3W9DA

Structure of human monoclonal antibody e317 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
209
Chain Sequence
VTLKQSGAEVKKPGSSVKVSCTASGGTLRTYGVSWVRQAPGQGLEWLGRTIPLFGKTDYAQKFQGRVTITADKSMDTSFMELTSLTSEDTAVYYCARDLTTLTSYNWWDLWGQGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab heavy chain
publication title Structural basis for the antibody neutralization of herpes simplex virus
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 209
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA01
2VR4A 1MRCH 1S9KC 3L1OL 1U8MB 3JTTA 1EUUA 4X7TB 2I07B 5E00A 3GDBA 1CGVA 4F7CB 4EXKA 1D9KD 4S1SH 1KNOB 3KPQB 3UROR 3I50H 4HAFA 3C5ZA 4Z5RA 5DJAB 4HLZH 3GSVA 1XGPB 1D5BA 3VRLF 4Y4KB 2PYEE 1ZWIB 2BSED 3ROOA 4RZCA 3BGAA 1MAKA 4TVPH 3FB8A 3ECBB 1ADQH 3QB7C 3TIDA 4RNRA 4QO1A 3OR6B 4FQ2H 5CJXC 3BWAA 4ODSH 5INCB 4PJFE 4K9EL 1IC4L 1EO7A 3GSNL 1UJ3A 3E6HA 3O2DL 1TJHL 5FF6B 3HE6A 1SEQL 3DBXB 3CDGB 1TZHB 4KJPC 1IEBA 1OP5K 2X1PA 3RX8A 5IMOB 2Y7QA 2Q7YB 5DEFB 1HIMH 1LE9B 4JFEE 3ARUA 3HG1A 3QSKB 1WWWX 4WI4A 4A6YL 3MOAL 4ZFFB 2CLRB 1G0XA 4YAQA 2QV2A 1F97A 4ZUTA 5C2BH 5SX4I 2BP3A 2FSEB 4JPVH 4FTVA 4K71C 3KLDA 1G9EA 1UA6H 2VSDA 5I9QC 3H3KA 4P59L 2QSCH 4M5YH 3GIVA 3ARFA 4EJ1C 3WKML 2ATKB 3RL2A 2DWDA 4S2SA 5DRXB 1INEH 4MX7B 1MJ7L 3WLBB 1WCBA 2HKFH 5H35B 3EYFA 4X80H 3BZ4B 3BESR 3FO0H 2CRMA 4HCRA 5EZOH 1R3JB 4Y88A 5FGSA 1I1AD 4U1JB 6CGTA 5JHDE 2HG5A 4EKXA 3EFFA 3KS0J 3MLRH 3STZB 4LSVL 4LGSB 1D6EB 4MAUL 3OMZA 4CADA 4FXLA 5GGVL 3DVNA 2E7HA 4RISH 5CBAB 5C08E 1H3PH 2HJKA 5BQ7B 3LVEA 1U0QA 4XNXH 3PWPB 3BKMH 4MWFA 1FBIH 5J9PA 5BVPH 3OAZH 1VFAB 4XC1H 1DANT 3IXTB 3MBXL 5TF1H 4IIQA 3EHBC 5L8KB 1AXTH 1KT2B 2R69L 3MROA 3F7YB 4JM2D 5FK9B 4O02H 4R2GC 5DVOA 5HTSA 4MNQA 2EKSB 5K9OA 1H9VA 1QYGH 4YFDB 5DUPL 3S36L 4LVHB 1GHFH 4KRPC 1T21A 1MVUB 1YEDA 2E6QA 3H9HB 1RZGB 4JFHE 3ULUC 2ZKHL 5D6DA 3S35H 3NIFE 5GZOD 2WZPD 2YXFA 1S7XA 5HYJB 4XP9L 4G43A 5IF0A 3T2PA 1YQVH 2A74A 1JNNH 1IQDB 3QHZL 1DDHB 1BREA 1CDHA 4HUWA 1XR9B 3MRCA 1IGML 4APQC 4G8FA 2NY6C 3SGDI 5DVLA 1A7PL 3VD9A 4XCYB 3MRNB 1JZ7A 1LDSA 3C5JA 4JY6A 3SPVB 3HMWH 5EZIH 1T83A 2DQTH 3CD4A 4ODWB 4FA8A 3EYUL 1Q9OB 1DBMH 3VXSB 4HWZB 5HYQB 1FFRA 1T83C 2EH8H 5JW4R 2P24A 2VDRH 5ISZD 2FH8A 1EFXB 4UV7L 1UZ6F 1EGJH 2P46B 5GIRA 2CLZB 3REVB 2KUTA 1J1PL 3RFZC 1DBAL 5F7NC 2F58L 3RWHB 5F72S 5T3ZD 4X9BA 1LO2L 5JORB 1XR8B 3KPTA 4QEGA 5HPMA 5IFAH 2XZAL 1S7QA 4AQOA 3FB5A 4IEFB 4LEOB 5IMMA 1CZ8H 2AQ3A 4GG8A 4NUJB 3VFRA 3HNVH 4CU6A 3IF1A 4K23L 5IBTL 3VFPB 1RIHL 1K5NB 5IMLB 3E3QC 3GBNH 5BZWB 1M71B 4JPKH 3O4OC 1EAJA 3BUTA 2Z31B 3D2UA 1P1ZB 1A7QH 5I8CA 2EC9T 4Z95L 3ARED 4FFVC 5C0GB 3R1GL 2I9LB 2J6EH 4U7KA 1P69B 4M8QB 1IAIM 1R5VA 5C09D 4Y4FB 1WZMA 3IFOB 5A3IC 2YD2A 3K4AA 2D7TH 2IFFL 5JTWA 2VH5L 1QLRA 1JRHI 2IF7A 3ILPB 5DRNB 4PRPE 3TJHC 2FX8H 3I6KB 1DBKH 5I1DB 5LG1A 4DGVL 1JRHL 5B38A 3MCLH 2H26B 1IGFL 2NPLX 4OKDA 3ARBC 5DQ9A 3BISA 5BV7H 4BQCA 3KPOA 2WUBL 3LKRA 3KJ6H 1FN4A 4LEXL 3B5TA 2BSSA 4HXBL 1J12A 4JO1H 4F7EA 2Y25A 1CE1H 3MGAA 1LO5A 4ONHB 2PYFA 1DN2A 2BCKB 1AD0B 3BIKA 3PQYA 4PJGA 1JNHA 2FGWL 2YD6A 3SDXE 3C08L 1ZT4B 5A2LH 2GK0A 2VUYA 1DUZB 2X89D 4FQCH 3DV6A 4OLWL 5F3BA 1IAKB 2PO6C 1S8DB 4OD2A 2XQBL 4ZO7A 3TBYB 5JO5A 3CC5B 3MLPA 3HA0A 1YA5A 5CIPB 3BHBB 3ARZA 1F3JA 5I1CL 1YEFH 3BDBA 4FQXD 3GM0A 3QWRA 3PWVA 3EYOB 3LMJL 3RDTA 3EO9H 5EDXA 2K1MA 2P5WA 3BQUA 4J1UB 3AXLA 3GK8L 1RQ5A 1T89A 4HIIB 4TUOA 1C5BH 4M1DL 3BQUC 3V2AR 3RL1B 2CRIA 2VOTA 5C0NC 3L95B 4KJYB 5CZVL 3U0TB 5CUSL 5GS0C 4DW2H 3T65B 3G6AA 5M7QA 4MXQD 1JYVA 4QRRE 4MDIA 1MI5E 3FO1A 3UYPA 1K8IB 3QNXB 2VIRB 5DMGC 1QSEB 3V5HA 1T7XA 4U6XA 4DFIA 5D2LB 1CFVL 2VDQL 1JCKA 3NA9L 3O8XD 1I7RA 8FABB 3NACH 1NAKH 5SWSD 5TE7H 1CLYL 2DTML 2OI9B 4FMKA 3GUTB 2VABA 3JVGA 4TULL 5E2WH 2ICWB 2ARJB 4BA8A 4Z7NF 5I15H 5DO2D 5IBUG 1JN6B 1JNJA 1FIGH 3KPNB 3WIFB 4J6RL 3SE4C 1QHPA 3CX5K 1YNLL 5C09A 3U4BH 2OZ4L 1T03L 3QUMH 1HOCA 1TPXB 3SJVB 4PJGF 3KYOA 1G6RB 3HE7A 4JFDD 3V8OA 1YEHH 1IGTA 1AQDA 3I2CH 1NGWA 2D0GA 3G6JA 4HQQL 5C0BD 3FB6A 1RMFH 2X4RB 5IQ9A 1TLKA 1CF8H 2QQLH 2K7PA 4QY8A 3C8KA 1JZ8A 2R23B 4PGBB 3BN9C 5DQDH 4NC0B 2BNRE 3GFUA 1DQDH 2WWMC 3MLXH 4Z77B 1JFQH 3I6LE 3MYZA 4HWBH 4AT6B 2RBLA 4MD5A 1WBXB 1A5FL 4Q9RH 4LU5L 1I7TA 4DGYL 5IEKA 3WHXA 1JF1A 4DEPB 4QOKE 2X89A 5AYUH 3RVWC 3BJLA 1FNGA 4W68A 3G6DL 2LTQC 2W9DL 1FNAA 1NFDB 1P84J 3T3PE 3HC0A 1YN7B 4K94H 2IWGA 2YHGA 4GS7B 3UZVB 3BJ91 5EIVA 4MVBC 1CGWA 3SY0A 3DVIA 3UTTB 4AEEA 1GOFA 5HBBA 3PHQB 5DJYB 3IJHA 5IFHH 4Y2DD 1HN1A 2PW1A 2ADFL 1I3GH 3V4UH 3WO3B 1KB5B 1L7IH 1MFBH 1BIIB 4RFNC 1XGQB 4CAGA 2R15A 1IZJA 2OK0L 3QDGD 5SWZB 3NH7L 2EDEA 1RZ8A 1UFUA 4KAQL 4OI7A 4JDZA 2GJJA 3GMOA 3ARGB 4UINH 5I73B 4R0LB 5GGUA 1EZVY 2AJXH 4KKCD 1N2RB 2VXVH 2AABL 5DEGA 2GITB 3VFSB 4Y8DC 3GNMH 3VFVB 4RGMB 2NY1B 3KPRD 5SWSA 1I1YB 4P4KA 3VXQB 3G6JF 4G6KH 2IBGA 4GSDL 2W38A 4PTUA 1K4CA 4QWWD 1DR9A 3DI2B 3MXWL 1KJ2B 5HI3D 4Y5YA 2FHBA 1DSFH 2NTSP 2VDLH 5T1LA 1FVDA 5DSCA 4PJAB 1IKFL 1P7KB 4AMKH 5M95B 3WFDH 4P23D 3P0YH 1TVBA 4ZTPH 2H1PL 5FYJL 3HC4L 4QHNB 4LNVA 1EFQA 1A6AB 4V2CB 3VI4F 