3W9DA

Structure of human monoclonal antibody e317 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
209
Chain Sequence
b'VTLKQSGAEVKKPGSSVKVSCTASGGTLRTYGVSWVRQAPGQGLEWLGRTIPLFGKTDYAQKFQGRVTITADKSMDTSFMELTSLTSEDTAVYYCARDLTTLTSYNWWDLWGQGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTQTYICNVNHKPSNTKVDKKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab heavy chain
publication title Structural basis for the antibody neutralization of herpes simplex virus
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 209
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA01
1AE6L 1YYLH 2HYMA 1CT8A 4ZFOL 3IFPB 2VLRA 3CGTA 4I4WB 4Q58C 4EI6B 3QPQC 4B41A 4XNYH 2GIYA 5EC2B 2EEDA 2ZSVA 4NFDA 4X6FB 5DT1H 3VXSB 1JF6A 3EFFB 1QSED 5MI0B 3UROR 3WKMH 2W92A 3L3JB 4HJJL 4HH9B 1U2HA 1T22A 4DEPC 4PGBB 4XNQA 3IDYC 3OWEA 2OK0L 2HFGH 2PTTB 3C08H 1DR9A 4GAYA 1QVOA 3QISA 3RNKB 3T65B 2FH8A 2JKXA 3T0AA 3WFBL 4NN6C 2R8SH 3ZLQC 2YD5A 2ILLA 4OLWH 4MA8H 4GOSA 1OWRM 3SDCD 4QOKA 3CXDH 3NH7H 3FAXA 3QDGD 3IFOA 5C0AB 2BNQD 3HPLA 4MB5A 1CE6A 2J88H 1LNUB 1KJMA 4L8BA 3MV9D 1CG9A 4Q9QL 4CN1A 3TA3B 3H3PL 3HUJE 3QULB 4G8IA 5IVXB 2FBOJ 5JA9A 3MRKB 1Y6KR 1RZKH 3ARBC 2WUCH 4MYWB 2RFXB 4P23A 3UTZA 2R23B 3MJ8B 4OUOA 4JPVH 4GH7B 3GIZH 2D31A 2G75A 3NGBB 4PRIB 2VR4A 3QUXC 1C08A 2F74A 1ITCA 4OCWH 2EC8A 2QSTA 1DFBL 4PY8J 4BH7A 1UWGL 2UYLA 1C16A 5EU4A 2F19H 1LE5B 3VGFA 4QHMB 1JTTA 1R3HA 1P53A 4P46B 3QDMA 4I18C 1P9MC 1KIPB 2R1XA 4FTVB 3I02B 3EAKA 3RL1B 3QI9A 5F7MC 2XN9D 4I9WD 5FUZH 5HHXH 3CVIL 3GO1L 2QR0A 5HHVL 4ODTH 1ADQH 5C0CE 2P5EB 3MXVL 1CLYL 3VXPB 4HCRL 2EEAA 2W60B 3TVMB 4Z0BH 3LQMA 3FB5A 4UINH 5SX4I 4LVNB 4IRZL 1F6FB 3AB0C 4R96A 1F4YH 4R4FL 2MHAB 3NCFB 5GISH 1Q1JL 2R69L 5JDJA 4PLNC 4ORGA 4KKCD 2Q87A 4AENA 4JZOB 3MA9H 3BEWB 4P9MH 1GSMA 3RUGE 3BPNC 5E5UB 5T5NG 1I3RA 3VA6A 3MROB 4ESKA 3MLYH 1XF4B 3GB7B 1A5FH 1JGLH 1G7QA 3FHAA 3LEYL 1CGVA 3JV5A 1KJ2B 3KYAA 5DUMH 2I9TB 2NXYD 4B7LA 1JJUA 4JFXB 3LKSB 3ARBA 3AUVA 5DC0A 3X11B 3GM0A 5DMYA 1S7VB 4UB0L 3K8KA 1BZ9A 4XRCB 1KTDA 4YFLI 3L3IB 1EA9C 2XOTA 4IRJC 1IILE 1ROWA 3QUXA 5FHBL 4Z7UE 4TNWF 3EFDH 4G6ML 5ANMA 2VL5B 3UTOA 3RY4A 4OFKA 2VZTA 3BYTA 1WLHA 1AO7E 3D2UD 1F3RB 1S78C 3DROB 3EOBA 3NCMA 3FQNB 3BZFA 3DRQA 4I18A 5EBWB 1P9MA 1JPTL 4NC1E 5CHNA 4G9DA 4FA8A 2XQBH 3VFGL 1FVEB 4DVBB 1C5BL 4ZFZB 3OX8A 4NO3B 4JANA 4I8DA 2XXMB 4XBEL 5IKCA 1VERA 3AMKA 1FYTA 3MX0A 5BV7H 1KXTB 3IDUA 1LO0L 4PJDA 4NZTH 1YMMB 2ENSA 1J0IA 1BQSA 4PG2C 5KVMC 4LLWA 3W9DB 1X5JA 3SDXE 1NBQA 3VXMA 3ABZA 4JQIL 2NNAA 4KTEH 3HMXL 4L3AA 4KDVA 3W5NA 3RWIA 4TYUA 1XCTB 5FYKH 3U0PA 4JHAH 4F15C 5LGJB 2XA3A 3IKCB 5FYJL 4QY8B 1A1OB 5AYUL 3VXRD 4A6YA 2ZSWA 4ZUWB 5IT2H 2VLLA 1EGJA 2R9HC 5SWSB 1WWWX 1FL3B 4X9IA 1ZT7A 4EOWL 1EK3A 1NSNL 1UWEH 4U7MA 2YZ8A 4PS4H 4X5XB 2UZXB 4S0SD 5HGAA 3BSZH 4P3CH 3WLBB 3QNZB 3LMJH 1CLZH 3X12B 4DTGH 1FJ1A 1MQKL 1FNEA 3EO1A 4EEEA 2QHRL 4EN3A 4IRJA 2IANA 3VFTB 3W0WD 1NGZA 2H2SD 4PJ9C 2VMFA 4URTB 2QADD 3RZCC 5A16A 1P69B 3CC5A 3LPWA 4NOBA 2AXGB 2R2BA 4R3SA 5EBMA 5BZDB 3QG7H 3WO4B 3DGGA 4MVBD 5IMLA 3NAAL 4LSRH 4XPFH 4Y4HB 3SGDH 3Q1SL 4P5TB 3NABL 1CFVL 3O3EB 3A6BL 2B20A 1RVFH 4KI1A 2A77L 5F6IB 4GAJL 4LEXL 4GBXD 4JFYA 2C3XA 5GHWL 4XVTH 1JHKH 5EOQH 1Y0LA 1RUAH 3F12B 5FDYA 4HEPG 4PG2A 5GZOD 4ZO6A 3WXVL 5IG7B 1MLCA 1JHLH 1A02N 5T3XH 4DW2L 2VQ1A 2IPKA 1X44A 3FOMB 1IM9D 2PW1A 4M7JH 2Y5EA 3B9KC 3PP3K 4DKDC 2GJJA 1HSAA 2VZSA 3U4AA 1PJ9A 4KJYB 2O61B 5K59E 5J3HD 2R1YB 5GGSB 3DGCR 3CIQA 2A6KA 3EBAA 2EYRA 4PJHE 3RGVB 1NJ9B 3L3DA 4JHWL 3NACH 1NFDE 4HEME 4HK0A 3L3HB 1ZOXA 5HYSG 2ICEA 5DFWH 3TO2B 1YJDC 4LDEB 1SJHA 4NQTA 3VFMA 5K9KA 1T5XA 4U6VH 2UUDK 3X3FH 3MV7E 1T1XB 5A1AA 1UB5A 4UOW0 3WFHB 1WITA 5E2UL 2OM5A 3VD5A 1D9KA 1HNFA 4G43B 4PJ9A 3SJVB 3SPVA 5I8KH 2W9DL 3UC0L 2CJUL 3RZCA 3GJFH 3MNZA 4YHNA 4D8PB 1YEGL 3FT2A 3B9KB 2CO7B 4Y2DA 3HAEG 1HQRA 2HT2D 4AH2A 1CGTA 3UYOD 4UAOB 2AI0L 3HZKB 1KENH 3GSOA 3LZFH 2BVUA 2AXFB 4KH2A 5DMJB 5INCA 3KPMB 4M1GL 1EV2E 3OPZL 1T1WB 4X4ME 5GGTL 4C56A 3FCTA 3K2UH 4NSKB 1MJ7L 1A3QA 3DVNA 2EKSA 2VDNL 5I1AB 3T0EB 5ISZB 4OD2A 3M8OL 2L4OA 5BVJB 4ODVH 3OKLB 1TZHA 1I8LC 1X5IA 3TPUB 1CXLA 3C6LB 1RZ8A 3P2TA 4QGTA 3P77B 1KN4L 3GMLB 2ARJQ 2AJSH 2YRZA 4N90E 1P2CB 1IBGL 4ONOA 2V5TA 3G5XA 3CH1A 5IIEA 5C0IA 2HG5A 5T5FH 1BM3H 1XF3B 3QEGL 5KSAB 2OTUB 1RZ7H 1JFQL 5CSZA 3RY6A 2FO4A 5DGQA 1KBGL 4HG4K 1S5IH 5HYJD 2CLVA 2Y7QA 3QWQB 1OW0C 5TDNB 3MLWL 4QRPE 1A7OL 3U0WL 4UIKL 2HJFA 4OM1H 1JHTA 1SBSH 3VRIA 1JTPA 2Q8AL 3BWAB 3FQRA 4P2RD 3KJ6L 5C0CD 1J10A 1EUUA 1I7RA 5FA4A 1FL5B 2Q3AA 3CU7A 1MY7A 4MA3A 4P3WA 4Z7NE 2PYEB 1N64H 4JO4L 1NCTA 2B2XL 4OCXL 2VQUA 4PJEF 4XCEB 5DR5L 5TQ2L 1QSFE 3ULUF 3RU8L 2OTWB 2EIZA 5D7SL 1IQDA 3MTRA 3GNML 1WISA 3L95A 1QLFA 2VE6A 1QRNB 1UVQB 4YZFE 3GBNL 3TV3L 3D3VD 4GT7A 2FNBA 5F7KC 5DRNB 3JTSA 2L7JA 2DRUA 2APWA 5BS0B 3WL9A 1J0HA 3HZMB 1E27B 3MACH 1RMFL 1DE4A 1DL7L 3DSFH 3SN6N 4LCWA 5CMAB 4MD4B 1RZGB 3QXAA 4JFDB 1N6QL 3FFDB 1ZT1B 4N9GB 3V79C 3VXUE 1GHFH 1I8LA 2AJUH 5DHVH 2GT9B 1ITBB 5I1DB 3G04A 1ZLUK 3SE4C 5FYJU 5HGHA 3FB6B 5IJVA 3T4YB 3FFCE 