2CBMA

Crystal structure of the apo-form of a neocarzinostatin mutant evolved to bind testosterone.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
112
structure length
112
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of in Vitro Evolved Binding Sites on Neocarzinostatin Scaffold Reveal Unanticipated Evolutionary Pathways.
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antimicrobial
molecule keywords NEOCARZINOSTATIN
total genus 16
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2cbmA00
2CBQA 1HZLA 1AKPA 1HZKA 2MCMA 2CBMA 1O5PA 2CBTA 1J5HA 1NCOA 4JW3A 2CBOA 2G0LA 1J5IA 1ACXA 2G0KA 1J48A 1NOAA
chains in the Genus database with same CATH superfamily
5K9JL 1AGBB 4CMHC 3SPHA 5JUEL 4XCNB 5KSBA 5I5MA 2IANB 5D9SB 1BYOA 3DNKA 2ITCA 3QHFH 4UU9A 1YPZE 4A2GA 4LSSL 3WY1A 5DJDB 3UX9B 4YNYA 1KIQA 2F74B 4KJYB 4LMQE 4LRNL 1QKZL 4G72B 4FFZL 4UQ3A 2ADFL 2V2WA 4WQOA 1WIOA 2DWEB 2FB4H 4YXKL 5CBEA 5KVFL 3TN0B 4FGMA 3DX2A 2NR6A 1PDKB 4PJ7B 1G9ML 4JPVH 4QJ3B 3V4UH 1JVLA 4OFYA 3FHEA 4JY4B 35C8H 3Q3GA 5J9PB 4LRIC 3EDFA 1D7CA 4XXWC 3VWJB 5J11B 2YPLA 5HPOA 3MLTA 1RJCA 4L4VE 2MIZA 4KX7A 3WFBL 1UM6L 1UATA 4YK4B 4YS4A 3GJEB 2HT4D 3IMUA 3MRCA 4LEXL 4L0YA 3D06A 5AW4B 4C56E 4ZUUA 2E75C 3AGVA 1FYTD 3MJ9H 3QQ9C 2BIMA 2BX5A 1P9MC 3K2KA 4IBQA 4D2NA 4JPSA 4MA8L 3HPLB 4TUKL 3ARUA 3A23A 5MEQA 4PJFA 4RZCA 2WBWB 4J6RL 4PV1C 5FYKL 2Y7LA 4PJ7F 5AOLA 3VXRB 1DQMH 5KBKA 1MNNA 2JB5H 1TQUA 1ZAGA 3ZKSD 1IGFH 5EC1B 4QRSA 5SX4H 4Y5XC 3HN3A 4PJIA 3BMWA 4BZ2A 3VD9A 1H6TA 4MDIA 4OU3A 2JB5L 3QZOA 5F88B 2GJ6A 5GRWA 5E2TH 4G59C 2CDFB 1ITBB 4PWHA 4LRNH 1AXIB 4QT5A 4ZPVA 3S96B 3VI3E 3T0EE 4YHZH 3HI1B 2A9CA 1IGIH 2NYYC 3KPQA 4H25A 2GJ6E 3FT3A 1RZQA 3EOBA 4IRSC 1MCOH 4ODSH 1C08A 1YYML 4RGND 3VFSB 5B38G 2E0PA 1PZBA 3C5JB 1MEXH 3QXAB 2BNRE 4HFWA 1F4XL 2Q8BL 3N42B 2HH0L 2DZEA 2GCYB 5F1KC 3ZIYA 3D33A 3K4ZA 1OF2A 4X6EA 3B2PA 4MS8D 1V5JA 4HUXA 4PGDA 3D39B 4P9MH 2OMWA 4JRYE 3VI3B 4MSWB 4LCWB 1Y18A 3Q6FA 3TM6A 1RY7B 4OZHF 3KYNB 3P73A 3FONB 3P9LA 4QKXB 2ZXBA 1UGNA 3RZWA 5T8IA 5M94B 1CBJA 4J1UB 4N0YL 2EDQA 4I18C 1IGCL 2NY6D 3BAYA 4GAYA 2RFXA 1PZCA 3WE6A 1BZQK 4ABQA 2EYSB 3HEIB 4R7NB 5DJZB 4GUCA 4NNYA 1ETB1 2PW2B 3HB3D 4OT1H 2E8ZA 1TTAA 3GPSA 3THML 4IHBA 5EHFA 2K6WA 3ARBB 3BGFC 1BBJA 2WQXA 1CFBA 3BVVA 2CJ3A 1INQA 5LJYH 4JO1H 1S7XA 1GW0A 5C0BB 1G1OA 3ABMB 4MLIA 3B7UX 1QW8A 3C09C 3POCA 2GYSA 5DVMA 1QNZL 4FJ6A 5E00B 5DQDH 4PRPB 2A6JA 5J06A 5BUPA 4Q6IA 2CK2A 4PJAB 4ZX3A 3KWTA 1NDTA 4MBRA 2NX5E 1YEGL 1E3XA 3B2MA 2HFEB 1HI6B 4X9BA 5C2UB 3KGUA 5IHUL 1AZRA 4LLDB 3OKOA 1IGCH 3QXDB 1ORSA 5E6ZA 4KNSA 3ZE1F 2AQTA 3DX6A 5F7AA 2WQRA 2E7MA 2J8UF 2IH9A 2XIIA 2J1YA 3OJDB 4XZUB 4HAFA 3PQYD 4MD5B 4YFEA 5SWSA 1M7DA 2J1ZA 3DSNA 3OGCB 4BZ2H 4JFFE 4YLCA 1NGYB 3GRWH 2W81C 1FFOB 3GZPA 1B0RA 1T0NA 3L3DB 5CINH 3IAPA 1AZUA 4QI3A 4K23L 4BFJA 3NCXA 4FQXB 5AVWB 7PCYA 3B6SB 5JXEA 2ENPA 4WNJA 2WXFA 3FTZA 3MRGA 1S4IA 1OY3B 5CP3A 4ZFQA 3SJVD 2A0LC 1JYNA 2FAUA 2ZWSA 3C8KB 5BS0E 1IEBB 4NN5B 1YDPA 1VADB 4X7SH 1RHHA 4X5WA 3TV8A 2V6HA 5BVPH 1J8SA 2F58L 3H42L 2Z1KA 3N85H 2HTKC 2K6YA 5L8KB 5J0BA 8FABA 3MUJA 2YPLE 5EZIL 4H5SA 4OLXL 2BFGA 3O2DL 1F2QA 3QFJD 4I2XE 1UZGA 3BKCL 2ZF8A 4HKJB 4HH9B 4GSDL 5ALCH 4DNLA 1HHJA 5C0EA 1DVFB 1OAXH 2CD0A 5J3HD 3VFRA 1JI2A 1MFBH 3CQQA 2IWFA 3MA9H 5DEZA 5KVGH 3RWJB 5IOPB 3SY6A 1RZIB 4MB4A 2IAMB 3NIDB 2A77L 4HQQH 4LU5L 2Z65C 1Q0XH 1NLDH 3IJ7A 3O6FA 2YJLA 3L17A 5J13B 1FYTB 2VDNL 1DSYA 2NLJB 5DQ9A 4OVVA 3RTQD 3QJRB 4PWGA 3RY4A 1N2RA 1BD2D 4EIGB 2OXGB 1DE4B 2GJZB 4HU2A 5E2UL 4PPTA 1FBIH 2P8MA 4YDMA 3L5WB 4IRSB 3AXLA 5EF1A 1YMMA 1RZ7L 3P0GB 4XVJH 4K7PH 1NAML 3DUSB 3SPCA 4JHAL 3MRQA 5D1ZB 2ILLA 4IMLB 3WNMA 3TO4B 2ICEC 4MMZB 5K9QI 4Y7OC 3NIDF 5DC4B 1LP9B 2FWLB 4M7ZC 5BV7C 1C5CL 4AE1A 2ADFH 1KSRA 1C7SA 3KD4A 4HC1A 4UUJB 1AHWC 1S7UB 3V0JA 1PEWA 3B37A 1SN0A 4X6DF 4MHHI 1WC7B 3CH1A 1CLZL 2DQ6A 5D1QD 1W6WA 3WCYA 2OXHA 5CJOH 2V3FA 1G84A 1FO0B 3QI9A 1N8OE 2CGYA 2BNQE 4Z7UB 4JKPH 5LHDA 2BWIA 3O6LH 1NLBH 2ATPB 2CQVA 5JPMB 4JM2A 1E9QB 1WG3A 2QEJA 4TVUA 1MNUH 5E9DD 2ADIB 3HCVA 1EQWA 5I18L 3IPEA 3S0PA 3ZHDA 1HZHH 1TJXA 3N04A 4Q9QL 4BIKA 2D7QA 3ZHKA 5E8PA 5T3ZD 5GGTA 1N9PA 1F11B 2QQLH 2A6IA 1YY9D 2AGJL 2IJ0C 2J55A 3BJLA 3G5ZB 1BOYA 5I1KH 5I5RA 1QR1B 2EDEA 1U0QA 3KEHA 4MA3A 4QHPA 1ZHNB 5FWRA 4F7PA 3QBTB 1PCXA 4I85A 4C58B 5IFJB 1FVEB 2VE6A 3TBSA 3LS4L 2QSQA 3EYQC 3LKPA 1YEHL 1NCCH 3NP3A 5IROD 3CPLB 1WWBX 3FQTA 1PBYA 4PJ9C 1Q9OA 1SF5A 1B2WH 3DROA 3KPLB 4YDKH 4ANXA 4BKTC 3D50A 4LLUB 2FX7H 5DO2C 5E9DA 4NBZB 4A38A 5I5JA 4IDJL 4QLWA 1BX2B 1G6RB 3FQ2A 4PTTB 3ABGA 4ZYKA 1YEJL 1U42A 4I87A 1SBSH 2EIKB 4RFNC 2VN4A 1HEZA 4U49A 3BWUC 4KDTA 2VL4A 1JNNH 1WV7T 2EIDA 1ZXQA 1NCBH 4IRSD 3ZVVA 4BXVA 1HH6A 3UGEA 4Z7NF 4I0PC 4XNDA 3OTTA 2EH7H 4QF1B 5AYUL 3S5YA 3P0VH 4R4BB 5E6UB 2D73A 4WUKH 3RHWK 1QR4A 2A73A 4XMUA 2ZUSA 3QYCA 1MVYA 5JW4N 3QJFA 4GYBA 2F53B 3L7FB 2JLLA 1UM4L 1KLFA 3PNWA 5F9AC 5FIEA 5B1KA 3RKDD 4B53A 2WXIA 4XN9A 1BVNP 1WP6A 3OJVC 4OM0H 1ZANH 2O5XL 4AIEA 3G5XA 4RSYA 1W0WB 2HLEB 1WTLA 2UWEB 1G1CA 1HZLA 4I7ZC 3BKML 5IW6B 