4CUCA 5IHUH 5AYQA 2GUOA 4S10A 1BJ8A 1DVFD 4KHTL 4PRBB 4OUOA 4Y0GA 4ZAKD 4WTZG 1IFHH 5C0RH 3M8OH 4Q6IB 3FMGH 3S35X 1BFVL 3GKWL 4NDMB 4PR5A 2A9MH 2V2TA 1P4IH 3GSNA 4GBXC 3HB3D 3O2DA 5DRWA 1JTPA 3U7WL 1FP5A 5I8KH 3U36A 3NCMA 3RIAF 4JO4H 1RVFH 3CFBA 1RJCA 1AGEB 4H1LG 3QHFH 1LNUA 4JAMA 4GW1A 4M1CC 4HS3A 4EN3D 3DMMC 1UM6L 1F58H 2YWYA 4JRXD 1S9VB 4A6YA 3VXPB 3WSQH 3FONA 2Q87A 3TCLA 5FGBA 1PLGL 3CK0H 1MHCA 3SKJH 3L5HA 2ICWJ 4MNHA 3SE8H 5FYKD 4MXWL 5FOBB 5BO1H 1T3FB 2WQRA 2JB5L 2IG2H 1BD2E 4LIQL 3FRPA 4H20H 3T1WA 4JKMA 3UYOD 1MSPA 4R4NC 4U2ZA 4MA1C 3WNLA 3I9GL 5MP6L 4M93B 4DK6A 4YGVA 3LDBB 4M7JL 1E4XH 4WUUD 4XCNA 8CGTA 2NY2C 5CKAA 2CRZA 4Z7OE 4WUKL 1JK8B 2ATPB 4ZPVA 5IOPA 4YFEA 1UCTA 5DYOA 3F6IA 3VWKA 2UZIH 1MNUL 1WC7B 2OBGA 2A0LD 3TO4B 4EUPA 5JMOC 2P49B 4CDHA 4EQ2A 1L6ZA 3EAKA 2OR9H 3QIUD 1DEEA 4GRLB 5DFVC 4HX1A 2HT3D 4UI2A 1QFPA 3LEVL 3GSOB 2AV7B 3BKCL 1G7PA 5DMYA 1FGVH 1I7UB 1MFAL 4LMQI 4ZFGL 4G8GD 1ZVHA 2AV1A 1X5YA 4NWTL 3KHQA 1JPSH 2VZTA 3QZWG 3NFSH 3LB6D 2F54E 4GQ9H 3ARWA 5FYLL 5HDLA 1QQDB 4TQEH 3BE1L 4JFYA 4K3JL 3H3PH 4Z8FH 2NLJA 3DXAE 3ORJA 5B4MC 5KVGH 5H37H 4XPBH 1OTUC 4PJBB 1U8OB 3SKNA 3QFJB 2BX5A 1TZGH 4HPYH 1FNSH 3SN6N 1DVFA 4J3XA 4ZAKA 3TN0B 1F02I 4LHQB 5E2UH 5BRZB 5B8CB 1BVKB 3MV8D 1JGEB 1I4FA 4PJDB 3NIGE 2FJHB 4TPRL 4PRIA 1F4WH 4OF8A 3A6CH 3GMMA 1K4DA 1KG0B 1Q8MA 2UZYB 3CCHB 3KDMB 4ELMB 5ALBH 4E0RA 2QQKH 3SDCD 1A21A 5L88L 3X14A 4S1DD 1MF2H 1AFVH 4JRXA 2OM5A 3HUJB 1YPZA 3ARTA 5D70H 5ANMB 3RGVA 4XCCH 1U8LA 3RJQB 3QEQB 2JLLA 5I66B 4KUCF 3C9NA 1NBVL 3RGVC 4N0UA 4X7DC 1JHLL 4ZXBB 1UVQA 5T3XD 4XXCA 1Z9SA 3CFEB 4Z7UF 3RI5K 5GZNC 1WZ1L 3D87B 4XXCC 1J5OL 4D9QE 4RGOL 3TNNA 1A3RL 3HZVB 5DT1L 4NZRH 1FJ1B 2DWEA 3I02B 5KJRL 3L5XL 4P2OB 2GT9B 1MLBA 1MRCL 4PJIE 2YA0A 2JCCB 1DBJH 3G08A 1PKQB 3UEZA 2ERJB 5GGQH 5AG8A 4UV4H 1CG9B 2OR7A 3IDYC 3I50L 3P9MB 5EU4B 3U83A 4LL9A 1SEBB 3PDDA 4UNUA 5CD5D 1BX2B 4XNQB 2D2OA 4HKZA 1MPAL 1ZVYA 2X10A 2OS7A 2X4UA 4YIQB 5E6IC 3BGMB 1ADQL 2XXCB 3MRFB 3RTQA 4LAJH 3O4LE 2F8XC 3QWOB 4OKVA 3RTQC 2DJ4A 2ITDB 3B8YA 2DTSA 1TVHA 4KI5E 4D2NA 5J12B 1KXTB 2R2EB 5DGQA 3ZSTA 5LGJA 3RUGA 3CH8A 4MNGB 1MWAH 1U3YA 4P5KB 2FJGA 2HJFB 3LKSA 4ZUVB 4YFLI 5CBEB 1HIML 1EXUA 4ZFZB 3T77B 3HHRB 1YPZF 4HXAH 4BQ9A 5DURB 5HYJE 2ZSWB 3B6SB 3PUCA 4KKNA 2A77H 4LCWD 3W2DH 2FJFB 3D39A 3ARPA 5C2BL 5TQ2H 1W72B 2PXYD 4GRWE 4JPVL 3FFCD 4XBGB 1N59B 3WD5H 1HHHA 4XHJD 5CILH 2QSCL 4M5YL 3NCJH 4PJCE 5I18H 5IEHB 3ES6A 1JPFB 5F21B 3UTQB 3EJYD 1EVTC 4LHUA 3ESVF 5IB1A 3L5WB 1YUHB 1LEIB 3DLQR 5ESVA 1BAFH 2IQ9H 2XKSA 3GSWA 1YDPB 2HLFD 3OKEA 3DROB 3OQ3B 2HKFL 4O5LH 4CW1A 2DQJH 3E6FB 4G80B 2DL2A 4HIXH 3IAPA 3QIBC 2SEBB 1U8JA 3B4NA 4MD4A 1ZHLA 2VERN 3MLRL 2ESVE 1N26A 4KKLD 4L4TA 4QYOA 2WANA 4JJ5B 3FQWA 5DHVB 1WUNT 4NQCE 4XWGH 1V3MA 2VDPH 3RWCA 2DRUA 2X9WA 4YEFA 4Y5XB 2Y06L 1MJUH 4YHLL 4RISL 2W65A 2NNAB 1H3PL 5FM5M 4R3SB 5I2IB 4NQSB 2J88H 3DYPA 4J3OC 5CP7B 4Z7VB 3RUGF 5I8EA 1PD6A 2RIKA 1FBIL 2NY0C 5BVPL 5F9JB 4U1NB 4BK4A 5K9QI 3HZMA 2MHAA 1U8HA 3AAZA 3T0ED 3PV6A 4IRSC 1YY9C 1ZHNB 3QWQB 1AXTL 1M6OB 3CGTA 4U6YA 1Q72H 1CTNA 4LCIL 3P11H 1DTUA 4O02L 5LBSL 4NKDB 3O2WL 2H32H 4R7DA 3C60A 1QYGL 3OKDB 2IMNA 1GHFL 5E9DB 4XVJH 3C60C 3N1PC 4WFFE 2OZ4A 5GRVL 5AD0B 1LEGA 1U3HC 4HIHB 2C7UB 2EE6A 4N0FA 1QA9B 1DFBH 2ZJSL 1YQVL 2HJLB 4ZYKA 3NVQA 1JNNL 3PGFH 4GAJH 4KJWC 3FHQA 5FYJD 4BFIA 5T1KB 3Q3GB 4JZOB 2YD5A 5ERWA 3O11A 2IFGA 1OVZA 2BNQB 4LCWA 3NN8B 4WHDA 2A6JB 4KPHL 1PZ5B 1FFOA 3O3AB 3L6FB 3HMWL 5EZIL 2VWEE 3D3VA 4K8RH 4P3WA 1MRFL 3GZKA 1CE6A 4LVNC 4U6VH 2A38A 4PGCA 4H0GA 2EH8L 4LVOC 3ARXA 1DEDA 1EGJL 3WS6A 1T5WA 2DQUH 4MD0B 3IFLL 1I9IL 3WFEL 1NAMB 1WAAE 2DKSA 3OKOB 4Q7DA 3IGAA 1CXEA 1QG3A 1WFOA 1UWXH 2VAJA 1G7IA 2OQJA 3DURA 3N1GC 3FQNA 3T2NL 1GJIA 1CZ8L 3B9KA 4KY1H 2ICEB 1CICB 2F53D 4HGKC 2AGJL 4PJ5A 1VFBB 3JV4B 4HGWB 5IVXA 2NXYC 4JPKL 1J8HD 3QNYA 1N6QH 4KTDL 2APTA 5SWQA 4ONFH 1A7QL 3FO9B 3PGDA 2AEQL 5A16B 3SQBA 2J6EL 1FQ9C 5EZLA 1K3IA 3QFDA 1XGRA 1G1CA 4YNYB 5B21A 3UTZB 2AJUH 2D7TL 3T0EA 5D71H 1TQBC 3S7GA 4FFWD 4KMQA 3VXRE 2KDGA 3VRIB 4JQXA 1DBKL 4HV8B 4HK3J 4IHOB 5HHMB 3MCLL 5FV2A 3T2QA 4D3CH 1J0JA 5BV7L 3KYMA 3KJ6L 3PF2A 3IU4H 3MLSH 1N0XH 3ILQD 5BJTA 4C56B 4JO1L 4YDLB 1ZHKA 1CE1L 3IDGA 4G3YH 5DD3H 3HPLA 3E8UH 3MGTB 3EOTH 4DGIH 4P5TB 3U1SL 5K9KA 1H3WM 3RKDD 3LPWA 2JJVA 5IG7B 1IT9H 4UNTA 4YHPA 4YX2H 2J8UB 3PP4H 5FGCE 1QSFB 4L8DA 4OZHA 1MHEA 5IHZA 2ZUQB 1AIFB 1A6UH 4RX4D 1YEFL 5T1MA 5JIIA 2FBOJ 3BW9A 3BPOC 3QT2A 2HTKC 4LPYA 1JWMA 2CIIA 3WJJA 2EIZA 3MLUH 3EO9L 4H88H 5ICXB 4X6BA 2A73B 4LBEB 1FSKC 2R56H 4YR6A 3UTTE 2FO4A 5H94A 3WJJC 2I25N 4RAVB 3GJFB 5F7FA 1U8NB 5IVXF 1W0WA 4P49A 3L3IB 2ADGB 4TNWF 1NJ9B 2W60B 5KS9B 4QRPB 2OTUA 2KZWA 2W0LA 3EDKA 3MV9E 2DQGH 3BYTA 2J1KA 1OLLA 3L5IA 1JGVH 4U33A 4POZD 3RWJA 1EK3A 2PTTA 1JYWA 4PPTA 1WGOA 3LH2H 3BEVB 1NAKL 1YY8A 1Z5LA 4N90E 4YHIA 1BBJA 4IDJH 5TE7L 3RZCA 2JF1A 2ZG2A 1JGLL 3MREA 3REWA 5I15L 4L8CA 4MA8H 3S4SG 4EBQH 1FIGL 3D9AH 4A2LA 2AQ2A 2KPNA 3L3JB 3PHOA 3U4BL 1K6QH 2JJUA 4R9HA 3BD4A 5TDOB 1S7VB 1ACZA 4LVEA 2IADB 1FNHA 2DQIH 2PCPA 