4JRYA 1IC4L 1P6AB 5DVKA 2XN9A 1RSFA 5I73C 3O41B 1DBKH 4FQCH 3MRNB 5M95B 2V9QA 5FOBB 3QP3A 4UIMB 3LN5B 1V7NL 2VDQH 4PRAB 1N59A 3TC9A 3LRSB 3QQ3A 2FHBA 4J4PC 1HH9B 4AEHL 1WAAA 1A3RL 4HS6B 2PR4H 4H8WL 4Y16D 5BO1L 1UA6L 3H3BC 4H20H 4XXDB 4KAQH 1RUKH 3REVB 1CZ8H 1KCSH 4RIRA 4YFLF 2GCYA 4KY1H 4U1NA 3HS0B 2O26U 1TNMA 1I1AB 3QUYD 5I8EB 2CGRL 4G6KL 1NLDH 2GFBA 4OZIE 1OQXA 2Z35A 3MR9B 5MEPB 4XPGH 4L3EB 5ID0A 1KCVH 1FV1B 5D1QD 5DQ9A 2HVKB 4WHYG 3ULUD 1XR8B 4YLQT 3DPBA 2NTFA 4GXVH 4HGWA 3NIFF 32C2B 3HNVH 3OKOA 1MCJA 5BW7A 1S9VA 2K7PA 2W59A 1IARB 3DSNA 3TYFB 1NGWA 3H42L 4QTIH 1C5DB 1FZMA 4OD1H 3BRDA 4YPGB 4DGVL 4N8CH 2R29H 3DUHA 4IMKC 5HVFB 5BQ7B 1S7RA 2PYFA 3VI4E 5IB1B 3ZZ1A 4PGEA 3D9AH 2D7QA 4S2SB 4H5SB 2X9WA 5EA0L 2DL2A 3F7RA 3H0TA 1BWMA 3GSXB 1OM3H 3MLUL 3D2UA 1JYXA 4MMXC 5E5MB 5INDA 4Y0GA 3SE4A 2ZOKB 3TBSB 2CKBA 3CX5J 3D85B 2APBA 2DB8A 3MRQB 2I5YL 2R15A 4FQ2L 1KLFA 4YIQA 5D8JH 5DURD 4ZSOB 3LN4A 2E3VA 1BFVH 3HG1D 1IGYB 1LP9F 4RFOL 3CDFA 4F7TB 3M17A 1EEZA 2IAMD 4OFVA 1JYVA 1G0YR 4X5LA 3ILPB 3PJSB 3GBMH 4NQCB 1S5HA 4K8RC 4MA1C 4PJ8D 2DYPB 5E9DB 3T2NH 3RVTD 3QFJE 1WUNT 3QSKB 1SEBB 5GGVL 2VLKA 3LQAL 4ZO9A 2FWOB 2K3TA 4R0LB 1MHPL 1R3JA 3EDEA 2BOCB 4D9RD 3EZJB 5E8OB 4NQSB 1YECL 2YD9A 4QRTA 1O7VA 5CFHA 5KSUB 1D5BA 3RRQA 3IDGA 3RVVD 1UKQA 1NUDA 4Y8DC 1CL7H 3UYRL 2Y06L 1YY8B 2CO6B 3ULVH 4XMLL 3C5ZD 4XH2A 2WSKA 4GG6E 4WVRA 4QXTB 1F3JA 1G7IA 2H32A 4U6HA 4UMGA 2IC2A 5SWZB 1FO0H 5IQ9A 4X6EA 1ZTXH 4PGZA 3BPCA 3EJZD 4PLJD 1TTFA 4EBQH 3MRGA 5E6IC 4CN4A 1EPFA 4BSWB 3EYUL 4HZLB 3ESUF 2ZJSH 4BFIA 5IW1A 4LF3B 1ZSDB 1KELH 5LQBH 4OCNC 1FVCA 5ETUB 1MCKA 3OJDA 3ARFD 4FQLL 5C0GB 3B2VH 4FQHB 1XR9B 3HLAA 1EBPA 1G9NH 1DUYA 1RJYB 3LEXA 2BDNL 2EIBA 3LV3B 5IFAL 2G2RB 5IR1A 3O2DH 4S1SL 1AQDB 3LEVH 4PREB 3UTSD 2ICWJ 2H41A 5ICYB 2MCPL 1FBIH 1H8OA 2F54B 1UH2A 3L5XH 1IM9A 1U3HB 1I75A 3DMMD 3O3DB 4HS8H 3SKJL 1G9EA 4MJIB 1JGUL 3SCMC 3C60C 2XQYG 3T8XB 1XZ0A 4HC1H 3NA4A 4Z5RB 3IJSB 1BFOB 1WBYB 4Q9CA 5CWSB 5EUOE 1GZQA 1YQVH 4ZXBD 4YUEH 4JFFE 4KHXL 1H8SA 2YD2A 3IXAB 3FL7A 1HEZB 1VPOL 3TBWB 5MENE 5LXGH 2BC4A 2AK4D 4U6YB 4CADA 3A67L 4NZRH 1B2WL 2W65A 3EYVA 2XIDA 5I15H 1GGUA 3JWDL 4OCYL 3S97C 3ECBB 2Q1EA 1KTLA 1YPZF 5EU6B 4QHNA 2AGJH 3I9GH 1T7WA 3QXTA 4P57B 2NX5B 3DRTA 1U8NB 4YHLH 1K3IA 2XG5A 4M03A 1JZ7A 4M3JA 2BHYA 5KOVC 4YX2L 2V7NB 5I1JL 3C60B 3ZKMC 1ZHNB 1UZ6E 5EIVA 4L8SB 3WFEL 4MJ6A 5IESL 4OZHB 4F7EA 5F8RC 2FX9H 1MHCB 2CDGB 3VRLF 5DC4B 2P8PB 1P5VA 3N06B 3S96A 1TJGL 3OL2A 1IKFH 1L7IH 1H0DB 4QTHA 2NY6D 4U33A 3F7QA 5I71C 4G9FE 4LSSH 1RUQL 4U2YA 5F88B 2UZYB 4HV8B 2Q8BL 3O45B 4MSWB 2HWZL 3MJGX 2DLFH 3VFRB 8FABB 3OKYA 3TO4C 3WLWD 3SCMA 1XGQA 1K6QL 4EJ1C 4I0PB 4DJMA 3QCVL 1BPVA 1OAUL 2WNGA 4PR5B 3X14B 3WCYA 3IFNL 1DZBA 1MCFA 2R2HA 4AEEA 1JUFA 1QPXA 4HXBH 2E7MA 3C9NB 5HYJA 3AREB 4P4RA 4M02A 1D6EB 2N7BA 5IROA 3KPPB 3LIZL 4G8GA 1ZGLB 3MBXH 2FEEL 2MCG1 3VCLB 4L9DA 3AC0A 5F7DA 4WU5B 3IVKB 4BZYA 1EEYA 4X7CC 4P2RA 4OIIL 3LSOB 3NFPA 3T2QA 4YBQC 1JWMA 1ZVHA 1KB5A 3FQXB 5D7LB 1OSPL 1KCKA 4GAFB 4FS0A 3UTTB 1NGXA 1FC2D 3OKKB 1ZXQA 1GGBL 3UDWC 3WDIA 1VGKB 4ZPTA 5L9DH 4JO2L 4Q9RL 1UADC 3V6OC 4PYHA 5TPWH 3JV4B 3KXFA 3ULUC 4OZFB 4GG8B 1OB1B 2F58L 3GSNA 1P4IH 4PLKD 1QP1A 3AS3A 1WGOA 1EEUA 2NY5C 1NEZA 2A6IB 4B0MM 3R0MA 4O2CA 3BPOB 3PL6D 2YC1B 2Z92B 4U3HA 1EXUA 4DAGH 5E1AA 1H3PL 5C2BL 5BCAA 1S3KH 4WU7A 5J7CC 1HCVA 3F7VA 2IEPA 1FE8L 1HXYB 1C5CL 2HT3D 3TO4A 2IMNA 2J8HA 1JGVL 1GIGL 4XP9L 5CEZE 2A9ML 1OGAE 4ZTPL 1PG7H 2IJ0C 4IOIB 4P4KC 5DI8B 3OXRA 2IBBA 3TJHD 4X4ZA 4LPCA 3D6GA 3GMNA 4MNGE 4LNVA 1P4LB 5HVHB 4DQOH 3FZUC 4WEBL 2RQ8A 5FA3A 1Q9LA 4JG0L 1XFPA 3DIFB 4RA3A 3U46B 1CDCA 4OZFG 2HT4D 5KOMC 3CPLA 5C0EA 1CFSB 3G5YA 4UQ3B 4Y16A 6FABH 4PJ8C 5IHBA 2ZCHH 4D94A 4X7SH 1GGYA 4FG6C 4WDIA 1UG9A 4ODXB 4WUUE 3UDWA 3W9EA 2CK2A 4TSAL 1F11A 43CAA 2I9LA 3MGTB 3MRMB 4XX1E 4PJEA 1IZJA 3Q3GB 4XB7A 3QDJE 4JY6A 3VMOA 2HTLC 5ILTL 3C6SB 4Z7WE 4OKVA 5JUEL 4O58H 2HAZA 5DD3L 3MRFA 2HH0L 4PJ5E 4XC3L 3E6FA 1N4XH 4PJFF 3HC0B 4V1DD 4QRRE 3ARSA 5I8CA 3PGDB 2ENYA 1N2RA 3UBXB 4IOFD 3UPRA 3WSQH 4R90H 2WAHA 3Q6GL 4TUOA 5JPNB 4MQXC 3UAJC 1AI1H 3IDMA 4S10A 3ZKNC 3L7EB 3IYLW 1U91A 1X5AA 3EDJA 1BD2D 1M71B 3WIFA 5D2LB 4GMSH 1WZKA 3GSWB 3BIAX 1TJIL 4P4KA 4KDTC 3QIWC 3IRZA 4Y4KD 4WO4B 4PRHD 2HRPH 3SBWC 4XB8A 4GRMA 5DJ2A 1AY1H 1AD9B 2GTZA 1YEDA 3QUZD 1FLRH 2R0LH 4KJPD 4AG4H 2APXA 4GRLC 4PJ8A 1FSKB 5T1MA 2YOCA 5FK9A 2CIKB 5JR1L 3BH8B 5IFHL 1Z0MA 3KPSD 1I9EA 3LD8C 3EO0B 5HI5C 4XI5C 3UTQA 4R8WL 4MD5B 1B0RB 4NM4H 3TH2T 2NCMA 2ZNXA 4MQ7B 1EHNA 2R0WL 3ARDB 5JW5B 2DICA 4NKOA 3RDTD 3PNWB 2X89A 3E3QE 4ONFL 4AZ8A 4LLQA 5E2TL 3C5ZA 3ARPA 5ESAB 4JFZH 1A6ZB 4GRWH 4KJWD 4ZS6D 1Q9WB 4X6DE 2F5AH 4NC0B 3CD4A 4ZFOB 4AT6A 1K2DA 4M7LH 2B1AH 5D1XB 4Y5YC 5KSBE 5D9SB 5EIIB 5HHOE 4CN6A 3FT3B 5H8DA 5T3ZH 4TNVF 1TENA 1JGDA 3VGGA 1IEBB 1IQWH 3HNSL 5IGXL 4ZAKD 1LK2A 1WCQA 1INDH 4QXUL 4XPTL 5ENWA 4NT6B 4MAYB 4APQD 4RNRB 1HHGB 2XYCA 2P8LA 4KDTA 4YC2B 2P8MA 2HFEB 1XGRB 3LDBC 3DLQR 3QIWA 4QXGH 1N5YH 5KVDH 2BY0A 1SHMA 4JN2A 3VXSE 5CJQH 5TE7H 3SBWA 5FKPA 4I5BA 1HOCA 3SOBH 1TVDA 