2CBMA

Crystal structure of the apo-form of a neocarzinostatin mutant evolved to bind testosterone.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
112
structure length
112
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEOCARZINOSTATIN
publication title Structures of in Vitro Evolved Binding Sites on Neocarzinostatin Scaffold Reveal Unanticipated Evolutionary Pathways.
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antimicrobial
total genus 16
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2cbmA00
1J5IA 1J5HA 1NCOA 2CBTA 1NOAA 1O5PA 2CBOA 2CBQA 2G0LA 2G0KA 1AKPA 4JW3A 1HZLA 2MCMA 2CBMA 1HZKA 1J48A 1ACXA
chains in the Genus database with same CATH superfamily
3PP4L 1CIDA 4X9GA 4OCYH 1FL3B 3AQXA 4JLRB 4OFYA 4XX1G 3WI9A 4ZS6C 4OKDA 4DPBX 1U8QB 4TNEA 1AANA 3RVTC 3KZ8A 1SQ2N 4TUJB 3K6IA 2VXUH 1S5HB 3VRIA 4X8JA 4W4NA 5C0DA 2CJTA 3IS1X 3VU1A 1GCFA 2DL2A 5IEHB 4X9IA 1IGML 2QKIC 5E5MB 3I3BA 1LD9A 2N3JA 3IAGC 2E74C 2PO6D 4KJWD 5ENWA 3C5SB 2GFBA 4NZJA 4FAAB 2D0HA 4KTDL 2GITB 2CQVA 1G9MH 2OZNA 3B83A 1U36A 4XZ4A 5DQJB 4WFGE 4GW4A 2P26A 1JS4A 1PZBA 2WCPA 5FFOA 2CR3A 4ADJA 4AKPA 1XIWA 5JIPA 5LUMA 2PYEA 3JZ7A 2ZG1A 3AZUA 1PCSA 4FQXC 4F27A 1Z5HA 9PCYA 2EVIA 5DDHB 2YN3A 3NZUA 2EEAA 2E5EA 3QDME 4APQA 2AHIA 2VWEE 5CIPB 2J6EA 3Q9QA 5EBMB 3IDGB 4G6JL 4QR7A 4F57H 1IX2A 4Z7VF 3IJYA 4XN8A 5E70A 4LPTA 4YDLC 4AUUA 4F3FA 4EN3D 2MNUA 5DUBB 1XH0A 3NJNA 4PAZA 4F15B 1JHLL 3V5KB 1E5UI 3SDXA 1UXSA 2DQCL 2BO0A 2I24N 2OMBA 4IHOA 5ANMA 5EU7C 1AH1A 35C8H 3RTQB 2H1PL 1BQKA 2WOYA 4LU5H 1OE2A 1RFDH 1CL7L 5CJOH 1U3HA 1DUYA 1QEXA 4LDEB 3AM8A 4EI5A 2WB1A 3B2XA 3U48A 1A3LL 2P48B 3APDA 4R7VA 5JNYB 4GO6B 5IHUL 4NHCL 4HSCX 4OI8A 1YRKA 4X7EC 3MKKA 3MRRB 3TWCL 1ETZA 4YL9A 4R5XA 1MCOL 4S10A 3QEQE 2IANB 3FF8A 1N5AB 3IMVA 4QD2E 3G5XB 1AXTL 3HB3C 1A6AB 3VH8B 2XBZA 4DQOL 5IVNA 3ATFA 4M6OL 3U4EB 3MUZ1 1QBLL 4KGJA 4TM9A 1BAWA 1UYWH 3LZRA 4NENB 4FZEL 1TNNA 3NCMA 4F1ZA 3L4XA 3OAUH 1EUTA 4AIOA 3MLZH 1V3MA 3LKOB 2E7DA 4NXSA 1D7DA 3HZVB 1XH2A 1KN2H 3DVGA 4ZMTA 2WLHA 1FNHA 3BXNB 4JZOB 4IRJC 4P5KB 4PJ8A 4H8HA 2VITB 4O58H 2DM4A 4YR6B 4LCCB 2N59A 1NCWH 3FHQA 4A68A 3T1WA 4PCYA 4ES9A 3MJ8A 5AVWB 1BWMA 4A7GF 3U7YL 4X99B 2ITDB 2VN4A 3LIZA 3LEVH 3NGBC 4Y4KD 5KANI 5EOQL 5EHFA 1HH9B 2IAND 4YGVA 1E4JA 4XBMA 5LAXB 4BSWB 1GKEA 2SEBB 2JJTC 3C8DA 1RVFL 4HIJB 3IAPA 3VMOA 2DQDL 3NJIA 1XGTA 5ESQA 4NQDA 1KJVA 1WBZA 5JA8B 4QRRA 4MVBC 2WOBA 3I6GB 2A73A 4MS8D 3LNIA 4X6DE 4LDOB 1XR9A 1FGVH 4X98B 4N85A 5ESAA 5SWZE 5D55A 3QIWA 1KWKA 1H9DA 2R39A 5F72S 3NCFB 5CZRA 4X7SL 1NBYA 3MXVH 1RZJC 1DO6A 2O5ZH 2GKIA 2VLLB 2W59A 3WIHH 5D4QA 2QQQA 1NCGA 3D8MA 2ZKWA 5HDWA 5F1OB 3JVGA 2X4RA 3QZOA 5HHOB 1DBAL 4AGPA 4M56A 1GGYA 1XD1A 1UWXK 2YIHA 4JY4B 1NGZB 5T5FL 3U79A 4FJYA 1F11B 4GI6A 3TASA 5DZJA 2G3NA 3U4KA 3MLSL 5E1HB 1A9VA 3QISA 1F4WH 5AEAA 3FRUA 1NCHA 2P46B 2WN2A 3UGUA 1HWWA 2VW6A 4X0KA 3W0WE 2KUTA 3HCVA 3WTUA 4G6KH 3K3QA 4AK1A 2IWFA 5I19L 2BVOB 1QPPA 5E2WL 2WLLA 3LZQA 3QORA 4K4KA 2PR9A 5KBLA 4PI0A 4IRZH 1WWAX 2WWMC 1Z3GH 3MLRH 2P42B 4JVWA 1YJDL 3VMNA 3E9TA 5LXVA 1QFUH 2GSMB 5D5MB 2YSSA 4Z7VE 1W0YT 4HQQL 3QI9C 4Z18A 4XPHH 2H3KA 5CAYB 2J56A 5HI3D 3AMKA 3VFRA 4AIZA 1V7ML 3C09C 2IDFA 1FGNL 3HUJA 3S37X 1VEMA 2X4SA 2MFNA 4K3HA 4RQQB 4YK4B 5C09B 5IHZB 1RZPA 1AKJA 3NZ8B 4X6EB 3P4NA 4ZZKA 5IB5A 1L0YA 2MPAH 2W9LA 1NL0L 2WNWA 3ZZ1A 3VD1A 3ATAA 4IDJL 3GJEA 5ACZA 1QBML 4N8CH 5EUKA 1S7XB 2W60A 4M8QB 3GPSA 2J6EL 4WY7H 5CBEB 5IMOB 3C12A 1NFDB 2R0WH 4XBEL 3I3DA 3RU8H 1CTNA 2WBJA 3GS7A 5D71L 3UDWC 4EUPH 1K3IA 1FDLH 3RRQA 4LMQE 4XP5H 2B15A 3ZRFC 1P4LB 1CURA 4R97B 1YMMB 4ONFL 3QFJE 2QMKA 2XZCL 4N6QA 1PKQE 3O45A 1BZDA 1L7IL 4RBPH 2MRYA 2UXFA 4G1EB 4E9TA 4UBDD 5FO7A 5FW7A 3BLPX 3MMEB 3M7FB 5FK9A 1ZEAL 4YHYC 5LGKA 3OB0K 4U1JB 3B37A 4ONHA 3W56A 1FCGA 1OCCB 4BV1A 3EO0A 5C09D 1NIAA 1NKOA 2VZSA 3X1NA 4Z3HA 2P24A 5GJSH 3S35H 4MB5A 2IPTH 1Z5LA 1A66A 2FJGA 2QGDA 4G6AD 3EF7A 4TUUA 4YUEL 4ZFQA 4YEFA 2GY5A 3DC0A 1O7DC 1QOKA 3AS2A 3ECWA 3MGTB 3RZWA 3TPUA 3WO4B 1KSRA 2LVEA 5C0AA 2F54B 4J8RB 3CIQA 3BQUC 3HIZA 5AAPA 5KS9B 3RYMA 4N2LA 4UMSA 5CSGA 5EOCJ 5FCUH 2JB6A 3BJLA 1NMCB 1IGJB 1FLRH 2AJUH 4LGPB 2D0GA 4XO9A 4DVBA 3FFDB 4NM8L 1BG9A 1YMMD 2KZKA 5ALCH 4J3SA 4KOBA 5CEZH 2OYPA 2J8UA 1R75A 1D2PA 3LCYA 5FKPA 3F62A 4GMSH 4HS3B 3WKNA 1A6ZB 1CD8A 1QSEB 5C70A 1HINL 1N7MH 2MCG1 3VXNB 3FCGA 4ZPTA 1CLVA 2Y4SA 4Y2DB 3IYLW 2G4GA 3D07A 5GGSY 2A77H 3V8CA 4PJDA 5K59F 4R7NA 1NCNA 1SYVB 5IG7B 2VR7A 4LCVA 3X13A 5BXFA 3LIZL 3EOTH 3JWOL 1ZT1A 4JW3A 2UV3A 4U7SA 4J3OF 4ZSOE 2TRYA 4ZBJA 2LW3A 2XIBA 4ZUVA 1U3JA 3NJXA 1MHHB 2UZIH 1T4KA 5EDXA 1CDCA 1J18A 2DEYX 4IOSA 4K7FA 3IMBA 4LASL 3TU6A 4H40A 4M93C 3S3CB 5FWQA 1JZ2A 2I25N 4Q6IB 2ZX9A 4H8VA 4U3SA 4B9GA 1G7QA 4OJAA 4JFEA 4Y89A 1I7RB 5A2KH 3DETD 2C8NA 4MLIA 4WHDA 4FNQA 3OLEA 3TN0C 3WIHA 1QSED 3NZHH 3CK0L 1UT2A 2ORBH 2Y7OA 4MGXA 4QJ5B 4Y2DD 2N7BA 3TA4D 3LKQB 1VACA 3KPSA 1CBVH 4HD9A 3TPKA 4B41A 1CIUA 1YN7B 1BVNP 4NQDD 4XVJL 1B90A 4K5PA 1WT5C 2J5LB 4ONGH 4QRRD 4TLKA 3KPNA 4FF9A 1UXMA 5E2JA 3ZIYA 3QIWD 1JVLA 4IKKA 3OB0H 