5EO0B 3C6LC 3H0TA 4TVPD 5ID0B 3I2CL 3L3OA 1PAMA 5E8NA 1RHFA 4XTRC 4ETQB 1RMFL 4OZHF 4EI6B 1AGFB 3CXHK 1CF8L 1TIUA 2QQLL 4K07A 3HKFA 2VAAA 4NBYB 5KSVA 5EBMA 5DVMA 3PABB 3ZLQC 3NABH 4GAGH 5CZXC 1Q9WB 5DQDL 1QVOA 3KNBA 4K7PH 3MLXL 3K7UA 1JFQL 4HWBL 3QI9B 5L2KD 3QDJD 2AJZB 1UWGH 5JW5B 4D9RD 4XNUH 5AYUL 1OQXA 3QJHB 4KJPD 4WHTA 1O7SA 5D93B 1I85A 2IPUG 4DVRH 3ZDYF 3SCMB 1Q94A 2APVA 3EJZC 2D31A 3TPUB 2GJZB 4WW2A 1UH3A 4NQDD 5KG9A 1I3GL 3LN5A 3V4UL 3UP1A 1HE7A 4WW2C 1MFBL 4I18C 3UTSD 3Q6GH 3J8F7 3I3DA 4OLUL 2H45A 4ZS7H 2Z8RA 1ZV5A 5B39G 2DYPD 3FT4B 4X8JB 3FT3B 4GAYA 4R90H 4UINL 1MEXH 5E5MA 3CMGA 2X70B 4GUPB 4OZFB 4PRAA 2FO1A 4XPTH 2BRQA 3GIZH 4Y4HB 1FYHB 2VXVL 4OF5A 3ARDD 5E8DL 2L7JA 4L4VE 3GNML 3U9UA 3P30H 2AK4A 2BVOA 3D18B 3SKOB 1NFIB 2E9WA 4YDVB 1W0VB 5C07E 2R2CA 2LAGB 3OB0H 4P2RE 4G6KL 5EO9A 1LEKB 1RJYA 3KPPA 5F1IB 3QBTB 4NGHH 2GSGA 1SMAA 4QXTA 4JKWA 4X99A 2YC1A 1DSFL 2XWBA 1S7TA 3EOAB 1MJJA 1P7QB 4MS8C 3IKKA 4AMKL 3P40A 5F97E 3FN3A 1EEYA 4M9OA 4R4FH 4HS8H 3WFDL 3P0YL 5E5RB 1IGIH 2BZDA 1S9YA 4ZTPL 2XQYG 1N6UA 4IMLB 1ADQA 4YJZL 4FQJH 2EYSA 4ZUUA 1OP5H 1CVRA 4AENA 4HEME 5IHUL 1NC2D 3BFOA 2AJYL 4Z76B 1HWGB 4E42B 1IFHL 5C0RL 5E4EB 5A2JH 5I6XC 1EEQA 3VXUE 5BXFB 1KPUB 1S7RB 4WW2F 2A9ML 1P4IL 2P5EE 1RZKH 2VKXA 4R2GD 4AIXA 1A1OB 5I8KL 3TH4T 3QDJA 4KRPD 2IBZY 4JO4L 5BRZE 3GSRB 1RVFL 3JTSA 3ULUD 1KACB 3QHFL 3EOBB 4U1LA 3O3DB 4J8RA 4TN9A 4Y19A 5FHAH 1X4XA 1HEZA 2XY1A 3WSQL 5CJOL 1A4JA 2VLJB 4IDLA 1CFBA 3H7BB 1HZHH 4MJ5B 4O2EB 4L9DA 3SKJL 1OB1B 1KGCE 2AXFB 1S7WB 4APQD 1CCZA 4M7KH 2ZPKH 1OGAD 5ANME 3QUXB 2IG2L 3QEQE 4H20L 5ETUA 3RWGB 1WBYA 1E4XI 4M6OH 4O2FB 4U1MB 4DJMA 5JUEH 3JV0A 1HH6A 5IM7A 2Q86A 2ED9A 3AMLA 1E4XL 4NCC1 4I9WE 1K9TA 3VD4A 4JCLA 5IVOA 1QUNA 1C5DA 2JCCE 1DCLA 3UBXI 3FQUA 1QSZA 2UZIL 4L9LA 2LV4A 3ULVE 1AQKH 1TNNA 3MRKB 1NLDL 4OCRH 1JV5B 2D3VA 2FIKA 2EYRB 4U05A 4BSJA 1FGVL 3GJFH 5A2FA 5TF0A 5GRUL 5GGSB 3J7HA 4JFFB 1U36A 1TCRB 1CFNA 3OX8A 3QUZA 5KN5B 5DTFA 2GTZB 1JPSL 2DI9A 4W4OA 4FFVD 3MRHA 2NY7H 3D85D 4D0CA 5ENWB 4TQEL 1XF2B 4Z8FL 1OAQH 3OTTA 1OP3K 1IGJB 4YFLF 5KVGL 4MNGE 1P4LA 1AC0A 2QADC 2EDBA 2H2SC 1RUPH 1RIUL 1TZGL 1FNSL 4HPYL 3QDMD 5BCAA 2EYTB 3B8SA 5E2UL 1BFOA 4HUUB 3TJHD 3UYRL 4OGXL 5LQBH 5EORH 4OSUH 4Y16B 1F4WL 4KK9C 3A6CL 3CXDH 3KWWA 3ARBD 1MREL 4PV9A 3T4AB 1ZTXH 3LN9A 5EUKB 1KLGB 2AXHA 1NGZA 5ALBL 1FFPB 3HCVB 4YDKH 1IILE 1MF2L 1AFVL 3V5KA 3R4DA 5DJDA 5D70L 3T08A 3BDXA 3CLEH 3BPLC 4KVNH 5KVEL 1MFCH 2DJUA 1BVLB 3SDDC 1XGTA 2PO6D 4BZ1H 2FX9H 4LQFL 4L8BA 5T5FH 4DZ8A 5DJZB 1JF5A 4CMMB 3SDAA 4YC2C 4FQIL 1OD9A 1VKXB 4Q6YA 1QFWH 5CMAA 4J3UA 1R5IA 1I7ZA 4NZRL 1EGJA 3QJFB 3LKQB 5D96B 3SDAC 3W0WD 3VD5A 3TBTA 4I0PC 1BGXH 3G9AB 3MUGA 2VLRB 3F5WA 1JUFA 2LU3A 2C3XA 1DBJL 2DI7A 5DR5H 3EZ8A 4IS6B 2E8ZA 3QRFM 2CXKA 2HRPL 1AXSA 3CVHB 1QBBA 4B50A 2HP4A 1U41A 3TEUA 5KSBE 2XZCH 3BYYA 3OZ9H 3EIFA 4PGDB 4LSUH 2VZ3A 4G6AC 3BXNA 4NO0D 4F58H 2XRAH 3L3GA 3PWNB 1MCRA 3VXOA 1G7MB 4LKCA 5JXED 2J6EA 1PYWA 1QR4A 1YMME 3VFUB 5DQJB 5HGDA 3CX5J 4WV1B 3WV0A 1MWAL 3H9SB 2G5BB 4OCWH 1FGNH 1FVEB 4KRMB 4JFQA 1TDQA 1BLNB 5GS2H 2CR6A 3S5LG 1FPTH 3MCKB 4XGZB 5F1NA 4OZGB 1ZA6A 2VJXA 1XIWB 3ALPA 4HXAL 5F1KC 3QDMA 4OCSH 1SBBA 3H42H 3MFFB 3OKKB 5DI8A 2DBLH 3FOMA 1QTYT 1NANI 2UWEA 1VDGA 3MJ9H 4FQ1H 3W2DL 5ABDE 4K7PX 3ROLB 5TQ2L 2WMPA 3NCEB 1PX3A 5D5ME 1ED3A 3ALWA 5CILL 3TFKC 4YGAB 1U8MA 3NCJL 3WJLC 5I18L 3QNZB 4X7TA 1KJ2L 2BNQE 2I07A 4F7CA 3BN9D 2EZ0C 4WWKB 2CXGA 3TWCH 2DIJA 5CEYB 3KPQA 1NSNH 1ZVSB 1BAFL 2IQ9L 4GH7B 4JDVB 4L1HA 5DJAA 1X5JA 2D7OA 4FG6D 3B43A 3RIFK 2ADJB 5DVNA 3RVWD 4O5LL 2DQJL 4ZUWB 5JNYB 3CUPA 4U1HA 4HIXL 4XZUB 3ECBA 4Y4KC 5IK3A 5C9JB 1KULA 2BOBB 5E2VH 1D3CA 3OR6A 4RMUA 4I2XE 4P2YA 2EDXA 2YMXH 1OQOA 2WNGA 3PHSA 1WSST 2VDPL 2LVEA 3VFTB 3B3IB 3PDGA 5FF6A 5IESH 1NCTA 1SVCP 1MJUL 3CDGA 4JG0H 4MB4A 5D1ZC 2Q7YA 5DEFA 3QUYB 1LE9A 2J88L 2DBJA 2FBJH 3P4MB 1C1EH 4AM0A 4ZFFA 2B4CC 5ICZA 3EYQC 3V6ZB 3QQ4A 2FNBA 3MRQA 2DIBA 4NQEB 2FSEA 2PR4H 4M7LH 3TCXA 1NGXB 3ZKMD 4LPXA 1I8KB 3O6ML 4WI2A 1HYSD 1Q72L 2BC4A 1MCPH 3ARVA 3NZHH 5CEZH 2UWEF 2ATKA 3MRBA 3VA2C 3TNMB 4JREB 1FVCA 1T1XB 5JXEA 5F9OL 2VLKE 4H8WH 4POYA 4ZODA 5DRXA 4MX7A 1RZFH 5EU6E 3ZL4H 3Q5YA 3RWDB 4FXKA 4DZBB 5K9QG 4MAYA 5E8EB 3WIHL 4OGAC 4HAGA 2WWKO 4ONOA 1DFBL 4PP1C 3WEXB 4NRYA 3O6FB 2ARJQ 3ARQA 4C56E 3K8KA 2NY3B 2VQTA 5E00B 3MBEC 3STZA 2IBZX 5DLML 4XC3L 4WO4D 4HUVB 1D6EA 1F4XH 1UB5B 3C5ZB 4KJQC 4AIZA 4Z5RB 3W9DA 3AC0A 5CWSA 1RUQH 5KAQF 5CBAA 4K8RL 3ROOB 3LD8B 1MLCB 4U6VL 3FB8B 3DX9B 1MFEL 1R3IH 4GBXD 1VEOA 4N8CH 4QXUH 5BQ7A 2X4SB 3WMSA 1WEJH 4PBWD 1ZE3C 1QPPA 3PWPA 4WY7L 4LPUA 2DQUL 4HULB 4L3EE 4RNRB 1ZLUK 3X13B 3LQMA 4BZYA 2F5BH 5GGSY 1VFAA 3IXTA 3DMMD 3E6HB 1KT2A 3O9WB 4GKOA 4RGNE 1IEBB 2DMCA 1WZKA 4KI5C 2Y7QB 3F7YA 1JYXA 1V7NH 5FK9A 2YRPA 1P9MC 2F9BT 5KS9E 3P73A 3H9HA 1MVUA 1P6AB 1F3DJ 1BHGA 4LVHC 1LO3L 4YAQB 3V6OA 3GMNA 1FYTD 1UQSA 3EO0A 4FTVB 4ZD3H 4OZIB 4HBCH 3U0WH 5F9DC 1IQDA 2LAAA 1FH5H 3AS0A 3GIVB 4PRDA 4R8WH 2XTJE 3MLWH 3CFJA 3RVVC 4JG1L 5MENB 4X83A 1QFUL 5CGTA 2NY2D 2HH0H 4P2QB 2AJUL 