 3LIUA 1EUTA 3HBPA 2ZX7A 4MB1A 4E0RA 2WHVA 4HIEA 1F11B 4B97A 1SHSA 1S9VA 4KQ4H 1EJOL 2NY2B 4KK6D 2H8PA 1BD2B 5IMOA 3IDUA 3S3BB 5I8CA 3GS4A 3Q06A 1RJYA 5ANMB 3RWJA 4RMRA 2AXGA 3LYRA 2VDPL 4PI2A 2NY0B 3GSOB 5DJXA 3FUIA 2HZHA 4PJ7A 2JJSA 2EO9A 1I7RA 2XWJB 1EXUB 5BNXD 5DS1A 4PJ8B 2WQAA 1X5KA 3C8KB 8FABA 3SKOB 3L4TA 1Z3RA 4YIQB 5HYQA 3QHTC 2Y07L 2ZSWB 1NCGA 2MJWA 4JFVA 4J3UA 4XPHL 2KMWA 4JPWH 2BJML 4OCXH 5C70A 2BXYA 3NFPB 3IKCB 4L0PB 4F57H 4NN5C 2APWA 2ZAIA 5B4MC 1T03H 5TH2A 3WHE1 4KRPD 4BKTC 1AJ7L 3RTQB 2HWZH 1AVAA 2UWEE 5DS2A 2VDRH 5T1JA 3NJLA 4CSPA 1UWFA 5AZEL 4PBDA 2WBJC 3NYKA 2H2SC 2VR4A 3M1CA 2XTJE 2ICCA 3PWLB 2XXCB 3OKMA 2XN9A 1KN2H 2D8KA 2ITDA 3UYPA 1FHGA 1A7OL 4BM7A 3WN6A 1P53A 2FBJL 1E6JL 2UWEB 3AW5A 4YFLI 4Q9QL 1AFVL 4MZRA 2FO4B 4QMEA 4IQHA 4JFZH 4U0RB 4EPSA 4YZFF 4FZ8H 2A74C 5C0CA 2D7NA 2V2TA 1RXLA 4XAKD 4OQTA 3EADA 1A6WH 3L1EA 3UO1H 2Z7ZA 4UIMA 3ARGD 4XVUC 1Z0MA 4O5LH 3OAWA 3MODL 1WAEA 1HI6B 1MFAH 1PSKH 2MOGA 2JJWA 1V7ML 3UAAA 2AQRA 1G1CA 4C4KO 5C3IA 3V4VH 4GIAA 4B9GA 2WLZA 3QS2A 1DQLH 5DFAA 5I1EL 4XPTH 3RX5A 2D9CA 3H3PH 4Z18A 1H5BC 1RSYA 4MD5B 4PS3A 3CX5K 3CSPA 3W38A 4HOXA 2CO7B 3O6KL 3LHPL 4MSWA 5HYEA 5FW7A 1QFHA 3KR3L 1NGQL 4DEWA 1W8EA 5AW6B 3VQ2C 3HE6D 1RSFA 1Q9WB 3F83A 2W0LA 3GBNH 3QIBB 1PZ5A 1RK7A 2DQIL 3QISA 5FYJL 4J3OH 2LU3A 4P23A 1QEXA 2IH8A 3OHXB 4FKKA 4PJGF 4R5VA 2VGLM 3EOTL 1I3GL 3NZ8A 5I2IB 5FYKU 1JYWA 2MTAA 5GGUB 5GS3A 3R7RA 2G30A 3Q5YA 2ZOOA 4NKMA 2JJTA 1GKEA 4RIRA 2WM0A 3U7WH 3VVWA 5JPNB 3EH5B 4WQOA 5I28A 3CV5A 4OLWH 2FJHA 1F3JB 2W95A 1HSAB 2AV1A 1CFSA 1XIWD 2F8VA 1X5XA 2Z4TA 5D7KE 4P3DA 5IQMA 1CT8B 1T89C 1YEHH 3DUSA 4FS0A 4DGUA 3QWOA 4GY4A 4L48A 3GRGA 1BZ9B 1GY1A 4G8IA 4KVCH 3UERA 3DV4A 3HG4A 2PPCA 1DQQB 2GBAA 3TNMA 4JKMA 3BP5B 4E9SA 4ZMLA 5LDSA 1SVZA 4KUCD 3K2IA 3QRLA 4YZFE 2JV6A 1A7RH 2A74A 1JPSL 2DBJA 5MEOA 3V5HB 1NINA 4ICXA 4N6RB 1ASOA 3E9UA 3I3EA 4UZUA 5CGYC 1N8OE 2UVFA 1CDYA 3BUYA 2NQ3A 5E4OA 5HY9B 3CX5J 3OLEA 1SDDB 2W9EL 1XXDC 3SOBL 3CZUB 3J7HA 1Q9LB 3QC5X 3B3BA 1VRSA 1RJCA 2GTZA 1VJSA 1FL5B 1D5ZB 3K91A 5CP3H 4BYHA 4DN3H 5C0EB 1HKLL 4XHJD 3W37A 4NZFA 1C8QA 3FQYA 3P73A 2X4PB 1MAML 4FQLL 4DK6A 5B1BB 2VDRB 4PRPD 4CNIA 5FYLL 2PTVA 1UWYA 4KUZL 3GHEH 3UAJA 4ZMWA 5AFAA 2I7OA 3O11B 5HI3D 3BKJH 3WYRA 1E7UA 2JB5L 4GT7A 4Y16B 2LQRA 1EGJH 3GJEA 4PJGE 2JKTM 3C2AH 3HJ0A 3RHWF 3F7VB 3L4WA 4OB5L 3QJRB 4BD4A 4K0OA 4F7MB 3CE1A 3DTXB 4JDTH 2B1AH 3RDTB 3UPAA 3UPRA 3F6JA 4V2BA 3IDMB 4PJGB 2WXJA 4R0LA 1IGIH 1FSKC 3V52H 2UUDK 4WUUD 3AROA 3CPUA 1LDPH 2OTWA 3OPZL 1DCLA 4NWTL 2AQSA 4MXQC 3DPBB 1IE5A 1T89A 3FH5A 1XSKA 4HWBH 1C12A 3GRBA 3T08A 3JVFC 1BVZA 1GC1C 3L3IA 3O9WD 1OP5K 2PXYD 1QEWA 3V4VB 2Q9OA 3BVNA 1IE4A 1ITBB 1FVCA 4HK0A 4KJQD 4WO0A 4KK9D 1XGYL 3R7QA 2XUWA 1YY8B 3SCMC 1W2KT 1FGVL 2YJLA 4WF7A 2GQHA 1TQBC 2KC0A 2E7BA 5E1HB 1YCSA 2AERT 4TRPL 5FGSA 2J57A 3ENEA 1X7SA 3EYVB 3QULA 3TGXA 3FQUB 5C86A 4RFOH 4DQOL 3MVSA 4NZUL 1Z9PA 4K5PA 1YEJH 2YBRA 2WINB 3W2DH 2VAAA 5CR8A 1EEYA 2R1XA 2A83A 5L7XL 2WN3A 4BZ1A 1MEXL 2F74A 2O61A 3CZGA 3LPFA 5FM8A 5G4NA 4YHYB 5DJ6A 1EMTH 3MX0A 1R0AH 1NBYB 4TS6A 4YHPA 3RWGB 2O5ZL 1KBPA 1GTFA 2PKDA 5E94B 2XC8A 1VFAB 2FZ3A 4LEBA 1WGOA 2YD4A 4JFHE 1MLCB 1UYWL 1JL8A 3Q8BA 3L3OA 3EUUA 4ONOA 4A6YH 4ZI8A 3NA9L 3H53A 4CMMB 4YSUA 1NBVH 4LXFA 2BSEA 2FLRT 1OHQA 1U2CA 4F2MA 3ML8A 5K59F 1NAMH 2AK1L 4IBSA 3HR6A 3PWVA 3BE1L 3GKZA 2JLLA 3RY5A 4ZW5A 4AENB 3PGDA 4A04A 2FAUA 4U3SB 1TVBB 2AAVA 1S5HA 3H9HA 4JHZA 3D4YA 1VPOH 3O2VL 3L95B 4B3EA 4M8VA 2V3DA 4NBZB 4XCEB 1XF4A 5EA0L 1JERA 5H2BB 3K7UA 1JV2B 1P5UC 5E95B 3V10A 1BVKB 2DQCH 4F9LA 2PYED 3Q2CA 3L1OH 3T65B 1U8PA 1MRFL 4ZUUA 4YHZH 1MQ8A 5G5DA 2H5UA 1NLDL 1OSYA 2XCMC 3O4LA 2XSKA 4AGLA 4APQB 3HAEG 4F33A 4XO5A 1FNAA 3UAEA 2G3XA 3BEVA 1HHIA 2WXLA 2FGWL 4L4TE 5J1TC 2BSTA 1TJMA 1AZUA 3NRFA 4YEEA 3MFGB 3D4GA 1DVFD 5JHBA 4OSUH 3SZKC 5EOQL 2D7QA 3ULVL 1AD9A 4B95C 1SPDA 2VDLL 3CPLB 4Y5YB 2VR3A 1S7SB 3TXAA 5F7NC 4YE0A 3QZLA 4YX2L 4WDIB 2F7OA 4KXBA 2EDOA 4NQDE 3MGOB 3P3RA 4GRMB 1WD8A 2BS8A 3RIKA 2MRYA 2NUTB 1JZ3A 1E6OH 5DHDA 1T6VN 2HLAA 3QPQC 3WHXB 5D71H 1GA2A 3BWUF 3D07A 4TXVB 2TAAA 4L8SC 2BZCA 2DQJL 4WGVB 3H2PA 3OAZK 4NQDB 2DM2A 1ZVNA 3FFDB 4MBOA 3EGSB 2KZKA 1F58H 2VZUA 2VH5H 3US0A 1BXAA 1EVUA 2IC2A 4BFBD 1DBAL 1VFUA 2G2NA 3HE7A 2QR0A 4KGJA 3SOTA 1LE5B 5JXED 3VYNA 3CQQA 3JWNG 5CJOH 3PV6B 4JG5A 4YDJB 4O2EB 4X9YA 5CSBA 5KUKA 2C3HA 4PVMA 1T4KB 4QTIH 5FO9A 2EE0A 4YBQD 1A5FL 3QC6X 4ZJ9A 3BUTA 3SKMB 3C6LA 5HDQH 3KWXA 5T1MB 3WEXB 1ACZA 2V3EA 2YPLD 4NN7B 5DF0A 3M45A 2P5PA 2GC7C 4MNQD 5F8RC 4RGNE 3L3KA 3ZKSD 3K6SB 4OIBA 4FG6D 3OKNA 5JOPD 4CADA 5TDOA 3SE4A 2NY3B 4EI5B 4AQEB 2JQMA 1E4KA 5E9DD 4OQTH 2C3VB 3EBHA 2HVKB 2JNZA 1JRHI 3JTBA 3MOAH 4OR1A 3MU3A 1JZ6A 4JO2L 4RGNB 3BFQG 4TNWK 