3W9DA

Structure of human monoclonal antibody e317 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
209
Chain Sequence
VTLKQSGAEVKKPGSSVKVSCTASGGTLRTYGVSWVRQAPGQGLEWLGRTIPLFGKTDYAQKFQGRVTITADKSMDTSFMELTSLTSEDTAVYYCARDLTTLTSYNWWDLWGQGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the antibody neutralization of herpes simplex virus
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antibody Fab heavy chain
total genus 43
structure length 209
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA01
4UDTB 3WNMA 3QH3A 4GAYB 2YPLD 3GSNL 1A21A 4HK3J 2J6EH 3EDJA 1CG9A 3I75A 4LLMA 4KUZL 1OT2A 3PE9A 1NL0L 5SWSB 3THMH 1I3GL 4BZYA 3ARGD 2VLLA 3ROOA 3N1PC 1IE5A 2IANB 1WT5A 3CFKB 3FQXA 4ZOEA 1CLOH 3FO0H 5HHPB 2H2PC 5EU6B 4Y1AE 4I2XE 2Q3ZA 4X6CF 3RX7A 4PBXA 4RX4A 2APTA 2WP3T 1SQ2N 1JHKH 3MLUL 1MRFH 1R5WA 3HNTL 3VGEA 3RL2B 2XWTB 4C58B 4ZODA 4AENB 5DC0A 5CEZE 4BSJA 5D93C 1TCRA 2PCPA 1WICA 1ZAGA 3E0GA 5JOEA 4AYFA 5KSVA 1WLHA 5GGUB 1MHCB 1BF8A 4K7PY 2QQNH 5I1DB 1S5IH 3HZMA 4Y4KA 4GAGH 1DL7L 1VESA 4I5BA 2UVFA 1FL5B 1RK1B 3MLUH 1H9VA 1MRFL 5F9WB 4Y5YA 3WDIA 5C09D 1AGBB 3C5ZA 5ICXB 5H2BA 1V05A 4NPYB 1CDJA 1AH1A 4JVPA 4PB9H 1EJOL 4ZOBA 4Y4KC 1BM3L 4RNRA 1XT5A 4PUBH 2BNRB 3GI9H 4K7PL 5SWZB 1S5IL 2KKQA 5DD1L 2XKUA 4A6YA 3PQYD 2DL9A 3IAQA 1GGYA 1WAAA 4OV5A 2ZJSL 4PG2C 1ZTXH 3NZ8B 2QQQA 3LZFL 3BFOA 4D0CA 2GITB 4N0FB 5E4EB 5E00A 25C8H 3FQRA 2HRPL 3OJVC 3X13A 4NT6A 2D7QA 4UUJB 5L2JA 4EQ2A 1AXSB 4HCRL 3SGDI 3EDDA 5E5MA 5C0NC 4Z7OF 4XCCL 4O51B 4NM8L 1EJOH 5C0DB 4MA3B 4KKAD 4UZGA 4K9EL 3HNSH 1DQJB 3EO1A 1IVLA 1IARB 3GSQB 5DTFA 3T4AA 4BQ6A 2GK0A 3U0TB 2VE6B 3HPJB 5ACZB 3V7AE 3U7AA 2EXYD 3IETB 2X44D 4PLJC 1H15B 1LE9A 1N2RA 5ETUA 4UQ2A 2D7MA 3P77B 2UZXB 5DS8B 4KWUA 4M48L 5DD3L 3STLB 3IJYA 3C8HA 1T7XA 3FQWA 4JN1H 3LEVL 4MLSA 2VH5L 4I3SL 1OAKL 2W38A 2EDTA 3ZT7A 3TO2B 2VN7A 5E2VL 5EIIB 5FOBA 5DJ0A 1S9XA 4NN5B 3MRGA 2XI9A 5D5MA 2NPLX 5ACZA 1YEHH 2VL4A 1SM3L 1EO8L 1FGVL 4WWKC 2B1AH 3OKEB 1AD0A 4XXDB 4M48H 3RP1A 4HS8H 4YDKL 3DETD 1MI5D 1CICD 4EI6B 1YEDA 4H88H 5EOQH 1AXSA 4ZNEE 3PV6B 5CUSL 1ZXQA 5SV4A 3X13B 5F7EL 1FGNL 1PDKA 3L7FB 2R1YA 4GAFB 3OB0K 1S7TB 5F9OH 2X4RA 3O3EB 4X5XA 1U2CA 4FFWD 5ELIA 2ICWB 5ESAA 2RFXA 2EDBA 4X6DA 4KK5C 4NWUH 2AK4B 1TPXB 5T33H 5E94A 1EO8H 4GUPA 1FFOB 3PGCB 5I1IL 1LD9B 3FCTB 4WU7A 2VXTH 4MWFB 3VXUB 4JO2L 5EOQL 3RWEB 3QO1A 5EULV 3C5ZB 5ICXA 1MH5B 4AIZA 4G6KH 2VQ1B 5F9OL 1T0NB 5D93B 1FNGA 5IW1B 3UO1H 4RWYL 3CLEH 4P2OA 5C0IA 4KPHL 3DECA 4HC1L 4OCNC 1SEBA 5T33L 1NQBA 1U8OB 1YNLH 3DBXB 2QKIA 3REWB 1S78D 1FYHB 5CJXC 4ZD3L 2ZKHH 2P24A 3EGSB 4MDIB 5A2IH 3TIEB 5DT1H 4DN4H 4R0LA 3GMOA 3V9FA 5EBMA 2IF7A 5IR1B 1RPQA 1TVDA 4UMGA 3GIVA 1K4CB 1LEGB 4LCWA 3DVGB 5T3XD 3SOBL 1YQVH 3FO2B 3OG4B 1N3NA 5D96B 3VGDA 1R5WB 4EVNB 1JN6A 3NACH 1MCBA 1JNNH 1FNLA 1FFQA 2VLRB 4HFUH 4KPHH 5IK3A 5JUEH 4HC1H 1K8DA 5H35B 5IWLA 4KZEL 4HWBA 1HXYB 5CZVL 3HNVH 1SBBA 1I8MB 3FAWA 4XC3L 1P7HL 3OTTA 2R1XA 1A3QA 5JPNA 4U1JA 1MVUB 3WNKA 4F57L 4JFED 5DT1L 3V5HB 3IAPA 3UTTD 5IMMA 3WIHH 3MRCB 2VLKB 3BI9X 5GS0H 3O11A 1ZT7B 3ULVF 2EECA 2UWEE 1PD6A 2DQJH 3VXPA 1SY6L 3WUWA 4RA0C 4LLMB 1WBZB 2AK4E 4NKIH 2EYTA 3VFNB 2DTSA 4KDTC 4JJ5B 1T6WA 5K9OA 4JFHE 4U1KA 2A74A 3T4YB 3KPRE 3T65B 4TUOB 1S7XA 3TYGL 3C60B 3HG1E 1LNUA 3DO3A 3V8CA 5CD5D 3T2PA 1RUAH 2EDYA 4P46D 2MQ0A 1M4KA 4WEMB 4CU6A 4P99A 5BVPL 5GS0L 4MYWB 1MLBB 3PWUB 2DQHH 2WMPA 2DQJL 1BGXH 1EEUA 1U91A 1X5GA 2MKLC 2DLTA 2QJDA 5F70A 5D7IB 4OKDA 3ULVE 1DN0B 4KROB 3CFEB 4QHKI 4LPXA 2YUXA 1G9ML 4WUKH 5D7JD 1DLHA 4U1HA 3QQ4A 5HI3C 1C5BL 4PRPB 1RZFL 5E2TH 3D39E 3TYGH 5JDSA 4KGLA 4X7SH 5FYKD 1RUAL 4J3VA 5IF0B 1Z5LB 1BQSA 4APQA 4XPFL 3B2VH 1F4WH 1DE4A 5IEHB 5D7LD 5FYJL 1TXKA 3NIGE 1EHLL 2DQHL 2WUCH 1T0PB 2R4RL 1KJ2A 2MNUA 2FX9H 5T1MA 3ARZA 5F96L 1LHZA 4PJIB 3CFCL 4HH9B 4LEXH 4LGRB 4RFEB 1G9MH 3SKJL 5I74C 4LPYA 5DJYB 4PG9B 1BBDH 3O2WL 4MLIA 4H8WC 3X3FH 3KPRD 3OKKA 3ISWA 1P7QB 4X7SL 1IEAB 5EU3B 4EXPX 4NFCA 1R5IB 2X4PA 5GISL 3H9HB 5LCVH 1LK2A 2X4OB 1U8NB 3B2VL 3EYUH 3FONB 3OR7A 5A3IC 4MNGB 3ZT5A 1OB1A 2C3VB 2P47B 2DDQL 4J8RB 5IVOA 4H8WL 4IRZL 1I7RA 5IM7A 4XPAL 5DFVC 5F96H 4HQQH 3NIDE 2DQDH 1U41A 4YDVB 8FABB 4LSSH 3NCCB 5TJWK 2FSEA 3BZ4B 1U93A 4PD4J 1FJ1A 4P59H 3QUXC 3E6FA 4NKOB 2QR0A 2P5EE 1KCRL 3IKCA 4KK8C 1KIPB 1KCSL 4PP2A 2QSCL 3UBXA 3FRPA 1EUTA 1N5YH 4XPAH 3SDCC 2FJFB 4OLWH 1CQYA 1MVFA 2VDML 2AJYL 3UBXB 4KRLB 3TCLB 3QO1B 2ZCLH 2MCPH 5KVFH 1FVEA 1OAZL 5I1KL 5T3ZL 1A14L 3OV6A 3WFHA 3GHBH 2V2WB 2HWZL 5T3ZE 5I6XB 1OP9A 4XMKH 1D6EA 1N26A 4H1LG 2VDQL 1T7VA 2CKBB 2VXQH 1UB6B 5GRXG 1IEHA 4JREB 5HGHB 3QULB 1CFVH 4ELMB 1MLCA 5KG9B 1SVCP 4N1HB 3GJFB 3QCTL 1NBYB 4QRPE 1UC6A 2RHEA 2E6PA 3HG1D 3WS6A 1PJ9A 4N0YL 3TFKC 4HUWA 3RNQA 5IWLC 2ZCLL 4MHHG 1KLUB 3SDDC 5KTEL 4GS7C 2R0ZL 3CSPA 1NANH 3QUZC 1A14H 1LK2B 2DLHA 2X4OA 4MX7B 1U58A 4G43A 5J3HD 4MD0B 1PKOA 1TQCB 5IMOB 2Y4SA 4K3GA 3PWPB 5D5MB 5IW6A 1FH5H 4YK4C 4LARL 4YX2L 3MRGB 2FIKA 5GHWL 3LEYH 3BYYA 3KPLA 4M8QA 4OZGF 4PREB 3QCTH 4PJ8C 5I8KL 3T0BA 2BXYA 2IAMA 1WBXA 4MNQD 5F1NB 2XY1A 1PYWA 2KQMA 2CIKB 