4KZDH 4XCCH 4XP4H 1EHKB 1U6AL 1IGYB 5GS0L 1BPVA 3TWCH 2NY6C 1OPGL 4Y4KB 5EA0H 3ZQXA 2BO0A 4XCFH 2NY0D 3TN0C 2F54B 5IZ7A 1X4YA 3RTQB 2ISDA 2GI7A 2BY3A 2VMFA 4N8CL 4IRJC 3L3IB 3FT0A 3QQDB 1P1ZB 3CWGA 5FYJH 4NQED 2X4NA 3SYQA 1RZGB 3F05A 3SCMA 3DOSA 4E42B 3MXVH 3EJJX 5I75B 1PZ3A 4M56A 4G5AA 4WV1A 4C4UA 4Z7VA 3GSNH 2WKOA 2IH1A 3ZTNL 25C8L 5TK4A 3BEVB 1RCYA 1DSFL 1QBML 2EADA 2YD3A 3DUUB 3JTSB 4XE0A 2ZYRA 1BM3L 3W9EB 4K3DL 2BOLA 3CAFA 2HX7A 1XR9A 4AGOA 1KIQB 2F74A 4FI7A 1MCWM 3MLUL 3ZE2E 1R3IH 1YNLH 3O2WL 1BLIA 4NWUH 1WRFA 5LCVH 8PAZA 1MHPL 4FMVA 5CBEB 4HBCL 2FSDA 2GTZA 4L8SB 4HZLA 1MFNA 1EAQA 4OAWB 1M9SA 2NY5C 5F7UA 2ZUXA 4K55A 3N41B 3Q3GB 1MQKH 2LHAA 1PFCA 3MLTB 2WJ5A 1BECA 1JBJA 1E90A 1OTTD 4N0FA 1CFQA 1UB5A 5EUOE 5FA4B 3CVIH 3EYSH 3LN4A 1AXTL 3MN8A 4XNZC 2UZXA 1YC8A 3WO4C 2VLMD 3APDA 4N2LA 3NAAL 3E7JA 3RIFF 3S5LG 4WI9A 2Q5BA 5E1QA 4FQLH 4A04A 4XMWA 1FV1B 2XT1B 2X87A 3HPLA 4WY7L 2WQWA 4LAJH 2E9IA 5HI4C 5B8CB 5IEKB 1FG9C 1KPRB 2NW3A 3VXRA 1F1AA 3HTLX 1I7RA 3BGAA 2XTJB 4BUQA 4DQOH 5J5EA 1J1PH 5EC1A 4DP0X 2X28A 3FHAA 4TRPL 3U30C 1QBMH 4FE9A 1PAZA 4LSVH 5C9JA 2E47A 4JEGB 1U3HD 5HHVL 3DX1A 1MAKA 2E5EA 4GT0A 3TVMA 1GC1H 1CD1B 1U8NB 4XWGL 2AJZA 1I9IL 3KPMB 1KJMA 1BIHA 4BJLA 1YN6B 1OTSD 3B5GA 1XZWA 4KKQA 4W4NA 2EXYC 3C5JA 3FTSA 3QXAA 1KEGL 5JIDA 3V5HA 3G5YB 3QJVB 4DKAA 4D9QE 1HQRB 2GCYA 1G7HA 1KB5B 3TWCL 1CGUA 2H6UA 2R9HC 1OAYL 2J6EL 2NT1A 1A7QH 2Y36L 3ZDXE 5D93B 4Y1AD 4OD1H 5HDQH 4A6YB 4Q7DA 3L1OL 4XP5L 2EDHA 3PL6A 4KK5D 3PP4H 5DURB 2VISB 4PJDF 4Z5RB 3ARRA 2E6QA 4NM8H 4L18A 4N9OB 3TVMD 2HFGH 4PGCB 1P7QA 1YY8B 4KKLC 5I23A 4XO4A 3BW9B 3VXSB 4GAYB 2LU3A 3B7RL 3WE6B 3OB0H 3BZFB 2EYRB 4R7NA 2QDVA 2YPKA 4QAWA 3NT0A 4F2FA 2QQLL 3V0AC 5D8JH 2F8VA 4KJPD 2WNWA 5FFGA 5KJRL 5T1LB 4GRWF 2L0DA 2Q3AA 4MQ7B 1JZFA 3ZTDC 1E50A 4LZKA 4Q14A 1VEMA 1EEZB 1D2OA 2OCJA 1S7XB 1XIWC 4N87A 3IWVA 1BVKA 3G6JE 3MCYA 3RWHB 3PWVB 3UJTH 4YSUA 4BH8B 2HP4A 2HX8A 2OLDA 1CR9H 1R0AL 1OTUC 3ARGA 3MBEC 4QRQA 2R69A 2NUPA 3ARTA 1YCSA 4UDTA 3IE9A 1HI6A 5AVQB 2QMJA 1IEAA 3OAYK 1XH0A 1YJDH 4GH7B 1X5YA 2BXYA 5E94A 2ID5A 5DXWA 3OJDA 3BFWA 1KV7A 4GRWB 3V4PH 2CXKA 1OAZH 3FO0L 3K6OA 4ZO8A 4GMSL 2AGJH 3HLAB 4PJ8B 2ICES 2ZXEB 5CSGA 3VSVA 3ZW3A 1X4XA 3EW3B 5CN3A 3BFQG 2XWCA 1C5DB 4BGLA 5JIPA 1UWEH 3D0LA 4LEOA 2UXFA 4ECNA 5KYWB 5I1IL 3RL2B 4G7SB 2CO6A 3SE3A 3MGTA 1T7ZA 4EE2A 4ZUSA 3WN5B 1FA4A 4RFEB 2YXWA 5T1KB 4HOZA 2AANA 3NCBB 3F6LA 5CJ5A 3TYFA 2VO5A 1YDPB 2IWGA 3FQXA 1AQMA 1VADA 1RHHB 4GP4B 4X5WB 3WEMA 4URKA 1RIUH 5ID1B 1DTUA 1O5PA 2QFPA 1MHHB 4YC2C 5C0JB 4H5SB 4NOFA 1ZIBA 3ECBA 5LBSA 1U3NA 4Y0GA 3VI4E 2WPGA 4JN1L 3UAAA 1MCDA 1VZIA 3KNBB 2AQSA 1DDHB 4TOYH 3OKDA 3QDGE 4P4KC 4QTIL 5KG9A 3GSNL 2ENYA 3VA2C 1IM3B 3DXAB 4X5QA 5GJTH 1S7WB 5FV1L 1HCVA 2VQTA 3AC0A 5HHQA 5IJCC 2KUTA 5IOPA 4HWZB 5HPMB 2FNBA 4UILL 3GHEH 3FUNA 3LKQA 4YSPA 3ZDYF 2CM6A 2J3SA 3CG8A 5JIIA 1TOXA 5T3XH 1G7IB 2W9DL 4LDOB 3O6FB 4OZFH 5FYLL 5GSVA 3UCQA 3OZ9L 4Z0XB 5FYKE 5DQ9B 3UAJC 1N5AB 1E42A 3VXOA 4WWKD 2BS71 3AZUA 1TFPA 3MRRA 2GBVA 4GRLB 5LG6A 1TXKA 4Q6YA 5IEHB 3WNJA 4N2DA 2ED9A 4IRSA 4KFZC 1CVSC 5JIMA 4PJXA 1T7YA 3D85D 4XB8A 1BIIA 5KBPA 3HG1B 1QFUH 4KI1A 5AOKA 5CEYB 1RUKH 4XI5C 3MRQB 3RU8L 2EUZA 1PJ9A 3KYOB 1EHXA 2JKNA 5H4ZA 2DM3A 2UUDH 3GJFB 4R5VA 2WUCH 1UH2A 3A21A 3FSVA 4WGVB 4ZNEE 4G9DB 3CUPB 2XWTA 4DP7X 4ZFFA 1YMHA 2YPVL 2HWZH 4K5MA 1EFXB 4NUGH 4OD3H 3ZHLA 2JQMA 3NIGE 3IJHA 4DKFH 2QFRA 4KRNA 4F8LA 2CLRB 1LEKA 2K3TA 4LHUG 2CJUH 4AVJA 2ODHA 4M1CD 3CHRA 2F19L 2XXFA 3WIIL 1GCFA 1A4AA 3MV8E 5A40E 1P9MA 2BH0A 1SBSL 1J10A 4ADGA 4FOMA 5FV2A 1JYWA 1TUPA 4DO6A 3TJHD 5DHDA 4FEMA 5D96B 1YNTF 1DANT 2AEQL 2QDWA 3HE7D 3PWUB 4YFLF 5FOBA 1HQ4A 2IFGA 3WN5C 4C4KT 4Y4HA 1NGQH 4KTDH 5DJYB 3SE9L 1RULL 1R24A 1WA1X 2FJHB 3N41F 3GKWH 4W70A 1BQLH 2KZ1B 3IBEA 1F11A 5SWZE 2XV6B 3OM3B 2EZ0D 6FABL 1NCIA 3NCJL 3U0PA 5DHVA 1A14H 4PJHE 4F7PB 2KYIA 4EI5D 3E8VA 3FO2B 1WEJH 1LO4L 4C54A 3CSPA 2BVPB 2WB7A 2ZKWA 4L3CB 3A67H 5AAMC 5I1KL 4EDXA 1QASA 2G2RA 2Z8RA 1SVZA 3P40A 2QADC 1SFHA 3KWUA 5L2KA 3H3KA 3I6LE 2AVFA 3A4DA 4NKIH 1DQIA 3IMVA 3N1GC 4GP8B 1D7FA 3ULVD 4RGNE 4PJ6A 1Q94A 4GNKB 3D2UA 1XB3A 3BXNB 4XHQA 4O2EA 4OJYA 1GOFA 2XZAH 3RDTC 1KGIA 1A6PA 3D3VA 3QNZB 3AQZA 3DTUB 1OF0A 3VXNA 4R6UA 5L88L 4OF6A 4JCWA 3CTTA 5DUBA 3NCMA 1SJHB 2PXYB 1U3JA 4R4BA 1WVZA 3IGAB 5B39G 3F65A 3OAZK 1E28B 4J3XA 1BVOA 2VR3A 5DD3H 1LMIA 2D3JA 3PABB 1KLFB 4A67A 5TJWK 2IWKA 1IVLA 3KWVA 4FQIH 4R90H 3AREA 4JE0A 3G5XB 2CIKB 4KPHH 5MHSE 3T65B 1R34A 2VR7A 5FF6A 4YQXH 5F8RC 3GBMH 1TEYA 4UTBA 5IR1B 5GIRB 5LBSH 3CXFA 1YYLH 2YD6A 1IGYA 3MRDA 4H40A 5KUMA 4KQ4L 3X3FH 4OGYL 4XNUL 4YLBA 3WIAA 1UUNA 1J0KA 1JPTL 5EO0B 2QBWA 3EDKA 1IT9L 4Y89A 5C07E 5I0YA 2FO4A 3FQNA 3ZL1A 2CALA 3MLSL 5J11C 4Q2ZB 2VDKL 2X7LA 1JF6A 4UYPA 3KYAA 4WJ5B 4E42A 4POUB 3QPKA 3DOSB 4GRLD 4WK4B 3DLQR 4S1SL 3D0AA 4NBXB 4WV1B 3WTWA 4JPVL 2A9ML 1SEQH 3VG9B 1OAXL 3QCTH 3SQOH 2YHGA 2XETA 3BEVA 3Q5YA 3QZMA 5DD6A 3BC9A 4JQXC 4Y19D 3OSVA 4WENB 1T03H 1JXKA 4JFDA 4YSRA 4FERA 1FYHB 1JWSA 3B9KD 2R23A 2APWA 4E9XA 1KCUL 1RJZA 3HG3A 4MCZB 