1JZ2A 3AS0A 1LP9A 3C08L 3KPRB 5C6TH 4GSDH 4GRLA 3UTSA 3MV8E 3UX9B 4WY7H 3HC3L 5FB8A 1QR1A 2R8SL 1FZKB 1QQDB 4O2FB 5EO9B 4R2GC 3U6RA 4NZUL 4OLWL 4MWFA 1KF9B 1YNLH 3DHJA 4JPWH 4XAKE 5IHUL 3NH7L 3MJ9H 5C0AE 5GGRY 1ADQA 4KK6D 2G60H 1J1OH 2J88L 3RHWK 1JF1B 2CDFA 5JO5A 4U1GC 3QWRA 1H8NA 4ZUTB 3ZO0A 5BV7C 3S37H 3LDBB 3B3IB 2AEIT 3FB7A 1JZ6A 1H3VA 5CEXB 2UZIL 4Q6IC 4KUCF 2WUCL 3DYOA 1G6VK 2H8PB 2EEBA 3DX6A 3GIZL 2XKNA 4Y5VC 5F9OL 1D5MB 1NCCL 4HWEH 4Y5YA 4PRIE 1VFUA 1CVRA 4OV6F 4CNIB 2EDOA 1LVEA 1TNNA 3W82A 3MLSH 4BSVB 2EZ0D 3ULVF 5I19H 2F19L 2H26B 4MDIB 2A73A 2GKIA 5DZLA 5C07A 3DJ9A 3Q2CA 5ACLA 2AS5M 2EDLA 3BQUB 5EULV 2NLJA 3TESA 4KHTL 5ESVB 4YNYA 1KXQE 1KGCE 2BSSA 3QNYA 1WZLA 2FJGB 4ZS7H 2BXZA 5HD8D 4U1GB 4AM0A 3BVNB 1ODAA 4UQ2B 5I8OH 5MP6L 1BEYL 3GUTB 4M7KL 3O6FD 3MRIA 3O11A 1YMHA 4B53A 3KR3L 3VDAA 1R3HB 2GJZA 2EXWC 3MYJA 5GISL 4ZTOL 3UZVB 1A2YB 3C8DA 4OSUL 1J0KA 1FNHA 5DDHA 5LGKA 3F5WA 5C70A 4P9ML 2AEPH 3O4LB 2CK0H 2IH3A 4RGMC 3GKWL 5C08A 3IJYA 4AIZB 1HHIA 1U58A 3CX2A 4NQDB 4H1LH 1AC0A 5AUMB 3QJHA 3PHQB 4JPKL 4PRPB 1OP5K 1RQ5A 2R4SL 5A40E 4Q6IA 4RWHA 4OF7A 3H3KA 3SY0B 4G7VL 2GAZA 4Y5VA 4TTGA 1I3RB 1T5WB 2B5IC 4G6AD 3D39B 2V7HA 4QYOB 4KUCD 2AW2A 5A3ID 2NY7L 4Y7MA 1DQLL 3EFDL 1YN7A 4LLMB 3FN9A 2C1OB 1GZPA 4GW1A 5BRZE 1NCAH 3MQIA 2QQLH 5F3BA 3VDBA 1OARL 3EDKA 2ICWA 3NZ8B 2CDEB 3PXJA 1T0MB 1XF5A 3CSPA 5TF1H 2DLGA 3ULVD 2P44B 2XQBL 3VGHA 2Z31C 1BZ9B 5KSVA 1ZANL 4BELD 3C5SB 1J12A 4Y19B 5DFTA 5L2KB 3NN8B 4X98B 4NP4H 1CR9H 1CN4A 2X1OA 5DJCB 1QFHA 1LE9A 2YKLH 3I75B 2JJWA 5ID1A 5GS1B 1AGBA 1YEEH 1JE6A 1KSRA 1YMME 2JLLA 2P49B 3GZKA 5EBGA 2YA0A 3DRQB 2AAVA 4BK4A 1R5VB 3PL6A 2DF3A 4HZAA 3IAGC 2J5LC 1KYOK 4IOFC 4QWWD 2V2WA 4BFEA 3BZEA 1ZVSB 3OX8B 2X4QA 1ZLVK 1TITA 5LJYH 4CU8A 3NA9H 2AJZB 2OMBA 2IH1B 1L6XA 3LKRA 4LLWB 5GJTH 4TTDD 5SWSE 3VXMB 3S34H 1NC2A 5DS8A 2ZUWA 4FRWA 4L4VE 4CJ1A 4HKBB 4H0IA 1Z9LA 5JHDA 1Z5LB 1LO4H 1UC6A 1TVHB 2C3VA 4XPBL 3BSZL 3RZWA 5JNYA 3ES6B 5D7IB 4Z7OF 5CJXC 1F6LL 4Y5XC 1MRFH 2I07B 3FQTB 2DS4A 2OI9C 3V6BR 2DQGH 1F90H 3PWUA 3S4SA 3T4AB 2HMIC 4K7PY 3EW3B 1H9VA 3EGSA 4N0CC 1Q8MA 5CGYC 4X5WA 5GGQH 1RURH 2KPNA 4JHBA 3TNNB 5HGAB 1C12B 5I9QB 4ZUSB 3V6ZA 1FZJB 3ZT6A 2Z31A 4S11A 2FSEA 2E9BA 4ELKB 5AAWA 5F6HJ 3EO1B 1N3NB 3WNOA 4MGXA 4HFWB 3QCTH 4EN3B 2IANB 4WRLA 5GS2H 3B8SA 1QO3A 3HE7B 3DX8B 2DQUH 4XVTL 5EOQL 3QNXA 3QEUB 4XT1C 2CH8A 1PLGL 3GJFA 1BGXL 5GRVK 4NIKB 5E2VL 1QA9B 4F58H 4WNQB 1WVZA 1JHLL 2YEZA 5I1HL 1HNGA 4N5UA 3IFLH 1XH3A 2HLAB 3ZTNH 1LILA 4FXGA 2PCPA 3FOLA 4TVPH 3I6KB 4KK8C 4WW2B 3EJYC 4L3CA 4Y1AA 1AKJD 1N8ZA 1VB9A 1MREL 1KIQB 3CFBA 2LAGB 1H3UA 2VYRE 5T1KB 2XTJD 4CL7A 2X42A 4XXCA 1B4RA 4F8TA 3RWHA 5LAXB 3ROLA 2XKUA 3I85A 3WIHH 3NACL 4X0KB 2V2XB 3GI8H 1CF8L 3VG0H 1OSZB 4YO0B 2DQCH 4M8QA 4IHOA 5E8NA 4M1CC 4PRHA 4PGCA 3TBTB 3EYSL 3LHPH 4HT1H 4OQ1A 4DKEH 3QUZA 1UFUA 4POZC 5E8EA 5EFIA 1LDSA 5F7HA 5C09B 2AK1H 3HZYB 1KIRB 4J3WA 4HIEB 3QXDB 5ERWA 2FB4L 3G6JB 1D6VH 3OF6D 3CMOL 3HUJF 3KDMA 5IBTH 2Z91A 2A83A 5EZJA 2VUOA 2ICEB 4ODHL 5FGCE 5FKAA 1W2KT 1A4KB 1RJZA 1FH5L 1KENL 3MREB 2AABH 5DO2D 1PQZA 1XF2B 2ATPA 5KN5B 4U1SA 1N5AA 5CZVH 3STLA 2J6EH 1U95A 3J8F7 5CP7B 5J6GB 1OF2A 4YHPB 2HTKD 1AR2A 5DD1L 4F37K 1AGEA 4K7FB 3QXWA 3UCRA 1S7WB 1A6UH 1T7XA 5HSFA 5HHMD 2BFVH 3OB0H 1R3KB 2HLFC 2FJFB 1L9MA 2O5YL 4PJFA 5FGRA 5FV1L 4JDZA 1ZEAH 4PJXF 1IGJA 3GM8A 2E9IA 2IADA 1YN6B 2C7UA 3JUZA 4QCIA 4GAGL 2WINA 1FC1A 2NY2D 4ERSH 5C0BA 1MFEH 4LLUA 1MCOH 4APQA 1J0JA 5H94B 3KS0H 4D3CH 1S5IL 3TT3L 1OAYH 3LKNA 4NBZB 1X6NA 4NZJA 4X80L 1EHLL 2MWCA 3BXNA 5KG9B 3L5WA 4GW4B 3V0AC 1JMXA 3MV11 2BVYA 4KMTL 1PYWB 5T1LB 4WGVB 3ZT5A 4GKNB 5DHVA 3VD3A 2C26A 3BKCH 2PYEE 3P4MB 4RGOH 1QHOA 4KXZH 2ITCA 1J1PH 3KLHC 2BX5A 3T2OA 1VDGA 4HKXB 1JRHH 1WBZB 4K07A 4R6UA 3QHZH 5EIQA 1QSEB 1RK1A 2OS7A 5FYLE 2F53A 4MD0B 1HXMA 5CP3H 1QRNE 3MRDA 2ARWA 2R39A 2NPLX 3PDDA 5AZ2H 1A21A 4U1MB 5DEFB 5KANG 4D9LL 5BS0E 3K80A 4TRPH 4X7EC 3RJDA 3ZYZA 1XGTA 4K55A 4FFZL 4PTUA 5HDBE 3BW9B 5L2JB 1AGDB 1TQBB 1BQLL 3WHE0 4TOYH 2Y1VA 3SDCB 2BSTA 3L95B 3NFNB 2G5BA 3QDGB 3V7MA 4HS3B 1MUJA 2BNQB 4OFYA 1DBAH 1XGYH 1B9ZA 2P24B 3MV9B 1NCDH 1NCBH 4RX4D 4PYGA 4GRWF 1A7BA 2DJUA 2C4FT 1DE4B 4MMZC 4F9LA 3BH9A 4WI3A 5CINH 5HGDA 3RWJB 4JHZA 1MWAH 5HI4D 4MJ4A 1QNZH 2KH2B 1BQHA 3R0NA 3EYQC 3KWWA 2ITDA 1T21B 4OV5A 4EVNB 4NHUA 3EJJX 5FUOH 1FFOB 1AXTL 1CD1A 2PR4L 3QIUD 3H2WA 2QV2A 5SX5H 4ZFFB 1JCKA 1IGCL 1MJ8L 2K9UA 3NPSC 1KCSL 1MFBH 4GUPB 2XN9B 1MY5A 3HI5H 4KY1L 2F8VA 5H35B 4Z7QF 1AHWC 5F7YC 4Z7VB 1I8KA 2X6MA 3ZTJG 4O4YL 3VXNA 4L3EE 3FMGL 4XPGL 2WWKT 2W0FA 5HHNA 1YEFL 3LQAC 4KU1A 1A6VL 1FHGA 4NKMA 5CD5D 4CMHC 3HNVL 4JZNA 1UWXH 2R29L 4IDLA 4J1UA 3UO1L 4TQEH 3D25A 2Z35B 4U0QB 5ID0B 2OMNA 1DQQB 3MRCA 3STZA 5DQ9B 5D5MF 1X6LA 4N8VA 2CXKA 4Q7DA 3BP6A 3F62A 2HVJB 5J1TC 4OBSA 2OZ4L 1RK0B 3VFVA 3ZSTA 1AHWB 3OSKA 15C8H 3ROOB 2NXYB 3KLAB 1HQ4B 1NANI 1FZMB 4NYLA 1OTSD 2Z8RA 3TT1H 2NR6C 3QEQB 3HI6L 2PYFB 4ZQKA 5D8JL 4ZSOE 5TE6H 4YAQB 3RWEB 5JORB 3BP7A 5C71A 2W9LA 4IRSD 2Q20A 1U93A 4OGXH 1MIEH 1NUGA 2BVPB 3TFKC 1YUHB 4NKDA 1B0GB 1FO0A 