3W9DA

Structure of human monoclonal antibody e317 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
209
Chain Sequence
VTLKQSGAEVKKPGSSVKVSCTASGGTLRTYGVSWVRQAPGQGLEWLGRTIPLFGKTDYAQKFQGRVTITADKSMDTSFMELTSLTSEDTAVYYCARDLTTLTSYNWWDLWGQGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the antibody neutralization of herpes simplex virus
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antibody Fab heavy chain
total genus 43
structure length 209
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA01
4JCMA 4P2QE 1IAIL 5FHBH 1Q1JH 3OXSB 2KPNA 3H42H 1CR9L 1QPXA 1QFUH 1D3CA 1V3KA 1U0QA 3T0EA 2VLJB 3LS4L 3GNML 3HNSL 2UVFA 4XB7A 4J6RL 1RUQL 3FQTB 4QT5A 3EDJA 4TULH 5KOVC 5JNYB 5EIIA 1FL6B 5AZEH 3LKPA 1YY8A 1KPVA 4PJAE 4TRPH 3LV3B 5L8KB 1M7DB 2J6EH 1T66C 2Z91A 3L3OB 3PP3K 2ZCHL 5E9DE 5GS1C 1RVFH 4PRHE 2UWEF 3NIDE 1RZFL 4JDTL 5EBWB 4OI8A 1KULA 1MRCH 4MVBC 1B0GA 1ZGLB 4U1MB 3EFDL 3G5ZB 3FONA 1AI1H 4HKXA 2ITCB 4MXQD 4XBPA 1FO0H 3DVNB 4R4NC 4M1CD 5DMGD 3CFKB 3TO2B 4M43H 3F6LA 4UT9H 5FUZL 4NN7B 5LKNA 3QDMA 1FPTL 1L9NA 2DQTL 4JANB 2ESVD 4W6XB 3T0AA 1CFSB 1QLEH 4FA8A 4Y4KC 5L88H 1FZKB 2F8OA 5H94A 3JV0A 4U6HB 3ZKXB 3P9WB 1DQTA 4LSUH 4I18C 1K8IB 1AQKL 4PP1D 1V5JA 4JY4A 5T1LA 1S7RA 3SQOH 5C0FB 2HN7B 1X5JA 1KIRB 2VQ1B 1T0MB 3G5VB 4OZIB 3U79A 4JFFD 5HY9A 3U36A 3UTTE 5CGYC 2NY5L 5DS8B 4Z7QF 1GC1H 2P49B 4XTRC 4TSCL 2MOVA 3PABA 4L4VD 3UJJH 2CIKB 2EC8A 4R90L 5D71H 3MCKA 4FFZL 3U9PL 1FN4B 6FABH 3JWOH 2VN4A 4DZ8A 4R4BA 1QLFB 5E00B 1RJZA 3QWOB 3WFBH 3NA9L 2VERN 3SN6N 4OZ4B 1DANT 5E2UH 4NP4L 4Z95L 5ERWB 2OYPA 5CJOH 3EKCA 3NCJL 5HBBA 5GGTA 3TZVA 4F57L 3WFEH 5SX4H 1AGBB 2ICWB 1RV6X 4PREA 1R3JA 3CX2A 1G0YR 1HHIB 4U6YA 1UM4L 1F4YL 2MPAH 4RGOH 3GM0A 3U7WL 1KB9K 3O41B 1T5WB 3RKDD 4GAJL 4RA0C 3O3AB 5DZNA 1YYLL 3MCG1 2GK2A 1VADA 4GAYA 3H9SA 2ED8A 5GJTL 4B53A 3VFWA 2HH0L 1UM6L 2YPLD 3FB6B 2W0LA 1FL5B 2PCPA 2VAAA 3RWEA 1BIHA 4KJYA 2W9DH 4TSBL 3OPZH 3DYOA 2W1NA 3GMRA 3K80A 3QO1B 5EOTA 3RGHA 2IH1B 4GW5A 2H2PC 3EOAA 3BPOC 4RDQG 2R2CA 5DJ8A 1DUYB 5F21B 3QP3A 1RUAL 4HPYH 1RULL 4M1GL 2HWZH 4XCFH 1FYTD 3CUPB 4UAOC 3HCVB 3CVHH 4KJQC 2NLJA 5HHOD 1NANI 1ETZB 1CYGA 5B22A 1NCUA 2LE9A 4G6FB 4HGKC 1P7QD 5SX5H 5JXED 4G8GD 2HAZA 1T5XB 4MGXA 1HCVA 3V0VB 2DQGL 5D7IF 2P4AB 4NGHH 3R1GH 4PJDB 2DD8H 1KIRA 5HHMB 4P2RA 2VZSA 2O61A 1E28B 5IFAL 1CFBA 2ITDB 5BVPL 3WFCH 3D69A 2FX7H 3ULUL 5K33A 5TDNB 5IG7B 1MPAH 1G9MH 3X14B 3MBEC 4JQVC 3O6FC 1NUDA 1YEHH 1TZGH 2W9EL 2Z4QB 5EUKB 2DQJL 2X7LA 5CIPB 1NGPH 4JHWH 1MOEA 2KDGA 2X09A 1MUJA 4M7JH 4Y19D 4HLZH 5E94A 1JZ3A 2OZ4A 1T21A 3WO4C 1S8DA 1ZLWK 3O3DB 4KROC 4PJFA 1JI2A 3U7AA 4BSWA 4KJPD 4NQVB 5TDPA 2CKNA 3K4ZA 5ITFB 1Q38A 5AZEL 4YHPB 3MQIA 1T0MA 5DD6A 2AJYH 4AT6B 4DGVL 2Q1EA 3UBXG 4Z6AT 4LHUA 4GRLC 1GH7A 4NJ9L 3DXAA 3MYJB 3TJHD 3B2VL 5EBMA 4U1HB 2OP4L 2JK5B 4W6YB 4OLWL 1UWEL 1IKNC 2R0WH 3K2MC 1K5NB 4PBVC 1LEKB 1EIBA 3L3HA 5LBSL 1T89C 4WFFD 3H0TA 2JJTC 3NFPB 2FLBT 3FB6A 3SEPA 3BX7C 3MRDA 5LAXA 1G6RH 1Q9OB 3KPLB 4HUWA 5JW4N 4N68A 2PXYD 3FB5A 5L88L 4G80B 3DUSA 3RVXD 1S7VA 4QHLB 4Y7MA 1DZBA 3QA3A 4GBXC 1D6EA 2O5YL 2J6EL 5D7LA 5A1AA 1BOGB 3KLDA 4O9HH 1JP5A 3B2UC 3LB6D 4PLOB 1KJMA 3UJIH 3ZTJG 3WHXA 3LZFH 3P0YH 4XBEL 4M00A 3UCRA 1MELA 3HE6C 1JNLL 4HJGA 3GK8H 1INEL 3UDWC 4G43B 5IEHA 4JDZA 4EDWL 3TV3L 3C87A 2NY2D 5DVMA 5TH2B 4NCDA 4YPJA 3T04D 3DTXB 5L2JB 4QHNA 4OZ4A 2B0SH 3ULSA 3BE1L 3E8UH 4G7VH 2BSED 4NQCA 4LSUL 5EOQH 4JJHA 4G80A 1UJ3C 2APWA 3WIHL 4JFOB 3KXFB 1KOAA 2VXSL 3GRWA 5CGTA 4LFHD 5CZXC 5HHQA 5I73B 4Y5VB 3RTQB 3D2UB 4YEEA 1C5CL 3T4YB 2CUMA 3IS1X 4DFIA 3V0WL 4TSCH 5HYSA 1MCLA 4QOKA 3TVMC 2D7NA 3LN9A 3FRUA 5EU4B 4X6DB 3JWOL 2EC9T 2O5XL 4G8GB 5BS0D 1QA9A 2R4SL 1JNJA 4MXWL 4KKBC 4DCQA 2R23B 3T3MF 3LQAL 5C9JA 1A0QL 5HGBA 1U8LB 5EO0A 3E2HB 2ITDA 4Y4HC 4M48H 3FL7A 1IC7L 4FQHB 2I9TA 4WY7L 3IETA 3UC0H 2JK5A 4LLUA 2VSDA 5FA3B 4S11A 3UBXI 1CXLA 1F4YH 2MPAL 4X99A 1RULH 5EC2A 4YHML 1ZTXH 1EK3A 1AD0A 1AH1A 2AJXL 2NTFA 1BZ7A 5DS8A 2HT4C 4TVPD 1EHLH 4OGAD 4YHOL 4GOSA 4KRPC 1T2QL 1KCKA 3MJ9H 1I9RH 3CFEA 4FQXB 1IKFL 2A1WL 4HK0B 3DUUB 2EYTA 1UM6H 3FMGL 4P9HH 4IOFC 3BUTA 1P69B 3VRLE 2DD8L 3O2WH 1S7TA 4LLVB 2XPGA 3RI5K 1NFDB 3QXAA 4LSRH 3MLRH 4QTHB 1MIEH 3MGOB 1DBAL 4ZO6A 2AV7A 3MLVL 3IJYB 3EOBB 3ROLA 4MNQA 3AB0C 4PB9H 3VJ6B 5C0CA 3BP5B 4P5TA 2C5DC 4ZODA 2UWEB 3ZKSD 4HZLB 5JZ7D 3QEHA 1BJ1J 1T83C 4KJWD 1A7QH 1XF1A 2MHAB 4RAHA 2X05A 1BIIA 5HVHB 3DIFB 5D2LE 1OQXA 4UV4H 1MJUL 2I27N 3LKSA 4OD3L 4ELMF 1EXUA 3CXDH 5IMMA 5KVMC 1QR1B 3K2UH 5LJYH 2HVJA 5GHWL 3V4UH 3BI9X 3RDTD 4PYGA 3BMWA 4NYLA 1KJ3H 3BZEA 2HYMA 1HOCB 3PGFL 3DVGA 1K6QH 2W9EH 3GGWA 2A9NL 2VWEC 4IRSC 4WCYL 1IAKB 2DJ4A 2ZCKL 5GS1A 4LAJH 1K8DA 2W0FB 1J8HD 3MV9D 3V6ZB 3PE9A 1X9QA 3O11A 2NQCA 2VZTA 1VHPA 1ONQA 3G6JE 4L4VA 4LVNC 1JL8A 4M1DL 5IB2B 1UXSA 1L6XA 1UWXK 2CK0L 4F9LC 1IC5H 1C1EL 5L7XH 2ZOKA 1IGFH 4BFBD 1OF2A 4LSPL 1YZZA 3NOIA 3SJVD 3Q0HA 1IGJA 2YKLH 4S2SA 1P4IH 1J18A 5IMMB 1UCTA 4MJIE 4YHNA 2WNGA 4N0UA 1I9EA 4XHJD 1T1WA 4XCYB 1CDJA 1IEAB 4OGYH 4M6NH 1F42A 3L6FA 1JZ6A 3STLA 3QI9A 3QPQD 4GBXA 4KK9C 