5I76B 1CI3M 1UUSA 3KBHE 3HC4L 4IGBB 4MTMA 4PUBL 4XNXH 1NDGA 1ZV2A 4PRHB 2F8XC 4N25A 2YMXL 4P3CL 2EP6A 2OZNA 4NJ9L 3L1GA 5K9JH 2Q0ZX 4KROD 5BOZG 2OZ4A 4WNSA 3MBWB 2YO3A 3E9UA 3S8WA 4N0FB 4TNWF 4P23A 3QH3B 4N0UE 1MCWW 1ZLUK 3S98A 2EIZA 4ELMA 2Z92B 1WZ1H 1S8DA 3GBML 3GSNB 3RUGE 2FIKB 2IPTL 3NPZB 1AY1H 3PU7A 2YPLD 3E38A 5GRJH 1AANA 1ZT1A 4GI9A 1MY7A 3PCYA 1LILA 5CSZA 3QIBC 4RBPK 3GTNA 4OI8A 4PI2A 4PGBA 4GSXA 2OMUB 3OG6B 4OQ1A 2OMZA 4H1LA 2WSDA 3M8OL 4JO2L 4E41E 4FFVC 3UABA 4JFQA 1D5MA 3MFFB 1RJYA 2PR4L 2DAVA 2W65A 1XGQB 3X1EA 2CZNA 43C9A 2E7DA 4LAQL 3R7QA 1F13A 4JRYB 2E7CA 2J4WH 4MCNA 5AYTA 3NIGF 4YUEL 1P4UA 4OLWH 1G1KA 5BUGA 1CD1A 4I0PD 4CDGC 2OKMA 4XOBA 3MLYL 4FJZA 1KJMB 2DQTH 1F97A 1B4LA 2WTPA 4GEJA 5C08A 2NY4C 5I16B 3H56A 5I73B 3GSQA 3EO9L 1EUUA 3ZDXB 1G1YA 4FFWC 2XYBA 3DIFB 1BWWA 2DWDB 3NP4A 3HZKB 1K3IA 1NGPL 1WBXB 3FQUA 3GSRB 4L3FA 4YHLH 5TD4A 3L6FB 1WHOA 3RILA 3QO0A 4RAUB 1TJIL 3RGBA 4NP4L 1U8CB 1MJ8L 1MIEH 4TUOA 3WIHH 1RUMH 5F9WC 3RGVD 2Y7QA 1CICD 2DBLH 4FTVD 5CIPH 4Z5RA 3G6JA 4HIJB 2VIRA 1AY1L 2VQ1A 1OGPA 5KANG 1YY8A 1H9VA 2FVNA 1SUJA 2ICWI 3V4LA 4Y2DD 4CVXB 1AMXA 1TYJA 3QEQE 3VFUB 4F3FA 1TZIB 4RLDA 2DQTL 4G8GE 2BNRD 3ARWA 3FMGL 1G7MA 3TZVB 1UD8A 4M5YH 3CFJA 3N44B 4N28A 2NOYA 5DZ9A 2YEZB 4K7PY 1CZ8L 2V17L 2D7TL 4JREC 2ZX8A 3O41B 5DWUL 2WO4A 2Y2TA 3K4AA 4C8XA 4IRJA 4KX9A 4U4IA 2P43B 5AYQA 1QLRB 1YMMD 2A6DA 1MCPL 3O4OC 1U8QA 4LQ1A 4W9EC 2ZXGA 1GAFH 5K59E 4I0PA 4WDIA 2CH8A 4GQ9L 2DJ4A 15C8L 3ERXA 2A9MH 1E6JL 2IPTH 4QOKD 3JZYA 4PY8I 5DT1L 3ZDYB 1P2CB 1HINL 3Q9QA 4FQCL 1U3HA 4N86A 4H20H 1D5ZB 1E7VA 5FO7B 3WEAA 4UQBA 3RE0A 1P4IL 5T1DL 2ZG1A 3RAJL 4BDVB 3ZMRA 4B96A 2BSSB 3G6AA 3JV4B 1CE1H 4PJ9A 3KR3H 2YMXH 2XWZA 1JWUA 4KJYA 4NKMA 1J9CT 3TYGH 1QAWA 4JPWL 2W95A 4NOBA 5T1KA 3VE0B 5FUCE 4AVIA 4KXCA 5I0ZA 1EZUA 1FFQA 3MOBL 1XMEB 1HNFA 1A4KB 1XGYH 1YPZA 2CHWA 1ZXKA 5ID1A 2HZHA 1AJ7L 1JZJA 5L8JB 2VZ1A 1U30A 1MHHA 4HJ1A 5J9PA 4N2MA 2ZNXA 1H3WM 3IDXL 3C6LA 1IAMA 5CZKA 3EFDH 3AU0A 3GJEA 4NNPH 1I1AA 3RVUD 2H1XA 1L9MA 1D5IH 3DWTA 4ANWA 5KG9B 1Q0YH 4KOBA 3GZKA 1MJUL 4YDJA 2IXQB 1D6VH 1GSKA 4MJJA 5J1SC 4B3EA 5MEQB 1DANU 3PS6A 4FNLL 5LN4A 5GGQH 1VCBC 1HYRC 4IHOA 3UTQB 5LBSL 4AV4A 1TSRA 1IAKB 2YWZA 2WBXA 2WW8A 4QRSB 4UWQB 4FNRA 3PFQA 43CAB 2X53A 2EVIA 2FX8H 1U4EA 1JCKA 3CZFB 5F88A 4A66A 3F5WB 2COVD 3RVWD 4QRFA 2DYSB 2CDFA 4NQEA 4JKMA 3BPNC 5FCUL 3ZQ9A 2WNXA 3TNNA 5DTFB 4E9VA 2CBMA 2WHVA 4ONHA 3HG1A 4M5TA 1C08B 3UO8B 3OHXA 5TE4H 2VITB 2CO7A 1S3KL 3KYOA 6FABH 4OTXL 1H8NA 1KXVC 5BRQA 4BM7A 5CFAA 5KSUB 4XP9H 4YHOL 3PQYB 2XWTB 3O8XB 4N0UA 1EFXA 5BO1L 1E5BA 5DLML 1OP5K 1HSBB 4P5MB 5IVXE 1QWHA 2J7LA 3F00A 4Z7VF 1I9RH 3IGFA 3OAWA 2PETA 1MREH 2AJ3B 5IG7B 1Y18B 5DJXB 5T1MA 4ZBJA 2OQJA 2B4CC 5DJ8A 3A6BL 2ICCA 3FONA 3P9LB 2VJ8A 1TTCA 1ADQH 4B0MM 3N1MC 5I5IA 2CJUL 2I69A 2QADB 3F01A 1AIFB 1UQSB 1OAQL 3LQAL 1MPAL 3MYJB 4PJAE 4U1MB 1A6WL 2DY2A 2DH3A 4Y4HB 2GK2A 4LPCA 3SYCA 1C1EH 4L9LA 2DQDL 2Q9OA 3IAQA 1A9BB 2MNJB 2OMNA 4LVNC 4S1QH 4ZS7H 5E0FA 4U1GC 2X6VA 4DGUA 1F4WL 5JQ6L 3TH2T 3VXMA 1MRFH 1UD2A 1E27B 2HT2C 5JZ7C 3IFPB 5DHVB 2VDQH 3EFFB 4YSDA 3TO4C 2DM4A 3FT2B 3T6QC 2IBBA 5IKCB 4JBSA 4RFOL 3Q5TA 4JS7A 1EAOA 3E80A 3T2QA 1U2YA 3F6JA 4KTEH 1FL3B 2VTFA 1CT8B 3VACA 1AS6A 2D7PA 3LQMA 5D6CA 2UVEA 2XVLA 1E4XH 5CIPA 1AI1L 1UZ8A 5L2KB 4AXWA 1T83A 3DURA 4ZW7A 5D2LA 4MZ2A 4BWWA 3WIIH 2IDSA 1OP9A 4G8EB 3BUYA 1KNOB 1DZ0A 4O58L 5EUOA 5FHAL 4DP6X 1ZEAL 1JGDB 2OL3B 4HIPA 1XXDC 2J25A 2A74A 4JPKH 4JKLA 4MD5A 3WFZA 4FCHA 2IADB 5E08L 3RZCB 4LL1A 1NGYA 2FQEA 4FTDA 1FAIL 2WUCL 3L4VA 3P4MB 4UT6A 1B0RB 1T0NB 3HG1D 1IRAY 3G7TA 4NKDB 2P42B 2NXZC 1E28A 5IB4A 5HXMA 1AGFB 4P2RA 5KYYA 2HVKB 1DBAL 3GQFA 2QGEA 2P8LB 2RJMA 5E6YA 2VGLM 4JDTL 5PAZA 4YAQB 4PJGE 2QGBA 2P5ED 2XRAH 4B9ZA 1IBBA 3QG7H 3LQZA 5DZLA 2EO9A 2NCMA 1TJHL 4LCUB 5C0BE 1GJIA 2WIIB 2PO6D 3WKML 1JYVA 2HTLC 3IF1A 4W81A 3H2QA 5JW4R 3K80A 5IBTH 1T5KA 2FUQA 2WXKA 3LRKA 5LGHH 2BVOB 5FUZH 3FQNB 4K15A 4B95C 4V33A 2BY2A 4TOYL 4YGVB 2BJMH 2V2XB 4HBCH 4ZAKA 3OB8A 3KZ8A 3H9SA 5H94A 3FF8A 2OX5A 2NTFA 3M46A 2KZWA 3M7FB 4Y16D 1GGCL 2P9RA 3NJIA 4UQEA 2EO7A 3D3VE 2G75B 1IZKA 3GRWA 3IT8D 3MSPA 5FO2A 1WO2A 5C07B 5CGYC 2EE0A 2VDOL 2AJSH 4O02B 2P48B 3MA7B 3L5WA 1W8EA 4ALAH 4MCZA 3AXLB 3U9WA 1DBJL 4R4FL 2NX5D 3CZJA 3TONA 1H5BA 3FSZA 3PNRB 5AG8A 3CXDH 3D08A 2YJQA 1JV2A 5F21B 1BFVL 3OHXC 4YSEA 3BDBA 5D1ZA 4JZJC 1BD2B 1JPST 3O45A 5HHOB 2W0LA 4WCYL 4XNYH 4LK4A 2G3ZA 4KKZA 4JHWL 2VR5A 2XQYG 3R18A 4KVCL 3LIZH 1UXWB 4MX7A 4OKVB 2V7HB 1NC4A 3JWOH 4MZRA 1CL7I 2V2TB 3IJSB 3RZCD 2Z92A 3QJTB 2E27H 4FFTA 1SLVA 4ORGB 2OXHB 2VDLB 5AB9A 5E23A 1A7BA 1CFNB 3BKMH 4KI5D 3VFWA 4WFGD 2OL3L 2OR9L 1EVTC 2ATPA 3JT0A 2NY7L 2PTVA 3OC8A 2X6MA 4I0KA 1S9VA 1WH0A 1TNNA 4GO6B 4HPOL 4PJXE 4QHUA 5CSZB 3W39B 1ZLVK 4E2OA 5C0AE 1DO6A 1W2KT 2ADIA 4HHGA 2DQDH 3GHPA 3U4BH 2ARJB 5BZWB 3QIUA 5AUMB 3S4SA 3P0VL 2AXFA 3HFFA 5LNEA 4CADB 3MRFB 3QDMB 2GC7C 3ARFB 4PJBF 2R0ZH 1PLCA 1K3ZA 3FN9A 5HHPA 1KB9J 3KL0A 4EXPX 2EDWA 2FJGB 3W0WE 1IX2A 2B5IC 1HNYA 4HK3N 1I9JH 1QG3A 1MHCB 4LSPL 2DQIL 3SKNA 4FNPA 