2XA3A

Crystal structure of the broadly neutralizing llama vhh d7 and its mode of hiv-1 gp120 interaction
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
AVQLQESGGGLVQAGGSLRLSCTVSARTSSSHDMGWFRQAPGKEREFVAAISWSGGTTNYVDSVKGRFDISKDNAKNAVYLQMNSLKPEDTAVYYCAAKWRPLRYSDNPSNSDYNYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords LLAMA HEAVY CHAIN ANTIBODY D7
publication title Crystal structure of the neutralizing Llama V(HH) D7 and its mode of HIV-1 gp120 interaction.
pubmed doi rcsb
source organism Lama glama
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xa3A00
1M6OA 4FA8A 1UEMA 4LVHB 1NCCH 3O3DB 2W0PA 4KTDH 3W39B 4AYFA 1EFXD 4PJFE 3GSNH 3ARRA 2YPKB 1AC6A 3D39A 4GRWB 5D7IA 1I3RB 1HDMB 5DJAB 5C0AE 2X1QA 4L3EE 1F6FB 4NO3A 1ONQB 5FKPA 4OCSH 2B5IB 3JV6B 4XBGB 3KVQA 1T83C 3U9UA 4FQXD 1MRDH 5EO0B 1DQQA 4NZTH 3VXTA 3KPTA 1EUTA 1NEZG 5E2UH 1MCOL 3B9EA 3VFVA 2UWEF 4NJ9H 1YN6B 3NZ8A 4I3SH 2HJLA 1NMCB 4ODBD 2NY3C 4ALAL 1XR8B 4LCIL 5F1NB 5DQJB 5BVJB 2GCYB 1P6AB 3PQYB 3C08H 3X3GL 1NGYA 4ZS6D 1T0PB 3JXAA 1J05A 3L6FA 4JKWA 4U1SA 1P7QD 4Q9QL 3P4OA 4S1QH 3HNVH 5C0ND 4BZ1L 4XPFH 1F6LL 3RDTB 4GW4A 4F7PB 4C54A 5DI8B 1HSBB 2A0LD 5C0CD 4M1GH 4AL8H 4LLQA 4IHOA 1T0MA 3QCUL 5ALBL 5TDOA 3DVFA 3IDNB 4RFEA 1WFTA 2B0SL 1K5NB 4ZAKC 3H2WA 4HIHA 2Y9RT 3L3KA 2QQNH 3QUKA 2FR4B 1J1PH 3MLUH 1NUGA 4Z5RB 3QB7C 3K46A 4ZTPH 4J8RB 3KPRD 5K59F 1ZT7A 5FO9B 1M7XA 1P9MA 2YD5A 4WO4B 1T7VA 3MRJA 2FECI 1RJLA 5L2JA 3PV6B 4KJWD 1ZSDA 1CXIA 4LSQL 3IDGA 2GKIA 1I7TA 4HFUL 4NFDA 3HE6D 3QUMB 3ALWA 3ULUH 5IB4B 5EC2A 2ICWJ 1WICA 5DHVH 5FGCE 3BPCB 1G7LB 2PXYC 5IQ9B 1IM3A 1MI5E 1UEYA 1WTLA 2I60H 1OB1B 3QISA 4W4NA 4KVNL 4XRCA 5B38A 5C0RH 2BFVH 1QKZH 4H5SA 3TBSB 5DT1H 3MRKB 3LIZH 5F21B 4HPYL 5B8CA 2UZIL 3MUHL 4HXAH 4YDJA 3MRFA 3VXMB 1SJEA 4JAMB 4K7FB 3I50L 1CDUA 1XGQB 2BOBA 3BKCL 3MV7B 4KJYB 3ZYIA 1R3JB 2DQTH 3KG5A 2F74A 4IJ3C 4ISVB 3GBLA 3OJ2C 4TUKH 1TTFA 2ZSWA 1T20A 5C0IA 3BIBX 2IFFH 4BQ8A 3NABH 4U31A 4WNQB 5I0ZA 3LN9A 3MRLB 1HSAB 4X6DB 4X7EC 1OGAA 2V7HB 4WV1B 5GGRB 3QDGA 2EDXA 1RULL 2EXWD 1U8PA 1AHWA 2FGWH 2FHCA 5MENA 4R4FL 1VFMA 3HNSH 2CKBA 4KY1H 3QQ9C 4KV5F 2P44B 4HCRH 5DLML 4YR6A 3G6AB 1RZKL 3OV6A 4M8QB 1CLYL 3MFFB 2PO6B 1K8DB 1LNUA 2D0FA 3SDCA 1C5CH 3LPGA 3GM8A 1EHAA 4LBEA 4XWGL 3OXSB 1KG0A 4HS3B 4K3JL 1S5IL 3QWOB 4J3VA 1NGZA 3S35X 3QSKB 3UPRA 4P2CG 3K8MA 5D5ME 4EN3C 3P4MA 3F7YB 3WFEL 4NIKB 4CJ1A 4L8CB 5T5NF 4F3FA 2OL3L 4G8EA 5D72H 3NTCH 5CEZE 3U0WH 5IBTH 3BP4A 4JHWH 4MNHB 3D0LA 3VG0L 3B43A 5F6HJ 1XAUA 2DQDH 4LEXH 2HWZH 1IC7H 3ZDYE 3GMRB 3DVNA 5FHAH 5EUKB 3QXUA 3RWHA 1XGUB 1P4BH 3MGTB 1QFUH 2ICWA 3Q2CA 2AK1H 4OGAD 1CFSA 1FL5B 5HVHC 2PKDA 3DUHA 4WENB 3TYGL 2NY6C 1N8ZB 4PGJA 2VITA 4FFZL 3OX8A 3VRLE 4PJEB 5IVNA 4ZUUB 1SEBB 1TZHB 1A47A 1P4IL 2WBJB 4EZMA 5IHZB 2BCKB 5KSUA 3LEVH 4JFHD 1SJHB 1CIUA 4F80A 2DQJH 1C8PA 3FT3B 4JFPA 1I7ZB 2MQCA 3ARPA 1FYTB 4P4KD 1OARH 3P11L 3OKMA 2J4WH 4NNXB 4HD9A 3ELAT 4ETQA 3I02B 4YDLB 5C7XH 1YEJH 5C09D 4JG0L 1JIBA 2W92A 3B83A 3BT2H 1KPUB 4X5XB 3UP1A 3REVB 4OZ4B 15C8H 3RL2A 3HG1E 4V1DE 4FS0A 3KXFA 1H3VA 1U8IB 4QOKD 4L3CB 2YUZA 1AO7E 4UDTA 3BW9A 2BK8A 5I1DB 5BXFA 5I9QB 3F62A 1XF4A 1WUNT 4QXWA 5L6YL 5LVEA 4PJXA 