3W9DA

Structure of human monoclonal antibody e317 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
209
Chain Sequence
VTLKQSGAEVKKPGSSVKVSCTASGGTLRTYGVSWVRQAPGQGLEWLGRTIPLFGKTDYAQKFQGRVTITADKSMDTSFMELTSLTSEDTAVYYCARDLTTLTSYNWWDLWGQGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody Fab heavy chain
publication title Structural basis for the antibody neutralization of herpes simplex virus
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 209
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9dA01
2WIIA 5IKCB 4C56B 2V9RA 2H32A 2F8OA 1FG2A 5HGHB 5GZND 4V1DD 3RWFA 4XBEH 5SV4A 2WBJB 3D5OF 3B6SA 1KTDA 1U92A 3FN0H 3QHFH 2IANA 4LRIA 1A1OB 3HI5L 3QCVL 4CVXA 3PWPA 4YLQT 5B38G 1OF2B 1DCLA 4Y16D 5J6HB 4J3XA 2XNAA 3L5JA 3D2UA 3BOVA 4WWKD 3MUJA 2L4OA 4HIIA 3OHXB 4OGAC 3DBXB 5MENA 1HCVA 1DBAL 1JP5A 5FV1L 4UTAL 5HYFA 4U7MA 5HPOA 1VSCA 4GKZA 1CFTA 3MNVB 4EUPG 3I50L 1KEMH 2ICEB 4M62H 5GGUB 4FQXC 2VQ1B 3QAZC 4DUWA 1MIEH 2R0KL 5IEHA 1IGCL 3EUUA 2FR4B 1VDGA 7CGTA 4X7SL 3FQUB 3IDGA 1MHCA 1I9RL 5B39G 5D1QB 1MJ8L 4XWOC 3VXUE 4EN3C 3GSNA 5TQ2H 1QSEE 5IBLD 1LO2L 2VAAA 1AH1A 4PRPD 1WIPA 2AKRA 1WBXA 1S8DA 2OTWA 2WMPA 4M6NH 4F7EB 1EV2E 4Z7OE 5BMFL 5DD5L 4WI6A 5BVPL 2HVKB 4XP1L 5I0DA 4ZQKB 1JPSL 1MCPH 4P23A 1FO0B 5DYOB 2DRUA 1FGNL 3FAWA 4N8VB 4NJ9L 5T5FH 3P0YL 4LPXA 3RWCA 1GIGH 5I1GH 5C07B 3MGTB 2FL5A 5FECA 1NDMB 3HE6B 2J12B 2Y06L 4G6KH 3VFGL 1JHTA 3CVIH 1C12A 1LO5A 1BBJB 2HLFC 3W11C 1AD9B 4Y5YA 4EI5C 5C7XH 2A83B 4BK4A 5ITFA 2CR6A 1UZ8A 1D7FA 5ICYB 4CMMA 1PW3A 4ZPVA 2A9NH 1G1YA 2UWEA 3VFOB 4AT6B 3TT1H 5IT2H 3ZTJG 1H3WM 3NAAL 2W9DL 1MUJB 3EOYG 1EGJH 3MV7A 1C16A 2X10A 5EZOL 3NACL 4LDOB 1FNSH 4HXAH 3MRLA 2OL3L 4Z7UF 1RZ8B 4HV8B 1F3JA 1QLRB 1UM4L 2AERT 4KK6D 3L1OH 1BD2A 4YHOH 3QZWB 4LEXH 5HGBB 3WUWA 4L4JA 5B3JF 1C5BL 2DIBA 2NZ9D 5ERWA 5GGQH 4M5YH 3IDYC 5BVJB 1MCEA 3E8UL 3G6JF 3ZYJA 3IU4H 2ZG1A 1IAOB 3MCG1 1IC5L 3CXDL 3I6LD 2D31B 4JFPB 2DQIH 4KK8D 2VZ1A 1CFSA 4XI5C 4YK4B 5LAXB 4DVBB 2E7CA 1CCZA 3QO0B 1T03H 2P5EE 5GRVL 5K59E 1CFVL 2KUTA 1MAJA 1SBSH 2BXYA 3GRWH 3GKWH 3HC4H 2NYYD 1UACH 1SYVB 4H5SB 3ZDZE 3GNML 4FN0A 2YEZA 2D7MA 4D8PB 4JCLA 4WNQA 4M7KL 1E4XH 1AJ7L 1NEZG 2WZPD 4UINH 3AAZB 3BP4B 43C9B 2FGZA 2ZOLB 4KXZI 3TPUA 4OBRA 1V3JA 4IJ3C 3Q1SL 5I30H 4J4PD 4ZOBA 5C07D 4NN7C 2X1PA 1ORQB 1MCLA 3DWTA 4XPAL 4E41A 1GGIH 3FQWA 2I9LB 2Y9RT 1I1RA 4XBGB 1I8LA 4XHQA 3ARBD 1KELL 4ZFOB 3KYNA 5KAQF 3D25A 1HSAA 5AWNL 5JDJA 3RDTC 5J11B 5J9PA 4OZGB 1JZ4A 5IW6A 4U2ZA 2BP3A 2AJXL 3F7RA 5DJ6B 3QRGH 4JY4B 4X83A 3W9EA 3HA0A 1UA6L 3WFDH 3MNZB 4X4YA 5C0BA 2YUZA 4FOMA 3GK8L 5E8PB 5MEPB 4CDHA 1NGYB 3RWEB 5IBUG 1ZWIA 1YMMB 1I75A 3OAYK 4Z7VE 3BSZH 2YPKA 3OKEB 4PRID 3HAEG 3VFNB 1EVTC 4WU7A 5FB8A 4NRYA 4P59H 4AQOA 2IQAA 1NC4B 5IESL 3FFCE 6CGTA 4JZNB 4ISVA 3EFDL 3FCTB 2F58L 1OT1A 1IEBB 1NFDE 4Q0XH 5IVXB 1H8OA 3W81A 2A2QT 1K5NA 2Y5EA 3RZCC 2NY0D 1WZLA 1ZVSB 3D6GA 4G80A 5ID1A 1GAFL 4EDXA 5IB2A 1XZ0A 5HVHC 3WL9A 2CUIA 1E28A 3QPXH 1TITA 4CGTA 3CFCH 1P6FA 3HE7B 3RWDA 5DRWB 1XGPA 1CLCA 2FSEA 4PJDF 5HYQA 5T33H 2O5XL 5DJ0B 4QGYA 4U3CA 2EDQA 2R1YB 2KZ1B 3NIGE 2QADD 4BZ1H 1EERB 4N0UB 2V2XB 5CHNB 2FX8L 4WFHE 5CZVH 4N8PA 1X5ZA 4XVJL 1S9VA 1G7PA 1L7IL 2DD8L 2X4RA 4QKXB 4HIJA 5DD0L 5TE7H 1J0KA 4WW2F 1JHLH 5BRZE 4OFYD 5C2UB 3C60C 3FQTA 3WD5L 4L8CB 2VLRE 4X80L 4U1IB 1HQ4B 2QQKH 4NBYB 2L7JA 3QEQB 3CJJA 2QQLH 4JAMA 4GRMA 4ELKB 1AQDB 5DHXB 1JE6A 4G3YL 1CXHA 5I6XC 3MA7A 1CL7I 5FYLE 1Z9SA 1M7IA 4KDWA 3RNQB 5LCVL 5I9QC 4O4YL 3SO3B 4YDLB 2XQYG 4X6DE 3ARDC 1BEYL 3VFUB 2BNRE 2G75B 4ODVL 3VRLE 3GHBH 3EYVB 2CDFA 3BKCH 1A9EB 5BXFB 3IGAA 5TFSH 2HMIC 4DW2L 4LNRA 1D5XB 3KJ6L 1RMFH 5IGXH 1DBML 2MKLC 4U1GB 1T1XA 5F6HI 4PG2C 3MRPA 4K7FB 2ZUTA 1JZ8A 3MX0A 1NCBL 4HGWB 5GGVH 3FB5A 4CU6A 3TYGH 3FTGB 3B83A 1G9NH 1YEDA 1P4LA 4JFDA 4WW1A 3QJHB 1S9XA 3RVWD 3T0EB 3LS5H 4OZHF 1CK0L 1ZGLP 4X5WA 3C87A 3EO9L 1BIIA 5DJCB 1V7NH 4NCDA 4KQ4H 3ZE0F 4RGND 2Z31C 4Q2ZB 3HE7D 2DJUA 5EIIB 1YYML 5F7EL 3NFPA 3LY6A 1S3KH 2R0ZL 2WQ8A 2ITCB 1WISA 4C83B 4DN3H 1RZJH 4LU5L 1KENH 1HHKB 2EO9A 4J1UB 4AJ0A 3VH8B 5BV7B 2APXA 3C5JA 3GSWB 5E9DA 5CILH 5DMKA 2Z4QB 4WFEE 4MAYA 1L6XA 3GSXA 3MLVH 3T65A 1J12A 1ZA6A 1WK0A 4I2XA 1GXEA 4JDTL 3TJHD 1NL0L 3V6OE 4LLWA 5FKAA 1RUAH 3ZSTA 2E27H 4Z95H 4LASL 1FBIL 2R69L 2VQUA 5JHLH 2XRAL 1FAIL 1KJ2B 4Y4KB 2Q7NA 5GSVA 4H26A 1KB5H 2VUYA 1MHEB 3L3JB 4OJFL 1KLFA 3DMMC 12E8L 2C9AA 3KYKH 3MC0A 3ZE1F 4GAYA 4HC1H 4MZ2A 4APQB 1JZ3A 2MMXA 1N26A 2NY3C 3ESUF 1J86A 4UILH 4JFEA 3IFNH 4JY6A 5DZNA 4UIMA 4OLVL 5EU7E 2HRPL 4MWFB 4YAQB 1VKXB 2B39A 3O9WA 2FZ3B 4FXGB 1F00I 5K9KA 4GT7A 4MX7B 4N0CC 1IC4L 3WEXA 4W6XB 3MPCA 1AGDB 4FFZH 2IWGA 2WBJA 3DI3B 4FS0A 4O51B 5D5MB 3RTQD 5HDLA 1A1OA 5K9QI 4U1NA 3F6IA 2Z9TA 4OD3L 1OF2A 3WN5B 3LDBB 2PR4L 3T1FB 1MCRA 4JVUA 2AEIT 4GQPH 1N6QH 4P48A 1J05B 3SDDD 4UDUA 3S96B 1B0GB 1ONQA 2F74B 4JO3H 4LSUL 3RVTD 3IXAB 5GRJH 4Z6AT 3BDXA 4I77L 3RIFK 3VCLB 3TH4T 5LVEA 4JQVC 1TZHB 1HWGB 4IHOA 2DYPB 1NMBL 3ZLQC 4OI9A 5HHOE 1CDUA 3TO4C 5A2FA 1INEL 3NCYP 2F19H 1L7TH 4J6RL 5H94A 4WW2A 2DM3A 2AK4A 2XKUA 4ODXA 