3MRNA 5D71L 1R0AH 1SBSH 4GRWH 4UU9B 3SPVA 2YD4A 3EYFB 3ZMRA 3VXSA 1Q9OA 4EI5C 4HWZA 1OPGH 3DI3B 2X7LA 5D1QB 5EOCJ 5C0CE 3ULSB 2BY2A 4D3CL 5I30H 2HG5B 1JMXA 1WJ3A 1PY4A 2CLZA 1MHPH 1WZLA 4U1KB 5DFVD 3REVA 3IU4L 3MLSL 1AO7E 4HD9A 4XPAH 3RWHA 1A1MB 3TV3H 1R5WA 5FEBA 5JORA 3LQAH 1BEYH 2B20A 1XR8A 4G3YL 4CADB 5DD3L 3S3SA 5HHNB 4I4WA 2VLMD 4DGIL 2W59A 2WP3T 1Q38A 2J3SA 2HJKB 4DUXA 5E70A 1HYRC 1WTLA 2EDTA 4J3SA 4LEOA 1U8KB 3U2SA 1D9KB 1A22B 1IT9L 2NYYC 4NUJA 2B5IB 2AEPH 3EJJX 3PP4L 3VFPA 4V1DE 5J9PB 5IBUB 2V2XA 1OT1A 5IMLA 2ORBH 1M71A 5BZWA 1EEZA 4YLQT 1AC6A 4ERSH 1RU9H 5IB2A 4N0YH 2GIYA 2R56L 2Z31C 1UKSA 1SJEA 1UCBH 3BH9B 3MROB 4JO2H 4M8QA 1F3DH 1QEWB 4Y4FA 3IFOA 5J8OA 5E8PB 1MCKA 1UZ8A 2A9NH 4KK5C 1T21B 5EFIB 3MV7D 4Y4FC 3NTCH 3O2VH 2E7LA 2NX5D 5DA4A 3I6KA 3BH8A 3S34L 2WK2A 1KEGH 3AY4A 5I1DA 4G43B 5AAWA 5CCKH 4WI7A 3RY5A 1T1YB 3SBWC 4HUWB 1SYSB 4LCCC 3MRCB 3LH2L 3HNTH 4E41D 3KYKH 4G8FB 1EJOH 5IR1A 4IDJL 1T66D 4M00A 1JPGB 2BCKA 1AD0A 3JXAA 4MA8L 4Z7WB 1A1NB 3AS1A 2HRLA 1DUZA 1FNLA 5EOCH 3GBMH 3S37H 1IAKA 1S8DA 3QQ9C 5EULV 1A7RL 3QXWA 3RWFA 5GIRB 4FQQB 3O3UN 1KV3A 2DQIL 2X4OA 1NBYB 2P4AB 4E9LA 1BIHA 1P7HL 5HPMB 5J6HA 5GGRB 3QO0B 4L5FL 3QISA 1I1AB 1S7QB 2Q76B 5E6ID 3FB5B 4HIIA 3FQXB 4WENB 4GAGL 3C5SA 4UNVA 2XIDA 4K7PL 3VFRB 1AR1D 3L95A 1IM3A 3IF1B 5HHOE 1CFTB 2BVYA 4KTEH 1UWGL 1UEYA 2P42B 4XNUL 1HI6B 1CQKA 4QTHB 4GO6B 1K8IA 4JO3L 3LRGA 1VERA 4I3SL 1QSEA 1WITA 5D2LA 4DVRL 4NM4L 3ZKNC 2VITB 3ZT5A 3F58H 4QHKI 2R4SH 3GUTA 1IKNA 4AEIL 2ICWA 2ARJA 1QLRB 4P2CG 3DARA 2OI9C 4NIKB 3KPNA 3WIFA 1QKZH 4JM2B 3Q6GL 4NBZB 1T80A 3T3MF 5B38B 1IQWH 4JGJA 1IL1B 3CDYA 4S1RH 1H8SA 1KCKA 4ZOEA 3GSQB 3KPOB 3LKRB 3R0NA 4NC1C 1FN4B 4GMTH 5IB5A 3I3BA 4R90L 1MEXL 3HAEH 3FL7A 4F7EB 2XI9A 4UDUA 5FM5O 1LO5B 4XPTL 2PYFB 3BIKB 4QNPE 4NN5B 1GGTA 1IAMA 2X4RA 4PJGB 5J3HD 4KUZH 4PRHD 3QIBD 3P30L 3DV6B 4XCFH 2R23A 4PGBA 5F3BB 2DN7A 1YYML 4NJAL 5JO5B 5CJ5A 5TFSH 2Z0BA 4Z77A 7FABL 1F3JB 1WBXA 3ZKXB 5ACLA 2JJWA 3QPQC 3MCG1 4YHYB 5F7HA 5D4QA 4FABH 5JW4N 3PWVB 5BW7A 4OM1H 4PLOB 1J0ZA 4DEPC 2V5YA 2P5WB 5ISZB 2F74B 4KKBC 1NAML 5BW7C 2DKUA 4R4FL 5LAXA 1WBZA 1D5XB 2FLBT 3PHQA 4GS7C 5DJYA 2HKHH 4TNVF 3TGXA 2NY0D 2HWZH 4FQJL 1KB5A 1YZZA 5D2LF 1I8IB 2NQCA 1BIIA 3L7EB 4IRSD 1ITCA 5DD1H 5F89B 5EOQH 1U42A 4JDTH 1KCRL 2BVQB 3FAWA 3V5HB 4U6XB 4PP2A 3B83A 2F5AL 1RZKL 1INDH 1BZ9B 2BNUA 4MQXC 1NEZG 3ARGA 3RNKA 4JFOB 4XHQA 4R0LA 2I60H 3AGVA 3ARGC 2VABB 3NPZB 5C0AD 4QCIA 5I73C 4PJXA 1U3HD 1N2RA 1D5ZB 1INQB 1T0MB 3AREB 5FHAL 2GITA 3VFSA 3VGEA 4MA3B 2P8MB 3V6FB 3MUJA 1EBAA 1ND0A 2VDOH 5C09B 4KJWD 3SO3B 1I1YA 1HOCB 5DDHB 1M05A 1RIVH 4K8RD 4M7KL 4M5ZH 2ZPKL 2BVTA 1KJ2A 4MB5A 1MY5A 1W8OA 3PE9A 4AK1A 3QZWB 4OT1H 1M7DB 1F42A 4MJ6A 2DQEH 1UKTA 3WFBH 1H3GA 3IT8D 5HHQB 5IQ9B 1DANU 4M6OL 1FE8H 5JUEL 4PJAA 4QY8B 3P9LB 3OF6A 4RQQB 2R2HA 2PYED 3CPLA 4JY4B 4Q74A 1S5IH 4QHNA 3WE6B 3C2AL 5IEKB 2R0ZL 1BQHG 5KANI 1FNGB 1R6VA 1A47A 1AQKL 3HC0B 4M3JA 4PV8B 4Q6IC 1RUKH 1FNEB 1ZANH 4KDVA 4DVBB 2X5PA 3ZTNH 1AGEA 2PW1B 4RMRA 2DLHA 2X4QB 4JFED 4JKLA 1HKLH 1S9VA 1ITBB 2XKUA 3W11C 5EUOA 4WFEE 2NY7L 2MCG1 4PJXF 3S3JA 2YOCA 2X4PA 4JDZB 1U2CA 3GMOB 2DQHL 5FOBA 1A7BA 1RUPL 4NNPH 4KZEH 4LRNH 2WP3O 5DEGB 5LQBL 5EORL 1FL5B 2V6HA 4OSUL 3GMRB 2GJ6E 3O8XB 1SY6L 5CGYC 2OL3H 3WUWA 3CXDL 4UAOB 3WIHA 5TJWK 4M93C 5SWSB 1ZTXL 3WIIH 3QCTH 3VXME 3LDBC 1T5XA 3KXFE 4PTUB 4YDKL 3JWDH 2ZCHH 4JRYE 4PJAF 1T2XA 1JK8A 5JHDD 2NY4C 4Y5YB 1L6XA 2ZZUT 1WC7A 2LQRA 5T1LB 4KVNL 5DSCB 4HUNB 5DZNA 2FX9L 2Y6SD 2DI8A 3ZE1F 1G9NC 2EC9U 2VZVA 3OAYH 5T5FL 3TO4C 4GRLA 4BSVB 4JFDB 4K55A 1QFWI 2FR4B 5C08D 3GSOA 3K74B 5DWUL 2AV7A 4QGYA 2EO1A 1G9NH 5BS0E 3IAQA 2YEZB 4GRLC 4PJ8D 4JN1H 1JI2A 4TRPL 5C0BB 1QFWL 2HT4C 3MYJA 1LO4H 1AKJD 2ZOKA 4X4ZA 5GGRY 4EDWH 2VUOA 1BQUA 1PBYA 1X3DA 4PR5B 1YYLH 2YPLE 3GSNB 3MX0A 1KJ3H 3TBVA 1ERNA 3R0MA 1NGPH 5DR5L 3TJEH 3CVIH 1BOGA 5HVFB 4PJBA 5EUOF 3QFJA 3LKPB 1LNUB 5JMRA 4GW1B 4N9OB 1BVKA 3OZ9L 5CJQL 3DHMA 4LSUL 4PJDA 3TN0C 3O45B 3R8QA 2B8OT 5B8CC 4JFHD 3FONB 2ZG3A 4F58L 1KG0A 4M1GL 2XRAL 3VH8G 3OGOE 1MHCB 3CCHA 4YXKH 2ED8A 3KDMA 4RAHA 5GSRB 4ELMA 4Y2DB 4BH7B 3S37X 4KRLB 5D7SL 1PEWA 1E6OH 3IETA 1YC7A 1ZEAH 1EUTA 2FATH 3HUJA 4P9MH 3RPKA 3QDGB 1VHPA 4OCWL 1FGNL 4TUJB 4Y89A 1T2QH 3DSFH 2E9JA 2R4RH 4ZXBA 1FPTL 1GC1H 4WEBL 5FKAB 3CFEA 1DBBH 4ODTH 4ZXBC 4OCSL 5TGBB 2W91A 3C6LD 4BFEA 1FJ1A 3MJ9L 4FQ1L 4ZPVB 3I02A 5HY9A 2V9RA 4H1LH 5DYOB 3VWKB 3SKMB 4Z7UB 4MQTB 4WGVB 4RFOH 3KPRB 4EUPB 4P2OC 1PKQA 7CGTA 3QAZB 2ICES 4Q9QH 1FV1A 5EIQA 3GI8H 1DEEB 1NSNL 1FL3B 2BHZA 2CDFA 3K2UH 4PG2C 3T2OA 4EIGB 2ERJC 4DKEH 1G7PB 3P9MA 3RWEB 5EU4A 3ULVC 4J7RA 1UH2A 1SEBA 1TTUA 5ALCH 1BX2A 5T3ZH 4NWUH 3MO1B 1DE4B 4PJBF 5EPMB 3MRFA 1ZXQA 4XMLL 4P23B 5IVNA 1Z3GH 1H8OA 5E2VL 3IDJA 2NLJB 5L8JB 4PJDF 2FEDC 3KGRA 5J11C 2R8SH 4XMPL 4LHUG 4XVTH 2YMXL 4OLVH 5JHLH 4PGJA 1DVFB 4ZAKB 5F71A 1J0IA 5J12C 5IESL 4NQXA 4P5KA 5IIEB 2DLFH 4JG0L 2CD0A 3TBWB 4ELMF 2HJFA 3U7YH 5E99H 1I4FB 4ZUVA 3HG1E 2Y36L 3F6LA 5CBEA 2V7HA 2A83A 3BP5A 2XA3A 2FBJL 3T77A 1K4DB 3HUJF 1PFCA 1YN6A 4PRPD 