1JMZA 1MPAL 1FNEB 3V52H 1CBVL 5DVKA 1HOCA 4RFNC 4KI5C 5TGBB 1FRGH 1FVDB 4X9FA 3ZSSA 4QHKJ 1DZBA 1LP9E 1KTRL 5LWYH 4FMKA 2NY0C 1JCKA 1CGUA 3GGWB 3WFDL 1X5FA 2Z93B 1DL7H 1L7TL 4D9QE 2K7QA 1IGYB 4EIZC 5JO5B 1HHKB 2F53B 1P53A 5FA3B 5SX4I 3BUYA 2XA8H 1RJYA 3C60D 4HC1H 1KSRA 5JPMA 4Q7DA 3MX0A 3U4BH 2Y4SA 1MFAH 4RCAA 5BRZB 1ZKAA 1KJ3L 2LU4A 3EAKA 5IEHB 5DHVB 2I07B 1HHHA 1M7DB 1KCVL 3DHJA 1DVFD 4FZ8H 2O61A 4OLZL 2GITB 3QIBD 3PL6B 3ARGA 3HPJB 2BXZA 2IADA 5C6PB 3WXWL 4F7EA 5K9KA 2BHYA 3DMMD 3VE0B 1BD2D 4FQXC 5I30H 4PJCF 3EOYG 2R69L 3R06A 3V2AR 2XTJD 5D4QA 1D5BA 3IVKB 1WBZB 2UZYB 1ND0B 3OAUL 4G6ML 5L2KB 3HZVA 1YEDB 1WBYA 2XRAL 2G9HB 1AR2A 4K7PL 1KEGH 3VXSB 4YJZL 1LO3H 5IWLA 2AJUL 2VAJA 1W0VB 4YPJA 4W81A 3BSZH 2EYSB 2WAHA 1MAMH 5TE6L 1I9EA 2ERJC 3LKRB 4YO0A 2DYPB 1L7IH 2X4TA 2AJ3B 4U0RC 5J3HD 3W9EA 4RQQB 3BIKB 3MRNB 1L9MA 1YEFH 5C6TL 5C0NC 3D2UB 5HD8D 4NBZB 3MA7B 4R0LC 2X40A 4WUKH 1RUPL 2P5WE 1XCTA 4R4BB 4JGMA 4U1IA 4RGOL 2ESVE 3V4VH 3VD7A 4HWEH 1IGML 2ATKB 2PYEB 3DGGB 4DN4H 1I9RL 2A9MH 5FEBA 4LLDA 4QXTB 2DJUA 4XNQA 4A6YL 4PJAE 5F89B 1TJGH 4ODUA 1WC7A 1QPXA 4ZXBD 3SDYL 3TIDB 1LDPH 2HFTA 3DHMA 3FO9A 4KJWC 4RX4D 3ZE1E 2HT3D 1F97A 3BKJL 3L95A 5A2KH 3DECA 4I9WE 1OAYH 3QCTH 1CLOH 1N26A 2DICA 2LQRA 3WHXB 3HE6C 1XGPA 1OP3H 2H1PL 4RRPG 2FSEB 1IC1A 4YHNB 1VFBA 1Q94A 4HWNA 2OJZL 4MA1C 1IE5A 1GVIA 3UTSB 2WANA 4JY4A 2LTQB 5I1GL 4F9PC 1ZGLA 4ZNEA 1KPVA 1JPSL 5CGYD 3M8OH 2DLGA 4I13B 2Q7NA 3V79C 3T4AA 1YYLL 3LKNA 5HGHB 5TQ2L 4JM2B 4NHUB 4PRHE 4WCYL 5C2UB 2FZ3B 4GKNA 1AGCB 4LMQI 1D7FA 1QBAA 3JWOL 3TYFA 3VXRD 4YHLL 3S8WA 5HYQB 1ZT4A 3GMMB 4RMSA 4GG6A 2CK0L 2Z8VC 4X99B 2XACC 5CSZB 2NY7H 1EDQA 1IM9D 3QFJE 2JKXA 1GGCH 2ZPKH 1NCUA 4D0DA 1J87A 3WEXB 3GSWA 4UT7H 3V4PH 5GZNC 1G7HB 5IGXL 2BVQB 1T1XA 1AQKL 1BZ7B 5DUPL 3TBYA 4XAKD 4JO1H 2EXWC 5KTEL 2X42A 2GQHA 5GS2D 2E8ZA 5D1XB 1MRDL 3G5VB 3CLFL 2BJMH 4NQVB 3MRMB 2JIXB 4ZFFA 2BNRD 1REIA 4F7CA 1DLFH 5D2LF 4TSBL 2HJKB 5JQHC 2AABL 1A7PH 2FB4L 3O2DH 4XPTH 4GQ9H 3QXWA 3V7AG 1Y6KR 4QRPE 4RMTA 1YUHA 4DGYL 5JXED 4KUZH 3EOBA 2HTLD 5TF1L 4YXLH 1P84J 1PSKL 4Q58C 1CDCA 1WIUA 4Y5XA 3T65B 4CN4A 4DVBA 3SGKC 5D70L 3MGOB 5DK0B 3MZTA 1JUFA 5E9DB 1GOHA 5EOQL 1JGUH 1GGBH 4LDLB 2NY6B 1AGFB 3BP6B 2G5RA 3F12B 4OLYH 4Y16A 3KYNB 1IGCH 4TNWK 2XNAA 5IB1B 1FN4B 5BVPH 1DTUA 1MOEA 4RDQF 3U30B 4DKEL 1IZKA 4D0BA 4X8JA 2F9BT 2XOTA 4XXDB 2YRZA 3MRCA 1Y18B 5HYJB 3QHFL 3D5OF 3IT8D 1I3GL 5EIIA 3V5DA 1N7MH 3MLXL 3STZA 3GSOA 5LBSH 4RMWA 3V6OA 3G6JE 3ARBD 1R5WA 5HDBE 4G9FA 2KH2B 4A2MA 1Q0XL 2HT4C 4OF0A 3FMGH 1C5BH 5B21A 2X9XA 1RHFA 4NO5B 1ADQA 1UJ3A 3MYJA 1QYGL 1X4XA 5E5UB 5FYKD 3IXAB 3TVMC 2W9DH 5C0DA 2VXQH 4NKOA 2HFGH 1MFDL 3TFKD 1KB9K 5IMOA 2OSLA 1QHPA 4JZNA 4CN6A 2DQHH 1LEKA 4P4RB 4POZD 2ZOLB 1RY7B 2NZ9D 1QBBA 3RGVD 5DJCA 4F2MA 2I9LA 5EU4A 2V17L 1F4YH 3T0EE 2DQTL 4FQQB 4O51A 3H3KA 1RHHA 1LO5A 4LU5H 3BPLB 3NCFB 3ZKQD 4NQUA 1T7ZA 4RFNB 1RZGB 3BFOA 4NC1C 4PV8A 4UT6H 2YUWA 3W9DA 1ZLVH 3QRFM 4Y4KB 2ICEA 1SYSA 5IHUH 4NN6C 3U0PB 1JHKL 4I0PC 3O3BA 3AY4A 5IB2A 2VJXA 5JW3L 4HF5L 1Q8MA 1D5ZB 1VFUA 3OG6B 2N7AA 2D3VA 3C2AL 3C60C 3CH1B 4MXQD 3UJTL 3VFUB 4L29A 1F11B 3K4ZA 1RUAH 1GAFL 4GRMB 4RMQA 4X7FC 1MFCH 5DJ6B 1UQSB 3TZVD 1BIIA 