1K9TA 3WFHA 4M7JH 1LNUB 5EUKA 3LHPH 5J0BA 1JZ2A 3VD5A 3U30C 3MJ9L 3S4SB 4JJ5B 4JM2C 2R0LH 3I9GL 5EOTB 4L9LB 5EWIL 3OBAA 1AXTH 3OL2A 3Q6GH 2X7LA 4APQD 3MRQB 3K3QA 1QA9B 1OARH 3QCTH 5KVDL 1A6UH 5IVOA 3LKRA 4NWTH 4U0RB 3B9KB 4ZQKA 1FO0A 4HQQH 1KCSL 4JO4L 1W8NA 5HDQL 4F7MB 4N8VA 4QRSA 3UMTA 4GQ9H 4JN2B 4PV8B 4HJJH 5EPMB 1NLBL 1HIML 3HE6A 1K4DB 3LKNA 3BX7C 3O3DA 3PDGA 4KQ3H 2HN7B 4JKKA 1KIRB 3BISA 4RFOL 3O6MH 2QV2A 3TV3L 5I1LA 5ICYA 5AD0B 4P2YA 2HJFB 1A02N 2X4TB 2VKWA 4R0LA 3QJFA 2VDQH 4YE4L 1VACB 3KDMB 4J2XA 4OZHA 4G7YL 4UT6H 5EOQH 1T2JA 1F58H 5ANMB 4HV8A 4S11A 1CDHA 3QZWA 5HGBA 4MQXD 3C6LC 3VXUB 3EDEA 3TC9A 1KJ2L 3R1GH 5CJ8A 1QSEB 3HZKA 3PJSB 3BT2H 3D0LB 3K4AA 5JUEH 3EJYD 1IAOA 4S1QL 2G60L 4D3CL 4TUJB 4LCUA 5LAXA 3L3IA 4XRCB 1SY6A 5EBWA 5C0CE 4QEGA 2YN3A 3FO9A 1VFAB 3PWNB 4GKNB 3VE0B 4IRJC 4FNLH 4CN6A 4XBEL 1QR1B 2HT4D 1T21A 3FN0L 3QHFL 3UBXG 2G2RB 3NPSC 3IDMA 4U0QB 5JZ7C 4HWBH 3MR9A 3MROB 4OCSH 2NTSP 4XCEA 4MD0A 1T1WB 3AAZA 3ULUH 1QYGH 4NCC1 4KAQH 7FABH 4AH2A 1KTLA 4M4PA 4M8QA 3O6KL 3DETD 3RVUC 2FWOA 1X4YA 1BOGA 1JUFB 5D7LE 5ECJE 5TF0A 3VG0H 4ORGB 2IG2H 4XBGA 1KEML 2DS4A 3TYFA 3IJYB 4XPHH 4ZFOA 1PY9A 4ZPTA 1MIEL 1Y18A 3VI4F 3T0XA 4GG6A 2VZTA 1CDYA 2EZ0C 3UTOA 1A6AA 5TQ2L 1PZ5B 5E8PA 1NGYA 5D1XD 3F6LA 4KXZH 2HJLB 1UB6B 4DK6A 4OQTA 4M7LL 1DEEB 1M1SA 4PTTB 3O3UN 4M6NL 4TSAH 5C0RH 1N64L 2JLLA 4LOUC 1H3PL 3VFNA 5C8JB 4XP6L 1QSED 4I18B 2R9HC 3KPNB 2P5EB 4BH7B 3FL7A 1NC4A 1FG9C 3ZHDA 3MRJB 4JZNA 4P3DB 3OGOE 4NO0B 1MCPL 5F97E 3ZDYF 4ZAKD 1MWAB 5I1CH 1ITCA 4D9RE 1UXWB 2DI9A 1Z9MA 5T5FL 5I1GL 1GIGL 4NUGH 5B8CC 1T89A 4C55A 4TTDC 4R4BA 2IBZX 3O3AA 3E6FA 4G6KL 5J13C 3CVIL 3AUVA 4LSDA 3Q3GB 5DJ0A 1YNTA 2ATKB 3SPVB 4KHXL 1QBLH 4KVCH 4C58B 5TH2B 5C7XL 4J3WA 5F9JB 3SGJC 3U36B 2YXFA 2DLHA 2V2XA 3NFNA 1ADQA 2A9NL 3QA3A 4PJ8D 3TT1L 5IT2L 2BVPB 1EGJL 3V0WL 4NM4H 1MCQA 1G7LB 3SOBH 1ITBB 1FNSL 4HXAL 4MXQD 1NCCH 3OR6B 3VWKC 4F15C 4FA8A 4Z7QE 1FNFA 2AQ2A 3L1OL 4PS4H 4LEXL 1F4AA 1MH5A 1VGEH 3QEQA 2F5BH 4ETQB 1AQDA 4M5YL 2SEBB 1JYNA 3RNQA 2BZDA 2DQIL 3V8CA 5A40E 1NAMH 5I8OH 3EAKA 2I9TA 1GGTA 1G84A 1N4XH 1R3LB 3EYVA 1JZ6A 5SX4I 3RA7H 1T03L 5BXFA 4W4OA 1KPUB 3FFCB 1SBSL 1JNLH 3GRWL 3GKWL 4RIRB 1KULA 1F4XH 4HPYH 1ZKAA 1NFDB 3HC4L 1Q9LB 1BFVH 2J8UE 1B4RA 3P3YA 4K7FA 5I1JH 2RGSA 4DVRH 4ONGH 2W9EH 3L7FB 2EDBA 1E4XL 1KF9B 5GHWH 4GUPB 3DARA 4UINL 1CL7H 3QUKB 5KS9F 4HIXH 2FEEL 2ZUYA 1RIHH 3W82A 5C2BH 3T0EA 2P42B 2EICA 5FM5O 4ZUSB 4PJCE 4N5ED 3GUTB 3BPNC 3T09A 5IJKA 3SDCD 2PO6C 5HJ3B 4RRPA 1FN4B 1W0WA 3QUMB 4X5LA 5H8DA 4G8FB 2VNCA 1T66D 4C83A 2X4PB 3N0PB 4OCYL 2DIAA 4MHHI 2VXQH 5GRWA 4PJ9B 1UXSA 2FLBT 4YFLF 5B39A 1UWXH 3GSWA 5I74B 1UWEH 3I2CH 4FQPA 3IYLW 3WFDL 4ZTPH 2ESVA 3B2UC 1I9EA 2QL1A 4CADB 2NLJB 5ICZB 5CD5C 3OJ2C 3BSZL 2DLFH 2BNUA 4M6ML 5IV2A 5BCAA 3H9ZA 2BNRB 1TJGH 1EFXD 4NQDA 1NCWH 3RBGA 2QSVA 1I8MB 3MUY1 4UNTA 4P59L 1TZIB 3MMEA 1ZHLB 4Y4KA 1J8KA 1FJ1A 2PYFB 3DV4B 4Q0XL 3L3JA 2ICWB 3I75B 4MMZC 3CUPA 2ZUXA 5DHVB 3MBED 5DRZA 1MWAL 4P5TC 4URTB 3CFCL 4BK5A 3FFCD 5CJQH 1AGFB 3CK0H 4P2OA 4MWFA 4YAQA 5T33L 1J0JA 3S35L 4LLUA 3IVKA 3GBNH 4PB0H 2FZ3A 4HEPG 5I8EA 3REVB 4MA7H 3BZ4A 5J1AB 1LO0H 5D2NC 4BZ1L 2FEDC 1ZT4A 4MZ3A 4H25A 3A6OA 3BP6A 2WM0A 1KEGH 4K7PH 4Y5VB 3QT2A 3IETA 3O6FA 1AGDA 4LQ1A 3VA2C 1XCTB 1J8HB 4OZ4B 5TE7L 1ZHNB 4Y4FC 1JHLL 1LHZA 4ZXBB 4MJ5A 5CINH 2MCPL 3VXTB 1RU9H 3DYPA 2X70A 5AG8A 4TSCH 4HGMA 3IJSA 4LCWD 4WFHD 4Z7WE 3WN5A 3B8YA 1EPFA 4YIQB 3RUGA 4KI5F 3WXVL 4YBLB 4ZO6A 3NZ8B 4KV5F 3U6RB 5BRZD 4P46D 3KPSD 4F8QA 3TVMB 4RFNB 4GS7B 4RBPH 5JOPD 2W0KA 5BS0D 3CFKA 2VLRD 3I6GA 4FZ8H 4X4ME 1B0GA 3ALXA 2E9JA 3RL2A 3SKOA 2F74A 4BSWB 2APWA 5E95B 3WLBA 3GHBL 3VCLA 2P8MB 5TFSL 1M6OB 4LVOB 2DYPA 4Z78A 5IGXL 1AP2B 2AJZB 4JANB 2ARJA 1P7QA 1T5WA 5DFTA 3QUXB 1IKNC 5GGVL 3LS4H 5KSUB 1BZ7B 1NEZA 4GRLC 5F1NB 5J3HD 2Y36H 4PY8I 2AJSL 3LKPB 3T2PA 3DUHA 3LS5L 1GOFA 4JJ5A 1YECL 4A6YH 1A7PH 4L9LA 3SKMB 1UZ6E 3DOSA 1V7NL 4KQ4L 1BLNA 3MRQA 2GJ6B 8CGTA 2LV4A 3ECBB 4PBVC 4K3JH 5D7JC 3B9KA 5T1KB 5KOVC 5KW9H 3BD4A 4F7MA 5FK9A 1CDJA 2KBGA 2C7UA 3D39A 1SHMA 2X9YA 5KSBE 3PWJA 4L4VA 4PV8A 5EPMA 1U8NA 1K4DA 3LMJH 3FONB 4F3FB 5DUPH 4JQIH 1CTOA 3VGAB 2JCCF 2DMBA 4NZRH 1AIFB 2NX5A 4L8BA 2HN7A 1HHHA 3MLVL 1XR8B 3L3HB 1YYLH 5AAMA 1QSFE 3GJFK 3GMQA 3RJDA 5CBAB 1BJ8A 1SMAA 1VADB 2DKMA 3FHQA 5BW7A 5FYLL 5DLMH 1RUAL 1N0LA 3BDBA 5SWSA 4WFED 5D1ZA 4PY7A 5TQ0H 2E27L 4QOKD 5FA3B 4Z95L 3BZDA 3V4UH 5JHLL 5ANMA 3MCKB 1W0VB 3NGBC 3QIBC 3C9NB 1KB5L 1OQXA 2ZUWA 4OLWH 2VWEE 1QFOA 2PXYB 1T20B 1RUQH 3SGDI 3SCMB 1OSZA 4UILL 1GHFH 3IFNL 5BO1H 2BCKA 3ROLB 4N8CH 3UCRA 4Z0XA 2ADJA 1KN2H 4HGKC 3S5LG 3TFKD 2IPUK 4Y88A 1U8QA 1P7HL 1KLUA 3VXNA 3PWNA 4GKNA 2MCG1 1MRCH 3VE0A 2ZCLH 5EO9A 1NANH 1QR1A 3BN9C 2IPKB 3BWAB 5ISZE 4LGSB 3MJGX 4R7DB 2G2RA 4UBDD 5K33A 5LJYH 4JGJA 4JHBA 5IFHH 3HMXL 5DUBA 1PQZB 1WF5A 1T1WA 1KSRA 5HYSG 2X1OA 5IVNA 1RVFH 4PRAA 2A9ML 2YD4A 4P5MB 1MHPH 4KJPD 4I3RL 2H3NB 1N6QL 2ADFH 3Q2CA 4RX4D 3MRKA 4KROD 4LRIC 4M8VA 3QQ3A 4ORGA 1PBYA 4JO3L 2X89D 4PJIE 3RI5K 5CLWA 4HK3J 4LIQE 2A6DB 3DX8B 4U1MB 3ZO0A 