4HUVB 5F9WB 4U7MA 2D7MA 2ZG3A 3KYNB 3QZWA 4HFWB 1EVUA 1HH6A 1XF5B 1A6UL 3VMPA 4ZS6D 4JZNB 2J8UF 4WEMB 1JFQL 2HTLC 1MCPH 3V4VH 3O6FB 2GK0B 3UO1H 5IVXE 4WHCA 4IOIA 3ARDB 2VZUA 5FKAB 4Y4KB 5HI4C 1YEFH 4JFHD 1JPSL 2HKFL 2AQ3A 4YUEH 1N2RA 2DLGA 2DYPD 1QG3A 5GRVL 3QXWA 3U30C 5EOCH 4M61A 3L5XL 2C3XA 1E4WH 1QVOA 2NY7L 1AXIB 3RY5A 2FBOJ 3LIZL 2XTJE 1A1NB 5GGQL 4C4KO 3QR2A 2CDEB 4FNLH 5J6GB 5HJ3A 3MJ6A 2AEPH 5IVZA 3VFNB 1RK1A 3QUXB 3VWJD 3L3HB 4QHMA 3WJJA 1HCFX 5ESVB 1IBGL 4OQTL 1TCRA 1UJTA 3O2DL 1S7TB 2BY1A 3FT4B 4QF1B 3WKMH 5A2FA 3ARQA 4IMLA 3REVB 1INDL 2IALA 1MHEB 2DOCA 2FD6H 2DI8A 5DWUH 3HB3D 4RMTA 43CAA 5KS9A 3EGSB 3GBMH 4QYOA 1NQBA 3V8OA 1IM9B 4XPHH 5I30L 5CJ5A 4GRWH 3TCLB 3QUZA 1QKZH 3CZJA 3IXTB 2OJEA 3QIBC 2Z8SA 3OBAA 2NLJB 4WI4A 3QUKB 5BCAA 1JN6B 3MV7E 1ONQB 5IB2A 1EHLL 4Z7UA 2IFGA 3O2VH 5EA0L 2IAMA 4Q7DA 3RGVC 4OTXL 5BXFB 3S97C 3FO9B 1H8NA 1YC8A 3CX5J 4RGNB 2MNUA 4JZJC 5IHZA 2WWMD 5E8PB 1HSAB 3GSVB 3GHEL 1C7SA 1EXUB 1JNHA 1XCQA 5CEZD 1FCCA 5DEGB 5L9DH 1OSZA 3GSRA 4KJYB 3ARSA 2D0GA 4LGRB 2AK1H 5D7IB 5D9SB 1MIEL 1FO0L 5J6HA 2DS4A 4GXUM 1EX0A 1M05B 4L9LB 5DJCB 4PJ9C 4NM8H 1DVFA 1F4WL 4MVBD 3MRQB 4NHCL 3H9SB 5TPWH 4KK6D 4ZD3H 4PJAA 1HDMA 2GJ6B 1EEZB 2EH8L 1XGRA 1P1ZB 3RWJB 4LLWB 1E27A 3TBSB 4WRLA 4QRTB 4QRQB 3BP6B 3DSNA 3OB0H 3VXSD 1H3UA 1AQKH 3ALPA 4X4ZA 4N0YH 1HH9A 3RZCC 2GSIB 3RL2A 1NGYA 5DGQA 4PGCB 4LSVH 2X9YA 2ADIB 5SWZE 1PJ9A 3H3BC 1M7XA 1QFOA 4P0DA 5B38G 4PJ9B 1UFUA 1S7WB 5GS3A 4DK3A 4OZIF 4X98B 4UINL 4K3DH 1EMTL 3VFTB 4QRRE 1KLGA 1C16A 2C1PA 4APQC 1LE5A 6FABL 1C12B 1CE6A 2JJSC 2CDGB 4OUOA 2BJMH 3O3UN 3D85A 3PWJB 5JOFA 4LASL 3VA2C 5M95B 2OI9C 2XZZA 4KK8D 1DLHA 4O2FB 4QOKD 1PD6A 3ARUA 2CGRL 2FH6A 2Q86B 4LLUB 3AGVA 1C1EH 2I26N 3B3IB 1EDQA 1HHHA 4LSPH 4X5WA 1TETH 1CL7H 4LRIC 3RWGB 3ZDZE 1ZA6A 1I8LA 2BSRA 4QXGL 4J3WA 3KPSE 4FTVE 5DJAA 4MA7L 4HAFA 2R0ZL 4P4KD 3SDAC 3MV9B 1X5AA 1A21A 2H6PB 2UV3A 5E2VH 5T1KA 1MRDH 1X5LA 5L8JB 1S78D 4KKAD 2VWEE 4OCLC 4AT6A 4PJIB 5DMKB 2J8UE 5F9JA 3ET9F 5H35A 5I8OH 2FZ3B 5BVPH 5F9DC 1WQVT 2OSLA 5JORA 2ADFH 3ME0A 5D7SH 3S3PA 5IMOA 5T5NG 2L0DA 3HC3L 5CP7B 3FQUA 4KHTH 5DMIH 3TCXA 4G6JH 3VGAB 3SDAB 1XEDA 4JPIA 1OAXH 1DE4A 3TESA 1U91B 1FVCB 1JWUB 5CUSH 4HIHB 1BLNB 1QRNB 3F7YB 2DQGH 2EKSB 4KJQD 3MRIB 3GO1L 3VWKA 1T1ZB 3PIQB 2VAJA 5HVFB 3L3IA 4F33A 3OMZA 1WZ1L 3SDCB 1MNUL 4R8WL 1IBGH 4XNYH 2VL4A 1M6OB 2DBLL 3DGGA 1IAIH 1N4XL 1CLCA 1C5DB 1CN4A 5GGTH 3U4EA 2VDNL 4UILL 1QR4A 4PRHA 4F37K 5I18L 1CU4L 3EOAB 3EYFB 5E9DA 3HR6A 3OKKB 5HPMA 5F1KC 4ZTPH 3GBML 1G9NC 3X13A 2R0WL 2DWDB 3P73B 1F13A 4Y2DD 3E0GA 4TVPH 4JHWL 1S7UA 4NKOB 5E2JA 5B39G 3TT3L 3U1SH 2GAZB 1ND0A 5J12B 3I6GA 5IESL 5T5FH 5LCVL 2VKXA 5F7HA 4M9OA 4PJ8D 4ZFOL 5DJ8B 3HUJA 3VXRA 3L5JA 2XKNB 1ZHLA 1CD1B 3IKKA 4WUKL 4OZHE 1FRGL 4HWEL 4PRPA 1JF1B 1XMWA 3ULUE 1FG9C 1WAAF 3V5KA 5D7IA 3SKNB 2BC4A 3QCVH 3VH8B 3PABB 1SJHB 1A6AA 2VISB 4U1LB 3HAEH 3OKKA 4JQXA 5HPMB 1LD9B 1LWRA 3ARPA 4HC1H 2G5BA 4Y5XA 1J8HE 1G7PB 2XKSA 5TPWL 1F8TL 4HFUH 1YEJH 5EBGA 1NCWL 4L29A 4Q74A 1M71A 4WWID 1V7NL 4Q9QH 4XP9H 1IARB 1CQKA 3HPJA 1FNGA 3QHZH 5KSAA 3MROA 3FZUD 1VGKA 3FOMA 4HXBH 4ZTOL 3BDXA 1G6VK 3DLQR 1NBYB 4KVCL 4K8RD 1X5GA 3AMKA 4NZRL 1FIEA 2EE2A 1BJ8A 4M62H 5CEXB 5JUEL 2I60H 4P9ML 1DDHB 1H5BC 4N8PA 2Y06L 3L3KB 3VWKD 2EIDA 3S36L 3TV3H 1V3MA 1MRFL 1UA6H 4D0BB 3FB8B 4TNVF 4LDLB 1XIWA 1JGUH 4RDQF 5C07E 2IPKB 3CFDA 1F58H 2Z31B 1MFAH 4AIOA 2HJKA 2WBJB 1I3GH 1JPST 4XP6L 5EOQL 4HJJH 2QSQA 2WQRA 1E4JA 2V7HA 5MHSD 4N5ED 4WVRA 3QUYB 1N2RB 2XWBA 4AZ8A 2BY2A 3D2UA 2E7MA 1JGLL 2Y23A 1ZKAA 5HVGB 1Y6NR 1U3ZA 2APXA 3U6RA 2XXMB 3DRTB 1DN0B 4E41B 4ZQKA 1I3VA 5T1LD 2PUQT 3DX8B 4Y1AB 2D7TL 2NW3A 3QAZB 2J7LA 5JHDA 3ORJA 4DFHA 4I18A 4DKFH 3LHPH 4JFZH 2IBZX 2DQUH 1NAMH 3D48R 4NFBA 4HJ0D 5JXAL 2Q3AA 4IIQA 4HWBH 4F7EA 2CGRH 1CICC 4O2CB 2V5RA 1RI8A 2C26A 3VFGL 3U0TA 3OR7A 4HLJA 4HJGB 5FA3A 3WBDA 4D2NA 1NBQA 1WJ3A 4PREB 1S3KH 4RFNB 5C3LD 1A1OB 3RU8L 5J1TC 4KHTL 4B50A 1E27B 5TQ2L 4XNMA 1KCRH 3EIFA 5J06A 5IB1B 2MSPA 2IBGA 1A3RH 2DIAA 2R1WA 1FNLA 5DEFA 4ZQKB 3RPIA 4ZUUB 4DZBB 1BREA 3IDGA 1X5XA 4ODWB 4JRXE 3PIQA 1IGJB 2G60L 1RZKC 3TYFA 3OKOB 2RAMA 4UV4L 4RZCB 4JG0L 3V4PL 3VMNA 5HYJB 4NWUL 3U4EB 4JE4B 4NZDA 4K55A 1U95B 1WC7A 4UQ2A 3KR3H 4FABH 2PW2A 1TLKA 4KFZC 3MLZL 3D3VE 4WFGE 3IJYA 1ODAA 4R96A 2CUHA 4K2UL 1PW3A 3GUTA 5CKAA 5F89A 3PWNA 4BQCA 4XNMB 4AJ0A 3FAXA 1FLRL 4MA8L 1MQKH 2X4UA 3G9VA 5JW3L 1N7MH 1Q0XH 1QLRB 4K71C 2YN5A 1WCBB 2A77L 5C0DA 5EZIL 5F7LB 3QHFL 2NY4D 4JY6B 2Q87A 1QFWI 3RI5F 5BQ7A 5JZ7C 3D39B 5TE6L 4YXLL 1ZHKA 4HWEH 3HG1E 1LO4H 4NO5B 5KJRL 3MA9L 1XF2A 4LIQE 4UDTB 2WQ8A 1KN4H 3WLBB 3BIBX 5ITBH 1A7PH 1A1MB 1WSST 1AKJD 2XN9D 3BJLA 2CDGA 1PKQE 4JHAL 3GKZA 4NQXB 2F54A 2VLRE 2NNAA 5EC1B 4BELD 1T1YA 3G6AA 3MUGB 3HI1A 2CK0H 4B0MM 3UJIL 1MJJA 3TEUA 4ODVH 4GKZA 1AXSA 3T3PE 3KPMA 2VLKD 2R39A 3N50A 4PG9B 3SDYH 3HRPA 4P23B 5HDBE 1TJGL 3VXUE 5BQ7B 5GS0H 3KPSD 4FTVD 1OP5H 5BZDA 1XGTB 4M7ZC 2UUDK 2X2YA 5IBUB 4AIZB 4JQVA 2AP2A 1NCCH 4Z7VB 3RDTB 2J6EA 4QY8A 1MQ8A 1RAMA 4YWGL 3SO5A 4CW1B 5AG8A 3TA3D 4HC1L 4LHJB 