5DK0B 3SOTA 2OR7A 2W95A 4QRPA 3U2SA 2UZYA 4J3WA 4OCYL 1IFHH 3HVNA 1NUNB 4I87A 3MV7E 2BP8A 2L8AA 4JGNA 2BIHA 1J1PH 1FPTH 1KFAH 5LWYH 2MTAA 1AR1B 3ARTA 4KZ0A 4IRZA 3L3KA 1R3KA 1CFNA 2VXUL 3VFRB 4F7MB 1PG7W 5DJ2A 1VLXA 1N0LB 4N9OB 4KTGA 4DVRH 4G82A 5KSBE 4NZTH 2VDMB 2VUYA 1WZMA 3GLDA 2D7QA 1JI1A 1AGFA 2KZ1B 2DWEA 1IVLA 1FL6B 1G9ML 2EAEA 1ANUA 3ARBB 5L9DH 2VDOB 3W9EA 5IW1A 5I5IA 1SJEA 3IJEA 2LAGB 4BUQA 2J5WA 4P8QA 1AFVH 4N3UA 2VM4A 3VU2A 5I1AA 2WLMA 4GO9A 4FFVC 4RGOH 3VX1A 3HHSB 2YQGA 4P23A 5J1AB 4XNBA 2FECI 2W0FB 1N64H 2OMTB 4F57L 3H9ZA 2ODHA 5B1AB 3VD3A 2DMCA 1IGTB 1AR1D 3EFOA 4EUPA 5E4EC 5K9OB 2NXYB 2OTPA 4I48A 2OMVA 4FOMA 1NPNA 1FC1A 1KMGA 3PDOA 4N5UA 35C8L 3ULVH 3FS9A 4Y19B 3SGEH 3B2DC 2V8MA 3P9LA 4LU5L 1RFDL 3KPMA 5CJOL 4YDVA 5KVDH 3V7AG 1KNOA 2QEJA 3RVVC 3UYPB 3US0A 5EBLB 2O30A 3A4AA 1N59B 3MOQA 2OMUA 1D7BA 3BZ4B 2CM6A 4J2QA 2QBWA 2VO5A 4PRPE 1WBYA 3GHEH 3LV3A 3P77B 3BUYB 5IQOA 1MIEH 3DTXA 2DMGA 4G6FB 3TBWB 5M7QA 2KS0A 4XPAH 3SY6A 1A25A 3RQ3A 1ZT7A 1MCBA 1NBQA 4XHJD 3VRJA 3TZVB 5GGUA 3SODB 4HZ1A 4WGKA 2VLMD 5EV7A 5K59E 1DBKH 3QNXA 3ELAT 1BG1A 2JK5A 1LNUA 1UYWL 4LHUB 1KXVA 4HA1A 3DX9B 43CAB 3GJFH 3OAUL 1K4CB 1S7UA 2NXYD 2ZCHH 4FQQB 1ET8A 4UDUA 4BFRA 4CADA 4YZWA 3MLZL 2G2PA 2IH1A 4I18A 4JFZH 4HV8B 4KJYA 4X7DC 3W57A 3P2TA 2BNQB 1KN2L 5HGBB 2Q8BH 3MCLH 1GMEA 4R9HA 4Y19D 4YNYA 2ZG2A 3ZUNC 4O58L 4WI2A 3WUWB 3ES6B 1NC4A 1FNLA 1S7TA 3REVA 5CMAB 1HESA 1NCWL 3UBHA 1YUHB 2ZUUA 5GIRA 4FXKC 5F1KC 3ZOAA 1AZUA 3NFPA 1CFTB 4OM0H 4ZMOA 5I8KH 3KVQA 3CE1A 4BFKA 4YFEA 5DJ6A 3WYRA 1B0IA 1F8TH 3QZWG 4DZ8B 1N67A 1JZFA 2VZTA 3MRIB 3QVAA 3QK0A 2BSRA 3LEVL 4G6FD 4GAGH 4PJ6A 4OFQA 1M6OA 4KZCA 4Y5VA 2WVUA 1DVSA 3BFWA 2I85A 1IAKA 5JHDE 4MNGB 4BYHA 2CCVA 2BWDA 4FFYH 1EHKB 1NGWA 3O3BA 4ZXBC 2CO2A 4HP5A 3MBXH 4LHUD 2WCSA 2DM2A 1MY7A 1T2QH 2H6OA 1FGVL 4DUWA 2FH6A 4Q58C 1U3NA 2LGNA 2YD8A 2BNQD 3HMWH 3MXVL 3DX8B 1A1OB 3PAYA 2O5ZL 3LTVA 1TTRA 2GI0A 2XPYA 7CGTA 4C83B 3WIHL 1CBJA 2D2OA 3DWTA 4JKMA 4QRAA 3MV11 2ZOUA 1NC2B 1EAQA 2JKIS 3NK4A 3KDPB 1CQYA 3X1GA 3EOYG 5HYSG 4AJVA 4NNYA 1OXYA 4ZFFA 5CJXA 3BD4A 4LCWE 1AGEB 1TG8A 4OVUA 3EYOB 5T33H 4I1NB 2YPLB 3RZCA 1OCZB 1F4WL 3T2LA 3PLYA 4NOBA 3CU7A 1QUNA 1HEZA 1ZE3C 2FWSA 2R4RH 2WMPB 4QT5B 2V17H 1HDMB 4G6KL 5IEKA 2L04A 3ALXA 4Y9EA 5FO2A 3KWTA 2WLZA 2ZSWA 1MUJA 3QXDB 3ARGC 4IRZL 1Z3GL 2G5BB 3MLRL 4KK5D 4WWNA 3WKMH 5E1AA 3PE9A 4N86A 4PJ9A 5J11C 1Q9WA 2F19H 3SDAC 1QFUL 4KK6C 4PGDA 4WHTA 5EOTA 4KQ0A 5EMYA 2KQMA 2WTRB 1NC2D 5FDWB 1JNHB 4BZ1H 3D0VA 4XPHL 4FQJH 1QLRB 4P99A 1WAAA 1JWUA 3V4VH 1OAQH 5DK2B 4C56E 3RGVC 4F92B 1JZDC 4L1SA 1PGRB 5F9AC 4HUKB 3KS0H 3U4BH 4KMTH 1YA5A 1UZ6F 3QG6A 1KB5H 3PQYB 4I0CC 2YPLD 2NX5B 2OMZB 2NNFA 4P23B 2MPAL 1RJLA 2QELA 2E6PA 3GBMH 5KYYA 1HSAB 1SDAB 1N2RB 4N8CL 2ISDA 3MRPB 5EDSA 3WN5A 3KYMB 5INCA 4HU8A 3GZQA 3NPSB 4WY7L 5I8EA 4P49A 5EEXA 3PUUA 4O51B 4DFIA 2R0WL 4XBPB 5K1NA 3RU8L 2UX7A 4NDMB 2R51A 3UIYA 3HZKA 4ELKA 1FDLL 4BD4A 1L6ZA 4XP5L 5AW4B 1XGZA 2W65A 1RUAH 4F7TA 1FV1A 2EE9A 4M03A 4Z3IA 2ODIA 3CSYA 3UEQA 3SDDB 1JF1A 3IDJA 3ILQC 5K1JA 3ZKXC 1MAJA 3HPJB 4XNUH 2Z92A 4G9FA 1Q90A 4ZFOA 1NUFA 1ORQB 1ED3B 2C3GA 3SPVA 3PQYD 4AYSA 5CBAA 4P23D 2WB7A 5GJSL 2X1PA 4N25A 3S35L 4AH2B 1AVAA 2MQ3A 3KCPB 2IPTL 5JPNA 1I7UB 2XOTA 3D39B 1YC7A 4CMHC 4H1LH 1A21A 3GSRB 4IDLA 4QXTA 4ANVA 1KBKA 2UVEA 1ORSB 5B1JA 3D52A 2ZX8A 3HZYB 3T6QC 2DIBA 5FCUL 1DVXA 2HRGA 4WAFA 2AJUL 1FLRL 1TVHA 1MIMH 2AV1B 3VXPA 4Q14A 1W91A 3GJFA 1ZPUA 3PIQA 5ALCL 3AG2B 3CDZA 2NYYC 4LPCA 4UQCA 2BRRH 5CEZL 2LVCA 4M7ZC 4MMZB 4OT1H 3BP5A 3ECBA 3SDDD 1JNJA 4YLBA 4GMSL 3CPLA 5T3ZE 1LK2A 1OEZW 5IVZA 3HE6B 3EW3B 3QDJA 5F8RC 1BQ5A 1N7ML 3P0VH 1XCQB 2D31B 3VFPB 2CKBB 4LLVB 4LLUB 3BPCB 5IROD 1SJXA 2A77L 2DMBA 5FO8B 4QMEA 3T0EE 1KB3A 5ID1A 3EOTL 4N5EC 4IM8A 3D39D 5D1XE 5AD0A 3K8MA 4AQ1B 1CL7I 1UKTA 5KSVA 2CXKA 5D2NB 2DEXX 2UZIL 4PGCB 3NCJH 3QDMA 4BDVA 4HAKA 4G83A 3EHBC 2Y3NA 3WFZA 4A1RA 1RJYB 3S4SA 2VN6A 4L8BA 4RAUB 2QT6A 2J21A 3FUJA 2C3VB 4LLWB 3HFMH 3KPQB 2YRLA 4FFYA 1XF1A 3GWJA 3CHOA 3MNDA 1HT6A 2FT8A 4XVUC 2IV9A 4TL4A 2GJ6B 5DURB 2Y1AA 4PTTB 1OQXA 1KGUA 3DECA 3SGDH 5JXAH 3BQVA 1AGCA 1EXUA 4ONOA 2CDEB 2CHNA 4V1DB 4BRVA 3HE6D 3NZHL 1BYOA 3OR7A 4JQVA 5IUSA 2ORBL 4GRLC 4P4RB 2FLMA 2WZ6A 4XN9A 1J5DA 3HHMA 3P54A 4Z7QB 1X7SA 2MWCA 1XHHA 2WNXA 1CBVL 3NP3A 3I6LD 1QHQA 2Z7ZA 3MV8B 3I9GH 2XUWA 2YXFA 3HLKA 3UG4A 3Q6FA 4AZ8A 4G11A 4ZMPA 5AW0B 4ONGL 2YS4A 4OLEA 3NDZE 1DVFB 1I8AA 4PJ5B 5T3XH 4PS8A 3ZBMA 5HI4C 3BAYA 4HOWA 4OZFA 2BNRB 2XKSA 5I6XB 3D2UA 1FJ1A 3WEBA 4BEIA 2GEQA 4PJ9B 4J4PC 3ZKND 5CJ5A 1HQ4B 1IFHL 2PCXA 2XXCB 1S2EA 4EIZC 4PSRA 1J1PL 1FPTL 1KFAL 2GJ6D 3ARQA 4L0PB 5DURD 5T1LB 2YUZA 5LWYL 5MERA 2CA4A 2GYSA 3RWJA 1LE5B 2A0LD 2BFVH 3NQIA 1TTAA 1F3JA 2GJZB 5FLUA 2YEZB 3SE3A 3O4OB 3L1EA 3OC5A 4V1DD 4XOBA 5L4IA 4B9PA 4G8IA 5J6HB 1EZUA 4DVRL 1YMHB 2ZZUT 4YSOA 2P47B 1XF2A 1IBDA 1RUPH 1XTLA 3R0NA 4NZTL 3M88A 4BZ1A 1ZK5A 3HI1B 3FQTA 3V4VA 1B0RB 1NSNH 3QG7H 1F2QA 3X1BA 3MV8D 4JFTA 5L9DL 2N4IA 2YUVA 3QEHA 2P80A 4PRIB 4JRLA 1KB5A 1G7MA 4ZODA 1Q1JH 3L4ZA 1DVFD 4PJ5D 4XNMB 