4ELME 1IT9H 1ORSB 3ARFD 4QWWD 4C54A 2EDHA 4W68A 1D9KD 1JCKA 3IJHB 4KRPD 3T3MF 1J1XL 5DGQA 2WQRA 5E6IA 3VRJB 1HINL 1Q9KA 1L7TL 3K8MA 4OBSA 2DJSA 5E2WL 1S9KC 3O8XB 4M7JL 1TTFA 4PTTA 3LHPL 1V3KA 5HHOD 3LRSB 4LMQI 1CIUA 1NUGA 4JJHA 2VKXA 1T7YA 2R0LL 3ZKMC 5C8JA 5KVEH 5TF1H 5C0CB 3Q6GL 4P4KB 5FO7B 1YN6B 4X6BB 4I18A 3UTSE 3VGDA 4H20H 1OARL 4BH7A 4HD9A 1IAKA 2GFBB 3CH1B 4PRNA 4NWTL 4P3DA 2F5AH 4HFUL 3CMOH 4NO0A 4FQIH 1JIBA 4HQQL 4FQCL 2EDDA 4PJ5B 5I17A 4CMHB 1TETH 5FYJE 4YWGL 3QFDB 2XACC 4L3CA 2VXSL 1ZV5A 2Y5TB 3VXQB 3TIEA 4XPBH 3FO0H 4UB0H 5GPRA 4KQ3L 4LPUA 3Q3GA 3BQUB 4P23C 1PEWA 2G5RA 2NXYD 2YS4A 5TH2A 3ULUD 3O6ML 1A6WH 5D7LB 2XOTA 3LV3A 5D6CB 4LGPB 3S8WA 3IKCB 4QHMB 4PG9B 4I0PB 4NHUA 2BVPA 2EDTA 5KANI 2VDQL 1HXYA 3WIHH 4L1DA 2CKBB 3PGCA 4UT6L 4XHJC 5EOQL 2ZSVA 5J1SC 1F58L 3QXTA 4OGXH 2VZVA 4JFQB 3V4PH 1TQCC 5KZCD 3G5YB 3S35X 4WENB 2ZPKH 1AHWA 3R1GL 2C3VA 1YPZA 4F9LA 4DOHE 1J0YA 3KPOA 3SJVE 4O00A 2MHAA 4NQEB 1T2XA 3PP3H 4MXVF 5JUEL 2I27N 2GHWB 4F7PA 3IDJA 3UTTE 2A6IA 1ZLSL 4NGHH 4XZUB 3AREB 4KC3B 1R3LA 3OKNA 1VB9A 3G6DL 1N5YH 3MQIA 3T77A 1HYSD 1LO4H 1Z6JT 3CFJB 4OUUB 4N5UA 3O8XD 3E0GA 4RIRA 3BKMH 3GBLA 4FNLL 1JVKA 1GZPA 5IG7A 5L7XH 2YKLH 4UU9B 5F96L 1JV5B 4O2EB 3QUYA 4KGLA 2O5ZH 4HWBL 3RX5A 3IDXH 1OCWH 4OCSL 2Y07H 4QRQB 1T83A 1QYGL 5FYJH 3QUKA 3UJJH 4ESKA 3STBA 3OF6D 4KAQL 7FABL 1BZQK 5C09A 3HPLB 2Q86B 1ZLWH 3LD8C 4JPIA 4MAUH 1IM3B 4HAGA 1LE9B 4IOFD 3VG0L 2X1XR 2IG2L 3IFLH 3QFJA 2GY7B 3QUMA 1UH2A 5IFJA 1U8KA 1QFWI 3UPRB 3G5XB 1MFDH 1LO3L 1ES0B 3QDJA 4PJ9A 3T2QA 1FFQA 4Z76B 5D7LD 5EU6A 3H7BB 3BZEB 3EYFB 1JNHA 3UTQB 5DTFB 1RUMH 4WHTA 1R0AH 4PJGE 2OP4H 1I8LC 1EIBA 4IOIA 3GZKA 5ICZA 4PJ7F 1OTTD 1F3DH 4I5BB 3PV6A 4TSAL 1QRNA 4ZUWB 2DQCH 3GI8L 1T4KA 4FZEH 1I8MA 4WO4B 5IJVA 5JNYA 5FM5M 3WHE0 2EDEA 4UOW0 2XIDA 3RVVD 5HDBF 3MGOB 1FLTX 5I1CL 2J8UB 2ICWA 3V5KB 3MRRA 3ARXA 4BM7A 3QEGH 5ADPL 4NUGL 1XGTB 4JY5H 4JZJB 1T7VA 4NZDA 3QNZA 4BZYA 5J6GB 5DI8B 5ALCH 3ARGB 4G8GB 2A1WL 3NPZB 3H9SE 4PRHA 3MLWH 3HB3C 3QNYB 3TCLB 1YY9C 4D9RD 1ZLUK 4PJCB 3FB8A 2CLVB 4YX2H 1CE6A 3DX9A 3CX2A 2YPLE 2V2TA 1RHHB 2W91A 4YXLH 5F9DC 1J8HA 1BP3B 3RAJH 3IRZA 5L8LB 1HEZA 2VLJE 3SOBL 5IF0B 1ZAGA 2ARJQ 1NCCL 3TA3D 3ZT7A 4RISH 5DGRA 3MRGA 1H0DA 1QPXA 2CKBL 5IMKA 1QP1A 4YIQA 1VGEL 4YDIH 2F5BL 2DL9A 3D48R 1DDHB 3VW3H 1E6OH 3L6FB 1A9BA 1JGUH 1MCIA 4PJEE 5FUCC 3EIFA 3CU7A 2F53B 3TNNB 4NCC2 3RWJA 1NCDH 3QIUD 1MQKH 3DROB 3QDGB 3IDIA 2EDFA 3MLUH 1N4XL 3H9HB 5D7SL 3L3KB 3CVHH 3M07A 3RA7L 3U9UB 1U8OA 2K7PA 4M93C 3KHOA 4D9QE 3PL6D 2UZIH 3ILQC 3EHBD 4IDJH 4KK9D 5FV2A 2O5YH 4PGDA 2MQ0A 4OZIB 3X17A 1BFVL 5B3NA 5EO1A 2LAAA 4NQXA 4FQXB 2RR3A 4LP5A 4XX1E 3QAZB 4S1DD 3MCLH 5I1JL 3KXFE 3FT3A 3UTPD 4DVRL 4ONGL 4YDVB 1CICB 5IEKB 1UT9A 3MLXH 3BUYB 5GHWL 1P1ZB 1CL7L 4HIXL 1RIHL 5C2BL 3LKPA 1TLKA 4EN3B 2HT3D 1CDIA 1CGXA 1I8KA 3MNWB 4OD2B 4XWGH 4S2SB 3GSUA 4AENB 1I3RB 4O2FB 4AY0A 1W0YT 2FB4H 2GJ6A 1WTGT 3V8OA 1LD9B 3ARGD 5ESAB 1VFBB 1A1MA 1KIQA 5E7BA 1CZ8H 3L3DA 3KS0H 4WCYH 2VXQL 4LCIH 5C08A 1F6AB 3EDFA 2B4CC 4Z7WB 3LH2H 1UWEL 4GW4A 3QBTB 5CCKH 4ZSOE 4YHYC 2H2SD 3L3HA 1ZS8B 4PYHA 5I1EH 2HTKD 1VADA 3PXHA 1T3FB 1CVRA 1NDGB 4XNZC 1NCWL 1BFTA 3S98A 4U7KA 1FAKT 2IAMD 5LBSH 1FC2D 4MAYC 5IHUH 4QT5A 1KG0B 1BVKB 3IKKA 1F4YL 2E8YA 1AXIB 3O41B 4CJ0A 1D5MA 2EDYA 1OP3H 4OGAD 1HHJA 1YQ2A 1T20A 3VG9C 3A67L 3SCMA 5CJQL 3GJEB 4MCZB 1FYHB 3CK0L 5TDOB 3ROLA 2ZKHH 3BGMA 3UYPA 3GBNL 5TPWH 1CWVA 4PB0L 3X14B 4MA7L 3IDYB 4PYGA 1YC7A 4FQXD 1KEGL 5EUOF 4K7PL 2E9IA 4NC2B 5H35A 1U2CA 3MXVH 3GIVB 4HX1B 2VERN 3F7YA 3U2SB 4XWOD 1CD8A 2YD5A 3ZMRA 2IPKA 3BWAA 5CINL 3O9WC 1RU9L 5KSBB 4E0RA 3LPWA 1P2CA 1H9VA 2FYYA 4TSCL 1RHFA 3UJTL 3DURB 4LMQE 5IB1B 3SGDH 1K2DB 2OI9B 1IFHH 2QTEA 3QULB 3X12A 4P5MA 3G6AB 3VXME 3O3BB 1G9EA 2H3NA 2WBJC 4LL9A 3FZUC 4XNXL 3SDYH 1QSFB 5IQ9A 3RKPA 3TBVB 4FZ8L 2H8PB 2H26A 4BUHA 1TCRB 1NGWB 3VXSA 3O4LE 4PRPA 4PJBE 3LEYH 4MD5B 1U8MA 2WV3A 3DX8A 4U1MA 5E5UB 5F70A 3KPMB 3BD3A 2RBLA 1FL3B 3IJHA 4X5XB 3ULVC 4CN1A 1A47A 5DQ9A 1EBPA 5FGSA 4OKVB 4X6FB 1YEEH 4OCRH 1JTTA 5CP7B 4KKCC 3RDTB 5LGJB 1VEMA 3LS4L 2J4WH 4EI5D 4NQCD 4YZFF 15C8H 1F45A 1SYSB 2AGJH 2Y36L 2BNQB 2G9HA 3MOQA 4OZGF 5JIIA 5DJXA 2APBA 4NM8H 5EH1A 5CGMA 1S7RA 2DBLH 1EA9C 2YA0A 4W81A 2A6KA 2GW5A 1A7PL 3QP3A 1F2XK 1VENA 1JPGA 1YN6A 2P43B 3BAEH 4GG8B 4P9MH 3BPCB 3S88H 2GFBA 3FQNB 3CH1A 4WW2C 2P7TA 4MDIB 4Q74A 5CJBA 4PJ5A 1LEKA 5KW9L 3EYOB 3HC0A 5T1MB 5ITBH 2O61B 1DVFB 1IGFH 3QFDA 3LMJL 2JK5A 2EEBA 1BM3L 2B0SL 2Y5TA 4XI5D 5DUPL 4JQIL 2D2OA 3RZCB 4AM0A 5JORB 4NZRL 1WAAE 5DR5H 1X7QB 3BQUA 5IVXF 3DV6B 4GMSH 1S7TB 1BBDL 3BH8A 2R8SH 4GW5A 3Q5TA 3MFFB 3QG6B 2B2XH 5BOPA 2C1PA 4R7NA 4PG9A 4PJIB 3HE6C 5DLML 1UADC 2CSPA 4H0GA 2P5WE 3P9MA 3S7GA 3SKNB 1J7VR 4ELMB 1KIPA 1QFUL 4KVNH 3V4UL 5FKPB 4I4WA 8FABB 1GVIA 1QEWB 4OLWL 3VFVB 1OAZH 4LARH 4QRRE 4GO6B 3UZEA 4G8EB 3C60B 3VU2A 5FGBA 2CMRH 1PKQB 5D9SB 3CFDB 5F8QC 5HTSA 1YN7A 4YHPB 4NQEA 4R0LC 1HYRC 1GHFL 5BO1L 2RAMA 4N8CL 2BDNH 3FT2B 4NZUH 4TTGA 4RNRA 1KN2L 4W70A 3AREA 5I6XB 5FXCH 3RDTD 4BA8A 1LP9F 3UTSB 4YFDB 