1NFAA 2IDQA 4JX0A 1OO2A 4P07A 2BM3A 3SD2A 2EUVA 3O3UN 4B9YA 3DIFA 2O5ZL 4XPHL 4YZFF 4GS7C 1N10A 2NCEA 2FEDD 2JXMA 4UM8A 2VC2H 2X40A 4X98B 3QORB 3TTYA 2E27L 2ADYA 4DUWA 4PJBB 4GKZB 5DEFB 1VFBB 2OL3H 3G6JB 4C47A 4HIJA 5J1AB 2ATKB 1GZQB 5AVZB 5FUZL 5IW1A 1YHPA 1HH6B 2VQ1B 5D2NA 4K3HA 3RWDB 2EDTA 1AXTH 4OZGA 3RIFK 4DEPC 2C4XA 4LLVA 4APQD 4NQQA 4POZC 5CCGE 4WFGE 4FZ8L 1OTSC 3MV8D 2O5YH 3S3SA 2EDYA 1WBZB 3TBTB 3QQNA 4BWTA 4BCYA 2HPOA 1G7MB 4ENEC 3TZVA 4D9LH 1XGPA 5MEND 3LD8C 1NLBL 1FC2D 4OIFA 4PS3A 3ATDA 4QRRA 4ADJA 3BQUB 3K6IA 1F1GA 2P1YA 1ZS8B 5EOQL 1VIWA 1W72A 3I3DA 3KGSA 4IK7A 4OFQA 5E2VH 3QWQB 1J1PL 4BSVA 1MHPH 5I73C 4YHNA 4MQSB 1MCHA 2OZ4L 2JI1A 5HHOE 1WD9A 3L3OA 3LRLA 1BLNA 3NSXA 4Z95H 3MROA 1SGKA 4Z23A 1OT4A 2Y6SC 1FZJA 1BV8A 4WDIB 4AGLA 2F54A 5KW9H 2P7TB 1U8IA 1QFOA 3CCHA 3ATBA 2P5WE 2PF6A 3TF7C 5GS1A 5DRXA 1WFJA 4X9YA 1RZGA 3SCMB 3ZE0F 1U3HB 5EDSA 2VABB 3MRKB 4Z7WF 1PY9A 4GOSA 2TRHA 1BQHG 2BVEA 5IQ7L 2FSEB 4I0CC 2Q8AL 4NQXA 4CBZA 4O4YH 1TJHH 1JWUB 3LCYA 4RWYL 1XAUA 1E4WH 3O3DA 4NRXA 5T1JA 2BY1A 2XRAL 3QZNA 2KL6A 1WS7A 2Q3ZA 1J5OL 1WBYB 1ILSA 4L8SA 2G60L 3CJJA 3WHE0 3J7HA 4EZKA 7FABL 4J2QA 3SO5A 2VM4A 5ISZB 1ZCRA 4G80A 4S1QL 4ZS7L 1C12A 5AW2B 5C08E 4GRWE 2WLNA 4P3DB 2DB8A 1AG6A 4X4XB 4WFED 2CRIA 4G7YH 1OOWA 3QT2A 5MENE 2NY0C 3TN0D 4CGTA 1T4KA 4Y4FA 5ACLA 5AYUH 5INDB 3QRFM 2NR6D 1GKOA 4Y9FA 2PKDA 1HHIA 4G8GD 1UC6A 4XN4A 1P7KB 1OW0C 4DN4L 4G2AA 5FGCE 3RA7L 3LOWA 2ITEA 3VB8A 1W0YT 1EDHA 3D51A 2P52A 3VGBA 5CEZD 4RISL 1U6AH 3GS7A 3K46A 4R8WL 5KVGE 4ONFL 3T0AA 1IAKA 2AXGB 2PXYC 2VW7A 2GJRA 1KELL 43CAA 4KTEL 3FU8A 4X0NA 4G9FB 3F5WA 4QR7A 3FS9A 5EBLA 4F9PA 5HD8C 5F3HB 3SPVA 3I85A 4H0LC 4NHCH 3GZQA 3TH4T 4BFFA 4X5XA 4LSUH 5T3ZH 1ACZA 1F4WH 4Q97A 5JQ6H 3W57A 3U48A 3C12A 3SJVA 3V5HB 4PBVC 4G8IA 4ZMXA 1MI5D 4R5XA 4JRXD 5FA3B 1PZUB 4I48A 5AAWC 1KB5A 4OF3A 4Q58C 1OD7A 3X11A 2FJFB 1E67A 1WA0X 1BSIA 3L3KB 2LAGB 3T3ME 2R29H 4AJYV 5JW5A 4YX2H 3O3AB 3FQWA 5I1EH 4LOEA 2Z8WC 5DLMH 4LLAA 2WXMA 3NK4A 2H2PC 5E8DH 5KTEL 5AOZA 4WI5A 3LVTA 3SGJC 3GEWB 4KV5E 5GJSH 2EXWD 2EYRA 3GYRA 3GSVB 3ZUNC 5KJ7E 1M6OA 3NN8B 5DZAA 1A6AA 3UBGA 1A9BA 5SX5H 1JERA 4KVNL 4NJAL 3B9EA 1CICB 5F3BA 2ZG2A 2J8UB 2XWEA 5CLWA 3U46B 1S3KH 1ZHKB 4A2LA 4UM9B 1DR9A 1BZOA 2ZCZA 5HVHB 1EEZA 4KI5C 2WLIA 4QO1B 4QXWA 3K8KA 4K7PL 1PW3A 4L5FH 3OF6A 5KWYC 3JWNE 5C0IA 1GZPA 2GKIA 2Y1YA 4UB0H 4HJEA 3V0VA 1TZGL 1NBZA 2EEAA 2QT6A 5FDWB 2L4OA 1FL3A 3V0FA 4EN2A 5JA9A 5EIIG 3O2VH 4MD4B 4PTUB 2H7WA 3BKJL 3C8HA 3LN9A 3IN2A 3ATFA 3NCWA 2Q8BH 4P49A 1YG9A 4NWTL 3PP3H 1K4DB 1MEXL 1URIA 5MEOA 3KPNA 3FU7B 4P04A 1XCQA 1YYMH 2WGNB 4KK5C 4U1NB 1NUNB 4NPYB 3S3DB 3WKNA 4CU6A 5EEUA 3VDAA 2R83A 4NEHB 1A8ZA 4H88H 4J3OG 3OSKA 1HHHB 3L2NA 4FKKA 1WHPA 1NGWA 3RVUC 1NL0L 3RZCA 1KEML 1JK9B 5B1JC 4DGVL 2HXAA 4F33B 3P4MA 5KUKA 1MFCL 3MPCA 4P46D 4LOFA 4ZFZB 1EBAA 3MLPA 1CG9B 4FS0A 1WT5C 4JHAH 1QPPA 1O6SA 3BZDA 3FQRA 4JMNA 2MTAA 1JGEA 2QSCL 3CLEH 5DYFA 3ARDA 3KL5A 1N7MH 4HIEB 1WYJA 3WYRA 1KDJA 3O9WB 2HVKA 3OHMB 2P8LA 1VZGA 4JR9H 2OJEA 4WFFD 5IFAL 1N18A 4YAQA 5C0JA 3FTGA 4K5LA 1U8PA 5E4IA 3F58L 4ODWA 3ZZLA 1DFXA 1P5UC 5F7HA 1JTOA 3TU6A 1OT1A 1ASQA 1DL7H 3U7YH 5KYUB 3RJOA 4APQC 3TL5A 2IMNA 5ECGA 3VD0A 3TP4A 1MH5A 2WJ7A 4OF0A 3MNWA 5HYFA 3LHPL 1G9MH 5C0FA 3AW5A 2KBGA 2DKUA 3QCUH 1HCZA 3DGCR 4PCTA 3CFMA 4WSJA 3SJVE 4F1SA 3MRIA 5DT1H 3Q9PA 3L54A 5FKPB 1V10A 4ZAKB 2YAMA 2WBJA 1RFDL 1CJYA 3LKQB 2ADGA 4I9XA 4OZFG 3ZGHA 1IKNC 4BD4A 1CO1A 4CSSA 15C8H 1OSPH 1MLBA 4LASH 4LO9A 5EZIH 5KVEL 5L2JA 4LESA 2LQRA 1JGLH 3HNTL 2R56L 5FC9A 4JRLA 1ASPA 2XICA 3LS5H 1SDDA 4AENA 1ZA6B 4PYGA 2XY2A 1Z9NA 2VDMH 1FE8H 3LH2H 3MRRB 2IAMD 3AFLA 3W1ZA 4EN3D 3RFZC 1ETZA 3X12B 4GRLA 2DYPA 3MA7A 2KQMA 1FNLA 4HDIB 1OSYA 4W9FC 5A16B 3U25A 3UJJL 2N1TE 2V9UA 3FTWA 2SODB 1G7QA 2Q2LA 3RJDA 1ZGLA 3EO1A 1CPUA 2V17H 4H26A 1IIKA 5CEYA 2FBOJ 1U8JB 2H6PA 2AEPH 3I2CH 2E9WA 1MVUB 2X1QA 5HHOA 1WS8A 3Q1SL 1E9PB 4LIQE 2H3KA 3FMGH 4A7TA 4BKLA 4Z7QF 2VXVH 2LU5A 2DMGA 3BAEH 4OCWH 3CUPA 1WFUA 5MENA 4AEEA 4PRHE 1F4YH 1SJVA 1PL3A 2NY1D 2V7HA 2R2HA 3CK0H 3HNVH 5K1VA 3WKQA 5JZ7D 2HYMA 2XN2A 2CLRA 2NMSA 1LEKB 3WIHL 3AQDA 1O9WA 2OMYB 1J0YA 2B3RA 4P57B 1BD2E 1CFNA 1H3VA 3A22A 1WT5A 2IWEA 1KG0A 2Z34A 3QJQB 4GQQA 5LGYA 3L9RA 2MH4A 3H0TB 1S9VB 5CLZA 1XF4A 2APBA 4ETYA 1ONQB 3HFMH 5C7XL 5KS9A 4RQQB 1DJWA 1HQ4B 3WTUA 5FGBC 1R24B 3BP5A 4HKXB 1BBDH 1FG2A 2I25N 2HH0H 1NUFA 4JO1L 1JWMB 4S0SD 3FCBA 3DO3A 4PLJC 5JPNB 3BSZL 1U93B 5GZNA 2N7BA 2XOTA 4DSYA 3C2AH 1HILA 1NM4A 3TH3T 4IIZA 4MJ5B 1RD6A 2BHYA 1FAKT 2J8UE 2OAAA 3ESVF 4AEHH 5FDYA 1ZWIB 3CDGA 4M8RA 1IFHL 4JAMB 1AMYA 4MRCA 2D3VA 3FW6A 4JFZL 5FGCB 2Q7YA 3QIWD 5JLZB 3DJTA 2DQGH 5JHDD 5LDSA 1JZ7A 2YD2A 1QI3A 2OJZL 3FAWA 1PS3A 4QRAA 4DVBB 1QFWM 5ESVB 4K9EH 1AR1C 1CGSH 2JXMB 3UGUA 4AG4L 3QIUD 4K5PA 1I1YB 2XI9A 4PCYA 3KE0A 3QORA 1JMXA 4YSTA 4DPCX 2OMXA 4XAKD 3VJ6A 3BVWA 1XEDA 5DEFA 4K71C 3MLSH 1ZHBA 2OTPA 1DBKH 3HAEA 5IM7B 1OSEA 4I1PA 4HIXL 3U30B 4F2EA 3QVAA 4I2XB 4OZHA 3TWYA 5H37A 3GT6A 1GOHA 2IIJA 1HHKA 2PWHA 4ODXA 5EOCJ 4YDZA 1AQKH 5FYLH 1FLTX 3BMVA 