5F7BA 3W39B 3NCYP 1AFVL 4UM8B 1QD0A 5DGQA 2BNRD 1Z0NA 2NUPA 3CZFA 4XH2A 2ZYSA 4RGOL 5BRQA 1SM3H 2H4EA 4PJ9D 3WENA 4CU7A 4HIQA 4E9SA 5CM1A 4A2EA 1N64L 1OLZA 1PJ9A 4QWWD 1XCTA 1W9XA 3K1KC 5T1LD 3U46B 4DP5X 1Z9SA 4YHNB 5C3IA 1RXLA 2M1KA 3FPXA 4HFWA 5IFHH 3VXRE 4CSSA 3ULVL 3ZTJH 4UU9B 3IGAB 2EDYA 4XE0A 1FZMA 2QMJA 5KVDL 1FNGB 1FQ9C 3O2VH 5GRVL 3W82A 5I24A 1R9FA 2IO5A 1CI3M 2WQRA 4ZFOL 1MCIA 5HVHB 4FMVA 4HISA 4RFOH 4PRID 3GHEL 2GK2A 3P4MB 4HWUA 4ODXA 3GD1C 1MIEL 2HT4D 2WXGA 4ZNEA 3O8XA 4H1LA 1KIPB 4Y4FC 5B8CB 2J7LA 2NY0B 1DBKL 4DEWA 1T83C 3EJJX 4PB9H 2XJLA 4Y9FA 4I1PA 3T4AC 2WVTA 3A6CH 4EI0A 4GS7B 5C9JB 2PYFB 3UADA 3QDGE 1T3FA 2V2XA 1GYWA 2ZCHL 4L8SC 1AQDA 1SDYA 3I02B 4TUKH 3GBLA 4XXWA 1LWJA 4JFZL 2LFGA 3HG5A 2YAFA 3NZSA 2Q8BL 3MCLL 4W4OC 2HKFH 3HBZA 4HKBB 2DKMA 1CFMA 1N0XH 5ICUA 3SDCA 3BYTA 1CK0H 2ZKMX 5F8QC 4KNTA 2DI9A 3ZXAC 2CMRH 4PM1A 1KDIA 5FGCE 2Y7QB 4GBXA 3D6GA 4OM0L 5I8KL 3ZHFA 4UF7C 3QE5A 4CVZA 1F8TL 4MKTA 1A1NB 1T21B 3CD4A 4GAGL 1C08B 4PRAB 3LS5H 3S6CA 4PGBA 4OF6A 3N0PB 3IMUA 4B9IA 1NEZB 4NNXB 2HPTA 2WXHA 5SWQB 4MMXA 1A9EA 2NY0D 4OZGA 1KIRA 4YEEA 1HJBC 4FFYL 2HFTA 4ELMF 1P0SE 3HJ0A 1IBHA 3MBXL 3PL6A 1YY9D 1R5VA 4YBLB 1T2QL 5C0JA 3MLTA 5K33A 4JFQA 3OLGA 5EIVA 2NY3B 1WISA 2P8PA 5CEYB 3TV3H 4G6MH 3HMWL 4OFDA 4G7RB 1EAJA 4CGUB 4NT6B 2X89D 4M4RA 4WFGD 3ZQWA 3MYZA 4LBEA 1DN0B 4P2QE 1JP5A 2C4FT 2XTJE 1ZJBA 3WIIH 2PPDA 1F5WA 2GPZA 3QEQB 4RRPM 2WO3B 2MTPA 3QDMD 4ZX4A 4K3DL 4LLDB 1TFPA 3SIKA 5I66B 1MY5A 3SJVE 3MSPA 4L4TA 1N26A 1L9OA 4KXCA 4OZFB 3VI3E 4JE4B 5T33L 1IKFH 3D06A 1A7RH 1XWVA 2JWYA 4DCQA 2WWNA 2FBJH 1G7IB 4GQ9H 2P43B 2R4RL 3QJZA 4PWGA 2V17L 3EYQD 3FO9A 1SXSA 1WP6A 3QDHA 3QNYB 4W6YB 4GSXA 3MROA 2DLTA 5AL0A 2ZUSA 2CUMA 3DURB 2HUHA 1S3RA 1K85A 4Z6AT 2NY3D 3J2PA 5ITFA 1I9EA 3TJEH 3QULA 3B2VH 3WKML 2W1NA 4KZDH 4BQ9A 3DVFA 1M42A 2JH2A 2F19L 1BQHB 4U1HA 3MV01 4MAYA 4BK4A 1AQMA 4UZGA 5F89B 3VSUA 2NW3B 5IMLB 3QEQD 4NO0A 4BZ1L 4JRWA 1I3RA 4FQJL 4X6CF 1M7DB 3NESA 4C8XA 4OFPA 3GPEA 3V4VL 3L6FA 1OAQL 2V9RA 4OZIF 5K9KB 1IFGA 3U4BL 4KMTL 3WTYA 1KB5L 4A39A 1E2ZA 3OXSA 1R19A 3WLBA 1RU9H 4G1MB 4DO6A 4IKJA 3V4UH 3GBML 1MCPH 4P2OB 1YDPB 1SPDA 1AD0A 3ECVA 4WV1B 4X6DB 5DD1H 5SWZB 2GUYA 3IGLA 2UWEA 1TLKA 2NCMA 1G9NH 4WK4B 2YC1B 2WQ8A 2AJVH 5ETUA 4QYOB 1S7SA 5DC2A 5LGYA 4TTDD 4XCNB 4OGAD 3TNMA 1AS7A 2C1OB 1DJXA 2EDFA 1WCBB 2X10A 2MNJB 4MJ5A 1GJIA 4XE5B 3VQ1C 1RUAL 1YEEH 3LKSB 3AG3B 2J3SA 2XQBH 1WA0X 1T22A 1BOGB 4WWKA 3MJ6A 5D7LE 4M1CC 1Q9LA 3GXNA 2EEDA 4X8GA 4QO1A 4XNUL 2EVJA 1QBAA 3W0WB 4M7JH 2BVUA 5AW8B 2Y0SA 3VQMA 4CDGC 3ZR5A 4MQXC 3V6FB 3LEXB 4P2OD 1CCZA 3QBTB 5SWZD 4X2UA 2QR0A 3B7RL 4NZUH 4P05A 1FWXA 3RGBA 1KT2B 1MQKH 1KBBA 5L4MA 4A04A 3C6LA 1HILA 2NDFA 4M62H 3POCA 5JXED 1QRNE 4Z7VB 3WTWA 2OYLA 2BSTB 1MIML 1BD2A 4PV8A 2WQWA 3EGDB 2E9GA 4KK9D 1JTTA 2KT6A 2WIIA 5LBSH 1S46A 2V2WA 5D6DA 2Y5TA 4WK0B 1TTUA 2RQEA 2HFGH 3BAIA 2BRRL 3CFEA 1HYRC 4ELME 4CAGA 4OT1L 1FN4A 1GPOH 3VWJB 2ZIDA 3VXUE 3BDXA 2WPGA 3VD0A 4KNUA 2XVBA 4NQEA 3KLHC 3PJLA 4R83A 4LLMA 1RHHB 3P0VL 4YVUA 5A2IH 5ID0B 2NSQA 5KBMA 2CUHA 4MCYB 4WUUE 5CGBA 1ETB1 3FQ2A 4JZJB 1EQWA 1FZOB 1UT1A 3E1ZA 5EIIB 2WQUA 1B3JA 3SHSA 1AXSB 4U2YA 4Z0XA 2ZUVA 2VQUA 3BWAA 3NCJL 3QUKB 5GS2H 4E9YA 3MLTB 1S5IH 4A6YH 1FLTX 1B0GB 4FG0A 3QFJB 4ISVB 1PKQB 2GEEA 3HFML 4JRFA 2C1PA 3HAEB 1ZGLP 4XB3A 5D7IE 2GAZB 3HE7A 3RWHA 1TT6A 5HD8C 5DMGC 1SUHA 5JXAL 1E4WH 3RFRA 5DJ0B 5HSFA 2DBJA 3VWJD 4ORGB 2OULB 3U25A 1EJ6A 3F12A 1TMQA 3Q2WA 4WJ5B 4QHMB 3C08H 5IT2H 4PRPA 4W81A 2W0KA 3N1PC 4UANA 1WE5A 1HXYB 2PP7A 2G75A 3HBPA 2VIRA 3I9GL 2KDGA 1EHLH 4UQIM 3G04A 1D5BA 4NQVB 1M7IA 4X6CE 5IFJB 4TQ8A 5T3XL 5CN1A 2GTQA 3QFJD 4NFCA 1SN0A 1B4LA 2ZSVA 3X1EA 5MP6H 2P5WE 3O3EA 3NDYE 3OKEA 4YSQA 1MVUA 2WNKA 1PYWB 4I5BB 3E8VA 3E1F1 4PY7A 3MLPA 4NC2B 2HLAB 5EU6E 1FFPB 4PRBB 3MA7B 4P5SA 2VZOA 1Q9KB 2B59B 3B1TA 4Y1AA 4EI6A 4HUMB 5CCJA 5INDB 2Z8RA 4A2GA 3RIAK 1Z3RA 1PY0A 4NFBA 2BFVL 1QI4A 1YAZA 3OX8A 5J89A 2DYPB 4K3GA 3LVEA 4M02A 3LPWA 5FM8A 3BGFC 4JDVB 4ZSOB 1E27A 1H3XA 5CUSH 1RUPL 3BHBB 2X1QA 2CHXA 2FT6A 1FZKA 1VFBA 4ZUWB 3VFSB 4BE6A 4WTZG 2D8KA 3AUVA 1NSNL 3QG7L 4Q9BA 5EFIA 1HHJA 2P5EB 5DEGB 1PZ5A 5JW4N 3VCLA 4K3EH 1YEFH 1V3LA 4ILDA 1AZZC 4FNLH 4JCLA 2F7PA 1EWHA 3BKYH 2CLRB 1Q1JL 2YJLA 3H9YA 5DMYA 5EU5A 1S3KH 1RJZB 2X53A 5C0BE 5JLZA 4OFKA 3TCLA 3WL9A 3VXQA 4WI0A 1SM3L 3MNVB 1JPGB 4QHKI 4X9BA 1WEJH 3B6SB 4MAYD 4Z77A 2OYMA 1DE4A 2HJLB 4GAJH 2OCFD 3VE0A 1E9PB 4KFMA 4U6VH 3HRZC 3QIUC 1J8KA 3B5TA 3MU3A 2NY5C 3H3PH 3F05A 1PEWA 3UBGA 1I85A 5IFHL 2DYPD 4TPRH 5KYWB 4BFGA 3Q8CA 1OCOB 2G60H 2V5YA 1CXEA 1ADWA 1JGDA 3SOBH 1BFOB 2YR3A 5I6MA 5JHLH 3O2VL 5IMMB 1J0JA 2P8MB 5MEPB 2AC0A 4KROB 1DQVA 4G80A 4RFOL 2A4ZA 5HHVH 3ME0B 3WIAA 3C6LB 3IK2A 2R7EB 3MV7B 4OTXH 1L9MA 4Y5YA 3WEXA 4FXGA 1IEAA 4R84A 2P5PA 4LLQA 4PB9L 4NQSB 4PCKA 4ENZA 3QC6X 5F1NA 5MEOA 5DWUH 1X5GA 1OPGH 3HS0B 4MNQA 4WW2F 1UH4A 2O72A 2R0LH 3A6CL 4X6BB 2AJ3B 5CGMA 1QO3B 3FUFA 4AJYV 1P1ZB 5KSBB 4TUKL 2JKRM 4UDTB 2NY4C 4K8RC 1JYNA 3IFPA 5LBSA 2VH5H 3LRSA 1QR4A 3BVNA 1QTSA 2HKFL 2DDQH 2CU9A 4RDBA 2NR6A 