2JB5H 3B4NA 2DQUH 1YEJH 3RWIA 1INQB 1MRCL 5I9QB 5JPMA 2D7OA 3KJ4B 2VR4A 2GUOB 2ZCLL 3FOMB 1RZKH 5CIPH 2HA1A 4YK4C 2FHCA 1WFUA 3T0AA 2DQGH 2VITA 1OP5K 3MRCB 1PAMA 3MO1A 2UUDK 1X5JA 3VXRD 5ISZD 2X4OA 2ADFL 3LKSA 2CLRA 1DQJB 3HPLA 3MV8E 1YDPB 3KPRB 3S37H 3TM6A 4BELD 4P2RE 5CWSB 4LKXA 4U1KB 4Y19E 3FRPG 3UPRA 1IKFH 3U46A 3G5XA 3KR3L 5D2NE 4RBPK 4LSRH 5I71C 1IT9L 1JK8A 1NLDL 2Z31B 2PYEE 5GS0H 1SEQH 1DE4B 3RJQB 3H7BA 2J1KA 1SEBA 2NY5C 3BZEA 3EYFA 5D2LF 5EUOA 3UTQA 3M8OL 4NT6B 5DTFA 2BMKB 3S36H 4DOHB 1HH6B 3MLSH 4JG0H 3BXNB 1XH3B 3UXFA 5J11C 4I5BA 1RJZA 2PTTB 4P3WA 1KCRL 1MFCH 4S1SH 2ADGB 5KVEL 2DQJH 4MNGA 4WO4A 2Q8AH 1II4E 4H20L 2DI7A 1RULL 1FYTE 3MA9H 1NKRA 3ALWA 2F5AL 4MQTB 1H3GA 3CMOL 4FQIL 3SE3A 1QHPA 1TETL 2ZJSH 1SJVA 1U93B 1MEXH 5FHBL 4NNYB 5JHDE 3UTSD 3CSBA 1IM9B 3EGSB 4OCMC 5DI8A 3DMMB 3SDXA 4YH6A 4G8GA 4GSDL 3FO0L 3ARDD 2V2WA 1F42A 4JRXE 1MLCB 3TCLA 4HKJB 4GRWF 2J3SA 1NMAL 2MQCA 3W9DB 1AKJB 5TDNB 3MV9E 2NY3B 3VGHA 4RWYH 5FYJD 1QFWM 3SGKA 2C4XA 2HMID 2YC1B 1T89C 3W0WB 3GJFB 1RHHA 3ZT5A 3PQYE 4POYA 4LK4A 1XFPA 3BO8B 3WIHL 1QSVA 2E3VA 5K9JH 2IPTH 4O58L 5FO8A 3AC0A 3OKLB 4LIQL 4EJ1C 4OGXL 2AJ3B 3V4PL 5T1DH 1F3RB 2ZPKL 2CPCA 4P99A 2Y7QB 4PJGB 3FRUA 3GI9H 4K55A 5D5MF 4MJID 1GOHA 4K7PX 4HHAB 5JPNB 2F53A 3TNNA 2J88H 1DQLH 2YUXA 3MV11 4NGHL 3DROA 3QDGA 3B9EA 5I1AB 1F2QA 2QSTA 2C5DC 1I4FB 1EEYB 3C5ZB 3H9HA 4LEOA 3L3KA 2F9BT 3SJVD 1LO4L 5F88A 1MOEA 5SWZE 1BWMA 1C5CL 3BKML 2HLAB 2Q7YB 2A73B 3UTTD 1YEHL 4OZIA 2QSCL 5L7XL 1JMXA 2YKLL 4UUJA 4YDLC 2ERJC 5DD6B 5E8DH 4Y4HD 2O5ZL 4PD4K 4PD4J 1BX2A 4MNQE 4KJYB 1CICA 5IEKA 1OCWL 1FZOA 3TNMA 5EORH 3R8QA 5FYJL 4W4OC 3TO4B 3UJJL 5HYSA 3H9SB 4XTRD 5L2KD 2V5TA 4Q6YA 4OD2A 4ODTH 4S2SA 4HK0B 4U1GC 1MLBA 2YPLB 5DS8A 4MAUL 3ZL4H 5MEQB 2Z35B 3L5WA 4EXKA 4RMSA 3X3GL 3U30B 3IFLL 3DMMD 4XPGH 1ZLVK 5ESAA 1I1AD 1VFBA 2DICA 2FX9H 4MGXA 3W39B 3T0EC 2YR3A 1PLGH 2EYRA 3OAZH 2FJFA 3KWWB 2VIRB 2CGRH 5IJKC 4IMKA 2KH2B 4ZDHA 1R0AL 3ROOA 3AMKA 2OP4L 3O3EA 3LCYA 5I19H 5AZEH 4N0CD 1FHGA 1ZA3B 1HKFA 3F58H 5I2IB 1R3IH 1UKQA 1SJHB 5BV7C 4FZEL 3GMOB 1RJCA 4HWEH 1AD0B 1VPOH 3NOIA 4FFWC 2IANE 4MA1B 1M05B 4ZFFB 1YEKH 1BVKA 3T08A 1NJ9B 3PWPE 3MLZL 4NRZA 5E2UL 5BOZG 1FVCB 3QEGL 4ZFZB 4LVNC 4G9FD 1TNMA 4QTHA 3KXFB 4L4TD 4WU5A 4JDVB 4NUJB 5FCSH 3NN8B 2XXMB 3GMRB 2JTDA 2FJGB 4HUVB 3RTQA 5DK3A 5ALCL 5MENE 2XFXB 4G6MH 1HH9A 5TDOA 3VXPA 3MLWL 3MRBA 5ACMA 4Y4KC 4D9LL 3X14A 3QRFM 4YX2L 4PREB 1LK2B 2R29H 4KDTA 1JGDA 1CTNA 2XYCA 1IGYB 5FO9A 1FNEB 2XPGB 2VL5B 3TO4D 2JIXD 4YXLL 3HZVA 3LAFA 5D70H 2BY1A 4ODUB 1GGUA 4P2OC 4U1SA 3RAJL 2ARWA 2OX5A 2R39A 4Y8AA 4NWUH 3W2DH 4O9HH 1M7XA 1KIUA 1KJMB 5IB1A 1G6RB 4YDIL 4JM2D 1G9MC 3QULA 4XMKH 3O6FC 2XZCH 3NPSB 3VW3L 4NOBA 2VLJD 1JGUL 4X7DC 2HFEB 3PXJA 3TBVA 2FATH 1VGKA 2OSLB 3PGDB 5I8KL 2VDML 1MQKL 4JVPA 1S5HA 4UDTB 3WN5C 3MLUL 4Q9CA 2H32H 4MD5A 2MNUA 5CKAA 5GQBA 1JNJA 5HGAA 3GEWB 4BFBD 5C0NC 5D72L 2DDQL 4RMRA 2XN9D 1FL3A 3QO1A 4X5XA 4IDJL 2O5YL 1A3RH 4OKVA 2VZ3A 4HS6B 4X6FA 1AY1L 1J1PH 4GFTB 3MCLL 1Z2KA 1J18A 4NRXB 4RFEA 2ENSA 2X4UB 4WUKH 1VFOA 1N5AA 3MLXL 4D94A 1TVHA 1MY7A 2BNQA 4D9QD 3ARYA 2UWEE 2O93L 1HOCB 5DRXB 2M2DA 4XWGL 2V7NA 3MV7E 2QQNH 4OZFB 3VGGA 4DKEH 3TO2A 5D96C 1JF1B 2FB4L 3OKOA 5F93C 4CW1A 3AU1B 2GEEA 4LLYB 1FFRA 1M71A 3C6LD 1IRAY 1BD2E 4KY1H 3RY4A 4QRPD 3EYOA 2DWDB 3MJ8A 1JTOA 1Q0YH 4WCYL 4NO2B 3EJZD 4LCIL 2CKNA 4P2QD 1DVFA 3EYSH 2EDLA 5GGRA 4L9LC 1HZHL 5JXEA 3LEXA 1AI1H 3LH2L 4U6XA 3IU3B 2X42A 5BQ7B 4UAOB 4GMTH 5T3XE 3B9KC 4Y2DD 3JV0A 4HMEA 3VXMB 1S7XB 3F7VA 5GSRB 1A4KA 5I8CB 5B4MC 5D7KD 1SVZA 5J57B 3ZDZF 3CLFH 4HKXA 5DURB 4IRJD 4UNVA 5I1EL 5J13B 5C0AD 5HHNA 3VD7A 4PJBB 5LBSL 5JZ7D 1F3DJ 5FKPA 2H1PL 1HSBB 4PJHB 1MCDA 8FABA 3VFVA 1C1EH 3BDYH 3DLQR 1IL1A 1RZ7H 5BW7C 2VLKB 4UQ2B 4PBXA 2VDNH 1PKQA 5D9SA 3VWKB 4F15B 5D1ZC 1JPST 2BHZA 3BIKA 3JVGA 5CKGA 5KOMC 2ZKHL 3C6SA 4RDQF 5F1OB 3FJTA 4E41E 4Q97A 2YMXH 1GH7A 4YXKH 4NO3B 3CZFB 4J8RB 4JFFA 1QQDA 3LOWA 4PRBA 2NW2A 3N1GC 5CIPB 5I15H 3MXVL 4MA8H 4Z7VF 3FOMA 4GXVH 2FHBA 3MV01 1I3GH 5C0BE 3RP1A 4MSWA 1BWWA 5ADOH 4YHMH 1N0XH 4M48H 4YC2B 5DO2C 4PJXA 1FFNA 1OHQA 3QEHB 4W6YB 4HG4J 3T8XB 4LOUD 3WBDA 1FL5A 1S7SB 2JELH 2R9HD 1G6RL 2QEJA 3FHAA 5SX5K 1YDPA 3KPRA 3N9GH 2AQ1A 5GXBB 1AO7A 2JJTA 5CWSA 3RWGB 1MCCA 3DPBA 3JTTB 1UG9A 3LEYL 1QBAA 3QI9D 2QHLA 1W72H 1KLGB 2PO6B 2P24A 1E4WH 1U8PB 3NIGF 3HRPA 4I1NB 3LRHA 1NGZB 4QRRB 3O4LD 4H0IA 3R8BB 1OGAD 5H2BB 3JV6B 2BMKA 3DTXA 1DANT 2BRRH 4N0FB 1HH6A 5HHQB 3BXNA 4ZAKA 15C8L 4FQ2H 4P3CH 2AGJL 3TBYB 3MRFB 4TQEH 3UROR 3IF1B 3ZHKA 5IMOA 1AGBA 4NM8L 3AS2A 5HPMB 2NY1B 3OMZA 4DQOH 5IP4A 1F8TH 2ADGA 2E7MA 4GJTB 4P57A 5E6IC 2JE8A 1NC2B 5D8JH 4YHLH 5FUCE 1U8JB 4ZD3H 4P9ML 1KACB 2ZUSA 4KGJA 3VWKD 2NPLX 1TJIH 3U4AA 2V17H 3NA9H 3ETBF 1A6VH 1B6DA 5ITBL 4X6DF 4J3VA 4HKBB 3L3GA 1XGQB 3QEUB 4KTEH 5T1LB 1QACA 1U93A 5JXAH 1IGFL 3VRLF 1A7BA 1YEGH 4NNYA 5BJTA 4YO0B 5I1DB 5E5RB 1IM9A 3EGSA 3SE9L 1ZT7B 5L0QC 3BW9B 1X4ZA 4I18C 1P7KB 4HXBL 1MLCA 3KS0J 2M26A 5AZ2H 4GMSL 1YUHB 3MV8B 1WFNA 3PHQB 1QO3A 1CVSC 3QHTC 5E70A 2B2XL 3W0WA 3GJFA 