2EDWA 4HIXH 1FWXA 2ENYA 1DVTA 5CBAA 5DK2B 4FFVD 4E41D 1BFVH 3QORA 3TO2A 4P3CH 3KGUA 2X6VA 2DD8H 3PJNA 1G7PA 1EFXA 4A6YB 1TEGA 4PCYA 4YSPA 3O2DA 3AM8A 4YHMH 4AY0A 1R3LB 3KPSB 5C2UB 4FQQA 1FYTD 1NAMB 4Z0BH 2RAMA 3SYOA 2OXHB 1UM6H 1HJBC 4K94C 3ZOAA 4JDVB 1WUZA 2NMSA 4HEME 5SX5H 1AOHA 3KCPA 1IIIA 2ZTBA 3OR6B 4IS6B 3FQNA 1DP0A 3G3LA 3NIFB 4B9KC 2QGDA 3I74A 3CCHA 4D94A 4KZEH 1VFBA 4N0FB 2YLKA 5I6XC 5IZ7A 3ETBJ 3SDYL 3K6OA 1MPAH 1QTSA 5DRWA 3WIHA 1SXAA 3LEYH 3RVTD 3IRCA 5C08E 3UTZA 1EANA 1AANA 1U8NB 3GMLB 3HTLX 3K6DA 4G7SB 3DOHA 1O6VA 3KGRA 3DVIA 1OZTG 3WL9A 3BDYL 3N1FC 3HG0A 1OB1B 2XQYG 5E00B 4PBWD 3FSAA 2BVTA 4TTDD 3O6FB 5C08B 3KEHA 5FF6A 4E0RB 2F08A 3GMNA 4HIEB 3WBDA 5E99L 1S9VB 1GHFH 5I8CB 3ZT5A 3D18B 4BINA 5IMOB 1RJYB 5CJQH 3RWJB 3ZKXC 2AXGB 5AOLA 4C8XA 1UOWA 5DJXB 3T5WA 2XDHA 4PJ7B 1I7RB 4H26A 3U6RA 3MXVH 4IEFA 3R18A 4KKBC 3T6QC 3VWKD 8FABB 3DC0A 4N2KA 3NA4A 1C5BL 4XCYB 3GSVA 4PLJD 4ES8A 4LFHG 1SYSB 4YZWA 3W9EA 2KERA 1JDCA 3WNIA 4QUOA 3UP6A 3IS1X 4KHTL 2OR9H 1JK9A 3VXPA 3PNWA 4HBCH 5MEQA 2ENSA 2J44A 1KPUA 1SF3A 1DBKH 4D9LH 5TH2B 5D93C 3VCLA 1OSZA 4HUUA 4P49A 8PAZA 4D9RE 3K4DA 3VFMA 3KJ6H 3WUZA 5B3JF 5TE6H 4DOHE 3EHBC 4I7ZC 4J6IA 3S37H 2EIEA 3TO4A 2AZAA 3SD5A 4XP6H 1KGCD 4QF1A 1JZ8A 1P1ZA 3ME0B 4L3FA 5C0CE 3OKMB 4N5UA 3UPCA 4NX0A 4GB9A 2ITDB 3KGSA 4I9WE 3UYPB 5AVUB 4D8OA 5F9OH 1CGYA 4KTDL 2I7SA 2PTTA 2ARJQ 2MIZA 4DOHB 5CLWA 1OGTA 4NCC2 1IMHC 5BV7C 4YGVA 4XMTA 3GYRA 5C0CB 1CG9A 1F6AB 4OUOA 2A9CA 2G5UA 3ESPA 3LXCA 4HJTA 4N3UA 4Y4FA 1BXUA 1NJ9B 3NH7L 3QJFB 3S8GB 2ZD0A 1XF3B 4UIMB 3WLBA 5A7EA 4CC1A 1JI2A 2VB5A 1BM3H 3P2DA 3A4EA 3LY6A 3B4NA 5DRXA 4WLCA 3OJDA 3JV0A 1K3ZA 2J5LC 4MMZA 3TP4A 1QG3A 1LXMA 5TQ2H 3I2CL 1QBLH 4OF8A 2VJXA 2R0KH 1PX3A 2X0VA 4XAWH 4MSWB 5FO8A 5DUML 1EAQA 4KXZI 3PUUA 5JYLA 2VZ3A 2QPEB 3VXSD 2HB0A 2V8LA 2RHEA 3VSVA 3NRQA 5DR5L 3NMEA 2LVEA 1JHKL 4P23B 3WFEH 2V2WA 2WXQA 5A3IC 2E7MA 4BZ1H 1XH3A 5DC9B 4HLZG 2ZNWA 4OZGA 3GB7A 4F7KA 2MPAL 3Q13A 2OV0A 5D7EA 3VA6A 3GMRA 3MUY1 5DURB 1LO3L 2ZP8A 4RIRB 4NKMB 3QUMA 3CFKA 3RG1C 1XGRA 3X13A 5K9QI 2X10A 1NC2A 3NCCB 1PYWA 3WIFA 4NN5B 4OFIA 4R7XA 4YLBA 2CJUH 2FJHB 2R0WH 3OC5A 2Q87A 1QSVA 3NJMA 2W80C 1CFSB 1DBMH 4LP8A 1DQDH 4OKVA 4P3DB 3VSQA 3QDGA 3BQUA 5EUOA 4OM0H 1I1AC 4IRJD 3T2PA 2R29L 2O6CA 4KVNL 5B3JE 4LF3A 2WBJB 3EYUH 1ERNA 3RU8H 3TA3C 3RHWK 2R2HA 4JY6A 2WZ5A 4G8IB 5DQJA 3DV4B 2NRDA 3GO1L 1QASA 2MCG1 4KJYA 4BK4A 3TNMB 2ODIA 5L2KD 4Q4EA 1I1FA 2P5WA 2AGJL 2DQGL 5EV7A 5IW6B 4ZTPL 3BAIA 4ELDA 3US9A 3X3GL 1RULL 2VQUA 4NQSA 5EO1A 43C9A 2A74B 4LMQI 1AIFB 5FKPB 4CBZA 4R3SA 5MEOB 5HHXL 1OARH 1XR9A 5F7DB 3D85D 3BUYB 4DEUA 1ED3A 1FP5A 3CHQA 3HUJA 3LD8B 5FDWA 1CFNA 4P4KD 1NUNB 3V6OA 1LO2H 4FFYL 2QJDA 2XTLA 1GYAA 3O8XC 2GTZB 1XB8A 2R1WB 1VEPA 4U33A 1H5BB 3RWEA 3BZ4A 1TSHA 3Q6FB 2EYRA 2LLLA 4HVBA 3SE9L 4JM2D 1Z7JA 3SGEI 5FCSH 3D08A 3IJYA 4CNIB 5J11C 4GI8A 2CGZA 1HE8A 3LDBC 3D0AA 3UROR 5J6GA 1TETL 5HGHA 3GS0A 3UTSD 3GJEB 2GG1A 1VB9A 3BP7A 1CFVH 5FAAA 4C4UA 4NUQA 1X4YA 3U7YL 3UTPD 4Y5XA 1ZLEA 3QXWA 2ATAA 1I7ZA 4Z7WA 1GSMA 4PS4H 1FG9C 3UPRB 1NKOA 1AZNA 5KVEL 2JKJA 4MA1C 1HWWA 3HB3C 3ARBC 4R0LB 2EIZA 2VR8A 4AMWA 3KYAA 4RMSA 1IC4H 2FWLB 2GUYA 3FTYA 4NBYB 1IBHA 4NC1C 4X6DA 1C12B 2IIJA 1J0YA 3OR7A 4NZRL 3T6WA 2J5WA 3X17A 1QEWB 2X2IA 4ETQA 2BNRE 1FVCB 2VCOA 5KANI 5I71B 1OPGH 4X7SH 1RPQA 1QX1A 5LGHL 5SWZA 4S0HA 2IG2L 3QULB 4L1LA 3SQRA 5IB2A 3FS9A 4HWEH 2NNFA 2LVCA 2VAAB 5IBTH 1EEYB 2R1XB 2A83B 3RX7A 1BX2B 2F74B 2O61B 2OSWA 4MDJA 1OLLA 5DJ6B 3MX0B 5DHEA 3VFRA 4ALAL 4KH2A 1ZJBA 3G6DH 4KJPD 1D9KD 4YHPB 5DRNA 1YAIA 1T04B 3GI9H 3TT3L 3UMTA 1AZRA 2FZ3B 1BOYA 3FCSA 1QFUL 4TVSa 4WI3A 5DFWH 1N10A 5C9KA 2QTVA 2W92A 3L9RA 1FGNL 1QI4A 1OOAA 4HUKB 4HYTB 3CN0A 4N6QA 3L3OB 3C09B 4N2DA 4NFCA 3TNNA 5FWRA 1RU9L 1RZJH 5I6MA 3HI1A 3OKDA 5HVWA 2YD2A 3O2DH 4K7FA 4B5EA 4C47A 1MJ7H 2A73A 3A6BL 4DNLA 4LU5L 4LSQH 3F7PC 2VXQL 1U92B 3T2OA 5KSBF 4F1ZA 2XJKA 3PWVB 4WHDA 3PGDB 4P5KA 2WXMA 4JHVA 5F7EL 4DN4H 1HAUA 1S5HB 3U83A 4V2CB 3H9HB 4PGDA 4OZIA 3QNZB 4M3HA 1HYSC 3H42H 4F80A 4AMXA 3OXSA 1XF4B 3WIHH 1L7TH 3L4CA 5FYKH 4HJ0D 1A6VH 3HMXA 4KMLB 2PCYA 1V7NH 1XGUB 1V05A 1U8QA 5D2LF 2CHDA 1U8PB 4KKCD 4ZUUB 5LBSL 5G5DB 4JDEA 1J5OL 3O4LB 4KI5D 4Y4KD 3H9YA 5BQDA 5D7JD 4F33B 3PWNA 4BDVA 4G9FE 3S5LA 1BA9A 3BEVB 1HHIB 1JGUH 1OAJA 1E5UI 2IJ0C 3O2WL 4U2ZA 3WUWA 5IQ7L 2BSTB 1JZ2A 1KZYA 3C6SA 1F1AA 1H6EA 3SCMB 4FNLL 1IAII 5C0DA 4JKPH 1L5GA 2E4FA 2NZIA 4O00A 4XXCA 1AD9B 2AV7A 2BVQA 4HD5A 1QWNA 1ZEAL 4PTTB 4BFIA 3MZTA 2H1XA 5FW6A 3P1VA 4DGIH 1KGYE 2J25A 1KJ3H 2CXGA 2O72A 3E80A 4TVPE 5I82A 5KSAC 4G82A 1DVQA 2Q5BA 1TQSA 2F9BT 4PJIA 5FUOH 2YKLH 4JFED 1KSRA 4QT5A 2CNZA 4KX9A 4G59C 1MCOH 1OK8A 3GRWL 4XWGH 2EDEA 3ISYA 1ZTXE 3QB7C 2P45B 4KKRA 3KPQA 1IB5A 