5KTEH 1FVCA 4HWZB 2YK1L 1UCBL 4L4TD 3MMEB 1CGTA 2OSLA 4GXVL 5ID1A 2K7QA 1MCQA 1N2RB 5ETUB 4P5MA 4M93C 1J05A 2IBZY 3AM8A 1S7SB 1FH5L 4FABL 3OX8B 4ERSL 1ZHBA 1HI6A 4GKZA 1KCVL 1W8NA 4GKZB 4XVTH 5HPOA 2YD4A 4GAGL 2M8XA 1V8HA 4OZGE 1X3DA 1JPGB 3F7QA 3VXNB 3FB7B 5DA0B 4PJ8D 3HPLB 5T1KB 2OL3B 4I48B 3MLWL 1II4E 4OLYL 4OJFL 4JO1L 4HIEA 5K9JL 5MHSE 5E2WL 4QOKB 3OKOB 3AREC 1IRAY 5FHAL 3FQNA 3TV3H 3BUYB 1I1AB 5IV2B 1EIBA 4Z78B 4NGHL 3P0YL 3LKRB 4OCYH 5D7JB 3O41B 5CINL 3V6ZA 3MREA 4A6YB 4MA1B 3DX9B 5JW5A 5FGBA 1MRDL 2BNRA 4XNMA 5SWZA 5DD1H 4BFBD 1ACYL 3L5JA 4JZJC 3RUGE 2WV3A 2DLFL 1RU9H 3VXOB 3EFFB 4S10A 4HFWB 4OJFH 5DLMH 5BS0A 4LPTA 5E2WH 2NY4D 1KTDA 4LFHD 1Z6JT 3MBEB 1AI1H 3KNBA 4XCCH 3S98A 4NZTL 3DRQB 3R8QA 1KULA 4FFWC 4JM4H 3MNWA 5B8CB 3RBSA 5E70A 4YLQT 3LKSB 4JEGB 3DV6A 3HB3C 2F19L 3FL7A 2DLFH 3K1DA 3QI9D 3WLBA 4XPHL 4KTDL 4YHKL 5BOZG 1DFBL 4Y19B 2WW8A 3ZTNL 4AENA 4E41B 5MHSD 3MX0A 2J8OA 3PIQB 4G8FA 4W70A 4XNQB 4Z0BH 4HPYL 2PKDA 4OUOA 4M6AA 4P3CL 4YZFF 4ZSOB 3REVB 1OAKH 2L4OA 2VLKE 4YC2C 3QQ9C 4V1DB 3KDMB 3TVMC 3MCKB 4DGYL 1IC1A 2DM4A 3TA3A 3RDTA 3RWGA 1KB5L 3O6FD 3QEQD 3BPCA 3EFFA 3I84A 5IW3A 1YNTA 4AEIH 5C2BL 2F54A 1AGFA 1XMWA 1DFBH 3DRTB 4NRXB 3RWEA 3T09A 3DURB 4NSKB 1JYVA 3T1FA 3MCLH 4P3DB 4WU7B 1JWSA 1A1OB 5DZNA 5I0DA 2DL2A 4XVSL 4YDKH 4HWBL 5A2FA 4U1NB 4Z0BL 3AB0C 3MREB 4N0RA 4AT6A 3QDGD 4GBXA 2IJ0C 2ZG3A 2WBWB 4YZFE 1TVHA 4YK4B 3TYFB 4TSAH 2X4PB 4R4FH 4ELME 4APQD 3MPCA 4AEIL 3MUZ1 4N1CA 1J8HB 2VDLH 5A43C 3QWRD 4GW4A 3BP4B 4L3EA 1OAXL 2DLEA 4UT9L 5HI3D 1G7MB 1RIUH 2AK4D 4GW5B 1FFPB 4C55A 4UTBL 4MCYA 3AMKA 3BRDA 1X4XA 3BDYH 4PTUA 5A3ID 1IAIL 5I1GL 3MV7A 2WINA 5JTWA 3SDYH 3O6LH 3W0WB 1NJ9B 1X5XA 3ECBA 5I73C 3CLEL 2OR8A 4BA8A 1R3LB 1MIMH 3ARFA 4U6YA 3GMMA 5DHYA 3HCVB 1MI5B 4ELMF 5C07B 1F8TH 4FMKA 3STLA 4N9OB 2OL3L 3SY0B 5I15H 3MLTA 1JPTL 1FYTE 5CWSB 1QHPA 4MDJB 3KPLB 3F65A 4M8QB 3CFBB 1H15A 2GYSA 2F9BT 3C9NB 4NZDA 5C0GB 4FFZL 3GSXB 4MCZB 3SOBH 5ID0A 4WW2B 3PG2A 4FFYL 1JGLH 2FNBA 5MEQA 4XGZB 2HTKC 2FO4A 1I1AC 4BSVB 3QA3A 1B0WA 3OXRA 7FABH 1HDMB 1BLNB 3CDCA 1MIML 5FYKE 4U1KB 3T65A 2NY1B 4HIJA 5HYQA 4MA8H 4N0UA 4PJFA 2IGFH 1UACL 5D7IF 3A6CL 4RRPG 2DMBA 3CZFB 3NZ8A 5C0AD 2VLJD 4XHJC 2OYPA 5ID0B 4Q9BA 3MRBB 1XCQA 4FFZH 3RWHA 2HVKB 4MXQD 1IL1A 4UNTA 3VU2A 3ULVC 1I85C 1A9EA 3NCMA 2RJMA 4NQUA 1JFQL 2R2EA 1HZHL 1F4XL 5GSRB 1JZ5A 5HD8D 2E7LA 4HDIB 5C07A 1YYLH 1IQDA 2IAMC 1RZ8B 1HH6B 5H35A 1FZJB 5B39G 3Q1SL 5I8EA 5CSBA 5J9PA 1QTYT 3H9SE 4OI9A 3UPRB 3TA3D 5BVPH 4F7CB 4POYA 1BGXL 3DNKA 1K4CA 1MCNA 3PNWA 5J13C 3CCHA 3VXRB 1ES0B 3HUJB 2PW2A 1GGCL 1ZEAH 3QEUA 2WBJA 5ALBL 1JFQH 3GMOB 3MOQA 3B9KA 3D2UB 2C4FT 1F4XH 4OFDA 5DUPH 5E2TL 1B88A 5JPMA 1HK6A 4CVWA 4WNQB 2AK1H 5FO9B 1V7MH 3BJ91 4HAFA 4CADA 3LHPL 2IAMD 4PGBB 1T3FB 2XV6B 3LV3A 1DLFL 4Q2ZA 1X5AA 4F33A 1CS6A 12E8L 4IDJL 3EJYD 4D0BB 3GI8H 2EXYC 1OARH 2E7HA 3VXUA 1I7UA 4L3ED 4K07A 4MA7H 1NDMB 1ZT1A 2NXZC 1JK8A 3EFDH 3RTQC 5B3NA 1VCAA 3RWGB 4OAWA 4DGIH 5LCVL 4X4XA 3C2AL 3PJSA 5F9JA 1ZHLB 4YPGB 4HIJB 5HYQB 3ALPA 4OCRL 3ARFD 1IGCL 1OARL 3MV01 3KVQA 4NJ9H 2HN7A 1IJ9A 2X70A 5JOPD 1S9WB 1N7ML 4YFLI 1G7LA 2V7NB 32C2A 2VUOA 4O2CA 2FO4B 3MLXH 2XQYG 1SYSA 1JNLH 5EZJB 1DQML 4G7YL 4NRYB 2UWEB 1MJ8L 3B3IA 5T3XH 2FBJH 4OZIA 3U82B 4PV9B 1A3RL 2YPLB 4R4BB 4HUVB 5C9JA 4EUPG 3CPLA 5INDB 4R26L 3PHSA 2AJYH 2XACC 2Z31D 2DB8A 4LDLB 3WEXA 2WUBH 1N7MH 1G1CA 3KPSB 4LU5L 2PXYB 1HQRB 2YXMA 3V4UH 2CDFB 4QXUL 2WLZA 3GHBL 5JXAL 1DQMH 3D3VA 1M71B 2J4WL 1SYVB 1FP5A 1JL8A 1RK0A 3QNYB 5IP4A 1Y18A 1CK0H 1UQSB 2X4UB 3G5YB 1CFVL 4P46C 1A3RH 1JNHA 2G5RA 4PJ5E 4X9HA 3CU7A 2H2SD 4U1JB 1DR9A 3RX5A 2VB5A 5ENWA 1C16A 1TIUA 4F7PA 4BFIA 3C8DA 4NT6B 1EUUA 2AI0H 4G80A 4RGOL 1NLDH 2F5BL 3HB3D 4QXUH 5EU5B 5JXAH 1JN6B 4NO3B 2IEPA 3G6AA 4QRRD 2EDQA 1NGYB 3G5YA 2ITDA 4PJDB 3QFDB 4LEOB 3NN8B 3LEYL 3IS1X 3QPXH 2Z8SA 1S7QA 3HKFA 3QCUL 2P5WA 3VWKD 5HVWA 2IQAB 4P5MB 3QQ9D 4GQ9L 3P9WB 4IMLA 3T2NL 4ZUTB 4GRMB 2QHRL 4XNYH 1L0YA 5JORB 4RMSA 5IB1A 4RMWA 2DM7A 4NO0D 4R2GD 1CDUA 2FEEI 2OTUB 4ENED 3LKOB 3T2OA 3GM0A 4PREA 4FABH 3FO1B 5FDWB 3OPZH 1KCVH 3LB6C 4XVTL 3RVXD 3QPXL 4NRYA 1W72L 1IC7L 5H94A 5C0BB 2R0WH 3BWAB 1UWXK 1KT2B 4QLRA 3U36B 1MFDL 5EOCJ 4D3CL 3SJVB 3HLAA 1OTTC 3U6RB 1OWRM 2ZOLA 2BRRH 5CJQH 1ND0B 4UV7L 3UTSE 5FHAH 3BW9B 1YEKL 4QWWC 4U6XB 5HHPA 4JQXA 2EEDA 1ZWIA 2LTQB 4F3FB 4NNYB 1G0XA 2ZG1A 4HFWA 3P9MA 1G6RB 2K7PA 3GMQB 3OHXB 1YMME 5SWSE 3BPNB 1AD0B 3RVXC 1PY9A 1FIEA 3D85A 3I6LD 1T03H 4KV5F 1D5BB 4ZYKB 3GRWA 5DUBA 3ALWA 4HJJL 4OF5A 2YZ1A 4HPOL 3P4MB 3WE6A 4DKEL 1BOYA 3GKZA 3KLAA 4QRUA 4Y4FD 1MJJA 4QCIA 1HOCB 4NZTH 3E6HB 3JWDL 1VFBA 5BZWB 4XCYB 4JM4L 4PGZA 3OBAA 4U1IB 4KMTH 1U8HB 4IOSD 2WQRA 1PG7L 1R24B 1T5XA 5DS8A 4P2YA 2F19H 4NQCD 4HZLA 2AJ3B 4I9WE 4Z7VF 4M00A 4YE4L 3T08A 5DVMA 2BP3A 4WW2C 4OLVH 5HGAB 3QPQD 3JWDC 4L8DA 2VXUL 4DKEH 3L7EB 4P23B 3GUTA 4G9FB 3S36L 4L8DB 1XZ0A 2MWCA 2OTWB 5DJXB 3F7VB 3ARDB 5TQ2L 4HPYH 2P46B 1N6UA 2NX5D 4ZO6A 3SKOA 3KYNB 3HMWL 5J6GA 4M1CC 4NRZB 2NNAB 3PWPE 4DGYH 1MCWW 3CDGB 4KMTL 2X4SB 3BQUB 2EIBA 1FVCB 2D0FA 1HHJA 