1FP5A 4U6XB 4XP1L 2A74A 5DD6B 5T3ZD 4WCYL 5LBSL 1AGCA 4NQCE 4GMTH 5I0ZA 5CEZL 5GGSY 5E9DE 2YPKA 3PQYD 4P3DA 2RGSA 2OL3H 4KQ3L 1QBAA 1OL0A 1UYWH 5IBLD 4FABH 3H9SD 4P5KB 1TZGH 1Z9SA 1IC7H 5F71A 4BZ1H 5BJTA 4HFUH 2D0FA 1FVDB 1D5XA 3K4DA 3ULVL 4L1DA 3V5DB 2X05A 1XIWC 2AJYH 3HB3D 3L5HA 4NQVA 2AXHA 2KQNA 3O2DA 4X7TB 1AGFB 5K9OB 5JHLL 4FFVC 1RIVH 5BVPH 1F4HA 1NMBH 4K23H 1T66D 2JB5H 4RZCA 1EFXD 5I1CH 5E4IA 1DLHB 2DQHL 1R24B 1D5BB 4IMLA 4X6CB 5E7BA 3VXRB 4XTRC 3H7BB 3K74B 2IQ9H 3NCJH 4OZGB 5AZEH 4HC1A 2EDBA 4JFQA 1G7LB 1Q72L 3U83A 1FQ9C 2VIRA 4RAVA 4QT5B 1T20B 4YGAB 4F7PA 1TTUA 4YDJB 3L7FB 3BE1H 1F00I 3ZDYF 1TLKA 3SDAD 1EH9A 1DTUA 3RWCA 3BZ4B 4X6EB 1S9WB 3W0WB 4PGJA 4XNXH 2VKXA 1B90A 3W39A 5F9WB 2QADB 3EHBC 4MXWL 1XIWB 3B2VL 2XRAH 3INUH 5HTSA 3S88L 4YDLB 2NY4C 4HUUB 4WFEE 1G7HA 4KTYA 5DZOA 4G80A 5ALBH 2ZKHL 1MFNA 2H2PD 3MLTA 1DBMH 1RAMA 3L5XL 4WW1B 4X6BA 5JOFA 2QEJA 4BYHA 3GGWA 4NO2B 4HS8L 3LS5H 2CPCA 1MI5A 2YD4A 4KQ4L 4WHTA 1PD6A 1ZE3C 3OAZH 1IAKA 4GBXB 1JN6B 1NC4A 1H3WM 1BP3B 1DUYB 4HC1L 2E8ZA 5FAAA 3OZ9H 1NAKL 2QLVB 1E4XH 3PG2A 5IF0A 2ADIB 5F1OB 3VGBA 1UM6H 1HHJB 1KB9J 4D9QE 4Z7NF 3MO1A 1TTGA 2OSLB 4JREC 4KI5E 3O3BA 2WZPD 5KJRH 5DHYA 5I18H 1H5BC 3B2UC 1QFWM 1K4CA 3ALPA 3RI5K 5JDSA 1KIUA 4UILH 1IAOA 2ESVA 1QKZH 1JPFA 4WWKD 2BNRD 4PJIF 2YPLA 2CSPA 5J8OA 2NX5E 2DLEA 4L4TD 5FDWB 2Q6WB 4Z76B 4LCIL 3UTPD 1UCBL 2V5SA 3QT2A 1UZ8B 2XNAB 5GSVA 1YEIH 2IPTH 1K9TA 3GMMB 4UOJA 1ONQA 3DNKA 1WFNA 4ONGL 3H9HA 4NUJB 4RBPK 2FX9L 5ALCH 4KV5F 2ADJB 3T1FB 4M48L 3BUYA 3HMWL 1HI6A 1KCLA 3T0XA 4BQ6A 4KK5C 1DLFL 1CBVH 4OJFH 1NDMB 1ZHKA 2OR9H 1ZLSL 5CD3A 4NWTH 3U4BH 4NNYB 1TQCB 3CFEA 4JVUA 3RFZC 1MCHA 4PJGF 3UXFA 4J3XA 2D9CA 2NXZD 3LS4H 4JRWA 3PGFL 2X7LA 3QWOB 3UYPA 4NCC1 3VFNB 1NCWL 2A9NL 5TF0A 2IBZY 2ZZUT 4JO3H 4QTHB 5FOJA 3ET9F 2H1PL 4K7PH 4ZDHB 2X4OB 3MBEC 3U1SH 1HKLL 1EDQA 5FGBA 3TIDA 1A1MA 1I8IA 4OLVH 3KPLA 2J4WL 4HIJA 2FO1A 2EYTA 2FDBP 1TZIA 4HUMB 3MCKA 5J89A 1J8HD 4XBGB 2VITA 1NMAH 3R06A 4KFZC 3VXOA 4PRNA 4HXAL 5D7LE 5IB4B 1LEKB 5HVWA 3UTTE 5I1EL 1P5UA 3GRWL 5D7KE 1EHAA 4MXVE 1NAMH 3V6FB 5C8JA 3N1MC 4GXUM 4JRXD 4M8VA 3RVXD 5L9DL 2ZG3A 1EAPA 2VO5A 5D71H 5F7DB 4LCYB 1J05B 2VXSH 4BZ2L 3M45A 3OKMB 2X1XR 3HUJA 4EI5D 2P45B 5KAQF 4DVRH 5C0CB 4KKAD 4LLDA 1P4IL 3SEPA 2XWJB 4PUBH 1DP0A 1JWMB 5KVFL 1BOYA 1OGTB 1PZUB 1ED3B 3KNBB 3RWGB 5E8PA 1CYGA 3CFKB 3CK0H 4R4BA 1ZA6A 4ZPTB 1E4XI 2YUZA 3E8UL 1ZMYA 1VEMA 3T1WA 4NQEE 4OGYH 3KS0J 3I2CH 2ZPKH 3D3VB 3VWKC 2C3WA 3S36L 2BJMH 3MUGB 3GSNB 4NC1C 2NY3C 4PP2B 4LSQH 1T3FA 1ZHBB 1QEWA 5D4QA 4C57C 5EU5A 4E41E 4F2MB 3GHEL 5EO1A 1QHPA 3DURA 3FAWA 3PWPD 3TJEH 4IIQC 2RB8A 2X1PA 3CXHK 4PJBB 4ENED 3S8WA 4HMCA 2BP3A 2YHGA 3LPFA 2NY1C 2VC2H 4DQOL 3GEWB 3MBEA 2Q7NA 1CDBA 3F7VB 2VDLH 4QF1B 1KLUB 2ARJB 4YBLC 4TVPD 1G6RL 1T1ZB 4EUPB 1CFQA 4LIQH 4Z7UB 6FABL 5E99H 5EZIH 1TXKA 1HYSC 5IMMA 4U1IA 2W38A 2IMMA 3RUGA 3WFCH 2YSSB 1KJ2L 1WZ1H 5F93C 3BKML 2L7UA 3MRHB 3UJTH 1SMOA 4QRQB 4U2ZA 1QBML 1KJVA 3LY6A 3VFUA 3GSRB 1A7RL 2AJVH 5F89B 5L88L 1QZ1A 4OAWB 1U8OA 1UM5H 3KPTA 5KBNC 4IIQB 1TMCB 4F9PC 3IF1A 1D5ZA 4JE4B 3WUWB 4O58L 1MAML 5IEHA 3PGCA 3L3KA 1JNNH 5DMGC 4OLXL 4Q0XH 4O9HH 4HJ0D 2OP4L 3QUYB 2JELL 3WE6A 3SDXB 1QYGL 4BFBD 2A1WH 4Z77A 5D6CB 4PD4K 2B8OT 2I9LB 1EO8H 3VXTB 5D1QB 2VDMH 5ITBH 4PJEB 4XNUL 1VGEH 3Q5OA 3VWKA 1AO7A 3V52L 3QQ4A 3P4OA 3FO9B 5ESQB 2MSPA 3RAJL 1IJ9A 3MRFB 5D2LE 4GMSL 5F9AC 3QFDA 3ETBF 5M94B 4HG4J 1GVIA 2IFFH 1CGYA 3MC0A 1FRGL 1B0WA 4L5FH 2X9XA 1MFDL 2KZWA 3UPRB 3BP5A 2HRPL 4LLAA 5CGTA 3QIBD 5EG6C 5T33L 5KW9H 3R4DA 4AMKH 3CNKA 1Y18A 5I1GH 3QH3A 1AY1L 5F7UA 4RFEB 2YMXL 1SYVA 1FLRL 1PBYA 2WV3A 1CGUA 4WWID 5FM4A 5TGBA 4YQXL 5SWQB 4AK1A 1HDMA 5I2IA 2XWTA 3PQYA 1N26A 1OTTD 1ZKAA 4M9OA 5C3LD 5IOPA 4OLUH 4R4NC 1T0NB 2MKLC 3HG1B 4CW1B 3H9SA 3VD7A 4X7FC 5DUPL 3N9GH 1A64A 4EQ3A 3FRUA 3RPKA 1JNLH 4NRYA 2IAMB 1QLEH 4DOHB 3O9WD 1VFAB 4P2OD 4Q2ZB 1FORL 4ZD3L 3HNTH 3KYOA 5F1IB 2JTDA 1NL0H 1MIMH 3IETA 3HR6A 5F72S 3FQWA 3MJ7B 5T1MB 4M7LT 4LLVA 1EGJH 3QR2A 4S1RH 4NPYB 2XTLA 1S7UB 5C0RH 3OHXB 1CDUA 1T6VN 1XGPB 2AP2A 1OTUD 3VD4A 4HLJA 4TUKL 1P1ZA 1TJHL 2B1AL 4IS6A 3LPGA 5DK2A 1EFXA 2NY0C 5D96C 2WIIA 1CD9B 5JQ6H 3IB4A 5DJYA 4XP6L 5H2BB 1E28A 3FTGB 5GZND 1V7MH 1DVFD 3MOBL 2SEBA 3MJ9A 4O02L 2DD8H 2FBJH 2JJSA 2R1WB 3C5ZB 3DV4A 3U9PL 3DX7A 1YC7A 2VDPL 2PO6D 2HJLB 5DQDH 1INDL 4OTXL 3ARZA 2A6DA 1E4WH 4D0BA 4ZUUA 3U48A 3BEVB 1S7QA 3SDAA 3BZDA 2VDKH 5CGMA 5J13B 2Z93A 5KVDL 4EXPX 1CGWA 1F4AA 1FL6A 1IKNA 2FYYB 2NYYD 1JP5A 5C7XH 2E6QA 3PWVB 3MV7B 3T3ME 1A7PH 5JZ7D 1EERB 1U0QA 3IS0X 1BVKA 4HIHB 4LHUA 3KPRE 1U41A 5TDOB 4GSDL 5ENWB 1YDPB 1AR1C 5D96B 1JV5A 1FPTH 4WY7L 1N0XH 3HCVA 3AS1A 4PJ7F 4RISL 1FNFA 4B7IA 2DMCA 2EDTA 1UACL 5B38A 3OR7A 1N0LA 1RUPH 1IGFH 2NXZC 2FX7H 2BNUA 3IJHB 3PWNB 3V7AG 1FGVL 3ARFB 4RAUA 3BD3A 4PJHA 3VE0B 4GXUN 4HIXH 2G60L 1JGEB 3QO0B 1NFDA 1Z0NA 3WEXA 2YWZA 4GKSA 4YR6B 3HE6C 5JXAH 5LCVL 4FXLA 5FHAH 4PFEA 1FYHB 1U8PA 2BMKA 4BH8B 3U6RB 2X4UA 4MWFB 3DMMB 6CGTA 3P11H 1MRDH 4HWEL 1SJEB 4M3KB 1M7IA 1F4WH 5JOEA 2BCKA 1WBXA 2WLZA 4OQTA 2EH8H 3MLSL 