4ZS6C 5TQ0L 15C8H 3FTGB 4E0RB 1OAKH 1QLEH 2ZSWA 3WXWH 3B6SA 3BPCB 4EN3B 2GW5A 4GG6E 3VFMB 3X14B 1NDGA 4JRXB 3RY6A 3UJJH 1W72A 4M7LL 5E7FA 1GAFH 3DO7B 4M6MH 1IAIH 4XCEB 5C6TL 2E27H 3OBAA 3UTQA 1MCPL 3BEWB 3C9NB 5CEZL 5T33H 4N0UB 2EDOA 4NCC2 1OM3L 4D94A 3S98A 4QRSB 1N7ML 1FO0H 4PLKD 1YDPA 4H8WL 3DROA 3T4YA 1RZFL 3GBLA 1OCWL 3ZL4L 3E6FA 4G80A 2DWEB 5C2UB 1KCSH 2SEBA 4OV6F 4MS8D 5KSAC 2O93L 4I77H 2NZ9C 5FM8A 1UZ6E 4TTDC 4F3FB 4JJ5A 1AGDB 4FP8H 1PVHA 2FL5B 4ZOCA 1F4XL 2ZP0T 2DQFA 3JV5A 4Y5XC 4XRCB 5E7BA 4NJ9H 5I2IA 4FHBD 1R3IL 4QXUL 4Z7VA 3QIUB 1WEJL 4QRRD 2VXTH 1RI8A 1TENA 1MI5D 4OKVB 2A2QT 4KK6C 5F9JA 2Z8WC 4U1NA 2F5BL 3OKNB 5MEOA 4G8GB 1KF9B 1DQMH 5LGJB 3RUGB 2BMKB 2C5DC 2DQCL 3VGDA 1GGYA 5K9JH 1M6OA 2FJGB 4MNQE 2K7QA 3LKSB 3HRZB 4D8PA 4OAWA 1T22B 5HYFA 1V7NL 5CLWA 1V7MH 3OKDA 5E9DA 3NIFF 1FG2A 1VFUA 2FLRT 5AD0A 3BRDA 3RIAK 3MV8B 2CK0L 4HIHA 2C7UA 3D39B 1QA9A 1RZIA 5E24E 3MMEB 4HBCL 2HJLA 1DQQB 3TIEB 1HHHB 1FH5L 3OKLA 1CGSH 4R8WL 4LSQH 3MLWL 2E8YA 5IB1B 1A6VL 5GHWH 1X4YA 3CDCA 2RCSH 4DN3L 3OKEB 1EMTH 2A6JA 3TP4A 3QXUA 3DETC 3L6FA 35C8H 2JELH 2BNRD 1ZHBB 4CW1B 1P6FA 4RRPA 4M6NH 1IGYB 4PUBH 4CDGC 1JPST 3T04D 1U8JB 1U2HA 4QOKD 5I30L 1E4KA 1ZHLB 4MD0A 1MHPL 1WFUA 4XPAL 1NAMA 4L4TB 1QBLH 3TV3L 1BEYL 3RWCB 2Q8BH 1EVUA 1IC7H 1KFAL 1X6LA 4Z7VF 4IMKC 3HS0A 3OKOA 3KLHC 4YPGA 3CVHL 3UTPE 3UO1L 3E3QE 3O6KH 2I27N 3JWOH 2ICEA 1CICA 5HVHC 1IJ9A 2AEPL 4O9HH 1VFBA 5JZ7C 5MEQA 1CICC 4HUMB 3JV4A 4HGWA 4PJHA 2ORBL 3QCVH 3HZMB 2MHAB 3AAZB 3S88H 3PV6B 1B6DA 2HVJA 4ERSL 4N0YL 3BMVA 4XX1E 5A16A 4KK9D 1UCBL 2B1AH 1UXWA 1NKOA 3CU7A 1XGYL 3GEWB 3IDNA 5GS1A 2A9NL 1A64A 4LLQA 3NTCL 1Q9KB 3O2VL 4EQ3A 4ZNEA 3QIWD 1LEGB 4NUGH 4Z7NE 1KEGL 3IVKB 4HV8A 4N0FB 3F7QA 4NKMB 4BFGA 4ZYKB 5CCKL 3SDDD 2WBJC 3LRHA 2XWTA 1X5FA 4U1SB 3HNTL 5ERWB 3KYKL 3O11B 3PQYE 3IYLW 1EJOL 1K2DA 4PJGE 4LCWB 5FUZL 3HI6H 5BMFH 4I8DA 3FFCB 3TESA 1FFOB 4YDLC 3D3VB 4N0RA 4F2MB 1CE6B 4S0TD 4P5TA 4PGCB 4Y7MA 2K3TA 3S37L 5L2JA 5IG7A 2MQ0A 4X8XA 5FAAA 3PWUA 3MLTA 5GGVY 4HUXB 1BQSA 1QSFA 1I9JH 3P4LA 1AIFA 1WCQA 3DX7A 2P5WE 1F6AB 2ZUQC 2FYYB 2QSQA 4GKNB 2A73A 4LBEA 3NBNA 4G6AD 2YK1H 5T5NF 5CD3B 4P0DA 4RDQG 4RAVA 3GJFA 1WFTA 4X98B 1G7IB 2OQJB 3S96A 1U8NA 4PJHF 1UACH 1VEMA 3FQNB 3B9KB 1VB9A 4NKOB 4G6MH 1CGYA 5J0BA 4PJ5B 4QRPA 4KTEL 4R96A 1G7JB 5CSZA 4FZEL 2WLZA 1IEAA 3QNYB 3NPSB 2QHRH 4L8SB 3VWJD 1BD2D 4JEGB 4LLMA 5I1GH 2CSPA 1XGRB 4OB5L 1RUMH 3BEVA 3F58L 1NL0H 3K4ZA 2R4SL 2HFFB 1SY6A 3T0EB 5ADOH 4JHAH 2X1WL 3SE9H 4NNYB 5EO1A 5I1JH 3BP6B 1CT8B 5HPOA 3ZO0A 5DUBA 2MSPA 1QKZL 5JQ6H 1D6VL 3T8XA 1H15B 2ZCLH 5DD5L 1HQ4A 3ISWA 3NMEA 5DGRA 3DJ9A 4S1RL 4UIMB 1S7VA 4GMTL 4X4MA 2J4WH 2IADA 3G6JE 3QIWA 4GT7A 4N5ED 4LQ1A 5EO0A 5ID0A 1RULH 1ZHKB 3IDGB 4K7FB 5FDYA 4PJ7B 4U4BA 4MSWB 1EO5A 2R0LH 1ORSB 1MIEH 4Y4KD 5D7KE 4PIRF 4KUZL 3PABA 4UB0H 4XCFL 1CDBA 4YHPB 4HGMA 4JPWH 1DP0A 4KQ3H 5TFSL 1U93B 4L8DB 5EU7E 1VGKA 2F54D 1RURH 1G9MH 1X6NA 1Z0NA 2AJZA 4YUEH 5JW5A 3QI9C 3GB7B 5C0IB 1B6UA 3DXAD 3T0VA 2CIIB 3T3PF 3VI4E 1F2QA 5D1ZD 4FRWA 2W0PA 2FO4B 3WLWC 2ICCA 2AI0L 5HI4D 3MV01 3GSUA 5D93C 3R06B 1A9EB 1I1CA 3TPUA 1W0WB 1MCDA 2GJZA 5C3LD 3SCMC 2HKHL 4D9LH 1A4KA 3EYQD 1ZMYA 2G2RB 1N5YH 2OTUB 3ZE2F 5GGTH 5DD1L 4YHKL 5FA4A 4QF1A 4J4PA 4JDTL 1Q0YH 4GOSA 1R3KB 3LHPH 1WLHA 4UQ3A 2ZUVA 3RWJB 4Z6AT 2F53B 4HK0B 2DS4A 4UDTB 4NM8H 4PJ9D 1INDL 4X8JA 3FT3A 1W0YT 1TJIH 3JV6B 1YY8B 4YHIB 3RZCB 4JRWA 2I60L 1J8HB 4NSKB 3REWB 2NY5L 2Y23A 3QQ3B 4AG4H 2VZSA 3VWJA 3ZDXE 4WTWA 4HIJB 3D18A 3K4DA 1MIMH 4OBRA 4Y4HC 5EH1A 2VDOL 3SKOA 1NFIA 4D9QD 3MJ9A 3PHOB 1W0VA 3GRWH 3FO2B 3MBED 1TQCC 2YZ1A 1LEKA 5F1IA 5MERB 5KVFH 4M5ZL 4KJQD 4HJ0C 2PCPB 2YSSA 4F7PB 3L9RA 5DFTA 4ISVA 2C1PA 5FB8A 5I16A 2XN9A 2DQEL 2N1KA 5E8NB 4LASH 1JZ3A 3EOAA 3MQIA 1P7QA 2JJTC 1BM3H 5MEPB 4PBVC 5A2IH 2RFXB 1QVOB 4HJGB 2CKNA 1S5IL 3LS5H 1YNKH 1W8NA 5F96H 4X6CE 1Y0LA 2GTWA 1LD9B 3O4LD 4D0BB 4LKXA 4NZDA 4X6EB 3IB4A 1KPUA 1S7RA 4KI5D 4N1CA 2P44B 1YEIH 5E4EC 5IFJA 1RUKL 4Q9BA 1A1OA 1ZANL 2OTWB 4WRLA 4WW1B 2D31B 3GSRA 4RBPK 3ZTNL 4KQ4H 5SV3A 2FX7H 1HCVA 3FRUB 1NEUA 3EOBA 3BAEH 1I3VA 1KPVB 3O3DA 3UC0H 1N0LA 5HYJD 3QUKB 2V5RA 2VLJA 3H7BA 3RVVD 1S7WA 4JKKA 3HN3A 4U1GB 3T0AA 5E5MB 5F7UA 3QUXA 2WM0A 4NNPL 1U6AH 4JR9L 2R0KH 1YJDL 3RWGA 4NKQB 1XF4B 4OGYL 4LRNL 4EI5D 4U1MA 1V3JA 3FQRB 3U9UB 1A6WL 4KZDH 2OL3L 1MQKL 3R8BB 2ZWLT 1OOAA 3QCTL 4RMSA 5DD0H 2B39A 3V0VB 5MHSE 5EO9B 4Z7OF 2I5YL 2GSGB 5CGMA 4QXTB 4DOHB 2APXA 3MOBH 5C0DB 2ZCKH 1YEGH 2YC1B 4WI8A 4UQ2A 1S7TB 2HMID 3WNKA 1MJJB 1ZLUH 4NQCD 5DS8A 1DL7H 1JV5A 2APFA 4ODUB 2EYRA 3CFDB 5FKPA 1S9YB 1G7QB 3SGJA 5GGSA 5EIIA 4JN1L 4ZUUB 1TCRA 4P46A 3DOSA 2L7UA 4LNRA 1LO4L 5KN5A 3SGJC 1P5VA 2GTZA 5LVEA 4EDWL 4ZO9A 1NCAL 3S5LB 5ENWA 5FCUH 1YYLL 3P3YA 2I9TB 1XMWA 5J6GB 1NGPL 3TJEL 2VN7A 4O51A 3CVIL 5MI0B 3QDJB 3AS2A 4KK5D 5L2KB 2EYTA 1LHZA 2O5XH 4CKVX 4F57H 2CLVA 4HUUA 4PRIE 4U1LB 3LPGA 3NIGF 1H3XA 4KH2A 4J8RB 4M43H 4Y19B 1ZGLA 2LFGA 1HEZB 3OXRB 2X9YA 1UXSA 4QRUB 4WFFD 1A4JB 4UBDC 2BY1A 2IPTH 3T4AA 2RHEA 4Y16C 4YXKL 5EUKA 5JXAL 1KLGA 4MQSB 3HCVA 