1N0XL 5EBWA 4CN6A 4ODSH 4CJ0A 5G5DB 1FAIH 1CK0L 2AITA 3H42H 4NC1E 4GLRH 4F7KA 5KSUA 3RIFK 2CMRL 1AIFB 1BYNA 4YFLF 1JGEB 2WC7A 4UZUA 3D18A 4Z3EA 2VLKA 2E7CA 3RY5A 1W0WB 3Q8EA 2WXKA 4IOIB 3VWKB 4HJTA 3C6LD 3MA9H 3FQ1A 3RFZC 1NUGA 2QQLH 3MV7D 1U3ZA 2MIZA 3LS5L 4ZFZA 3RJDA 1DVYA 1CICB 1P84K 3VA2C 1X4XA 3CDGB 3UGEA 3OV6A 2JQZA 1M4KA 3SN6N 2CH8A 3OKDB 3ILPB 1J10A 4A6YA 2PO6C 3H53A 4XXDB 3ZGIA 3OHXC 4PV9B 4U7MA 2PF6A 3FL7A 4A37A 4YHMH 4MJJA 4TNFA 4RCAA 2O6FA 1JSYA 3ZDZF 2VERN 5E6SB 3TV3L 2X4OB 1D6EA 4G6ML 4GAYA 5I1GH 5M95B 3HLAB 1A4AA 4L4VA 5F7KC 3RPIA 3MRLA 4FYQA 2VW4A 1X5LA 3WIIL 4QF1B 1T0MB 3IPEA 5L8LB 3MBWB 3FNKA 2H3NA 3OGCA 4YLQT 1A4KB 1HHHA 4GKZB 4RX4A 3QA3B 4EN3C 1W80A 3VWKD 1U8JA 3O4LE 3L17A 1IKFL 4FC3E 4DH2A 1PEZA 1A7RL 3TBVB 4AQAB 1CF8H 2BINA 1JV2A 2H47C 3L3JB 2FBJL 4OD2A 4GQ9L 5D2LA 4N0YH 3HE7D 5C9KA 4PJFA 2MSPA 1H8LA 4X4YB 3FH5A 3FTVA 1R33A 4AC2A 2FZ3A 1FO0H 3QUHA 5G4MA 1A6VH 3QWQB 1HC1A 3GLZA 4M5YH 3WHXB 3N40P 1L9NA 2NZIA 1IQDB 4JM2A 2L7QA 4PJXA 1LE9A 1K9TA 2OMYA 3TJEL 3B2VL 2BHUA 2H1LM 5DJDA 4POYA 5M94B 4KZDL 5AENA 3T0VA 1J5HA 5IB1A 4PRPD 2ZPKH 3D0AA 1JYVA 4OFIA 1BFSA 1WFUA 4QXGH 4AQOA 1K4DA 4AY0A 4FQHA 3VYOA 3T2NH 1X9LA 4CC1A 4DWHA 3L3OC 4OIIH 1XT5A 3O2WL 4EDXB 2MQCA 4IMLB 2YMXH 4RNRB 1NZRA 5JHDB 4F15C 1KYOK 2IALA 3VXQB 3FOMB 4LPVA 4J3OD 3FU7A 1RU9L 5FV2A 3GI9H 1U8LA 1WJ3A 3SKOB 3V4UL 1MCPL 4H2AA 4BGLA 1FFQA 4AITA 5DD1L 5LNEA 3ULUH 4IGBB 3MRGB 4LT7A 1G9NL 2VISA 1KGXA 4M29A 3C5ZB 4C54A 1SMDA 2AJVL 2PPFA 2PNDA 4MWFB 5C3LD 4NKQB 1KLUB 3KGUA 8FABB 4MXWH 3JUYA 4Y4KC 2JF1A 4XVSH 4JJ5A 2R59A 1YEEL 2XACC 2VMJA 1F42A 2DH3A 4LCWB 2XQBL 2A83A 5CR8A 1ZLWK 5IJVB 5TF1H 1V27A 2ICWA 4NP4H 4YN3A 5JHLA 5E5UB 3PNWA 4MS8C 1NDTA 5JHDD 2RQ8A 4WI3A 3O6MH 4M7JL 5DHMC 1XV8A 3VFNA 1XF3B 3Q2LA 1KTDA 3JV6A 4YH6A 5ECGA 3SQBA 3SB3A 3W11D 1KIQA 4GAFB 2C9AA 1U8IA 1GAFH 3MZTA 1U41A 4IGBD 1WAPA 3C8HA 4FNTA 3OF6A 4NZUL 3U9UA 3C5ZD 3FQXA 1BIHA 1P7KB 1MQKL 2XWJB 3VB9A 1RERA 5CZXC 2EIEA 2G9HA 1KTCA 4FXLA 1A6PA 4CGTA 1KXQA 3LRSB 4M62L 4YWGH 4N90E 5KANG 4MD0A 3CIAA 3U6RA 3IDMA 2ICWJ 2OMWA 2ED9A 2XN0A 3P9MB 1C12B 5LBSL 4ES8A 4C56B 1QYGH 1QQDB 2HFGL 1P9MC 2GK0A 3GSQB 4LCWD 3QUYC 4PVMA 5C1MB 3FU3A 2EYTB 2CRZA 1ZHKB 1GPOL 3PWJA 5HGAA 5JO5B 1TZIB 4ZUSB 4EKJA 3V4PB 4PH8A 3BWZA 2B08A 4PU2A 4G72B 2FYYB 3ZDZE 3WIFA 2CCLA 5F0JB 2L3BA 2BS8A 2UZXA 2M26A 4F37K 2A9BA 4YHKH 3EFFA 3O6LH 1UA6H 2B4CH 2COVD 4KO5A 4YDIH 1GGCH 3QQ9D 3HFFA 5DLMH 3RUGF 3HA0A 1S5IL 2CDGA 2EIMB 3GM8A 3UTQB 4A6YL 5F7NC 5HI3C 1BLIA 1NEUA 2WXFA 1AP2B 4NSKA 2UWEF 3R0MA 4U33A 4ZPVA 1MSPA 3UACA 4K55A 4I8DA 5GHWH 3BMVA 3KGSA 1QSVA 3UPRB 3RWCA 5CLYA 3GYRA 4N2IA 1D5ZA 4C56D 3GMQB 3PWNB 3INOA 5B39B 4ZW6A 1E4WL 5ICYB 1GHFH 3QRFM 4HDIA 2NUTA 1E6JH 2C9QA 3ETSA 1I3VA 2ZAIA 3C75A 4X7TB 1EA9C 2BZDA 2NSXA 3L3GA 5SWSE 2ATKB 3L3DA 5EC2A 3C08L 2RFXA 3PWPE 5IT2L 4YSSA 4QHPA 4MX7A 1P4UA 5A2FA 1AACA 1W72B 4QHLB 4R4BB 4U3CA 5I74B 2BSDA 2E8ZA 2H6PA 4RMBA 5TFSH 3AQYA 1EHLL 2AXWA 3KVDD 3HKZA 3CUPB 2XWRA 1M9SA 4J7RA 2DI8A 4UBDC 5I1LB 5D1QE 4O2CB 2VL5A 1ZLWH 1WHOA 4F7EB 3F7PC 4P0DA 1KLFA 4AQEA 1R46A 2NPLX 4JS7A 1XIWC 3ZMRA 3BVTA 4W9IC 4N87A 4Y7MA 2Q20A 5DJDB 3VI4F 5HDOA 2K3HA 5MP6L 1OPOA 2BSSB 2N01B 4JPIB 4QUOA 4YK4C 1FO0A 1NCDH 5ERWB 3ALWA 3EXLA 1S8DA 1Z7JA 4ZK8A 3WJLA 5IB2A 2AQTA 3BYYA 4G6AC 3OKLB 2CNYA 3A47A 4DO5A 1S9XB 1UD6A 3T0EB 1H5BA 5D1XB 5CUSL 2R1XA 4M61B 3B2MA 4JKKA 1U8LB 4O4YH 3K6OA 2DAVA 4W9HC 5DRZA 1QZ1A 3WY3A 1I1AA 2EDBA 2PCYA 2E7HA 3H55A 4K3EL 2PR4H 4Y5XA 4EI5C 1YEFL 5BZZA 4FNLL 3BKYL 4LL1A 3FQUB 4EXKA 1ZA3B 3GMRB 5FV1L 5HPOA 1A1MB 1MWAB 1S3KL 3U2IA 2WLJA 4F2ME 1YUKB 1XZ0B 4KKZA 3UX9B 3TA3B 3KXFA 5D1ZB 4JCWA 1DEDA 1WEJL 3Q3GB 5IMKB 1MI5E 1I31A 5HYJE 4JMNA 5T3ZD 1JZ8A 2CLZA 4JB9H 4GAJL 4U6VL 2WYIA 3FH8A 4XAKE 3RTLA 3VFOA 2IQ9H 3H3PL 1QBBA 2BXYA 2E9JA 4ATTA 5ABZA 5LAPA 3DJSA 1VRSA 1JD7A 4TPRL 1MH5B 3T0ED 3S36H 4N6RA 5D1XD 2G60L 1TO4A 3SOBL 3FJTA 3EJZD 1GW6A 5JHLL 1AC0A 4C4BA 2B9BA 1IBZA 2I26N 4AX3A 1BZEA 1MF2H 3VI3A 3OKNA 2X28A 1KCSH 5HHVL 1AXIB 5ICZA 4W6WB 2IV8A 3F7KA 4KXZI 2JQMA 5I0XA 4EXPX 3FXIC 1BM3H 2QTEA 4JPSA 4OTXL 3K81A 3PGDA 1JZEA 1FC2D 4ESKA 3ATBA 5DO2D 5JW5A 3UTPE 1ODUA 3TA3D 5F6HI 3HN5A 1P84J 5D1ZD 2Z7WA 1LEKA 4TMPA 3CLFH 3VFUB 3NRFA 1ULVA 4JO3H 4Y2DC 3FZUC 3GMNB 4NQXB 5DWUL 4L29B 1OPGL 4J5VA 3O11A 4H26A 2VLJE 2R0LL 4NKMB 1ZHBA 3LSOB 5DJZB 4UQ3A 3RX8A 1G7PB 3T9WA 3RUGE 1K2DB 4I4WB 1HOEA 2UUDK 1NCTA 2VUOA 2VH5L 4Q2ZA 3IJHA 1JVKA 3FUHA 3K0YA 2DRUA 3QIWC 3EDEA 2DDQL 3K6DA 3N06B 4ODSL 1P5VB 2WBWB 1FAIL 3H42L 3BGMA 1E30A 1N3NA 3OF6D 4E9QA 1Q72H 1T0PB 1F41A 2Q2LA 4Q6IC 3JVGC 1PX4A 3TEXA 5DLLA 2VDKB 4AXWB 5HVWA 4NCDA 2XBTA 3CSTA 3K71B 2C9XA 3KEHA 3MA9L 4F91B 1R3JB 2QQLL 1JZHA 1BP3B 3H9SE 4UILH 5C0FA 2GT9A 1Q38A 3E38A 2A9DA 3JWNG 1BX2A 4XCEB 4LSSH 2PW2B 3IXTB 4P06A 4UIKH 3U7YH 4BSVA 1WFJA 1M7UA 2IGFH 2X41A 3VXRB 2KYIA 2OTWA 1AHMA 3NJMA 4YHML 2ZXWB 2APBA 4L9LB 1VADA 2RAMA 2R1YB 4H25B 2J5LC 4IK6A 3D3VE 1J8HA 3TYFA 2MKWA 4GRWH 3QIBB 3QORC 5I1GL 5FA4B 5BS0A 3ZIMA 3VI4E 2Z31A 2XXGA 4MZRA 2AS5M 1U92B 2GC7C 1T6WA 5J8OA 