4BQ9A 3RA7L 4I87A 2J88L 3CBRA 2FHBA 1ZWIA 3DECA 4A63A 4UYQA 2UZXA 4XVOA 4Y2OA 5B1JC 3HE7B 5I5IA 2QR0B 3MO1B 5I15H 1OT4A 2WC7A 5IJVA 5B22A 3MACL 5ESVA 4PRAA 3MV11 4N2HA 3RWIA 4GKNA 4ZXBC 3SE3A 5I9QC 3ET9F 1TQVA 4P9HH 5FO9B 4LLMA 4FI6A 2WWNA 4ENEC 2J71A 1YYCA 1BMWA 3KPPA 2D73A 2W65A 3IPFA 4H2AA 1NBCA 4DWHA 5LN4A 3UYRH 3IMVA 3K3QA 5IHUL 3S3CB 4ODSH 3I84A 3OKNB 6FABH 4CADB 5D2LE 1DJXA 2N59A 4MVBC 2V6HA 1I9IH 5EC1B 1BPVA 4Y1SA 2AK4D 5KVDH 1OAZL 2G9HA 4S10A 4UV4L 4NHCH 2L04A 2JKIS 3FCUB 4PCTA 4WW2A 5J5EA 1KYDA 2VMCA 2R56L 3C60C 5SX5K 5FFOA 3IU4H 2XV2A 25C8L 2KL6A 2QQNL 2OCFD 4K73A 5D2LB 3ULSA 1C16A 3TO2B 2ZQKA 3AT9A 1MRCL 2R0LL 3EUDA 1G7PB 1EFXB 3SBWC 3WO3B 3GSNL 4XMLL 4X98A 3HJEA 5F1NA 1AI1L 3UBXI 3FB8A 2F5AH 4TOYL 3GXTA 4ZZKA 2EIMB 5BQ7A 2ATPA 4OZHF 4FQQB 3FT4A 3WXWH 3NJGA 5DWUH 3ZGIA 4GJTB 1OPOA 1WV7T 4OJFH 1WUNT 3KCPB 2WXKA 5FYKE 4J23A 3ABGA 2CA4A 3FQNB 1D7BA 1V8HA 2GY7B 3BAEH 1QR4A 3CCHB 1F1DA 3NRPA 1VFBB 1I85A 3LKSA 3L3HA 5CBEB 2Z64C 3UJIL 4FI7A 2Y25A 4QRRE 4PWKA 4D3CL 2HG0A 5DRWB 3E8VA 1KENL 5DMIH 4JZJC 3QUMH 5T1LD 1OD7A 4WWNA 1A22B 5C6TL 3UTZB 1OAKL 4IBLT 1M1XB 4HMEA 3U0TA 4EEEA 1IKNA 1ZHKA 5B1JA 3B2UC 1CD1A 4QRRB 3T2NL 1J5IA 3SDAA 3WL9B 2OI9B 5DHVA 3QI9A 2GHWB 3MUUA 4XC3H 4X7EC 3S4SG 4JRXE 3NABL 2XICA 3ARDC 2RR3A 4GNKB 4KXAA 4ZXBA 1A8ZA 1MQKH 1RV6X 3GMNB 1IT9L 3D0LA 3P3UA 4AYEC 5T3ZD 1WFIA 4FFZA 1I9RL 2Z65C 1G84A 4R4FH 5CWSA 2ZCZA 4U2YA 3ZX1A 2AI0L 4TN9A 2XZCL 1FHNA 3HN8A 3U6RB 1PU0A 2Y69B 4JZOA 3FQXA 5C6PB 5F71A 3LPOA 4IEFB 1FLRL 3WD5H 5KZCD 4K8RD 4OTXH 3GSVB 3GLDA 1WDAA 4FJYA 2YWZA 3NSYA 3QGVA 2IOOA 1IX2A 3PREA 4N8CH 3IMBA 2F8XC 3D39D 4FJ6A 2Z92A 1C08A 4QOKD 5EUOF 3D2UB 4MAYD 1JK9B 2J21A 3OWEA 5F97E 3SDCD 3TIDA 3VXPB 3PNWB 1U8IA 4LCYA 4ZBJA 4A7GF 5MEQB 4X6FA 1KPUB 4QRPA 5FUCC 2NX5A 3SYQA 3VCLB 1HNYA 1OSZB 4HUUB 1L6PA 2KT6A 4C83A 3L5IA 4G5ZH 1N19A 1HS6A 4OZHE 3RIAF 3VFMB 5KJ7E 4DK3A 1MAJA 1IQDA 3ETSA 3K0YA 1IM9A 3AREA 3HHMA 2XFGB 4GPVA 5I30H 3TO4B 4LPYA 4QF1B 1P1ZB 4OCSL 2EDHA 3HG1A 1QBML 5KVDE 3A21A 4OZHB 4WJ5A 3NPSC 2PTTB 5D5MA 1KB5A 3L5HA 3O3EA 3S3DB 1H3PL 1KTCA 3S6CA 1OGTB 3HUJF 4JZJA 3K4ZA 4HALA 3S36X 4WEBL 4IBZA 1CG9B 2N1TE 1IFHL 1OL0A 2Y23A 1FRGH 4KY2A 1A66A 4GS7C 4JFFA 4UMSA 5CEZE 5E8OA 5I8KH 4JBSA 1A65A 3APMA 1E42A 3FSVA 3IWUA 1E5YA 5DRXB 3ARDA 3OJDB 3QDJD 2X70A 5I1HL 3NACL 4YSSA 1N0XH 4HJUA 1FO0A 2OMBA 1J9SA 2XACC 2ZX8A 2DQTL 2ZUXA 1ZTMA 2Y2YA 4OZGE 5FO8B 3LKOA 3CVCA 4FFTA 4PAZA 3HKZA 3MXWH 1FH5H 4DW2H 3ZUCA 1VGEL 1SEBB 4PV1C 3HNSL 3HNTL 1H8SA 3APFA 2V2WB 2PUQT 1IQWL 4GQZA 1YNKL 4M5YH 4OZGB 3EGXA 3GB7B 5AUMA 2WKOF 5B3NA 3VDBA 2VC2H 2DB8A 3L48A 5EIVA 3GMRB 2F8IA 4EQ2A 2XVBA 3J8F7 5HHOD 5EUOE 4YDIH 3QUMB 3CFKB 3O6MH 1XGRB 3X13B 3CHPA 1NC2B 1PYWB 1U3YA 3OZ9H 2MCAA 4ZMQA 5JIPA 4HCRL 1EZVY 4RQQB 5D93B 3UX9B 3O4OC 3BAKA 4OKVB 1DSWA 3QDGB 5EUOB 1RAMA 3CFEA 3PFUA 4TULH 2P5WE 2PYFA 1JPEA 4LF3B 2N7AA 3U9PL 4ADJA 1H3GA 4MZ3A 3QA3A 4ONGH 3CZKA 1YDPA 2R2HB 4KPHH 4JY6B 3ZE2F 4CVUA 5DQJB 4ORZC 3DURA 3KPOA 4KJYB 5DZJA 4PGZA 5FGCE 1I1FB 2VR7A 3KDMA 2P5WB 5ISZA 5BPPA 4XB3A 4QYAA 3UOAB 3HUJE 1BYPA 4LSRH 3D4ZA 2NXYD 3D5OF 5EO1B 1IGJA 43C9B 3ARSA 2DYSB 2FTAA 5F1KC 3HMXH 3OLIA 1BJ1H 5F1SA 1GVIA 1DQVA 3WJJA 3WMSA 3UZQA 1FNEA 2NY2D 3X1BA 1EHXA 1BD2D 7TAAA 1LEGA 3MYJA 4PG9A 4R3SB 3MLZH 2WWMC 3B7SA 5FGCB 1QYGL 1XR9B 1KEGL 2ARJB 2X41A 1ED3B 2WPGA 3HUJB 2NY0D 1CFNB 2V9QA 5JHAA 3DSNA 1Q4NX 2GK0A 2JKWA 2X9YA 1ORQA 3DV6A 3ILDA 2QSTA 3LRSB 4PJ8D 1IFRA 3AG2B 3TZVC 2WNWA 5JOEA 3GT6A 3BZ4B 1DQTA 3MNVA 3RWCA 1LP9A 2XX1A 4M7KH 2NY7H 2EYRB 3I9IA 5IR1A 4N2GA 4ZUWA 4ANUA 3SD2A 4P05A 3UTTA 1WEJH 2CU9A 3IJYB 4QYOB 3AUVA 3HI6L 4K9EH 3ARFC 4JAMA 4JR9L 2KZBA 3CVIL 2VQ4A 1UENA 5J6GB 1WWWX 4GLRH 5HGHB 1DJGA 1BAFL 2A4EA 2AJUL 1G1OA 3BP7B 4HIPA 5IESH 1IC0A 1DE4B 5EU4A 1J9CT 1AD0A 3RTQD 1ZA3A 2WUBH 1W91A 2CDEA 3FRPG 1I7ZB 4L5FL 4MDRA 3VFWB 3BIKB 4BQ8A 4Z7WB 2J4WH 4CSSA 4DCQA 1CXEA 2CO1A 3X1NA 5IOPA 4JN1H 2BVEA 2EIZB 4XNYH 4DT2A 4Z7NF 1F00I 2R1YA 3CC5A 1KTLA 5SWZE 4AGQA 1U3NA 4WO4C 4LL9A 3OR7B 2NT0A 2XV3A 3DYOA 4ETQB 4DUXA 2X6MA 3ZE2E 5KBNC 3CDYA 1YMMA 5BO1L 5JYMA 1R5IA 2NYYD 3EJZD 5SWZB 4KWUA 4H8UA 3WEOA 2OSXA 5FM5O 3HN5A 1JPFA 1RVFH 1U9KA 5IB2B 2PWEA 3T0DA 2WCSA 2DLFH 3A22A 5D1XA 5GIRA 3ESUF 4XN4A 2FEEL 2OXGA 2OTPA 2K7PA 4ZX5A 4DFHA 1G1KA 5MERA 4MDJB 2VC2B 1OGAA 3VFRB 3VFSB 1T6BX 3VQ1C 2A3TA 4LOFA 4TQEL 3QW9A 3FCSB 3QIBD 5CAYB 3TZVA 3L9RB 4M03A 3PXJA 5CGTA 1OSPL 1L9MA 5GRUH 3HC4H 3TNNB 3GS7A 5I0ZA 1UT2A 1CWVA 1TYJA 2XA3A 3BEWA 1T0OA 4U49A 4PGEA 1PPIA 1XDTT 1A14L 2VIRB 3OKDB 3QFJE 4K7FB 4TUOA 3RL1A 3GK8H 4KROB 2JKLA 1IJ9A 2XU9A 1H15A 1L9RA 4IMKA 1I3UA 3QUYA 1XB6A 4JO3L 1XMWA 1CLZL 3V9CA 3QDAA 4QEGA 5I0DA 3PQYE 4XPGL 5E4IA 1TJIH 5DJAB 4X6BA 4PGDB 4OZIB 2YBGA 