1KB5H 2X6MA 4K3EL 5DQDH 4PRNB 4YUEL 4QRRA 4ODXA 5IUSA 4ODWA 4NCDA 4Y4HB 4Q97A 3OJDB 4PY8I 3MCLL 2VXUH 4HIHB 2H26A 3PQYE 4EN3B 3IJSA 3SDAA 2YUVA 5DMKA 1GAFL 1K6QH 1X5FA 2GHWB 3DVFA 4JKWA 3UP1A 2V7HB 1XIWA 5J11B 1YN6B 4ZAKC 4MJ6A 3K80A 3RPIB 2ZSWB 4K3EH 1DBKH 1NUFA 1ZS8B 4JFYB 2H6PA 2XWBB 1I8LA 2W0LA 5INDA 3RWJB 5DMYA 1ED3A 2DWEB 1QFUH 2Z4QA 3IB4A 3WYRA 5MEQB 2IH3A 3MOAL 3WO3B 2D03L 4YGVB 1U3HA 4ZQKA 1WK0A 2FL5A 1IAOA 1QVOB 5HGGS 1GAFH 3CFBA 3DYPA 5EU4A 1VSCA 1AE6H 3J8F7 4CBPA 3VGAC 5DO2C 5ECJE 2VKXA 3UTZB 4WHYG 4M6OH 3DUUB 4FN0A 3MRJA 4X6BB 4J2XA 4GG6A 1AGDA 4JQIL 5IT2L 1WV7T 4PRIB 3SQOH 3INUH 1F8TL 2V6HA 3QDJD 1ETZB 2FRGP 4BZ1L 1QRND 5I15L 4RDQG 4LBEA 4KJYB 2V5TA 1D6VH 3VI4F 2ATPA 3O4LB 2ESVD 3ARDD 3X14B 1FJ1B 3BIKA 1FRGL 4OB5L 3WSQH 3QIUD 2B1HL 1ZLUK 2V2XA 3LY6A 1FYTB 1WEJL 5MEOA 4NUJB 4ONOA 4M6OL 4HT1L 1ZK9A 3QFJD 4ZXBA 1SHMA 3A6BH 2NY6B 1ZGLP 4JQIH 5TF0A 5IT2H 2OI9B 1JPFB 1AP2A 1K8IA 3S8WA 1HXYA 5EBGA 5EOTB 3DO7A 5D7SL 4J8RA 5DURD 4AIOA 1OB1B 2C3VA 4HC1A 5DD5L 3U4BH 2GSGB 4FXGB 3F6LA 2BSRA 3LOWA 1H5BA 4JM2D 4DOHE 4MXWL 4OB5H 3WSQL 3T8XA 2B1HH 2CKBL 1R3HB 4HGWB 4M9PA 3D3VD 4UT7L 5B38B 5JHDD 4CDGC 2P24B 3HC4L 4IRJD 3ARED 4HKXB 2QKIB 1QKZH 3LS4H 4KVNL 5D6DC 1RHHA 3TNNB 5TE7L 2NX5A 5AYUL 4AH2B 5I9QC 1NDGB 1Q72L 1DE4B 1JYNA 3CXHJ 4F7EA 4PRIA 2DAVA 3SDXB 4MXWH 5H8DA 3SGEH 1I85A 4G8FB 4NQSB 3TJHD 5HY9A 4V2CB 4HDIA 3OZ9L 3O45B 4YAQA 3GSNH 4OCSH 4LHQB 1X4YA 4X6CA 2P43B 2FWOB 4KVNH 3DMMB 4ZQKB 1UJ3B 5EO9A 1NL0H 2XTJE 4HS3B 4LDOB 3C87A 1SYSB 1F00I 4LPWA 4LF3A 6FABH 4AQOA 1YEEL 3FAXA 3QXTA 1FSKC 4J1UB 3CXHK 4P2OC 2V17H 4IDJH 4DZBA 4LL9A 4NO0B 1GHFL 1KTDB 3S4SB 1OY3B 4EI6A 1I1FA 3CC5B 3TBYA 1P7KA 4NO0A 3TT3L 3UTTE 3SCMC 4LSUL 2JB6B 1DBAH 5KS9F 3A67L 5TF1H 3IF1A 3PP4H 4X4XB 1YA5A 5A40E 1WCBA 2FWOA 1A0QL 5CBEB 1DUZB 1I7TB 1KNOA 3TNMA 3SE8H 3OJDA 3AAZA 4OTXL 5CSZA 1HQ4B 2V17L 3IXAA 4G42B 4QWWD 4JPWH 1I7UB 1IC4H 4QRRB 2OI9C 4KKLC 4NJ9L 4WHDA 3WFEH 1J87A 1T89C 3ARFB 4A2MA 1K8DB 1PZUB 1DBAL 2W07A 2EDFA 1ZVYA 3CVHA 4FZ8H 2WINB 3G6JA 2VDOL 1M6OA 3LIZL 4R8WH 3PHOA 1A6VH 4MCYB 1NDGA 4OIIH 2Z92A 3FMGL 5F3HA 4JFZL 5C6TL 3H9YA 3QIUA 1A0QH 2F54D 4LMQI 3TVMA 3L5WA 3T0EE 2PW1B 5T3XL 4HKXA 2ICWJ 3WHE1 1HIML 1FV1A 3S6CA 4JFDB 3BP4A 4L3EB 3QHZH 3MRIB 4R26H 4I3RH 4K7PX 3VXRA 4RISL 4W4NA 4MQSB 2PXYD 3MV11 1EGJH 5HHNA 2XZQH 4OZGB 5FA3A 1H8SA 43C9B 1OL0A 1TLKA 3HMXL 3V4UL 5F7MC 4ENEC 1MHPH 2YPVH 4QCIB 3LRSA 1BJ8A 1WZKA 3CJJA 3MRNA 5HGBB 1UXSB 3D6GA 3DIFB 4CGTA 5F7FA 3BMVA 5TE6L 4K9EH 3HNSL 5F7KC 4LNRA 3PHQB 5TDNB 1IFHH 2E8YA 3P9MB 2YUWA 2GJ6E 1ZANL 2AJVH 1DQQB 3MYJB 3QZWG 3TA3B 3DLQR 3WS3B 3HMXH 4YQXL 5FYJE 4KI5E 3KPMB 3Q0HA 4KXZI 5FA3B 1F58H 1INQA 3IDNB 4F2MA 3CDFA 3G6DL 2Q20A 2XZAH 5J1AA 3HZVB 3PP3H 5IVZB 5C7XL 5BRZD 2P8MA 5HGHA 4JN1L 2YC1B 1JWUA 4H0HB 1EPFA 3QIBD 1XGTB 2MHAB 3AMLA 4Y1AB 2WAHA 3MRJB 5BW7C 5ERWA 3ZLQC 3PDOB 3L5XH 4WFHE 3P73A 2H9GA 2IFGA 5BJTB 2PW1A 1K5NB 5I6XC 2AJZA 1ZLVK 4OLUH 1ZANH 1KIUA 2AJVL 1PX4A 2HG5B 1YEHL 2FL5B 4YQXH 1Q0XL 2OTUA 4J3UA 2R0LH 4ODTL 4RX4D 3KNBB 3RI5K 3EOAB 2XTLA 3GNMH 4DVRL 1H3WM 4M7LT 3EYVB 3W9DB 3L5XL 4YHLL 2O5ZL 2R0WL 1ZHNA 2QSVA 2VMFA 2WWMC 4HWEL 4EUPB 3R8BB 3TBSA 4JFFE 1FQ9C 3RY4A 1GOFA 1OLZA 4L8BA 3SDCD 4L1HA 1YJDL 1Q0XH 4JDVB 4HW6A 4ZXBC 4Y4KD 1DQJA 3EO1B 2O5YL 5SWQB 4EUPH 1YEKH 1CCZA 2XWJA 3GB7A 5FXCH 1NCWL 3GNML 4DVRH 2D9QB 4PJEF 1QPXA 1BD2D 1D5IL 2JJTA 3H9HA 1OLLA 2WIIB 1AR1C 3MRQA 4F7PB 4LF3B 1U3YA 2XTJB 5T5NG 1I9IH 1BFOB 2NNAA 2W0PA 2P8PB 1GGBH 4TUKH 4PLNC 3R06A 1CGSL 1HHHA 2OMNA 1A64A 4K23H 4LKXA 1ACZA 3B4NA 4OD2B 3N0PB 4Y2DA 3QUYB 1M71A 1RJZA 4U7MA 5CJ5A 2DD8H 3EJYC 3GK8L 1J8HD 4Y16B 1NCWH 4KFZC 1OWWA 4BH7B 1YQVL 1HSAB 3T1WA 4TNVF 2G60H 3EOAA 2UYLA 4HMCA 1T7WA 4PJAA 1ITCA 4HXAL 2Y5TB 4X6FA 4RIRB 1U8PA 4QRUB 4K23L 1DN0A 2DBLL 3FT4A 5DWUH 3TZVC 3KLAB 4CUCA 2I9LA 3AU1A 2E7BA 2F5AL 5D2LF 4F57H 4I2XB 2D4FA 3ZDYF 3I9GL 3F7YA 3V7AG 3QEQB 3HMWH 1RIHL 1H3VA 2ZPKH 3DV6B 3SN6N 1T5WB 2I07A 4G9FE 3U9UB 3QO0B 4X5WA 3MNWB 4AEHL 5HDOA 4PJBA 3VFRA 4UU9B 4AG4L 4CMMA 2LABA 5EO0A 3TJHC 3GEWB 1UVQA 5IHBA 2ZCKL 3FN0H 3HC0B 4N0CD 5TFSH 5C86A 5DA4A 3CH8A 1NAMA 5I16A 5GGVL 4QT5B 5IG7A 1ND0A 2X09A 5HDQH 5C0BE 4YDLB 3QI9B 1K6QL 2VSCA 5FO8B 4YBHA 1RIHH 4QRPD 1DDHB 3RY5A 3WFHB 4WEUD 1J10A 2EO1A 3I85A 1LEKA 1ZHKB 5JMRA 5HHMD 1I8IA 4UTAL 4OSUL 3D0VB 5HPMA 1BEYL 1CDGA 1P4IL 4UU9A 4DAGH 3MBED 1AGDB 4K71B 5CIPA 5C71A 1MFAH 3V79C 2ZUSA 1RUMH 1XGQA 2JF1A 5HDQL 5IMKA 1TJGH 4GRMA 4U4BA 3QUKA 1F3RB 5IEKB 3H8NA 4APQC 5AZ2L 3SDCA 4FQHA 1UWGL 4D9QE 2FX9L 2BNQE 2EE6A 3BXNB 4XZUA 3FFDB 4XAKD 3QP3A 4M93B 3QUYC 1HI6B 3MUGB 3SKJH 2CSPA 4JZOA 3VGAB 2G5BA 3RWJA 1BBDL 5IKCA 1WFUA 1J05B 3ARTA 2XQBL 1KCKA 1X5LA 2MPAL 2BK8A 4QOKD 4WCYL 3K1KC 4BH7A 5T1KD 3EYUL 2Q3AA 4HWZA 1S7RA 2VSDA 3PWVB 4PJ8B 1P84K 1FRGH 5M94B 3VXME 4JFXB 3QUYA 1DP0A 3FOLB 4GSDH 4BK5A 5CEZH 5FCUL 4QRRE 4HQQL 3TBTB 1R5VA 2DQDL 2PUQT 4Y2DC 5I1AB 4R7NB 2DIJA 4BQBA 4WI2A 3TVMD 5ESAB 3D18B 4YHZL 3KPPA 4K9EC 4ISVB 1T2QL 4YHIB 3VJ6B 3JUYA 5D7SH 3GBNH 3VFOA 3GSNB 1IZJA 1IBGL 2DWDA 4NBXB 