4M5ZH 4Y19B 1CD9B 4PY8J 4H0HB 4I3SH 3WDIA 5T3ZE 4M00A 4QXWA 3T0DA 4KVNL 5GS3A 2DTML 4XCYB 4HT1L 4ZUTA 3D85D 1KNOB 1I9IH 2AJ3A 2BC4A 2G5BB 4JFDE 1OAZL 1JZ5A 4Y4FB 1N6UA 2P5WD 3ES6A 2FJHA 2CMRL 2HWZH 3L9RA 4LLQB 4OB5H 1XT5A 5GS0D 4YBQC 3KNBB 1MF2H 2PO6D 2BDNL 5DQJB 4NZUL 5I76B 1JI2A 4POZC 4QRRD 1N59B 4WRLA 5I1AA 3HMWH 1H5BB 1ZGLA 1G0DA 3C5ZA 3MFGB 5GISH 1AHWC 3T4YA 2JB5L 3A6CH 2DQUL 1YEJL 1CF8H 5HHXH 3R0MA 1XF5B 4I8DA 5J8OA 3PWVB 3QCVH 4OGYH 1DEDA 2Q7YA 1HHGA 5E9DE 3SDCA 1S9WB 2W1NA 3QQNA 2C1OA 5IMLA 3B2UD 1CXFA 2DQGL 3CX5J 3CX5K 5JHDB 4KJYA 4I2XE 1A8JH 4LKCA 3AGVA 4RAHA 5IK3B 4JRXB 4H1LB 2V5YA 1MCJA 3MRDB 3IDNB 5MEOB 2FBOJ 3EDKA 3MV9B 4HK0A 3C2SA 1I1FA 1ED3A 4N1CA 2WWMC 4XAWH 1JMZA 4XP9H 1UC6A 3QUYC 2FCBA 3I3BA 1HE7A 4CVWA 3JV4B 5CBEA 2R0KH 1IGCH 5INDB 3PQYB 1EMTL 3TIDA 4X7SH 1I9RH 1IKFL 1T83C 2XTJC 4WI2A 2ILLA 4YGVB 4R97C 3W39A 4FXKA 3K7UA 4P5TD 5FOJA 1LO2H 5D7JB 1EFXA 3MV8D 5T3ZH 3Q6FA 2VIRA 1SEQL 4P2RD 4JFEE 3FB7A 2E6PA 2IEPA 4P4RB 1XR9A 4X4XA 3S36L 2Q6WB 1B0RB 3MLSL 5BMFH 4JG0L 5DD5H 4IEFB 4MDJB 1ZA3A 5BVPH 2D7QA 4KJWC 4CRPA 2PYED 4XP1H 1YNKL 4PJ9C 5I2IA 1HQRA 1MFCL 5CFHA 5DUMH 4HIHA 4S1SL 2B4CH 1JPSH 3ZKXB 4Y4FD 4QRTB 1EO5A 2YZ8A 2VE6B 1FCGA 1S7UA 1XGUB 2Q8AL 4PJFA 3MYJB 1QFWL 3P0YH 4HUKB 2LU7A 5SWZB 4DZBB 3MA9L 5MERA 2WIMA 6FABH 1S7QB 3G04A 2AAVA 4F37F 4OCWH 3SE4A 3VFGH 3AXLB 1DUZB 2AJUH 3O2VH 4BZ2H 3AY4A 5JW4Q 4UQ3A 5EZIL 1MEXL 1MVUB 4JDVA 4NUJA 5I0ZA 2GITB 3NN8A 3O2WH 3NGBB 4FTVB 2FJGA 4NKMB 3ULVE 1LE5B 1FYTD 2CJUL 2XFXA 3UEZA 5JLZA 4R90H 4NZTH 3BKJH 4CDGC 2PUQT 3GKZA 4C59B 1X9QA 1K8IB 3F8UB 4LCWA 3DUSA 4RWYL 1AR2A 1T0NA 2AXGB 2DLTA 4Z18A 3C2AH 4P46A 2J6EL 3KPSA 5CGTA 1FNEA 4G8IB 4LSTH 3HFMH 5BS0A 4Y5XA 3DVIA 3MV9D 5K9JL 1KC5H 1G7JB 2IPTL 3MJ7A 4GRLD 3HS0A 3P4NB 2EDKA 3UO1H 1KJMA 5T1DL 3RWHB 1A1NB 1NCAH 2XG4A 2ZUUA 3PQYD 2FHFA 3EDJA 4ALAH 2WIIB 3GI9L 4ONFH 3QXUA 3VA6A 3U0WH 3DX6A 4N0YH 4XP4H 2F15A 5SWQB 2OSLA 2J88L 1DQLL 1FG2B 2EH7H 2VDPH 1XMWA 3U4BH 4D0BA 3RWFB 4JFOB 5C92A 4UDTA 1R5VA 1KTDB 1U92B 4YBLC 4HC1A 4CAGA 5I66A 3TVMC 1SJEA 4RFNC 1XAUA 4CVXB 4BSJA 2GK2A 3CDYA 5FOBB 1NEUA 4HS6A 1PDKA 1P53A 3PHOA 5E8DL 4HIIB 2X4UA 1RY7B 3BEWB 5SWZD 5MENB 5EORL 2FBJL 4WHYH 2X05A 4QXUH 4GKZB 1CFTB 1HOCA 5LQBL 2R2BA 4ODTL 1A64A 3U1SH 4OZFA 1KELH 3BWUC 4QHUA 3ZL4L 1JF1A 3ILPB 2ZSWB 4MNQD 4OZHE 3QUXC 4X7TA 5E2JA 3QIBD 5IEHB 4CJ1A 1Y0LA 3IDGB 1MHCB 2FX9L 4KKAC 4OTXL 2DWDA 1CE1L 1PLGL 1TTGA 3GSNB 5DMGC 5FUZL 3QIWB 1CQKA 2VAAB 2CGRL 4I0KA 1WBXB 1JPFA 4FFVC 4QOKA 1S8DB 2GSGA 3SGEH 1P84J 1S7XA 5I19L 5AZEL 5GSRA 3WUZA 4HZLB 4KUCF 1FFOA 1CDBA 3LZFL 5IESH 4FQHA 1R3IL 4XNYL 4TULH 1VERA 3BN9D 2ATPB 2ZWLT 3OJMB 1KJ3L 4HWEL 1VPOL 4OFVA 1BFOA 3L5HA 3VGAC 5A43C 2E6QA 4ZMAT 1DQDL 3N85L 1FO0H 2DWEB 1HSBA 5FECB 1YEKL 4L8SA 2IFFL 3PIQA 5KAQG 2HJKA 2R2EB 3C09B 4PJHA 5C9JB 4NN5C 1JHTB 1C12B 1LO5B 2VLKA 4UQ2A 4DN4L 2O5XH 3IFPB 4IS6A 1MCNA 1QFHA 2R2HA 4Y5YB 3OKDB 2IAND 5ITFB 3GMNA 4BKLA 1TQCB 4G6ML 3F12A 4NQVB 1RK1B 1UKSA 1CXKA 4GBXD 3SKUD 4Z7NE 4MHHG 3PWPD 5FDWA 2UWEB 4EKXA 1X5AA 4J8RA 5DD0H 4NKIL 1C16B 5EBGA 2EC9U 2BSTB 2VOTA 2XKNA 3D2UD 3IAQA 1A6ZA 2R29L 5FHAH 3WD5H 5GZNC 3MRLB 4X80H 2VUOA 1UQSB 1F3JB 3SCMC 1WITA 4GG6E 4U6YA 5CD3A 5I75C 1KGCD 3DXAD 5EBLA 1T22A 3P4OB 3FOLB 5ERWB 4XCFH 5GGTA 4NNXB 3QQ4A 4QHLB 3P30L 4HUXA 1IGJA 3ARFA 5LCVH 3W5NA 3ARTA 4YR6A 4XMKL 1CFSB 5DJ2A 3ZKMD 2WBKA 4M4RA 1D9KA 3T8XA 4D0DB 2IJ0C 1BVLA 2XZCL 5IM7B 2VZOA 5HGGS 4QYOB 3K8KA 2NY2D 1FIGL 3KYMA 4NO5A 2FATL 1FSKB 1SY6H 4NPYB 5IB4A 1DUYA 1BGXH 4TUOA 4UNUA 1WVZA 3VDCA 1YMHA 2DQHH 2Q3ZA 3RRQA 1F13A 5HI3D 4WNQB 3DVNA 1A3RL 2X4NB 1J1PL 3P9LA 5H2BA 3MRMA 4P23D 3TPUB 1U3HD 4RQQA 1CK0H 4K3GA 1UM6H 4WUKL 1D6VH 3O45B 3DGGB 4PJAB 4ZO7A 3MBXH 5KSAB 3TBYA 1BQHG 5DEGB 5E94B 5ENWA 3GMMA 1IBGH 3FQWB 4E41B 4Z7QF 5CZXC 4RMVA 1HSAB 1U8JA 3AROA 4XHJD 2VH5H 4DKEL 5FM8A 1BJMA 4J3UA 3WIFA 2X9XA 3F62A 4KY1L 3W9EB 3WJJA 2IH1B 3QEQE 4X4YB 5C0BB 3MV7D 1I1YA 5ESVA 5I1DA 4P4KC 1AI1L 2OK0H 3GSNL 3H2WA 5CLTA 2NXZD 1BD2D 4BFIA 4OQTH 3OAZK 2J8UF 3CFBA 3QQ9D 5DQDH 5IIEA 1YUHA 3CLFL 4JZOB 4CMHC 4NRYB 5FB8B 3H6JA 5GJTH 1QSZA 4Y1AB 2XRAH 1I7ZA 5DJYA 4HFWA 4OJFH 1OL0A 4KTDH 3DRQA 5DFVC 4M7LT 3DYMA 4KK6C 3BQUC 4GKSB 4PJCF 1NBYB 4EDXB 1WCQA 1WZMA 3KPLA 3WL9B 1E28B 1KNOA 4UT9H 3GIZH 1C1EL 1J87A 1XGPB 3BDYL 2NZ9C 5HYQB 1QZ1A 3T0EE 3KPPA 1CGTA 4I0PC 4LLQA 2ADIA 5F9WB 4PP2A 4D0CA 1IVLA 2UV3A 4WV1A 4F33A 1V5JA 4LPWA 5F7YC 4YXKL 2X4RB 1XIWB 4HIJB 4MLIA 5B22A 4KRLB 1H5BA 3KYOA 1GGBL 3GSVA 2XWTA 1ADQH 5FGBC 1XF5A 3P2TA 3OAUH 4OD3H 4GXVL 4ENEC 1S9WA 4AEIH 2E6JA 2PR4H 1R3HA 4E41D 4EOWL 1HILB 4JAMB 1I3GL 5F3HB 2CH8A 4GRMB 2XI9A 3AREC 4M93B 4WY7H 4U1HA 5KVMC 4I0CC 2ESVE 2VR5A 4AIOA 5ADOL 4YHML 1N0XL 2XQYK 5DEFA 1M7IB 1RK0A 2GSIA 2APTA 3BEVA 3OV6A 4OLYL 4NQSA 3V52L 2OTPA 2Q20A 4LSUH 3IDNA 5MEOA 5DRNB 4NQDE 2JELL 3I02A 1U3JA 2CDFB 2R23B 1E4JA 4PRDB 4X98B 1X5LA 1FQ9C 5LG1A 5T3XL 3IGAB 3N9GL 3JV4A 2NY4B 9CGTA 4LNRB 5INDA 5EFIA 3TH3T 4WJ5A 1MCOH 4YGVA 1T1XB 2BSRA 3MRPB 2E9WA 2R56H 1G7HA 1E4WL 2DQEH 3IRPX 3GSOB 1P4LB 4NQTA 2D3VA 