1FC1A 3DO3A 1RIUH 3EYQC 2VLLB 3TC9A 1I3RA 4FHBD 4F80A 5E1AA 5MENE 1QHOA 5T3XL 4FXGB 2C4XA 3E3QE 4OQTA 3T1FA 2EDDA 3OKEA 1OCWL 3Q6GH 1NKOA 1Q1JL 3BP6A 4XP6H 1P2CA 3JV6B 2EIEA 4X6BA 3GM8A 4CL7A 3GNMH 3HNSH 3HE7D 5DUBB 1TJIL 4GXVL 3NPZB 3P0GB 3LKOA 5E8DH 1HZHL 4FFYH 4R96B 4YDVB 5IV2A 2A38A 4Y5YB 3ZHDA 1T0PB 1ND0B 4JN1L 4MDJA 3O6FD 3TFKD 4YFLI 2CRYA 2DQIL 4P9MH 3UPCA 2ESVB 1F6AB 1KB5L 5I15H 4KMQA 4QOKB 4P2OC 3RKPA 1FGNL 1KJ2A 4FNLL 3OJDB 2JE8A 4FS0A 1OTSC 2W0KA 3UC0L 1H3PL 3MLSL 2OMBA 5EU7E 4OQTH 2CXGA 3O3EA 4EI5B 2XY2A 1I1FB 4U7SA 5T3ZE 2Z8WC 1HINL 1FPTH 3T3ME 2EH7H 5ALCL 3W11C 1PVHA 5L9DL 4P3CL 1QP1A 1IM9D 5L6YL 1MVUA 3EDDA 1FDLL 1NL0H 3QIUB 1S7SB 1YQVH 3QDGE 2NY6D 4GRLD 3WDHA 5CSZA 1F4WH 4JJ5A 3GJFA 1RHHA 4KTDL 3RWCA 4WHDA 3V5DA 4S0SD 5J1AB 2NNAB 3DSFL 3UDWA 1CE1L 1YECH 5F7EL 2QADB 4WNQA 1UCBH 3OF6A 3RVWD 4U1IB 1AO7E 5FB8B 3P4NB 4PG9A 1URLA 4QRPD 5KBNC 1ZE3C 3CCHB 3GBLA 5ANME 1AD9A 3CC5B 3FFCB 4DKFL 3GKWH 5ICXA 3ULUD 4X6CA 4EN3D 4ZUWB 4HWBL 1T2XA 4OBSA 1V7ML 5D1ZB 3CFIC 2J88H 4U1HA 3MLTB 4OZFB 3VE0B 1LNUA 1EMTH 2FX8L 3DVNA 3KR3L 3T77B 1IZKA 3K8LA 1AJ7L 1O0VA 3ETBF 4JJ5B 1ULVA 5HHVH 4D0BA 5ISZD 4BZ1L 3BQUB 1T83A 3KLAB 5IF0A 3PWNB 4OJFH 3MUGA 1S9YA 4JRYB 1FZJB 1HYSD 2DQDL 4JM2C 1T21B 1D5XA 2VN7A 2VZ3A 4HMDA 4E42A 4N1CA 1BM3L 5EZIH 2A9NH 2HLFD 5CINL 5CHNB 3DARA 1U3HD 4LCYA 4PRIE 1I1CA 4WU5A 1F4AA 3TH3T 4EUPA 4YZFF 3C60A 2R1YA 5A2JH 3RY6C 2GIYA 2P43B 3F5WB 5E2WH 4JFDD 1F6AA 2W9DL 4TSBH 1HWGB 4G7YH 5BJTA 1RZKL 1C5BL 4X6DA 2ORBL 2CMRH 2PKDA 3O9WB 3GSXA 4LLYA 1IAKA 1PG7W 4JVUA 1FFRA 5DK0B 1CGYA 1EH9A 1CLZH 2ZOLA 4GQ9H 1CGTA 4N0CD 4PTTB 4LLWA 5EO0B 3HE6A 4K94L 4BQ6A 2ZKHH 5CEYB 3UYRL 4U1NA 1A4JB 1HH9B 3BVNA 1HYRC 3FOLA 2PW1B 5D7SL 5EIQA 5E6YA 4BK5A 3LN4B 5CJBA 3UTZA 3RWCB 3KWWB 4KH2A 1WFUA 2EZ0C 1MFCH 1RUPH 3KJ6L 5B8CA 4PJ9A 4EOWL 1IGIL 2BMKA 5HYFA 4UT7H 1QSZA 1NGWA 2JIXB 5CUSL 1J5OH 1BQHA 1A6WH 5IMKB 1DN0A 3O9WA 4K9EH 3WV0A 1IC4H 3WN5C 1CI5A 3I6KA 3DROA 1DQJB 3VFWB 1VESA 4FXGA 3D1MC 4CADB 5FCUH 1ZLWH 4NQDA 1T1XB 2ILLA 4CJ1A 4S1QH 4XP5H 1P2CB 3JV6A 4I3GA 3MMEA 3ARBD 1Z5LA 5E56A 5FYLH 3RUGF 2K1MA 4YO0A 3WEXB 5ILTH 2DM3A 3U9UA 4YGAB 3FQUB 3IRPX 3SKJL 5D8JH 3OAUL 2IANA 2VDKL 4GRWF 1W72B 5CP3A 3VRJA 2P5ED 5HHMD 2X1PA 3QQ9D 1N6QH 2PO6A 2BSTB 4PJFB 4LDOB 5I2IB 3OB0K 1OLZA 1MFDH 3HNVH 1NC2B 1G84A 4R4BB 5DK3A 2R2EA 1UH3A 2QKIB 43C9B 1E4XH 4AG4L 3X12A 4A2MA 4H26B 1HINH 4LVOB 5HHXH 1NGQH 4GUPA 3V6BR 3GB7A 3MNVA 2DWEA 3RTQD 2W60B 1S9XA 3FQRA 4JFFE 4H5SA 1YEIL 4YXHL 3VG9B 4KTDH 5L2KE 5FEBA 1YEKH 4XMPH 3K8KA 3S4SG 5F7EH 2Y25A 4DKAA 4NZTH 4TOYL 4ODTH 3J7HA 3NFNB 1T7YA 2A6KA 2VZ1A 4HW6A 3WE6B 1GXEA 3M8OL 2NY2C 1KPRA 4GFTB 4IDLA 5JW5B 2CLRB 4LOUC 5C09E 4LKXB 2Z8VC 5J1SC 3C6LB 1FH5H 2AJVL 5E8NA 4XNQB 3L9RA 1E4KC 4WUUA 2W38A 2H9GB 4OLXH 1H9VA 4I2XE 3C08H 4LCCC 4ZAKB 3NCFB 3ISWA 1HXMB 4KRPB 4FQIH 4ALAL 1VEMA 2DJUA 3VW3L 5AAMA 2VQTA 3CX5K 2L7JA 4CU7A 3HC4L 1FG2A 4BSJA 3OKMB 4GW4A 5IK3A 3R06A 4D9QE 3LKNA 2IFFL 3QG7H 4NQCB 3D85D 4QRQA 3EO1A 2B2XL 1RMFL 4ZS6C 3V6FB 3VXRB 3BKML 3UTPE 4BFIA 1A6PA 3IAPA 5HHQB 3E6FA 2CRZA 1A1OA 1JBJA 3NFSL 1JGDA 3OG4B 1T66D 1U8MB 3D9AH 1XH3B 2LTQB 4POZD 5D9SA 4FZ8H 5CSGA 1RQ5A 4XVJH 1KLGB 2WW8A 1EAJA 4X80H 3B9KB 4MXQC 3DO7A 4NHUB 5HHNB 2V2TA 4OCMC 2GUOB 4KVNL 5DGRA 4WI9A 3TYFB 5BRZB 3MXWH 4GO6B 1ZTXL 5IVXF 4ZFZB 1SEQL 3RWFA 5CEYA 4Z5RA 5I8KL 2YUVA 3WFDH 1JRHH 4PRBA 4EUPH 1GPOH 4QRSA 5DUBA 4MJIB 5E2VL 5ITFA 4JFYB 5DFVD 2BNRE 1EV2E 2QBWA 5DJYA 3TP4A 4ODUA 4U3HA 5CKGA 4WFHD 1HHJB 3RA7L 1DE4B 5ESQA 1C5BH 1DBBL 4N0RA 4AM0A 1MHHA 4UOJA 3VXPA 4Y1AD 2F53B 3MRIA 4TNVK 5E1AB 5FO7A 1H15B 4NZUH 1VGKB 2LU3A 3AROA 4KHXL 4POYA 4JFZL 1MFEH 4K94H 4U0RC 5C0CB 2J1KA 4GG8A 1EFXD 3O4OB 4HPOH 4MQTB 4Y8AA 5CEXA 3DJ9A 1JZ8A 1LE9B 3L5WA 4WEBH 3GSNH 3SBWA 3HS0B 4QRPA 5GS0D 4KJWC 2GT9A 1X5ZA 5GGVY 1KYOK 3VXTB 1GGIH 5I1GH 2EDEA 1WWAX 3P0VL 4QEGA 3BEVB 1VFUA 1I7RB 3RDTA 3EDFA 5CBEB 1OAUH 4M4RA 2DQFB 2A83A 4PJBB 1A1NA 4WNQB 3NTCH 2VDNH 4MSWB 4LEXH 1D5IH 3HR5B 5JA9A 1CU4H 4KK5D 4DGIH 4NUJB 1N64H 5ESVA 3CSGA 3V4PH 3EAKA 3RZCD 5HGDB 4E0RA 3FHAA 1OGTB 4JFFA 3WLWD 4N9GA 4M1DH 3GIVA 2BC4B 4XVSH 4JFPB 3VE0A 3MLXL 1X4ZA 4NM4L 4S2SB 3VXOA 5LGKA 3QIWC 1QQDB 3BT2L 3SOBL 1AE6H 1KJ2H 3TBSA 5L2JA 4MQ7B 4MMZC 4PJ5A 1EO8L 2X4PB 4NWTL 1J8HA 2X9XA 1DR9A 3TNMB 5GZNC 3PV7A 4U1IA 3GI8L 5JMOC 4NO0A 3CU1A 2GSIA 4ZUUA 3PXHA 3TVMA 3NN8B 4GRLA 1DQML 2EDQA 3NIFE 4U05A 2R9HD 4DOHB 1UADC 4M7LH 2JCCF 4YDIH 2X89A 3RBSA 4BH7A 1S7WA 1YEJL 1SY6A 3UTSD 2IG2H 2DBJA 2YPKB 4MWFA 4Y4FA 4P2CG 4EBQH 3BKJH 4P2YA 3KJ4C 1YEIH 1LMKA 1LP9B 3MRCB 4L3EE 5LWYL 4DZ8B 5IQ9B 2FH8A 1QEWB 4XPFL 5JHLL 4JDTH 4ZUTB 3WNOA 5EUOA 1ACYL 4G6FD 4I3RL 4IEFB 4JGMA 1TXKA 5I1IH 3P4MA 3PWPA 2GJZB 4U1GC 5D7KD 1R24A 3PGDB 4FQLL 2R29H 3FOLB 3S4SB 1MRFH 2IBBA 4N8CH 1KEMH 3VA6A 4LQFL 3TA3B 2ZWLT 4JN1H 3WXWL 4M93C 2DQIH 4YBLC 1UG9A 1B0RA 3NCJH 4UZGA 4E9LA 3G6DL 3BPCB 3GMNA 4LLYB 1T2JA 1R5IB 2FECL 4NC1C 1G7HA 3ROLB 3D0LB 2XZCH 2DKUA 2ERJB 5MENB 4LMQI 4K3JL 3CFDB 1FZJA 1H0DB 4NNPL 1HILB 4KRNA 4P3WA 3WDIA 4JRYD 1KCUH 2B2XH 