5FV2A 3RPIA 4GW5B 3NZHH 1DQDL 4BQ9A 4NWUH 4H1LA 4S1QH 3REWA 5I17A 1LK3L 4FOMA 4ZXBB 4QRUA 4KKNA 4O2EB 4N1CA 1FFPA 1PEWA 4XVSH 4I3RH 2AV1B 1UQSB 2XKNB 3BGMA 1H3XA 5C92A 2AK4B 4PGDB 5I30H 1QTYT 4EI5C 5C0JA 5B22A 4YBHA 1NH6A 2ICCA 2X44D 1K5NB 4ONHB 3TWCL 3OMZA 4X4MA 1S7TA 4I0KA 4LPVA 3TN0B 1CDGA 1CIDA 1IGMH 3QDME 5E94A 1K8IB 5IFJB 4JZJA 1IM3B 4HHAA 5CJBA 3L6FB 3RL2A 4ZNCD 3CFJA 4LQFL 3O2WH 5JXED 1PGRB 1M05B 3QNYB 4XCFH 3MOQA 2DQFA 2FEDD 4HWUA 2X4TA 4AM0B 4L8DB 4MCYA 4WV1C 3O4LE 3WN5C 2CK0L 4I0CC 4OUUA 3MRLB 5LWYH 3B9DA 3MRIB 3MLVL 4XWGH 4IDJH 1E6JL 4LSPL 2Q7YB 2NY6B 3O8XC 3WUZA 4KRPD 5F97E 3PHOB 4MA7H 4QRPA 2VXVL 3I50L 4U1LB 3F5WB 4PRBA 4OCRH 1YJDH 5KS9F 4AEIL 1TIUA 3D39E 4D0DB 3D0VB 2BHUA 3WD5L 3BAEH 5DJDA 3O6KL 5DFVC 3CH8A 4RGND 1QSFA 3MNVB 3DX9A 1HILB 3ARYA 5ITFB 2H9GA 3MCG1 3VWJB 1G7MA 3WN5B 4M6MH 3TBYA 3VFWB 3WHXA 4JRXA 3FJTA 5DQJA 4G8FA 3P0VH 4HBCH 4NRZB 1IGTB 3MLRL 3OKNA 4YXHH 4EI5A 2VERN 5L2KE 1NGYA 2V7HB 1D3CA 5ICXB 3L3OA 1CR9L 1T89C 4G3YH 4NO0A 4NP4L 4YE4L 4KUZH 5ANME 3T2PA 5M7QA 1HHKB 3LKPB 2YKLL 2EXYD 3HR5B 2DTML 5FYJE 4U1JA 2E7BA 3EKCA 2VZOA 2EDHA 2VNCA 4XMKL 2H3NA 3OGCA 3VXUA 5CBEB 1YPZB 2EDEA 1KEGH 1NGPH 1Q0YL 1KC5L 1A0QL 1MHEB 3JWOL 1BJMA 4N1EA 2P43B 1P7HL 3L9RA 4BSJA 3P0YH 4WV1A 3MV01 1G0DA 3DXAD 5JW4N 1FYTE 3CVHL 1NBVH 1WWBX 4NBXB 3FFCA 1HWHB 1WWAX 1KTKE 2UWEF 4KPHH 5JIPA 5FYLH 2DAVA 4PJGA 4CMMA 5F7WC 2B4CH 3O8XA 3VXME 1G84A 5B4MD 5KVGL 2VABA 3S3SA 3VFSA 1CCZA 2EC9T 4HUXB 4YHIB 4MX7A 5DMIL 5F8QC 1WK0A 4JFED 1LO4L 2X4QB 5IHZA 5D7IE 1H3TA 3ARGC 3BGFC 1A6TA 2WBJC 4RMSA 1S8DA 1SVZA 2HN7A 2NW3A 3CFCL 3VGEA 4FXKA 2GK2A 1F4XH 2GJ6D 5JW4R 5CILL 1F90L 4CUCA 1I1CA 3P9MA 1UJ3C 1UH4A 3G5VA 4LHJB 3NCCB 1HKFA 1INQA 3F7PC 1T04A 2JB6A 4OZ4B 2VAAB 3IDIA 3WIHA 4BKLA 4JDVB 4WFHE 4NHCH 2D3VA 1U8KB 3HN3A 3W11C 2QQNH 1A4JB 2IANE 3QCTL 4H25A 2HFFA 3KPNA 4EIGB 4FQXD 4X4XB 4WTZA 5HI3D 4ZNEA 4MNHB 2VLJD 3PV6A 2C9AA 4WGWB 2BOBA 4XC1L 1DQJB 4QO1A 1KCRH 3SGEH 4KTDH 5B21A 3T04D 1NFKA 2A38A 4F58L 3AAZB 2WP3T 1WT5C 3TH3T 4I3GA 4Z0XB 4OBRA 4PY7A 3F8UB 1E6OL 4K71C 1J0YA 2J6EA 4ETQA 3QNXB 3GMQB 3OQ3B 4YHKL 2CKBH 4V1DB 1ZWIB 4M5ZL 4P5MB 3GJFB 1PSKH 1ZLVH 4RQQA 5IHLB 1GGIH 4OGAC 2FIKA 4N1HB 5DEGA 4YFEA 5FO8A 2M8XA 4M6NH 1O0VA 5GRVL 3BDYH 1LO2H 2CLRA 5I1IH 3ARGA 1GAFL 3THML 4RMTA 5DYOB 2WBJA 3RIFF 4P2QD 3QFJA 3S4SG 2YUXA 5TJWK 1PZ5B 1BD2B 2LVCA 4J6RH 3V4VL 4C83B 1VEOA 4XWOD 4FQ1L 3B6SB 4MNQD 1DJSA 1U8HA 1JPSH 1W0VB 1W0WA 1UJ3A 1YEHL 1DEEB 5IVXF 4Y4KB 2FGWH 1RV6X 1S7SB 3CJJA 4ELMF 5D1ZC 3T0BA 2D03L 5CJOH 5F96H 4NM8H 2AEWA 2VLRD 3MODH 1HCFX 1QRKA 5MEQB 1FAKT 4GG6A 2BVTA 5DJ6A 3O6LL 1JMZA 1OCWH 3QO1A 4TNWK 3WYRA 3G5ZA 3VH8A 4LVOC 3KPSB 5FO7B 2LVEA 1XEDA 2Z91B 4K9EH 3RGHA 4HULB 1MRCL 2QBWA 2VDOH 5DZNA 2JK5B 4N0YL 3VJ6A 4LCCC 4MB3A 4FP8L 5IK3A 3SE8H 2DL9A 3RDTB 1YZZA 1QLRA 4JY4A 3TGXA 4TSCH 5CP3A 2AJ3A 2FL5A 4V2CB 3T77B 2LU7A 2W9EL 1A14H 4QOKD 4HIIA 1U8QB 4MDJA 3U36B 3GSQB 2PO6A 35C8L 3N85H 3OXSA 1MFEL 2F8OA 3S36X 5EUOB 2OJEA 3T3PE 1NEUA 4HGMA 5I76B 1U92A 2DWEA 4KKBC 3SKOA 4P59L 3TZVC 4P23D 4DN4L 1OAYL 3FT4A 2YPVH 2GSGA 2FD6H 1B4JH 1MPAL 2VTFA 4K3DL 5I0DA 5F9JA 3I3BA 5IMKA 5HGBA 3IU4L 2DI7A 4ODWA 4ZAKB 3PXHA 1GC1H 4NN5B 5EUKA 2EH7L 5JA8B 1J1PL 1Q9OA 3V4PL 4M4RA 3V0VA 3QDMD 4N5ED 2HKHH 2DQIH 2Y6SD 3N0PB 1MWAA 1WIUA 3MRRA 1B88A 2IQAB 5D1ZA 3IDNA 3BXNB 4H26B 1AP2A 3ME0A 4YDKH 1A1NB 4PJDF 3QPQD 5EC1B 1KPVA 1R5IA 4D0CA 4JFFA 2C1PA 5E7FA 2F5BL 1NMCC 5CUSL 4K2UL 5MENA 3LB6C 3MRPA 4JDTL 3ARWA 4DGIH 1RJLA 2MOVA 5EZLA 2OXGA 4G9FB 3MCLH 4LCCA 3QDGE 1QFWI 2BNQE 1SM3H 3D0LA 4H88H 1EO7A 4P46D 3MV9E 5IB5B 4WHDA 5L6YH 2DM2A 1NCBL 1ZV5A 3HRZA 2Y4SA 1XGTB 4WI6A 5CINL 4ZO8A 1TCRA 1EAJA 2P5ED 2XICA 2PXYC 1ZT4A 1I3GH 2VSCA 3ARBD 4PRDA 3TZVA 1IAIH 4LRNH 2AQ3A 4N0UA 1I3VA 1B3JA 4L9LC 1N7MH 2D7PA 5JPMA 2K1MA 4PY8I 3SDDC 4WTXA 4Y4FC 3PP4H 1MCBA 3QUXD 3GI9H 2GUOA 1DUZA 2QSQA 3BH9B 1AJ7L 1FFRA 5JXEA 3ZE1F 2XN9E 4I9WE 2FJHB 1J18A 5IV2A 1MVUA 5GRUL 1I7TB 5DD0L 5DRXA 1RULH 2JIXA 1OVZA 1X5FA 4NO5A 4JKWA 3O6FB 2DQEL 4PJ7A 1I7ZB 4JKMA 1U6AH 2ZUQC 4XGZB 3G6AB 5GGRA 4Q97A 1I1FA 3EOAA 2O5XL 4G8EA 5HHPA 5CEYB 5KTEH 1FN4A 4L9LB 1HN1A 2WUBL 1A9BB 3NTCL 3QG6B 1W72L 3SDDB 5B3JF 2OL3A 5CBAA 4QHUB 4XPAL 1MCIA 1S9KC 4PTTA 4R7NA 3NVQA 4LKXB 4PJAF 3SKMA 2VWEE 5J12C 3U4EA 4PV8A 5GIRA 2E27H 2P4AB 3NCEB 3V4UL 1K4DB 43C9B 15C8L 3BP4A 3CFDA 1L7TL 4KZEH 2OTPA 5ICZA 4J1UB 4MXQC 1MH5A 1P7KA 1NPUA 3GHBL 5DD5H 1AQKH 2VAJA 4UZGA 2PXYA 4MNGB 4PV9B 5DJZA 4JO1H 2R0ZH 4FQXC 4G6JH 4OGXL 1MIEL 2MJWA 3WFZA 1MF2L 5HI3C 1E4JA 1KT2A 4IRJD 4I77L 4W70A 4HX1A 4KVNH 2Z4QB 1INEH 3HI1B 4WFGD 5J9PA 3SGJC 1AXSA 5EOTB 5A43C 1S78D 1RJCA 1YNKH 5I1KH 2Y36H 4LKCB 4LLYA 1LEGA 5HHQA 1AD0B 1SY6A 4FABL 4X99A 2X70B 4KVCH 1U93B 1OGAA 1TZGL 4NKDB 1Q9KB 2A74B 1GCFA 1BVLA 1BX2A 5DF0A 1UXWA 1WF5A 3QDJB 2G5RA 4XMPH 4Z7WB 3D48R 2B7DT 4G5ZL 4HDIA 3QHFL 3IU3A 5D70H 4N68A 3S37X 4QRRB 3TPKA 1MCPL 4HK3J 2GITB 2JB5L 3I6GA 4KROC 3TNMB 3E1F1 3GK8H 3O2VH 2BK8A 3VXRE 1MCLA 3KJ4C 4BUGA 4NZDA 1G7PA 2IQ9L 2DDQH 3NCYP 4WUUA 4OZGE 4L8CB 5IJKC 3NCJL 4FQQA 1MJUH 1OPGL 