4OZHF 3GGWB 3GMOA 2RH0A 3QZWA 2B7DT 3WS6A 3OR6A 2VM3A 4QCIB 3CQFA 3QWRA 3G3LA 2Z35A 4EQ2A 4X6FB 4U1IA 1JFHA 1ZVSA 3FN3A 1KYOJ 1CF8L 5BUAA 1RUMH 1AS6A 2DF3A 3OKOA 3QDGB 4NKDB 1G9MC 3RDTB 4N0YL 1QWUA 4NUJA 3CFUA 4GSUA 1FO0L 3L7EB 5AZEH 1A6VL 2X9YA 5IQ9B 5ACMA 4M5YL 1L6XA 1VCBC 5F0LB 2L7EA 4KQ3H 3QIBD 2DYRB 1E8YA 5FYJU 4RGMC 5D9SB 4PBXA 4FJ6A 3MLUH 2D2CC 2IPKA 3X2QB 4XHJC 2ZPKL 1XGUA 1YO4A 4QTHA 1PZDA 1BZQK 4QXGL 5CD3B 2X6VA 3QQ3B 4JHWH 3K1DA 3T2NL 3HR5B 4Z76B 5HYSA 3NQKA 3SGJC 1O6SB 4OIIL 3V10A 1PDKA 2AQ1A 2YMXL 1CTOA 4R3SA 5IREA 2LT9A 4HK3N 3SGDI 2Q87A 1UURA 4V11A 4R2GB 4TOYH 3GI9L 2A6DA 3QDGD 4PSPA 3RDTD 3SYCA 3BRGC 2YWYA 3SGKA 3ULUL 1HSBB 1IE4A 1ACXA 2EUZA 1PD0A 4HJGB 2X05A 4NNPH 3TIEA 4R90H 5DZ9A 2V2TB 2PWDA 2XXMB 1ITBB 1AYOA 1PF3A 3N2JA 4P2QB 4MQSB 4LRIA 2IADB 2TSBA 4MXWL 5D7IA 4BUGA 5IGXH 2XTJB 5HP5A 1DCEA 5KN5B 1BMWA 5FFLA 3NA9H 3TCXA 5CZVH 2HVJB 4M6MH 4XVSL 2ITFA 3FCSA 1PLBA 3CHQA 3TH4T 2R4SH 3SJVB 2EKSA 4WWID 1VB9A 1FL5A 3BPOB 4YDJA 2EDJA 4PVBA 5JDSB 4QXUH 4YHIA 1MFEH 5IVOA 4P9HC 5TF1L 4NP4L 3FT4A 4NZ8A 3GZKA 4FYRA 3O6ML 4R7LA 2F9BT 2XT1B 3GEFA 7FABH 4R2GD 4OLWH 3ULUD 1U8OA 1FA4A 2PTTA 1HI6A 3KXFD 5FO9A 4F58H 3ABLB 3UPAA 4N8VB 3T0BA 2FATH 3SE8H 5D7JA 2O26U 4U0RB 2BNUB 3LN4B 1GAFL 3ARFB 1YN6B 2KZBA 2NW2B 4MHHI 4FLHA 4OAWA 5DHYB 3RWGB 43C9B 3KPRA 3QXTA 3EGXB 5AVSB 3MLVH 3OXRB 2DM7A 2OKMA 4P2QD 4YWGL 3BMWA 2XTJD 3PABA 5DS8A 4BZYA 3WHE0 3MX0A 5J6GB 4AUYA 4QDGA 2J57A 4AM0A 3ZDWA 2JIXA 5T5NF 3E3QC 2HLFD 1QYGL 3SJVD 1QSZA 5ALBH 4C4KO 2OMXB 1FZJA 4P46B 3KGTA 2ZAGA 1KN4H 3LKPB 1ZTXE 2Y69B 3P40A 3H4HA 5E4AA 4RAHA 3MRMB 1HL8A 2Y3AA 4GXFA 3KWWA 4KFZC 2XG4B 2VSMB 5IV2B 4F5CA 2O4EA 4A66A 2X42A 4JY6A 2VDNB 4YHKL 3O6LL 1UA6L 2B4CL 1FVCB 4KK5C 3VGDA 1HZKA 4L8CA 5AB9A 4IU3A 3CC5A 3FRPG 4LARH 4YDIL 1Y18A 3C2SA 4U1MA 1GGCL 5C0BA 3SBWC 1O5DT 3IAQA 4OZHE 4UB0H 5DLML 2QKIA 3BPLB 4BH8A 2OXGB 3FO0H 4X9YA 2ZX7A 3VG9B 1YEGH 3PAUA 1KJMA 4XNXH 3OKMA 5I17A 5TQ0H 3G6AA 5EEWA 2DWYA 5GHWL 1TYRA 4U6YA 3WOVA 4J1UA 1NKGA 3ESNA 3OSKA 4DGYH 3II1A 5D7LB 5T1MB 2WP3O 3CCHA 4F7CA 2WKOF 1YEKH 32C2B 3QWOB 4P46D 1PQZB 1GHFL 3QQDB 1E6JL 3RWIA 2AKRB 4H2CA 4XC1H 3L1GA 4AENA 2BCKB 1W0VB 1OSEA 1EAPA 3G5YA 4PRNA 1NIDA 2VXVH 2DQFB 4WGVB 3KWVA 5D7KE 1F00I 1MJJA 5AYTA 4L8DA 4WF7A 5BZWB 1RUQH 2VR5A 5TFSL 4WEUD 2HFEA 4PS4H 2BHZA 3LPPA 2IMNA 4LK4A 1QRNB 4R7XA 4G8GA 3C9NB 3F7YB 3GUFA 4LLAA 3V7MA 4ZI8A 1SEBB 1PS3A 5DQ9A 2WINB 5HGDA 2W07B 1F90H 2EADA 1K8DA 3KLAA 3QFDB 3ESVF 4ELMB 4G5AA 4PWIA 1NCDL 2AQ2A 5DS1A 1E2VA 4P23C 3VXUB 2Z91A 5GS1A 1ILUA 3DV4B 3MRKA 1I8KB 1XGQB 3BN9C 4KI5C 5JUEH 1WZLA 4UTCA 1OGAA 1KPRA 2EC9T 4WUUB 2ZWLT 4GNKB 1E3ZA 3NPSC 4NCC1 1T66D 4ZDHB 2VLRA 2ZJSL 2VMCA 2FGZA 3I3EA 4O4YL 5JOFB 2FO1A 3V0VB 2R0KH 4G7VH 3VXMA 2OAAA 1LLAA 4QRUA 1GL4B 2PR4L 4FYTA 2ZP0T 2A99A 4MJIA 4U1GB 2Q7YB 4Y8AA 2C7UB 4KK8D 5B7FA 1QRND 4IRJA 3GSNB 2FTAA 3JV4B 2F08A 2ZQKA 1EEYA 3RIAF 5F97E 3O3DA 3SDDC 2KLSA 5D7IB 1TEYA 2ZKHH 1QP1A 3WKYA 3T4YA 4HWNA 1IRAY 3PY9A 4GI8A 5DTFB 2FO4A 5AUMA 1GY1A 5IROC 2GUOB 3ARVA 3VXUD 2J71A 3T6ZA 1IE5A 2ADIA 5FYJE 3BZEB 4JB9L 1OGPA 3EAKA 1WUNT 1M05B 2MEJB 5I23A 2YBGA 1TPXB 2IQ9L 1CI5A 3P4LA 2DWDB 2JJTA 4WUUD 3WFDH 3O0LA 3VO0A 2BIIA 4X5XB 1MW1A 2HT3D 3S36L 2WQVA 4I18C 1ZHLB 4DESA 4XNQB 2IJ0C 4XZUB 1ZANH 1UH3A 5DHXB 2Z8WC 5F7HA 1ZS8B 5IK3A 4X6CB 3ZRSA 1RJCA 3L3IB 4EVNA 3V6BR 3QCVH 4KRPD 1PG7X 4QEGA 3DIDA 4OZIB 2BH0A 1UEYA 1MF2L 2CE6A 3O4LA 1KCSL 1MVFA 2P5WB 3OSVA 5GGRA 2Z93B 4LIQE 4MMZC 2FJFB 1BM3L 5EU6B 3PABB 3VFMA 1FAKT 3HE6C 4UM9A 1PIGA 5J7CC 1E6OH 1BBJA 2WGNB 3CLFL 4ZTEA 4JO3L 3IKCA 1X5ZA 3FSVA 4Y5VC 3GXUB 2WLYA 2PPCA 5DVLA 2V5TA 1FVEA 3N5AA 2EUWA 3EJUA 3DDFA 1SOQA 5EF1A 2OR8A 2K9UA 1JXFA 1Q94A 1UD5A 5D2NC 3EBGA 3LNHA 2ESVA 2E9IA 5I73C 5F7YC 4R0LB 4GRMB 2XETA 5D7JD 3L08A 3MJ9H 3MTRA 3ESMA 4JFFE 3ZKNC 5JTWA 1U8KA 5C0BB 4QRSA 1PFCA 1DDTA 1Q72L 5IM7B 1I7TA 5DI8A 2P5WD 4JG5A 3S3PA 4DTGH 5E94A 2VN7A 1JOIA 3RNQA 2A0LC 1JZ4A 5E6ZA 2XN9E 1T5WB 3L4YA 4P9MH 5CJXC 5EU6D 4LQ1A 5KVGH 4UILL 3DX0A 4PTUA 3VH8G 2JCCA 3LNFA 1FFOA 4TLTA 1IVTA 4W9DC 1B3IA 4I2XA 2JIXD 4LSSL 5TH2A 1TYJA 3QQ4A 4UIKL 3Q5OA 2BVPA 2XBDA 3MJ7A 5IVXF 5K1VA 1R1CA 2IDSA 5CU5A 3PAVA 2IGFL 1BCIA 4CW1A 2V5RA 3SO5A 1TUPA 4BBWA 1XR8A 3RIFF 2OR9H 1FH5H 5GS0D 1DVFC 4J3UA 4DHLA 2H32H 4XB7A 1DSYA 1X7QA 4RZKA 1ACZA 5I6XC 5MI0B 1BOYA 1AO7E 1UQSB 4KKAD 1ID2A 4J3TA 4PJ9C 1WBXA 2A5UA 3ETBJ 4JJHA 1YNTF 3NSXA 2HKAA 4PPTA 5HJBA 4QWWC 5IBLC 3QZPA 3UDWA 3IRPX 1A6TA 1M2VB 1HAUA 2AEQH 1T20A 2H8PA 2XSKA 3SKUD 3HMXH 3LZFH 3U0TA 1A7PH 4GOSA 4BRJA 4B9JA 5A2JH 3O4OC 2F5BH 1CGVA 1J8RA 3SYOA 1RUML 2VDLB 5IB3A 1N6QH 3MRKB 4N68A 1G9HA 4PJAA 2IXQA 2YEVB 2Z8SA 4X4MA 1O0VA 3U1SH 4QRTA 5JHBA 3DVNB 3N1GC 4ZQTA 4AV5A 5AZEL 3QUMH 3WN5C 4E0RB 5CEXB 1UENA 2AJYH 3ZYOA 4KQ3L 4JX0A 1HJCA 1NAMB 2HT4C 5D6CB 1KXTB 3MLUL 2UYLA 4DSYA 1NBZB 1MCRA 4JHWL 3NCXA 3KM2A 2GTZB 2XWBA 1UHVA 2LTQB 1NBVH 2XV2A 5DJCA 4G8GD 2ICEB 2YPKB 3NFNB 4K94C 4O5LH 1SNRA 3UTTE 4KGLA 4ZUUA 5C8JB 3ULVC 1E5CA 1U58A 3HN8A 1J0YA 4TOYL 3HTLX 5E8OB 3O41A 1OGTA 4BFNA 5EEUA 2AGJH 4ECNA 