2X7LB 1TZGH 2M1KA 5F7DA 3CLEL 2Q7YA 1MRFL 1OSPH 4PJ8A 1DVFC 3QDJB 3RTQD 1KCLA 5ISZA 3H8NA 3VXMD 3A6CL 4JFZL 5CBAA 2D9CA 3L1OH 3SDXE 3GK8H 4MAYA 5I16A 3DXAD 5J13B 3H9SA 3VRJB 1QFWH 1DANT 1U8QA 2YMXL 3DMMC 2EDQA 5EZJB 5I19H 1G6RA 5F93C 5I8CB 4P0DA 4XNUH 4MHHG 2WIIB 5DURB 5F9WC 3MRBB 5DK3A 1RUQL 4PGCA 5F7KC 3BE1L 2XTJC 3QIUA 1KXVC 4EI6A 5FOBB 3I6KB 4HIIA 2X4UB 4LLWB 4OZIA 2YS4A 3CXDH 1RUKL 1AD9A 4J3SA 4XC1L 5EG6C 3VJ6B 4NSKA 4MJ5A 1K8IA 1YYMH 2DQEL 4MHHI 5IW6B 4OLEA 1KT2B 2PO6D 1IAIM 5J3HC 5C8JA 1CD1A 1VADB 3IU4L 1EGJL 3O2VH 5HD8C 1AY1L 3K2UL 4X6FB 3QDMD 3R0NA 4HK0A 2ATPB 4QRQA 4ZUWA 5HYFA 1M4KA 4OUOA 3HB3D 3V95A 3H9ZA 2DQCL 4ZUVB 1MY5A 4JCMA 2R1YB 1MCDA 5GGTH 1ZLSL 2O5XL 5C07A 4X98B 1V3LA 2DM7A 3F5WA 3H42H 2Q87A 4KDWA 1BEYL 4OF7A 3UYPA 2KPNA 4PJFB 3U48A 4DTGL 2B4CL 2MWCA 3O3AA 1M7IB 3CZFA 1A7OH 1R5VB 5C0AB 3QUXA 2Y06H 4ERSL 4CU8A 5GGUB 5I2IB 1FORH 4NYLA 3GHBL 2JK5B 1JHTB 2DLFH 5SWSA 5D7KD 2AJXH 2DRUA 1JPGA 1ZANL 1QRNA 4MD0B 1ZGLP 5DJXA 2IANA 5HHXH 3OGOE 5SWZD 5CD5D 1EJOH 1QD0A 4U2YA 1EXUB 4MNQD 1XGRB 1YQ2A 2W07A 3B5TA 4FXKA 1ZLWH 4PUBH 5CGYC 4G6KH 5K59E 3ISWA 3LN5A 4IRSB 3QG7H 5DQDH 2HFFB 1H5BB 3MOBL 2W65A 2NY5L 5DJZA 2W91A 5J89A 4LFHD 3KYOA 3D25B 3V7MA 1JZ4A 4PTTA 5HJ3A 3GSNA 1I75A 3NPSC 4E5XA 2V5TA 3TPUA 1NCWL 4AJ0A 5BV7H 4ODSH 2ADIB 5FXCH 5F88A 1WITA 2VZOA 4LOUD 2NXZD 3U7YH 4BFIB 1ORSA 4M6ML 4LLUA 1MREL 4XPAL 5I30L 1IGFH 2XZCH 1EEUA 1PFCA 1EFQA 2EEBA 3KPNB 1KXTB 3T3ME 4PJ7A 3RFZC 3I85A 2YEZA 1NH6A 3KLHC 3EYUH 4HBCH 3BWAB 4YEFA 4JN2B 4XVTL 3GMPA 4P5KA 3DSNA 1QBML 4OM0L 2QQLL 4M4RA 5FGCB 3OKDA 5EULV 5HGGS 2VL5B 3FOLB 5GJSL 5TDPB 2ZG2A 3FQUB 3L7FB 1MI5B 2HTLC 4GAJH 4P9MH 4C59B 5EPMB 1UM5H 1CXLA 3NZHH 1FH5H 1XMWA 3NGBC 1A4KA 3DETD 4DQOH 1WCBA 2H2SD 4IS6B 2O5ZH 3DBXB 2GIYA 2X89D 3MCLH 5IESH 4QTHB 4PJBF 2DBLL 2IGFH 1JF1B 3LQZA 4YHYC 3QHZH 3QZWG 4JFFA 4KROD 4WFED 5F7FA 3KPPA 3MODL 1YNKH 1WISA 1FQ9C 4MA3A 3E8UL 4U1GC 3HC3H 1J0IA 4QF1A 5F70A 1SYVB 1WGOA 1CK0H 4L4TE 1MCLA 4GRLC 3OKOA 5DK2A 3ARBC 4MMXC 4EVNA 4XHQA 3CUPB 3IJSA 2J8UF 2Z35A 2VIRA 1ROWA 3F7RA 4G8GB 2H9GB 3VFRA 3S36H 3ZTNL 1SEQH 3SDAB 1NCDL 4HKZB 1QUNA 1FFRA 4HJGA 4N9GA 5DZLA 2H26B 4M1DL 1T83A 3GMLB 5IR1A 1E4XL 1HI6A 1J1OL 3RGVC 3LHPH 2J2ZA 3QULA 1J11A 1FC2D 4HFWA 2XIDA 2H3NA 3ZYJA 1NC4A 3MLZH 2NY7L 5FUCC 2RCSH 1I9JL 3PABB 4KDTA 4LARH 5DYOA 5FDYA 2A6DB 4MNGA 4YFEA 5EORH 4FXLA 5E94B 4NKDB 4FQ2H 3PWNB 2FIKA 1MHPH 5J56B 4I0PB 1T80A 1CFTB 2D0GA 3FTGA 3EOAB 5F3BA 2FL5B 1KCKA 5L7XH 1LK2A 1DBBL 2ZSVB 4MXQC 4JFYB 2RB8A 3SOBL 3RHWF 2BNQD 1MEXL 4LCWE 2VXTH 4YFLI 4HKBB 3WIFA 4BUHA 5C08E 5FO8A 3KYMB 3TZVC 2ZUSA 3TCLA 4JM2D 4YXKH 4IRZL 2NY4B 1B2WL 4CJ0A 3RTQC 3TA3B 4X7DC 1QP1A 2VLJD 3RA7L 1KV3A 4B53A 3VFGL 4ZTOL 2H32H 4CVZB 3IF1A 4LHUG 4LAJH 5DJ8B 2FYYA 1OD9A 4V1DB 3FRUB 3SCMD 5JHDE 4AQ1B 1QSFB 3RVUC 1E6OL 1AO7B 5F9WB 1QSEE 4P3CH 4Y19B 5C71A 1QLFB 4XCYB 4YDKH 1CL7H 1QR4A 2WINB 2XKNB 4ZS7H 2PXYA 2X5PA 3P9MB 5DJ0A 4RFOH 3MV9E 3VH8A 3MNWA 2NW3A 5D7IF 2LE9A 3LKQB 5BV7B 5F7NC 4NQXB 3E6HA 4M7JL 5FYKH 2JIXD 3KPMA 3MRPA 1AIFB 3MV8D 4PJ5B 3WKML 4P57A 1LP9B 3CH8A 1BP3B 1NGXA 2BY3A 4Y5YB 4OCXH 1A1OA 1KCSL 1BZ9A 5ACLA 4LQ1A 1IGIH 3G6DL 1TENA 4IMLA 1VKXA 1C1EH 