4NO2A 3VD4A 4WCYH 3WJJA 4WFHD 1CU4H 5ADOL 3IU3A 3LKQA 4L4TB 4C4KT 5TGBA 1MJUH 2H45A 4C54A 4RA3A 2EC9U 1QYGL 1KCSH 3GMRB 4MS8D 2BHYA 2LE9A 2B7DT 3AFLA 4JY6B 1IKNC 3HRZB 4JFEA 4PJBE 3AS3A 1KENL 2EYSB 2QL1A 1YYMH 1L7IH 4TOYL 5E9DE 3CFEA 3WNPA 1D6EB 4H26B 2DKMA 3DMMA 4WUUB 5T3ZH 4NP4L 1T2QH 2K1MA 1S9XB 2P45B 5TE7H 4MSWB 5D1ZD 4YIQA 3I2CL 5ADOH 1XGQB 2H2PD 2VDQH 2F53B 1XGYL 1JF5A 2YMXL 3O3AB 3PP3K 1A02N 4S0TD 5D2LB 1EERB 1B0GB 3HG1B 3VRIA 2X70B 4NM4H 4PJGA 2NXYB 5CJ8A 3OZ9H 3R0NA 4NCC1 1VEMA 4KKBD 4HIXH 4JJ5A 4U6TA 1KENH 2X4NA 5I8CA 4OGXH 3IVKA 2EDJA 3TWCH 2KQNA 4P48A 4PJBF 2R0ZH 4XNUH 2X4QA 4NP4H 4NKOA 4NKQB 2CQVA 4DN3H 4KJPD 3WUWB 2Z91B 3QYCA 3P73B 1IM9B 4WTWA 3I2CH 1AHWB 4EZMA 1YEEH 3MA9H 3TH2T 4LARH 4LLVA 4ZS6D 1GHFH 1KXQE 1MHHB 3BKYH 5I8KH 3Q5OA 5E08H 2X1QA 3FQUA 4HIXL 4JFOA 5AZEL 2VLRA 3H6JA 2C5DC 3TT3H 5JXEA 1IKNA 2G2RA 2QEJA 5D7LA 4XTRC 4PJ9B 2YK1H 1PLGH 1X5ZA 3UTPE 4KK9C 1EFQA 5IVXB 4NN6B 4KUZH 4LVNB 1R5IA 4O02L 1I3GH 5BCAA 1P7QA 5C0CA 1NEZB 4WI4A 4WUUD 2E6QA 3QUZA 2A6IA 2GAZB 4XAKE 3SE8L 2CDGA 4ETQA 2V2XB 1IAII 1M7DA 3O3BA 5DJCB 5F6HI 1CLOL 4OLEA 2ESVE 4PJIA 3WFEL 5BOPA 1OT1A 3ARDC 1EXUA 4Y5YB 1N0LA 1E0OB 3C5JB 4MJ5A 5IHZA 5FM5M 43C9A 5D70L 3HNTH 3MLWH 5GJSL 3LIZH 4R8WL 4FQXA 4JO1H 3WUZA 4LIQE 1GSMA 2BJML 2YD5A 1HH6A 4LHUA 4JRXA 5JDSB 4BUHA 4K3JH 3T0WA 4NGHH 5EZLA 4LVHC 5C3LD 4L1DA 4OCYL 5CINH 1FDLL 1HHHB 5E4EC 3BN9D 5C0FB 3PUCA 2XWTA 4RISH 2QLVB 4JM2C 5KZCB 2DJ4A 1QD0A 1FHGA 5D70H 5B8CA 5J57B 4F7MB 2G2RB 5D7LB 2X4RB 2FB4H 3ETBF 4OFYA 4ZFGH 5GJSH 3EYFB 1MHPL 2NXYD 4M61A 3SDXE 1QFWL 1HWHB 3MLRL 4RMTA 1NGWB 4EDXB 3VD5A 1T1YB 4GBXC 2F53D 5SWQA 3M07A 3QSKB 4BSVA 4PUBL 4U1GB 1AKJA 5DVLA 4WV1C 1T1ZB 2YD7A 4OQ1A 4O9HL 2PTTB 1MY5A 3GSRA 3GSRB 1RZJL 4MCZA 1ZT7A 4EN3A 5FKAB 3C9NA 3HR6A 1M7XA 1ZTXL 2CDFA 1MI5E 3LZFH 1KEML 3TBSB 4GAYA 3TH4T 3LN4A 25C8L 3HI6H 5L2KD 2BOBA 3JTSB 3PGDA 4P46B 3V5HA 1CFNA 5C08B 1NGWA 4EDXA 1KPUB 1QFWH 4X0KA 5C7XH 5CJBA 2NY7H 1D5XA 4NM8H 2CLVA 2MQCA 3MRKA 3M1BA 4DCQB 2YPLA 2H3NB 1U36A 3FB7A 2EXWC 4BJLA 4O9HH 5E0QA 4X7FC 4TQEH 4BKLB 3GKWL 1NC2D 2FHBA 3MC0A 5C0FA 4LVEA 1JYWA 3GIVB 4LCWB 3L7EA 3U0TA 1I9EA 5FUOH 1OAYH 4BZ2L 3HI6L 4Q9CA 3OAYK 2YR3A 3V8OA 3HRZA 4JFEB 3RKPA 4NO5B 1ZA3A 3D25A 2R0LL 3GMRA 4ODTH 4Z76B 1P1ZA 4L8SB 5EUOE 3SE3A 3LEVH 5E5UB 2NYYD 3QRGL 2DMKA 1MPAL 2VXVL 1R24A 1T5XB 3MV8D 3QQ3B 4DKAA 1KGCE 1NCUA 5IW1A 1J9CT 4ZFZB 5IHZB 1YUHB 4P57B 4HWEH 1NFDA 3GKWH 1EZVY 4TSAL 2HH0H 1WZMA 3V6OA 2AXJA 4WV1B 1QFHA 1AO7A 2VDLL 1FGVH 2VUYA 3GDBA 4HLZH 4U2ZA 3QI9C 1G0YR 4RNRB 4XP9L 2O5YH 3FOLA 3GIZL 3LB6D 1U58B 4G43B 5DD6A 3QRGH 3ZE1F 2ICWA 4I13B 4B0MM 5F7EH 1NKOA 2YEZB 3BDYL 1YUHA 4P57A 3DO7B 3C60D 3MLPA 4OZGA 5IKCB 5BMFH 1K3IA 2ITCB 1NCBH 1HWGB 2FZ3A 4HZAA 5JIKA 4JFPA 4LHUD 5HHXL 1YY9C 5IMLA 2G9HB 1CGSH 4XNQA 1MAMH 4NZJA 1FCCA 1VFAA 3QUYD 5GGUA 2OL3H 4XP9H 1MFBL 4JRYE 4Z18A 4N5UA 5GQBA 2VXTL 3B8SA 4JO2H 2VLKD 3BWAA 2EYRA 2KBGA 4OZFG 3BE1H 1XR9B 4WFFD 1JGLL 1GVIA 3X11A 2FJFA 5BMFL 1Z9LA 3QIWC 4MS8C 5D71H 4RWYH 3UO1L 4HXAH 5J9PB 4CW1A 2EDHA 3MGAA 3PXJA 2IC2A 3BPLB 3D39D 5CD5C 5IB1B 2VISA 4XBPA 1Q9LB 4MD5A 5IOPA 4ZD3H 2DBLH 2BVOA 4HUXB 4PRIE 3UAJC 4QHLB 3DUHA 4Z7QE 3CLFL 5DMGC 3WFCH 5HDBE 1KACB 3DV4B 3EZ8A 3IDUA 3QI9A 4JZNB 5J11C 3WJLA 2NX5E 4O5LL 3VH8G 3G5VB 5CJOL 5E2JA 2QQLL 3BE1L 4YGVA 3S34L 1F3JB 5E95B 2Y72A 2ZPKL 4M7LL 2XN9A 1RMFL 1S7WB 2E6JA 4AEHH 3ESUF 5E03A 5ISZE 3QB7C 4JFYA 5JUEL 4KZEH 3ORJA 3K8KA 5EC2B 2ZSWA 4KKBC 1EA9C 4XC3H 4JN2B 4GLRI 1AQDB 2YSSA 1X9QA 5GGVH 3RL1A 4G80B 2PF6A 5FM5O 3I6LE 1NSNL 4HIIA 4JZJB 3QEQA 5E8PB 2AXFB 3WIHL 3HPLA 1VFMA 4NKMB 4Y16D 5D1ZC 3EKCA 1FG2A 2CRIA 3OXSB 2KL6A 1TMCB 3IRZA 4NKIL 4E42A 4HAGA 4ODWB 1GC1C 4PJ5B 2A6JA 3IYLW 5DHYB 4G7VL 4ZFFB 5IEHA 2EZ0D 1R3LA 2AK1L 3G5ZB 4ZTOL 2EIEA 2N4IA 1JP5A 1UYWL 4AJ0A 5ID1B 5DVOA 4PBVC 1NSNH 3HE6B 4LNVA 1DLFH 5FHBH 1TJGL 3GJFH 3RVVD 2HTLC 4KQ4H 3L3OB 3MJ6A 4FQ1H 3F7VA 4PJXB 3QG6B 2FCBA 4LK4A 1JF1B 4NC1E 4X9FA 5CLTA 4KJWD 3SE9L 4YHYC 1ORSB 3QCVH 2A6IB 4HZLB 4OGZA 2ARJQ 1NEZA 4MJIA 4MAYC 2VIRA 1E27B 1E4JA 4ZTOH 1UG9A 3UROR 4HIIB 4JZJA 2V7NA 32C2B 5JLZB 3EIFA 3TIDB 1C12B 2GSGA 3QPQC 5CEYA 5FHBL 3LQAC 4Q6IC 3HS0A 5FYJH 1KG0A 2HTKD 4UOJA 3WFDL 5E8NA 1N59A 1GRWA 4KMQA 1OP5K 3B9VA 4PJHA 4BYHA 1IGCH 5CEZL 3A0OA 3VMPA 3PJSB 2HP4A 4X4MA 3CFCH 4O2EB 4OF6A 1T89A 4JFDD 3EOYG 5E6ZA 5DJ2A 1BZ9A 3LQAL 3QUXA 2DBJA 3O2WH 3OKMB 2VLKA 1KV3A 4U3XA 2FX7H 1ZHNB 3GBNL 4JGUA 2VR9A 5DJ2B 3V5DB 3V6BR 1KB5B 3N9GH 2RB8A 4KHTH 5GISH 4L4TE 4F3FA 3I75B 2A9ML 2NXYC 5JPNB 5DVNA 3QIBB 3ROLA 3ULVD 1IGJB 3WFDH 3BPOC 2YHGA 2YBRA 4OF0A 3VA2C 5TH2B 4PJBB 3O9WD 2WUBL 2YRLA 3UX9B 4LSSL 5C0AA 3IDIB 2DKSA 3LN5A 4JB9L 2F53A 1XR9A 4O58L 4LU5H 5J3HC 3WO4C 4LLYB 1U8QA 1LEGA 4MVBD 1IEBB 1PGRB 1KELH 1MCDA 5EBLB 4IMKA 3ARBA 2VXSH 1ZSDA 2W9DL 3IFPB 4PLJD 5SWSD 4P59L 2J2ZA 3FN3A 3EHBC 1NBVH 1X5HA 1UEYA 1IAOB 1KLFA 5I73B 5F7NC 4LSVH 1KCRH 3FB6B 1XGYH 3PNWB 3FO9B 3STZA 2QSCH 4JFPB 2AKRB 5DD0H 1N5YL 3VFMA 5B39A 5FCSH 5CEXB 4OGAD 4PLKD 2VQ1A 2FEDD 1X5IA 3JVGC 2AI0L 4NQEA 2MCPL 5KVFL 3FONA 