1BJ8A 4I3SL 3E3QC 2DBLH 2VZVA 4KK9C 2R9HD 3EYFB 3QPXH 4JCLA 3MGOA 1FLTX 2BSED 1ORQB 3W0WE 1NLBH 3UEZA 4PJ5A 4FQXA 1EEQA 1SQ2N 4OB5L 3PWJB 2X4RA 2VXTH 3INUL 1JWUA 1OP3H 3O3AA 2PTUA 3HPJA 5CIPA 2H6PB 4PJ9D 3HC4L 4M1DH 3RZCD 1URLA 2YBRB 2PW2B 3NIDF 5FF6B 1V3KA 1DBML 4FFYH 4KGJA 3OAUH 3U30B 5DRWB 5LGHH 1VADB 3K0WA 2ZNWA 3W39B 2X4PB 3RVUC 1VFBA 2ED8A 3WJJC 1J9CT 3DUSA 4HWZB 1ETZA 5MI0C 1E4XL 1ZA3B 3EDDA 2YWYA 3KHQA 4LPXA 3AU1A 1F45A 3FO1B 3G6DL 4C56D 5KJRL 3MZGB 2UWEA 3HZVB 4LRIC 4X6DB 4AIXA 4EDXB 4HUVA 4G42A 4P9HH 3RWFA 4U1KB 1AKJB 4UU9A 4F7CA 5I66B 1YEJH 2EDDA 3N1QC 4LASH 3RP1A 3SJVD 4CDGC 1VKXA 1LEIA 2XTJB 3QA3B 3B9KD 5I16A 2X10A 4XAWH 2A6JA 4AQ1B 4JGMA 1MNUH 1VACA 5TE4H 2AV7A 2YD3A 1LO3H 5HDLA 1I1YA 3ELAT 4I2XB 4YXLH 3KPOA 2VQTA 5DLML 5DJ0A 2Y23A 2GTWA 3TA3C 1WAAF 4LNRB 2BSRA 3BO8A 4HKZB 4NJAH 4DZ8A 1R5WA 1X5KA 3CSGA 4JKKA 5ALCL 3DBXA 5AWNL 5DSCB 1RFDL 3H9ZA 4TUJA 3T0ED 5ISZD 2JJTA 5KSBA 2R2EA 3NGBC 3SKNA 4CVZA 4ZYKA 1CBVL 1F6AA 3MUJA 1LMKA 1A7NL 1ES0B 3L1OL 3MV8B 3KPQB 1NAMA 4LSVL 4JY5H 4P46C 5DA4A 2XY1A 5JW3H 2I60H 1CXFA 4ACPA 3U7YL 1KNOB 1FG9C 3X3GH 1R3IH 1FG2B 3IFPA 4I4WA 3C2AL 2LQRA 4EI6A 3BRFA 3CUPB 3RBSA 5EC2A 2X4SB 1DQTA 4LPYA 5HHMB 3VXSA 2EO9A 3TVMC 3L3JA 5DK3A 4HH9A 1RIHH 4LVNC 4LMQI 1HSBB 1Y6NR 4LCWD 4JLRB 1U9KA 4LRIA 4DN3L 1JVKA 2PTTA 3PWLB 1AE6H 2PTVA 5BMFL 3RNKA 3T65A 5JIHA 3CX5K 2EICA 3CLFL 1CDYA 2NY2B 4LPUA 3GSVA 2WW8A 5EOCH 1D5IL 4ZODA 5HYJE 4KKLC 1P6FA 4N0RA 1C1EL 4DFIA 3MA7B 2YD1A 1QG3A 5CAYB 2XPGA 4JRYD 1LNUA 2OK0H 4JKPL 1L4IA 3E0GA 3TA3A 3QULA 5IVXA 4P2RE 4YDVA 1HH6A 1VA9A 3MRKA 4ELMA 4F57H 3WFBH 2GYSA 2RFXA 2KZ1B 4ZPVB 1DDHB 2R23A 5JIIA 2P5WD 5FO9B 3MJ8A 4DK3A 3BKJL 1I9JL 5E8DL 4K3EH 3P73A 1X7QB 3SDYH 1KPRB 4RWYL 1LE5A 3D3VE 4QHMA 2ZPKL 3H3PH 5GGVY 2ADFH 3IGAA 1TCMA 4P46A 2BJML 1UGNA 5B8CB 1NCUA 5ACZB 1KIPA 4FTVA 4LSQL 1G6RB 3LAFA 4QGYA 5E8PB 1OLLA 1R3LB 3U7WL 1TVBB 4R4BB 1HINL 2P5EA 2IFGA 3VXPA 1DFBH 1UWGH 2W60A 4PJBE 3TVMA 1H15B 3CDCA 5D2NB 1KG0A 2VDLL 2MHAA 1BLNB 1OAKH 1EJOH 2ED7A 1A6AB 1QEWB 4LIQL 2AXJA 3CVIH 5EZIL 3GO1H 4PJXB 4FHBD 3BEWA 5BRZB 3MXVH 1CLYH 4HCRH 1X9QA 3SE3C 2FATL 4WI8A 1IEAB 3MROA 1XF4A 3RNQB 3BDBA 4IRZH 3GB7A 4PB9L 3K8MA 2AJVL 5JMRA 3KG5A 1Q1JH 3V0WL 3QIUB 4R9HA 1G7JB 2R69H 2ZG2A 4JQXC 2I9TA 1PG7W 4JFXA 3CDGB 3DI2B 3LKSA 1VHPA 5C0FB 1KJ3L 5F7NC 4XHJC 3DO7B 4J4PD 2B1HH 1WTLA 5E4EB 1U8MB 3L3IA 3N1FC 4QKXB 5GS0L 3GDBA 1KJVB 4UTBL 5C0DB 3VFUB 2A0LC 1ND0B 2VLKD 2WWKO 2VL5A 1IL1B 4PJEE 3SE9H 5ITBL 3LEYH 3RWDB 1VGEL 3DROA 3DUUB 3ULUE 1T2QH 4OM0L 2MQ3A 5JOPD 3FQNA 2XZQL 4FMFA 5EBWA 1KTRL 3WO4C 1EHXA 2E7HA 2DWDB 3PGCB 1JK8B 1FVEA 4Y4HC 4P5TC 4XVJL 4ZFZA 4NO3A 5IVZB 2IFFL 4KC3B 5F6IC 4G6MH 4L4VB 4GQ9L 2E7LC 5L8LB 4M6OL 4MS8C 1BZ7B 5KW9L 1YMMA 2XZZA 4HUWB 1IE5A 5MERB 3R1GL 4LDLB 4JR9L 12E8L 4OLZL 3GIVB 3P0GB 3VFGH 1R0AL 2MFNA 3LQZB 5DC9B 1C5BH 4NDMB 2X40A 1XCTA 4OLUL 5LGJA 4GRWB 3SE3A 2P7TB 3HG1E 3IKCA 4QY8A 5IQ7L 1A1OA 1FFQA 3NFSL 4IRSB 2AJXL 5HYSB 1S9YB 3KLSA 3FO2B 3RGVC 3CZFB 4DOHE 4OIBA 1QLEL 4YEFA 4L29B 3UJIL 1MLBB 4TPRH 5SWSA 1FL3A 3DV6B 4JQXA 1RZIB 4A6YL 1M7DA 4LSUH 3KYKL 4ALAH 5IB2B 3PQYB 4LARL 4QHLB 3WLBA 3BHBB 3QNZA 1EGJL 2GK0B 4XP5L 4S1RL 3X12A 1HHHA 5C0RL 4EZMA 3MOAL 5SWZD 4K8RD 5F3HB 5FYJH 3VFTA 3HAEB 5CZXC 5AYUH 2KDGA 4D9RE 3ZE2F 3V7AE 3VA2C 5IW6B 5JQ6L 4TULH 1JZ3A 5HPMB 5FFLA 1V7ML 4EOWH 2AXGA 4M93B 1AIFB 1NSNH 4OZHF 5BZDA 3AM8C 3FQWB 4YHOH 4UAOC 2X4NA 3GJFK 4ZUVB 2ZUYA 4PJAA 1KV3A 4OCMC 4UV4L 4Y4HA 1MQKH 3NIFE 5ADOH 1ACZA 2QHRH 4YPJA 3O3EA 4M5YH 4YGVB 3OB8A 5DK2B 1I8MB 2E7LA 4Z95H 2QKIB 3F12A 3TBVB 5C7XL 1A3LH 4OCSH 5TH2A 1A7PL 3T0EC 5IG7A 4LK4A 3NAAH 5D5MB 3S35H 5I1LA 1J11A 2F54D 1NKRA 3FOMA 3Q1SH 3C6LC 4S1DC 5E6ID 5BOZG 3PIQB 2Y5TB 3NABH 1CFVH 1N0XL 3A6BH 1SYSB 2EDJA 2Z93B 2Y25A 4LEXH 4KJYA 5F7EH 2O61A 5EO0B 1IGFL 2R1YA 5GGSA 5FGCB 5KSAC 1ZLWH 4W4OC 4LAQL 3RGVA 1NJ9A 4HIXL 3G9AB 4J8RB 4LOUC 3WXVH 2NW2B 1NBYA 3C8KB 1DANT 3WNLA 3NIGF 1LP9E 3B5GA 4DW2H 3L3HA 4E5XB 2Z8WC 3UTSE 3VXQB 3TO2A 1T1XA 2ICWI 4XCCL 3WFHA 3IRPX 3P11L 3P9WB 4G43A 4XCYB 5CS7A 5K33A 3SJVA 5EU6D 1JNJA 4JHWH 2FR4B 4LEOB 4D8PA 5JMOC 3MLXL 1UXSB 3B9KA 3NZHL 1CLOH 4OGZA 1GXEA 3SCMD 3AM8A 4NWUL 2RCSL 5J6HB 1X5ZA 2EIDA 3C60D 3HZKA 2DIJA 2B4CC 1L0YA 2E9WA 4BQCA 4YK4C 4I3RL 1HWGB 2X4UB 4F7MB 2ZP0T 2AXFA 1KEMH 1EJ6A 3G9VA 5E2UH 3IAPA 2AK4E 3KPMA 1DN0B 3RVWC 2W9DH 3UC0H 1WWCA 1T1WA 4G8GD 3PDOB 1YEGH 4CGTA 3J7HA 1QFUH 4NSKA 2CQVA 4WWKB 3WFDH 2BNRB 3SGDI 3BMWA 2FH6A 2DM3A 1Z3GL 5A2JH 3T0EA 5ISZA 4L4TB 5BVJA 4JFOB 3BIKB 3OKLA 5CKAA 2F8XC 1WCBB 3TPUA 5IB3B 3C6LA 2EIEA 5B38G 3P77A 5DMKB 3GMLA 1MCDA 3V5HA 3MRBB 3OPZH 1P2CA 2XZCL 5GGTH 2OBGA 4CBPA 3ZKMD 1S7TB 5KSAA 2OTUA 4W4OA 3KXFD 2VDNH 1T4KB 4YK4B 3M8OH 4OLYL 4JZJB 5TDNA 4CAGA 2CMRL 2XA8L 3BI9X 3O81A 1KN4H 2X4TB 3AGVA 3GSUB 3BWAA 4OCRL 1IBGH 1NFIA 2CIIB 5IP4A 1YJDL 5C9JB 1FL5A 1YQ2A 1BAFL 3QEGH 1JFQH 4JAMB 1KBGH 1I1AC 4XCEA 4H1LG 2OTWA 3N1PC 3TO4D 3U0WH 4N8PA 25C8L 1S9XB 4GQPH 1QRNA 2F15A 5HDOA 4PLOB 1KLGB 2Q8AH 1K3ZA 5DRNA 1JWSB 3GMOB 4UV7L 5BS0A 1MFAL 1U8LB 1J8HB 5DUBB 3VRJB 