1Y0LB 4S1SH 3RQ3A 3BPNB 3C87A 3HLAB 4N90D 4P9HH 1OM3L 4M1CD 5HHPB 1OGTA 1EBPA 2ZCLH 3QIWA 3VXQA 2PYFA 3I2CH 1BQHG 3EFFA 5IMMA 3MRDA 2B1HH 1Q9OB 4LLYB 2E27H 1S7VA 4PBWD 1QLRB 5E00B 4OLVL 3WIIH 1FAIH 3VD9A 1TVBB 2QSCH 3KPSA 5SWQB 1F5WA 3FO0H 2AEQL 1IQWL 2M2DA 1IBGL 1GGTA 3QJHA 4P2RA 3RWDA 1A7RL 3Q6GL 5D1QC 4XX1G 1CGYA 5D6DC 1YNLH 3TIEB 3UO1L 5AG9A 1ULVA 1EX0A 5D1ZD 3BO8B 1VEMA 2EKSA 3KNBA 4OUUB 1XEDA 5CD5C 1DFBH 4EN3A 1KBGH 4ENEC 5E2WH 2YN3A 3EFDH 5HHVH 3UTZA 2Z8SA 5SX5H 2F15A 2OK0L 2GJJA 3L5HA 2FJHA 3LQAL 5CD3B 2QSTA 2GFBB 5FDWA 3FB8A 4OKVA 5L0QC 4UAOC 2IC2A 1FGNL 1ED3B 4K8RH 4BZ2L 4I18B 3CJJA 3WJJC 3JUYA 2F19L 2G5BB 4LRNL 3MLSH 4M7ZC 2P5WB 5HYSB 1CICC 2B1AH 1Q9LB 1ZEAH 3HNTH 4YQXH 3VU2A 2YD7A 3Q6FB 5TQ0L 3HA0A 1T1WA 2ESVB 2QR0B 5IBUB 3DUUA 1GC1C 2CDEB 3VXUA 3WHE1 3UTTE 1CU4L 1T4KA 3LKSA 3RX7A 5BW7C 2NXZC 2EIZB 3P3YA 3RWEA 1UT9A 4PJAB 4FQPA 4PJDA 5FYLL 1S7RA 2VXSL 2QQKL 4KHXL 3SKOA 5I74B 2JELH 2W60B 4FXGA 2FATL 5JTWA 1UH2A 4WI9A 4PRDA 3NBNA 1TJHH 1MCIA 2Q6WB 4J1UB 3ARTA 3IDXL 4NBXB 5D7LD 4N5ED 1F8TH 3K80A 1C5DA 3MLTB 3NCJL 4XP5L 1KN4H 4UINH 3P4NB 5CLWA 1R3IL 4R97B 5CJOL 3QH3A 1J8HD 2MKLC 4JN1L 4TPRH 3QO1A 4EOWL 4YK4C 3BKMH 2BXYA 3D85A 2X09A 1NAML 2BSED 4R26H 5E8NA 5CEZL 3PP3K 1N2RB 5DJYB 4UU9B 4Y8DC 5EU6D 4PRHB 3QDJD 3VRIB 2H2SC 1JNNL 4KVCL 1TXKA 3FL7A 4LVOC 4HJ0D 5E5MB 4B7LA 2HVKA 5HPOA 4G80B 3Q1SL 5D2LE 4Y5VB 4O2EB 2H6PB 1G0XA 2PTTB 3QFJB 4WU5A 4OLUL 4U6HA 5M94B 3F65A 3GBNL 4HIEA 1FPTH 4HS8L 5F9JB 1T0NB 4JRXE 3L3IB 2BVOA 3A6BL 1CD0A 4X80L 4MZ3A 4Z7VB 1AGEB 4GRLB 3TJEL 2ZJSH 1T1YB 5EZLB 3TV3L 1B6UA 2DAVA 1NJ9B 3IGAB 3L3OB 5KW9H 1INEH 3QUZD 1NLBH 3QDAA 1EFXA 4Z7WA 2JE8A 1BAFH 4UUJA 1FFOB 1GC1H 4C56D 1NUDA 4WY7L 1T5WB 4C55A 1UACL 1KTKE 4PRID 5KSBE 2DIBA 3S88L 3G5ZA 4S10A 4FQXA 4JZOA 1XGTB 1QVOB 2Y1VA 4H1LB 4GLRH 4MQSB 3QJFA 1A7QH 4AG4H 1MF2H 4TVPL 1OOAA 5DD0H 4FNLH 4YHPA 4YBLC 3W0WE 5FAAA 4HWBL 5ITFA 3QO0A 4P59L 4LPXA 3UC0H 4L3ED 5IF0B 2YRLA 1HEZA 1A4JA 1OAKH 2GJZB 4AT6A 3VCLB 1S9YA 1OAUL 3BP7B 1KULA 3AMLA 1P7QA 3NFNA 2AK4D 4K3DL 2J5LC 2YSSA 3BN3B 4TULL 2BX5A 1Y6NR 3MCKB 5DFVD 5C0CA 3FQXB 4BH7A 3HE7B 4KPHL 5HVFB 1A6UH 1MCWM 4LCUA 3U9PL 3O2DA 2A74A 3GKZA 2YD6A 3B6SA 4XC3L 4ZUTB 3GO1H 2HJFA 2AV1A 3KPRA 2P46B 3TBTB 4GMSH 2VDML 1A2YA 1BFTA 3L3DA 1BJ8A 4EDXA 5DTFB 3FB7B 2FO1A 1NDGB 1R3LA 2V5SA 3PJSA 2GTZB 3BEVB 3HC0B 3UTQB 4PV9B 1ZWIA 3K8LA 3MMEA 3SCMC 3PHQA 2BSSA 3HE6A 1E4WL 3MA9L 2IALB 1ZA3B 1FVEA 3MCLL 5BOZG 3SY0A 4E9LA 3DSFH 3S34H 1NBZB 3QNYB 2V9RA 4ODWB 4KTEH 3SPVB 4D3CL 3U2SA 4KTYA 1MHEA 2YUXA 1U8NA 3MNVB 3HN3A 5BZWA 1BLNA 4MA7L 3RWCB 2P47B 1G7MB 1WZLA 1ZHBB 1YEIL 3OJDB 4OD3L 1D5IH 1N6UA 2CLZB 3AB0B 4WHYH 4CMMA 4S0TD 1KLUB 2HKHH 3OAZH 2O5YH 5FO7B 2QTEA 3CFDB 1AJ7L 4NRXB 4NZRH 2VC2H 1J0HA 1CE1L 4FQ1H 5T1LB 4M1CC 2ZUQB 3ROLB 1GPOL 3SN6N 3AS0A 1IAIH 3B2VL 2I9TA 5IVZA 5E6ZA 2HVJA 1HCVA 2WLYA 4XMKL 4WGVB 5JOPD 1U8LA 2UUDK 3HR5B 4ONFH 3TH2T 1RPQA 5FHBH 5GZOD 1MLCB 2C1PB 3VI3E 5M95B 1A6WH 1TTGA 5EOCH 3ZYOA 1WK0A 2IBGA 3O6FD 2FGZA 1EV2E 5GRVK 5JR1L 5D1QB 1C12B 3EO9L 5D1ZC 1RZIB 4TNVF 5FYLD 2ITCB 3V6BR 3Q5TA 2YKLL 2VABA 5F1OB 3HAEG 5JORB 1RZ8B 4HX1B 2FRGP 5LCVL 4UILL 2GJ6D 5JDSA 4WTWA 2A6IB 4RGMB 1YEKL 