5GJSL 4NC1E 8CGTA 5J57B 5CN3A 4AEIH 3PQYB 5AYQA 1GZPA 3HB3B 3EO1A 3ARBB 4HGMA 1D6VL 3EJYC 4WKXA 5AVXB 2J20A 5FLVA 1U8QB 1JGEA 4Z7NE 5F44A 4HBQA 5D7KD 3CVHA 4JQIL 3PWNB 4BDVB 4G8FA 3S5LB 3QUKA 3WUWB 3L4UA 1VZGA 1WIPA 1CF1A 3C6SB 5AZ2H 1GGCH 3EJTA 2G0KA 4NRZA 2ILLA 5MP6L 5D96B 3EJUA 4AQ1C 5C0DB 5EUKA 1L5GB 4WI0A 3VXTA 1BV8A 4TSAH 2Z0BA 3H7LA 4FFZH 2BVQB 1F45A 2GKIA 4Z3HA 4FF9A 2KQMA 4BFIB 1NOLA 2X1OA 4NN6C 4PJFA 3CXDL 1T7VA 1CL7H 1QD0A 5H94A 1HL8A 5DMKA 5BZZA 4PJIB 4N86A 1YRKA 1KJVA 1RZGA 4EUPA 4QT5B 3VUAA 4TUKH 2YK1H 1YAZA 1IUZA 4V33A 4M4RA 5FA3A 2R69A 1U33A 2G0LA 4XNMA 2YQBA 3OX8A 4EDWH 5BMFH 3KPQB 3HPLA 1B2WL 4UAOB 4Y16D 2CBOA 1BJMA 2LE9A 4NM4L 5DZLA 4OJEH 3BO8A 2UZXB 1JWMA 1XZ0A 4Y2OB 1KULA 4N2LA 3EFFA 4F15B 5L4FA 4GI6A 4U1HA 2N4IA 1J86A 2LTQB 2W1NA 4K3EH 2CKBA 4GAAA 4O02A 4GW4A 3RDTD 5EBMA 5ESVB 2ZPKL 2X4RA 3RWIB 1ZLDA 1XL6A 4GKNB 2CALA 1IBFA 5C7XH 2VM4A 3RFZC 2WN2A 5T5NG 4JKNA 5E6IC 4LLMB 4X80H 3CSYA 2MCPH 1JHLH 3VXNA 5B39A 4YHOH 3LIZL 3Q2LA 3KPPB 1EEZB 4ZMXA 3AWEA 3ULVC 4M1CC 3R19A 1KB5H 4D9QE 4LCWE 2DPKA 5HDWA 2QPFA 1CDHA 3M7OA 5JIQA 1RURL 1IEAA 1ZGLP 4QRUA 1KC5L 3VXMA 3BZEA 1X9RA 4UQCA 4OT1H 4LKCA 1KV7A 4IKNA 5C0BA 5DDHA 1KJMA 1F41A 4YBLC 3D1MC 3N9GL 5F72S 5LNEA 3MBXH 3LCYA 3ULSB 4J3OD 1C16B 5JW3L 3DSFH 4FMVA 5JNYA 2BCKB 5JDSA 1OCCB 2BCMA 1FO0H 2WJ7A 2HP4A 3V0WH 4X98B 5F1NB 4OLZH 4Y1TA 3FB8B 1PLAA 4YPGA 1RZ8A 4P99A 4KAQH 3ASOB 4WI7A 5BQ7B 2B3IA 5KSAB 3RLSA 5FM5M 1Q8MA 1NZRA 2BY0A 1I9JH 5I1JH 4KITB 4FCAA 3HI5L 4DKDC 4JFUA 5CXPA 1KEML 4LASL 1VERA 3D7PA 4KC3B 1RUML 3LKSB 3L3HB 3VFGH 2TSBA 3C6EA 5F7UA 2KHAA 3VG9C 1GKOA 4Q14A 1UH2A 3WI9A 2PO6C 1WZMA 3QWQB 1QWHA 4JFHD 4XPFL 3MR9B 2YR3A 2NZ9C 2HKHH 1WA1X 2L3BA 3ZU8A 3RIAK 3U0TB 1LK3L 5E5LA 4XOBA 2WO4A 2K6ZA 2FB4L 1RZQA 3BIBX 1CD1B 1QFOA 1PZAA 1NLBH 4FXKA 3SDAB 3HCVA 3LNHA 3UCQA 1NGZA 4UQEA 1OF2A 5C07A 2E3VA 4G42B 5IOKA 1A9BA 2EC9T 2CGRL 2YGOA 4ZXBB 3IRPX 4TF4A 1TF4A 3D0LB 1TTGA 3GSWA 2A6KA 2R9HC 2KH2B 4APQD 5LQBH 1JGVL 4NUGH 5GZOA 1AE6L 1AXTH 4MCZA 2XPGA 1JNLL 5CWSB 1G9EA 2OYLA 3ZDYF 2H45A 2AJVL 2WIMA 5DMJB 5EBLA 4JZOB 3EO9L 3FQXB 3WKNA 4IRSC 3TPKA 5E8PB 2V7NA 2DV6A 2VDNL 1CPUA 2ATKA 3FQ1A 3JZYA 3WS6C 3NBNA 4XC1L 4QRPE 2BWIA 4KK8C 1FFRA 4R90H 4XOCA 2I27N 3KHQA 4K23L 1MVYA 4GAFB 3MNZA 1FE8H 3U25A 4NAJA 5LWYL 2Z92B 1KCUL 4PN6A 3X3FH 4HG4K 4LCYB 1U8IB 2HT2D 3NFNA 3IDXH 1YEKH 3PJLA 4X6FB 1U36A 4PJ9C 4PJDA 1MCEA 3QEUA 4XVSH 1T21A 4QRPB 5B7FA 1UEYA 1ZHLA 2R8SL 1BVNP 3FQRA 1D5XB 3HG1E 4X5RA 3MLRL 4C83B 5KAQF 3PAYA 4O9HH 5HYIA 3OLDA 4NQDD 5E2WH 1IQDB 4RISH 1WFNA 3PAZA 4XMVA 3MRCA 1IM9B 1GIGL 3AREB 5BRPA 2OP4L 3TBWA 1S7VA 1LJMA 4ZTOL 3VXRA 2C9RA 3RAJH 3HG1B 4JFFE 3P0YH 1HZLA 2COVD 4WJ5B 1TVHA 3S96A 1KWGA 3O3EB 2PO6A 1SXCA 5EORL 2NY1B 4JZJB 3D06A 3HKFA 4JCMA 1S78D 1WIUA 1KF9B 2M8XA 4FYRA 1EJ6A 2VXUH 3OL2A 3RNKA 4JFFB 4W9DC 3VWJA 5I19H 1MNUH 5L4IA 3ARUA 4WHYH 2CCLA 4OFYA 1JI1A 1II4E 4Q6IC 2NR6C 2FATL 4ISVA 1MJUL 2DI8A 4FAAB 4TSCH 2O1AA 3FKUS 3KLHD 3ARDB 5JW5A 1V3MA 2X70B 4GAGH 2DWDB 3QZWG 2ZX6A 1FO0B 3PHQA 5GGTL 3CSBA 2NY3D 1O9ZA 1KELL 4EI5D 5A16A 4R2GC 5DEFA 5J4MA 4KDTA 3AS3A 5IP4A 1MCCA 2GSGA 3LKOB 4M43L 3ZDYE 3DX8B 2UZPA 2J8HA 1IO4C 2Q76A 4RGND 2GJ6E 4H1LG 4AJVA 3L9BA 2OK0L 4UTCA 3GBML 2PW2A 2JQAA 3FO2A 4N9OB 1OGPA 5AUMB 4M6ML 4CC4C 4HG4J 5FUCE 2D3NA 3ZDYB 4LL4A 4LRNH 4RGOH 5BUAA 1HWHB 1KFGA 1S7TB 2PP9A 1W6LA 2P24A 3AS1A 1F42A 3KPSD 4GINA 3VGFA 5IKCA 3OMNB 3AWFA 5T3ZL 4PJ5E 1SMDA 4AVJA 3GXFA 5JMRA 3K74B 1SXZA 4IDJH 4M6NH 1KPVA 1I7TB 5DJ2A 4OV5A 2GIYA 2VYRE 5EZJA 1QW8A 3VXOA 3VDAA 15C8L 2X0UA 4G5AA 1NSNH 1NUDA 4KQ3L 4PGBA 3CFEB 3CAFA 1DVYA 2BZDA 2PYFB 1AP2A 4BZ2A 4K8RL 4L9LC 2CG9X 2H26A 2JCCF 3QA3B 1OLZA 1YDPB 4DVBA 3BRDA 4ZDHA 5EU7C 3CTTA 4L8BA 3ECWA 2NY5L 1N6QL 4ORGA 2DAVA 3KPOB 3P2TA 1TZ8A 3BKCL 3AS2A 3NPSB 3QRFM 1TSRA 3Q0HA 4HIIA 1FAIH 1SLUA 4AK1A 2AXFA 5ISZB 1ZGLA 4PM1A 2DI7A 2EXWC 3EOBA 5INCA 1UCBH 2HFGH 3BCDA 5B21A 3RVUD 4EI0A 1SDYA 3O6FD 4HAGA 5C08D 5KYWA 3CLFL 3OF6D 4GS7B 4P59H 4FHJA 4G8EB 3UZQB 3CNKA 4I4WA 2VUYA 4PG9B 3ZKMD 5EU5A 1LP9E 4MS8C 3CVHH 3EOAA 5AW7B 3QIUC 3RPBA 3W5NA 3TJHD 3UTTE 3SY0A 5D7LA 3W81A 4DKEH 4OZ4A 3DSNB 2ZUTA 2X42A 3ECBA 4RMQA 1ORQB 2QV4A 3EF7A 3SBQA 5C97A 1FZJA 5IW1A 1SJHA 3A5VA 2AEQL 3MNVB 3RWCB 1LP9B 3GBLA 1Q9KA 1CLYH 1T1WA 5IR1B 4KVPA 1J7VR 4ZUWB 3SBPA 3UTTB 3ZY7A 4Z7UF 2A9ML 3KBPA 3NK3A 2WO2B 3GMPA 2X7LA 3RZCA 4JAMB 2D31A 4UTBL 4L2YA 2EUXA 1WZKA 3MREB 4WWKC 2IANE 5J12B 4PD4J 2N1KA 4WFGE 5EU4B 1DSYA 2H32A 1AD0B 2Z8RA 4GAJL 3QARA 1O7VA 5CMAA 5I6PA 3IGAB 4AL8H 5IMLA 1GW6A 1ZA3B 2EDBA 2CDEB 2DZEA 2VLRA 2RH0A 3E8UH 2R69H 4ODXA 4Y9EA 4FQCH 4CRPA 3LNFA 2P8LA 3Q6GL 4DCQB 2ZUUA 2IANB 5JPMA 5FA4A 3ZZLA 1YMME 5IQOA 1AHWC 4KRPC 4U4BA 3X12A 2HTKC 4D9RD 1ZSDA 