3OR7B 4O58H 4PGDA 3TWCL 1TQBB 5MERB 1FZJA 2F5BH 4FXKB 1BIHA 1KELL 3MXVL 4LPUA 5CP7B 2YPKA 1S7QB 3MOBL 3VJ6A 4NQCE 2HLAB 1F3DH 4LSVL 3QFJE 2FJHB 2JIXA 4WU5A 2VXQL 1I8KA 1HH9B 3KPPB 3MA9L 3WBDA 5CP3H 3SBWA 5E94B 2AEWA 5TPWL 3QCUH 1JWMA 1XF4B 3BKYL 2R23A 2VLJE 5T1MB 1U8JB 3BIAX 5EU5A 4U33A 1X5JA 3CVIH 5E8PA 1S7TA 5FGBC 1F6FB 2APWA 1J11A 1PLGL 3BQUA 2QHRH 4XNYL 3QDJE 4PLKC 3V6FA 4O02H 3OB8A 1J1OH 1FC1A 1CXEA 4X80L 1Z3GH 1XFPA 1AFVH 3OG6B 4MNHB 4XX1G 3U2SB 4LCYB 4HMEA 2G5BB 3CDYA 1H8NA 1JGDA 4NDMA 4YX2H 5GGRA 2HKHH 1W72B 4FHBD 3JTTA 3PWJB 1HCFX 1W72H 5EZIH 4DVBB 2Z92B 3CVIL 5F3BA 4NQXA 4M1GH 2WNGA 3KYKL 3GMMB 1UZ6E 1UB5A 1LNUB 4BFEA 4X0KB 4X80H 1Z3GL 3KAAA 3C60A 3HE7B 2BY1A 5F1NA 4ZSOE 1RZKH 1JZ6A 3P77A 4U1MA 3U0PB 3S37X 1GGTA 3ZKNC 1YY8A 4NQEE 3T77B 1P2CA 2PTTA 1I7ZB 4UB0H 4FNLL 1WJ3A 2VDNH 5IB4B 2FB4L 1KJVB 3KYKH 4O51A 1T6VN 3KHOA 2FATH 4PJFF 5IVZA 5BXFA 3MLRH 3FJTA 3S3PA 4F2MB 1RZKL 5F9JB 1UZ6F 3FQRB 3FB8A 2BX5A 2DQGL 4K8RD 1CWVA 3QJFB 2PXYC 4P3WA 2EDKA 1ACYH 1PG7H 5JIHA 3ZDXE 3ARBD 2IPUG 5FF6B 1AGCB 1HYSD 1KEMH 2YS4A 4YE4H 2EIZA 1U8LB 4UT6H 5DLML 1R0AH 2IBBA 3QEHA 2DQUL 1PFCA 3LPGA 3WDHA 4MDIA 1S8DA 3LAFA 3QWOB 4F9LC 5HVHB 3K2UL 2FLRT 1AI1L 5D1XC 1Y6MR 2BOCA 1VACA 4QKXB 3E2HC 2JCCE 1B90A 2DQGH 3ZE0E 4CU8A 5E4IA 3TC9A 1CVRA 5K59E 1C08B 3C2SA 4Z76A 1H0DB 3QAZB 1GPOH 3QNZB 4YNYB 4XPHH 3PL6C 4NO5A 3EBAA 3ZDXF 4Y16A 1ZOXA 5FUOL 5B38A 2P5WD 3VWKA 1R0AL 1SEQL 2A6DA 5BQ7A 5GRUH 1A7RL 1WQVT 3K2UH 1MJ7H 3EYQD 2PYFB 3C5SB 1G9MC 1MPAH 2VXVH 2GIYA 4C56B 4QRQB 3M17A 4MJIE 3SKMB 4LCUB 4MNGA 3M1BB 3BQUD 3QDJB 4U1LB 1NCTA 5J7CC 2MMXA 1JPFA 1K8IB 3CMGA 5IBUB 4YEEA 4GG8A 3ZE0F 1G7HA 3UTSD 4LLVB 1T1XA 4F37K 3O2DH 1LP9F 3CFKA 3VXQA 4NUJA 1SEQH 4OUUA 2X89A 3MOAH 4XVSH 1DBBL 5T1DL 1WCBB 1WZLA 5DRXA 4MAYD 2NTFA 4PJ7F 3QUMA 3K8MA 5F7WC 5BV7H 3ARUA 1NGPL 1KIRB 3DHJA 2AJUH 1OF2B 1DQTA 4JKMA 4P2CG 1OSZB 1T1YA 2NW2A 4ZPTB 4R4FL 4OKVA 4OLXH 3TBVA 5E8OB 4PJXE 5DZLA 4PJCE 4R7DA 2QADB 4I0PD 1OAXH 4BZ1H 3EDFA 1DBBH 5T1DH 1RIUL 2BY3A 2IADA 3CSYB 4PGCA 1A7NL 4X6CB 1C1EL 2IADB 3CSYA 3QUXD 5EZJA 4WFGD 4PJ7E 2YUZA 2HT4D 3BZFA 2RR3A 4GS7B 3PABB 4HX1B 1VEPA 3PDOA 5F71A 4S1DD 4HT1H 3MRPB 5D71L 2NZIA 4YXHL 1S9WA 4Y1AA 2HJFA 4P9MH 3GBMH 2D7OA 3GHEH 2HN7B 1ZA6A 4Y5XB 1QLFB 4F7EB 4PJXF 1MCSA 3IFOA 1JPTH 3MA7A 1BP3B 4PJCF 3U4BL 2ILLA 5C8JA 2Z0BA 3MYJA 5DMKB 4ZFOA 5ANMB 2FJGB 1A7NH 1UZ8B 5CJOH 3S34H 1JZ7A 5FUZL 4G9FD 4Z7VA 2CKBH 4FFYH 3MRLB 1J0JA 3PHQA 1RMFH 1K4DA 3FTGB 4LLWB 1T0MB 1F4HA 2W0KA 2AXFA 3VA6A 2C4FU 1LVEA 3GHEL 3DGGB 1QKZL 3BN3B 3MJ9A 4UBDC 1YEJH 3BGFC 4MA8L 1U9KA 1Q72H 4QRQA 5EORH 4OZIF 2ARWA 3QG7H 4C57C 4GFTB 3OAZH 3HTLX 3C09C 5T1LB 1S7WA 5ACMA 4H1LA 4JZOB 1CICC 4EOWL 2BDNL 2FYYB 2OP4H 4P3DA 4YBQD 1MHCA 4RAVA 3R0MA 2ARJA 4JDZB 4OCSL 3RTQD 3BKJL 2AJXH 2IBGA 3LVEA 2GTZA 3ALXA 2FEDC 2EDLA 3Q1SH 4GBXD 1UYWH 2FR4A 1Q9LA 4MD5B 3LSOB 5BZWA 5EORL 1ETZA 4ODHL 3CVHB 3ARFC 1MRCL 4KQ4L 5F1OB 4U3HA 3IRPX 3G9AB 1OGAA 1D5ZB 3X11B 2CUHA 2IPTH 2OP4L 3PIQA 5FIEA 5ALBH 3MBEC 2QR0B 4Y19A 1LD9A 3FCTA 3F62A 3BKJH 2AJXL 2NMSA 1A1MA 3H2WA 3P30L 3RGVA 2CUIA 5KSBF 2Q87A 5JO5B 3AB0B 1FIGH 3UJJH 4NQDA 4ZNEA 1XIWC 2P5EA 1S78C 3O3EA 5SX4I 3DRQA 5T1LA 1MRCH 3L3HA 2PR4H 4F15B 4U6XA 4OTXH 2JB6A 2XWBA 4F8QA 3HE7D 3ILQC 4JPWL 1IC4L 5GS2D 2IPTL 1BECA 3QXDB 5AUMA 5GZND 2NZ9D 1GJIA 3U6RA 2V7HA 3Q6FB 4NIKB 1UH3A 3MUY1 3SJVA 4MNGE 2GY7B 3EFDL 2VIRB 1NC2A 3C09B 5GGTH 2FLBT 4JFZH 2BVQA 5C6TH 4U6HB 3MV9B 2W9LA 4N0CC 3JWNC 2A9MH 4HIHA 5D7JA 2PN5A 4Z7VB 3PL6A 4CKVX 1U8PB 1JI2A 4Z78A 1LEIB 1NUDA 3IXTB 1CYGA 1RZGB 5C0JA 3WXVL 2IANE 4JFXA 3OKOA 1CDHA 1MI5A 3DX6B 4NQSA 5HHOE 4P0DA 1QR1B 5HHOA 3X17A 3ECBB 2XZQL 2HLFC 4JB9H 5GRZA 2NZ9C 3G5ZA 4P4KD 4V2BA 4MJ2A 2NCMA 1NMCC 4R6UA 4HUUB 2OTWA 4HX1A 5DJXA 3TN0A 3NA9L 2FIRT 2EDRA 1OQOA 4FQQA 1JZ4A 1MJ8H 3NN8A 1YEIH 3QZWB 3G9VA 4LKXB 3GSWA 1JGEB 1UM5L 2FBJL 5TE6H 1BQHA 3WXVH 2JB5H 5C0RH 1DEDA 3LN9A 1FL3A 2DJUA 2UZIH 2DI9A 4JQVC 5IQ9B 3WUWG 1IFHL 3I6KB 4YO0A 1DANT 1QOKA 5DJDA 5JIIA 3V0VA 3BO8B 4OBRA 3RZWA 1HEZB 1GZPA 2NR6D 2Z31B 2YA1A 3ARBC 2YN3A 3O6FC 2VJXA 2NW2B 2A74B 3T4YA 3G6DH 4P2OD 4LPCA 1A2YA 5FGRA 4Y5YC 1U6AL 2MTPA 1XGPB 4XCNB 4D8PA 1V5JA 1QA9A 1JWSB 3OAUH 3SCMD 2ATKA 2NTFB 4LSDA 3BUTA 2UZIL 5IIEA 4MMZC 5DYOA 3IDGB 1QACA 1YNTB 1WC7B 3CZJA 5D6CB 3RGHA 5ITBH 3G5XB 4OBSA 4RGOH 1ODAA 3IGAA 3BH9A 4OZHA 4NNYA 5I16B 2CK0H 1F4YH 5DMGD 1NLDL 4GO6B 4DFIA 3O9WB 43CAB 3CPLB 2DTMH 2W59A 5BZDA 4ZSOA 1RUPH 1AFVL 4CW1B 3RFZC 5L88L 3VFRB 4M4PA 2J8UA 8CGTA 1MWAH 4AEEA 1A4JB 1N3NB 2HKHL 3PDDA 2HG5A 3QXAA 3OAUL 3HLAB 3LCYA 3UTZA 4YHLH 5EZIL 3K0WA 1XCTA 1XCTB 1GC1H 2XZCH 4TVPL 1QFWM 1RUQL 1AJ7L 2P5ED 2NY1C 2I9LB 1CL7I 5C0AB 4RBPH 1Q1JH 2XN9D 3U7YL 1H0DA 2XKNA 2JJVA 3ARVA 4UAOC 5KJRL 3SGDH 1RUPL 2Y5TA 5JW4M 4KY1H 5L88H 3VWJB 1MWAL 4M5ZL 5K9KA 3ROLB 3GMPB 2HJLB 3E6FB 1D5IH 4Z7OE 1PW3A 3C6LB 5T3ZD 1WC7A 4FXLA 4KK8D 3O3BB 4M8VA 5F7DA 1MFDH 1GGBL 4KRMB 3ROOB 1RUQH 1AJ7H 3WKMH 4K94C 1WT5C 4XNMB 3EDEA 4O2EA 1FFOA 4UV7H 2FATL 3VXRD 3V6ZB 3O4LE 5HGBA 3ULVH 1NCNA 7CGTA 1ZE3C 5KJRH 4YHYB 