1KPUB 3VI3F 4GUPB 4GKOA 1AXSB 2GY5A 4P3CH 3TPUA 5TF1H 2E6QA 1IT9H 3VXMB 4M7KH 1REIA 1BJMA 3VGHA 3GI9H 1PAMA 1OP5K 3D87B 2J3SA 5HDLA 1KFAL 2R1XA 4NQXA 3LB6C 1BZ9B 1UT9A 2HG5A 3VXSB 1OP3K 2DQFA 1BVKA 5FYJE 2R0KL 2AS5M 5GGRB 2R23A 1FE8H 4KZDL 2BVQB 3UPAA 1CBVH 2HWZL 3N1GC 3S96A 1IEBA 2H45A 1DL7L 1JF1A 4BKLA 3CXHJ 4PRNA 3KPRE 5I19L 2QSTA 5TE7H 3GB7B 4KUZL 4DQOL 3HRZB 2OBGA 3PWLA 4MNHA 2GJ6A 2ADIA 2VO5A 5D1ZC 4WI6A 5IR1B 3HPLA 5F71A 1CE1H 1YECL 5E94B 3JV4B 4PJCF 2EDRA 4IJ3C 2HT3D 4KAQH 2C1PB 2D9QB 4OGXL 1HWHB 3BO8A 2P8MA 4YR6A 4HWZB 2G5RA 4GMSH 3ARXA 1ED3A 2BRRH 2BSSA 3GSVA 3RNQA 3CVHL 3RVWC 3W39B 1CDCA 3LN4A 5GRXG 1XZ0B 1CDYA 4O02L 1MCBA 2O61B 3HZVB 4ZOBA 2IAND 3LH2L 1BQUA 4E5XB 1ITBB 3P2TA 2B8OT 4HK3N 2KH2B 1MHPH 2ZSWA 5I6XC 1QOKA 4CNIB 5F1SA 4EI6A 3B5HA 1QQDA 3GSUB 4AEIL 1NGXA 4L8BA 3TZVC 1A7NL 4MYWB 4XNXH 1LO4L 3VMOA 1OW0C 3SDAD 3P4OA 5ITBL 3T0EE 5DD3H 2OP4H 4JVPA 5IKCA 4JREB 3CGTA 4G8IA 1RZIA 4HT1L 1C08B 2AXJA 1MRDL 4IOFD 2FO1A 3C60B 4OF7A 1I9JL 3IFOB 5SWSD 1D5BA 3OJMB 1AGFB 4P23C 3LPGA 5KS9E 5F9JB 1QBML 4N5EC 3C6LA 4F15C 1BBJA 4DN4L 12E8L 4XVSL 4PP2B 5AG9A 1IM3B 4YNYA 2Z92A 3C5JB 2H32H 3U6RB 2ADJB 4RGND 5T1KB 4HIJA 3ARFA 3H9ZA 1MCWM 3VH8G 1GZQB 5IVXA 1PFCA 2X1OA 1AE6L 1KJ2L 3I02A 1NC4A 2BFVH 3O4OC 4QHUB 1CT8B 3BQUA 3PDGA 3TIDB 3UROR 4EKXA 2ZJSH 5E2TH 3G6JF 2XPGB 1B9ZA 3WS3B 4E41E 2Q8BL 4NO2A 1DQQA 1EUTA 1S8DB 3GI8H 3L7EB 3MODH 5JW4R 4OV6F 1LO0H 4OV5B 4GAFB 3KHOA 3B3IA 2YD6A 5IMOB 3FQRB 3OXRB 2R56H 2LABA 4PG2A 5DJDA 4HAGA 2WWKO 1QBAA 1IQWL 4UT7L 1NCBL 2Q20A 1BVKB 3RDTC 3E8UL 2XRAL 4G7VL 5T1MA 1BVZA 1HHKA 4AK1A 1B2WH 1IZJA 2ADJA 5AWNL 4G8GA 3IDNB 4XPFH 5JHLH 5DUML 4ZTPL 2NX5A 2BVQA 4F2MB 4PJDA 4WWKD 4HC1A 2ZSVB 3S3JA 4GRWE 4MNGA 2OR8A 3D3VA 5HTSA 2GTZA 3FT2A 5FHBL 3NCEB 4JHBA 5T5FL 3W0WD 4Z5RB 1S7SA 4OFYD 2CSPA 3U46A 2HJLA 1MCFA 2YA2A 1JIBA 5MEPA 1KEML 2HFTA 3QJHB 3F65A 1OLLA 4P5MA 3X17A 5K9JH 1GAFH 1KN2L 5EU3A 4D0DB 1P84J 3ES6A 5IW1B 1BD2A 1KJ2B 3RUGB 3QCVL 3HNVL 1ZK9A 1QA9B 3IDGB 5IHLB 5IM7A 5IQ9A 3W82A 3ZTJH 1IE5A 4G8FA 4XX1G 4P2OA 4UT6L 1MH5B 5DD1L 2E8YA 4X4XA 5EBWA 1CXEA 1JPFB 1N5AA 5B39A 3WNLA 2VL5A 1PZUB 2O5XH 1O7SA 2WIIA 4U49A 3BD5A 3FO0L 4UV7L 3PL6A 4XAKE 3ILPA 3I6KB 1D9KA 5TDOA 5IEKB 4TRPL 1ZV5A 1HHJA 1F45A 3OXSA 4U1GB 2NY0B 1I7UA 2Y36H 3JBG7 3ZDYE 4YX2L 4P46C 2X4PA 1XCTA 1YEEH 5C6PB 2IFFH 1LQSR 5EZOH 4LPUA 2ADGB 1J0JA 1W8OA 3MRPA 3QCUL 4WIQA 5E99H 4JRYE 1UEYA 4KZDH 1KTDB 5C08E 2YRLA 4YHMH 2QQQA 3LD8C 3PHQB 1U8NB 4ELKA 4PRHD 1HHIA 2DM4A 2IBZY 4NNYA 4X8JA 2MCG1 1OM3L 1QLEL 3CLFH 4GG6A 5C2BH 5JTWA 4HG4J 3MGOA 3L3DB 4WUUE 3TLRA 3QUMA 1LO5A 3FMGH 4P9HL 2P44B 1UB5B 2IPUK 5GRYA 3HZMB 1RJZB 1JTPA 2GKIA 1T89A 2F54B 4DGYH 4HH8A 1HSBA 2VDOL 1FSKC 5DTFB 1ZEAH 3QUKA 3MZTA 3TNMA 5H94B 4FQXA 4NN5B 4JM2B 1KJ3L 1U36A 4N9OB 5C0JB 3HPJB 3CCHA 4WI8A 2NW3B 3BZFA 2WWMC 3ARED 3LKRA 3WFBL 3RWGA 3AAZB 3CDCA 4BJLA 1I9JH 3HZKA 3TO4A 3VXME 3LH2H 2OQJA 2BVUA 4XVJL 1FFOA 1A9EA 2PR4L 1CFNB 1AXTH 5GGSA 4U0QB 2VDMH 1CLYL 3RL1A 2BNQE 4QLRA 1BVLB 3RZWA 4NZUL 4I5BA 1VB9A 1ACZA 1P4IL 1U8QA 2BFVL 4HQQH 5DVNA 5E2TL 2WBJA 2ARWA 4QXUL 4JPWH 4WFED 2EXYD 3ROOA 1A47A 4IS6B 4NNXA 1MF2H 3A6BH 4LRIA 4D8PA 5ALBH 2XKNA 2IANE 4PRPE 4XWGH 5E8EA 4JFYA 1ADQH 1GL4B 5MP6L 4KRLB 1FLTX 1JF5A 1DQDL 5FKPB 5K9OA 5CJQL 5HXMA 2ATKB 4OZGF 2FL5B 1IGYB 2YEZB 1IQWH 5B3JF 2WK2A 2X40A 3FONB 5GJSH 3RP1A 5F7YC 3RNKA 4NWUH 5EOCJ 5MEOA 3NCYS 1RUAH 4LEXL 3S88L 1ZHLB 4OB5L 4CNIA 5HI5C 1EGJL 1CDIA 2K9UA 1FFPA 4YBQC 1WICA 3QYCA 1OQOA 4L4VB 3RWEB 3ULVH 3RWIA 1N0XH 5BMFH 5C0RH 2VB5A 4M6NL 1GCFA 5IWLA 3FJTA 1PYWB 5BVJA 4M1CC 4JLRA 1AGDA 2PW2B 1Q0XL 5FGRA 5DYOA 1LO5B 3DI2B 3O4LD 5BV7B 3X13B 4CMHB 4ZFFA 3NA4A 4QRUB 1JGEB 2IAMD 3EHBC 1H8SA 3TIEB 2V9RA 4WENB 3SCMD 3VFPA 5F9OL 1Z9SA 1RZ8A 1RJLB 3O45A 5T5NF 2QR0A 5L2KB 1G9ML 3CH1B 1FVDB 3ARWA 4YUEL 1G7LB 1HYSC 3QEQD 2DQJH 2VKWA 1FNSH 5ICZB 4Y16B 5D7LB 4L4TB 3LQMA 3RJDA 1Q9KA 2Q3ZA 5CGYD 4KDTC 7FABL 3NVQA 5E8NB 4KXZI 2GSGB 1H3XA 5DJCA 4N0FB 1ZT1A 3BKJL 1AGBA 2FGWL 2CXKA 2ICWA 3MOBL 4HCRL 1MAJA 4G6KL 2RGSA 3W2DH 3M07A 4PJFE 3VG9C 5HYEA 2NTFB 2D0FA 3HI5L 1DSFH 3SDDD 1ZS8B 1HILA 1MJ7H 4PGEB 3MA7B 3DUSB 3DRTA 4MSWA 3L5WB 3WUWA 1QSEE 2EYTB 1S7RB 1BOYA 1QKZL 4JZJB 4YDJA 3WD5H 3VGBA 4M7LL 5T3XH 3D3VB 1IMHC 3KLHC 4EIZC 5I9QB 1A9EB 5E4EB 3ZDYF 5I0ZA 2WBKA 4UV7H 3IU4H 1T03H 3IDNA 3HR5A 4J3XA 2BHZA 2O5YH 5D7JC 4GAGH 5KSAC 5E6IA 3Q6FB 3KYNA 1WBZA 4QXWA 3KYOA 5GS2D 3HMXL 2JB6B 4LVHC 4ONFL 1CFSA 2AK1L 2ATPB 4XC3L 1S9VB 3D18A 3N06B 3RGVB 4Y4HB 3AC0A 4NC1E 1OTSD 1YEDA 3H9SE 1FGNH 2R29L 3CVIL 1HHHB 5KTEH 1MCSA 4PJ7A 3VXQB 4HV8B 1MJ8L 5SWZA 3CUPA 4UB0H 4LQFH 3ARBC 5F96H 3ARRA 4I1NB 3JXAA 2ZUYA 1JJUA 3BE1H 4L4JA 4Z7UF 4O58L 1BZ7B 5C70A 3VRJB 5E70A 1RURL 3OJDA 2BVTA 1L6ZA 3VH8A 4EN3B 5D7JA 3B9KA 2D0HA 1Z9MA 1MEXH 3O81A 2BXZA 4DZBA 5K59E 2FYYB 2ICWI 1HK6A 4ZUSA 3WXVL 5C86A 2P5WD 2VUYA 5FHAH 1UM5L 1SQ2N 5BRZA 1NGXB 3K1DA 4L8BB 1ZLSH 1NCDL 4OT1H 3RA7H 5JQHC 4Y4FB 4P5TC 4Z78A 4XP4H 2X4OB 2R4SH 5MI0B 1F4XL 3KGRA 3DOSA 4PRIB 5TE7L 1NGYB 3ZO0A 2NY0C 3T2QA 4GS7C 4EN3C 5C9KA 