4WW1B 1NAMA 5EZLA 1SM3H 1S9XB 1YY9D 3BJLA 3MJ9H 3MRIB 4X5WB 1BIIB 1LVEA 4FQ2L 4MDJA 4P3CL 5CS7A 1LDPH 4TQEL 4RCAA 2C26A 1CGUA 2QBWA 4DQOL 1F8TL 4Z7WF 4LHUD 4YHYB 4YHLL 1XGUA 3QXAA 4V2CB 4ZD3L 5HDQH 2F54B 1EZVX 2VZSA 1MCSA 4HK3N 1WWWX 3P73A 1TJIL 3WJLA 2V17L 1H3TA 5F7KC 4X99B 4XNZB 5E9DB 5EC2A 5DMKB 3RUGE 1DUZA 3QDMA 2ICWI 25C8H 1O5DT 4KTEL 5JXAL 3GSXB 2AI0L 1YEGL 3T3PE 5BV7H 4FTVA 4WO4C 2R1XB 3F5WA 1XCQA 3RU8H 4LLWB 4RAUB 4CNIA 1PX3A 2GIYA 2QADC 2XZZA 5AZ2L 3T1WA 3VG9B 2FD6L 5E5MA 2XY1A 4YE4H 1CR9H 4J3TA 4WI5A 2XY2A 2W92A 1FPTL 2JJSA 2AP2A 4PTUA 3CD4A 2NTFA 5GSVB 4M5ZL 4H26B 4XMPH 2QLVB 3KVQA 5DVLA 1FNHA 4ODSL 4O02H 4GAYB 1FV1B 1KJ2H 1V7MH 1C8PA 3QIUA 1TZGH 1UZ6F 4NKOA 5FM4A 1I9IL 3SGKC 4JFEB 4JY6B 3RWHA 1YEIL 4D3CH 3PL6A 2HWZL 3D0VA 5T3ZD 3OKKA 4E5XA 2H6PA 3RKDD 1JTPA 1MF2L 4X8JB 3U79A 5K9KB 3WEXB 3LQAC 1U36A 5SWQA 5KSBF 1WBYA 3NVQA 4JFDD 4Q6IA 3DUUA 4JFOA 4DKAA 3HMWL 3V7AE 4JQXA 5D7IA 5GISL 4I9WE 2OTUA 3A6CL 4JVWA 3D39E 1CF8L 5HHXL 4L4VE 4XXDA 3V5DB 4P9HC 1A21A 1R5WB 4U1NB 4OGYL 3FFDA 1CFNB 1QKZH 3ARPA 5FOBA 3V95A 2C3GA 1BVZA 5EOCJ 4PLJC 1U2HA 1GC1C 2NX5E 4XAKE 4OUOA 3O6KH 4UDUB 1OAYH 3BEWA 3RVWC 3CCHB 4G6AD 4LBEA 1ONQB 3DIFA 1WWBX 5SWSE 4HUWA 4RGNC 4PJDB 4XAWL 4MAYD 4XP9L 2ZNWA 3ILPA 4QHKI 2ZSWA 4FQ1L 4IHOB 4JM4H 4WEBL 1CICC 4XMLH 3HR5A 5ANME 1WBZB 2BY2A 3KLSA 5KN5A 1NBVH 3BMVA 1M4KA 4X7CC 3CGTA 2IADB 3H9YA 1KB9J 3QIWA 5H94B 4M9PA 4WW2B 5T3ZL 4CUCA 3WYRA 2AK4B 4RA0C 2IAMA 4ODXB 2PETA 4M7LH 1S7WA 3WFHB 3HPJB 2BSSA 5EUKB 4AIXA 1N64H 2NY6C 2AXHA 1H3PH 4HZLA 4XP6H 2X7LB 4TOYL 2OLDA 2CXKA 3LKRB 5DUML 2OR9L 1Z0MA 4PB9H 3PDOA 2B4CL 2ATPA 4IMKC 3T04D 3O9WD 1UVQA 5CEYA 2W9LA 4C4KO 4QRSB 2AJYH 3FO2A 2DWEA 6FABL 4C56D 1OAQH 2R2EA 3LKNB 3O3DB 2MQ3A 5C9JA 4OCWL 2AJUL 5HHPB 3O2VL 2JB6A 1Q72H 4BZ2L 4PJIF 1YNLH 2WBJD 3IFPA 3FZUD 4A6YA 1UJTA 3OKDA 3O2WL 4KHXH 4ELMF 3JXAA 1UFUA 3NCMA 5I1LB 4R90L 4NZTL 1AC6A 1RK1A 2GTZA 3I3EA 4NQVA 3BKJL 5HGDA 1Z9LA 3JSSA 3ARWA 3B5TA 2N1KA 5DF0A 4R0LB 2BSTA 3V0WH 3OGCA 3QJFB 5FGCB 4OZHB 1T1ZA 1NUDA 3C2AL 1UQSA 4LSTL 3HFML 3RTQC 4KKCD 3Q5YA 3STLB 4LPCA 1KC5L 1YY8B 3HZKB 1OTUC 3P4OA 3FOLA 4NNXA 1X3DA 4QHLA 3UO1L 1NCAL 1RV6X 1S78D 3GSRA 4DFHA 5AYQA 4LCUB 3L3IB 4D0DA 2HKHH 1MFNA 5D1QD 5EBWB 5IM7A 4QYOA 4ALAL 4ONFL 3U0WL 4JRYA 4N0YL 3HUJA 1EH9A 3PGFH 4XP4L 3FO9B 4GXUM 5EU3A 3LEVL 2WLZA 2EH7L 4NPYA 2VDPL 1HHIA 3U4BL 4NQCA 2A77H 3UP1A 4DK3A 1DFBL 2OI9C 5MP6L 1T21B 1C7SA 3IDMB 2J5LC 3MR9B 3B8SA 2A0LD 4MD0B 4XCEB 2X4NA 5HVWA 5I1HH 5I71B 5E4EB 1KTLB 3C8HA 4M8QB 4QTIH 2YRPA 4AH2B 4N90E 3O45A 1XGRA 3DGGA 4PJAA 5KSAA 5DEGA 5E94A 2FWOB 4U1JB 1BOGB 2D03H 3B9DA 3HE6D 4QXUL 3ULVL 2GQHA 2VWEC 3TYFB 3U1SL 1MAKA 2VSDA 1A6TA 2DAVA 3RX7A 1WLHA 1EAJA 4ZPTB 4OCYH 1BZ9B 1Y18B 2GJZB 4ZO9A 3BGAA 1KXTB 2AABH 4GG6B 1P5VA 2A38A 1IILE 1T2QH 2DOCA 1T5XB 1U95A 2IH1A 3QWQB 4AIZA 4K71B 1A6AB 4J3SA 5IB5A 1YPZE 4ONOA 2HG5B 1I85C 3S3JA 1YA5A 3MUHL 4M6MH 5E8NA 1EX0A 5GGRY 3HR6A 3R06B 3OB0H 4JHWL 3KGRA 1ETZA 2DLEA 4JZOA 5HHME 4OI7A 3O6LH 1DVFC 4Y1AA 5JXEC 4TULL 3T4AA 3K4ZA 3DI2B 1WEJH 3ZDXF 2GK0B 5K9OA 2W65A 1QNZL 4GKSA 1NBYA 1FO0L 1MWAH 4MQSB 5A3IC 4M1CD 4R4BB 5ACZB 5DC4B 3IAPA 3O3AB 3E6FB 2XTJE 3BD5A 3THML 3S35H 4LPVA 3QYCA 5C09E 1YNTB 3EJYC 4KJQC 3V5HA 3IT8D 3NFNB 4U49A 3QA3B 4C57C 1G7IB 3QFJE 4G6FB 3N1MC 1XIWA 1UH4A 1QFPA 5T5NG 1MREH 4PJGF 1LQSR 2MCPH 5FHAL 3VXRA 3QDJE 5GRXG 4OV6F 5FCUH 5KG9A 2EE3A 1T6WA 1T0MA 1MH5B 3WXVH 4C4KT 1AXSA 1HILA 5F3HA 5F44A 2FIKA 1U8HA 4HBQA 4XCFL 2OXGA 3O4OC 1EAPA 3S97C 3ELAT 2ERJB 3WO3B 3KJ4C 2I9TB 1LK3L 5EA0H 5HI4C 1QRNE 5DRNA 4K3HA 2R23A 3BJ91 4PRDA 4X98A 1EJ6A 2QJDA 1YMMD 1SY6L 1BGXL 4OCXL 5F89A 4ZNEA 1MI5B 1ZANH 2DQHL 3PV7A 5GRVK 5LGKA 1I7RA 1KCUL 5D6DA 1NC4D 5B38B 2DLIA 3GSOA 1RPQA 2X4SA 2OQJA 3MUZ1 4N9GB 1N8ZB 4Q9BA 5JQ6L 2AJSH 4PRHE 1ACYH 4Z7UA 4JM2F 2JJTC 5JQHC 3TZVB 2I25N 3MRIA 1YECH 1UM6L 4U31A 1D6VL 3MBXL 1G1CA 3MOAH 1IBGL 3G6JA 3P77A 4EUPB 1W0WB 3RHWF 1J8HE 2NY5L 1ZE3C 2VH5L 2F54A 2VDRL 1UXSB 3QUMH 5DVOA 4PJEF 2PTUA 4ZAKC 4ZFOL 2FRGP 3MZGB 5B39B 4X99A 5TE4H 5LXGL 4QNPE 1IJ9A 2ESVB 1Y6KR 1B6UA 2Z8WC 1FIEA 2R1XA 3A6BH 2OK0L 5MI0C 2BNUB 5IV2B 4LVNB 3LN4A 4RAUA 4DEPC 2H9GA 5FYLH 4OQTL 2I24N 3QEQD 4GW1B 4NQDB 3BHBB 5DQDL 4ZS6C 4RZCA 5GJTL 1VFUA 3ARZA 3MMEB 4NDMA 1UJ3B 1OPGL 1FJ1B 3RPKA 4MJIA 1U3ZA 5A2KH 2OM5A 1ZT1A 4JFYB 4KTDL 3GMLB 4K3DH 1TXKA 4MXQC 1FV1A 3CUPB 2Z91A 5IB3A 2OMBA 5DRZB 4E42A 2OCFD 3C08H 4UT9L 3GIZL 2C4FT 3HLAB 1KFAL 3OKMA 4P2OB 3UYRH 5DHVH 4LLUB 3IVKB 4KI1A 5I8EB 2ZUQC 3BZ4B 4PUBH 4X8JA 3RIAF 1ZT4B 1XF4B 3U7AA 2GJ6E 3BP6B 4H25B 5H37H 1A7QH 4Y4HA 4L29B 2UZYB 4HLJA 1LWRA 3IETB 4X0KB 3MSPA 1NMCC 3O6FB 1ULVA 3T0ED 4HJ0D 1RI8A 4MJ6A 1ADQL 4MJ5B 4JPWL 5L2KA 1ZK9A 5C08E 1EEUA 2X70B 3BRFA 3V5DA 1R5WA 3HMXH 1UCBH 1PSKL 3IJSB 4HLZH 3OAUL 1CFNA 1KBGH 4QGTA 4AEIL 3RUGB 1U58B 2A9MH 3T2NL 4WY7L 1AGCA 1I1AA 1N3NB 4I3RH 3C5ZC 1S5IH 3GM8A 3CFKB 3I6GB 4XB7A 3CCHA 1A4JA 3RL2B 3SKOB 4XCNB 1K8DA 2WK2A 3WLBB 4FFWD 3RNKA 3SDCC 5DHYA 4PJDA 2ESVD 4CKVX 1DBBL 2CIIA 3WUWG 4Z78B 5HD8C 2A6JB 5DT1L 1WBZA 1J1XH 