5G4OA 1TNMA 3MBEA 4S1DC 4UF7C 3TBTA 3QXUA 3PABA 2KPWA 1QRKA 4GG6B 4A2EA 4JM2D 1NC4D 1QTYT 4XNXL 5IT2H 4Y16C 4JR9L 4MQXC 3FCSA 4ODVH 1BZ8A 3BQUA 4DP8X 4PBDA 4FG6D 3HC4H 3WS3B 5HTSA 1DBBL 1T04A 4KXDA 3T04D 4G83A 3BHBB 5IFHL 1YAIA 3RL1A 2YQGA 4LCCB 5ES4B 5AW5B 3L3OB 1BLNB 3O0RL 2Q10A 2DIJA 2P49B 1D9KD 1MFCH 3QFDB 5DFVC 1J9RA 5EH1A 5CCKL 1FZJB 2YZ8A 5FM4A 1ZLVH 3PXLA 5KANI 1PZDA 3I75B 2CPCA 1FNGA 2OW6A 4X7CC 2X7LB 5DRXB 1TIUA 1B9KA 5GGSB 3VH8G 1MI5A 3SPIA 4LEXH 4UNUA 3N1PC 4YDVA 4A37A 5BO0D 3VXPA 4PRPE 4MJ2A 2J5WA 4OCLC 4OGYH 3ZGIA 2JIXD 3IU3A 1PKOA 4YFDB 5AB0A 4PM1A 2EXTA 5I0XA 1T6VN 4NQDA 1XH3A 3O3DB 4NRXB 3QYNA 3BAIA 1L7IH 3LKSA 5DRNA 1TMCB 2B59B 4GW1A 1NDGB 3NJXA 3T8MA 1IC4L 1PZ2A 4PRHA 1AKPA 5LAXB 1DJGA 1CF1A 1PCSA 1N5YH 1HNGA 2FWOB 1KPUA 1T6WA 1BQRA 5ISZA 1PX4A 1FFPB 3TFKD 3B9KB 3EHBC 3O4OB 4MNGB 3D30A 3DECA 1QLFA 4P3DA 2VR4A 5BVJA 1HIML 3MBWA 2Q6WA 2BK8A 1B4TA 5IESH 4HJGA 1EZVY 3QH3A 1HDMA 1AD9A 2OBGA 4GLRH 1NKRA 4JFXA 4Y4FB 2IOOA 5INDA 3K91A 1QUPA 1S7QB 2RH0A 3TCLA 3CFTA 2FIKA 4P5TB 2ZUUA 1A3LH 1I9EA 2EIMB 5IOKA 1SHSA 1ZT1B 3D18A 3S37H 3NJHA 1KBPA 5C86A 2R29L 1O7SA 3KDMA 1A6VH 1X44A 2C4FT 4BV1A 1MCFA 4UQ2B 2G5RA 4IBSA 1SEBB 2C9UA 2D2OA 5JQIB 1LWRA 2G4GA 2IDFA 2NY4D 2ZICA 4TLTA 1O7DE 2W65B 2ZUQB 3OB0K 4G9FA 3L3JB 1VJSA 4A2HA 4LOUD 2Y9RT 2YAPA 5HYJA 4AJWA 3GJFH 2D8KA 2DI9A 2F68X 5EBWA 4MB5A 1A14L 4X6DE 2JCCA 1J8KA 3BIKA 4APQA 4BE6A 1YEEH 2MQGA 2P5WD 1HEHC 4FQXD 2BNRA 3F64A 4NAQA 3NFPB 1RZFL 3Q48A 2K45A 3SJVB 1BZ7B 1QO3B 5C09A 4LSRH 3SBPA 4XOCA 2JKRM 5DSCA 1WBXA 3FQUB 1K8IA 1L7TL 3GSRA 4RISH 2AEQH 4GMTL 3TBWA 2HFFB 3ZX1A 1GGTA 4JDEB 3GTVA 3V5KA 3S3JA 4XXWA 3JT2A 2EICA 1KIRA 4U1LA 5TQ2L 2Y7QB 2YK1H 4ES8A 4J12A 1MCSA 3PWPB 2VIRB 1DJXA 3IPFA 2I26N 5HGHA 3SE4A 1TJGL 4JY5H 2VSCA 3HW7A 4G6FB 4HK0B 1GMIA 4MZIA 2R39A 1FVDB 1NFDA 5FS5A 3DX9B 4DW2L 3KBPA 2RBLA 3GSVA 3ECQA 4P99A 5C08D 1QSFD 3QNXA 4YHIA 5CU5A 5I9QC 4G6KL 2NQ3A 4NS0A 4YR6B 1L6ZA 1BXAA 3KBFA 2XXMB 4PG2A 4Z0BL 4MA7H 3BUPA 2W60B 2ZCKH 4Z8FL 2A9NL 4HS6A 3O41A 4TS6A 3GK8L 3HLKA 3LZFH 5C0ND 3QAQA 1RUQH 2YLKA 5FM5M 4KTGA 2FHBA 3CDFA 3WIFB 5IB5A 4MQTB 4P59H 1A21A 3SQRA 1JVKA 1JZ6A 4HISA 1TO5A 4MD4A 1RUAL 2UYLA 4PTUA 4QCIA 4F57H 4DH2A 3AY4A 2AI0H 1WIUA 2CBOA 3F04A 4AC2A 2YAEA 4JZJA 4OLYL 5DC0A 4GUQA 3BZ4B 1T20B 3T09A 4Y8AA 5IIEB 3UPRB 1Q38A 1BQUA 2XWBB 4LPWA 4OJFH 1MFAH 2HT3C 4L4JA 1QHPA 3VXSE 5JHDB 4ZXBB 4Z9KB 5FO7A 3LNGA 1WWCA 1YNLL 3QR1A 4TL5A 1J5IA 5C0CD 2R1WB 1TVDA 5E6IC 3MUY1 5HSFA 2XX1A 5E2VL 1WZMA 1KB5H 1A47A 3RGVA 4MNQB 1FNEA 4M00A 4V1DA 4YDIH 3MV7E 1T0MA 4NKMB 5F7BA 3QEHA 1FGVH 1EFQA 1FGNH 3OLGA 4OCRL 1SMOA 3GI9L 3CVHA 5E9NA 4DTGH 3VTMA 2VDKB 2IPUG 4HIEA 1A4KA 1YPZB 2BINA 4KJWC 5E6IB 2XTJC 4K94C 2YZ1A 5CHNB 4D7PA 2FEJA 3KGTA 3FTGB 5KJRH 5HYSG 3EGDB 3PE9A 3BEWA 4NUQA 2DIBA 1M7IB 5E8EA 2CO1A 1VLXA 4RA3A 1FORL 4U3SA 1U95B 3UAEA 1NOAA 1XL6A 3WO4B 1T5WB 3EOAA 1FDLL 3WJJC 2ZSWA 4R7DA 1D6EA 2JJSC 2YD0A 4OFYD 4XPFH 2X3CA 4YDJB 4ZW5A 4YHPA 2GFBA 3RY5A 5FKPA 1P84J 1QNIA 1YJDL 5F6IB 3GF8A 3LVEA 3EG9B 4DEWA 2J20A 2VSMB 5GRXG 1E6OL 1OE1A 4R0LB 3VB9A 2NSMA 1PEZA 3MCLH 1SDDB 4FG0A 4P5TD 3BP6A 3RB7A 2BSRA 1ETZB 4AH2B 1T5XA 1MAMH 2ZJSL 5M95B 3TNNB 3T3PB 1I9JL 4RDQG 1EAJA 3BP4A 4PS8A 1DQQB 4JQXA 3T4AB 1U3YA 2DQMA 3D4CA 2ZJSH 2MKWA 1MCLA 3ULSB 4FYQA 2H6PB 3BN9D 1FZKA 1M2VB 1DEEA 4U1KB 3ZL4L 2ORBH 3C08L 4BKLB 3V0WL 3FB8A 2X4UB 2B2XH 2UV3A 2YN5A 4LP8A 3OZKA 4TRPH 1AFVL 1DBMH 5AD0A 1ZVNA 4NM8L 4KHXL 3ZYOA 4BK4A 3WEBA 4HCIA 2EABA 3PP4L 3RPIA 3SGEI 3HR5A 2RALA 2OMYA 2AJ3A 5IG7A 4UDUA 3AITA 1HL8A 3G5VA 3ARGD 4Y1TA 5DJ8B 3SGKC 4AUJA 2FYYB 3WHXB 4KK9D 3H0TA 4L48A 5EIQA 3OKKA 3CHPA 4XO8A 4ZFOL 1R47A 2Y5TA 3VRLF 3HC0A 1PG7W 4DPAX 4M6MH 4M8QA 3DGGB 2E7LC 4N8VA 3MYJA 4U1MA 1Q0EA 1RP9A 2GPZA 2YAFA 1IGJB 2BOBA 4HS3A 1USZA 1X5GA 3AQYA 2CUMA 3NJNA 2X89D 3QJOA 4QHMA 4OQTH 1SJEA 1TT6A 2EEBA 2VN6A 4RAVB 1TVHA 4XOEA 3T0WA 1FGNL 3UC0H 1QBBA 3K72A 3VXMB 4PREA 2UXGA 4WO4A 3VGAC 4F7TA 1JI1A 5LGJA 2VDOH 1IM9A 4M6OH 5F96H 5FUCC 3VYOA 2AHIA 4FNUA 5GRYA 4LEEA 3HG0A 4GFTB 5FLUA 1N6QL 4EQ2A 4O51A 2AJSL 3FKUS 4Z7OB 1CT8A 4KTYA 5CIPB 4AQ1C 1AHKA 1UZ8B 2CMRL 4BHUA 2ESVD 4C56A 2CG9X 2WLYA 3BCFA 2PCPA 3DURB 4I77L 4NI6A 1PX8A 1LM8V 1X5ZA 5J4MA 1I1YA 1MDTA 1CXFA 4G43A 1NAMH 3SDCC 2OL3A 4I5BA 3EOTL 1MCNA 2D7MA 5LGHL 4M9PA 2NX5B 2VUOA 4W9LC 1PYWA 4XBEH 1VESA 3T71A 3ZYJA 4M43H 1KY6A 1FSKB 4I2XA 4OZHB 4XMKH 4NUPA 4IIQC 1LDPH 1OGTB 4AM0B 1SN5A 5JXAH 2BHUA 3BH8B 3HKZA 4F1ZA 1TZHA 4GG6A 1XB6A 2HKHH 3X17A 1TU2A 5LCVL 3ZXAC 3I6LD 4KDWA 1NAMB 1NGXA 2A9NH 2NY3B 3ZKND 3FCSB 1IAIM 4QHLB 3RVVC 4P4KB 3TNMA 1JTPA 4NIKB 4RGMC 4F5CA 2VXTH 4K0OA 3DHJA 1KDIA 2AK4D 4PJBE 5GRVK 3W9DB 1RZKH 2VH5L 5B1AB 2WIIA 4HUMB 3P0YH 4UOZA 4WUKL 2NY3C 5BRZA 4PJ8D 4NCC2 4P2QA 4M6OL 5F96L 3FTYA 4AK2A 5C6TL 5FYJL 25C8H 4P2OD 1MIMH 1DHKA 1ZJBA 4MA1C 1QHQA 1W91A 3VRIB 4YZWA 2MQ3A 5CGYD 2P5EB 2X4QB 4HIIB 2BC4B 2YD7A 4U7SA 1JN6A 4K7FA 5DVNA 3WFHB 3X3GL 5CJXC 3OAUL 1Z5LB 2NW2A 2Q2EB 2ERJC 1H5BC 1EIBA 2OX5B 5I8OH 1JFQH 4UV7H 5EUOF 4XP4L 1UWGH 5K1JA 1AI1H 1SXSA 3ESUF 3QC5X 