1CICB 5CJQH 1MREL 4LIQH 5C2UB 3V6OC 2Q7NA 4KROD 3QJFA 3B9KC 1CL7I 3MLRL 3P9LB 2W9LA 2A6DA 1H3WM 3B8YA 4M5YL 4RFNC 1Q94A 3MV7A 1TETL 2ADFL 3TYGL 4G8IB 1XGUB 3RWDA 3QWQB 1U3YA 4B7LA 2F19H 3MLVH 4O4YH 2P24A 5DO2C 1E6OH 5JR1H 3HZYB 5DJ6A 2BOCB 5I1GL 2DDQL 1Q9OA 3KPLA 2Z93A 3GSRB 4O2CA 5SWSB 1WZKA 8FABA 3CMOL 1IKFH 3KPMB 2A1WH 4RIRB 4Y2DA 5DK2B 1K3ZA 2FATL 5C0AA 3MO1A 4IRSB 3AM8C 1NEUA 3OKDA 1P5UA 2VXVH 4OD3H 3OKMA 4GW4B 4RAVB 4PLJC 1BF8A 4R4FH 4Y19B 5DXWA 4EI5D 3T0VA 2OR9H 4Z7VF 1VSCA 3MFFB 4UILH 1UACL 3S88H 1BBDH 4DUXA 5TFSL 3QDME 4KC3B 3QI9C 4IRJB 5DK0A 2BK8A 4NUJA 4Z8FL 3FCTA 4HT1H 2WWKT 4MCYA 43C9A 1CVSC 3VFRA 2AJZA 2VLKE 4N8VG 4IMLB 3REVA 3LKQB 3HI6L 3H3KA 1EFQA 3G5ZA 1KV3A 4G9FE 2YK1H 4ZXBB 1DJSA 4Q58C 4JQXC 1LEKA 4POZC 3L1OL 2C4FT 3QDMB 1DQMH 2ZSVA 2CO7B 3C8KA 3Q5TA 2BERA 1KBGL 2Z35A 1HSBB 3MRFB 3QPXL 1OGAD 1KT2A 1FGVH 3L95B 2LAGB 5EZJB 3JWDC 3PUCA 1HXYA 5KG9A 4IMKC 5CP3H 1P7KA 4S1SH 2H26B 2FBJL 3INUH 5DVOA 4MJIA 4OF6A 1IGTA 3OKYA 4I48B 5HGBB 4KY1H 3VXMD 4UTAH 3C5ZC 3ARBA 1UC6A 1OW0A 2EXWC 3UTTD 4CVXA 1NCBH 3KPQB 3OHXB 2VLJA 1KIPB 2ITCA 4X7FC 3VGAC 5IJKA 3J8F7 2XRAH 4IIQC 3DMMD 3G6JA 4L4VE 4BA8A 4NDMA 2UUDH 2GFBB 5ID1B 1CIDA 3ESUF 3I02B 5DMYA 4L8DA 1RZFH 4RGNC 3GUTB 5EUOB 2BOBB 3A67L 3AFLA 4Y4HD 3S35X 3MODL 3WIFB 1RJLA 1ZA3A 1LP9F 1ZWIA 3AS2A 3FB7A 1VKXB 1UZ6F 2CIIB 5CBAB 5C0EA 5KANG 5FUZH 1J1XL 3GMLB 1OL0A 4JRWA 4MJID 1MFDL 4OD1H 1EVTC 2KQNA 4GRMA 4OFIA 4BH7B 4XRCA 4D3CL 4MQXD 4X9GA 1F58L 3NZ8B 1NFDF 3WNMA 4HS8H 1B2WL 3KPQA 1RZ8B 3OHXA 4U3XA 3S9DB 1KCUL 5C0BE 2VSCA 5EN2A 5F70A 1BQHB 2DTMH 4ZSOB 1LEIA 1EEUA 4MLSA 3V0AC 4XWOC 1PKQB 4PJIE 3PHOA 2ESVE 4LPTA 3GI9L 1QSED 1FFPB 1G9EA 2IF7A 3QT2A 4H88L 5I30H 5DR5H 1YA5A 4V1DB 3AS3A 1OD9A 4OT1L 4ZS7H 2Q7YA 2R0LL 1XR9A 1V8HA 5EA0H 1BX2B 5C0AD 1M05A 4L9LA 3X3FH 3U46B 3VGFA 2DWDA 3P73A 5D1XD 3LKOB 3LRGA 2B7DT 4UTBL 2PO6D 4XPGL 3LD8B 3UX9B 1F97A 3OKNB 4R0LA 5IF0B 1AGEB 3G08A 4MZ2A 1H3TA 4YJZL 3BP5A 1NH6A 1DL7H 5FO8A 1MREH 2FD6L 5DWUL 1KSRA 2JJTA 4Q0XL 2IWGA 1A6VL 5ISZA 1HIMH 3SBWC 2MHAA 3ZE0F 1BVLA 1QRND 2A0LD 4MA3B 4CVZA 1TCRB 5DD1H 2CRMA 1A7BA 4E0RB 2VOTA 3PQYE 5M7QA 3RKDC 5EBLB 2FHBA 3ELAT 1NFDA 2E9BA 3QXAB 2VZOA 3L9RB 3BN3B 2AEQH 4WUUB 4XP4L 4ORGA 3EGSA 4LPVA 5K93A 3SGEI 3CFKA 1JTTA 4XPTL 1XT5A 5IW3A 1PQZB 4GMSL 1I85C 1SMOA 1VEPA 4MX7B 4NT6B 5C0NC 4ZYKB 5SV4A 5TF0A 2OTUB 3OF6D 4PR5A 1S9VA 2G2RA 5BRZD 4NN6B 3FT3A 4IJ3B 3STLB 1FL3B 2H2PD 3MRHB 3OGOE 4PJHE 3P4NA 2DYPB 2R69H 5I74C 1SY6L 3AMLA 5B38A 1BBDL 4XCFL 2HN7A 5HYQA 5DT1H 2AJSH 5IHUH 3VWJA 5CJXC 4PRDB 1IFHL 2X4QB 2KQMA 1OM3H 4OZIE 4I2XA 1AGFA 3MCLL 1PEWA 2F58L 5H8DA 1A3RL 1EFXB 4HXAH 3MRBA 4JGUA 5IBLC 2FATH 4NCC2 4PRBB 5FYLE 2NY6C 2GI7A 1VFBB 2P5WA 3WFHB 3H7BB 3MRQA 2QHLA 3IDUA 4MNGE 1S7UB 4NKOA 4NO0D 4PJDE 2Y9RT 4WFFE 4UIKH 4QXGH 1BQSA 5EIVA 4WEUD 5KJRH 4WI2A 3P4MB 3PWPB 1UACH 1UJ3A 2FLRT 3MV8E 4YR6B 1FFQA 4L3AA 5JNYA 1NMBH 2BJML 5DVKA 1NGPL 4ELKB 1KIQB 3LDBC 4OKVA 3F5WA 2KL6A 1BFVL 5A2KH 1FNEA 2A6DB 4HIHA 4HPOL 1NEZA 4HKBA 1JHKL 3DO7B 4LNRA 3VXRE 1K5NA 5DJ0B 2AEIT 4RA3A 1F6FB 4K8RH 4F2MA 4OLZL 3DROB 1ZHNB 4YXLH 4X6CF 3FKUS 3T2NL 3DX9B 1FGVL 2ICES 1OAXL 4XMKL 2Y5TB 3RX8A 1AR2A 5C0GB 2DF3A 4RFOL 2IADA 3PGCA 3RIAF 4HF5L 1NDGB 4RMVA 3MRNA 4PGJA 3S37L 2N1KA 4KK5C 1FORL 1AY1L 3C60C 5DDHA 1WZMA 1U3HC 3HUJE 1MI5D 3VGEA 4MQSB 2GAZA 1P4LB 5EPMB 4HUWB 1GGCL 2FX9L 5IUSA 2NXZC 4HS8L 5D1QA 5GGTL 5J13C 3GSOB 3WUZA 3WE6A 2J8UA 4GBXD 1ES0B 1QSEB 1UZ6E 3B9VA 3GSQA 3K4AA 4JB9H 5E8PA 1D6EB 2HT3C 1F90L 4GXVH 4P59L 4X9HA 2N7AA 1QBLL 2AERT 5I76A 1HZHH 3SDXA 3DGGB 3ULVL 3GIZH 4TVPL 4XBEH 4MHHI 1MAMH 1NUFA 4H0HB 4NPYA 4YBQD 3BRDA 5C8JB 4HS6B 1EO8H 4NWTH 1E6JL 1INEH 5DZOA 4EXPX 1D7FA 2HVKB 5JORB 1TENA 2R2BB 5DK2A 2YUWA 4JPKL 3QUYA 3TT1L 4NO3A 3P77A 2AQ1A 5GGSY 1J0KA 1FIGH 2QSVA 4OD2A 2B4CH 3BPLB 4U2ZA 3KYKL 3ROOB 1QBBA 2RIKA 2Z31C 1RIVH 4YHYB 3L5IA 4ZG1A 1FHGA 1TNNA 4IRJA 3HNTH 1EPFA 3FFCA 4D9QD 1U58A 4Y16A 1U8IB 5LWYH 2Z91B 3L3OA 4POUB 1C5CH 4NC0B 1IC1A 3X12B 3D39A 4GH7B 4XPAL 2EC9U 1I8IA 1S7QB 1QNZH 4GLRI 4X9BA 4OSUL 2WLYA 4AY0A 2ICCA 2P45B 3C5JA 3FRUB 5EU4A 3U2SA 2FGWH 5BW7A 3QIUC 4YO0B 4PRIA 4NQSA 5C0AB 3BKCL 5ANMB 5C0BD 5FK9B 4QRUA 3MLPA 1OTTC 3JSSA 3RAJH 2XFXB 3DBXA 4HXBL 3IJSB 4OLEA 4NZJA 4ZTOH 4CADA 2MQ0A 1RIHL 1EJ6A 4M6OL 2JKXA 4MNQD 3P4OB 4K3EL 3QRGL 2I07A 2PYED 4LCCA 4TQEH 4JFEB 3G5YB 3QXDA 3BRFA 2DAVA 1AJ7H 2DQTH 5F6HI 4BSVB 3MSPA 4L4TA 2X6MA 5FYJU 4RZCA 3TNNB 3VRLF 1JPFA 1SYVA 4LU5L 5H37H 3DVFA 4OKVB 2ZUQC 5CD3B 5AZ2L 2DQDH 4YIQB 2X70A 4NNPH 5TQ0L 4PLKC 4PJ7E 3LRHA 3QHZL 4M03A 5J9PB 1T7WA 1LE5B 1FN4A 5FUOL 2VDPH 3H7BA 4GAYB 4MD5A 5FGCB 1EAPA 1WEJH 1LO2H 4LSRL 4PJCB 4YHLH 1B3JA 5CZVH 1R6VA 4H8WH 4YDLB 3PQYD 3E3QC 3L3JA 3IFPB 4R90H 5D71L 2I07B 4J23A 5SX4I 1YPZF 5CWSB 1GZPB 5C0FA 2ORBH 1YMMD 2CMRL 1CLOH 3B9AA 3UP1A 5MEQB 4ODHH 1T04B 2YD5A 1AFVL 4CU6A 5T3ZH 1CLZL 3BEVA 4JFXA 4AH2B 1Y0LA 1JVKA 2MTPA 3WLBA 4P5TB 1NMCC 4XNQA 1TCMA 1BM3H 4NKDB 3ZT6A 1JHKH 2YRZA 1MJUH 3CFJB 4ZOEA 3DHJA 2DLEA 1S3KL 3CXDL 5I76B 4OFKA 5IMLB 2JCCE 1ORQA 1OWWA 5F8RC 