5I76B 2DD8L 4GXUN 1UWXH 1FBIL 3BQUC 2B4CL 3FB8B 3NPSB 2DQEL 3QNXB 3S97C 5ITFB 1BJ1H 1M05A 2G60L 1OSPH 2XWJB 2HT4C 1T03L 2EE3A 1S9KC 3QXVA 2BSTA 3TT1L 3CSGA 4QYOB 3V4VL 1YN7A 4HJJH 3VI3E 4H5SB 5EUOB 4Z6AT 4HPOH 4CVXB 4XTRD 2DQUH 3QIBC 5DI8A 3ULVL 1EO5A 2D0GA 3MLSH 5ESQB 3DWTA 1VGEL 3MR9A 5LJYH 4LRNL 4POZC 4UINL 1TFHA 2VLJB 3UZVB 3LDBB 1FBIH 1WWCA 4EUPA 2B4CH 3BVNA 3CH1B 3JWDH 4OF8A 2BY2A 5IVXF 3K74B 2H32H 3EYVA 3W9DA 5C0AE 5D5ME 1OSPL 3NFSL 4L9DA 2A77L 1GOHA 1E4XI 4LGPB 5CMAA 1D5MB 4NQXB 4JY4B 4OLVL 1A7PH 3LN4B 3TN0C 1U8IA 4JKKA 1DUZA 3MLSL 4CN1A 1C7TA 4FQLL 1Z2KA 1MLBA 3JTTB 5DO2D 4ZYKA 3IF1B 1UEMA 4Q9RH 1Q9OB 3FT2A 2ZCHH 3O6FB 5EBWA 5FECA 4MNHA 3U2SA 1AQDA 4MA3A 5IVXE 4Z7UA 3BWUC 4JN2A 4UAOB 2P8MB 2A77H 3ZHLA 4OZ4A 1KN4H 4YUEH 4XRCB 4UTAH 1U2HA 1ZHLA 3IDNA 3EHBD 3DETC 2OR7A 1A7PL 2IALB 3DX8A 1MLCB 1RUML 3D69A 4WTXA 4FQLH 4E41D 3D18A 5C6PB 1I9JH 3V0AC 1BREA 4NC2B 4Y19D 4R7NA 4BQ8A 2Q7YA 1NGPH 4LDEB 2ZP0T 1J5OH 4G9DA 4WJ5B 1R3JA 2AV7B 4RFNC 3BEWA 1CT8A 1DBKL 4OLXL 4KXZH 4UV4L 4KI5C 5H2BB 4LKCB 5DJAB 4HSQA 1DVFD 4GRWB 4Y5VC 3LV3B 1G6VK 1TZIB 3RVUC 3P9LB 1A6ZB 2CD0A 2AKRA 3QDGB 2EYRB 1CLCA 5EA0H 4PTTB 1BAFH 2P7TA 5T5FL 4F80A 2IQAA 4A6YL 1FN4B 1I1YB 1WGOA 5FA4A 2UWEF 3REWA 2G9HA 35C8H 3Q3GB 4YDVA 8FABA 2ADJA 5F3HB 3RL2A 2BMKA 3SQOL 2X10A 4S1SL 2ZWLT 4V1DD 3QEQE 5EOTA 1BAFL 5EU3A 1IGTB 4X7DC 4A6YH 2QHLA 1WEJH 1A1OA 1KB5A 1XF3A 2KPNA 4KUCD 3NAAH 35C8L 3A6BL 4X6EA 1L7IL 3SE4A 4AY0A 5FGSA 3CZFA 1NAMB 4G6FD 1YEJL 4X83A 3BKMH 3MA7B 4NOFA 3KLDA 3RNKB 1CE1H 4PJHB 3V5KA 4XAWL 3EOBA 3L3IA 1EVUA 4JGJA 1PY4A 1GZQA 2BRQA 3QO0A 2NY4B 2BDNH 3CVHH 4MNQB 4YXKL 1FFNA 5C09A 3LH2H 2APVA 2HVJA 5GGTA 4OGXL 4PV9A 4YIQB 1QBLL 3HC4H 2LAGB 3D48R 4GLRH 1NUGA 1TNNA 4XNUL 4Y7MA 3VGGA 4ELKB 4W4OA 5AYUH 2VO5A 3TBWA 1TZGH 4XAWH 4O2CB 1MAKA 3OKNB 3VXMD 3ZYIA 1ZS8A 5IJVA 1YJDC 5GGQL 4JREC 4C59B 2Q8AH 2ADGA 5J89A 5KVGH 4TUOA 3LH2L 4IRSD 4ETYA 2H1PH 1XIWB 3S35L 3OJMB 4MAUL 2R0KH 1QBLH 4JE4B 3NIDF 2J12B 3MR9B 1AQKL 3WLWC 2E9IA 2DIAA 3QIWD 3P30H 2D31B 3QUMB 4EKXA 4JQXC 4Q6IA 2W9EL 3ZYJA 4XB8A 1I1RA 2D3VA 4F9PC 1CGWA 2PO6C 4JJHA 3LKRA 3BSZH 5J6HA 5C0DA 1L0QA 3WJJC 1T1XB 5CGTA 1I1AA 1PBYA 2F74A 4QOKA 3DXAB 4X6DE 1I8LC 2H1PL 1TVHB 3S35H 5LQBL 4LSUH 3GSOA 3M17B 3QUMH 3KJ6H 3RBGA 1RVFH 2X1OA 4HG4J 2BJMH 1KFAH 1TVBB 2CUMA 3MQIA 4TNWK 4X5LA 5JPMB 1ZHBB 4PBWD 3BSZL 3PWPD 1J18A 3EYOB 3TIEA 1OAUH 4PYHA 3QNZA 1FDLH 1UGNA 2PO6D 2VL5B 3BIKB 3DBXA 4N1EA 2V2TA 4R9HA 3QDGA 3MMEA 5C0IB 4KRPC 5LQBH 2VISB 4XBPB 4X6DF 3OF6A 4ACPA 2A9NH 4XCYA 1FL5A 4J12A 4J4PA 1B2WL 5EH1A 1S7VB 2VDOH 4KDVA 1QBBA 1RVFL 2ZUVA 1O0VA 3FMGH 1R3IH 4IOIA 4M5YH 1UWEH 4ONFH 4HS6A 1CT8B 1YPZB 1OAUL 5GSRA 4DUWA 5JHDA 3MBXL 5EU4B 3TA3C 2ZUWA 2HTLD 3QXAB 3RWDA 3NCFB 4C4KO 2NY5C 2MHAA 1PZ5A 4WEBL 4X4ME 4WY7L 1EGJL 5KW9L 2QBWA 2A9NL 3HAEB 2HT3C 2YPVL 3K4AA 4EEEA 2OZ4A 15C8L 1R3IL 1T80A 5C1MB 3PV6A 4CMMB 2NY0C 3DSFL 3RPIA 3LKPB 4OI8A 3G5XA 4LIQL 1G1YA 2ICEB 4RAUA 1CFBA 3IDGA 1QO3A 1MCFA 4GXUM 2ATKB 4I0CC 4EIZC 3T77A 3TPUB 1YY8B 5C08E 1J0ZA 5KW9H 1KPRA 4QRTA 3DX9A 5JW5B 4ZAKD 3S5LA 3Q5YA 3P3YA 1OAYL 4UDTA 5F72S 4XH2B 4E0RB 2IG2L 2Z31A 5FKPB 3TO4A 4PRNA 4J23A 3CGTA 4PJAB 1CGVA 3O3AA 5HSFA 1HHIB 2OL3A 4I48A 3H3BC 1DSFH 1OP3K 4ZFOL 2NY0D 1EK3A 3W0WA 5J6GB 5IQ9A 4DTGH 1A47A 2VL5A 3QIWA 3ULSB 1ZA3B 3D25B 1FLTX 1GC1L 2XZCL 3AS1A 4WUUA 4TVPH 5F44A 2JJUA 1TJIH 3CFJB 3HAEG 2AQ3A 2ERJC 3DMMC 3TVMB 4TYUA 1UJ3C 1JF6A 3RUGF 3QFDA 1I3RB 3UTTB 5DHVH 3S36X 3MROB 4JANB 1CGUA 1ZKAA 1M6OB 1YEFL 2OS7A 4WRLA 2B5IB 1MCHA 4M5ZH 5SX5K 5L2JB 4DK6A 3KYMB 3U9PH 4NO2B 4W6XB 1QFOA 5FKPA 2HKFL 2FGZA 5IB2B 4XNZC 4J6RH 4LOUC 2R23B 5I76A 1NCBL 2CR3A 5I2IB 1V3KA 1ZLUH 2A1WL 5HHXH 4RFEA 3VE0B 5GS1B 2I60H 5FK9B 2HLAA 1CGXA 2XKSA 1MFBH 1IILE 2PO6A 4P4KC 4UNVA 3Q6FA 3RVTC 3FRUB 2CXKA 3BP6B 3C6LA 4OFYD 2NLJA 1AXTL 4KC3B 1WSST 3IU4L 4H1LH 4ZO8A 3I02B 1MAJA 2E9BA 2HKFH 1I3UA 2B4CC 3L3HB 4WHCA 4KTEH 1A7QL 2ZUQB 3QWQB 4QEGA 1CXHA 4WIQA 3FO9A 4TUKL 3REVA 3STZB 2A1WH 3TT1H 1OM3L 3WIIL 5JW3H 3VXUD 5I1DA 2A6KA 3H3PL 1AKJD 4XZUB 4XC1L 3EDKA 1CZ8L 1S7UA 5KSVB 1G84A 2P48B 4MD4B 3CLFH 1VGEH 3O4OC 4LRNH 4UINH 4X8XA 3O3DB 1P6FA 5I9QB 4O5LH 1KGCD 1BD2E 1MREH 4M7LH 2YXFA 1UT9A 3CX5K 1YPZF 3NFSH 1P84J 1BOGB 1D9KA 3V5KB 2D0HA 5KSAC 3D0LB 3H3PH 1CIUA 3VRLF 2CLRB 3DTXB 1WBZA 4LVHB 1CR9L 2F5AH 4OAWB 5FM4A 5ICZA 4PYGA 3PWNA 4XVJH 6CGTA 4XPBL 3KLHD 4R2GC 2ZCHL 4LNRB 5IB5A 3QUZB 1UM4H 5CAYB 2G75A 4R4ND 1HNFA 2AV1A 1S3KL 1H3TA 2VYRE 4AG4H 1R3KA 1DQLH 1GOGA 3WHXA 5IVXA 5IK3B 5HBBA 1YPZE 3SO3C 1IGIH 2GT9B 3U4EA 4G7VH 5TFSL 3VXMA 2IMNA 2VZVA 4UIMA 4D9LH 1T5WA 2I07B 5HVGB 4R96B 5LXGL 1GYAA 3HN3A 3V0VB 3VRLE 1QSFD 5HYIA 4OLZH 4AL8H 4ZAKB 3O6MH 4K71C 2OZ4H 5HHQA 1JNHB 3U48A 1FV1B 1YY9D 2GJ6A 1S3KH 3BD4A 4BQCA 4Q6IB 1WZ1H 1YMMB 3SE9H 4EN3C 4PLOB 1DQLL 4R3SA 1RUKH 3G08A 1DEEB 4JLRA 5CKGA 3MGTB 4JHWH 1A6ZA 3VFPA 4CN6A 2XTJD 2FGWH 2X4NB 4X7CC 3G6JB 1N6VA 1Z5LA 2FD6H 4D9LL 5GRVK 3WLWD 2XIDA 2ADGB 4GG6B 3DVNB 5JQ6H 3O6ML 1TCMA 3PABA 5AZ2H 1HQ4A 3IXAB 5D1XD 1UWGH 1WBXB 4MGXA 3PQYB 1QSZA 