3MUZ1 4I48A 2ADGA 5JW4N 3SGKA 1A6AA 4C57C 3L7EB 4NQCB 1W72H 2P8PB 4QCIB 4WI8A 2J8OA 5AWNL 5EUOA 2SEBA 2P4AB 2XN9E 3JSSA 3T0BA 3GRWL 5B3JF 2B39A 2DTMH 3CFJB 2CLRA 1CICB 4JFDE 1A14H 4S1DC 4JB9H 5CEZD 3HFMH 3BUTA 2UWEB 1L0QA 4Q9BA 5E1AA 5GJTH 3HI5L 1AQDB 3WN5C 2XG5A 1JWUB 2IH1B 4ELMA 3RX8A 1U8OA 2VZ3A 1XT5A 2AKRA 4QRRD 4GG6F 5ICYB 1S9WA 3BD5A 1JF5A 4P4KA 3CDYA 3GIZL 4KKLD 5DJDA 4YGAB 3PV7A 4NUJB 1ZHLA 5BOPA 1FLTX 5CBEA 5I1LB 2C3VA 2I5YL 4QHMA 4N5EC 3ABZA 2HH0H 1FZJB 3TVMA 3MLYH 5C09A 3CK0L 1X5KA 4N8VG 2NXYB 3DRQB 2IPTH 4JY6A 3AROA 2C3GA 1CIDA 2VB5A 4Z7QF 3IDIB 4HKJA 4QOKA 4XP6H 3LSOB 4CU6A 3SE8H 3UTPD 3FAWA 1I7RB 5DMIH 5I1JL 1VACB 1K4DB 3GMQB 4LASL 1A5FH 1WIOA 2E8YA 3D18B 2XG4A 2LFGA 3I9GL 4QHUB 3SE3A 3VXOA 1EHLL 5GGTA 4Z7UA 1KTLA 4U6VH 5DEZA 4IDLA 1U0QA 4LVOB 2DJ4A 2J88H 1HQRA 1DUYB 3HG1D 1XGYL 4TVPD 5AZEL 1UXSA 3QEHB 3V0VA 2W9EL 4OLWL 3BH8A 5H94B 1QSZA 5KOMC 3GJEA 4HUUB 4KQ4L 5JQ6L 4APQD 1NC2B 2PW2B 3C60A 1X5JA 1WF5A 2BHZA 4PYHA 5HPMA 3C6LD 3KHQA 1LK3L 4P46B 5KOVC 4NQDD 5CWSA 1CFVH 1AFVH 5D2NC 2F54B 4PRAB 3QUZC 3IXTA 1N5AB 4HEPG 1DVFA 3T2OA 4PJBE 5HHQB 1OSZA 3QIBA 3I3DA 5DJ2B 1E6JL 1NBYB 4P5TD 1H3TA 1Q1JH 4LAQH 5EFIA 2AEIT 4DUVA 1RI8A 5CHNB 3DMMA 1F2XK 5K9OA 1BD2A 2AJSL 3RY6A 2Z91B 1OAZL 4MJID 1BBDH 5I1CH 4ZSOB 6FABH 3H3PL 3HUJE 4GXUN 1I1AD 2AERT 4N0YH 1ORQB 3QQ4A 3TGXA 4JG1H 3TC9A 4KHTL 2WUBL 5CJQH 4DAGH 3MACH 4LSPL 1CQYA 4E41E 2VDKL 4XVSH 3ZZ1A 5IKCA 4Q0XL 1C7SA 2UYLB 1LE9A 2OTPA 2DWEB 3CX5J 1UA6H 1O0VA 4DGIL 1VHPA 3ESUF 4NUGH 3QEQB 2AV7A 5GSRA 1ZT1A 4WI4A 1JZ6A 2LAGB 2MCG1 2J5LB 1MJJB 1OLLA 4MDIA 4WI3A 5DFVC 2FO4A 4WUUE 3GNMH 5ALCH 4CVWA 4PJHF 3GJFH 4L4TB 4Q9RL 1R5IB 3O4OB 5T3ZD 2OJEB 5GS1B 4MWFA 4XMPL 1INDL 2ZG1A 4JPWH 4CVXA 1FG2A 4P2QE 5HI3D 2UVFA 2BC4A 5H37G 1IGJB 2OR7A 1CDIA 1V3JA 1A9BB 2FX8L 3JUZA 3S37H 5GQBA 3GUTA 3NAAL 4LDOB 3U46A 3FQRB 4RX4A 2Q8AL 3SHSA 3QUYB 3MRGA 4KDVA 3TN0B 5EN2A 3V6ZA 4UTAL 4O2FA 1W72B 1QNZL 1I8IA 4EBQH 3W5NA 3KYAA 4MCZA 4OIAA 4QXGL 3C8KA 2KBGA 2DS4A 3EYOB 3LPFA 4HJJL 4CVUA 1JV5A 3P9WB 3GIVB 5D6CB 2Y23A 1I3VA 4PG2C 2NQCA 3PXJA 4M02A 2PUQT 1PG7L 3OKKB 5I8OH 4YDVA 4DGVL 2VOTA 2DMCA 4I9WD 4WTXA 5K9QG 3VXRA 4X7SH 1LHZA 2JJVA 3BEWB 2P48B 2VLRE 1U8HB 1Q72H 1TLKA 2EYTB 3PNWB 3R1GL 4OZIF 2OL3A 4PRBA 5F9OL 3LQAC 1IM9A 5KW9L 2YPLA 4P5MB 4LCWB 5ADOL 1FNLA 1HZHH 5DRXB 3UZVB 5IMLA 5K9QI 1F6AA 1GOFA 2XZQH 4MAUL 4O9HH 2QKIA 5C08B 43C9B 3BAEH 1E4JA 2LV4A 5D7IE 3H0TB 3S3JA 2V7NB 2VLKB 2DM4A 2IQ9L 4OJFL 2DD8H 5GZOC 3V5KB 5JNYB 3GSVA 1HIMH 2BNRA 1LE5B 4GMTL 4U1JA 4OT1L 4ZMAT 2JB5L 3O6FC 4GG8B 3LS5H 5JLZB 2OXHA 3MRHA 2HKFL 1I8LC 4E0RA 3P73A 1BVKA 2C26A 3GSXA 4MD5A 4LLMA 4JR9H 4Y2DB 3BZFB 1J1XH 1CTNA 4O5LH 2DQIH 4L8SC 3C5JA 1IZJA 3O3DA 2LVEA 5JW5B 1OPGH 3KDMB 4XH2B 2YPKA 1CXHA 2V2TB 2DMKA 3DV6A 3FB5A 4HH8A 2XFXB 2VQ1A 5DJAA 1I3RA 2R1XB 3OB0H 1TTUA 5B39A 2QLVB 4PJCB 1G9ML 5JA8B 4FABL 3HZKA 4UNVA 4QRPD 4G3YL 1MCSA 3N50A 3VFWA 4JDVA 3RAJL 4LSTL 1DE4A 2R4SL 3SGDI 2UY7A 2CMRL 3CSBA 1JNLL 3I75A 5HHNB 2EDKA 1I1YA 3S36X 2X4RA 4MA8H 4S0SD 4Z0XA 4JRYD 2X4PB 2ZOKB 3ARBA 5KSAD 1V7NH 2EYRA 1OP3K 1BJMA 1S9VB 1FO0H 4QWWD 5EOTB 3HZMB 1OLZA 5F7EL 1F4XH 5BJTB 3QRGL 4WIQA 1EUUA 2GAZB 3OKNA 3EYQC 3X11A 