1FYHB 3GS4A 2APSA 5JPNC 1JK8A 3DO7A 1JE6A 4MD4A 4NPYB 4HBQA 2ZUQC 4NNPL 3SKJH 3V9FA 3K6SA 2X6UA 4R90L 1QR1B 1GCYA 2CDFB 5KYXB 1OTUD 5F9OH 3F5WB 5AAWA 3BAXA 4JG9A 5IGXL 3UP1A 2MH4A 3G5WA 4MS6A 3NA9L 4Z7OF 3K2KA 4JAMA 4JDZA 5CZVL 4M6ML 5BMFH 3GB7A 4IU2B 3ZL2A 4KDVA 5B8CC 5J3HD 5T8IA 5D93B 2R4SL 3WFHA 2NY0C 2R0ZH 2AW2A 2ZTBA 2GCYA 5SWSA 2V7HA 4QXUL 1SXZA 1MFEL 3DTDA 3WSQH 6CGTA 2CKNA 3IM1A 4OCMC 1IM3A 1YY9C 5LN4A 1ZMYA 2VSDA 3HNTH 2V7NA 7FABL 4OLWL 3HS9A 2A6IA 1NPJA 4FQIH 4F58L 2BSCA 4PJCA 3WAKA 5DJAA 2FATL 3SE8L 5ICXB 1J86A 2ATPB 1O9WA 3BW9A 3I6KB 3GIVA 2CBMA 4GW1A 3RWFA 4IIQA 5L2KE 4GUPA 1MNNA 4GJTB 1HE8A 2AK4A 2FK9A 2A6JA 1K5WA 4AYMC 4MNHA 3MLVL 1UH2A 2YGQA 5EEZA 1RZKC 3CFTA 1MHEB 4RIRA 1IEBA 3GTTA 3OPZH 1WT5A 3MRBA 2VYRE 4LSRH 1QLFA 2BIPA 5IVXE 5BUGA 1ND0B 5ALBL 4U1SA 3Q5TA 4DP9X 1AOZA 3O4LD 3EYQC 4ATWA 1KN4L 3RL1A 5L2JB 1R4XA 3V5HB 2VE6A 1RZ8B 2Y9RT 4HIEA 5D4IA 1LL1A 3ERXA 4YBLC 5D1ZI 3MJ9A 3STZB 3FQWA 1J1XH 2JELH 1LMIA 1EHXA 1IARB 1BVZA 1G1OA 3BLKA 3F7RA 3GXIA 1MFNA 1H8NA 2NY3C 4TLSA 3QXAB 4JQVC 2H6UA 4BK8A 1P4BH 3CHSA 1CFQA 4PP2B 4ZAKB 1TR7A 2R9HC 2HT2C 4LARL 5C7XH 1QTPA 3ENEA 3CFKA 5C07A 4I3RH 4UB0L 2NCEA 4UQEA 1N10A 2OCJA 5DJXA 4KJPD 4XC3H 3FO0L 4IBQA 1YEGL 3DSNB 3JBG7 4NRXA 2KH2B 2D4DA 4XNXL 4S0SD 5C0GA 2LLLA 3F84A 1K8IB 5TQ0L 3TTYA 4NO5B 3DPBA 1WA2X 4WW2B 4IOFC 4RH4A 3SKNB 4GQPH 1VPOH 3FFCA 2KI6A 4DGYL 1A2YB 5C08E 4J27A 4F37F 2XG5A 3IE9A 1IILE 4IKNA 1YEKL 5IKCA 4KBPA 1PJWA 3NIFE 2H32A 3H3KA 4EJ1C 1JGVH 1GZPB 1NDMB 2JJVA 5AZ2H 3CHRA 4X4XB 3FB5B 5HJDA 4XC1L 4X80H 3SD2A 2BPBA 5AOKA 4A38A 1VSCA 5IBUB 3PJSB 3SE3C 1OK8A 5ES4B 3NCBB 2VXVL 1WD8A 3D33A 1WAEA 5BZXA 1BIIA 1S78C 1RUQL 1TSHA 4JZNA 5DYOB 2FUTA 4ZAKD 3HMXA 2XI9A 3DIFA 3DKHA 1SHWA 3K0WA 3QRLA 4PS4L 1RZ7H 4WRLA 5E8PA 1RV6X 1I8MA 3T65B 4NHUA 1CD1B 2VOTA 4PJBA 3AGWA 2FWOA 3QCUH 1EGJH 1F90L 3AUWB 3NJGA 1WPCA 4S1DC 2WXRA 3MYJB 4YXLH 5I76A 1UB6A 1WZAA 3QUMA 3PXHA 5LCVH 1WF5A 3F01A 4ZOEA 3DXAA 3GXDA 2ADFH 2E4TA 4KO7A 2WYHA 4P2OC 5JUEL 3B9KB 3ZDZB 3E2HB 5F88A 1GS8A 3TEYA 2F7OA 4ANWA 4A2LA 2BC4B 4FLQA 1R5IB 1W8NA 1XF5A 4KKRA 2ZXQA 3OZKA 4Z7OE 5JXEC 1NDGB 4UV4H 4BFIB 2R0KL 4QAMB 5BRZE 2P7TB 4G7VL 3IVKA 3H9HB 1ZWIB 5CILH 1YEIH 4KK9C 2PXYB 3V5DA 4BXSV 5IHBA 2P8LA 2Q7AA 4N90D 2QVMA 4NO2B 2CO7A 3H8NA 4JANB 1TU2A 4U05A 3RWDA 5IB4A 2J1ZA 5B3NA 2ZKHL 1FVDB 1JN6B 4JMXA 1HEHC 3ABGA 4FXKA 4H8WC 1BWWA 5HPMB 5I75C 2FBRA 1G0XA 2R29H 3DA0A 4MMYA 4XGZA 2J4WH 1WFOA 3BI9X 4G2AA 3B9KD 5EEYA 3PWPB 3WFDL 2EXWD 1URZA 2E86A 4A67A 2BOCA 3GSUB 4UT9H 6TAAA 5C0ND 3CDCA 4AW7A 3TF7C 3WELA 4XXWC 2X0VA 3MRJB 4ZXBA 2BSED 3AAZB 1ZANL 4YPGB 2DJSA 3OAWA 3QJHB 1ZLDA 5D1QB 1V3JA 3QCVL 4N0FA 5GQBA 2PXYD 4PR5A 5DC0A 1IIIA 5EU4A 4K07A 3PFUA 1S9WB 3GEWB 3L81A 4PRHA 1D5XA 1JWMB 2Z9TA 5KBNC 1WS7A 2XFXB 1S9VA 1NMAH 3CVIH 1CXHA 2FO8A 3E6HB 3MBEA 5T1DH 4MYWB 2XQ0A 4XXCA 4IQHA 3S5LB 1YY8A 4MA7H 1E6OL 2DJMA 5F9JB 2NNRA 4MMXC 3GMPA 2VERA 5HJ3B 4M6NH 3AB0C 4ZRGA 1J5IA 4RAVA 1AGBA 2W91A 5SWSD 1NIFA 4CBPA 1VENA 3QEUA 3N1MC 4JG0H 5E56A 1OAXH 3IBOA 5AG8A 3PL6C 3G6JF 4HCRH 3B4NA 5A2BA 3M7OA 5EU3B 4FNSA 3UYOD 3OMNB 3DJTA 5DJ8A 2HFFA 2BMKA 1E90A 4YSPA 1IAIH 4DIXA 3MJ9L 1KTJA 4PP1D 5D1QD 2A9NH 3PWUA 4F8NA 4IEFA 4HXAH 4F2MB 2ZOKA 3IETB 1G1CA 4MBOA 1B4TA 3DBSA 4DTGL 3MRQA 2NOYA 4OCLC 4AT6A 4HMCA 1G6VK 3C60B 4HUVA 1OOWA 4OV6F 1MI5B 2C3XA 4P9ML 5KVGL 1UOVA 3KW7A 3V0IA 5HYJB 1INEH 2B16A 3TBBA 1MW3A 1ZHNA 2AERT 1AJ7H 1XXDC 4LHUG 1DSWA 4PVLA 2H26B 1LO5B 1KPUA 3TO2B 4PWKA 5EO0B 5BOJA 3WFBH 5AVUB 5DEZA 3UL4A 2XYBA 2OR9L 3UOAB 1FH5L 4TNWK 1H19A 1QKZH 4Z3TA 2B5IB 5TE6H 5DRWB 5F7EH 3WUWG 3Q2NA 3CVBA 3B2UD 1ONQA 3ROLB 4EZJA 2D73A 3QJFA 1GGBH 2ICES 4GEJA 3CSBA 3DRTB 4MAYC 1JUFA 3EH1A 2AEQL 3HMXL 3LZFL 1TZGH 3QW9A 2NNAB 4JRXA 3Q9PA 4JFYA 4IMKA 1MI5D 1A7PL 1DVQA 4G9DB 5I82A 4J3VA 3TT3H 1SUJA 2CBTA 2VLJB 5HYJD 2F5BL 1HH6B 4PBVC 4AV4A 4XAKD 2OPCA 1RIHH 1N6QL 4F9LA 1S7WA 2UY7B 4N9GA 3RUGB 1QEWA 1HXMA 4C55A 4N0UE 1IU1A 1EGJA 1UVQB 2BERA 1Y6NR 2CHWA 1OP3K 2X4NA 1VERA 2JJUA 3U1SL 3K5RA 5MENB 3QUML 2IPUG 4Z7NF 5I5MA 2GHZA 3TLRA 2D7MA 2AJYL 2V33A 3RBSA 5LCVA 4PW3A 4G43A 4AGNA 1EVUA 1GZQB 4L1BA 5DQDH 3N43F 1C8PA 1S7RB 5DEFA 4GYBA 3VFTB 3FUEA 1FNSH 2R2HB 4NOFA 2G2RB 5A7BA 5TJWK 3MRFB 4KOCA 5FB8B 3MCYA 4C4UA 5DZOA 2B1AH 4N26A 5FYLE 1FF5A 2C26A 4OKVA 5A16A 1NBVL 3AWFA 3H9SB 4WJG3 4MDRA 2ZOTA 3P4OA 4KKLD 4O5LL 4WWKC 1WUZA 3UTPD 4B96A 3VAEA 4CU6A 2ZCLH 3UTZA 5ISZA 2VLJD 3MNMA 1G4RA 2VDPH 3BIBX 3STLA 4IHBA 3IRCA 2AGJL 5E1QA 4ZW5A 5GGRY 3D3VB 3C6SB 5LGJB 1ROCA 2WBXA 3ETBF 3SKJL 3L9RA 3VRLF 3KYOB 3BAWA 1G7LB 1SHSA 2QADB 3VI4B 5F9OL 2R29A 5BO1H 5JIMA 3DRQA 1J5CA 3MN8A 5D72H 5EU7E 3C6LC 2W80C 2W81C 1NGXA 3BIAX 1SGKA 4B0MM 5BMFL 1AKPA 2K70A 2J1KA 4M7KH 3LNGA 2R0ZL 2D0FA 1OP9A 4NXKA 4UT9A 4RDQF 3PFQA 3FT0A 3HG1A 3WSQL 3H9SD 3FT2B 4BCXA 1E5AA 3BH8B 2Q76A 4LPWA 1JZ5A 1EIBA 3G6JE 2O6CA 4NPJA 2Y1ZA 4TTGA 2EIZB 4ANXA 3U0PA 1BF8A 4FQIL 5GGTH 1KGWA 1W8OA 2UY6A 4WU5B 3RVWD 4J6RH 5FA3A 1IFRA 1QSFA 3LVTA 4RGNC 4EUPG 4QHUB 3MUHL 3BC9A 4PWHA 3D3VD 4NUMA 5CSZB 3GRWH 2VR4A 4HKJB 2IH3B 