3O3DA 2GK2A 3BP7B 2P44B 3W39A 4LSPL 5FUCE 4WI3A 3SCMA 2D2OA 2HFFA 1U3HB 3PWPA 1CBVL 3LQAH 2IQ9H 2WBJC 4E9LA 2XA8L 2XQBH 4MD0A 3C6LD 2E3VA 3E3QC 3N9GL 4S1SH 2YD3A 3VXSD 1FFNB 5C09B 1FE8H 4HKJA 1INDL 2APFA 4ZUSB 5JQ6L 5LAXB 1LO2H 3MGOA 5DC4B 3EOBB 4ZPVA 3OKLB 1HDMA 1RSFA 1ZLSH 3W5NA 5FCUH 3GJFA 3OKEA 5HVFB 3S7GA 4PJHF 1L6XA 4K94H 1IKFL 1UM6L 4LMQE 2P5EB 3UTPD 4YHZH 5H37G 1CBVH 2VN4A 1S9VB 3RWCA 2COQA 5CGYD 3QXWA 1QP1A 5GS3A 2CPCA 4CVZB 3MACH 3Q6GL 1JGUH 4MQXC 4EXKA 2W9DH 1IBGH 3BP7A 4XHJD 4Y4HA 1NBVL 4ZS6C 1CU4L 1D5MA 2HYMA 1INDH 4FZEH 4CU7A 1IGTA 2JJTC 1FVEB 2DQTL 1I8MA 5I71C 1LO2L 1MJUL 5BRZB 2VNCA 3QDJA 1CGYA 2AAVA 5DD0L 3CVHL 4W4OC 3KYNA 4U0RB 1SJHA 4LP4A 2YWYA 2NTSP 1CVSC 4HLZG 1WIUA 1YYML 4DEPC 3FO2A 2ESVA 3ARDA 1WBYA 4PJIE 3WJLC 1EEZB 3W9EB 4JLRB 1W0VA 3ARRA 1IT9H 3MXVH 3RVVC 5BJTA 5HYJB 3ARGB 3U7WH 3BPLC 4J4PC 5HGAA 4QY8B 2M26A 2AQ2A 3QFJA 5T5NF 3VXTA 3QIWB 2AXHA 2FSEB 3BZ4A 1TZGL 2X5PA 2AJ3A 1SMAA 3EZJB 2DQTH 2GUOB 1JWUB 2YMXH 3QEUB 2FYYA 4KJWC 3SGJC 1SEBB 5IMKB 4Z0XA 5TPWH 5GGQH 2IH1A 5BS0D 4NM4L 4MAUH 2R0KL 5DJAA 5D2NB 4OV5B 4Z7NE 4PY8J 4YDIH 3JV6B 4QHMB 3WL9A 4POZD 4DN3L 1CFQB 4RGNE 4PJIF 1J1OL 2W9EH 3NH7L 1EH9A 4XP6H 1NFKA 1A8JH 3AS2A 5MEOB 1WIPA 3TM6A 2F54B 3AS0A 2RFXB 3DXAE 3JVGA 4X6DB 1X5KA 5DVKA 2DMCA 3CX5J 3RDTB 5CHNA 2R2CA 3GMPA 5CS7A 5AZEH 4PRHE 2I9TA 5CD3B 3VDAA 3QUML 2X9WA 5L2KE 2BY0A 1ZA6B 1F4AA 4Z7UB 3RA7H 3SBWC 1N4XH 3NH7H 4Q7DA 4Z7NF 2VZOA 2IFFL 4JFDA 3WFBH 1F97A 3QA3B 5GXBB 1B6UA 1BJ1J 1FNHA 3DUSA 3P11L 5C3TA 3EO9L 4NFDA 1I7ZA 2IAND 5GZNC 1EDQA 3HHRB 4GKNA 1KF9B 1KT2A 1DUYA 3P4NB 2OMBA 3DROB 3NA4A 1FL6B 3NFNB 3PHOB 4PGCB 3WN5A 4U1MB 5DJ0B 3FO1A 5FDWA 4UB0L 4O4YL 2DLGA 4Y5VB 3NIFE 3VXSA 3LD8B 1T20B 2VDNL 1CD1B 4RGMB 1A5FL 3O9WA 3HC3L 5L6YL 5IFHL 3V52H 4ONHA 5E8OA 4JAMA 2IFFH 4EI5D 4OKVB 1BWWA 4ONFL 3FQXB 2VZTA 4K3JL 2NQCA 4HBQA 1JNJA 2YRZA 2VTFA 3P11H 2AABH 5D6CA 1MCIA 2Z8WC 3BKCL 2YN5A 4OGAC 4FG6D 3MBXH 5DYOB 4GG6E 3EYOA 3SGJA 4N8CL 4IJ3B 1UH2A 3QWRA 3RVTD 3DMMD 2VE6A 3HPJA 1MQKH 4O4YH 4I1NB 5E1AA 3RZCA 4OUUB 1FNAA 2WM0A 3ARGC 2BHZA 4ZFGL 4BSWA 4GRLD 2R2HB 3NIFF 5K33A 15C8H 4WWKA 3ULUC 2VWEE 1FZKB 3MV7D 1HHJB 1DVFB 5AYQA 5LBSH 4QHNA 3BO8A 3MJ7B 4LCCC 2N1KA 1IAMA 3S3SA 4F7MA 4YO0B 1QLEL 1U8JA 4GBXB 4Q58C 5I71B 4HHAA 4RBPK 3X12B 1RZJH 4GG6F 4IRJB 3RTQB 1RFDL 3O45A 4YAQB 1JE6A 3T1FB 1P9MA 2YPKB 4HUUA 1WF5A 2LU7A 2NXZB 2R8SH 1OOAA 5GRUL 2IG2H 2EIDA 5KSAD 4JM2B 2PXYA 2J5LC 1MJ7L 4PJEA 1EV2E 2NY7L 2JK5B 1AC6A 3WEXB 2P8LB 4ZOAA 3C60C 1H3PH 3MCKA 3VFMB 5DJZA 1BBJA 3VMOA 2ED8A 3TBWB 3OMZA 4TQEL 2EDNA 2XT1B 3KS0H 3OWEA 4D94A 1S8DB 1Z9SA 2Q86B 4F9LA 1PG7W 3O2DL 4BZ2H 2BVQB 4S11A 2ZSVB 5IW6B 3ZTJG 4YDJB 1KB9K 5DK0A 2Y6SC 1QZ1A 5JNYA 4FXGA 2WWKO 3NPSC 4X98A 5JR1L 1H3PL 1QRNB 4MZ2A 2D9CA 1JPSL 3VMNA 2A38A 4YPGA 2R1YB 4PRID 5LGKA 1IQWL 1CN4A 1IGJA 5DQ9A 4CL7A 2HH0L 3O8XC 1PSKL 5BV7C 4AIXA 1JRHI 4Z7VE 1CXFA 4DUXA 1NAML 3GSVA 3KYOB 5IB4A 4PR5B 3NCYP 3RJDA 3GIZH 4K8RC 1IM9A 4Z7WE 5MP6H 4NN5C 3B9KD 2ATPB 3O4LA 3AY4A 4XCNA 4P2RB 1O5DT 2W0FB 3SGEI 1UXSA 3IU4H 4KUCF 3MRFB 1MHEA 3B9AA 4LPVA 5HYFA 2UUDH 1L9MA 4P4RA 4Q2ZB 3LEXA 4GQPH 3QJHB 1Q9KA 3GBML 3SKUD 5JW3L 1MAML 1CZ8H 2CGRH 5FYJD 4ORGB 5FM8A 2APXA 3NMEA 1FO0B 4Z7WF 2WBJB 1A1NB 4EN3D 3RZCD 1AO7E 1HXMA 5IHUH 5TDPA 1U3HC 3GMLB 4NDMB 1BX2A 9CGTA 1VGKA 1I75A 1NLBH 3QAZC 3VFSA 4Y4HD 3D1MC 2GJZB 4WWKD 1QQDB 3G6AB 3M8OH 4AZ8A 4LKCA 2PTUA 4I0KA 2ZG2A 3IU3B 4RFOH 4OCMC 3WFCL 1OHQA 5DRWA 4K3HA 1U95B 1I9RH 3IJHB 3QG7L 4XVJL 4XPBH 4XPGL 4TVPE 1XF4A 2QQLH 4LCIL 3D87B 4NN6C 5DJYA 1UM4L 4RGNB 1ERNA 5B4MC 4EOWH 3N1FC 3FOMA 2NY5H 3P0VH 1F11B 2A83B 3SO5A 4WUUE 4D0DB 2JIXB 4WU5B 2J88H 1I4FB 2X1WL 2K9UA 3QDAA 2XG4A 5I19H 2CDEB 4X9BA 5C8JB 2BC4B 5AWNL 2IALA 3W0WE 4MQTB 1IGIL 2LTQC 2VDPH 3NABH 4FXKA 1YEGH 1HQRA 4U6VL 2AGJL 4RFOL 2AEIT 3LMJL 2A0LD 4NQEB 3PF2A 1LK3H 4KK9D 2JJSC 4XVUC 5KSUA 5LXGH 3WIFA 4X99B 5IGXL 3P4OB 4ODHH 3IKKA 1T21A 5FECB 4L3EE 1RK1A 1J0KA 4NNXB 4LCIH 3FT2B 3MUGA 4R4BA 4TVPD 3VFTB 1AO7D 3FB6A 1T4KA 3KJ4B 4MQ7A 1WWBX 5MENA 3EYSL 1KYOJ 2PCPB 3VFVA 4P2QD 1RIVH 5ICYA 2DLIA 3JBG7 2FGWL 1YEGL 2LV4A 4U6VH 2FD6L 3UJJL 4R7DB 1K2DB 2ORBL 1LK3L 4K55A 5D8JH 5IGXH 3L3JB 1H3UA 3B2UC 4FQ1L 2PR4L 1JHLH 4PS4L 4NC0B 2E27L 5HI5D 2DQIH 1B3JA 2MCG1 3E2HB 1Z9MA 5CCKL 2FR4B 1VDGA 3QIBA 5BRZE 5HVHC 4LSPH 4Y8DC 1KUMA 3QCVL 3MLZL 5LG1A 4WW2F 2IANA 2WANA 4X6EB 2Z8RA 4R97B 4ORZC 2V9QA 4NNPH 5IMMB 1CXIA 5GGTL 3O2DA 2RBLA 3RX8A 1UA6L 1BWMA 5L7XH 2VZSA 5EUKB 5D8JL 2W65A 4RMRA 4JFDE 1MCRA 4F8TA 2ITCA 5KVDL 1KTRL 4FQ2L 1OD7A 1X7QA 2L7JA 4UDUB 5HDLA 4YDLC 5F6IC 4F33B 4NQVA 4FG6C 4K94L 1C12A 2BMKB 5IROA 3MLZH 4U1NA 2CLZB 3EJJX 2DIBA 1U8MB 2G75B 2FX7L 3VWKB 3NA9H 4KHTL 3NZHH 4YFDB 1YEIL 2Q86A 4FZEL 4NQDE 1CFSB 5C0CE 5GS1C 4PTTA 4ZFOB 1NFDB 1WISA 1PG7X 3ZO0A 2FO1A 4GRLA 1IMHC 3BEVB 4YR6B 2UYLB 2E8ZA 3BDXA 2A2QT 1XH3A 4Z7WB 3RIAF 2WSKA 3WN5C 1MCCA 1IT9L 3MZTA 2F8VA 4RGNC 5IBUG 3H9SB 2VXSL 3QEHB 4HCRA 3BH8A 5KS9E 1DLHB 4U1HB 1TZHB 4OD2A 4Y2DB 1AIFA 5HGDA 3OAYH 4LEOA 1U6AH 1A9EB 3IFLL 2C9AA 2VOTA 1FO0L 1NGZB 