2WUCL 4OV5A 1A0QL 1UVQB 2Y07H 4GKSA 3L9RB 5E8OA 1V8HA 2HLAB 3D9AL 1UYWH 3RGVA 4OZFA 3BPOB 3O3EA 4Z78B 3C09B 5I1EL 4MX7A 3O6LL 3G9VA 4OGYH 1JBJA 3P9LB 3PWJB 4RAVA 2ZCHL 3OL2A 3ESVF 3L3HA 3T04D 4NM8L 4ZO9A 2Z4QB 1CGVA 3SGEI 1KELH 1JNJA 1OGAE 1YPZE 3QDGE 1MUJB 2R9HD 2GTWB 3C5ZD 3GZKA 3A67L 3UTTB 5I8KH 4APQC 2DQUL 4JFQB 4OCRL 2FBJH 3T0ED 1NEUA 3C6LC 3RWFA 1IL1B 4PJIE 5DFWH 3TZVA 4NWUH 5MERB 4X6EB 5IFAL 2NR6D 3AC0A 3WDJA 3FRPA 1P2CA 4KUCF 2NYYD 3RTQA 3ARDD 4R9HA 1XF3A 2XQYK 3FT4B 4P5TC 1I4FA 3P0YL 3RU8H 4L9LC 3DXAA 4OCWH 1T3FB 3IFOB 3BESR 4M93C 1JPTL 3W2DL 4HUVA 5T1LD 2WWKO 1QEWA 3RKPA 1YEHH 35C8L 4NT6A 2FJGB 1IT9L 4A6YA 3U4AA 4LGRB 3L3GB 4WV1A 4OF3A 3FOMB 5CZXD 4OTXL 2ITDB 1VFAA 1MIEL 3HFML 5AD0B 4UIMB 1MVUA 2CXGA 2DM2A 5KVEH 1ZOXA 2OCFD 5D2LB 2Y36L 3F58H 3R4DA 1G9NH 2Z92B 4YUEH 2JJUA 3VMOA 4PGBA 2N4IA 3WIHL 3WLBA 4YPGA 3QDMA 4GJTB 3T2NL 4O4YH 1A64A 4NM4L 3F7YA 3FQTB 2A6KA 2JCCA 4DZBB 1X7QA 1ZA6B 4PS4H 1T03H 4WWKD 5KJRH 1X5GA 1KYOJ 1WT5C 5HI3C 3WUWA 4HUWB 4BSJA 5E8EB 1M05A 3S6CA 3V0WL 1JFQL 3CFEB 3QPXH 5EO9A 5CJXC 3KXFE 1CQKA 3IFPB 2NCMA 3RNQB 4NGHH 1N8ZA 2FHBA 1VERA 2A77L 4MD4B 4Z77B 1ZGLM 3GSQA 4F15C 2D7TL 3QYCA 4NNYB 4F33B 4ZUUA 5IJVA 1BF8A 4PJXE 2FNBA 4RISH 3EJJX 5D6DA 5EZIL 4OSUH 2GSGB 4UDUA 2IQAB 5DD5H 5IHZA 5SWZA 4XI5C 3WNOA 4MNQA 2DQFB 3W0WB 4BSWA 3OBAA 2R0LH 1GGIL 3O11A 5JHLL 3SQOH 2CR6A 1NBVL 1U2HA 4ZYKA 4YAQB 5L8KB 3NA9H 3BZEA 1JN6A 3EO0A 2C3HA 4V2BA 5GHWH 3K7UA 4DCQA 1FC1A 3WJJA 3UX9B 2NXYD 2EH8L 2R4RL 4GXVL 4X5XA 1XF5B 4G5ZL 1XR9B 5DHXB 1MCQA 1FO0B 2FLBT 2VO5A 3T1FB 1UWGH 2YXFA 4CBPA 1DLHA 4YE4H 4U1KB 3L5XL 2CDFB 4IEFB 4HIXH 1ZVYA 5BW7A 3MJ9H 5HHOD 4Q2ZA 3RL1A 2WW8A 3WXVH 3ZE2F 4WEBL 4FQCH 1KENH 1OP5H 2BMKA 1JWSA 4O02L 2VDRL 4FP8H 5CP3A 1PQZB 1FVDA 2EO1A 1U3HB 2JJSC 2B2XH 1UCBL 4NQED 3EOTH 4PRNB 1H15A 1X3DA 4WW2F 5T33H 1HHKA 2WBWB 5FYJU 2O93L 4HUNB 4TOYH 5T3ZH 3Q5YA 4U6TA 5DRNB 4GH7B 4B41A 4J12A 4EEEA 4NJAL 2VWEE 4OV6F 5CCKH 4KRMB 3VFTB 4F57L 1GHFL 3STLA 3BD4A 1MFBH 5MHSE 3H7LA 4UTBL 3BGFC 1JK8A 2D2OA 1Q9WB 5CJBA 3FONB 3L3JB 1Z9SA 4DFIA 3VWJB 1WZKA 1PYWB 1BFOB 2X89A 2A83A 4QXUL 5EOCJ 3MNZB 2BDNL 3K4AA 1FCGA 4OFYD 1UWEH 3VE0A 3VWKD 1UB5B 4C83A 1ZXQA 5J6GA 3CSGA 1U8JB 3S3SA 4MMZC 1KIPA 1JYVA 3O4LD 4UIKL 4FQHB 5H35B 3EYVB 3FRPG 4NQTA 2VE6A 4UV7L 5I8EB 2GK0B 5IV2A 3H6JA 1EEYB 4LNVA 4J3WA 2BVTA 1PGRB 5F9DC 2HG5B 1NFDA 2AGJH 2W9LA 1A6TA 1UKSA 3U1SH 3QG6A 2XKSA 5CP7A 5GRUL 1UZ6F 3LKRA 3S5LB 5GGSA 4UI2A 5KSVA 5KSAC 4HT1H 3SE9H 4AMKH 2ZNWA 2NY1B 3V5HB 5GGQL 3ZKXB 5JDJA 4HH9A 4Q6IB 5DDHA 3VG9B 2CQVA 3MUY1 4N0UB 3LV3A 3RVWD 4AM0B 4OQTH 4ZNEE 5F1IB 1HQ4A 2NNAB 3AU1A 4G42B 4RWYL 1I1CA 2KUTA 1MCFA 1JYNA 5IFHH 1YY8A 1T1ZB 3DX9A 5IIEB 4PJDF 5IB5B 2DIAA 3S96B 1ZLWK 5I8OL 1BQLL 2BVPB 5HYIA 3NCMA 4PJGA 3UROR 4TNWF 2BSTA 1ODAA 2QHRH 4DFHA 5ADPH 4AENA 1WAAF 1NUFA 1NGWB 4GG6E 4KZDL 1FNSL 1DQJA 1M1SA 3O41A 3V6FB 4GAYB 5C0BD 4P49A 4QGTA 2XN9B 4GBXB 3F6IA 1U8KB 4JO4L 1KIQB 4YEEA 3ME0A 3AVEA 4XPHL 5HSFA 3DGCR 4JFDB 4R6UA 3GMNB 3WHXA 4BFBD 2AQ1A 3IB4A 2R9HC 5DD3L 3C5ZC 4K23H 3EJYD 2OQJB 1QR1B 1LO4H 5GSVA 4U1MB 3VD3A 3BKYL 1P5VA 3RNKA 1AGDA 1N5YL 1CDBA 4PGZA 2BNQA 4WI2A 2EH7H 4KI5F 4MSWB 4WHTB 4Y0GA 4M7KL 