1T66C 5HYJA 1MCOL 2KL6A 1HINH 2ARJB 3NH7H 1UB5A 5EN2A 1P7QB 1T0PB 1T5WB 2UVEA 5D96B 4NQDD 1Z9OA 2R56L 2BVEA 5BZWB 2IADA 5E2WH 2DQEL 1NEZB 3LQZA 2EIDA 4MB4A 3HPJA 1F11A 1SM3L 4Y4KD 4QY8A 1GZQB 2RCSL 3KLAA 3VFRB 3CVHA 5I18L 1LDPL 4PR5A 1BLNB 4G9FA 4L4TA 1CGVA 4BYHA 1ZSDA 4HFUH 4ZUUA 3V6ZA 1J0HA 1MHHB 4FQCH 2ITDB 5FK9B 2C7UB 2EEAA 2HFFB 3D39B 1FDLH 3PWJB 4L4VB 3LN5A 1U8NB 4YWGH 4OLZH 2IH3A 2VXSH 3ZKNC 1IEAA 1U6AH 2EIEA 3BESR 5HHPA 3O6FD 4S1RH 25C8L 2NX5B 4L8BB 5IBUB 1BMGA 1HHHB 5BV7L 4DGYH 1J88A 5JW4R 3RU8L 3GMQB 4MA1C 1G9NC 4DGIH 3VXSE 1TQBB 4PRPE 4M7ZC 3HAEB 5SWSB 4OFDA 5KS9B 5D1ZB 4PY7B 1NBQA 4ODBD 5C0ND 3HRZA 3SE4C 1RAMA 1CR9L 3AY4C 4OIIL 4OFPA 1BQLH 3O11A 2BOCA 1V05A 4XMPL 5DDHA 2DMKA 4O02L 3STLA 4X6EB 1V7ML 3PWUB 4JHZA 1YY8A 1TZGL 2EYTA 2KQNA 2DM7A 1OSZB 1RZJC 1FVEA 2AEPH 3LIZH 2BCKB 2HP4A 2DYPD 4Z77A 1NGPH 4FQQB 2X1QA 4Z0XB 4P46C 2ADJB 1ZLSH 2XN9A 5F6IC 3O0RH 4Y5XC 1U8QB 2E7BA 3G6DH 1KLUB 3VXNB 4NJAH 5M95B 3PE9A 1UCTA 5EO9B 1CG9B 4PJ5E 1WAAF 1G9ML 4L1HA 5F96H 4U05A 4LHUG 5DUBB 1QKZL 1B88A 1AFVH 3B9KD 4PRAB 4YQXL 4YXHH 5B4MD 2FX7H 5J3HC 3MREB 4QRPA 1OAYL 3U4EA 3MRKB 1PFCA 2IBBA 4U1JA 3VJ6A 3QQ3B 3QWRD 1DQTA 3MOBL 2JJWA 4P2QA 4EBQH 1IAII 5ID0A 4WWID 1HDMB 5TDPA 4DGVL 3VFMB 1JYXA 4RWHA 1LO3H 3QUZA 4R26H 4JM4L 4Y2DA 2FNBA 1BZ9A 3ME0A 4XMLL 2GJZA 5E6IB 1NBVL 1T5XA 5E03A 1Q9KB 3STZB 3OWEA 1IC7L 5C0AA 2WP3O 4B7LA 2OMNA 4XVSH 2HG5A 3B43A 4NQEE 4AL8H 4KWUA 3BVNA 2VZUA 5CP3H 1AR1C 1J5OH 2KDGA 3R06A 5E00B 3VXUD 4NZJA 2DQFA 3GI8H 5L0QB 1WJ3A 1IAKB 2R0WL 4HZAA 4PRNB 3BPLC 3HN3A 4MQ7A 4PB9L 3TBSB 3U83A 4F80A 1WSST 4K23L 5I17B 3P0VH 5GIRA 2VLME 4UAOC 5ADPH 2GK0A 4AEEA 4DZ8A 2AJYL 1OAQL 4L3CB 1DLHA 4OF5A 5ACZA 3VFWA 4EVNA 3TIEB 4G43B 2A1WH 3UC0L 1Q72L 4I13B 1YNLL 5IVZA 1OD7A 2WW8A 2OZ4A 2ZOKA 3D18B 3VRIB 1X5KA 4LAQL 1I7UB 1TJHL 2FO4A 3RGVA 3LV3B 2PCPA 5TJWK 2EE2A 1G7IA 4L8SC 5HYIA 2CK0H 3ZTNH 4NHUB 3MLRH 1EUUA 1LILA 3PG2A 4YNYB 1L4IA 5DMYA 1JPTH 1HXYB 3DRTB 3PGCB 2ZSVB 3MLTA 4DJMA 1Q38A 4LP4A 1C5DB 2CKBH 2B7DT 3Q5OA 5EUOE 3EO1B 4EDWH 1AHWB 2C3VB 1YPZB 3BGFB 4NN6C 5C6TL 3KPOB 2MHAB 1HN1A 2XXCB 3QI9A 2LU3A 3BYTA 1K6QL 2B5IC 4GLRI 4WTZA 3SY0A 4F7PB 1G7MB 2D0FA 3IDJB 2A6IB 4KJPC 5E6ID 2HKHL 4PGCA 2RHEA 3OKNB 5EBMA 3PGFL 2JCCB 4MNGE 5D7SH 5HHMB 1OGAA 3T77B 2XG5A 2VTFA 4PLOB 3ZSSA 2PW2B 3B5GA 4M3JA 2A77L 1GZPB 5IG7B 3KHQA 1A14L 3VFPB 4YC2C 4U2YA 1UEMA 3ARFC 1MI5A 4XVTH 3OZ9H 3LSOA 4NOFA 5D71H 3QUYB 4XGZA 2P5ED 43CAA 5B38A 2EDWA 3QCUH 3SDXE 2XTJB 3HI1A 4N9GA 4G8GE 4R97B 1N8ZA 4M61A 4MLSA 4R4ND 4NO0D 5I1HL 2JF1A 4QTIL 3N1QC 3P4LA 4XH2A 3TZVA 2Q8BH 5C09B 3MLYH 35C8L 4JPIB 2HT2C 4FQJH 2D03L 3QFJB 4EUPA 1QLFA 1VEOA 1MIML 5IFJB 1U8KB 5JIHA 1VFMA 4KPHL 1V8HA 4N90D 4OSUL 3QDJB 4WUUB 1CD0A 4N0RA 2UY7A 1HK6A 2AABL 2E8ZA 3M45A 5EU6B 3TWCH 1E4XI 1T2QL 4WHYG 5KSVA 3TESA 1JNHB 3SE8L 4L3AA 4WHTB 2NY1C 3V6FA 1LEIA 1G7QA 1YZZA 4IOIB 1Q9OA 5EC1A 1L0XA 4ODHL 1VCAA 3LB6C 5T5NF 2F53E 2RFXA 3PV6B 2HTLD 1AQKL 3QDGE 2NXYC 2Y23A 3D85A 1QRNB 1Y6NR 3ULUC 4GW1A 1T4KB 3BHBA 2VLLA 3L7EA 3WJJC 5IJVB 3KAAA 5JNYB 3EO0B 3O6LL 3R4DA 1UJ3A 5CSGA 3D3VB 4HWZA 2HFGH 4G5ZH 1WEJL 4JFYA 4OZIE 1F4YH 3GMLA 2YA2A 3MRRB 1KN4L 4RGNE 2XICA 5FGRA 3LKQA 3OR7A 4H88H 1CU4H 1DN2A 5HHMD 4KK5D 1VHPA 3A67H 3QNZB 3HLAA 4L3EB 4PRHB 3C8KB 2DQTH 2WWMD 3FB8B 2AV7B 1H3VA 3MUGA 1CE6B 3DX9B 1XF4A 2QSQA 4KUZH 2V2TB 4L29A 4OF3A 4X0KA 2YD9A 1PY4A 4N8VG 4U3HA 1MREL 4P0DA 1HEZB 4X9FA 3NIDE 1ODAA 3GGWA 3QH3A 2VXUH 5J06A 4HJGA 5I1IH 5FCUL 2P8PA 3MRGB 3UJTH 3LQAH 4WV1C 1H0DB 5IMKB 1WIOA 3JWOC 1U58A 1LEGA 3ZZ1A 4X6CF 1N3NA 1D5BB 1H5BC 1A9BB 4KJWD 4XNXH 3QDJD 4PJ9D 4TYUA 2VQTA 3RWJB 4AG4L 4XCNA 2CR3A 4P9HH 5DK0A 3IDIB 5EA0L 3WNPA 4XBPA 4IOFC 1X6NA 3HG1A 1U8OB 1GC1H 5FYLD 3U0PA 3QZWG 5EIQA 2A6JA 2UZXB 1WC7B 4PGDB 4JKPL 3WS3A 1ZANL 5EO1B 4NQXB 3WO4B 2BNRD 5DJAA 3UBXB 4LGRB 5BZWA 5E8EA 3FT3B 3G08A 3AMLA 1EZVY 1E4KA 4KZDH 5E56A 4J7RA 3UAJC 3V0VA 1WV7T 1ACYL 1GZQA 2CXGA 1I8KB 3VFRA 1F5WA 5CSZA 1VEPA 3GSUB 1JF6A 4PP1C 2I07A 1CN4A 4ZUVB 4XVUD 3MOAL 1PG7X 2R1WA 2QR0B 2YWZA 3DSNA 3CPLA 1A1MB 1KIQB 4PRHD 1MHHA 2ITDA 3L3DB 4HMDA 4YEEA 3RVVC 2HFFA 5C0FA 2CUHA 3QUML 5C08B 4OV5A 4JPKL 4L5FL 5IHLB 4OF7A 3OJDB 3WFBH 2V5SA 3LPFA 1BM3H 4AEHH 2B0SH 4GW4B 2CRZA 5TE4L 1CDCA 1J8HD 1RURH 3P4MA 4B5EA 3ZKXC 5AUMA 4ZXBD 2KZWA 1UEYA 1FNGB 1BBDH 4JFHE 3A6BL 3EDDA 5JOFB 1N2RA 1FZMB 1H3UA 4NN5B 5DJDB 1K3IA 3WJLC 3HAEA 5KS9A 1OAUL 5SV3A 1QFUH 3JWDC 4GRWE 3TVMD 4QT5B 1T1YA 5ELIA 4K3DL 1U41A 3NZHL 4IRZH 2UWEF 4X6EA 3PWUA 1D5MB 1HHJB 3V4VL 1B0WA 4V1DB 3C08L 5GS2H 2BNQE 4FQQA 3UYRL 5I75B 1ZXQA 2JJSC 3BGMB 1L0YA 1IQDB 5E1AA 4PUBL 4YDKH 4Y16B 2AV1B 3QUXD 1JNNH 2Z92A 3VFSB 1A3QA 4MXWH 3QIUC 1A7QL 4R3SA 2IMMA 5H35B 2FECI 3OX8A 4KKAD 3F7YB 2AXFA 1MCFA 5DMGD 1IMHC 1CG9A 2FIRT 3D1MC 3PL6C 2LABA 4E0RB 2BX5A 4KK9C 1MRDH 1P2CB 1DN0A 2FYYB 2GJ6D 4FFVD 1UCBL 1KPVA 5CZKA 2FO1A 1DL7H 4NP4L 4QXGH 1KBGL 4O5LH 1RUKH 4Q6IC 3X12B 3WIIH 5T1KD 3CDFA 5A2LH 3LPGA 2DBJA 3MREA 4JQXC 3NIFE 1S5IL 5IQ9B 5C08D 1A5FH 4RMWA 2HT3C 2H26B 2NY7H 2OL3B 2VR9A 2YD1A 3HZYA 1B4JL 5E8OB 