4JO4H 3HZMA 1BIIB 1E27A 1OW0A 3A0OA 2B2XH 3CCHB 4OCXH 3ULSB 3CVHB 4TNVK 5TQ2H 2P5WA 4CVXB 3RU8H 4MD4A 1RZGA 4JFDA 3L3GB 1G7MB 3FFDA 1ZT1A 4N9GA 2GSIB 2BVQB 3GBNH 3TV3H 4YBQD 1YPZE 5EZOL 1KEGL 1NGPL 4PJIB 4XPHH 2GT9A 4NJ9L 1FNSL 3P0YL 1LD9B 2XZAL 2Y07L 2QSCL 3FB6A 1RMFH 1DL7H 4DUXA 3OR6B 1Z6JT 3T4YA 4EDWL 2CUHA 4U1JB 4PJCB 4DWHA 1NUNB 3O41A 1N6QH 3MRNA 1S7XB 3ARQA 5FOBA 3VRLE 4R26H 3LN5A 3QUMH 4UIMA 4PRAA 4K9EC 5EOCJ 3LRSA 3GJEB 1HH9A 1OOAA 1IT9L 4HS6A 5E00B 2FECI 4DKFL 2EDNA 4XXDA 3REVA 4UTAL 1F4XL 1IC4H 4LVHB 3HS0A 3TCLB 4U49A 3WO3B 1I1AA 3QEHA 4R0LC 3T08A 3MRJB 3L5IA 5I8EA 1IEHA 3PWPB 4NN7B 1SVCP 5HJ3B 4IEFB 3MR9A 5MEPA 4L3EA 2Q3ZA 1FV1A 4AEHH 4Z78B 4NNXB 1A3RH 1IFHH 2HVKA 4P4KD 1QPPA 4YHZL 1XR8A 2NZIA 1BOGB 5DRZA 5BO1H 1UA6H 3DTXB 5GQBA 32C2A 2BRRL 2FLRT 3TYFA 3E2HB 3FZUD 2X1QA 1C5DA 1FDLL 4GLRH 3PUCA 4LCUB 1GC1C 5BQ7A 4J4PA 5IB1A 2CGRH 4G6KH 3G5VB 1INQB 1FZOB 2HJKB 4S2SA 4H5SA 4HD9A 3MLZL 3R8BB 2JCCB 1KCRL 1A9EB 1CDHA 4FG6D 2BERA 2BY3A 3GSXA 4BFGA 5E5MA 1M6OB 4BK5A 3H42H 2ZOKA 3RA7L 3TBSA 4DGVH 3LKOB 3D85A 3B9VA 2Z8SA 1RU9H 2X89D 3T3MF 3PV6B 3BT2L 4DGYL 4ZSOA 4V1DE 2CKBL 4U31A 2HTLD 3WXWL 1BF2A 1IGYA 1DQML 1PSKL 4F7TA 4ISVB 2WQRA 1U3ZA 1QFWL 2D0HA 2YXMA 4J3OC 3ILPA 3PJSA 4IMKA 2AKRB 3T0VA 4NQCA 3QBTB 3WS3B 4NRXB 2DYPA 1JPST 3IS1X 5E9DA 4XZUB 3G08B 1BD2E 1WFUA 4B50A 4H0GA 1SEBA 2I5YH 3FO0L 4FQ2H 5IMOB 2DQTH 4NKQB 4MQXD 4LPTA 3UAJD 1F58L 1U3HC 5D7JB 2CRYA 4R0LA 4LGPB 4LP4A 4RFOH 1XCQB 3ZKND 2BOCA 4HUKB 2FGWL 5E8OA 4NQSA 4PRHE 5FO8B 3QIBB 5KSUA 1CDJA 5CJOL 3MODL 2CLRB 1SBBA 2YN5A 3QIWD 1YY8A 5F1NB 4Z18A 3QRGL 4NGHL 2K7QA 5GGVH 4KI5C 4WTZG 3TP4A 3TH4T 4QXTA 3LQAH 1FNGB 1EIBA 1QBLL 5EU3B 5KAQG 2LU4A 3KPSE 1MHPH 2W91A 2R0KL 4F80A 3EDFA 5SWZA 4R7DB 1YECH 2WWMC 4GRLD 3ZKXB 1UB6B 8CGTA 4G6FD 3UYRH 4MAUL 2Y06H 5C86A 1OD7A 3O9WB 3A6CL 2WM0A 4P2OB 5HI5D 4BSWA 4LL9A 2XI9A 4XI5D 4XMLH 1ORSB 4TSCL 2J8UF 5IM7B 1RIUH 4HZLA 5E6ZA 3SO3C 5F1KC 1G9MC 4O5LL 3ZDZF 4LF3A 1ZSDA 2AEQL 4L8SC 5J57B 3QWRD 4U1HB 4JM4L 5ETUA 1NDGB 5C6WH 4AY0A 3D5OF 3WNPA 5C0GA 2G9HB 2D4FA 2UY6A 4WENB 4FQHA 1XR9A 4PJFE 2EECA 2OQJB 4JY4B 3LV3A 1DVFB 2Z9TA 3KYNB 3SQOL 2G2RA 3EYUH 2EDQA 1AQDA 4FMKA 5DTFB 4MDJB 1BIHA 4P0DA 5C9KA 5ICYA 1CICB 2F54A 1GYAA 5HYQB 2HKFH 5E6IA 3VI3F 4K8RL 1U3HA 4JFPB 4UNUA 4MJIA 1HIMH 5C07D 1U92B 3SKOB 4I0PC 2C5DC 2FX8L 3T8XA 3AXLB 4XCNB 4JQVC 3SO3B 5CLTA 1A6PA 2BDNH 3IJSA 1BFOA 5IFAH 5J1SC 5CWSA 4KRMB 4M43L 5IMKB 4S1SH 4LU5L 3F7YB 5J1AB 5EPMB 3AREC 3WIIL 2MCPH 1LDPL 3IXAA 1JPGB 1OWWA 3DYMA 3TBWA 3QUKB 4ZFGL 1T0PB 3S6CA 1JGUH 4U6YA 1CL7I 4QXWA 1MWAB 4HJGB 3GMRB 3DVGB 1WC7A 2Q86B 2VLMD 3UJJL 2DKMA 1WICA 5EU6A 3CLEH 4M61B 2MPAL 3I6LD 4R2GD 3B43A 4H88L 4P57A 5CJ8A 2NX5A 5EN2B 3BQUD 1U8NA 5K9JH 4KHXH 5C08D 2DIAA 4YXKL 5C0NC 2V7NA 3C60A 2VOTA 1ZHNA 4X8JB 3C5JB 3LKQB 4L8SA 4HPOH 1B2WH 4OZHA 4J2XA 1KN2H 1RJLB 4OCYH 1IC1A 1RZJC 4LVEA 1MHCA 2CDGA 2P8PA 2V2TA 2XFXB 3OG4B 2VKWA 3P9LB 1H0DA 3BPOC 3HKFA 4GKZB 4YX2H 5I1JH 3HRZB 5FYKD 3D69B 3GI9L 5F88A 1BWWA 3WFEH 4O51B 5A2IH 4HV8A 5FCUL 2VZUA 3IDJB 4MSWA 1L9NA 3TIEB 1CXHA 5EWIH 4DCQB 8FABA 1MCWW 4NQDD 1EX0A 1W72B 1JIBA 2M26A 1MCSA 4PR5A 2IG2L 3X14A 4X4YB 5D7IF 1U6AL 4PRPD 2APTA 3C9NA 1IZKA 4OF0A 5HVHC 1RUQH 3F58L 1D6EA 4JJ5B 3KPPA 2Q8BH 2HWZH 4UT7L 2LU3A 1ZGLA 3ZL4L 4LBEB 3VCLA 4WU5A 2Q76B 3IVKA 2EXWD 3QJFA 2W07A 1YEKH 4HBQA 1ACYH 2QQKL 3LSOA 3V5KB 3QCVH 1EMTH 1OAUH 4NQEB 3FQXA 3IFNH 3M1BB 1YYML 3QQNA 4LGSB 5D7LA 3OKKA 1MCWM 1VGKA 5C2UB 4KRPB 1KB5L 5GGRB 3EOAB 1GOFA 1FN4B 4Y19D 4E41B 2WLYA 1OB1A 4OIIH 1NC2D 3LOWA 3S3JA 2ORBL 1AQKL 5DJAA 3VG9B 5JHDD 3BISA 4FNLL 3VW3L 4JO1L 4P9HC 1CS6A 1X4YA 4G6JL 1BBJB 2A6IA 1ZK9A 2YRPA 3BUTA 3U4EB 3GSNL 4RGNB 1KFAH 1A6WL 1GGBH 5T3XD 3U82B 2YC1A 2IWGA 2Z92A 3OKEB 4JO2H 4Q9RH 3BP4B 3WNKA 3ISWA 3VFOB 3ULVE 4JM2B 1INEL 5H37H 1KCUL 4ODUB 1HXYA 2CLZB 1PKQB 1YNKL 4KGLA 2Y36L 3LH2L 1MQ8A 3ZHKA 1SEQL 5GGUB 5MEOB 4NUGL 3V6OA 4K94C 4IOIA 2Z31D 5DI8A 3ALXA 3P30L 4WO4C 1H3PH 1P4LA 4XP4H 4I48B 3BDXA 5J9PB 1QR4A 3Q48A 4OFIA 1GPOL 3U46A 4LDOB 3BRGC 3JV6B 1C5CH 3G6JF 5DWUL 5MHSD 5HHQB 1CFSA 3DXAB 4UQ3A 1U8JB 4XP9H 1FSKC 2A9MH 4ZTPH 3JBG7 4YEEA 4UBDC 1J88A 5FECB 4YHYB 3LRHA 4Y1AD 1HE7A 4ODXA 5BXFB 4MQSB 1CFNB 4WEBH 2LTQB 3ARDC 1XGUB 3MGTA 3MRMA 4JFEB 1BBDH 3Q3GA 4XNMB 1RUML 4GJTB 3RTQC 1VESA 3OV6A 5GRJH 1Q0XL 4LGRB 3C6SA 1T2XA 4IBLT 3OAYH 4HF5L 2OYPA 2GJ6B 2V5YA 3ULUL 3C09B 3Q0HA 1P4BH 1T1YB 1MCEA 3HC0A 1ZHLB 1NGQL 3EOTL 5KS9B 2VXTL 5D1XC 4DKAA 3AY4C 3PGDA 3UBXA 3ZYJA 2NY5L 1CU4H 4M1DL 4E0RB 2HMID 5JPNA 1TETL 4EUPH 5ILTH 4FZEL 3U9UB 4N0CD 5CGYD 1OT1A 3L7EA 5JUEH 2WQ8A 1M71A 2HH0H 5D2LA 5F6HI 4X9BA 4JPIB 4MAYC 3GSWA 4YC2C 1CE1L 2VLJB 3RTQB 3CDYA 4WO4A 2GI7A 3Q6GH 5L7XL 3MGAA 4PB0L 3MNWB 2WP3O 1AD9A 1UCTA 4FQIH 4KJQC 4PG9B 2FZ3B 4OF5A 4R97B 4LASL 1TJIH 4JG1H 2JF1A 3K81A 2CIKA 2OJZL 2XTJE 3L5JA 3EO0A 3PABB 4KK8D 3EJYD 4MD5A 4F3FA 4XAWL 2NQCA 2VDRL 4MQ7A 5FM5O 2EDWA 3ARDA 3GMPB 5TE4L 5JLZB 5JW5A 1J86A 4RSVA 1FIGH 1YYLL 4I2XE 1CFTB 5C0BD 3PNWA 4KZDH 5CCKH 4XNYL 4P2QB 4MJ5B 1BJ1H 4KDWA 4M1CD 5DT1L 5JR1H 