1YPZE 4XPGH 1LO0L 1E6OL 2J12B 1ZEAL 3DGGA 2FATL 4P9ML 4TNWK 1OAUH 3FT2A 4FNLH 2P43B 2M1KA 4NRXB 3UTSB 1I8MB 5ETUB 1C8PA 4J2XA 1C12B 3KYNB 1YEEH 1A6ZB 1BVLA 1T2QL 3BWUC 3K1DA 1HH6B 5IM7B 2FZ3B 2R4RL 3Q48A 1CVSC 2Q86B 4KHXH 5DJZA 4F7TA 4CMMA 5DHYA 1DBBL 4ODTL 5IW1B 4JZJB 1LVEA 1VKXA 2W9EL 1YMHB 3ARDB 2GK2A 1C5DB 2VLRA 3O41B 4L9LB 4PB0H 5D96C 4X6DE 4RFOL 5F6HI 2MKLC 4QHMB 4MCYB 4Q9QL 3TZVA 1NCWH 4OFYA 3CVHA 2FIKB 2G9HB 3K2UL 2XKNB 1WV7T 1JGUL 1SQ2N 2ESVA 1CFNB 2NCMA 4C83A 5ALCL 5T3ZL 5DTFB 4NWUL 3X12A 2H6PA 1I1FA 4KWUA 1NCNA 1BBDH 3PWNA 1Z3GL 3RUGE 3X3GH 3THMH 2R8SL 4XVTL 1OP9A 3UPRA 4LCYB 1C08A 1NC2B 5DQJA 5F8RC 4WV1A 1BFOB 3H9SA 2DLFL 1FVEA 4XPFH 3BZFB 1OTSD 1N6VA 5E99L 4NFBA 4WV1C 3NIDF 3IJSB 4OZGA 3VXRD 4KRPB 3HLAB 1XIWA 4ZSOA 3V0WH 1NGZB 3MFFA 3F12B 3D39E 3PWJA 1J0KA 1OAKL 1G6VK 1IAII 4MA7H 4X9GA 4U1IA 3FB7A 4YPJA 3RWIB 4LOUD 3C2SA 3UJJL 5DJDB 1GAFL 5K93A 4MQ7B 1IAIL 4LSTL 5E1AA 3OR7A 3QNZA 3V4VH 1XGTB 5ELIA 5I1HH 5T33L 4L8BB 4WWKA 5D9SB 2BHUA 4WU5A 1UKQA 1OGAB 1H5BA 1FO0L 4X5WB 3BN3B 4JDVA 2H3NB 4ZTOL 4PRHE 4B7LA 1FZJA 3QPQD 4X7FC 1ZGLP 1MCWW 2IBBA 1H0DA 5CMAB 1R5IB 1EHLL 5JNYA 1BECA 1FZKB 1CFQA 1UM5L 5TDNB 1KCSL 2G75B 4FQLH 2BOBA 4L4TE 2VLLA 3DPBA 4I77L 3RRQA 3UTTD 4X6FB 4P9HC 4J3TA 3B3IA 4KDTA 3KPSE 1JHTA 1IVLA 1KTLA 1OTTC 4G42A 4B5EA 1MJ8H 3DUHA 2IALB 1WAAA 5HGAA 3QUYA 4NJ9L 3BKYH 1FC2D 5K59E 3QDAA 3QUYC 3MV9D 4MQXD 2YD9A 4NHUA 2IANE 3VXOB 4B0MM 3PDOA 1X5AA 4DN4H 3V6ZA 4LKCB 4NFDA 4NQEA 1X5HA 4KROC 4U3HA 5HGDB 2Y4SA 4I0KA 1I8KA 3D85B 4N90D 1YECH 4JFQB 1GSMA 2LE9A 1EV2E 5F1NB 1ZA6B 1T1XA 5J13B 3KPLA 3QDMB 4JREC 3CJJA 4F9PC 1AJ7L 3FOMB 5E8EA 4YQXH 1XFPA 2UWEB 1MCJA 5BV7B 1AI1L 4BM7A 4LAQL 3UPCA 2D9QB 3SDYH 2EXWC 3BDYH 5JOEA 2UY7A 4CVXB 3P4NB 4KVCL 3DTXB 1ED3B 1R3HB 3ARBB 3EFDH 3O6FA 1DQJA 4NHCH 3TA3D 4LSQL 2ZOLB 1L7TH 3O6FC 3MR9B 2EE2A 5GHWL 4HUVA 2RCSL 3D3VE 1Y6KR 1UB5A 2DL9A 4Y1AA 1EMTL 3N9GH 2VE6A 3VMNA 35C8L 2JELL 3C5ZC 1RZJC 3TYFA 1MLCA 4GMSH 1T04A 3CUPB 3KVQA 3DX9A 4M6NL 4U1HB 5IK3B 2OSLA 2X4SA 3PGCA 4BSWA 5DK3A 1WFNA 2YRLA 1CK0H 3X13A 1FRGL 1OGTB 5EG6C 1CLCA 1WAAF 3MV11 2CGRH 1QBLL 4HFWB 4NQTA 2HT2C 5C6PB 2Q8BL 2X9XA 2AQ1A 3BT2H 1JL8A 3O9WA 1UJ3C 4WTXA 1S7SB 3HE6C 3O9WC 3O6KL 2JE8A 3JWOL 4G9FA 1DLFH 3ZE0F 1GL4B 1T7YA 4O9HL 5IVXE 4AM0B 2VXSH 2ZG1A 4F15B 5ICZB 4LDEB 3H2WA 3CSBA 3QQ4B 2C1OA 1I3RA 3MRQB 3QCVL 2IGFH 5CSGA 1PW3A 3S88L 4OZIA 4CBPA 1QRNA 3OG4B 3OXSA 4LF3A 4OQ1A 2VDMH 2BC4B 5CGYD 5DRZB 3RI5F 5F44A 1U8QB 4G6FB 3MRBB 5E6YA 3U79A 4PG9A 1FVCB 3ARFC 2NY5C 5MENA 4L4VD 4P2QA 4HKJA 1GGIL 1GPOL 5EWIL 1Z0MA 2VDNL 4UU9A 4ZFOL 4PBXA 3QUMB 2NY4D 4FXKB 5C07D 2YBRB 4MAYB 4NUGL 4RIRB 4P2RD 3F7VB 1MRDH 5I1AB 2KL6A 5D1QA 3NCFB 4NRYB 3ULSA 1HXMA 5AEAA 3TO4D 5D1QC 1SM3H 4U1KA 1A7OH 1NMBH 1HNFA 3LN4B 1A1MA 4FZ8H 1MCSA 4AIZB 4TSAH 3HI6L 2OYPA 5HHNA 5BMFL 2HT4D 2EIBA 3W9DB 5CWSB 3I75B 3RVTC 4I1NB 2VL4A 3KLAB 4G5ZH 2IMMA 4F37F 1U8KA 1ZT1B 1LE5A 1D9KA 1KSRA 4H25B 4OZHE 3Q6FB 4F80A 1P2CB 5BVJA 2Z9TA 1D9KC 1ZLSH 4AL8H 2B5IC 3VXUD 2ZUSA 1CI5A 3VFWA 2P5ED 5JLZA 3H9YA 3TN0D 5BRZD 4IIQC 3BH9A 1NQBA 3BPNB 1QEWA 2EDRA 1UACL 2O5YH 5E8PA 3P73B 5HI5D 4OZIF 4NT6B 3ZDYE 5EFIA 1MCCA 5I71C 2GQHA 1KYOK 2BY3A 4XWOD 1J86A 1EA9C 1Q0XH 1TMCB 1KGCD 3GMNB 1UQSB 5D6DC 4EVNB 3ULUH 4XAKE 3EO0B 1T1YA 3QEQD 3EZJB 4PRDB 1OLZA 3MODH 4C54A 4HJJH 2BVPA 3CFJB 5I1GL 1SYSA 5EZJA 1CGTA 2H8PB 4LLVB 3VW3H 4GKZA 3VGGA 1PSKH 3EYVB 3WKNA 3IRZA 2A6IA 1JPGA 2OL3A 1WVZA 4JHAL 1X7QB 3GMQA 3SE9L 5FYKL 4Z7WA 1A1NA 1CDIA 4I9WD 5GRZA 2AJVH 4G8EA 5GRVK 4HPOH 2X7LB 1CGUA 2QSVA 5AZEH 4XNYH 1FORH 4FQQA 1MUJA 2J4WL 3ULVD 3M17B 1R5WB 1NBYA 4ZQKB 5D7IB 1WT5A 4KTYA 4I4WB 3ZTJG 3AM8A 5GGRA 4PLJD 2BOCB 2R0LL 3QO0A 4PJEB 1I1AA 1MIEL 2Q76A 1NDMA 4Z18A 3FQXA 1NEZB 3U2SB 1I1AC 3HAEG 5FYLE 4JPWL 4I5BA 4KQ3L 4R7NB 4WO4B 5IKCB 3JZ7A 4I3RH 1CFTA 3GHEL 3DX8A 1RURL 1G9ML 2V2XB 4U0QB 4LSRL 4XVSH 5CP3A 4PY7A 1EEZB 1HI6A 2DKMA 4QTHA 3WHE1 1C16A 2MJWA 4GBXB 5IB2B 4M7LT 2YKLH 5D2NB 4IBLT 4JHZA 1SJEB 3KYAA 3EO1A 5CSBA 2VITA 2P5EA 1UZ8B 4D9LL 1J0YA 3BGFC 3DMMB 3V7AE 2MTPA 5F9AC 3FFDA 4LCUA 4OFPA 1PDKA 5D7LE 5I17A 3BH8B 4JM2A 1Q0YL 3X11B 3LHPL 1IL1A 1IM9D 1WK0A 4JM2C 5HDBF 2MCPH 3GSQA 4OTXH 1OAZH 4Z7WF 2WSKA 1TJIL 1G7LB 4ODXA 5DMKA 5IR1B 1LK2A 3F7RA 1OF2B 4K3EH 1BQHB 4U6HA 4WTZA 5JW4Q 2DB8A 2AK4E 3QG6B 4YDIH 4AG4L 4W4NA 2FHCA 3W82A 1HDMA 5FO8A 2O5ZH 3D1MC 4NN5C 5KSAD 3TBSB 2N56A 3GRWL 3D0VA 4XNMA 2NZ9D 2NY2B 4H1LA 4DOHE 3RWFB 4HW6A 2YN5A 1NLBH 5KVFL 4UUJB 1FDLH 3PIQA 2X4OB 5T3XL 3UBXB 12E8H 1TJGH 2C4XA 5EU5B 4OJFL 3MACH 5ISZA 4LASL 5J6HB 2F74A 3RDTC 4OD3L 5ID1B 5FA3B 3C5SB 1D5XA 3WCYA 4MJIE 1T89C 1J10A 4KRNA 3LS5L 1IM3B 2J2ZA 5EBLB 1YNKL 3V9FA 1I8IA 3OV6A 5F96L 4Q9CA 1FAKT 3L7EA 5F89A 1CFSB 5GS0H 1TETH 3N1MC 2BVQA 3STBA 5FYJU 1MFNA 5J7CC 1NBQA 1U9KA 3BSZH 1YEIL 1YMMD 2EC8A 1BZ9A 2NW2B 4OCNC 4JFOA 2J7LA 3ZYJA 2GFBA 4JM2F 1IZKA 2FX7L 1O0VA 4XP6H 5C9KA 3MA7A 4ALAH 1TCMA 3BAEL 1D5ZA 1INQA 1H3TA 1T0MA 2CQVA 1J88A 2FECI 3AREA 3UC0L 3JVGC 4MA3A 2P8MA 3V6FA 3MRDB 4F9LA 3QH3B 5ECJE 4F9LC 1GCFA 1T7ZA 1FZMB 4OF6A 