1ZHKB 2IG2L 1TVHA 1X5XA 2NR6C 3SDDD 4JHAH 2ZUWA 2VDPH 2C1OA 4QRSA 2VLJA 5TJWK 3C6SB 1WBXA 3S97C 1FFPB 1FHGA 5CSZA 1ZAGA 4U2ZA 4WHDA 3SKNB 3QNXA 4L9LB 5J1SC 3DX7A 5A2JH 3AUVA 3TNMB 43CAB 2FH8A 3SCMA 2DI7A 3RWJA 3BD3A 3ZSTA 2CLVA 3ARED 1GIGH 3CSPA 1GZQA 4O2CA 5FYJH 3NCYS 1IFHL 4XP9L 1NAKH 2IBZX 4LCCB 5HBBA 3D3VD 4GS7C 5CZXC 1JGDB 5J12C 5IVXA 1R3KB 4AEHH 1EHNA 1EMTL 3HCVA 1MHCB 1XIWB 3LKPA 4NO0B 3PP4L 2JIXA 3MV8A 1S3KH 3KPQB 3ZTJG 3MXWL 3KS0H 1QOKA 3T4YA 2GY5A 4K3EH 4LNRB 4HHAA 4MZ2A 5JHDD 4L3AA 3FN0H 3UYRH 2OZ4L 1JTTA 1AHWC 1P7KA 1WZ1H 4H26B 1B0RA 1HXMB 3IDMA 5J1AB 4BH8A 1QSED 3U0TB 1T6WA 5T3XE 5ANMA 2VRAA 5EA0H 3RIFF 4NP4L 4G9FE 1A1NA 4Q9CA 5KG9A 1KFAL 3MV9D 5SX4H 2WP3T 1A9EB 4YWGL 3GMOB 1RJZB 4JE4B 1FNGB 1D5XB 2Z31D 4WWKC 5FUZH 1S7UA 4LKCB 1CE6B 1UXWB 4L8BA 5F7MC 5MEOA 3Q3GB 3NCCB 4LIQH 1DEDA 4PJBB 1F90H 4W70A 4HG4J 3PWLB 3HPLA 3HC4H 4XMLH 3BMWA 4ONGL 2VTFA 1U95B 1B0GA 3C2SA 4JLRB 3F12A 4J23A 3OZ9L 4PR5B 2YBRB 3WFBH 1HH6A 5LAXB 5D1ZA 3FT2B 2IJ0C 1NMBH 2VDOL 4G6FD 2MFNA 4XPGL 3RWIB 1F58L 5T1KB 5ENWB 3F7VA 4E41B 4U6XA 1HHGB 5GRJH 2R2EB 5J0BA 5K9JH 4PP2A 2J8UB 5MEPA 5T1MA 3THML 1DQDH 2EDRA 4XVUC 4J6RL 4PY8J 4P23C 3B5GA 1H3UA 2YD9A 2K9UA 3E2HB 4P2OB 5EBLA 1K9TA 3ARXA 4XNYH 2YD2A 2LAAA 5TH2A 1MFEL 1QO3B 1JGLL 1JGEB 1CGTA 4WUUB 4LF3B 2YK1L 1EAPB 3EKCA 4L5FL 4JM4L 4JFXB 3ORJA 2FD6L 3HRZA 5ISZE 4NKIH 4QY8A 5CSBA 5D7SH 3FN3A 3TO2A 2DKMA 1IVLA 8FABB 1CXEA 1DUZB 1AGBA 1YZZA 4GW1B 5CZVL 4P2QB 3TT3H 4XB7A 3OF6D 1G9MC 4U3CA 2XI9A 1S9KC 4KKBD 1IEBB 2IMMA 1MCPL 1ZTXH 4KI1A 4NRZB 3VFMB 2CKBH 3DIFA 3LEXB 4U1LA 4CGTA 4ETYA 4PYGA 4NRYB 2EC8A 5DRWB 3WUZA 3EYFB 5D7LA 1H3PH 3UBXB 2X4NA 2MCPH 4L8DA 3PGDA 3S4SA 3UTTD 1BJ1J 2ZCKL 4UT9L 3GSRB 1EPFA 4DZ8A 3IAGC 1J8HA 1SY6L 2NLJA 1A1MB 3IJHA 3JWDC 2W0FB 3DVGA 2MSPA 32C2B 1MSPA 3FQNA 4XNXL 1Z3GL 5EU6A 3GJFA 1ZLUH 4JFOB 1FL3B 2PR4H 5HVGB 5IB3A 1V05A 4OIBA 3CFKB 4WU7B 4U6YA 5DSCA 1IRAY 1CCZA 3P4LA 4NPYB 4HGKC 1GZPA 5DUMH 1QLEH 3ZT7A 1FIGL 1ZVSB 2VLRB 4GQPH 3VMNA 4K55A 4D9RD 1IMHC 5JOFB 1J8KA 3OB8A 5F6IB 4OZHA 1YECH 3VWKC 4XP1L 5C07E 2GSIA 3VGEA 1M6OB 3ZT6A 4MLIA 2V2WA 4ZDHA 1OCWL 3G04B 1XCQA 4XPBH 4PD4J 4CUCA 3D39B 5D7IB 3GB7A 2HFEA 1HK6A 2X9YA 4NO3B 1PLGL 5FKPB 5E2JA 5EUOF 5AYUL 3U9UB 4WFHD 5SWSE 2J1KA 3QXDA 5AAWA 3VXTB 5KS9A 4Y4FD 3V4UH 5D2NA 5H8DA 4GFTB 4ODTL 4LSUL 2IANE 3QUZA 2LU3A 3EGSA 3OTTA 4N8CL 3VFVB 1EO8L 1MJ7L 1RZJH 2AJZA 4RGND 3NZ8B 4JPIA 3RVWC 4ELMF 1QFHA 5D8JH 4C56A 1YN7A 4JRXD 2R2CA 4PRIA 3HI6L 3H3BC 2DL9A 5D7JD 4M5ZL 2R29H 1NGYB 3L6FB 4HGWA 1J05B 4U1SB 2YWZA 4K71C 3P4OB 5TE4H 5M7QA 1FL6A 4GW4B 4PREB 5FUOH 1DBAL 1H9VA 4YDIH 1RK0A 3DRTA 4LLQB 4WW1B 3QNZA 4IHOB 1T0MB 5CS7A 1CDHA 4RFEB 4HIHB 3TLRA 4G7YL 3N1FC 4L3EA 3L3KB 2EIDA 5E8DL 3QUKB 3T0VA 3ECBA 5EC1A 2GUOA 1KCUL 1CN4A 3SO3C 3E6FA 1ZT7B 4M48H 2AK4A 2FCBA 4HMEA 3EJYC 4QTIL 3JWDH 5I73C 4MD0A 4H8WL 1J88A 5JW4Q 3MRJB 5I1KH 1RJLB 5L2JB 1FYTE 1RFDL 1TMCB 2W0LA 1ZSDB 4PJ7E 3IDGB 4OB5L 2W1NA 4OGXL 4M9OA 3PXHA 1QA9B 3JV4A 1I7TB 1MHHA 2XYCA 1NKRA 2CUMA 3S37X 5EC2B 5I1IL 3SDDC 1SVCP 4M7LL 1A3LL 1MNUH 4LHUD 3BXNA 1SM3H 4XRCB 4TSCL 5B38B 3EIFA 2VKWA 4NN5C 2E6QA 3BDBA 4H5SB 3C5SA 1AR1D 4FQIL 5LGHH 5B8CB 3K1DA 4HMDA 4YDJB 