3SE8L 2WSPA 3CC5B 4DGVL 5HBBA 5IMMB 1KTLB 1HEZB 5I1DA 5GHWH 4EIBA 2R4RL 2CKBH 4O02H 3SDXA 4U0QB 1KIQA 2O4EA 4MJ5A 4G11A 4D7PA 2AJ3A 2Y7OA 3CK0L 3PE9A 5C0CD 2A9AA 5ICZA 4I9WD 1YMMB 5E1AA 2ZCLL 1R5IB 3LKPA 1OGAE 3V7AG 5JQ6L 3B9VA 1JPFB 3FFCA 4OCWH 1CD8A 3K2UL 3RWDB 2YRLA 5GIRB 1R9FA 4MFHA 2OXGB 1AZBA 4QR7A 1DQIA 1YPZA 1MFVA 2VDML 5MERB 3U2SB 5DVNA 1OGAB 3ARGC 3KM2A 3QZOA 2W59A 3L17A 3LPPA 5IQ9A 3ABKB 2DYRB 4M7LT 5IJKC 3TZVB 4G1MA 3QIWA 4XCCH 1JWSA 4P23D 3U1SL 1ROCA 3BEWB 3OMZA 1Q1JL 4PGEB 4TUOB 3RL1B 1BP3B 1U2YA 4Z7UE 4DVRL 4MBRA 5DURD 3HE6C 3D52A 5PCYA 2ED9A 5HD8D 3MRHA 3QUYB 1KTKE 4Y0GA 1SQMA 1GPOH 4WWKA 3RURA 1D2OA 2XWCA 2D2CC 3GXNA 4LO9A 4HS8H 3ZDZF 4NHUA 1TZHA 2SEBA 1KPRB 1RHHA 3R8QA 1Y18B 2AJXL 1MFNA 4X6BB 4PTUB 4W6XB 1MLBA 2DQHH 4EIGB 2LAAA 3FRUA 4H0IA 1L9QA 2WLKA 1TEYA 3HS0C 2QQKH 2IFFH 5DC4B 3PDOB 2WBJD 4DPBX 2H2SD 3IE4A 3K5RA 2AABL 2EEBA 1GZPB 3TYGL 3EO1B 4UDUA 4KKAD 3ZTNH 4CSZA 1JGEB 1FIGH 3KPLA 4OZFA 3BGMA 4AYFA 1IRAY 1XIWC 2MOQA 5DD6B 4AE0A 3CVHB 2M83A 1F0LA 2R4SH 2JH2A 4G8FB 4M7JH 1LL1A 3QUKB 4FA7B 3C8DA 1RZ7H 4HHAA 4HIHB 4TV3A 1YEEH 4ALAC 4HH9A 1BQLL 4NRZB 1UKSA 3STZB 1MCJA 2A9BA 1SJMA 5FYLE 5KJRH 1ULVA 4WI0B 3VXTB 1I31A 1RERA 4BEIA 5F3FA 5IHLB 4NQVA 1TQCB 1ZPLA 4WAFA 3NGBC 1AO7A 3QNFA 4ZFZA 4F58L 3FO9A 3QHFH 4PJFB 1A7NH 5H94B 3NIGF 2KZ1B 3GNML 5DMKB 1HIML 1FNSH 3BJLA 3DUUB 5IGXH 2I9TA 1KJVB 4M6OH 1RZGB 3DX9A 1MXGA 5BXFA 3EDDA 2XT1B 4UQ2A 2ETWA 2J6WA 1ASQA 4M4RB 2HT3D 2XQBL 4C55A 1Z3GL 3V6FA 3OX8B 3ETTA 4JFXA 3HPLB 4GSQA 3WGVB 4Z78A 4AH2A 2A6JA 2IPUK 4QRQA 4IU3A 4XHJC 1JWUB 1XZ0B 4WJKB 2CHZA 5LCVA 3Q2WA 4U1HB 3NTCL 4QXUL 3IMUA 5GISL 3GLZA 3QXDA 2CKBB 2AQ1A 3SDDA 4O02B 4WI6A 4GW4B 5EBMB 3I6SA 3ULVF 2X4RB 4HC1H 2NY4B 1A0QL 3MLSH 4KNSA 4WTZA 3ZDZE 4YEFA 1CE1H 2RACA 3JQOB 3G6AA 2GUOA 3GMQA 3CSYB 1LEIA 3VXNB 1SN5A 1WA0X 2Y7MA 4Y89A 1L0XA 5B39B 1U3ZA 3GZKA 4GBXC 2VLKA 4NQCA 1KCVL 3WXVL 1L9TA 4YPJA 1DUZA 1FNGB 3M8OL 4FQ2L 4E36A 4CMHC 4LHUA 5E8EA 3ZDZB 1IEAB 2F7RA 2Z34A 1E2WA 2VDQH 4QRUB 1YEWA 3VXMB 3BZEB 3NSJA 3H9ZA 4X99A 2ZWZA 5I5JA 2E9IA 3QZMA 3VTMA 4EJ1C 3V4LA 2FNWA 1WBYA 4RDQF 3TU6A 1AKPA 1JAEA 1KJMB 5CLZA 4W9LC 3BKYL 2Q0ZX 3V7MA 3ZT7A 3QJUB 3UIYA 1A3ZA 3G5YA 1S9WA 4KK9C 3BI9X 1EHNA 3GINA 4AQOA 4AQ1B 5JNYB 1R3IL 3CFBA 5JDSB 2EDLA 4POUB 2IQAA 4JW3A 5JXAL 3ZZ1A 3POCA 4N4YB 1ODUA 3HG2A 5HI4D 1B6UA 2H6OA 1FG2A 1RZ8B 3BPOC 3GUFA 1RUAH 3ULUH 2ZUWA 4KQ4L 3R8BB 3NIGE 1A1OA 3DA0A 2YA2A 4AYGA 3S35X 3VFNA 4ZO6A 1ZVSA 5JO5B 2D3VA 2I24N 1R47A 4AI7A 4G43A 2V4LA 2BSED 5D8JH 4YMPA 1OTTD 3IFOB 3NIGB 3SO5A 3ROLB 3ZL4H 1IGFH 1LWRA 4OAWA 4LHUG 1H8OA 2P44B 4ZMVA 1PFCA 5LLIC 4JPWL 4OCXL 5DD1H 5CD5C 3LQAH 5AVYB 2NYZA 3IJSA 4F57L 4FXKB 3U30C 2WIIA 4N2BA 3HCVB 3ULVE 5IFJA 1DCEA 1PZCA 1CXLA 1OF2B 1T03L 3MV7A 5BVPH 1A9BB 3QZNA 3B2VH 2HWZL 2GABA 4OF0A 3HFMH 1L3WA 2VDRL 3GSWB 4XMKH 1I9EA 2A6KB 4YQXH 3O4LD 4LP4A 2HX7A 1ET7A 4MCZB 4OI9A 2XPGB 4H8WH 4R4ND 2DQDH 5I74C 1NCAH 1E9QA 2VDLB 4E9VA 3QEGH 3N55A 1KN2L 2HX8A 5EBLB 4X42A 3GJFA 4A7TA 1DVZA 4JY5H 1DR9A 2WNGA 3SCMD 2V7NB 3TEXA 1R5WA 3ALWA 4JO8A 3GTVA 2ATKB 2VO5A 2VTFA 2DEWX 5F8QC 2DY2A 4JFZL 2O6FA 4PGCA 4FZ8L 4YS4A 3MNZB 4HV8A 4OVVA 3BZFA 5H35A 2R2CA 2NQDA 1A6WL 1PY9A 3UO1L 4TNVK 3WEMA 1DVFC 3GFUA 4WI2A 2CCWA 3NFNB 4O5LL 4AV4A 4UOZA 3QEUB 2Z31A 1T21B 2NNAA 2AAAA 3OSVA 1MFAL 1PSKL 1XO8A 4Q7DA 3FQRB 4BUHA 5IHHA 3V4VL 2Y72A 1DQLL 4XPTL 3H3PL 1QPXA 3H6AA 4BFNA 3MRCB 1XSIA 3TBWB 1S7VB 1IGMH 4G7QB 3VXRB 3K71B 5I9QB 3GBNL 3HE7D 4AGNA 1IBBA 1MVUA 1PX4A 2H32H 2VR5A 5CN2A 1TVHB 4YDMA 3S96B 3VG9B 5DO2D 2APVA 3LX9A 3TWCH 5BZWA 3E9TA 2PO6B 4Y8DC 3W39A 1PGRB 5I76A 1U8LA 1WT5C 2IH9A 1DJZA 2VDQB 2F7IA 1G9NH 5KSUA 4BCXA 2BSSA 3U7WL 4BFKA 1DJYA 5DJYA 5JXEC 6TAAA 5LBGA 3VRLF 4ISVB 4OLWL 3T0EA 2RFXA 3BH9A 3WTYA 5JW5B 5DJ0A 3PHQB 2BK8A 4GRWH 4DPAX 1YEHL 3CUPA 4P2YA 4PR5A 5DEFB 2QHRH 3L2LA 2GSGB 4N2FA 1TO4A 5F6HJ 1E4JA 5FKAA 4KVCL 2Q76B 3PF2A 4BUQA 4M56A 3ASNB 3RZWA 4IRSB 4G6AD 5IEKA 5FECA 5ANHA 1IKOP 1EFXD 3Q8FA 4FLOA 1Q94A 3FO2B 4WFHE 3BMWA 4NRXA 3DBXA 5ADPH 1O7DC 2P24B 1XD1A 1A7RL 4B96A 3EGDA 2IBBA 2XIIA 4HQQH 5IKCB 2YN5A 2DJMA 4XNAA 2XKNB 4J4PA 5EBWA 4XMPH 2XXGA 5HI5D 1UACH 2JIXB 4WVRA 5A7BA 1KPVB 5DJ2B 3CFUA 2RMNA 5L2JA 2P47B 5DRZA 5EZJB 3VU2A 3I9PA 4GRWF 3VXOB 5GS1A 4AK2A 2JCWA 3DNKA 4J3BA 4PGBB 2D3JA 3V79C 4JPVH 4DN3L 4G3YH 2UV3A 1KTJA 1AP2B 3CZLA 1NIDA 5FYKD 2H26B 1U3JA 4PVNA 3TN0A 4DVBB 5CINH 4ZDHB 4L8BB 5GGRY 3L7EB 3GHEL 4JANA 1WZ1H 3FTVA 4YVUA 2P4AB 3A4FA 3BKJL 2EC8A 4QRRD 1M7IA 4HIIB 1U8JA 2AXFB 1ZGLB 2ZYRA 1EGJL 1DQMH 5INCB 2X2HA 1X5IA 2B4CH 4JQVC 3C2AL 2WZ0A 2H7WA 3LXUX 5C0IB 1I1YA 5J1AA 1WT5A 3MI6A 5KYWB 3ESOA 3ATFA 1MHEA 1E65A 1GR7A 2QDWA 4EI6A 4EZLA 4JDTL 2B1AL 4OZFH 1IM3B 5EU5B 4LHQB 2F53E 3EOAB 3BP6A 