1KXTB 1EFXB 1JUFB 4X7EC 4Q6YA 4GKOA 1GL4B 3ZT6A 5ITBL 3BT2H 5JW4R 4X7TA 1MCJA 1TJHH 1UH4A 1KPUA 1H5BC 3LPFA 4QTHA 2R2BA 3BZEB 1YEDB 3GB7B 5AEAA 3RGVC 1A9BB 2DTML 1BLNA 4BSWB 3MOBH 4XP6L 1ADQL 5I1LB 3KJ4C 1VA9A 4IIQA 2DYPA 2NY2B 2N7BA 5LGJA 1NFIB 1NFIA 2NY3C 5JW4N 1SYVA 3OL2A 4JFFB 1XEDA 4S1QL 4ODBD 3G5VA 3MV8E 5DHVA 3VH8A 1A2YB 1F2QA 2Y9RT 5EIIA 4MDJA 5T1LD 3BT2L 1MVUA 3FB5B 3HE7A 4M7ZC 4QTHB 5DRWB 3U7YH 1AXIB 4HXBL 1KJMA 4HIEB 3MLYH 5I8OL 2HRLA 5E99L 1N4XL 5E8DL 3WFBL 3L6FB 3K4ZA 2C7UB 1MCLA 4NN7B 3U46B 5E6YA 5E2UH 4OM1H 4RRPA 1A7BA 2B39A 1AIFB 4XP4L 3BYTA 2D7TL 5EIQA 2GK0B 2NY3D 4R0LB 1S7SA 1FNSH 4QRPA 3WKML 4IHOB 1HKFA 3CXDH 2GKIA 4M1GL 2KZWA 3VGBA 1A5FH 2Y7QB 4HXBH 1ZGLB 3HC3H 4GKSA 4OFVA 3V52L 5E5MB 5E99H 2OSLB 4M7KH 1KIQA 5JXED 3VG9B 3UCRA 1JVKA 4LVNC 3T3PF 4YHPA 2H32B 2VAAB 1HOCA 2IAMB 4P2RE 4KRPD 5E2UL 3FFCA 1VADA 4JKLA 4KK6D 4CMHC 4N8CH 2B2XH 1CFSA 4JQVA 3I50L 1QSFE 1KPRB 4QRTB 4FNLH 4NC1C 3AUVA 3MRDB 1NANI 3VRJA 3D2UD 5IB3A 5AAMA 2EE2A 1T66D 3FT3A 5EWIH 3DURA 1RD6A 2AQ1A 3ILPB 1TQCC 4NPYA 1YZZA 5CIPH 3Q48A 4OQTH 2E7LC 2GTWB 2ED9A 1AGBA 1OGTB 3BP5A 4KJPC 5JOFA 1G6RL 1QSEA 3QXDA 2H32A 4WW1B 5CEXA 4G8EA 1J1PL 2KH2B 3KDMA 1QLEH 2AJSH 3BW9A 2C3GA 4H0IA 3T3PE 4I5BB 4Y16C 4JRXD 4UQ3B 4NFBA 1QRNA 1Z9OA 2ZOLB 1F2XK 2Q6WA 3ARWA 3RGVB 4DW2L 4JRWA 4XXDA 2FH8A 4UT6L 4L3CB 5EWIL 5DK0B 3L95A 1FNEB 4OQTL 3W9EA 4HS6B 1S5HA 5I8CB 5FOBB 4Q9RL 2J8UB 2R9HD 3TP4A 3O81A 4URTB 1S9YA 3VXSE 4R0LC 2CLVB 43CAA 3IKCB 4QXWA 4P23C 2ADIA 1KN4L 1GPOL 2JLLA 1QUNA 1U8KB 2GCYB 2EDWA 2DYPD 1QNZH 4JM2A 1LE9B 3UYOD 3OKMA 3D5OF 1A7RH 4DVBA 5F1KC 2OQJB 3RZCC 1I9JL 1QA9B 3VFTA 1AY1L 5GGRB 4AEFA 5JR1H 5L2KA 1HILB 3O2VH 3AREA 3MRRA 5GRVL 4GRWF 1NGYA 3X12A 4W68A 3F5WB 1JPSH 2OXGA 5ISZA 4LCCA 1KG0B 3D39B 4UV4H 4XNXH 3DXAA 2ZZUT 3L3KA 1NAMH 5TDOB 5CBAA 4BFIB 1FZKA 2BC4A 4Z5RA 2NXZD 2R2HA 2XNAB 2B8OT 1EEYA 3TESA 5EA0L 5BV7L 3MNZB 1GGUA 4RWHA 5D2LE 4HH9A 3GSWB 3ZDYE 1JF1A 2KUTA 1CIDA 4G6AC 4HUKB 4Z7UF 5D9SA 2AJUL 4GT7A 1JV5B 1CICA 4GRWE 1J0HA 4JG0L 5LWYL 2VDRL 3IFOB 1G7QA 4LHUB 1A6TA 4APQB 2Z93B 1IGFL 4FQXB 1Y6KR 2CGRL 4DKFL 2ZUQC 5DEZA 4FTVB 3L5HA 4HEME 3R1GL 1RJYA 1C1EH 2JELL 4OGYL 5C0CD 5IHUL 3SE3C 4FQHB 4CDHA 4OM0H 3MUJA 4PPTA 2X4TA 1NLBL 1TCRB 3T0ED 3LQMA 4YXHH 4G6AD 4ONGL 1W2KT 2RGSA 5TDOA 4P9ML 1IGFH 3VCLA 2ZNWA 4WO4B 4Q74A 2WZPD 1PEWA 3M45A 3QJHA 4DKFH 4XMPH 5DMIL 3ZE2E 3BKML 1LQSR 4LCCB 2PYEA 5B21A 1UJTA 2GSIA 5CZXC 2XICA 1I9RL 1I8IB 1BVZA 3AXLA 4IOFD 4PRPE 4XPGH 4RMQA 5GRYA 3VFNA 5DRNB 5FUZH 4MJ4A 1LDSA 2DQCL 3RQ3A 1ZMYA 5FFLA 4YXKH 2NY5L 1CLYH 3CU1A 3P0VL 1REIA 1N6QL 3PDGA 2Q8BL 4L4VA 2J88L 1AHWA 4XHQA 2HA1A 1LO3H 1ITBB 2CRZA 1BVLB 1NFDE 4K3DL 4LCWD 3AC0A 5KAQG 3DV4A 4L4VB 5E6IC 3GSVB 1ZT1B 3LS5H 4L9LB 3MO1A 5EFIB 4KQ3L 1C8PA 1Q8MA 1FSKB 3SE4C 3JV6A 4U1LA 4LAJH 4D0BA 3ZE2F 4F37F 2Z9TA 4TTGA 4EVNA 4OZHE 2Q8AL 5KVGL 3R4DA 1CLYL 1T1WB 4E41A 3BAEH 5KBNC 3H42H 2OK0L 3VWKC 3K2MC 5BW7A 1AQKH 2DQFA 3NCJL 4JG1H 1S7UB 3H0TA 5JHDE 3KXFE 5F89A 2FX8H 1FC2D 2UVEA 5F6IB 5I1EL 1GIGH 1KN2L 1MUJB 4GMTL 1HHGA 1JHLL 1I7RB 5IM7B 1A6WH 1F90H 2E27H 2F53E 2DQIL 3MYZA 2X40A 5JOFB 5CCKH 5BS0B 3BAEL 3K4DA 5D1QC 4I0PA 4OZHF 4QF1A 1KXVC 1RJZB 1U8LA 5D2NE 2EICA 3KJ6L 1NEUA 4N5EC 2R2EB 4K8RL 4PG9A 1FIGL 2FX8L 5IHLB 2HVKA 4U0RC 5I1EH 3KPOB 4OZFB 3TBTA 5KS9B 4ODVL 3RIAK 4FQ2H 4BUGA 3ZKXB 4Q9QH 5MENE 4KKAC 4ZTPH 3QDHA 3ZMRA 4OZ4B 5JHLH 4R4NC 5LAXA 4IRSC 4QOKE 1ZLWH 4FP8L 1K3ZA 4K8RH 3O8XB 4YHOH 1UWEL 2AW2A 2BSSA 1F6LL 2WLYA 4OD3H 4XBEH 1RQ5A 3RPKA 1NAKL 5D7IA 4CJ0A 2QSTA 3U0PA 4JZNA 1U8IB 5GRJL 3SJVE 3UJIL 4FQJL 5E1HB 4ORGA 1G0DA 5AD0B 5DQJA 5CMAB 4JAMB 1G9NL 1UADC 3FQWB 1SJEA 4MA1C 5C92A 4YXLH 1LO4H 2EEBA 5IFJB 1N5AA 1N8ZA 4WHTB 2BOBB 3JTSA 3PGDB 3SEPA 2QTEA 3V95A 3HI1B 1UXWA 3WE6B 1ZHKA 1KIRA 4OD3L 1NCAL 4XBEL 1UM5H 4LIQH 3TPUA 4JKPH 1NAKH 4JY5H 2JB5L 5C0RL 1FO0H 1IM9D 1KPVB 1PVHA 2H9GB 2HAZA 4L3CA 3O8XA 1D7FA 4I4WB 5ERWB 4XX1E 4LCYA 4QYOA 3KYOA 1YQ2A 1G9NH 3HFMH 3PWLA 2BNRE 4QO1A 5SWZE 1TJHL 3BZEA 1UCTA 4LHUG 3HAEH 5IBLD 4HUWB 3RNQB 5ITFA 5GGSA 1AGEB 3HE6D 1LO4L 5CD3A 3W2DH 1UVQB 4IRSA 3KPMA 1L0XA 2C4XA 3HZKB 3C6LC 3DYOA 5FYKU 4OZFA 2GTWA 4JKPL 1DSFL 1YMMD 5JZ7C 3NOIA 5DJ6B 2V2WA 4S1QH 5I1CL 5KSBB 5IB3B 2FJHA 3U36A 4YDJA 5GSVB 2VERN 4I2XA 2EDOA 5EZLB 1A22B 1KLGB 3BD5A 2Y36H 4S2SA 1GH7A 2CK0L 1F4YL 4DJMA 1JRHL 5E8EA 5E9DD 4K7FA 5BVJA 5J4MA 5GJTH 1T22A 3OR6B 5MEPB 3LKNA 5D1QB 4G8GB 4QGTA 4DZ8A 5ISZD 2F58L 4I0PC 3QBTB 3LKNB 3QQ3A 2Z31C 3HZMB 4WI9A 5F9WC 4OM1L 4P5TB 5E7BA 5I1CH 3TCXA 3CUPA 4XP4H 4IMKC 5EU6E 4MWFA 1ZSDB 3IFPA 4J3XA 3WLBB 1F6AA 1Q1JL 2CLZA 2VC2L 5DJ6A 3FKUS 1T1WA 3LN5B 3R06B 5J1TC 1FVDA 2I60L 1CD0A 1DBMH 1FZMA 2BZDA 4KY1L 3B6SA 2F58H 1RZKC 3MNVA 2YD9A 3BN9C 3EOTL 4J4PD 3CK0H 1HCVA 5BO1H 3RWIB 1OQXA 2ZOKB 2OJEB 4XI5D 2XQYK 1VERA 2B2XL 2C1PB 4XWOC 1QR4A 3KXFB 5D7KD 5FV1L 1Q0YL 2HT3D 3AAZB 2ZUTA 2CIIA 4L8CA 4DGVL 4KTEL 3TN0D 1A7QH 3GMNA 3ZKXC 3B43A 4JRYD 4IJ3C 1PKQE 4PJ7A 3WIIH 1E28B 2VC2H 2EC8A 3UTQB 1QRKA 2YRPA 3IDMB 4LHJB 2OX5A 1AKJB 2WIMA 1CG9B 3O41A 3EOTH 4NHCH 1QBM