5ESAA 5LKNA 5IFHH 3BJ91 2ED9A 3MFFB 4UUJB 3FB8B 1A6ZA 1NBZB 3WKML 1BQUA 4MNQB 3QAZB 2DLIA 4Z7OE 4ZFOA 2CXGA 4HKJA 4F33B 5D1XA 3KYMB 2HFGL 4POZD 5D9SA 5EIIA 3AY4A 1VACB 3K4ZA 2AV7B 3FT3A 5SX4H 1CT8B 4HWBH 2VLRB 1I9RH 2EYSA 1AFVH 1IEBA 4A2MA 5E2TH 2ZSVB 4MQTB 3BQUC 4MA8L 1X5HA 5JW3L 2F53D 1VFOA 3CXDL 3ZYOA 4NT6A 4RNRA 1T22B 1HHGA 4XNQB 2HFEA 1XGRA 3BN9C 2ZCLH 4GAYB 5HHME 1QVOB 4Z8FH 3S7GA 1RZKL 3HNSH 5GSRA 3ARVA 5BOPA 4JPVL 4Z7VF 3KPRA 4QOKB 4XPTH 4QXUH 3X13A 2IPUG 2LABA 1V3MA 2HLFD 3FRPG 5FIEA 3IFOB 3QI9C 3O4OB 3HPLB 3B4NA 1CE6B 4OCWL 4OFYD 2D7MA 5F44A 1L6ZA 1FZKA 1QQDA 1KJMB 2FHCA 4O2FA 4IJ3B 5EO9A 4L8BB 1CG9B 4BUHA 2WBKA 5EOCL 4G8IB 4XHQA 3EYOA 3UPAA 4POUB 3Q5TA 4P23B 3UTZB 1WIPA 2ZUUA 1JF1A 4ZUTA 5ADPH 2C3HA 1EVTC 2D31B 5FUZL 4M7ZB 5HHXL 2G75B 3B3IA 4ODTL 1ADQL 1C08B 2F74B 4F57L 5CEXA 5AYQA 3HC3H 1X4XA 4BH7B 2UYLB 1C16B 3GSVB 4Z0BL 5EU4B 4NZUH 4UINL 2H8PA 3U0TA 4HWNA 3OJ2C 1D5MA 1F4YL 3QDMB 5IHUH 2R1XB 4CNIA 4K3EL 1X5LA 3SDYL 2XPGB 4HCRA 1JTOA 3QI9B 4BSVA 2H26A 2QR0B 4MDIA 3MA9L 3KLHD 2ADFL 4YDVB 1HYRC 3W2DH 1HH6B 2IBZX 4ELMB 3BQUA 2UZIH 4OQTH 5GS0C 5ESVA 4Q74A 3FB5B 3MLYL 2YRLA 4DEPB 2FJGA 5F9OH 1A5FL 3IDYB 4R96B 1NCCH 1I3UA 1JGLL 3BVNA 1WFOA 2J8UA 3P73B 4UQ2A 5DUML 2DI9A 4ORGB 3GUTA 4NN6B 5GS1C 5D2NE 4AENB 2BXYA 3IGAB 1LHZA 3M07A 3P40A 4KHTH 1OAKL 1A2YA 1EJOL 3RKDC 4X9FA 1HZHH 3KLDA 5GRXG 4PJXE 1G7QB 5J11C 1QUNA 3O4LA 5MP6H 4AIZA 1BEYH 3ARBB 4M7KH 5I6XC 3DI3B 4NQDA 2YUVA 2COQA 3KR3H 1KG0B 5AUMA 3PHQA 3HFMH 1KTDB 3EYQD 4ZTOH 4PRPA 2XKSA 4OSUH 1QFPA 3QUXB 1YY9D 5ANMB 2YD6A 5BV7L 4X6CF 4EIZC 1T83C 3SY0A 4NZTL 1FAIH 3EOBB 2B1HL 3GKWH 3B5TA 1T5WA 3NOIA 3BZFB 4OZGF 4I18B 5CHNB 3D39A 4G9DB 4QYOA 3ZT7A 4NQXA 2R2CA 3MUZ1 4KTEL 3H6JA 4LLMA 2C1OA 4JPKH 3SE9L 3LRGA 2R4SH 4JANB 4LSDA 5J11B 1T2QL 5FYKL 3NZ8A 2CDEA 4JHAL 5IKCB 1FYTB 1T0MA 1MCRA 1KB9K 5I9QC 5I6XB 3F6IA 3QEQD 3HMXA 4PJDB 4RDQF 1NUFA 4G7VH 3AB0B 4JKLA 3C5SA 5IT2L 2UVFA 4Y19A 4EN3C 5L2KA 3NN8A 4X98A 3BOVA 4AYFA 4DK6A 1V5JA 2NNAB 2NY7H 1DQLH 4WFFD 5DJCA 3HE7C 1UWEL 3I75A 4PS4L 4YDIH 5GS1A 3RWIB 1T2JA 1OARH 4P3CL 3ZDXF 3LMJL 3U0PB 1CLZL 3BPNB 2W0KA 4DTGL 1R5VA 4A6YB 2ZSWB 1ZANH 1ZVSA 4WW2C 4WI9A 2VLLB 5B39A 1CQKA 4GRWE 1ZT7B 2AJZA 1PW3A 3ARRA 3QG7L 2IH1A 2NR6D 1I4FA 1F8TH 2VUYA 4LSRL 3ZMRA 4XPFL 5T3ZE 1FJ1B 1FNEB 5J0BA 4TPRL 2ADGA 4HKBA 4IRJB 1WV7T 1NGZB 1RVFL 4LSUL 1KPUA 1Z5LA 3ZE0F 4ALAL 3TFKD 4K3HA 5A16B 3PQYE 1TVHA 3CC5B 1JHKL 1T83A 3ES6A 5D7IA 3OTTA 1EZVX 1RUAL 2R2BB 4R3SB 5EBMB 2I07A 3H9SE 3FQTA 3RQ3A 3DGGB 5IMLB 3T4AA 5T3XL 4TULL 3IT8D 4Z7QE 4WJ5A 3W5MA 4JFHD 4M7JL 1MI5D 1M7DB 3TNNA 4YHOL 1C12A 4L1HA 4XPBH 4JFYB 4ZUSA 1NC4D 1FZJA 1Y0LB 2NZ9C 4ELKA 1HHHB 1CXKA 4WI5A 1N3NA 5ADOL 4HFWA 1JI2A 4M5YL 4EQ2A 1D9KC 4P99A 1MLCB 2YR3A 1XIWD 2VQ1B 2IPKB 3HE7A 3DX8A 3CMGA 2XWBA 4Z95L 2PW1B 4FFVD 3QEUA 4U6VL 3ILQC 1RHHA 4OI9A 4Y2DC 3X3FL 1A3LL 4OCSL 2XQYK 4W81A 4F15B 1HSAB 5CJXA 4Y5XA 5FXCH 1REIA 1QA9A 3WDJA 2X4NB 5D5ME 4WNQA 2A6KB 4PJAB 4QHKJ 3S35L 2ESVD 5I8KL 2EYRB 4XTRD 2HLAA 4OFPA 2YPLD 3I6KA 3L3DB 4WW2A 4EXKA 3OB0K 2GW5A 3DYPA 4HK0B 1KIQA 3OG6B 5F7EL 4AEFA 3FHQA 1SJHB 5T1KA 3VFMB 1T5XB 1GRWA 5K9KB 1P84J 1X3DA 4ZOEA 5TH2B 5LAXA 5GPRA 1PLGH 1BGXH 4X0KA 2V2XA 1UB5B 5E2VH 3LZFL 1OSZA 4YO0A 4NCDA 5I1LB 5I1HH 1D9KB 4PJ9B 3SPVB 3TBTA 3EHBD 5DJXA 3RZCB 2OX5A 3MNZB 3VMPA 4YHNB 3RIAF 3FT2B 3K2UL 1IRAY 4Y2DB 2NY4D 1HQRB 1MREH 4P2YA 4AH2B 5A2FA 5C09A 3HZYA 4ODVL 1KIRA 4HIEA 3QXDA 3GSOB 3RY6C 5T1DH 3G6JA 1E0OB 1CF8H 1NBYB 5GGTA 5INCB 1CLOL 2YD8A 3ZHDA 4FZ8H 4YWGH 2AJSL 3EYSH 1A4KA 4C56B 3MREA 3FCTB 5T5FL 1BM3L 1RZ7L 1XF2A 5KN5A 2OCFD 2FECL 3BWUC 3DVNB 1KEML 1MOEA 2EKSB 4OD2B 3PP3H 1Q38A 5CP7A 1TZHB 5J6GA 4YHPA 5C3TA 2FB4H 4W6XB 3B2UD 1RZ8B 4OM1L 4K7FA 1SBSL 1QFUL 3CMOH 1TQBC 5IVNA 2BNRE 3WFDL 1S7WA 4WI2A 3WNNA 3RUGF 1I85C 3SDCC 4L4TE 1R3KA 4ODHH 4UI2A 2KKQA 5KZCB 3G5XB 3CH1B 5IIEB 4N9OB 1FH5H 2FJFA 2HG5B 5C0IB 3UTPE 1N64L 1J1XH 5CSZB 2FO4B 2UUDH 2J7LA 3DWTA 2CLVB 2Y7QB 1YN6A 4H8WC 3NCBB 4PJBF 1A7QH 5DD1H 2HJFB 1JHTB 4X9GA 3MZTA 3VRIB 3ZDYE 5H94A 3FQRB 3Q6FA 4JB9H 1I7RB 2VL4A 5FA4B 4MA3B 2O5YH 1BHGA 4Z7UF 5KG9A 4DFHA 3MACL 4GW4A 3DSFL 1UJTA 3S5LA 4KK5D 2I25N 1J7VR 1PYWA 5T1LA 3V5HB 2EIZB 4GKNA 1IQDB 4GAGH 3C2SA 1QLFB 2VE6B 3P4MA 2PF6A 1GHFL 4GFTB 3JTSB 2AJUL 5FYKU 5SX5K 1BJ1J 4HKXA 3TT3H 2I24N 1WBZA 3KGRA 4X80H 1EHLH 1QSEA 3WL9B 4MD0A 4KMTH 3PE9A 4LCWB 3QUMA 5DEFA 1CWVA 2HA1A 4U1MA 1NFIB 3QXAB 3MLPA 3U7AA 1DBKL 3SDXF 1J8HE 4FQCL 2BHZA 1YY9C 1J8KA 3MBED 2DQJH 4KKCC 3BW9A 5L2JA 2VDQL 1AGDA 5F7LB 2OLDA 1I85A 3G04B 1UWXK 3Q5YA 3SDCA 2QTEA 5HGHB 3NFNA 3QDGA 2ERJC 4HS3A 4H20L 4JRXE 2BNQA 4KRLB 4KAQL 5IJVB 2VWEC 1RUKL 4JRYB 1CZ8L 4W6YB 4PJIE 2P24A 4D9LH 3MV9A 4XPHL 5BW7C 1V8HA 2NXYC 4FFZH 1NLDL 1F13A 1N59B 3RWJA 2P5WB 3QQ3B 1KCVL 4RFNC 1BQLH 4PJCE 5JTWA 4E9LA 1HK6A 4GXVL 1T21A 4X9HA 3P3YA 1EO5A 4R26L 4KV5E 3QUML 4RIRB 4QTIL 2GCYB 4XBPA 4EVNA 4OD1L 1FFOA 4U1NB 4N8CL 5TFSH 3CSYA 1GH7A 3PV7A 5C6PB 4J3UA 2GFBB 3D9AL 4ZFFA 2ZUVA 4K3JH 2ERJB 4GUPA 3VWKD 1AO7D 1DBBH 5IW3A 4PJGE 5H35A 2NTFB 4HGWB 4Z7VA 1FGNH