1QTYT 2FEEI 3B9KA 5DGRA 2ZCKH 1NGWB 5T1KA 3VRLE 1QFWH 4W9IC 3QHZH 2WBKA 4R84A 1IGIL 3SY0B 3V52L 1OE2A 2ZKMX 4MRCA 4TTDC 1LDPL 1URIA 3FOLA 2OMTB 2N0KA 1FZJB 4HWBL 3ORJA 1SJHB 4Q4IA 5IW1B 3SY6A 3I6KA 4F1SA 2V3FA 2F53B 2HJFB 5SWQA 1Q9KB 1MCSA 1T1WB 3ARVA 4JFWA 2IAAC 5I16A 3GHBH 4W4NA 4LPTA 2PP8A 3PP3H 4POZD 2BW4A 4YE4H 3GMPB 1KCWA 2X7LB 5H37G 3RZCB 4TMPA 3D2UD 4NOFA 4MASA 1WP6A 3KW7A 3VWKC 1JG9A 1X7TA 2G2RB 3VD1A 3EBGA 4FTVA 3EYFA 3MV9A 3IJEB 4RFOL 3VFOA 3ALXA 4FXGC 5CMAB 5ECGA 1YEJL 5IMLB 3W2DL 4JK0D 3V6BR 3NEEA 3F85A 4BSVB 1MHHA 2P8LB 1AKJD 1T7WA 1EMTL 3KWWA 4I8DA 4Z95H 3VFPA 5JPMB 1R0AL 3R0NA 2A99A 3TO4D 5IEHA 2IEPA 4JO4H 5KN5A 5EU7E 1A4AA 2E9JA 4GRWE 2EUWA 4BHUI 1UA6H 3X12B 1ZSDB 1J5HA 4LLYA 2B1OA 5LCVH 2RJMA 5CFHA 4A37A 5I1DB 3GF8A 2EACA 3AUWB 4ZAKA 4HPYH 5ALCH 3SDXB 4A6YL 3QXAA 1KIQB 4MJ5B 3B7TA 3ILEA 4HK3N 3ZHNA 2Y1ZA 4JPIA 1NBVL 4QHNA 2BFGA 1H3XA 3TL5A 2HKFH 3PFQA 4GRWB 3D09A 3PL6C 2GJJA 4RX4A 5E1AB 4TQPA 1ICTA 1FL6A 3VG0H 1NAML 3LKPB 4HWNA 4OGXH 4Y1AE 4GAYA 4OF6A 5IF0B 3BSZA 2LLNA 3L4VA 2C9AA 1T0PB 3FFCB 1WO2A 3IXAB 3FK3A 1I8KA 3IFNH 3BYYA 1Y6KR 3PV7A 5DTFA 4AEHH 1VPOL 4KMTH 1EHKB 2YFOA 3PAVA 2ZX5A 3FHAA 3VGGA 5LKNA 3QIUB 1WAAF 3O6LH 1XR8A 4BFEA 2DQCL 5IQ9B 3A67H 3L1OL 3RPKA 2YAQA 4YHZL 2KZWA 4KZDH 4G1MB 3QIWB 1BZEA 3OVUB 1UHVA 4RFEB 1JWSB 3WJLA 1XCWA 3EG9A 4YOKA 5J7CC 1RLWA 4TL4A 3CG8A 1HTYA 5K9QG 4TLTA 4MAUH 4OSUL 2LLGA 2RQEA 3MRHB 2DJUA 4WWKB 1NC2D 4WTWA 2E9GA 4HJ1A 1QSEA 1XGQB 1TZHB 2SEBB 4MS6A 1RHHB 5EZLA 2FWUA 1OIOA 3NIDB 4NYLA 4ES9A 1GYVA 4TLUA 1MLBB 5EIIG 3QDGD 3QWRA 3VSUA 1E6OL 3P40A 1W0YT 5D71L 3BD5A 1I8LC 1TTRA 2CJTA 4MGXA 5E24E 1KDJA 1KN4H 1Z9OA 3LVTA 3KPLB 1JZFA 4GP4B 4JCLA 4OZFB 4AYFB 3VM5A 3H9SE 1F58L 2VH5L 2P5WD 1IL1A 4HHAB 2IMNA 3T4YA 1KBWA 4YVNA 2QV2A 1CK0H 2NW3A 2GITA 1KXVC 1KACB 4K4KA 1J0KA 4Z76B 3PL6A 3BVDB 5DFVC 3H9SB 3HLAB 1S7QA 4WWID 5CJOL 1NAKH 2VE6B 2A38A 4NQVB 3T4AA 4N26A 1IBZA 4V11A 4ZFZB 3IPEA 3FO9B 5AVWB 1MWOA 1NBQA 4QTIL 4D0DA 2K4AA 3K1DA 1E2ZA 5HDQL 3B43A 4QHUA 3ZHLA 2I9TB 3B7RL 4Q97A 3DX9B 5CF3A 4ZW6A 3K4AA 1CQKA 2IGFH 1WAAE 3FHQA 4UQ2B 3WTVA 3BT0A 4F8LA 3OQRA 2OTUA 3IU3B 1N70A 3COOA 2P48B 4FMKA 4P4KC 1HOCA 3V6FB 4JFXB 1FIEA 5HVHB 3T0AA 1ZD6A 3PPSA 3TH2T 4Z78B 4OQTL 5FEBA 1G5GA 2A6JB 4XX1E 3MOAL 5A3ID 4QRQB 5BRQA 4XN1A 3RY6C 5KG9B 4IU3B 3L08A 1JRHH 5C8JA 4HIXL 2FUTA 3TPUA 2Z0UA 1BFVL 2H2PC 1CICA 3CMOH 3IDYB 3QXDB 2DD8L 1E5ZA 4P3CL 5D70H 3SDDB 3W0WA 4OCLC 1P4IH 2GJPA 4XX5A 3B8YA 3QJTB 4B9JA 4BBWA 4YHML 3NSFA 3G6AB 4Z0BL 2GUOB 3GMQB 1UM6L 2FT8A 2AXJA 1UH3A 5KANG 4X6CA 1DUZB 2DQUH 3HS0B 1N7MH 2X4SA 3GSUA 1SUHA 1QOKA 3KYOA 4KZEL 1INQA 5E8EB 3BRFA 1XCXA 4ZPTA 1I8LA 1MFBH 1QP1A 2B1HH 3GKWH 2H1LM 3CVDA 1K9TA 1MPAL 5AAMC 4X99B 5BJTA 4JNXA 1U4FA 3LEYL 5SWZD 3IDJA 1WBYB 4H8HA 1E0OB 3NJJA 3CC1A 4QXTA 4TM9A 2FO8A 3V0AC 5EF3A 4DUWA 3G5YB 1S9WB 2ZIDA 3CFBB 5DUPH 3U36A 2ZXAA 2IQAB 1COBA 4P2RA 5IQNA 2E7CA 4EUPG 1FG2B 1ZV2A 3OZKA 1WJ3A 2VL5A 2J56A 4JJHA 1GHFL 1A1OB 2E7DA 2YFNA 2YEVB 5CJQL 5AB9A 3N40P 1BZDA 4EOWH 3VFNB 3T77A 1ZVSB 4R26H 3T6VA 3SBRA 4G43B 3MXVL 4ZQKA 4PRHA 2EDJA 1LDSA 4KROD 4M02A 1J5CA 2Y06H 4ZUTA 5E6YA 1MH5A 4OAWB 4U1KB 3TCLA 1E8WA 3ZTDC 3MV7E 3AMKA 4PJEA 4HUMB 4B9PA 2YGVA 5C0FA 1IFGA 2E8YA 1MIMH 4I1PA 1TQTA 2OR9L 3QBTB 3ZXAC 3IJSB 4F8QA 4HBCL 2WIIB 5F21B 2OMYA 2DH3A 5IFJB 1DBKL 3ZE0F 4D9LL 3MV7B 2DDQH 4XP5H 5J3HC 5LGJA 1EH9A 3JBG7 3PQYD 4LB8A 2YXFA 3HB3D 3ARBD 1U93A 1KY6A 3MJ7A 4L0YA 1LTXA 3SYPA 3KJ6L 4WUUE 2FL5A 5TE6L 4XXWA 5JOFA 4LCCC 2QT6A 3CZJA 2BC4A 4J7RA 3S37L 3V95A 4XP6L 1SHWA 3NFSH 1E9QB 3LEXA 1JXGA 1XH1A 3AG4B 4HJ0C 5F9OL 3NAAH 4QJ4B 2B9BA 2HT4D 2ZAHA 3GLAA 3TCTA 1TZOA 4KKCC 3ZDXF 4KI5C 4Y4KC 1UFUA 3DVGA 1TJGH 3IPBA 3MC0A 4K2UH 4PGCB 4UF7C 3UFIA 5J9PA 4FQHA 4HV8B 1TXKA 4B9FA 1LO5A 2KLRA 3BZFB 4RMWA 4N90E 3FU9A 2WVUA 1RIUH 1BVLA 5DA4A 2NNAB 1MELA 1BM3L 1GGUA 3FSOA 3U7AA 4Z3JA 3CHSA 1HQRA 1KNOA 3EH4B 2QZ5A 2IO5A 3TS8A 2H3KA 4GI9A 5TQ2L 3EYOA 1QBLL 2R0KL 2CAKA 4XAWL 3UBXA 1HZHH 2BIIA 4R4BA 4Y2LA 4UILH 4PCSA 4DFIA 1MVUB 2IDUA 3RGVA 2WY3B 4AGMA 3RJDA 1JXKA 3WFEL 5J13C 4XH2A 5BZWB 4HCGA 4BZ1L 1XSOA 4AUYA 3W39B 4I5BA 1U8LB 2ZWSA 2YD7A 2YJQA 4OLYH 5KSUB 2BSSB 3CIAA 1LILA 2VN7A 5DJYB 2WSDA 3MV01 4JMXA 3N1PC 2X2UA 1CZ8H 5BVJA 2CJUL 3T0EB 3R06B 2R0WL 2RFXB 3BH9B 4UQAA 3ZE0E 4BFOA 3MCYA 1DBML 4R5XA 4WU5A 3WKMH 1DQDL 3DJRA 3QXTA 4FNUA 3WENA 1YYLH 1T0NB 5DJ0B 3KPRA 4OM0L 4NNYA 2CWRA 4KOBA 3CUPB 3EYUL 3RU8L 4PR5B 1E9PA 1UASA 5I74B 2X6BA 4D9QD 3BFOA 1D5RA 1RIVH 3BSZH 5FKAB 3RUGA 1WH0A 5IEKB 2FX8H 1CLOH 4P48A 3CFNA 5FECB 2G2PA 4ZPVA 3ZDXE 5A40E 2DKUA 4X9GA 1Q94B 5GGVH 4P2OA 1TZGH 3DBXB 1EZLA 5GGQH 2HJKA 2BWQA 5A6LA 3EGDB 1BBJA 1EFQA 2L7EA 4Y2DC 3SO3C 5KSAD 2ENJA 1KXQA 1VEOA 5LXVA 3FB6A 1S9XA 