5DDHA 2BY0A 4UT6L 3MV7B 1P4BL 5IB5B 1CR9L 3BX7C 1J87A 2XZZA 3FCTA 2BNQD 3DETD 1U6AL 3QZWA 1HHJB 3HE7C 1M7DA 3A6BH 4UDUB 2ARWA 3TH3T 3VFNB 1FO0A 5HHQA 1HCFX 1ZA3A 4QRTB 2MKWA 3CNKA 3P9LA 4RQQA 4ZUSB 5A43C 4KZDL 2LU7A 3BOVA 4E41B 1CL7H 5IWLA 4JY4A 2FB4L 4G7YH 2VL5B 5DD0L 5DJ6A 5IWLC 1LMKA 4FFYL 1AE6H 3WE6A 5DMIH 1PG7H 2UVEA 4NO2A 3MOBL 1UEMA 2ZCKL 3RHWF 5EU7C 3VH8B 5IJVB 5EN2A 4PV8A 1LDPH 1FNEA 3HMXL 3V0AC 1BQLH 1DL7L 2DF3A 5LAXB 4DVBA 1WBZB 5F6IB 3QCUH 2OP4H 4FQXA 43CAB 1B9ZA 2JK5A 5JZ7D 3TYGH 4PFEA 2R0WL 2X4QA 4RSVA 3CFKA 1G1YA 3OSKA 3ZKQD 4YBLB 5E6IB 4OGZA 3RQ3A 2NMSA 5KSBA 5B3JE 5FCUL 4HWEH 4DTGH 4YK4B 4PP2B 1LP9E 1JGDA 2D0HA 1MWAB 2BNUB 2M8XA 3RNKB 4N9GB 1D5IH 1OSPL 3GKZA 4QCIB 4F57L 2EXYD 2Z4QA 4PJXB 3B9DA 2VLKD 1FL5A 3GMRA 1GGBH 43C9A 4MYWB 1KPRB 4YHMH 3O8XA 2WBJD 1HXYB 1ND0B 5EU6D 5ESAA 1E27A 2IPTL 1UJTA 1QHOA 3O8XC 4YDJB 4WIQA 1KBGH 4UAOC 1M05B 4W6WB 1B2WL 2QJDA 1A7NH 4P4KC 4XPGL 4IRJD 2WINB 4Q2ZB 3ZYZA 4C56D 3AB0B 4JQIH 1GRWA 5DO2C 3PL6D 4MJ6B 4OQTH 1YEEL 3QEUA 4Y5YC 1AHWA 1OWWA 2VC2H 1GYAA 1S5HB 1KCUH 4Z0XB 1BPVA 2R2HB 3D69B 4BSVA 4JFDA 4KHXL 2FR4A 3ET9F 3VXTB 3VFGH 3CPLB 1OWRM 2MQ3A 4YHNB 2YEZA 4LLWA 3MNZA 1KIUA 4WU7A 2VQ1A 5C0BA 5LCVL 4XI5D 1A3LL 1B3JA 3QIBB 4LPCA 2BJMH 4L3ED 1NGQL 3VCLB 4PB0L 4CJ0A 1NCBH 1XF3A 4K9EC 3VMOA 5HYIA 2PW2A 4NP4H 4PB9L 1FAIL 5LKNA 3K81A 3LKPA 4RGND 5E94B 5KSBF 5J4MA 5AWNH 2N7AA 4HK3N 4I2XA 5EC2B 1J9CT 3O45A 5EBWA 2BVUA 2C3VA 2DDQL 3CSGA 5EUOB 4N8VG 4JANA 4GRMB 5FM4A 5E5UB 3CAFA 2ENYA 3CDFA 1QLFA 5GSRA 2EDJA 5JPNB 3G5ZB 3NFNA 4Y2DA 5FGBC 4BH7A 5GRJL 2X4PB 4A6YH 5EC1B 2GYSA 3THML 1JF6A 3X3GL 4ZDHA 2YUWA 1Q1JL 4Y2DC 1GGCH 1KIQB 2Q1EA 2QL1A 3K8LA 2XTJD 2QR0A 1FCGA 1VPOL 2H32B 5HVWA 1H8NA 2X44D 3QDGA 4TUJA 1ES0B 4XPFL 1KEML 3WS3B 4MB3A 4ZFOA 3MZTA 3QXAB 3WUWB 5FKAA 5TGBA 3V0WL 3CSYA 5C0AB 1T5XB 3C87A 3NZ8B 1B0RA 4XP4H 4KKCC 5C0CD 1CLZH 4E5XB 4BQBA 5DK0B 4YZFF 4HIEA 3SKMA 4Z7UA 1AO7D 3VGAB 2DLIA 2NR6C 1GVIA 3KPRA 4HKXA 5DC9B 3V4VL 2BSTB 3VWKC 2YPVL 2AVGA 5KOMC 1ORQA 1QFHA 5I1HL 4IRJA 3WN5B 1FL3A 3BZDA 3QAZC 3H6JA 3RWEA 4QWWC 1PJ9A 2RR3A 4PY8J 3QI9D 5LGKA 3MYJB 1WIUA 2ZOKB 4V2BA 3MO1A 1DE4A 3X3FH 5EPMA 1B90A 4V1DD 4P23A 5AG9A 2JKXA 4TSCH 1M7IA 4FQLL 2PYEB 2X4TB 3TBVB 4P23C 5IB3B 1BOGB 3SCMD 3SGKA 2XXMB 3H3BC 5IIEA 2WBWB 4KKAD 3TBWA 4PJFB 1DVFC 4ZAKC 2OLDA 4P5MB 1JI1A 1QSVA 4G7VH 2KKQA 4FXGB 5J1SC 2R69H 5IBLD 3BKYL 3L3KB 4CMHB 1TTGA 4NO5B 2QKIB 1IC1A 1VCAA 3FTGA 2Y9RT 3BPCA 4EN3A 3MRJB 3VFMA 1F2XK 4DN4L 5GQBA 4NNXB 3IETB 1R3LA 1U3JA 3D0LB 4BKLB 3DO7A 4EN3C 2XTLA 1MY7A 4XCEA 2JIXD 4YWGL 2CRYA 4XVUC 1U91A 4CVZB 2C4FT 3LKNB 1YECL 3BEWA 3IS0X 2AJSH 4JLRB 4QRSA 3SO5A 2ZNWA 2VRAA 2IAMD 3D6GA 1HHIA 2LVCA 1DUYB 4M62H 2JTDA 4RWYH 3LIZH 4ELKB 5HY9B 2EICA 3BDYL 4WUUA 5L6YH 3EFDL 3DV4B 5IT2H 3VXNB 4F33B 4HG4J 4S1SL 3LAFA 1FV1B 2IQAA 4LSDA 4F3FA 1AGDA 2CDFB 1JPTH 2FL5A 5JHDB 5JIPA 5IMKB 3LZFH 4XRCA 4C4KT 4HMCA 2XZAH 4ZO8A 4GMSL 2DMKA 4TVPL 3BO8B 5HHOD 3PWPE 2MOVA 3QIUA 4UMGA 3U6RB 5C08B 4UOW1 5HDQH 1BFSA 1CK0L 4DKFH 2R39A 1QR1B 3BP7B 3IDJB 3QIUC 4PJ8B 4FQ2L 4K23H 4ODSL 1RIHH 3OKNA 4G8GA 2EDWA 3UJIH 1AKJB 2BMKA 5D72H 1U92B 3BT2L 1FSKB 4V1DA 4NQXB 3HI1B 1ZSDA 4B53A 5DC4B 4JB9H 3HRZA 3R1GH 1T22A 4HKBB 2V7HB 2A83B 3BP5B 4GAFB 4BZ2H 1FCCA 4BYHA 1DLFL 1YN6B 2QTEA 2VXSL 3N50A 3GMLB 3MV8A 1NDGB 4OV5B 4H0IA 3MMEA 1DQQA 1S78C 1UA6L 3TIEA 1NANH 1PG7X 3W9EB 1IGFH 5HYSG 3IFPA 1DZBA 3SDCA 4LEXH 4HEPG 2AEIT 1CN4A 1INEL 4WHYH 3T4YB 2JIXA 4S1DC 3VXSE 3GRWA 1RFDH 1ZHBA 1RJZB 2FGWH 4X80L 3C08H 3PP3K 1IGYA 3FO0L 3EGSB 5EZOL 3PJSA 2BSRB 2P7TB 1SM3L 1A7OL 1NMBL 4M6AA 1MH5B 4XNZB 5I0DA 1QO3B 3ZDZF 4IRZH 2DQFB 1I8LA 5DJXA 5EA0H 3MRPB 1HHGB 4G5ZL 1I8LC 4RBPH 2HLAA 1NC4D 3WL9A 4ZOBA 4UT9H 4XNXL 1OSZB 3BKML 4AL8L 1EPFA 2NXZB 3S4SA 3C8HA 5CZVH 1S3KH 5MEOB 4XC1L 4I13B 5TF1L 5CD5C 3TVMD 5ESQB 5EU3B 3Q0HA 4D8PB 4OAWB 4RMWA 3C8DA 1SJVA 4Y16D 1AH1A 3NA9H 2RAMA 3VMPA 4M02A 1CLYH 2DTMH 1Q9KA 1FG2B 1TZIA 2Q6WA 3S35L 3GM8A 5AAMA 1Q0XL 3ZT6A 3EW3B 3RJDA 3IVKA 3M1BA 4NKMA 3ULUL 3LRSA 3QULA 1RZIB 4JVWA 1NUGA 2R2BA 1F11A 4L3CA 1TNMA 2ZUUA 3EUUA 3OKLB 4U1SA 1MAMH 3MODL 3W5MA 3T3ME 4M4PA 3VW3L 4XP5H 1PSKL 4AIOA 2PXYA 3QPXH 2XV6B 3FFCA 3U4AA 4MXVF 4QXGH 2DQTL 4NN6C 2Y07H 4F2MA 2AJVL 4D0DA 3OB8A 1DBML 3N0PB 4HPOL 1NUNB 1SJHB 2VDRL 3SDXB 3EJYC 4HUXA 1RHHA 5TPWH 2X42A 2XNAA 1FORL 1RUAH 4BH8B 3MPCA 2HLFC 3WS6C 3HMXA 1F6AA 4DGYH 2FYYA 3RU8H 4GKNA 3HS0B 3IDUA 5IFAL 4YPGB 5B39A 2B2XH 2W9DH 5CD3A 2WBKA 2CK2A 4X98A 1NUDA 2PF6A 2EEBA 4NKOA 3UCRA 2VMFA 2EH7H 3HNVL 4WFED 1OL0A 4I3RL 3B9KC 4KKLC 1XGUA 5BZDA 5MEQB 3MOQA 1G7JA 2BERA 3GBNL 1VSCA 4PJHB 1QSEE 4UILH 1HHKB 5D2LE 2HVJB 1GH7A 4N1HB 4L8SA 4HFUH 3C09C 4GW4B 3NPSC 3NH7H 5FOJA 3G04B 3UTOA 1UXWB 2CUIA 3IDNB 1BP3B 1UWXK 5GS1B 5FIEA 2HFFA 1VFMA 4LLQB 2GJ6D 4BQ6A 4NNYA 3BP6A 1CT8A 3T0EC 3VXMD 4NC1E 2FX8L 5KTEH 1H15A 3KXFD 3SJVE 3EDDA 1V3KA 1M4KA 4JRYD 5B22A 4JQXC 4GXVH 2XWTB 4UIMA 2MCPL 5T1DH 4OTXL 1OAZL 4GSDH 3W39B 1LQSR 5JPMB 2KZ1B 4WWID 1K2DB 4K3EL 4K7FA 4QRQB 5CEXB 4PJ7A 4MSWA 4YDIL 1C5CH 1ORSA 1OARH 