3SDCB 3CFDA 1ZLEA 3MYZA 3P1VA 3R06A 3PWJA 4FL4C 4H4NA 2V3DA 1DCEA 4L4VA 3GTTA 4ZSOE 4YE4L 3FOLA 3Q8FA 4NQDB 4FZEH 4O5LH 3LPPA 1CYXA 4AZ8B 4U0QB 5I0VA 1H5BB 4B97A 4R96B 1I1AC 2B59A 1LGVA 3MGOA 4LBEB 3N91A 1D7DA 1MRFL 3ESNA 4KHXH 4M3KB 4GO8A 1NCDH 4LHJB 3D25A 2DQFA 3LEXA 3O45B 3RIKA 1OAQH 4G6ML 2BERA 2Z31C 1EV2E 4G70B 4K73A 4MNGA 4UBDC 1C1EL 4ZW6A 3ILDA 2TSAA 4OKVA 4F93B 1INDH 2QGDA 4HJGB 4AIZA 3DPBB 5DJ6A 1KCRL 3RFRA 3ZQWA 2IOIA 5C71A 3DJRA 1CD8A 4RGOH 2FWSA 5HGGS 4Y9EA 4W1TA 3VFWB 1BMZA 3H7BB 4DGYL 4YVUA 1L7TH 1CFTA 1B0IA 1ND0B 2XX0A 1N8ZB 4FG4A 5E1IA 3JWNG 2R4SH 1QI4A 2WUBL 2AQQA 3ZL2A 2R27A 3RUGF 2BIPA 3FCTB 3TIDB 1ZK5A 2AQ2A 2ZYSA 2EYTA 3IYLW 2M2DA 3KG5A 4MJIE 4TUJB 3MLZL 4Z7WE 4FC3E 4TQPA 2A0LD 4OQTA 5SWSD 3WSQL 3JWDH 1KJ2A 3SGEH 3UBHA 3ILPA 5DDHA 5IQ9A 1L9NA 2Y07H 2FJGA 4UIKL 3KPSD 1F2XK 3HPJA 2JCCB 4WZ9A 3L2MA 3BIKB 4APQB 4UQDA 1XH2A 4MKMA 3NFPA 4S1RH 1MNUL 2VN7A 4GINA 2CE6A 1PG7H 1JXFA 2ED8A 4OBSA 2ZNWA 1HZKA 3RUGB 2RAMA 5E1AB 5I74C 3JXAA 1A3LL 1XXFC 2X4SA 4HF5H 4L4TA 4BH7B 2VOTA 3H53A 3VM7A 3RBSA 3ZE0E 4F15C 1HXMA 3F85A 4ODSL 4AQAA 3GXUB 3M1OA 3V5KB 3UBXI 3M6DA 4OCRH 5EUKA 5KBMA 3VWJC 3F7YB 3JWOC 5LBVA 4GKZA 3TT1L 4YHZL 2PTTA 1TLMA 3ZRCC 4TNVF 2FT6A 4BWUA 1UEMA 1DVSA 5HGHB 5HVHC 3E6HB 3QARA 3HBZA 5DJ0B 3RWDA 1BGXH 2CWRA 4OZGB 4XRCA 3N2JA 4JPIB 1N5YL 1LO3H 4LLVB 2AK4B 1I8IB 4FABH 2BS8A 5AAWA 3GMOA 1J8HB 5AQ0A 5GZOC 1WBZA 3QNXB 1JUFA 1B4RA 1V3JA 4K4KA 1X7TA 1AJ7H 1DVUA 2K70A 5T5NF 3CIAA 3A6CL 4L8BA 5HYQA 1RZ7H 4K3GA 1CE1L 1W72B 3Q2NA 4J3OC 4G8FA 4N85A 2RHEA 1FP5A 2BWQA 4KK8D 4F9PC 1JZ2A 5IVZB 1MFEH 3TPKA 2A77H 1AZZC 5GZND 1UM6H 2JVUA 4PRIB 2BMKA 3L48A 3LZFL 1PZ5A 3C60D 2ZOKB 5CINL 2CHDA 2N56A 1K72A 4HIXH 3OPZH 2KZBA 3WS6C 5HHMD 2P7TA 5EU4A 4JFVA 2F5BL 5CCKH 4K9EL 2WAHA 1WQVT 2EINB 2XWBA 3RTLA 5BQ7B 3RNQB 2F18A 4PW3A 4P23D 2VABA 3MRKA 4ZXBA 2EDFA 1K5NB 1Q9WA 1IC1A 4J8QA 3GMQB 5EPMA 4FFZH 2H0PA 4FI6A 5IHUH 3E2HB 4JG0L 2BP3A 4N8UA 3UIZA 3O2DH 2OYMA 4TVPE 4FQJL 2W8CA 5DQDL 3QNYA 4HSCX 1H3GA 3A0OA 3WLBA 4FLHA 4TN9A 4BK8A 3NJGA 2WV3A 5ANMB 1KGCD 3V6OA 3MRJB 5TTRA 3VGHA 2HFTA 3CVHB 2ICWB 2Y72A 5F6IC 1K6QL 3O6FD 3O6KL 5TK2A 1CFMA 2NZ9C 1DJSA 1N19A 1CZ8H 1PNDA 2H3NB 3SDCD 5TGBA 5K9QG 4IBYA 2V5YA 4M61B 2E9JA 1HE7A 4M5YL 4QHNB 4G11A 3M45A 1XBRA 4A68A 4OZ4A 3CBJB 5EWIH 4XVTL 3P3YA 1A3RL 4GI6A 2VMJA 3BEWB 1VGEL 3HE6B 4BZ2L 3HMWL 3VD5A 3CN2A 3QXWA 2XG4B 4XC3H 3NABH 3P2DA 2KT6A 3CQPA 3EJYD 2E8YA 1T89C 2IANA 3FF7A 4WWKC 4OGAC 2W9EL 3DX8B 3QUZC 3WKYA 4FHKA 1MIEL 3HNSH 3LKNA 4ZFGH 3MGAA 4NZUH 1HH9A 3VFOB 4OD2B 5A43C 5BJTA 2Y06H 3TT3L 1YEGH 4TQEH 3EDEA 3QUMH 1H0DB 4XN2A 1J9TA 2MHAB 3TN0A 2X70A 1F90L 2ITFA 1A6VL 4XCEA 2C7FA 2GITB 4QRTA 5MERB 4AVKA 1LK3H 4LCYA 2X4TB 3Q5OA 3VDBA 3BP6B 4KC3B 5GSRA 4ABVA 2CRYA 4JQIH 3WE1A 4AEIH 6PCYA 5F3HA 4GAGH 5KSAB 2WP3O 1UXLA 3ABKB 1VACB 1T5XB 4EKXA 3MRCB 3RX8A 3RIAK 3OR6A 4M1GH 3BP4B 2GY7B 4HOMA 1P4BH 2BSDA 3EH3B 3P4LA 1FZKB 1M2VA 3TA3B 3DRTA 3ORJA 5AVXB 5FA3A 2IALA 3LH9A 2DH2A 1RK0B 2R56H 4I3SL 3S97C 2VRAA 2CAKA 4N20A 2B8OT 1ZE3C 5MEPB 3DO7A 4UIMB 4XAWH 2C9QA 1BYPA 3VGGA 3OJ2C 3UDWA 1KTDB 2ETWA 3BVDB 3FQWB 3MV7D 4ZUWB 1TQWA 2WIMA 2GJ6B 4G6JL 2WTRB 1A7PL 1RZJC 2F5BH 2WYIA 3WHXA 3DSFL 5HJGA 3HN5A 3FH8A 3V10A 2XWDA 4DKTA 1FUNA 3QULB 4OV5A 4O00A 4J6IA 3KPQB 3CSFA 4H25B 2CRMA 5TH2A 3DGGA 2ZXWB 4CVZA 3B3IB 2PW1B 2D0FA 5JW3L 3NN8A 4JE4B 1BAFH 1UB6A 1TQVA 2X0UA 3KWWB 2VXQH 1OF2B 2QSCH 1SJEB 4A2DA 5C97A 1ED3B 1DP0A 1HCYA 3A6CH 3BD3A 1J05B 2YUVA 3JBG7 4FQJH 3D39A 3D34A 4NNXA 3AG1B 1E3ZA 1X5MA 2EDMA 1WAAE 4NQDE 3CLEL 4Y4HD 4OCXH 5EO1A 3FTUA 1GZPB 1KCUH 3VWKD 1JZ8A 1OE3A 1T66D 3P73B 2CO3A 4LFHD 3GUFA 4KDTC 3BAXA 4NN5C 4RX4D 1DVZA 4OIAA 2CK0H 3KAAA 4XXCA 1NKGA 3RJQB 3V4VL 4WI0A 4J1UA 2HN7A 2WOYA 4WO4D 1NCJA 2NY6B 4Y4KC 1M42A 2XTJD 4DGIL 2PPCA 2WXOA 2I9TB 3KPNB 3LEVL 1R3KA 4IEFA 1IT9H 2VXQL 1I4FA 1ODUA 4U1NA 4XPGH 1JPTH 4GXFA 2WZAA 4BXSV 3QI9C 3AJ7A 2PUQT 3ASWA 1W8OA 4GKOA 4UT6L 2CPUA 2GK0A 3PDOA 4M29A 3V6OE 1JK9A 2B14A 3UAJA 5EO9A 3S35L 1ET8A 4CMMB 3ZOAA 3D87B 4FYRA 1C8QA 1A7PH 3OMNB 4WF7A 4N5UA 1A4JB 1A7OH 5C09D 4PRPA 1JP5A 4PRNB 3MV11 5DUJA 4PJAA 3UADA 1GS6X 5TDOB 4Z3JA 2WQAA 5BS0D 4P4KA 2OJEB 3DETC 3WSQH 2OA9A 1U8PB 4XVOA 2PWDA 4N5ED 4PJGB 3CSBA 1GL4B 4X4ZA 3GSWB 1BQSA 1GRWA 3LPFA 3OGCA 3WUWB 4WHDA 5KYUA 3BDXA 2J1KA 1CFVH 3DVNB 2ROXA 3NZ8A 2VL5B 5CO1A 3M86A 5JUEH 4JHUA 3EJZD 3CBKB 3WMSA 1UOLA 5D7LA 3AS0A 2P5EA 2XVBA 3AWGA 4YL4A 5FM8A 3RVXC 1AG0A 2VQ4A 3WFHA 4OFKA 4F20A 4R5TA 5IJKC 3C9NB 2ADGB 4NN6B 3AM8C 5JDSB 3A67L 5L2JB 4W9KC 5E5UB 3B5HA 2JJWA 1FRGH 3FUKA 4CJ0A 3SDCA 2OI9B 1WEJL 3CFDB 4N0CD 4X4MA 4GKSA 1ZA6A 3VTTA 3LD8B 2OP4H 4PJGF 1QUNA 1EMTH 3F3HA 3TF4A 3ILQD 5DMYA 3US0A 3ROLB 4EVNB 5GGVY 4OH2A 3AG4B 2NY1C 1M2OA 4GEIA 1QEXA 4XPAH 3T6VA 3U79A 4Z3FA 5CSBA 1ZGLB 3MGOB 2WN3A 3CVBA 4KRPC 3FCUB 1BEYL 3BUQA 1RULH 3P3UA 4IRZL 1U8JA 3O9WC 4NQCE 4GY4A 2W5PA 4H8VA 3WXWH 3JV6B 4EIBA 4XVTH 1E9PA 1PPIA 3RDTB 2KDGA 4OCSL 1A6ZB 5L4FA 4IOFC 2EUWA 4M5ZL 2C3XA 3C87A 2ITDA 4UV7L 5ADPL 3DBXB 4WSGA 3ULUD 1K6QH 3ULUH 2YIHA 4ZPTB 3UTPD 