3B9DA 5EBWB 3SJVA 1OARL 3ZDXB 5CJ5A 5GS2H 5F7LB 2B7DT 2BMKA 3CDZA 1JIBA 1U8HA 4BXVA 4N0UA 4GG6A 1T83A 1I8AA 5L2JB 5DRZB 2APFA 2R23B 2WANA 1LO2L 2XOTA 4LL1A 4Z5RA 3V6ZA 3TTYA 1JXDA 4RVBA 2PWDA 3I9GH 5DZAA 5IIEB 3CN3A 2BS71 3FHEA 3MRBA 4QY8B 5E2VH 2EDQA 2WTRA 4TQ8A 3TN0B 1MRDH 2YD1A 1MCHA 2PR9A 4XPBH 1T1YA 3LJ3A 4LNRB 4JANB 2QGBA 2YAFA 5E6UB 3ZT6A 4BXSV 2XBTA 5EOCH 1M7IB 1U8JB 3SDAD 2W60A 3NCEB 1IC5H 2R39A 4RSVA 1CFVL 1I1YB 4FQXC 4GKZA 4LCIH 1LQSR 5J1AB 4ZXBD 1RK0A 3AMLA 1P9MA 2NT1A 1WG3A 4LLWA 4EI6B 1SFDA 4PS4L 5SV4A 1OE1A 3PP3K 3B9EA 2WLYA 3BP6B 3B9KB 1T6WA 3TYFA 2G3ZA 3MV8A 1D5IH 2FEDD 2FQEA 3LVEA 2J1KA 1IC4L 3FOLB 1QO3A 2V33A 4I2XA 3MRRA 4CGTA 5KBLA 4MVBD 3IDNA 3KG5A 3U0WH 1L0YA 2DLGA 2R7EB 4Y5VC 4FTVE 4PQXA 1E5AA 5SWQB 3MV9E 4H0HB 5DEGB 5JHLA 5KVGH 2JI1A 3IJ7A 5E9DE 5I16B 1H6TA 5C2BH 1O7DE 1OPGL 4PJXF 4X7SL 3FAXA 2X40A 2JKNA 3KEDA 1D7DA 1CDJA 1CDGA 2WLHA 4B9CA 4R8WH 5AG9A 1JXFA 4E41E 4RA0C 4FTVB 4QRPD 3EYFB 3MV9B 1MF2H 4FA8A 1EZVX 3GQFA 2H0JA 4HWEL 1RLBA 2NY5C 1YC7A 1KGIA 4OFDA 3QAZC 5IBTL 4OFPA 4Y2DA 1MHHB 3V5DA 1IM9D 4MAYC 2QPDB 3ARED 3N04A 3OG4B 1MW1A 3G6DL 5IEHB 2IDFA 2Q8AH 3F04A 4S2SB 3GI9L 3VB8A 5T33H 1AY1H 3E3QC 5KN5B 1LO0H 3HG1D 3I6GA 4DJMA 4ODTH 5F7WC 3CXHK 4FERA 1XHHA 4BWUA 2L7JA 2NY1D 1RZJL 4AGPA 1KOAA 4AUJA 4JPIB 2Z91A 3HR5A 3O2DL 3ZTJH 2XFXA 4QHNB 4F7CB 1MJ7L 4JFDE 3KH3A 4JFSA 3JVGA 4LSQL 4N8VA 3R1GH 4JFFD 5MI0B 1FL6B 4ZOBA 2PWFA 4GAYB 4AMKH 4LIQH 3BH8B 4JMNA 3AG1B 1RD6A 1ES0A 1A3LH 2CIIB 3T6XA 1I8KB 2V9UA 3ARDD 4DN4L 1VKXB 1K8DA 4JLRA 4JFDB 5DTFB 3H42L 1RH8A 3FQTA 4IGBC 4JVUA 3RKPA 4IBVA 1C8PA 1N3NA 2E7LC 4I77H 3WIHL 1L7TL 5FYKL 1A6VL 1XR8B 1V7NL 2BSBA 4DO4A 4Q0XH 1K8IB 3Q5OA 1KLUA 3EDKA 5ENWA 1PD0A 1P7QB 1ROWA 1FFNA 2EVHA 2JI3A 2HRLA 2Z1KA 1JGUL 2YGPA 1WBZA 1CB4A 3NCXA 3BVUA 3EG9B 5CU5A 5E23A 2VDOH 3G9AB 3F3HA 1F13A 3VU1A 3TEZA 2F54A 2LU5A 4IKLA 1OM3H 4BA8A 2Y9RT 2K1MA 4JKPL 2EDFA 4YDKH 3TLRA 2IOMA 3DXAE 1ZSHA 2Y7QA 1G9MC 2JWYA 2QKIA 3S36H 4DGIL 1QSEB 3ARWA 3TT1H 3U4BH 1KJ3L 4WW1A 1D6EA 3GIZH 1D7CA 3IWVA 1NMCB 3E1F1 4FXGB 5EZLB 4E9RA 2E7HA 3Q9QA 4BJLA 2Y3NA 2C7UA 2IV8A 2VR6A 3IBEA 4E9YA 1PDKA 5FUOL 1S7RA 2YKLL 3CXHJ 2EKSA 3BH4A 5I75C 4M29A 1VZIA 4Z3IA 3MTRA 3LV3A 5D4HA 3IFPA 5IW3A 1MCOL 1KGCE 4XWGL 3QS3A 3AJ7A 4RSYA 3B3IA 4U1IA 1EPFA 4YWGH 5DHMC 4JGNA 3MUJA 5ISZD 1IL1B 1KLFA 3T4YB 4TNEA 4LLQA 2NW3B 5JIHA 1X5HA 1G0DA 5I15L 1Q9OA 3HPJA 2EDRA 3PL6B 1S7QB 3L4XA 3QR0A 4LHJB 3KWTA 3B8SA 2G3MA 4UM8A 3T4AB 4P9HL 2QBWA 3T0VA 2NXYC 2EDXA 2DQEH 4AT6A 4UDTA 1M42A 1G7MA 4D7BA 4QHUB 5AW8B 2MCMA 5TE4H 3RVVC 4N1CA 3US1A 1BXVA 4XO8A 4ODSL 3UTTD 2OTUB 6FABL 1OCWH 3P30H 1E27A 1H3WM 1HOCB 1NCBH 1RP9A 1I9IL 4A2HA 1YECH 1F1GA 3LS5H 5KVDL 3BSGA 1RZPA 1T5KA 4P0DA 4QXGH 4NHCL 3N91A 1NCOA 1IBDA 3STBA 1HILA 1ZIBA 2XZQH 1MCDA 3IU4L 5C8JB 3MMEA 3AITA 5I1AB 2ZWYA 1F4AA 3DMMA 4F3FA 3KYNA 3HS8A 2CRIA 4LIQE 3W0WB 4S1RH 4UBDD 2F5AL 2IAND 1E5BA 2VQ1A 4J28A 2R2EB 5ESAA 1TITA 1ADQA 4WFGD 3WXWL 2AC0A 4HU2A 5ACZA 5DWUL 1URZA 1VSCA 1XH0A 3RTQC 5JLZA 1RL1A 4OJFL 2I26N 2VJ8A 4NCDA 2X4SB 3BAEL 3GSUB 4R5TA 2P7TA 3KYOB 1INQB 4ZPTB 2VLJA 1R3JA 4PP1D 1YMMD 2OMVA 3SODB 4ZOEA 1T3FA 1EHLH 3UO8B 1JZGA 5BJTB 1QZNA 1J12A 5DMIL 2QHLA 3QUML 3IDJB 2WWKO 2V2XA 1RUKH 4QXTB 1BG1A 3WDHA 2FJGA 4FFWC 4U0RC 4OV6F 2JKXA 1CYWA 1O6SA 4Y4HA 5F7YC 1YNTF 4U1MA 2NY6C 2GTQA 1ZV9A 4HZ1A 1MCNA 2NYYC 4XC3L 1OGAD 2VDOB 5KBDA 3V0IA 4JE4B 3TBTA 3SQBA 4K71B 1MQKL 4PRHE 4GXUN 3HRZA 2VL5B 4KU1A 4FQIH 4BQ6A 1DJWA 2CXKA 3TZVD 4MJHA 4RRPG 4R4FL 2IOIA 2WP3T 2AMGA 3FTGB 3T77B 3FBQA 2XBDA 2H9GA 4F93B 3RPIA 1KCLA 3PWPA 2AFNA 4NZJA 4ZQKB 3RE0A 1ZDSA 4PRHB 5DS8A 4A38A 4YSAA 3WD5L 4JZNA 1BHGA 3FN3A 4PLOB 1MH5B 3QIBC 4OTXL 3QNXB 3QUYD 4U05A 1AC6A 4TLSA 1EBPA 2EH7H 2FLMA 1GXEA 4G6KH 4AJYV 1U3HC 3AY4C 4PJEB 1OP9A 3JYCA 5SWSA 4JRFA 2ZP0T 3OHXC 4N8CL 5C0FB 1ZS2A 4NEHB 1SLWA 4K3HA 2LU7A 1A7PH 1EDHA 2CIKA 2F6AA 1MW0A 2OMYB 2V17H 1KXTA 2CJ3A 1M9SA 4MJ6A 4X8XA 5JPNC 1X9UA 5LGJB 2V7HA 4KX7A 2J8OA 3NT0A 1ZLVH 1EBAA 1U93B 3F00A 4G2AA 3MJ7B 4G5ZL 2Y2TA 3LRKA 2FL5B 5JOFB 2FE0A 1P1VA 1GJWA 2BC4B 5I30L 4HUVB 3JV6A 3WKQA 5F7BA 1RK1A 5ILTH 5E56A 2SODB 3QG6A 1FZOA 4DKTA 3FL7A 3BP4A 3LEVH 4NSKA 4WEMB 1NPUA 2GBVA 3B6SA 3EYQD 3DVGB 3NEOA 1A4BA 1BOGA 3C5ZA 3CDCA 4KNTA 4PS7A 2EUZA 5J9PB 1FRGL 2DYPA 1CN4A 2VR9A 4FQHB 5DD0H 1LO5B 4NERA 5L9DH 3WNOA 2DWEB 2X4TA 5FYLD 2FVNA 1K3IA 4XZ4A 5I8KL 3V9EA 3Q1SH 3TVMA 1DLFH 1NFDA 2CO2A 3LNIA 4OGAD 2J72A 4PRIE 3WNLA 5IROA 5JHLH 5C3TA 1HQRB 1N0XL 1KNOB 1UXMA 5KYYA 3EYOB 4TTGA 4K5OA 5TK4A 1OCRB 2VDKH 3UBXB 4A2GA 2BFVH 3BDBA 1BQ5A 3MXWL 1JGDA 1FH5L 1JMZA 4PRIB 4X5PA 3VW3H 4DW2L 1RFDH 2ZSVB 1SQ2N 3LKQB 4XH2B 3ZZSA 1MAMH 1G6VK 4H7VA 4M5YL 2ZF9A 3WFBH 2NY4D 4I5BB 1U3HA 2VC2L 2G5BB 3AY4A 