4HUKB 4K94C 4XMKH 3L5HA 1TITA 4IOIB 3B2UD 1EEQA 1U41A 2ZCKH 2F9BT 2HJFA 4XAWL 2VABB 2BRRL 2X7LB 3C8KB 3MXVL 4BFGA 2NY0D 4HGMA 3T4YA 5KSBB 3UYRH 4MJ2A 4K7PY 5KSUA 5B3JE 1EA9C 3L6FB 2CDEA 4PY8I 3MR9B 4RSVA 4PJ5E 3WHE1 3ZT7A 5FYLL 1U8JA 3MV9E 3U0PA 4OI7A 5FA4B 2WIMA 5ISZB 1DCLA 2E7HA 4ENEC 1I1AC 1A7OH 1J1PL 1QSFB 3U4BH 3K1KC 4K2UH 3B9EA 5D1ZA 5ACZB 3GIZL 4V1DA 1VFMA 2AXGB 2C4FU 4X98A 5DO2D 1J1OL 3LRSB 4RMUA 2D7QA 4YEFA 4GW5B 2DLIA 1E6JH 1A6AB 2VISA 3QI9B 3GJFH 2P48B 5DYOB 3KXFA 2C7UA 5E5MB 4D9RD 5E7FA 1RHFA 3LMJL 4DKEH 4CMHC 3QXTA 2N4IA 4J3UA 4YXKL 5FM4A 5F97E 4JFQB 5HD8C 3BH8B 3HHRB 1JNNL 5HHXL 4YFEA 2IMMA 2AK4D 2UY6A 4FG6C 1OSPH 4PS4H 3S34L 4PV9A 3WSQH 5TGBA 4QRRB 3GMLA 1G7LA 2NXYB 4DW2H 3UMTA 1NC4B 3EYUH 2XXCB 1R3HB 3QFJA 1MAML 1Z3GL 2QTEA 1CK0L 1BBJB 3HN3A 5GGQH 1N6QL 4XVUD 2H3NB 1MI5E 4OSUH 3S6CA 4NZTL 4TOYH 3P9LA 3EYFA 5DC4B 5E9DB 1HOCA 3D3VD 4WFGD 1AHWB 2AJ3A 5I66B 5I0DA 2FO4B 2QSCL 2EDYA 3PHOB 2Q8AH 2AJYL 3G9AB 3C8DA 1YYML 1KBGH 4GLRH 4NJAH 5IK3B 2FSEB 5DC0A 1A7PL 3ULSB 3BQUD 3FQWA 3MGAA 2VZVA 5D1XA 2A6KB 1T7VA 5DD5L 4KKLC 5GRJH 1ZXQA 5AWNH 4J2XA 4YXHH 1A9BB 1N8ZB 2Y07H 4WWKC 1W72H 3UTTB 2V17H 2VTFA 2HT2D 4X9FA 2EKJA 3CFCH 3ARDC 3DXAB 5AEAA 4U6XA 5E0QA 3GIVB 3VXUB 3FQXA 4EN3A 1SVCP 5TQ0H 1VACB 5ENWB 1S9XB 3F7YA 3DVGB 2EDTA 1RMFH 1NFIB 4NDMB 5FUOH 4J1UB 4L8DB 1G7JA 3IDYB 1RK0A 3I3EA 3QIWD 4HMEA 5EC1A 1W0YT 4WO4D 1GVIA 1KB9J 1QD0A 5HI5D 1RFDL 4IM8A 1D5XB 4MD4B 4WTZG 1T3FA 2W0PA 3CPLA 5I15L 2J5LB 5CJOL 4CVWA 3O6ML 3MRJB 4QTIH 3SY0B 4RNRA 2E6PA 5EZLB 3OAZK 5AD0B 2OCFD 1TTFA 1EBPA 3MLSH 3KYAA 3O6KL 5GGVL 4AIZA 5DD0H 1BZ9A 3ULVE 4WTZA 3UJJL 2W92A 4HMCA 4XBPB 3EZJB 4W68A 3BPCA 3GMNB 4LSVL 4DAGL 3QEQB 5E8DL 3GBNH 4XCCL 1AD9B 4JDVA 3LV3A 3SE9L 4JANA 1ORQB 5D93C 3MRMA 4XWOD 2DJSA 3MREA 5LQBL 1OOAA 3D18B 5J3HC 4JPVL 2BVYA 1BD2E 5AAWA 3MRJA 2E7LA 1DBBH 4TYUA 5C0DB 5EU7C 3SKOB 15C8H 3P11H 5DI8A 4JR9H 4H20L 3KPRB 3GJFB 1G7PA 2EIBA 2YD3A 1RJYA 3B6SB 5FYKU 2MQ3A 3QUMH 5D1XC 3UTQA 1LO3L 2UYLA 3STZB 3WFDL 5ABDE 3FB7B 3OJVC 1CXFA 3NAAH 4PJXA 2RCSL 5IMKA 3RPIB 3PGDA 4XXCC 3VD4A 1KTDA 4PYHA 1T1ZA 5T33H 2HTLD 4Z76B 2Y1VA 5F72S 4AL8L 3ULVF 3T4AA 1WIOA 4TUJA 3SDXB 1G9NH 1WISA 3T65A 5IJVA 4S1DD 4U0RB 4YHIB 3V52H 3ALWA 3PDDA 4R4FL 2ZPKH 1F4HA 5JDSB 1DQLL 1GOGA 3K74B 1YN7A 3Q48A 3LSOB 3SQBA 3PL6B 1YPZB 1YJDC 4KHXH 2WUCL 1FC2D 5I1JL 4P3DB 5C07A 3NZHH 4RMSA 3ZKND 4PTTA 5LGHL 4HCRA 3REWA 4ZUVB 2YMXL 3QWRA 2NY1C 1FVCA 4KJPC 2PYEE 3DRQB 3LY6A 5C0BB 1CS6A 4I0KA 4E41A 2YK1L 2GITA 3PJSB 4MAYB 2EIZB 5E03A 2XQYK 3ZYZA 4FP8H 3EYUL 3Q1SH 4PJGF 1XCQB 3WFCL 5HGDA 3D39D 4QTHA 2P47B 1G1YA 3BZEB 4CW1A 4KQ4L 3DURA 4JFED 2IC2A 4PJXE 4HX1B 3B83A 1JPGB 3H9YA 2FYYA 3ZSTA 1H5BA 2AGJH 4OCXH 3NCBB 4QWWC 5C6WH 3PWPD 4C56E 4L8CB 4G8GE 3RGVD 4K8RL 1WK0A 3MRMB 4OF3A 2PXYB 4YDIL 4CMMB 2GTZB 3FT2B 2IG2L 2YD8A 3AXLB 2R4RH 4BUGA 4YQXL 1LP9E 2OJZH 4TTGA 3HAEB 4X7DC 4E42B 1NBZB 3HFML 1A6WL 3QUZD 4EZMA 4X5WB 4JY6A 3AAZA 4GQ9L 4OZHA 1OGTA 5D5MB 1IGYA 3A67H 4I3RH 5FCSH 2UYLB 4JFPA 3O3BB 4ZXBA 4M9PA 5CLWA 2HFGH 5IHBA 2QSCH 5J6GA 3CXHK 1P4BH 4X7SH 4DCQB 2YPLE 4MDIA 1G9MC 2AK4E 3PF2A 3RX5A 3B9KD 3DWTA 3PP4H 1G7HB 4N8CL 1N3NA 2Z31A 2DTSA 2F5AL 4Z7NE 4NO2B 3W11D 3QHTC 3BD4A 4QRTA 2G9HA 4LDEB 1KB5B 1WLHA 1VFAB 4PD4J 4LKCB 4I0PD 5L8LB 4M02A 4K23H 4U1LA 1DEEA 3OZ9L 1FYTE 3T09A 2OK0H 4UNVA 4W4OA 3TVMD 1IQDA 4APQD 5FCUL 1NSNH 1OY3B 4HIEB 1CD0A 1PGRB 1T4KA 5HHOE 2A74B 4C57C 5CD3A 4ODSL 5HYSB 1HKFA 1JNLH 5JW4M 1WTLA 2XICA 1QLRA 4PJ5D 1A64A 4C54A 2UZIL 3E2HC 4GBXB 1JPSH 1U3HB 2HKFH 3ECBA 4KK8C 3WMSA 3SKJH 2JB5H 1LDSA 4PV8B 1EJOL 2BOCA 1BGXL 1J0YA 3OKEB 3SE9H 4LVOC 3RWIB 3TN0A 3R4DA 2AEPL 2HMIC 2APFA 4HX1A 3CDGB 4R97B 2ZUSA 1IILE 3ARGD 1J10A 4YLQT 5DJYB 3VXOB 5GGVH 3V8CA 1QR1A 4R0LB 5GZOC 1ZVYA 3H42L 4MS8C 4AEHH 4JM2D 4ZOAA 1CVRA 2NX5E 2Y5TA 1Q0YH 1S78C 3K4DA 2FB4L 5D2NA 3ULUF 4KKAC 1XIWD 2F15A 4HZLA 4PV9B 1BLNA 1QRNA 2LAAA 2QQLL 4YK4B 3IU4L 2GJ6E 3AU1B 4QHMB 3IDIB 1N8ZA 4FQIL 4W4NA 1CFQB 4I2XB 3FN3A 4PD4K 1FL5A 1XGTA 3SGDI 1M6OA 1X5KA 5F8QC 2IALB 1F02I 4ODTL 4GS7B 3VD7A 1DBJL 1K85A 1KG0B 2YOCA 5C09B 4DTGL 1CDUA 1HXMA 2R69L 3OX8A 3LAFA 4R3SA 3RAJL 3VXTA 1UGNA 4L3CB 2VIRB 4FQ2L 1G7QB 2ID5A 1IFHH 1VENA 2NY6B 4PJCE 3DBXB 1CXHA 1MLBA 2DKSA 3VJ6A 4HJ0C 1P6FA 1LEGA 3L95A 5EZJA 3VFGH 4OBRA 1TDQA 1MLCB 3EO1B 4HHAB 3QWRD 4BQ9A 2MCPH 3EYSH 4LSSL 5DHVB 5IGXL 4A2LA 1CTNA 2PETA 4WTWA 5JO5B 4I0PB 3VG0L 5EU5A 3MOQA 4WU5B 1KCRL 2E3VA 5EU6D 2BSRB 1UM4H 5KAQG 4WU7A 4ISVB 4Z0BH 5EU3B 1NCDH 1FVEA 1AR1D 4OZFA 4WDIA 1DBAH 1HHGA 2E7CA 3LDBB 4ZPTA 1KF9B 4MQXC 1ZHBA 3QFDA 4I4WA 3BN9C 1FCGA 2XN9E 3GSNB 2IPUG 4OZGA 1CT8A 1PSKH 2JTDA 3TIDA 3KPOA 4FRWA 4M5ZH 4K7FB 1A14L 4R2GB 5F89B 4UINH 2ZNWA 5DMKA 1YN6B 4LFHG 4KV5F 1UXSB 3ARVA 5C0GA 3LRSA 2ZZUT 3MNZA 4UU9A 4F57H 1L9MA 4MJ4A 4FQCL 3N85H 1WFOA 5IB4A 2E7BA 3GMOB 3HFMH 5T3XD 5HYIA 3FOMB 4M7LT 3K2UL 4NKIH 4M1GH 1JPTH 4LP4A 1BQHG 3OKNA 1MQKL 5DJAB 3SE4A 2IANB 3T0EC 5FDWA 5CAYB 2RR3A 1F11A 1T1WB 1NGZA 4XCYA 2X4TB 3I75A 1QPPA 4NQEA 4AM0B 3LQAC 5BS0E 5EDXA 5IFJB 1GPOL 5A16A 