3NA4A 3VXSB 1SJXA 4PRPB 4XNMA 1PJ9A 1U8MB 4TNVF 1HDMA 2GTWA 3KR3H 3TN0A 3VFMA 3VWJA 1Y6MR 1U8LB 2CRMA 4KH2A 1MJ7H 1NLDH 2FGWH 1XF2A 3DSFL 4PGEB 5HYEA 2ORBL 5DQ9B 5DWUH 1N6VA 3NH7L 3STZA 3M8OH 4OLEA 5JW4M 2ZP0T 1PKQE 5BZDB 5ABDE 3EFFB 4K8RC 2DL2A 1IGTB 1G0XA 2D7TH 2G9HB 5DJXB 1KCRH 4EI6A 1S7RB 5E00A 1RFDH 2A6KB 2H2SC 3K2MC 4JFFE 1JWMA 3M17A 1IAIH 3P11H 1JPGB 2HTKC 2PXYD 1RULH 4X6CA 2WUCL 3SCMD 3QIWC 4X9GA 3TBSA 2P7TB 3OQ3B 2IAMC 4LLMA 4HEME 1LEKB 2VXVL 3HC0B 1DJSA 4GBXA 5A1AA 1Z5LB 1FDLL 3TCXA 5FHBH 3G5VA 4OLZL 2JK5B 2BVQB 1U6AL 1UWGH 4PJXE 4GSDH 3WHXA 4G43A 4AM0B 5JW3H 4S1RL 2Q76A 4OF8A 2EDRA 5E2VH 3DVGB 1NMAH 4IOSD 1IAIM 4DGYL 5JW5B 3D18A 4RRPG 3UJIH 3BH8B 3VRIA 4GW5B 4OGZA 2P1YA 4WHDA 3KPRE 3DXAA 1I7UA 2M8XA 1BF8A 4DGIL 1AO7E 2APVA 2C1PB 4R7NB 2CO7B 2UYLA 1CS6A 3C09C 1HNFA 3P9MB 4EZMA 5IOPB 4YNYA 1KIPB 2EEDA 3DRTA 4LSSH 1BQLL 3TGXA 1OAXH 4TUKH 3VH8G 4HCRA 4O58H 4LIQH 4Y5YC 3HKFA 4I4WB 1E0OB 1C5DA 3QWOA 5E6ZA 3VXSD 4TRPH 4TNWF 3EO1A 1QR4A 3RPIB 3KPTA 4JGMA 2BY3A 3GO1H 4HS8L 1YN7B 5CEXA 4HS3A 3ESVF 2AEPL 3LIZL 4U4BA 1NGPL 2PW1A 2BK8A 1G7MA 4RNRB 3SDAA 5CZXD 1BREA 3O0RL 2ICWJ 5EULV 2JCCA 2EO1A 3B2VH 2EXWD 1DLFH 1U3HA 4NJAL 1W2KT 2PW2A 3RWIB 5JPMB 1C5CH 1BF2A 4YHZH 3PABA 4PLKC 3VFPA 1YEHH 3GSQA 2QSCH 2BVTA 3VI3E 5C0CD 4P4KD 2GKIA 2VITB 3ARBB 3GHEH 3ARSA 5J12B 3MO1B 1OAKH 2VDLH 3TT3H 1AFVL 1FSKC 2N7BA 4GLRH 3GMPB 4YXHL 4PJ5D 1LDSA 2FX7L 2X4OB 3IXTB 1M7DA 3LKSB 4KUCD 5L2JA 2CLRB 4IRSA 5EU4A 4B7IA 1KV3A 5IQ7H 5SX4H 4EBQL 3IFOB 4DCQB 3W0WE 3X3GH 4LKXB 5DFVD 1GOGA 3U46B 2IMNA 3HI6H 5FYKU 3WHE1 5CMAA 3BQUD 4UOW1 4R26L 4WUUA 1JK8B 2ID5A 4PRIB 3ZE2E 2VABA 4EEEA 5KSAC 1ZHBA 3RZWA 1SEBB 4O2CB 5EUOB 4I0PD 5FUOH 1SVCP 2VXTL 2ED8A 1Q9WB 2CDGA 4XVSL 5DK2B 1F4HA 4AL8L 4G9DA 4JDZB 2NY0B 4XNUH 1PG7W 1J5OL 1RJZB 1MJUL 3OXSB 1CLOH 4MNGB 2EXYC 1W72A 2NNAA 3T2OA 5IFAH 3EO0A 4NQED 5IBTL 4DKDC 4ENED 4HDIB 2QADB 3D3VA 3MLZH 4RAVA 1T04B 2XA8L 1RZFL 3P0VL 5E2UH 3ARED 2P49B 1KTKE 2AEWA 1MQ8A 5DC0A 4QHKJ 2Z93A 5F3BB 1H15B 3SDXB 3S4SG 3BH9A 1B3JA 3AFLA 3QISA 4L3EA 2V2WB 3EOAA 4D9LH 3B3IA 3C8KA 2N7AA 3HNSL 1EXUB 2VLMD 4Y7MA 2AV7A 3I3DA 1NGXA 2KKQA 4YHIA 5FA4A 5EO0A 1DBKH 3RVXD 3V7AG 1FORH 2OXHA 4POUB 2CK0L 3ZTNL 3D69A 3RL1A 3MLRL 1JPTL 2IC2A 1K85A 3QNXA 4NBXB 3GJFH 4MS8C 5F9WC 5FO8B 3E2HB 4LFHD 1RD6A 1FNAA 3NFSH 4F37K 4PLNC 1XGYH 5JR1L 3TH2T 4EDWL 5ESQA 5JA8B 1RUPL 1AGEA 2P45B 2CO6B 1PZUB 1XIWC 3FRUB 3NMEA 1KPRA 1D5BA 4OD1H 4HUUA 1MNUH 4NSKA 3TF7C 1P69B 3OXRA 4ZG1A 2IF7A 5I8KH 2VDMH 4F8TA 4MCYA 2GT9A 5IW3A 3S5LB 2XA3A 4LEOB 4PJFE 1U9KA 4Q7DA 5F88B 2EECA 4KKBC 5D72H 4R96A 2DDQH 3ULVF 4K2UH 1WC7A 4LLDA 4RGNB 1AY1H 4XVTL 3OZ9L 4UUJB 4ZOCA 5D71L 2EDNA 2R4RH 3UBXA 5C0GB 4WO4D 5IR1B 1BX2B 4LHUA 1S7VA 3QCUL 1FZOB 3TNMB 5HYSB 2APFA 4LLAA 3G5ZA 2NY4C 5AYUH 1MRFH 4LVHC 5D93C 2Q8BL 3MLYL 4LCWE 3BFOA 1MLBB 5DS8B 2V5RA 2BHUA 4FQJL 3L5WB 2A74A 4ZUVA 1ZGLM 3FN9A 3HZMA 1GPOL 2QR0A 3KPSE 5DJZA 5D6DC 2NY6B 4G8GD 5JOPE 1J0ZA 5BS0E 1NUFA 1B9ZA 1PYWB 4YHNB 3C5SB 2VN7A 4OFKA 2EYRB 2Z8VC 4U1LA 1EO7A 2FJFB 1HZHH 5HXMA 1LP9B 3OJDA 3TWCL 3OJVC 1Q94A 5TGBB 1OTSD 2W0FB 4ZDHB 4QRUA 3ROOB 3H0TA 3O3EB 1FL6A 3ULSB 1FNGA 5JOFA 1R3JA 1JGVH 4FG6C 1FZMA 5DJDA 3BUTA 3HNVH 1F90H 1X44A 1JBJA 3WDJA 1R3KA 1MFEH 2VMFA 5LGHH 4TVPE 1QVOB 1X6LA 2H1PH 2F53D 4R2GC 2HFGL 4G5ZL 4NRZB 4PLJD 3QDGD 3H8NA 2DTSA 4JKWA 3X11B 2VO5A 4QTHB 4H88L 4AYFA 1CU4L 4WU5B 1RIUH 3QG7H 4V1DA 5L88H 4G6JL 1CXIA 3RTQB 1HH9B 3VXPB 5FYJU 2RIKA 3MRBB 1IQDA 4S0SD 2DQTL 5DZOA 4NFDA 5D2LB 4Y16A 2AV1A 4XPTL 3VFSA 5EU5A 3T0WA 1JGDB 1R5IA 4KUZL 1CICD 2CDEA 3WKMH 4WWKA 4TSBL 4Y0GA 1O7VA 5FO9B 1IE5A 1QOKA 3SDDB 3HZVB 4PJ7A 4EN3D 4U1SB 4LCYA 4RSVA 2GCYA 3NABH 2VXUL 5I1IL 5CJXA 4JHAH 3UPAA 3LQAL 1KT2A 2W59A 2WANA 2N4IA 4QOKE 4FMKA 2X5PA 4Y4HC 1NGQL 2NY6D 5J7CC 1URLA 2RJMA 2J5LB 1MCBA 1JFQH 1G6RH 5C0JA 2GI7A 4XTRC 1VGKB 1IGML 5J1TC 2OL3A 3PUCA 5FDYA 5E8OA 3D87B 4P9HL 5HVFB 5IHZB 5ICXB 1S5HB 1NAKH 3S34H 4LQFH 2L7UA 4WIQA 4RDQG 5HGAB 3E3QC 1U8LA 4OM0H 1GC1L 4GRWB 5GRZA 4HMCA 1UH3A 1Z3GH 5EDXA 1I1AC 3QO1B 5DEZA 4PGEA 4PJHE 4WI4A 1OVZA 4Z7NF 3FT4B 2HLFD 2M1KA 2P8LA 3KPQB 4TVPH 3W11D 2E7LA 2VLKE 4G7VH 4OT1H 4ONHA 4RFEB 2WLYA 5BZDA 4KZDL 1N5AB 4YPGA 3EFFA 1TVHB 1MJJA 1IGTA 4Y8DC 1BAFL 3B9AA 2BFVH 4FMFA 5IKCA 4GG6F 1EJOL 4C56A 3ZT6A 5GS2D 2V7NB 3QHZH 5HGHA 3TO2B 4YGAB 3OKOB 3UZQA 2X2YA 2XV6B 3BN3B 4BFEA 4CW1B 4OZFH 4AK1A 3CSYB 1M71B 1HKLH 4RA3A 1A7OL 1YEFH 1OTUD 1HCFX 3MJ8B 5I1KH 4Z8FL 4MB3A 1EHXA 1Z5LA 3X3FH 1OWWA 5F72S 5J6HA 4EQ3A 5GGRB 1T7ZA 3EW3B 3LEXB 3RGHA 3SE9H 3WFBL 4U6XB 2BVQA 4AEHL 1FH5H 3OHXA 2EKSB 4HXBH 3DBXA 1D6EB 1RURL 1KCVH 3DVGA 2HFTA 4M6AA 3F7VB 1A4KB 5F6HJ 5JW5A 4AEFA 1WCBB 1ZTXL 3MNVA 1JGEB 4HKXB 1UWXK 2ICEA 4X7EC 4QXTB 5GRYA 5GGUA 5HHNB 3VDBA 2VQ1A 5IOPA 2FR4A 2DTMH 3FQUA 4V2BA 5D1QA 1QSFD 4JFHD 2Z8SA 4HT1H 3S3PA 4IRZL 1IL1B 3RPIA 2HVJB 2VDKH 3MXWH 5F7NC 3VD9A 3BIKB 4F7EA 1Q1JH 2ZG2A 3CSPA 4M9OA 3C6SB 3K46A 3K81A 5KTEH 1X5HA 2HVKA 4JFFB 1QQDB 4MJ2A 4YDKL 1FZKB 5F21B 1JNNL 4PRBB 4MXWL 3WFCH 3O4OB 3DECA 4LRNH 1WT5A 2NW2B 2YRZA