4Y16C 4UZSA 3P11H 4M62H 2DWSA 4AYMC 1OAQH 1PG7W 3KPRE 3VGAC 4X5QA 3H1ZA 4YDIL 3T71A 3O6ML 5CUSH 2CD0A 5BVJB 4WWPA 3OZ9L 4XWOC 1NGYA 3A6CH 3AFLA 3RDTC 3ERXA 3N40F 3WO4B 1Y7VA 4F91B 4WU5B 3SPCA 1YZZA 2FBOJ 3KPRB 4HKBB 4MWFA 1CGTA 5C0AA 4TULL 2G4GA 3QQ3A 4N8UA 4NNYB 4RAVA 3VXMD 3DO7A 2WUCH 2CRYA 2XWBA 4LCCB 1E9PB 2W07A 1UD3A 4ONGL 2EIKB 5F7MC 1E43A 2Z7YA 4JL1A 4KPHL 1OT2A 1BQHA 3RUGB 2A6IA 4F7PA 4AYID 1KXQE 2YXWA 3SJVE 1ACYH 4L3AA 1Z66A 1E4HA 2X12A 1JPTH 3C9NA 4LSRL 4S1SH 4ADIA 1HQ4A 1UEMA 2HJKB 1Z5LA 1BBJB 3HMXL 1U30A 1FPTH 5IBUG 5AW9B 2DLIA 4FKEA 3FB6B 4RGMC 3SJVB 3MLZL 2BW5A 1KJ2A 2NXZB 2Z8VC 4J3OC 4AIOA 5I66A 2BMKB 1QHOA 1U8HB 1L7IH 4N0UB 1A1NB 4YHYC 3IFLH 3QCTH 4Z7VA 4K7PX 4P5TA 3FO1A 4D8PA 2MMXA 3V6ZB 3QUGA 3MRBB 2BSDA 3VI4A 3SYCA 3QJHA 4M7KL 2NY7L 3TWYA 3EIFA 4PV8A 1WEJL 3DO4A 3OSKA 2DTSA 4Q56A 5DMYA 4FGMA 4K9EL 4GO9A 4Y9FA 1M9WA 2W60B 5CCJA 5J13B 2IWFA 3MV8E 4BQBA 5IESL 2R29A 4NO3A 4GKZB 4U7KA 3OKLA 2JB6B 1RK0B 2R15A 2WUBL 1N6VA 4LLWB 4UU9A 5F1IA 3FH8A 2J4WL 1L9OA 5GZOD 2VDNB 1UXWA 2I5YH 4LSUH 3TYFB 1T1ZA 3KD4A 1FZKA 1LD9A 3MV8B 4YHIA 5FV2A 3T04D 1MDAA 2N56A 4JN1L 4GXFA 4HPHA 4XNYL 3OZLA 4CU7A 1I8IA 1QO3B 2YAMA 3FU7A 2ZWLT 2AQTA 3MJ8A 3QJVB 4I2XB 4ZG1A 4JGUA 3IDNB 3TTSA 1YYMH 4MCMA 2J55A 4APQC 3QQ9D 5D1QA 2CO6A 4AEEA 2GSIA 2Q3AA 3G04A 3S8FB 3NCJH 2ESVA 3U79A 2GJZA 2G75A 5DSCA 1MI5E 1YUKB 1EVTC 2VDKB 2OQJA 1QWUA 1FN4A 1RVFL 1F4HA 3N6YA 4Q58C 1YJDC 2DLFL 4X9FA 1FQ9C 3G6JF 3V5DB 4UQ9A 5EOCJ 4Y2DB 5D7SH 5HGBA 1MI5B 2AMUA 1GOHA 2HT2C 4FP8H 3FQ4A 1JNJA 1WFTA 3VXRD 3JWOH 5FV1L 3V0EA 4LRIA 4BRVA 3I6GB 2V5YA 4KK5C 3D9AH 3HIZA 5F6IC 2GHZA 2PO6D 5IT2H 5GRUL 3HC4L 3L3DA 1ZXKA 1OM9A 4PJBF 2O5YH 4XO4A 2Z91B 3HR5B 1F4WH 2XFXB 1CD0A 3GK8L 2VT0A 1G9MH 1RJLA 4BWTA 4N8VB 1DJIA 1ADQH 2PWGA 3RB7A 3NJHA 3KJ4B 4X4XA 3DROA 1YNLH 5T5FA 4NC0B 1H19A 4OFYD 4BKLA 4U6YA 3WU1A 5CKGA 1BAWA 4L4JA 5DCCA 1JPST 1KIPA 3QEQA 1TJIL 2X4NA 2NDFA 2Z35B 1N8ZA 3GI8H 4RA3A 2OX5A 3T0XA 4FQXB 3B5GA 1K8DB 3QO0A 4JLRB 4W9JC 2EADA 3FQTB 4U1GB 1CDBA 3IAQA 3WSQH 1N3NB 4AEIL 3VM7A 2CCVA 3WNNA 3ULUD 2YS4A 2F54E 3KLHC 1KLUB 3CFJB 2K78A 3ELAT 2RTTA 4IRSD 5E8NA 5ENWB 3ZTEA 1FFNB 3T2QA 5IHBA 5D6DC 4PJAA 5BZXA 3WIAA 4B7LA 3I75A 1WBZB 1I1CA 4Y5VB 4EI5C 3FO0H 4UINH 4KK8D 5AZ2L 1GGCL 5DYFA 1TFHA 1XAKA 1MCQA 2A6DA 5EU6A 2ZXDA 2F54B 1S7UA 2VSKB 1NFKA 4RGNC 3SPHA 2EE2A 1SOSA 3D39E 4FFZL 4TSAL 2DM7A 2JIXD 3SKNA 2Y7QB 2QKIB 5D7IA 2DM4A 1X5LA 4WFHD 1AGBA 5CSGA 4AKOA 3QZPA 5HXMA 4Z3TA 4WW1B 1D6EB 3E3QE 1CL7L 1ECZA 3G6JE 5ITBH 2C7UB 3K6NA 4K3DH 4UQBA 1PDKB 3UZEA 2YGNA 2YIHA 2EKSB 4MYWB 3LTVA 1B9KA 4TUKL 5E2UH 2YK1L 3IFPB 2CHXA 4I89A 4QAWA 4EDWL 3MJWA 4U1IB 3RY4A 3B3IB 5BMFL 1AGCA 1RPKA 4M7ZB 1AOZA 1J0ZA 2HRGA 1V5JA 3R0MA 1KLFB 2XYCA 4L37A 4LLQB 2MTPA 4PJBE 3M1OA 4CKVX 4A7VA 4NXKA 5EZOH 5KTEH 1Q9OB 1FC1A 3HPJB 4N0CC 4K3EL 4FLRA 1J1PH 4WENB 1IM3D 3MRGA 5BRZA 4LLAA 2F19H 1HU8A 4MAZA 5A2BA 1MHCA 2NR6D 2WLMA 1CGVA 3L81A 5CJXA 5C7XL 5JIMA 4M9OA 3ZZQA 4PJBB 3RWFA 1JTOA 3RVUC 1L6XA 1NEZA 4X80L 2MCPL 1JHLL 2ENPA 3ES6A 3I6LD 4YHOL 3LZFH 4UDTB 4AT6B 3QDJE 3BUDA 4Y7OC 1P6AB 2E6PA 4IGBB 2HG5A 4OD1H 1KB5L 3ZKMC 2F53D 3KBEA 3M88A 5ACMA 3SB3A 1MCPH 1J8HE 3TJHC 4NCC1 3QCVH 1FVDB 1E27B 4HA1A 1EA9C 1JXJA 2JJSC 4PSPA 5GSRA 3VD5A 1WF5A 2NSXA 3RZCD 3IM1A 4LLDA 4OT1L 3W56A 3I9AA 4XNBA 2YA0A 3BN9D 3ZHFA 1HILB 1J8HB 2EXTA 2EYSB 3MMEB 5ID1A 2YUXA 3F01A 3MBXL 4HW6A 4KTGA 3TV8A 3QXVA 2PXYA 3DSFL 1WHPA 3KYNB 4F3FB 1FO0L 3RL2A 3VH8G 3CD4A 3V0WL 5DUBB 3ZO9A 1OP4A 4OLZL 1T2QH 2VQ1B 1OANA 1NEUA 2VLJE 3PHOB 4KAQL 5TPWH 2ADYA 1JYNA 5BUGA 5ACZB 3H7BA 4I3SH 2VMJA 1AMXA 3GEWB 1Q90A 5A2LH 2OJ1A 1I9JL 4MNGA 2UWEF 4HPOH 3KCWA 2BIOA 5I1JL 3AQDA 2P7TB 4U1JA 2QEJA 2VLJB 4HF5H 3VFGL 2ISDA 3ZGHA 1MREH 2HX9A 1C7TA 2OMVB 5E0FA 1T3FB 5CILH 2EILB 5DVMA 4X4ZA 1WFJA 3PPEA 2BNUB 4B53A 4NZTH 2V2XB 2JJVA 2HKHL 2M1KA 2FJGB 2FBRA 2OZNA 4LLUA 2O30A 3FFCD 3HZKA 1Z9NA 4B9IA 2DIJA 1O6SB 1NLBL 1QSFE 4U1MB 3GMOA 3B56A 4BA0A 2XIBA 1X3DA 1NGPH 3MBWA 1BD2E 1GYWA 2ZXEB 2J8UA 5IFHH 3QIUD 1F8TH 3PWPE 5ANME 3SQBB 3TBTB 4AIEA 4EE2A 1S5IH 4NP4H 5C92A 3HRZB 4QHKJ 3ATBA 3TOPA 3H3BC 5LQBL 4NUGL 1QSFB 4RETB 1AXTL 4LVOC 1B0IA 2MWCA 2VXVH 3QIWD 4CAGA 4TNWF 1CDCA 1ORSA 4UUJA 4P3WA 5K1NA 2H9GB 3FU3A 3RPIB 2CRMA 1SEQH 3PWPB 43CAB 5DS8B 1HNFA 3LRGA 3BT2H 2OS7A 4WFFE 4JZNB 1ZLVK 5I1LA 2YA1A 1I4FA 2PYEA 4P46C 4WWKD 1T0MB 4R90L 3ZMNA 1KJ2H 4P23C 2D7TH 3BPNC 2NOYA 4Z0XA 1NCJA 3KLLA 3PHSA 1FE8L 1JUFA 5GRJH 1UADC 1WFUA 2F5BH 2FT6A 3X3FL 3BUQA 1JGLH 2CIKB 4DP7X 3IDXL 1YEKL 4NI6A 4PB9H 1FBIH 4XP4H 1A4CA 4XVSL 5HD8C 2JJTC 3EOYG 4MJ6B 4X2UA 2Y24A 2V7HB 3FYIB 5E4AA 2DQMA 5CD3A 3MNWA 4O9HL 5E2WL 4RISL 2W81C 2HTKD 3MRPA 3WFHA 4IOIB 1GW0A 1UTDA 3UBGA 4ZFOA 3JV6B 4EZJA 3S98A 1RK1B 1YA5A