3OTTA 3L3HB 3WHE1 2WQXA 4HWZB 2Z4TA 5E2UH 2QADD 4NQCA 1QW8A 3VWKC 3RVXD 2DV6A 5F3BA 1DZBA 4JFHE 3OPZL 4NEHB 1X5YA 4LSRL 4JFDB 4PG2A 4JO8A 2E4FA 4HCRA 4JGUA 3HE7C 2AJZA 2VAAA 1XH3B 2Z7YA 3FBKA 2BS9A 2EH8H 2X2IA 1OP3H 4U1LA 4PJEA 2EZ0D 3UROR 1J1XL 2X0WA 2JELL 4DGUA 4E9RA 1VKXB 5GSVB 1EEQA 2WXOA 2KLTA 4QOKA 5K93A 1TCRA 1P4BL 5B38B 5C7XL 2J12B 1LGVA 4I3RL 1HYSD 1D9KA 4OI7A 4KXDA 2QSQA 3T0DA 1DCLA 4PWEA 4XC3L 3CZEA 5CN3A 1K5NB 1RULH 4NKOA 3BP4B 5IWLC 1ETA1 5KWYC 1IGCH 4KKCD 1NOAA 5HY9A 4LP5A 1RI8A 4FTVA 1PSKH 2LABA 3D25A 4KVPA 1E9QB 4OZ4B 1CVRA 1L3WA 1VPOL 4LCIH 1CB4A 1YLBB 4Z95H 5DHEA 2VC2B 5EPMB 1RPKA 3QNZB 4YBHA 5HHNA 4WCYH 2NY6B 4KDTA 3LQAC 4UAOB 3EOBB 1JGVL 4WNQA 4PGJA 5CS7A 4HIIA 7TAAA 1ZKAA 2X4PA 1U95A 2H9GB 5AZ2L 5T1JA 2Z0UA 4Z7NE 3MZGB 4MDJB 5TDPA 4GKNA 2ZXBA 4LE8A 1FRGH 2OXHA 2JE8A 3FN9A 4JFOA 5HI5D 3DGCR 4HSQA 3MNWA 1IM9B 1RZ7L 4S2SB 3JWNH 3IDNB 4MA3A 5C0IB 4K71B 5JYLA 3ZHNA 4CVXA 3FUMA 2ZOLA 5KVEE 1SXBA 3D69B 1SXAA 1EGJL 3QCUL 4FFWD 4U6TA 3US9A 2CCWA 2F8IA 3WTTA 2A6KA 4YXLL 4J28A 2NNXA 3GLEA 3N40F 5TDNA 4JN1H 5LCVL 3SY0A 4BHUA 3R06B 4DF9A 3DK2A 2ADFL 1MW2A 1YYMH 1SN2A 2NY6D 4PLKD 3W11C 2YRBA 4Y4FA 2L0DA 5CP7A 3VRLE 1EEUA 1XGRA 3H2WA 3C5ZC 5I1DA 4JFFA 2EDXA 3BEVA 3T4AA 1I85C 3EH2A 4PJ7A 3D1MC 4OZHB 2OYKA 1CXIA 3DX1A 4UV4L 1X9UA 3FONA 3A0OA 1RZFH 4ZD3H 3VGBA 5CILL 1YEIL 1P6AB 1IM9D 2EXTA 2FSEB 4FN0A 2HG0A 1NCUA 3JT2A 3EIFA 3PWVA 3VD2A 2XFGB 4L5FH 2HJFA 1T1YB 3QH3A 2VABA 1NFDE 2FLBT 2QLVB 3BP7B 2Y7LA 1XVSA 4ETQB 2R29L 3QZMA 4MDIB 3TBSA 1E2WA 5HYQA 3DX6A 5AW9B 2J4WL 5TGBA 3EO1A 5DMIH 4YSUA 4WO4B 1T1ZB 4LOEA 2QPUA 1ECZA 1KZQA 1LP9A 5FLVA 3QQ9C 4I0PA 3KPPB 3R8BB 4UT9L 4HJEA 4XOEA 5AAMA 4XMPH 4MTMA 5TDOB 4ENED 1T0NA 1RMFH 2AI0H 2JKWA 1RPUA 1A4CA 2AEWA 4Y9GA 3FUDA 3DV6B 3EG9B 2AZAA 5GGTA 1JGIA 2X70B 1MCCA 1X5HA 4QHNA 1PNCA 3CVIL 1NMAL 5T1DL 1TQSA 4PJGA 2I5YH 3GRWA 2HG5A 3ZE2F 4HUXB 4MA7L 2GSGB 1N6VA 4LCYB 4LXFA 4M6NL 3LJ3A 1YQVH 4OCWH 4RMTA 4A63A 4WO4D 4YHPB 3MRNB 4L0ZA 3V6ZA 2IWKA 3IDIB 3OKYA 4JG0L 1Z32X 4B53A 3VW3H 5DZPA 1OAXL 3IU3A 4MSWA 1P7QA 5D7KD 4HCRL 4I89A 3MPCA 1E67A 1ET7A 4MQ7B 4HFUH 4A2DA 1H3PH 1M53A 5FECB 4ACPA 2XWZA 1IAIL 4JVUA 3RJOA 3UTTA 2A9NL 4ZMNA 4HXAL 2VDQB 3DGDA 1UATA 1RK1A 5BVJB 4Z7UF 2B3RA 4CNIB 5LN8A 1WIPA 2DYSB 4OJEH 3RB7A 2WKLA 4DKTA 4MQTB 1INEL 2XWTA 1TQBC 2A9CA 2VO8A 2F61A 5K39A 2EILB 1AJ7L 3I6SA 3L4VA 1P7BA 2Q86A 4AYBA 4HIHB 1ZT4B 1JRHI 4WNQB 3WFBL 1MZZA 5FDYA 5EC1B 3O6FB 4JO1H 1OSZA 3CVCA 3RY6A 3WDJA 3GUTB 1QKZL 2WXQA 5TE6L 3X3FH 3TIDA 3BVXA 5F7EL 2OQJB 2RHEA 1ZD6A 4XN2A 2LR4A 1MN4A 5T1KA 2X1OA 1E8XA 3ARXA 3FCTB 3IJ7A 2XIIA 2WXIA 1GGBL 1GGUA 5AB2A 5IUCA 1MDTA 4IRSB 3S4SG 2LFEA 2A9MH 2NY5H 3S3DB 3IDXH 1F18A 1TZGL 1VGKA 1WG3A 3FU8A 1NEZG 3MLWH 4PJHA 5GRZA 3TT3L 3VTAA 4H0LC 4JHZA 2BIOA 1M71A 4QKTA 1HIMH 1F86A 1PD6A 5FYJD 3FB8B 3V0WH 1AAJA 5D1XC 4NJ9H 5L2KA 1CDIA 1RIHL 5IF0A 3EJZC 2XZZA 4FL4C 4LZKA 3P0YH 4Y16A 4L3CA 5EO1B 3F6IA 3IJ9A 1Q0XH 1M1SA 2AQRA 5CR1A 4XP6H 2OX5B 3LKRB 3O6FD 4HK3J 1WLHA 1KGYE 1S7VB 4UUJB 1E8ZA 3LKNA 1ZGLM 2CWRA 4PGEB 5DQDL 3P0GB 4FULA 4YXKH 1Q4NX 5J06A 1FNSL 2CK0H 5DD5H 5DO2C 3HPLA 3TA3C 1U2HA 5D1ZC 1JVOA 5FAAA 1M9WA 3BFOA 2ARJA 4J23A 1N6UA 2B1AL 2XN9B 3AGVA 5FIEA 3VXSA 5C0CE 4OZFG 3TO4B 2Z4QA 3C8KB 5KVMC 1O9ZA 3M1CA 4AK2A 2X4QA 1B88A 1RZGA 4APXA 2OA9A 2ZCLL 4Z3GA 5E8NB 3AU1B 2I9TA 2VDPL 2EACA 2PP9A 1UM5H 2MMXA 1U93B 5H35A 2WVVA 3T71A 4CA4A 1BECA 3ZE0F 3L2NA 1QATA 2VQ1A 1T7VA 5TK2A 4OF7A 5BO1L 5C08A 1AO7B 4YFLI 2EYRA 3FBQA 4JFFD 1CE6B 5D72L 1QABA 2F58H 1BQHG 4Q97A 3AQDA 3C5JA 1DDHA 4JFWA 3ZE2E 3QUZB 1N8ZA 3DJ9A 2X4UA 4M7KL 3MNZB 1KTLA 3N9GH 3KPTA 2XN9D 1J11A 2Y2YA 5GRWA 3UZQA 1T04A 1LEIB 1EBAA 1KJ2B 3TO4D 3L45A 5HBBA 1XGPB 4N2BA 1RSYA 3FB7B 3EKCA 4IBTA 5GGTL 1ES0A 2QSCH 1AYRA 3WEAA 2FR4A 3VYPA 5DFWH 2HN7B 4J6RL 4X5RA 1TZHB 1JYWA 3LDBB 1HHGA 4W9CC 2FIKA 4LKXA 4TSAH 3GRWL 4I1RA 3TBYB 2PETA 3EH4B 4D0CB 5E2UL 4IBUA 2G3ZA 3GSVA 4XWOD 4N20A 1NANH 1G7JB 1ZSDA 3VQLA 3VXTA 2JKNA 1P2CA 1UZ8A 4JFVA 3UBXB 2J43A 4GPVA 3UAEA 3MGOB 1PLGH 3GRBA 3QUZD 4OJYA 4YDMA 3S2AA 1MG2C 3EJYD 1OVZA 1MFVA 3J8F7 4DKDC 3BFQG 3AACA 3G08A 5BOPA 4HKZB 1I8LA 2G2NA 1MCWW 2EH8L 4LOVA 2DQUH 4ABVA 3PRZA 5A6MA 3JVFC 1CF1A 1IZKA 5KAQG 4L9LC 1I4FA 1GJWA 4ZX5A 4S0TD 1I9RH 1AGDA 2FL5B 3EZ8A 3FO2B 2CIKB 2XNAA 4XMUA 4I88A 5I6KA 1SDDA 3SO3C 4KMQA 5AW1B 4YXHH 4POZD 2CIIA 1ASOA 3WEMA 1RZIA 2VJ8A 2BDNH 3NN8A 1HHIA 1SOSA 3G5VA 1SN5A 1U2YA 4HOZA 4U1NB 3BP6A 1EH9A 1RULL 4Y4HA 4CMMB 4G70B 1DLFH 3WS3A 1IGCL 3O9WB 4HEMA 4QY8A 4RFEB 3KEDA 2V5MA 1PSKL 1QFWM 2GABA 3WN6A 5A40E 4O2FB 4LNRA 3CVHB 4LCIL 5BQ7B 1U8PB 5B4MC 3UTTD 4Z95L 1R3LB 4O2EB 4WCYL 3RDTC 3SCMB 5C0EB 5JORA 4LVEA 3UTSE 1PLAA 1I3UA 4P2RE 3KD4A 3WJLC 3KYNA 3FUIA 3GXFA 2OL3B 4GG6F 1I9IH 3UG5A 4PQXA 1QWNA 1OD7A 1EFQA 1NFIB 4FA6A 1FRGL 4TF4A 5DA0B 3REWA 2ZXAA 1H5BC 5EIIG 3QWNA 3HRZA 3MRCA 3CFDB 3QIUA 4HHAA 1FNEB 3QJUB 4KKPA 2OS7A 1QA9A 2IEPA 2VQ4A 3GSWB 4PJIA 3BZFA 3FRPA 3EFDH 5GZND 1QX1A 4FKKA 5F1IB 3AREB 5DSCA 5EO9A 4H5SB 3M17B 2Q6WB 5I8OH 1TKWB 3FO1A 4NP9A 3CSPA 3U9PH 3DOHA 3QPQD 