2YSTA 5D7JB 3X3GH 3LSOB 1KG0B 3WFEL 3F84A 5JHMA 1FC1A 2GJZA 4UT7H 2A74C 3S37X 1RPUA 4AIXA 3JVGA 3TS8A 3LS5L 4X8JB 2GSIB 4RMSA 4ZMVA 3EH1A 1TEFA 2VMCA 1D5XB 3D7PA 3LMJL 4XP6H 5HBBA 1IAOA 3FRPA 2BS9A 3LXAA 4MMZA 4JKNA 4K2UL 4PYHA 3NPSC 1TPXB 3VWKB 2I32A 4MXWH 1BW8A 3N9GH 1L0QA 4HUUA 4MXQD 1GH7A 3AUVA 3MRBA 1OCWL 3ILPB 1KYAA 3KLHD 5IQ9B 3QWOB 1WC7A 2CU9A 4HUWA 2PCYA 1URLA 5ESQB 4MJ5A 1X9RA 4Z7OE 2DWTA 3MXWH 5IBLC 3SGDI 2IDTA 3S7GA 3OZ9H 2Z31B 4Z18A 5JXAL 3VXUA 1JFQL 4HJSA 1D2PA 4DQAA 4RVBA 2Q7YB 1RK7A 3KGRA 1U2CA 1YQ2A 4X9GA 3IJYA 4BZ1A 2N7SA 2WVVB 3ULVL 1EAPB 5ESVA 3RVVD 4J4PC 1L9SA 5E95B 3VFPA 2BRRL 4G82A 1HXMB 5I6KA 3ALPA 2FBJL 1WAPA 3U7WH 2HLFD 2EXSA 2PTTB 2X9ZA 1D9KB 2OSLA 4I77H 5BMFH 2W94A 4DGVH 1FHNA 4DOHB 5IFJA 1NL0H 1HHKB 4ODXB 3O11B 2YKLL 3CPLA 1I7UA 1KV3A 1J5OH 5D70H 1F56A 1Q9OB 1MFDH 4M93C 5L7XH 5AKSA 5JIHA 5AVRB 5IGXH 3RX5A 3V0IA 2J1WA 3DK2A 5CUSH 1KGJA 1PD0A 1HU8A 2O5YL 5DJAA 4AYFA 4FFYL 4WEBL 5AZEH 5SWZB 3UC0L 4XVSL 4L8BB 2Y7NA 2X09A 4LL9A 5K33A 1LL1A 1BX2A 1G6RA 1WLHA 4M7JL 5J6GB 4N2NA 4ZZKA 4FTVA 1CLOH 3MJ6A 4DZ8B 4TUUA 1CFSA 3VRLE 4LCCA 3V4VA 3MMEA 4HX1A 5E7FA 2XNAA 3NJJA 4K3EH 2I5YH 2ZOKA 2ZWNA 1AR1D 1ZTXL 5CP7A 3SO3C 2FD6H 3KPRB 2WO2B 4K7PX 2A73B 1A0QL 1FNGB 1QSFE 2LT9A 3F7VA 2F53A 3L7FA 4XPHH 4AQOA 5GGSA 5BQ7A 1WCBA 2QR0A 2MJWA 2ZD0A 2ZYIA 4WKXA 5HVWA 1SOQA 4QOKE 2NQDA 5HGBA 5I19H 4YDVB 5D1QB 5IMOA 1T1WB 5D93C 3BRGC 1OAKL 2H1PH 1YUHB 2GT9B 1UT1A 3SDXB 5I1EL 1HN1A 1KOAA 5D7IB 3ZE2F 4X80H 1S78D 4Y4KA 5T5FL 3LKSB 5DRNB 3MRJA 3ECWA 5D1XB 1T80A 2CUIA 1JHLL 1JV5A 4IBLT 5LUMA 1YVLA 5TGBB 4GKNB 4TVPL 5EV7A 4F7CB 2BIHA 1QRND 2QVIA 3UROR 2AAAA 2AAVA 1UD4A 5DUMH 3HE6A 1X7QA 3QCVH 1E6OH 4PG2C 4Z7VB 2YQ2A 1KXTA 3LNFA 4GQRA 4JFXB 3IDYC 3PV7A 1T2XA 1DCLA 2D9QB 3S88L 3QUHA 3PRZA 3UG5A 4OD1L 2NY7H 4QXUL 4NX0A 1XF3A 2I9LA 1HEJC 4BEIA 2Y2YA 2DN7A 1VF5C 1HH9B 4LHUA 5GHWH 4YE4H 3RDTD 3BYTA 3UBXA 1WIPA 6PAZA 4H8QA 1U3HC 2XU9A 4XMZA 3OKNB 2O72A 3D4YA 4FXKA 2GTZB 4IIQA 2VWEE 5GISL 5C0DA 5EFIB 3B1TA 2UY7B 3JWOL 4X5LA 1SEBA 1JHLH 4N5EC 4GUOA 2NNRA 5F9WB 4I13B 4RDBA 1N59A 5I1AB 2WO3B 2DYRB 4QRTB 3LY6A 5MERA 4RBPH 4AVHA 3BDYH 4OZIA 4AYDC 4DN4H 3QUMA 1MW1A 2VDLL 4LQFL 5FW7A 1KGWA 5CR8A 2HPTA 3B43A 1CCZA 4LL4A 1A22B 4C4BA 3DA0A 5F0PB 5AKRA 2B1AH 5DVLA 4U0RC 3K81A 3QZWA 3GMLB 4PCSA 1JGUL 2YGQA 5FECA 1FGVL 4HAKA 4PS4H 2KDYA 4WTQA 5HHVH 4ANVA 1FV1A 2XKNB 3W56A 3KLDA 3T4YA 5EEYA 5D5ME 1PKQE 4HMCA 2HJKA 4ADIA 4NYLB 5F0MB 3A24A 4Z7VE 3UPAA 2NUTB 2P44B 2KERA 4D9QD 3Q06A 4L2YA 1GYCA 1B9ZA 2DQCH 1CXKA 1KTDA 2V5SA 3IWUA 3SKMA 4BHUI 2BP8A 1MFAL 4HBQA 2EC9U 3H9YA 5I6MA 2AV7A 1MF2L 4OW6A 4OCNC 1ES0B 2HLAA 5AZUA 5CS7A 4JANA 2VLKB 4Z7UE 5L6YH 3APNA 5FO9B 3ZKMD 5D7HA 1YN6A 2XWXA 3W37A 1P7HL 3B3IA 4WEBH 2DL2A 2E9BA 1U91B 4YHKL 3MODL 1UB6B 3F2LA 2WB1A 3CZNA 3MUGA 5J6SA 3H7LA 4CL7A 1GS8A 4KY1L 1EO7A 3KPOB 3GBNH 3UAJD 1PD6A 2DDQH 4IDLA 3KVDD 1HHGA 3CN0A 3ET9F 1ZLSH 3JVFC 3IDNB 2XLLA 1G94A 1LWHA 1QSFB 4KNQA 1DSFH 4FTVE 3RPBA 2CKBA 3B2DC 4FLQA 5F7NC 1P7QB 5F9OH 4V2BA 2YKKA 1YEKL 2HN7B 2R8SH 2QSTA 1NIFA 5HI5D 1RXLA 4PGZA 3BZ4A 4U1SA 7CGTA 1IC7H 4XE5B 1SXBA 2LTQC 2MQCA 5KSAC 4MXQC 2PMZA 4LCCC 1E4XL 4HCRL 2Y1ZA 1IB5A 5EORL 5T1LA 3IDJB 1TCMA 2F5AH 3EO0B 3MJWA 1HAWA 5DEJA 2FL5A 2YUZA 3VU1A 1T3FB 3KXFA 4FMKA 3QS3A 4YSSA 3PWVA 3MCG1 3B7TA 1U8LB 1F3RB 5F89A 4NERA 3G3LA 4ZUVB 1DJIA 3FFOA 2YA0A 4ZOAA 4OZGF 4Y9CA 5BZDA 3E9TA 4OLVL 4JLRA 2JQAA 2ZX9A 1GY1A 2VLJE 3S35X 4BINA 3FYEB 3V8OA 4HWBH 1A6WH 4LPVA 3BRDA 2J8OA 4MNHB 1JRHH 1UM5L 5C3LD 3V0WH 5I1HH 3CNKA 5DMJB 2QPSA 4OFVA 1AGBA 3R4RA 4FHBD 1MPAH 5FYJU 1EANA 3PY9A 4LVHC 5HDRA 1TCRB 3NCCB 4ZNEA 1KPVB 3OL2A 2VL5A 3L8QA 4M3HA 1T5WA 3EOAB 5GGUB 4KWUA 4O58H 3HRZC 2R1XB 3LDBB 3N0AA 3ULUL 4R7DB 1WFOA 5EN3A 1D6EB 1E5CA 2IG2L 5LKNA 2GEQA 1CK0H 1HWHB 2V2WB 3VRJA 4EN3A 2GFBB 4Z7NB 4ODUB 3NCEB 4Y1SA 5CILL 4OLUH 4HPYL 4BQ9A 3WN6A 3LNHA 1B2WL 1LE5B 3P30H 3U4BL 3EG9A 5JXEC 1VCAA 4X4YA 4PJ7A 5DEGA 1CDUA 2RQ8A 5ITBH 4ZW3A 5CJ8A 3VWJA 1DVQA 2YPLB 4BFEA 1D5RA 2DWXA 1QOKA 3GC3A 3QCVL 4OGXL 4X6DA 3A47A 3ECBB 4HAGA 4TNWK 4EVNA 1AS7A 1NFIA 3HZVA 1V05A 1NPNA 1JFHA 5HYJE 4N8PA 4K3EL 3OKDB 4TVPH 2A99A 3T4AA 3ULSA 3EYOB 1N67A 5IQMA 4JL2A 2NY2D 4U6XA 4PRBA 3GM0A 3VQ2C 3JWNC 4E36A 5T33H 4LVEA 3FNKA 1GOGA 4HWZA 4Y2LA 2X4UA 4NQCA 5HPMA 5TE7H 3EGSB 2ODIA 2Y0SA 1TTRA 4QMEA 1PIGA 2YOCA 4AQZA 1JG9A 5I18H 1ACCA 4X7FC 1OQXA 3TJHC 1I82A 4PAZA 1G7IA 1Z3GL 2VYRE 4HJJH 2GIMA 5DD5H 4DTGL 4MHHG 3K7UA 1FPTH 3HR5B 3ZR5A 3GI9H 1KXQE 4PJIB 1TQCB 5D7JA 3VD2A 2FYYA 3E8UH 4QAMB 1I8UA 5HDBE 3HI1A 1UT9A 2GSIA 1XQ4A 3OKKB 2R0LL 3HC0B 1KLGB 4HHAA 4X6CF 4Y5YA 5D55A 3VFSA 3HBQA 1KYDA 4FP8L 3AADB 5ISZD 4MWFA 3FUDA 3N3EA 2CDGA 4XVJL 2IBGA 1E7UA 3QE5A 2P46B 3LKOB 1N4XH 2MMXA 4N2OA 4RAVA 5BOPA 3BAKA 4JPWH 2Y3NA 4DAGL 3TX4A 2LOEA 4HUWB 4F7TB 5LGJB 1UWFA 3QNFA 4L8DB 4WVRA 4FN0A 4LCWA 5D1XC 3U4KA 3UTTE 3UCRA 2KLRA 1KN2L 1HKLH 3KYNA 3OR7B 4U1GB 3N50A 4O51B 3UAFA 5JTWA 5KN5A 4J27A 5I17A 1O75A 1H6UA 3QUXD 3T0EB 4U3XA 5T1LD 1NPUA 3V7AG 1UURA 1I3GH 1MWAA 2EDLA 3BPOB 3KPTA 3DUHA 1F6LL 4ZTPH 