5D7JD 3MZGB 4X4XA 1CDGA 4FQCL 5BS0D 1S9WA 5GPRA 5L2JB 3O0RH 3PWUB 2B7DT 3MLTB 1U93A 1NLBL 4LP5A 1FDLL 3DX7B 2YPLD 12E8L 1NFDE 3GB7A 5C0IA 5CJ8A 3VFOB 3S36X 4OZFG 1OTTD 2FWOA 1ZS8A 2F8OA 3MACL 1HK6A 1O7VA 3DUUB 3OKMB 4QOKB 3S96B 1C5BL 4X7SH 3R06A 1A9EA 3U7WH 1CXHA 3LKOB 3VGHA 3G5XB 5INDB 5D1XD 4KK8D 5C3TA 1G0DA 2G2RA 3AUVA 4DW2L 1DLHB 4R96B 4W6YB 3PWLA 4KROD 3EYSH 5SWZE 5CSZB 2D4FA 5GS0L 4JFZH 1TETL 1IEAB 4QHKJ 1R24B 1R3KA 4P48A 5J1AA 2F53A 1PLGH 4HK0A 4PRNB 4UDTA 1CWVA 4LLMB 3NACL 3JV6A 2XWJA 2VXUH 3E1F1 4PJXE 1T20A 1J8HA 4KFZC 4NSKA 2CJUH 4XP6L 5E2WL 3RZCC 3QQ3A 5EO1B 4KXZH 4C4KO 2XG4A 4JHBA 4HIJA 2EXWD 5DUBB 4YBQD 5MP6H 1EHNA 3QQNA 4WI3A 3T8XB 3WFHA 1ONQB 1HQ4B 3FO2A 5IVZA 3QUML 4M7JH 4PJ7F 4H26B 5DHXB 5MERA 4H5SB 5HHPB 1DQTA 2YA2A 3QIWB 2PTUA 4F7PA 1YEHL 4NOBA 5GRYA 2YWZA 4PJAE 2EDFA 3C5ZD 4P3DB 4P57A 3MRLB 1CL7I 2AAVA 1FLTX 1NMCC 3SDDB 5GXBB 1MNUH 2Y72A 5MEPA 1CL7L 2RFXA 4HJGA 1DQDL 3ZE1E 3G5VB 4OF7A 4G7YL 1VGKB 1AE6L 3ZKSD 4OUUB 1Z2KA 1PG7L 4Q9RL 1LD9A 4C58B 4D0BA 5IW3A 3V6BR 2X6MA 4K7PY 5BS0A 4NWTH 1J0HA 4X6EA 5SX5H 4NRZB 5I76B 2C3WA 3HE6D 4K94L 3RKDC 1LDPL 5HJ3B 5I74B 1L0QA 5I75C 1BQLL 3DVGA 3GSUB 2OTWA 4RX4A 1I85C 4WW1A 1MCOH 3QCUL 2OP4L 3HG1D 5IFHL 3FRUA 1A4KB 3TYGL 2KH2B 5EUOE 3WO4C 1KPVA 1L7IL 5FA4B 1T0NB 4L29B 4QF1B 3QUKA 4M3KB 4UQ3B 1YNTB 4HWEL 4DTGL 3INUH 5GRXG 3MLYH 3ARFD 2E7BA 5D1XA 4U3XA 2HFGH 4ZOAA 3LV3B 4U1GC 1EERB 2AJXL 1OT2A 2FDBP 2MMXA 1XF4A 5DD6A 5I1IH 3VWJB 2XYCA 1CD1A 1BD2B 3FQRA 4NBXB 5C6WH 1GGBL 4ZPTA 1CBVH 1NBVH 5J57B 2ITCA 1N4XH 3V0VA 32C2B 3MGOB 2YSSB 4RMVA 1J5OH 3L9RB 4RGOH 5C0DA 1A3RH 4ISVB 2C1PB 2IPKA 5FB8B 4IOFC 5I16B 3RVTD 2XN9B 4Z7QF 3IKCB 2VDLL 4OQTL 4AEHH 3QYCA 2VC2L 2IJ0C 5KBNC 1KCUL 1I75A 4ODUA 3VFGL 4HLJA 3CFDA 5F7LB 1G7QA 2GAZB 3OB0K 1Y0LB 2GTWB 4LKXB 3HR6A 3EHBD 4U6TA 1DJSA 3RP1A 2BJML 3M8OL 3S5LA 2WWKT 3FMGL 1MPAH 1NCBL 2I9TA 4PJBE 1JJUA 3QFJE 1X5ZA 2OJEA 5CJXA 2C3HA 5IFJB 5J6GA 2H2PC 2F54B 3QRGH 5L2KA 4PGEA 4NP4L 3K46A 1KYOJ 4MNQD 2YD8A 5HHVH 4PJDE 5AWNL 5MI0C 3DXAB 4Y2OA 3VG0H 5CJBA 5D1ZB 4B7IA 1F58L 1XH3A 2EDKA 1CDJA 3OXRA 4KGLA 1MCQA 4QRUA 4ELME 2D7MA 2W0FB 2ILLA 2D7NA 3CK0L 4RCAA 4LLDB 4WCYH 4NQDA 2NY6D 3HUJE 3MJ7B 1CS6A 3SE8L 1EO8H 5BO1L 4NQVB 1KIPA 1GGCL 4DCQA 4NRXA 3UTSA 1I8MA 2OR8A 1C12A 3B2UC 3KYNA 4GG6A 1A6ZA 4GQPH 1U8PA 4PJ9B 2DYPA 4JGMA 5F93C 2FZ3A 5DZLA 4WJ5B 2YUXA 5IW1A 4JZJA 4F8TA 4XP4L 1ZK9A 1CLZL 5JOFB 1E4WH 1YMHA 3ARDA 4JZJC 4JZNA 5L0QB 1KXQE 1PKQE 3O41A 4P4RB 1A6TA 3ARDC 4OCLC 2V5TA 4UQ2B 1E6JH 3MBEB 4L9LC 4QHMA 4MCYA 3A6OA 5DS8B 4OF3A 2OR9L 4PJIB 2G9HA 2XKNA 2BVEA 3IXAB 1K3ZA 5FKPB 3UTPD 5EIIB 4P46B 2Y06H 4LNRB 4YHLH 5DJCA 4LARH 3NFSL 4GQ9L 3X3FL 4PTTA 3DIFB 3QUZC 3D2UD 4TSCL 3LOWA 3K8MA 4W4OC 1X5GA 3H3PL 5A3ID 4O51B 4LCYA 4XPBL 1NC2A 3O4LB 5C0JA 2H9GA 1BZ7A 5ICYB 2CLVB 3ARYA 3L3DB 1IMHC 1ZKAA 3BZFA 1ZGLB 2XG5A 3GJFK 4G7VL 1U95A 3IJSA 1PY9A 1UXSB 4LCIH 4KV5F 3HLAA 4CL7A 2HFEA 2DIAA 5LBSH 3O2WH 4W70A 3F12A 2I26N 2QQKL 4WI5A 4GG6F 3RWIA 3DGGB 1A3QA 3MNWA 1KJMA 3FT2B 4MQ7A 1AR2A 4ZNCD 1ZLWK 4XCCL 2J8OA 3PQYD 2ZJSH 2DD8H 5JA9A 2VR9A 3OG6B 4APQA 4GRWB 4GKSB 2AJSL 5D9SA 4DKDC 1OGAA 1X5IA 4X5WA 4UZGA 4F7TB 4PJCB 5F8QC 2H3NA 4FOMA 5DHYB 4Q58C 4LPVA 4KPHH 1SVZA 4EI5B 2GCYB 4M62L 5J89A 1FZKA 1MRFH 3LIZL 4RWYL 3QWRD 5TDNA 2G75A 5CHNB 5E2TH 3RDTD 5L6YL 4PY8I 1QD0A 4HHAA 2GY7B 2P5WD 3KS0H 1BF2A 5IT2L 1MCNA 3BQUD 3P77A 2VZUA 4M9PA 4MMXC 1F4YH 3TZVB 5GGQL 3BVNB 3IFLH 4UV4L 5C0ND 1I9IH 3WFEH 4X6FA 1JPTL 3OL2A 5GS0D 4FQPA 3LZFL 2ESVB 5E2JA 4Z7VE 2IALA 4C83B 4NQCB 5DMGD 3X12B 2H6PB 1I1FB 1RK0B 2GEEA 3EDJA 2YUVA 3QXDB 3T2NH 1RSFA 5HDQL 3LSOB 4DKFL 3RNQB 2YD1A 2AGJH 3UPRB 4IJ3C 1C08B 4RMQA 2FHFA 3UJIL 5D72L 2BHYA 4KTDH 3ULUF 3D85A 1WTGT 2AEQH 4JB9L 4I0CC 3V4PH 5E9DE 3BD5A 4BZ2L 2UUDK 2VISA 4ENEC 4ZSOB 3PWJB 1BWWA 5J13C 2XY2A 4U1IB 3FB7B 1UH4A 3HE7D 2A77L 5FO9A 4DQOH 1YEJH 3P9WB 5C0FA 4CVXA 3P4NA 5BV7C 3DTXA 1R3HA 3ARBA 3WD5L 3IDIA 5E1AB 2R1XA 3OR7B 3U82B 4LCCB 2ZOLA 2WWMD 3MR9A 4WU5B 5I1LB 1H5BB 1I3UA 5D7KD 3VGBA 4HZAA 3FN0H 1JZ5A 1FZJB 3HC3H 1HSBB 1BMGA 1NCUA 3GI9H 1H0DB 1VACA 1RFDL 1LK3H 2PO6A 1CFQB 5LXGH 3U1SH 4ODHH 3OAUH 5D6CA 3NCCB 1G0YR 4MVBD 2VLLB 1Y18A 4M61B 1OGTA 5JIKA 4HFWA 4LSSH 3W0WA 2EDYA 4XWGL 2A1WH 4IRZL 1JHTB 1Z9LA 1KTLB 1S7SA 4G42B 5EA0L 2HYMA 3BP4A 5HGAB 1MCFA 4CN6A 1ZT7B 4UTBH 4UT9L 1Y6MR 4PJHE 1T0PB 4C57C 4NHUB 2GHWB 3PDOB 1S3KL 3TO2A 1XCTB 2X4NA 1N5AB 5BOPA 1MCBA 3BIAX 3ZYIA 4F15C 2B4CH 1F00I 3RX5A 4NO0A 5FV1L 5DRZA 3HTLX 3GHBH 1KN2H 2ZUXA 5JW3H 1U8QA 3P11L 4ZNEE 3KPLB 4MMZC 4P4KD 4XVJL 1JGLH 5JXEC 3EBAA 3QUMA 5HHME 3SE4A 2LABA 2Y5TA 2YBRA 4JN2B 4RIRA 5E4IA 2V5SA 3F7VA 5DJ0B 5I1AA 1KC5H 4MAYC 4ONGH 3HAEB 3VXRB 3K0WA 3PGFL 4GAJL 1DQJB 1X4ZA 2EO9A 5T1LD 1MAML 5F9WB 2DICA 2NZIA 5IHBA 3LN4A 4ODVH 4NPYB 5DA0B 4XP5L 2WUCH 4Y1AB 2BDNH 2I24N 3QPXL 2VE6B 2CO7B 2IH1A 3U9PH 2Q20A 4QXGL 3I75A 5GSVB 1VEPA 4WEMB 2Y07L 3TYFB 4HWBA 3KLAA 2W1NA 3OGCA 2J8UE 1T04B 1ZT1A 4M8VA 1QSFE 4H25A 3L7FB 3Q6FA 2OSLB 4WFHE 3PGCB 4BSWB 1P2CA 5TPWL 4NFCA 1HQRA 3DX6B 3SOBH 1RUAL 1KTKE 5JDSB