4WW1B 3GMMB 2DIJA 4XMWA 1Q9OB 5JPMA 4O02B 3O9WD 5IVXB 4L0YA 1AY1H 1NAKH 5T1KD 3JZYA 3ULUC 3CFJB 4R2GC 5F93C 4JN1L 3QUXB 3MR9A 3JTSB 1YYML 3SCMD 4XNZC 2AK1H 3CMGA 3WY2A 5F3HB 2VDRB 2WN3A 5IFAH 4GIPD 1KZYA 4I9WE 5J9PB 3N50A 3WEOA 4Y9BA 1W6LA 1BXAA 4P07A 5DRXB 5L2KD 1YNTB 2HTLC 2XTJC 4ZMZA 2WJ7A 3DARA 3OKKB 2DI7A 4QGTA 5DFVD 1RZFL 4ZD3L 1MHCB 2W38A 3F7VB 2Q8AH 3ARED 1NBCA 1YYLH 3AY2A 4DKAA 4BIKA 2YWZA 3OAZH 4ZUTA 4L5FL 5FCSH 3MRHB 2WV3A 1OP5H 2PW1A 3B1UA 4XCFH 3SBQA 3NIFB 1OP4A 3EJCA 3P73A 4JFPB 3KBHE 5J12B 1T03H 4WTQA 3QUXD 4B0MB 1E9OB 3FYIB 1MRFH 5DMIL 2WZPD 1INDH 3ZT7A 4MHHG 4FKEA 1NWOA 1S9YB 2XQYA 1OB1B 3BDYH 1UUNA 3DO4A 1ZVYA 3QAZC 4CKQA 3PGCA 3BO8A 5CJ8A 1GSKA 3I50H 4XMPL 2PO6A 3TVMB 3P3YA 5E5LA 3UG3A 3OHXA 1JNNH 4Y2OA 3KJ6H 1KCKA 1Y1DA 1RMFL 3T1FB 2AI0L 1TOXA 3WNMA 1I3GH 3FT3B 1P1VA 3OB8A 2V4LA 5GSRB 4AGOA 3LIUA 3JT0A 1X9QA 1A9BB 4HUWB 1BVKB 2X12A 4P46C 5BJTB 1I75A 5FUCE 1X5KA 2J73A 5C08D 2B1OA 1FL3A 2CHZA 2C9PA 1H6UA 2I5YL 2C3HA 5F7FA 1U8QA 1X5AA 4UNIA 4PIBA 1I82A 2CR0A 3GBNH 2OLDA 2UZPA 1YQVL 4OCWL 1YPZF 4TUJA 1S5HA 5I16B 3S96B 4WKZB 4ZZFA 3VW3L 4Z7OB 3CAFA 2I07B 5IEHA 2EDHA 5E5MA 4XPFH 5BRZB 3VG9C 4FFZH 3TVMD 2YK1H 3X14B 4HFUL 1PCXA 4EE2A 3AABA 3BPNB 3C5SA 2WHVA 3ARDB 4PRDB 1H3PL 3L16A 2GITA 4NN5B 3FN0H 4L3EB 1MXGA 1R24B 1RZIB 5DQJA 5L6YH 3BD5A 1MZYA 1CFSB 2AXFB 3IEAA 2F18A 2O6DA 4XBGB 2CO4A 4BWWA 5DDHA 2UX6A 2A74B 4OSUH 4GG6E 2XC8A 5CIPA 5EBMA 4XWGH 3IDGA 1IC4H 1OQOA 5KEZA 4EIBA 1WD9A 1EO7A 2MOVA 3MV9E 3B7TA 5EUOF 4G42B 5DUBA 3WXVH 2K4WA 3EBIA 5DO8A 3TBTB 4EBQH 4UCFA 3V5KA 1F0LA 4P4KB 4QKXB 4JO1L 5KZCB 3RTQA 3UJJH 5LXGH 2ZWYA 3FAWA 1FYTB 5JIHA 1JXJA 1LHZA 1JGUH 2EXSA 5BRZD 2FLRT 2WSDA 3X3FL 3S35X 3GBEA 1F3RB 1ROWA 3AT8A 3ARDD 4H44C 4DUVA 1UM4H 5JNYA 1P5UB 3VFVB 3ZDXF 2B14A 2DWSA 3WKPA 5AW7B 3MRRA 2APXA 2WZ5A 4YS4A 1F97A 2N1KA 2A9ML 2NY5L 4RMWA 5KVFE 1XL4A 3IDXL 2IANA 1N5AA 3GINA 3G5XA 1EXGA 3MLWL 3HZMB 2Y23A 3U0WH 4Z8FH 1ZY9A 1A6AA 1HIML 3DUHA 4YO0B 3VH8A 4TNWF 2HT3C 3V0WL 4D0BB 4P5TB 4NJ9L 3ZGHA 2NXZC 1NLBH 1Q0EA 4ZOBA 3GDBA 3U4EA 1UJ3B 2F74B 4NENA 3P0YL 5DJYB 3MUY1 3LAFA 3SGKC 2OI9B 4KRPC 1Q0XL 4RMRA 5E6IB 3SEPA 4P4KD 3LKOA 4XP6L 4U1GC 5CGYD 3HZVA 5KZCD 4ODBD 5G55A 3BXNA 4JZOA 4P5KA 1CS6A 4RA3A 2VITA 3GZOA 1HZHH 2O5XH 3T8VA 2DQGH 4ODVH 3WCYA 4LRIC 3UFIA 5I6NA 4LCCA 2CK0L 5DD5L 3EDJA 3FPYA 1YEJH 3TT1H 4PFEA 1CFVH 4HPYH 1QASA 4X99A 2ITDA 4JL2A 1O7SA 1IL1B 4E5XB 4BSWA 1HH9A 3AY4C 5LAXA 1YQ2A 2SEBA 4J3OG 5L8JB 4HIJA 2NY7H 1P9MA 4DEUA 3HVDA 3U30B 4P5TD 1UM5L 2EE3A 3IWVA 1LEGB 3WE6B 4Z5RB 1NCCH 3I6GA 2FX8H 5D7JC 3KWUA 1DQJB 1E7VA 2Q0ZX 4X98A 3LB6D 2ERJB 3J7HA 2ITCB 4L37B 3NEEA 1USZA 4IYKA 2F58L 5CXPA 2YXWA 3NYKA 1LO0H 3OJDB 2I7OA 1DBJH 3MVSA 2DQEH 2K3TA 4HJSA 2F53B 5HHOA 1TJXA 1Q8MA 1GIGH 1CLYH 4JY4A 1NGZA 2LU7A 3N9GL 5AOJA 5F1SA 1YPZE 1F11A 2MCAA 4TQIA 1Z9PA 2V3FA 4MLSA 2R2EB 1U6AH 5H94B 3QRGH 2QSCL 1VZGA 3KW8A 4N0UB 1KIUB 1GGIH 1IBBA 4HMDA 1JCVA 4GG8B 2BVOA 5AVVB 4FMFA 1IZJA 4TSAL 3Q48A 3ZYZA 4KKAC 3PHSA 2ZP8A 3EGSB 2QV4A 4KU1A 3K91A 2EO7A 4Z78B 1CT8B 3LHAA 3JV0A 1XSKA 2H5UA 4XMKH 3RX9A 2AEIT 3AXLB 3VGAC 1A14H 1PLGL 3L54A 5D5MA 2DQJH 1J48A 3KLKA 2YN5A 2VDMH 5ELIA 3F8UB 5EUOE 4D9QE 1R3HB 1SFDA 3VJ6B 3ZO0A 1T1XB 4FFZA 2F8OA 3ISWA 3P3TA 4FQXB 4QYAA 5I0DA 3RNKB 5IHZA 4RQQA 5C09A 2DQUL 3OZLA 2EVFA 3CH1B 2VDOH 3NZ8A 4X6EA 2WWKO 1T1WB 1XL6A 1A7QH 1CD0A 2IPUK 1I9RL 3W5MA 2LV4A 4ZS6D 1KTRL 4YXHL 2FJUB 1S7XA 1Y0LB 2RJMA 3GIZH 4M8QA 3RVTD 4GIOA 2BDNL 4BWTA 5FXCH 3ZDXE 4GXUM 3VACA 5CBEA 2FQEA 4UT7H 5IMOA 5K5YA 1NFDA 1L5GB 1PKOA 3B5GA 5FYKU 4YZFF 1KC5H 5A2AA 2K6WA 2VAJA 1DLFL 1EK3A 2E47A 2I69A 1P4LA 4HCGA 1YMMA 3M86A 5FYLD 4JHBA 3VFGH 4ODWB 4BH7A 2NY1B 1IO4C 4G1EA 4YGAB 3ZL4H 2WNGA 1HAWA 3MMEA 1QUPA 5ANHA 2EYSB 3G6JB 5AOLA 5GS1C 4XO3A 4U1JA 3VFWB 1DQMH 1OT4A 2FEEL 3MO1B 1DEEB 2ZD0A 3WGUB 5A43C 1D2OA 1CU4H 5FF6B 3SE4A 2IQAB 3I2CH 3TL5A 1OOAA 1I9IL 2QGEA 5AVYB 3HB3B 2EDEA 1DHKA 3A6BH 4B5EA 1BFVH 4XVTH 4LL4A 2IAMB 2X09A 3BT0A 4QXVA 3BE1H 3MGTA 3MREB 1VFMA 1A64A 3EFDL 4PMEA 1EO8H 1CPUA 2FE0A 1JERA 3Q8AA 3CZJA 2F54A 4J8RA 3TCTA 5I8OL 1IAII 2Y72A 3U9PL 5KS9A 4P9HH 3TURA 3ZHLA 3RTQD 4FHKA 2ICEC 4Y2NA 3HC0B 1IGJA 3CDFA 3FFDA 1AY1L 1M1XB 1NAKL 3PU7A 1XTMA 4Q89A 3KM1A 1S6NA 1ZGLB 2E76C 2NY1D 5C71A 5B39G 5C97A 1T2XA 2YKKA 1U8MB 4N2FA 5J6SA 4HS3A 1DL7H 3ZU8A 1TVBB 1A6ZA 1HHKB 1QSEA 3NGBB 4AEEA 3VXNA 2IVFC 2AK1L 1X6LA 5CFAA 4Y2DA 3HB3D 4WJKB 3TEUA 5IFAL 1ZLVK 1SYVA 5IG7A 4RBPK 4WI4A 4DZBB 4XMVA 1Z0MA 2IAMD 2YBRB 1QRKA 1GC1H 1NTDA 2RCSH 3D4GA 3CN1A 3B9EA 1MHHA 5E9DE 1PNDA 3PDGA 4OB5H 2Q8AL 5D93C 3I85A 1YYLL 3IGUA 3E9UA 1M2OA 4JFHD 4L2YA 3OGOE 3IXAB 4ODUB 3UPCA 4Q4IA 1X4YA 4MBRA 1MFCH 2OJ1A 2XPGB 5L4FA 2EC8A 4XCFL 2IH9A 3EYFB 3MCKB 4Q6IA 1UOLA 3X12B 2BRQA 4N3TA 3ZHDA 1T03L 3F58H 1TIUA 2AFNA 4P3DB 3B3IB 5BOZG 4Z7NB 1MRFL 3OQ3B 3QYCA 1INDL 1I7RA 1KUMA 4JRYE 3BDYL 3N43B 4LBAA 5C7ZA 1EX0A 2CO6B 3AWEA 4FNRA 2FGWH 4KJPC 1YEDB 4Z7WF 3I50L 4PHXA 2HWZH 3C6EA 1XB6A 4AE1A 3LKQA 4BHUI 1JNNL 3U7WH 3KJ6L 3BUTA 2DH2A 4M5SA 2CG9X 4LF3B 1YN7A 4G7SB 1I3GL 4MVBD 1DN2A