3SGJA 4MAYC 1RUKL 2AGJL 1I7TA 2AK4A 1CL7L 1HQRB 5SWQB 3HZMA 2HH0H 4P5KA 2R2EB 2BVEA 5TE6H 3IYLW 5IB3B 1MCDA 4U1KB 4GG6F 1T1XA 2F53E 3OPZL 1I8MB 3P0VH 3GMRB 5IFAH 1EZVX 3U30B 2YR3A 5C0EB 1RD6A 3CNKA 4HWBA 4K8RC 4JFEE 4JKLA 4ZNEE 4JO1H 3WN5B 2ZJSL 4JKPL 2EDNA 1N64L 1FNHA 5I1KL 3AY4C 4YC2C 1MWAL 1BFOA 4JAMA 4I9WE 3CZFA 3BDBA 1UQSB 4FQQA 2H9GA 3GSNL 4HKBB 3RHWK 4X7SL 3BWAA 2HLAB 3SE3A 2AW2A 3BPLC 3DMMB 5FUCC 2VLJD 4Z7OE 5MEQA 2APTA 4LOUD 5JW5A 2JJVA 2PYEB 4JO2H 4JVWA 1EJOH 1JFQH 5T3ZD 1Z3GH 3IDYC 4AEEA 1CFNA 3B2VH 4QYOB 4R7NB 4K7PH 3R8BB 3HS0A 4QRPB 2VLME 1BPVA 1YEHL 1OPGL 3KYMB 1JZ2A 5CP7A 3CVHB 3I84A 2X44D 3IS0X 3D0VB 1CD8A 1CFTA 1R5VA 3B9DA 1UZ8B 2OJEB 3I50L 3VI3E 8CGTA 4KU1A 3SDXE 5KSBA 1GGBH 3LQZA 4JO3H 4P2QB 1CG9B 1OWRM 2L7UA 1GRWA 3ZL4H 3MUJA 4A6YA 4FFYL 2W07A 1U6AH 3TBYB 2VABA 4QRPE 1CZ8H 1UVQB 4LVEA 4MCYB 4G3YH 4PJ9D 2B4CC 4P2OD 4PGDA 2X4TA 3EZ8A 1YMMA 3L3DA 3I75B 4X5XB 4XXCA 4Y16C 1LD9A 4NM8L 1HNGA 4IRZH 2ICEA 4XVUC 4YZFE 4ETQA 4ONGH 4X99B 5JHDE 4OI9A 2AXHA 3D0LA 3OAYH 4GSDH 3SGKC 2IAMC 1KTLA 1N26A 1Q72L 1RZJC 3WS3A 1OTUC 3WNNA 4PGEA 3MACL 3QDJA 1KT2B 3JUYA 3DETD 1NCAH 4UU9B 1CF8L 3GDBA 5D1XB 3HUJB 5DD5H 5KSAB 4KUCF 1F3JA 3CSYA 4K07A 3RIFF 4L5FL 4PGCA 4HK3J 1WFNA 5C0IA 4YHNB 4EJ1C 1XH3A 1M1SA 3EW3B 2XG5A 1OARH 4HBCH 4HUMB 3C60D 4U1MA 2WIIB 4H8WL 2HT2C 4YAQB 5IQ7L 4JFDE 2NX5D 2GJJA 5E08H 1QACA 2ZSWB 5IWLC 3X3FL 5KVGH 1KYOJ 1T0NB 3MGTB 3K3QA 1MCKA 4EVNA 1AGEA 2P1YA 2N7BA 3CLFL 2CUIA 3O11B 4LEOA 2B0SL 3R06B 4P46B 5BZWB 4C56A 1H0DA 4GMTL 5JUEH 1QYGL 4M4PA 3VFUB 2PR4H 1DUYA 1CXKA 1NBZA 3CDGA 4R7NA 1A6TA 1JWSB 1CLYH 3PDOB 3D25A 1MCCA 4N0UB 4MDJB 4X6FA 3V0WH 2XI9A 5FYJH 2FJHB 2CK2A 3JV4A 3P40A 3WJLA 1PG7H 4JCLA 4Z7UB 1WCQA 4Q2ZB 3OKLA 1TIUA 4NIKB 1I1YA 2EKSA 5F6IC 3QEHB 5C3TA 4OIAA 4PB0L 2VLLA 1KENL 2H8PA 4LRNL 5F93C 3MNWB 1J87A 4IHOA 5C0ND 4ACPA 4G8FB 2FJGB 4MD0A 2FECI 2A6JB 4PRNB 5GRWA 3LKNB 5INDB 1JHTB 4HH9A 1IC7H 3SDDA 2NY1B 4FQCH 3V6OA 3BPNB 2R0KH 4E5XA 1DFBL 4WGWB 5A2LH 3GRWL 4Z7OF 1CQYA 1BWWA 4X4YB 2A73B 1IM9A 2MJWA 3SO3C 5D72L 2GCYA 5DT1L 2GEEA 3TIEA 1ADQA 3KYOB 3KXFE 1I9IL 3EYQD 3NZHL 1SJEA 4YHOH 3PQYA 5GZND 4CVXB 5HSFA 4TUKL 5JOEA 3CFBB 1OTTD 3OKLB 4W70A 4D9LL 1HKLH 2VITA 5CMAA 2E9JA 4G42A 4HXAL 4KUZH 4DVBA 4HK0A 4XWGL 1YNTB 5BS0B 4LQ1A 5HDOA 4FXLA 2APVA 3BJ91 4JREC 3RL1B 1AO7B 3RU8H 1LILA 5EU5B 1TTUA 5I1AA 4F7TA 4LPWA 4MNGB 5T3XE 4LLVA 5FO9A 4OZIA 2IGFL 1MI5A 2ZCLH 3GMPB 4U6VL 3BHBB 2Q6WB 2ZPKL 3SKNA 5T1DL 5EBMB 4XNXL 1GHFL 3SCMA 1LE9A 3KPNA 1J86A 2HFEA 4KQ4H 1KNOA 5I6XB 5IB4B 1KC5L 4L4TD 4X4MA 3GJEB 3MO1B 4CBPA 4F9LA 5I1JH 4KUCD 4NRXA 4PB9L 4EVNB 5ADPH 4NQDB 3HI1B 5GRVK 1YJDL 3H3PL 2AABH 5BO1H 3UPRA 3QCTL 2B1HH 2HRLA 1D5ZB 4EQ3A 4LLMB 4Q97A 2YKLL 3VFRB 4NRYA 4LGPB 4GKSA 2Q6WA 3IDXL 5I8EB 1GGYA 2UY7A 3I3DA 2YS4A 3VRIB 4PLNC 3WL9A 1AI1L 4YFDB 1WBXB 1C12A 4XNZB 2HA1A 4HF5H 4M43L 4IRSA 2EDXA 4LSTL 4J7RA 3BH9B 5HYSG 7FABH 3L3GB 1QBMH 1CR9H 4KROB 3MA9H 1RY7B 2EDLA 4YDKL 4GG8B 2WBJD 1U2CA 2I24N 2JCCB 2F54D 2EDHA 2NMSA 4M3JA 4R0LC 5DMJB 3CH1A 1YUHB 1DEDA 3FO9A 5TE4H 5DQ9B 3NN8A 5E1HB 2B1AH 4ZDHA 4JKKA 2ZCHH 1PEZA 1F3RB 4JB9L 3HC0B 4AENB 3IXTA 3ZE1F 1INQB 3VWKC 2YPKA 2KBGA 3EFDH 2BMKB 4MWFB 4U7KA 3X11B 4U33A 1R3IH 6CGTA 4NYLB 4M62L 3O0RH 1A6ZA 1XR8A 3LEYL 4ODXB 4WHTA 5E4EC 2XYCA 3RVTD 3DX8A 3QEUB 2H8PB 4FFZH 4LHQB 2AXFA 1LK3L 4OM0H 3WS6C 5IM7B 4PJHB 5GS1B 2UZXB 1D9KC 3TT1H 1CTOA 3MRDB 5LAXB 3DX9A 1S9YB 1BGXH 5DEGA 4PJ5B 3WKML 4LK4A 3ZKQD 1KB5A 4GKZB 1OAZH 4ALAH 1RURH 2X4OA 4HLZG 4DUWA 4QHLA 4XCEB 4YBLB 3QBTB 3QNXA 1FQ9C 3MRGB 4M7ZB 1RU9L 4ZFFB 4PRDA 3LKSB 1KXVC 3JUZA 3QFJE 1OT2A 3JVGA 3ARBB 3L5XH 1XGPB 1VGEL 3FN0H 5F3BB 1QNZL 2ENYA 2NZ9C 4HIIA 3OJ2C 2EXWD 4XP1L 3STZA 1S5HB 4O51B 5D7JB 2AKRA 2R2HB 1JWMB 1TJIH 5DJXA 5ACLA 1UA6L 1Z9OA 15C8L 1OAYH 1FL6A 3FO0H 3NFSH 4NC2B 5F96L 5ADOH 3DV4B 1J05A 3MJ8B 3RIFK 3EDKA 5K9QG 1KCLA 5J4MA 5E2UL 1I3GL 3BHBA 2OZ4H 2VXTH 4Y4HA 4HBQA 3WIFA 3MNZB 3UTPD 3FFDB 3MOAH 2VLMD 4P4RB 3ARDA 4G5ZL 3TYGH 3QDGA 4IDJH 1ZLSL 3MXWL 4X7EC 1TVHA 4P5MB 3U48A 4AEHL 3BH8A 1WWBX 5ALCH 3SGKA 1VPOH 1SEBA 3BGFC 3A0OA 4MA1C 4U6HA 5I16A 5C07D 2VRAA 2AAVA 2YA1A 4MS8D 1Y18B 2NY3B 2DICA 1QTYT 4G9FA 3WIIH 4UQ3A 1FNGB 4XI5D 2OXGA 4J3VA 4LCWE 3FRPA 4JZJA 3LKPB 1XIWC 3IU3A 2EIZA 5MHSE 4F7TB 2G60H 5MENA 3BZDA 2C3GA 4I0CC 4PJEB 2OQJB 4PJ7F 4YK4C 2Q7YB 1ZGLA 2SEBA 2I9TB 1Q9LA 4Q9RH 1HEZA 3RY6A 5DRWB 5A3ID 3P30L 4P9HC 5I71C 2E6JA 4UOW1 2ICEB 1KC5H 2VIRA 5KZCB 3BEWA 4FQXD 5CCKL 3TBTA 4UNUA 3L7FA 4XGZA 1MHCB 2PXYA 2A2QT 4PTUA 2XT1B 4HDIB 2OXHA 3T0EB 2PTVA 2GW5A 4QHKI 1U8HA 2PF6A 4MD4A 1Q9WA 4LF3A 2ADGA 1Q94B 3MV7B 4ZFOB 2HLAA 1OF2B 4A6YB 4BFIB 5I17B 1RZGB 3EO9L 1AXTL 3UTTA 5JHDB 2BDNL 2B1HL 3MV11 3R8QA 1TZHB 1H3VA 5BV7C 2QQKH 3GHBH 5C6TL 4Z0BL 5I74B 3OQ3B 4JAMB 3GFUA 4HQQL 2I5YH 1ZLUK 3BSZL 1EERB 1A22B 3DXAD 5GRUH 3VXUA 4YIQA 3LEXA 2R0ZH 3IB4A 4QXUH 4Y2OA 1VADB 2E9WA 5J9PA 2QHRL 4OLWH 1B90A 1MF2L 1ITCA 3A6BL 2AXFB 3KS0H 3B4NA 4QKXB 1NC2D 2NCMA 4M5ZL 2ZOLB 4PJFF 5B8CC 2KZWA 3W5NA 1FLRH 2OL3B 4UTAL 3I6GB 3BUYA 4U1NB 5BO1L 3U0TB 