4DK3A 4CVUA 5FOBB 4C56B 1EEQA 3MA9L 4LLYA 5FX3A 1AO7A 3VFPB 3B2UD 5E24E 2PW2A 1MFVA 1U58B 3I3EA 4G43B 1Y0LA 2VLRD 3LIZA 2LU4A 3NJMA 2P45B 1HL5A 2R29A 1OCRB 3H8NA 3ME0A 2OSLB 3T3MF 5FCSH 1OP5H 3RX7A 3L4ZA 5C0BA 4QXGL 3SO3B 2P5WA 1MW0A 3L08A 5E08H 2DQGL 4XODA 4JPQA 2QVTA 5A3ID 4YBQD 1EZVX 1N6VA 4WHYH 3BH8A 1N64H 2UX6A 3JTBA 4AWJC 2J1XA 1NCWH 1NAMA 5FK9A 4UNVA 4LLDA 2CJTA 3OKOB 3SODB 5KVDH 5EF2A 4HXAH 4X8GA 2F8IA 1AE6H 3F7KA 4ZMNA 2I27N 3DX6B 4HEPA 2X6UA 1NIDA 5ABAA 2IH8A 4IKLA 1V7NH 4HZ1A 4QLRA 2I24N 5B7EA 4U1JA 3DSNB 2OK0L 4L1BA 4K23H 1G9HA 1DUYB 4FHJA 4A63A 3NIGB 2XNAB 1AHWA 2O6CA 3L4UA 1FH2A 2LE9A 5CWSA 3DTDA 4KRPD 5CP7B 1E40A 4IJTA 2Y1AA 5EF3A 3UZQB 2CM5A 5FW8A 2FGZA 4X4ME 3FFDB 5CBAA 2FCBA 5JIKA 2OJZH 1GIGL 1UFGA 3ILEA 4Z7IA 1I85C 3C8KA 1IEBA 1M7UA 1RZJL 1G9MC 3GGWB 1E30A 2AEWA 4NI3A 2GBAA 3KPSA 3Q8AA 1AAJA 5D4QA 2W91A 1T4WA 3R06B 3GXNA 3SE8H 4HC1H 4LIQL 3GMRB 4UZGA 4UNIA 3SDXA 3WG7B 1AGEA 2G0LA 4M6NH 4OZHE 3MRDB 5F7WC 3EH2A 4KMLB 2YAHA 4HG4J 3P2BA 3U36B 2HT2D 5KEZA 1CDIA 3ARYA 2VM3A 4JZNB 1J1OL 5C0EB 1Z2KA 1IBDA 3ZE1E 4TPRL 1F0LA 4UAHA 5BW7C 2BSEA 2J57A 3LZOA 4JJOA 3ZT6A 4Q74A 3FUJA 4LCVA 5LWYL 1GZHC 5I28A 2OYPA 4HT1H 3QIBD 5DJ6B 1IQWL 1RERA 3ULVF 1ZJAA 1KXTB 2MCPL 3UDWC 1EDYA 4TSCL 4ZFGL 1FYTA 1KCSH 4NP4H 1MXDA 3CLFH 4JFDB 3KS0H 3QO1B 2F6AA 4M93B 4DK5A 4JG1H 2P8MB 1KGCE 1ND0A 5I1GH 4IGBA 3HE7C 2X1OA 4LSQH 4O2CA 4OCWL 2WXQA 4FXKB 4Y5YC 4A7VA 5C0DB 3B7YA 3O6FC 3L5XH 4OFIA 4GSRA 1N59B 2I07A 2C1OB 5D1QE 4W9ZA 3AS1A 3L5HA 3V79C 4KKRA 1EZLA 4LVOC 4K8RD 4UUJA 3U9UB 4XB7A 1S5HA 2VO8A 3NG5A 3CZUB 1JXGA 2IAND 2YWYA 2X88A 1NIBA 1E65A 3O0RH 5ICXA 1E2WA 3ELAT 3DHPA 4JDVA 1MCCA 4JB9L 3L3HA 3SQOL 4Z7UA 1NC2D 3HS9A 3IRZA 4P2RD 3R7RA 3X13B 2XKNA 4C55A 1AVAA 2PO6C 4Q0XL 4F91B 2J56A 1DBBH 5JPMA 3BE1H 3GBLA 3HHSB 4NYLA 4PS7A 2X4SB 1LNUA 2BHZA 5GGTL 1WDAA 1TQBB 1S6NA 3SB3A 1E0OB 2OMZB 1T2QL 1QATA 2QTVA 1RJYB 1I7ZA 3JYBA 3PF2A 3F7YA 1I1RA 2YD9A 1J0IA 4TULH 5GZOD 3NRFA 1QR1A 2Z64C 4NXSA 3VD7A 1ES0A 2HLAB 3FN3A 4KV5F 1XSOA 1YYLL 3E6HA 1WGOA 1IM9D 2FJSA 4Z7NE 1BQHB 4U3CA 4LSQL 4IKJA 3WNIA 4DIXA 3V4UL 2NNXA 1D3CA 5EC2A 5I16A 1DYZA 3DMMB 2VLRB 1WICA 1N7ML 3V4VH 1SY6L 3CXHJ 4Q9RL 3VXRD 4I18A 3KLKA 4L5FL 5BV7L 3KPLA 1THAA 4O9HL 3NVQA 3KPOA 4HP5A 2LU7A 3DX4A 5AFAA 5HYQB 5ITFA 4NIYE 2AQ1A 3HN8A 4TUOB 1I8MA 2N4IA 3QCTL 5JMOC 1XX9C 3BQVA 1JNLL 2KQNA 1MLCB 2DQUL 5E2JA 4W9IC 2VLJB 1S9KC 1HEZB 1QKZH 1U8MB 2CKBB 2R2EA 5LB1A 2UXVA 3VSUA 5ABZA 5K1NA 2CHNA 3QHTC 4OI7A 3IXTB 1QFHA 2XZAL 4ZJ9A 1R5IA 4LSSH 4Q52A 1A65A 3ETTA 4QF1A 2WKGA 4JQVC 4N4YB 4OZFB 1JZ5A 3AUWB 2R7EB 1UA3A 3JSSA 3RGVC 1LEIB 1PGRB 4E9SA 5CMAA 5IMMA 3BKJH 3RNQA 3SE8L 3QDMD 2EVHA 3AG3B 4LVHB 5CU9A 3P11L 1U3ZA 1TQTA 3NEOA 4Y8DC 1T3FA 3HFML 2G9HB 5IW6A 4KPHL 3JTTB 4NBYB 3QUXC 4IRJB 2J5LB 5AB1A 2DBLL 3SQBB 3TJPA 1QLRA 4ISVB 1UA6H 4OGXH 2DJMA 3TVMC 4OR1A 3CMOH 3ZK0A 3ZMNA 4ODBD 4JLRB 4GAAA 5C07D 3LNDA 4MD0B 2ED7A 3SE9H 1WFTA 1VGEH 3MREB 4NO2A 4G8GA 3QQDA 4PJFF 1OGAA 1P1ZA 4M1GL 1BXXA 4AMKH 3O8XC 1GTFA 2GJ6D 4UANA 4N2KA 4PRAA 3FC8A 5I8CA 4WHCA 1Q1JL 5F7EL 1CU4L 3VXRE 4TLUA 1BFOB 3BH4A 2G5UA 3Q2CA 2IH1B 5JORB 4RMQA 4PJHB 3WAJA 1TCRA 2WXHA 2DQEL 5DZOA 3U0WL 4OLWL 1S2EA 3LKNB 1N64L 2WCPA 2Y23A 1TO4A 3VFOA 4PSPA 1GC1C 3EJTA 2VMEA 2VDML 5CGBA 1A8JH 1JTTA 5BJTB 5KBDA 3ELQA 1RZJH 5HI3C 2R4RH 5A2FA 3HMXL 4G6AD 1SHMA 2WXRA 5D2NE 4OAWA 3N43B 4G71B 3CVDA 3ZBMA 1I8AA 2VERA 1SRDA 2WNKA 3HAEH 4JGNA 1NC2B 3QYMA 2WZPA 4LCYB 3DETD 2X4TA 3C6LB 1FNSL 1NCUA 5EOTA 1W0VA 3QDJD 1N68A 4ABUA 3CFEA 4NENB 5B3JE 2E46A 4LP5A 5CEXA 2GHZA 3MZGB 4E5XG 4ZMZA 3PWPE 2WGXA 4P05A 4HVBA 4ZT1A 1KC5L 1PLGL 1YA5A 3V0HA 3EJSA 2CNZA 4L37A 5AW6B 4BSJA 2VDPB 1CLVA 3ALXA 5C9KA 1AGCA 3PDGA 2B4CH 2JI2A 4HXAL 2MEJB 4HS8L 2D2CC 4WV1C 5EDXA 4KNUA 3OMIB 4UIMA 4A7GA 2WINB 3QK0A 3WXVL 3GHEL 3R4DA 4QTIH 3RY6C 5L9DH 4NAMA 3CZFA 2E86A 4U6VL 1DJYA 2WTRA 1MW3A 3TVMB 1JIBA 2CGRH 4R2GD 5I74B 3PHAA 3QIBB 4L3EA 4ONHB 1P0SE 4GUPB 2Z7YA 3OHXB 3NZSA 3P3RA 2QPUA 4CVZB 5ICZA 2PW1A 3BX7C 4U6YA 3SOTA 2Z8VC 1TEGA 1IJNA 3IETB 3IJ9A 3L5JA 4WFHE 1HQRA 3O8XA 3UFIA 3US9A 2DMBA 4YHKH 2JI3A 4S0HA 4U33A 1SMAA 4YZFE 3NA9H 5EEXA 5B7MA 2YUXA 3B9DA 3PL6B 4KKCD 4OJDH 4L1TA 3BP7A 4GQPH 2K4WA 2EEXA 2CKBH 1OAZL 12E8L 2DEWX 1Q9KA 4PGCA 2VNCA 2QHRL 5LNGA 1G87A 4N1HB 1UQSA 5DGRA 5JQHC 3BW9A 5AW8B 3VXSA 5I6NA 1P6AB 4LLYB 1QPKA 2I9TA 1AO7B 2YPKB 4DZBB 4PLNC 1PSKH 4WK0B 4JFTA 2ALAA 3VG9C 5J6HB 5J89A 3QPQD 2OZ4H 2C9XA 3FB5A 3PDOB 4XMXA 5C2BH 4JQVA 4GKLA 2NNFA 3OJMB 4PVLA 5EO9B 5F44A 4ACTA 4G5ZH 4EAEA 5CZXD 1GGYA 1UZ6F 3PG2A 4EOWL 2ATAA 2D03H 4PVMA 5JHBA 3WMQA 1IKOP 4QRQB 5D6CB 3LB6D 4EPSA 2NUPB 1XDTT 5IQNA 2NQCA 3RP1A 3AVEA 3GLAA 5EZJB 2ZUWA 4AXWB 2H2SD 2WWNA 3L3GA 4Y5VC 5G55A 4EZMA 4PJEF 3QG6B 5TE7L 4NT6B 3MV8A 5E94B 3OD3A 3EYUH 4P06A 3BVXA 3RVXD 2ZAIA 1FFNB 1YECH 4KJQD 4U1JB 3GSWA 3EJRA 7PAZA 2Z7ZA 1AHWB 1TTGA 5CWSB 3LEYH 1IBFA 3CDCA 5KYWA 4EI5B 4EIZC 1Y1DA 3RL2A 3AROA 4F58L 2F61A 2H0FA 3UZQA 4RNRA 2Q3XA 5ISZE 4RFEA 4D7BA 2DV6A 3QDJB 1LE9B 2R4SL 5BUAA 1E5UI 2ZKXA 3ESOA 2Y7MA 4PB0H 3VFTB 1PZA