4C59B 1PY4A 5GJSL 3O9WD 4IRJC 1UKSA 3ZHLA 5IW6B 5TE4L 5DC9B 3EJYC 5F7DB 4DGVH 5DJZA 2XWBB 4O2EB 1BP3B 3PDOA 4FQPA 2CLVA 2EE6A 3K8MA 4XRCB 3O41A 4Z7VA 3KS0J 1ERNA 1IL1A 1N0XL 3P0YL 3V6OE 5BMFL 5C0RL 4P48A 4YAQA 3MCKB 3TWCL 2JJUA 5SWQA 4AQ1B 3GZKA 3C09C 3FB8A 1FG2B 4XZUB 4YDKH 3GSWB 3KJ6H 4U31A 5E5RB 4WFEE 1YDPB 2YD4A 2DBLH 4NBXB 2ZUVA 4A6YL 5IP4A 5F9OH 2LV4A 1T3FB 4LNVA 4WDIB 1T20B 5E6ZA 1HEZB 4FG6D 5DI8B 2CH8A 2HKHL 4ZPTB 5E9DD 5FGSA 1WTGT 4JKPH 4IBLT 3UTSE 3P77B 5J8OA 3TBTB 2CJUL 1G7MA 3ALXA 4FMKA 4P46D 5FDWB 1GGUA 4GW1A 3PXJA 1NC4D 3NCCB 1U92B 5CIPH 5DRNB 3LPFA 1DDHA 2Z9TA 3ZKNC 3BKYH 3QIWB 3WUWB 2EYRB 1YNKL 1NC2A 2NX5B 4ZMAT 4NFDA 4HFWA 2IEPA 2XTJB 1U6AL 4OFVA 1X44A 1GC1C 1YYMH 5IROC 3UAJD 3IXAA 3LN5A 4G6AC 3VXUD 3GMPA 5D7KE 4PJEE 1Z6JT 3V7AG 2GK0A 3C8HA 5TDNA 5JPNB 1KG0A 3KPRD 3ULVC 1P7HL 1YQVL 3MBEA 5FOJA 2X4RA 2PTTB 2QQLH 4IRZL 2P8PB 1QHPA 5I1LB 4G9DB 3BAEH 4OCYL 4HEPG 1DUZA 2GTWA 5I1DB 4OD2B 2NY5C 3PQYB 1A3LL 4L1HA 1GGBL 3QJFB 3O3AA 4JO3L 2UWEE 2PO6B 2HFFA 3QEQE 3EYVB 2UZYB 3BESR 3MOBH 4HCRH 5T1KD 3CAFA 5KAQF 2LFGA 4XP9L 4L8SB 3LQAH 2G75A 4Y88A 1MCNA 4L5FH 1RVFL 1JYWA 3VD3A 2H1PH 2F74B 4R26L 1Z2KA 5ELIA 4WO4C 3ZKXC 2C3HA 4YHYC 2NPLX 2ZUWA 3KDMB 1IKNA 1B4RA 1NFKA 4G43A 5IEHB 1R5WA 1SY6H 3QQ4B 4B41A 4NN5C 5HDBF 5MEPB 2DLTA 4RMWA 2VLRD 4HULB 5DHYB 4QNPF 4YDVA 5IV2B 2PYEA 3DSFH 3SDXF 5IR1A 4JEGB 4KI1A 4LARH 4EDXA 2AEQL 2YRPA 5FYKL 2QADD 4OKDA 3RVVC 3V6FA 4B5EA 3EYVA 4NN7C 3SQOL 4DQOH 1NAMA 4GAGL 2ERJC 3FQNA 3AU1A 4Y4KD 3DETC 1MEXL 3QDGD 4BSVA 1V7MH 1IQDB 3CK0L 4I0PC 5A2IH 4AENA 3AUVA 1PSKL 4LHUB 4PRAB 1A4KB 4KDWA 2OMNA 1GC1L 5SWSE 1W0WB 5J3HD 1BD2B 2FX8H 1LVEA 4EXKA 5C1MB 2F5BL 1HE7A 1D5MB 4N0CC 1ZHBB 3IDJA 3QFDB 1KTRL 5CCKH 5GJTH 1RJYB 3SGEH 3JWOC 1JGUL 1TZIB 2DLFL 2HJKB 3WYRA 1DQQB 4BZ2L 1B0GB 1JZ4A 2R9HC 1YUHA 4NO0B 1LDPL 3EJZC 3SJVB 5B38B 4M5YH 2V2WB 1I75A 3U82B 1IGTB 1YNLL 4HPYL 3TCLA 2RJMA 1T6WA 4XBGA 3SCMC 4CN1A 2MKLC 5E2WL 4GG6E 4Y89A 2EO1A 4PP2A 5TQ2H 5DD3L 4LLDB 5HYJD 3CFEB 2FIRT 3V52L 2QHRH 2NXYD 1F4XH 4O51A 4PGZA 3VFMA 5C08A 2J8UB 4HUVA 3LOWA 1RK1B 5GGRA 2DI7A 4JO1L 1XGYL 4FQJH 4BH8A 3RWHA 1A6UH 3VCLA 2DQHH 2VXQH 5CEZL 4JG0H 3L7EA 5D6CB 5F7FA 3ARGB 1U93A 1T20A 2XWTA 3DXAE 4FABL 4U1SB 3FTGB 3QUYD 2UVEA 4H1LA 5TFSH 1DANU 3VXNB 3H2WA 4UDUA 5IFHH 1G7QA 4GRWB 4RQQB 3SDDC 5FYKE 4CAGA 4TUKH 1E4WL 1FFOB 1OHQA 4NQDE 4RX4D 3MRLA 3U7YL 4G42B 4DVBB 2IH3B 3GGWB 2GITB 2IPTH 2BY0A 1WIPA 3MJ7B 5JPMA 5DRZA 3TGXA 2B5IB 2YBRB 1PDKA 1S9WB 5JLZA 3BZ4A 4JFXB 4AH2A 5T1DH 3I85A 4LCUB 1W0WA 4DUVA 1L7IL 4YQXH 2K3TA 3IAGC 5EORH 3QUZC 3QDJE 3FO2A 4Z8FH 2ED9A 1M4KA 1G7JB 5DF0A 5ADPL 3KAAA 1CZ8L 4IHOB 1TPXB 3BN9D 1R0AL 5I73C 2IAMB 1YY9C 2B5IC 4PJEF 1A4JA 3DI3B 5T1LB 3SE8L 2VQUA 3O8XC 4RWYL 4WV1A 1MCIA 1U8NA 2LQRA 2W59A 1CGWA 1ED3B 2ARJA 2BSSB 3NGBB 3Q5OA 4OCWL 4UT9L 5D1QC 4I18B 3PP4L 5HY9B 1WF5A 3W0WE 5EU6B 2H1PL 1JYNA 5HI3D 1KLUA 1A3QA 1JV5A 2BVOB 4WHYH 1Q72H 2FJFA 4X83A 5GSRB 1UWEH 4YWGH 1MCHA 3IRZA 1FYTB 5EFIA 1N6UA 5HHME 1I7TB 1U8PA 1YEGH 1NPUA 5IEKA 4ZD3L 3NFPA 1KGCE 2J2ZA 3L7FB 4ELMA 3RWHB 1A3LH 4PJ8B 5E95B 2IQ9L 3MREB 1MCQA 1NSNL 1YQ2A 3UTQB 2ZP0T 3R0MA 4JHZA 1OCWH 3BP7B 2EYSB 4KI5F 4H0GA 5KG9B 3O3DA 4LKCA 2CKBL 4QT5B 3TBVA 1ROWA 1TMCB 2XWTB 3IFLL 2WBJC 5MERB 3ZDXF 4KKCD 3TJEH 4YE4L 3VXQA 3KNBB 3VU2A 2Z4QA 1KXQE 1ACYH 1TVHB 3CD4A 3MYZA 1BD2D 1LO2L 3HG1B 4HIXL 4URTB 5DR5L 1XF2B 5EZOL 4OIIH 5CZVL 2X1XR 3C08L 4XB8A 3O3BA 1Y18A 5C08B 4EDWH 3LEVH 1LK3H 3WFEL 3IGAB 4OD1L 3Q6FA 3HC4H 5CFHA 5F1IB 4TVPE 1IGML 5CS7A 4LU5H 3RVTC 4XPBL 3VCLB 3I2CH 4XGZB 1A0QH 1B88A 4LHUG 2OL3L 2VMFA 2A83B 4PJBA 5F7KC 1D9KD 3BGFB 4OZGE 3H6JA 1KCVL 4Z7UE 3PL6D 1RPQA 2XZQL 2R2BA 1SBSH 4FFVC 3PJSA 4J4PD 5AD0A 1J9CT 3N0PB 1FV1A 4G5ZH 4KKLD 1EHXA 4YDJB 5FECA 2XZCL 1R3JB 3NCMA 3VI4F 2VLKA 2VDOH 1QO3B 3TO4B 1OSZB 2I9LB 3DUHA 4WUUD 4FZ8L 3P3YA 4XX1E 1FNEB 1HI6B 2AJUH 1B6DA 5CGMA 3S98A 4TUOA 4KI5D 1OAYL 4DTGH 5H37G 3RUGE 3NIFF 1K8DB 1I1FA 2EH7L 4ETYA 5KVEH 1VDGA 3BUYB 3QO0A 5INDA 4APQB 2VL5B 4U6TA 3L3JB 4PRHB 1JGVH 1WC7B 4P4RA 4D9LH 4QXTB 5IIEB 1BAFH 3GMQA 3OGCA 2VNCA 4FZEL 4IOSD 3UTOA 5F7DA 3E6HA 1JHLH 4H25B 3R1GL 4U6YB 4ZNCD 2DMCA 5JA8B 5HVHC 5C07B 1JGDB 3MC0A 4U1JA 4R7DB 2B39A 4V1DD 4P99A 1FZKA 5IW1A 1QSVA 4JN2B 3D6GA 1HQ4B 4OLYL 2HFFB 3HMXA 2BNQD 2R2HA 3G6JB 1MCOH 4KRPD 3W9DA 3PWUA 5F6HJ 5C71A 5E24E 1NAKL 3GKWL 1XGYH 4WV1C 5H2BA 5C09D 5JPMB 4TUJB 2E5EA 3C5ZD 3SDCA 1K2DB 2IJ0C 1IEHA 1MNUH 3DV6A 4R8WH 1MCEA 2IQAB 2QQKL 3GHBL 2BNRD 2P7TA 4OAWB 1FJ1B 1YN7B 4D0CB 2JIXA 3BYYA 5IVOA 1EGJH 4Y4KA 5IIEA 5HYJE 1PY9A 2XA3A 1RZKH 4J3OC 3SO3B 3BYTA 3MRRA 1P9MA 3UYOD 4NQCD 4CU8A 1ZOXA 5IJKC 2MMXA 1MUJB 2A74A 5CSBA 4KWUA 5IT2H 3QZWG 4FQHA 4HSQA 4B7IA 4OUUB 5IB5A 1F2QA 3MROB 3VFNA 4QRRA 5D2LF 3OAYK 3P4LA 1T80A 2WMPA 2DI9A 1FRGH 4LPXA 3F7VA 2XTJC 1MFCL 1RUPL 4S1DC 4LLDA 4OLVL 4JFHE 4WI7A 1OAQL 4PS4L 4HUNB 4Z7WE 4M6AA 2HFEB 4EBQL 5IFJA 2DWEB 4NQTA 3VXMA 3MBEB 3QIWA 3X14A 2Y7QA 3TWCH 4WI3A 1QSFD 3ARZA 4WTXA 3PWJA 4FFWC 4N8VB 5JOFB 3KPOB 4PBXA 5HGGS 4L29B 1AC0A 3QDJB 4X8XA 4ZFZA 4S1Q