3AREC 1EJ6A 4EUPA 3MRFB 1SJEB 1NGQL 2YA1A 2E6PA 4X6CA 1LEGA 2BOBB 4UB0L 5INCA 4DK3A 2F74B 3CXHK 2NX5D 4GS7B 5ILTL 2J3SA 4JFFE 3IRPX 2ZSWB 1T20B 3NN8A 4HPOL 5C0IB 3KPOA 4PG2A 2J6EL 3CDGA 4OIIH 3KPNA 2F53E 4YHIA 2PF6A 4B50A 2GT9A 1J5OL 5KZCB 1OGAB 3M17A 3QDGB 3ULUE 3BWAA 5BRZE 1INQA 5CILL 2EICA 1CR9L 1U8PB 1AHWB 4RAUA 5MENB 2A73A 3B9VA 1I8MA 2CKBB 4JFED 4YHML 4YR6B 4J3XA 1OD7A 3FOLA 5EZOH 1NCNA 1PDKA 3L7FA 4AMKL 1LNUB 1I85C 3SDCB 1FZKA 5D96B 1FNFA 4FG6C 4LBEB 2Z31C 1NFIA 1KG0B 3MPCA 2MHAA 1TPXB 3HMXL 1NGZB 2HRPH 3UPRB 1NMAH 4JJ5A 3T2QA 3P4MB 2IH3A 4F3FB 3NFSL 4G8EB 3KHOA 3BP4B 3D0LB 3FB6B 3WSQH 5L2KE 1T2JA 2RFXA 4I77H 4PJ9D 3DVNB 3RWHB 4FQLL 3O6FA 3VXSE 4N0CD 2ICWB 4TQEH 1N0XL 2JJTC 3PHSA 1CFSB 4MNGE 1I8LA 3ES6A 4ZD3L 4KQ3L 4UV4H 5EWIH 3CSYA 3KGRA 1FDLH 3EO1A 5I1HH 2VITB 1N6QH 2CGRL 2GJ6A 3CD4A 2VH5L 3U36A 3TBVA 4RA3A 2WIMA 4RMUA 4HMCA 3BGMA 5KSUB 4Y4HB 1BZQK 3TT1H 5GRZA 3IFNH 1AI1L 3V6OC 5D5MA 1EO7A 2IWGA 1A7NL 2CD0A 4NZJA 4TUOA 1E4XI 5DA4A 4JFPB 1NAMA 4E42A 3X14A 1FYHB 4CDHA 3H7BA 1FJ1A 3OKMB 4PY8I 4ETQB 4DEPC 1N64H 2NY2C 5BS0D 4AEIH 1MQKH 3NFPA 4QRRA 4KKBC 3RL2B 5E2TH 2RQ8A 3KXFB 4GAGH 1YJDL 1F13A 3LD8C 4X4XA 2EZ0C 2ED8A 3SKMA 5E08H 5ACZA 4N68A 4MXVF 1RIHH 2VLMD 5BXFB 3EHBD 4S11A 3S98A 3O9WC 1XF4B 2COQA 2XQYG 1DSFL 4M3JA 4PJXB 1KC5L 3RJDA 2L0DA 1HOCB 3KJ4B 4GUPA 4M9PA 2ZSVA 3MLWH 4ZQKA 2JLLA 1F4WL 1V7ML 1JHLH 4JY5L 5F3HA 4WRLA 5JPNA 5DEGA 2D03L 3SJVD 4Z0BL 4M6NL 1UB6A 4ZPTA 3OHXA 4KMTH 1IKFH 3ZE2E 5L88H 3N1GC 3PWUB 1T22A 3NIGE 2VDQL 3BUYB 4IIQC 1AKJA 1U58A 4J3UA 4M43H 3U79A 4G7VL 1RJYB 3LS4L 3OAZK 3CVHA 2DQGL 4KKCD 5GGRY 3I6LD 1LD9B 3W11D 4OD2A 5AZ2H 1HHHB 3HS0A 3O8XC 4XNZC 3U6RA 3HG1A 3T09A 4KK8D 5E70A 4NCC2 4ZO6A 5C0GA 1KN2H 2APWA 2APXA 3LOWA 2O61B 2A1WL 4Q6YA 4JKKA 5C0JA 4YC2B 3GI8L 5DVMA 3KPSE 3ARGB 4APQA 4HWBA 3S35L 2BOCB 4PGDA 5B4MD 2IADB 5TPWL 4JCLA 3CVIL 4WWID 5K9KB 4P2RE 3C6LA 1OT1A 5J8OA 1DBKL 1G7PB 2CIIA 1BM3L 1XIWD 4NQDA 4NO0D 2F8XC 3RWGA 4KGLA 4Y4FC 3DV4B 3R06B 5T3XH 1D5BB 2AW2A 1IC4L 4NHCL 3X13A 5GRXG 3HZVB 5C2BH 1IEHA 2AQ2A 1WBYB 4RGNC 1B4RA 4H88L 3FFCD 4I3RH 4P5TA 4WFFE 4Y1AE 1ADQH 3JTSA 5CEYA 5TFSL 4JDTH 5JXAH 1NEZA 1CWVA 4YO0B 3WJLC 5D7JC 2X4TB 4JKMA 5GIRA 4F7TA 4MJIA 2BERA 2CSPA 4MQXC 1CS6A 1I1AA 5E9DE 3ARFC 1U41A 4MS8D 1XCTB 4LLYA 4U1IB 4XCCL 4Z18A 3QQ3A 2CIKA 4NNPH 3QCVH 1BF2A 1RMFH 3IJYA 3VXUE 2NW2A 5J1TC 1RURL 2P8MA 4LLDB 4XHJD 4XNQB 3NIFE 3P0VH 4PJDE 1OQOA 4P3WA 4N0RA 1J0JA 4ODUB 1WC7B 4TUJA 3UJIH 3ZDZF 3JVGC 1DP0A 1IKNA 1KJ2L 3FO9B 4E41D 4JKPH 3L95B 3LZFL 3P30H 4NN7B 4ZPVA 4ZOCA 2FJFA 2OMNA 4HQQL 2GFBA 1A02N 1XGPB 4V2CB 1EVUA 1LMKA 1WT5A 5IOPA 3GHEH 1VFBB 1Q94B 4LVNC 5IVOA 4QRUA 3CZJA 3TPKA 4P2OD 4JY4B 4HLJA 5CJXA 1ZGLB 1KPVB 4WDIA 1OTUC 2AJYH 3HMWH 2CRZA 1AE6L 1NSNH 3T4AB 3LKNB 1LEIA 3TF7C 1AR1C 4R3SA 3UMTA 3LRSA 4GKNB 4JANA 5CKGA 1G6RH 3QEGL 3TYFB 2F58L 1D9KD 1ZT4B 4BQCA 4GG6B 4MVBC 4P2QD 1IAKB 3VFSA 1G7IB 3C8DA 3T0WA 4JPVH 1X6NA 4ZOBA 3HTLX 1JGVH 4D0DB 5F7HA 2Z9TA 3GSWB 1EEZA 2D4FA 1LWRA 5E0QA 1T1XB 3R8BB 4X4YA 3ULVL 1F2QA 1MJUH 1LGVA 1VGEH 4G6JL 1NGPL 4X6DF 4X4ZA 1KJVA 3T0DA 1CLZH 3RZCB 4ZFFB 1TCRA 1HKLL 4F7CB 4MB3A 1RZJL 5E2VL 3OR6A 4Z7WE 5MP6L 4CW1A 4YHKH 3BVNA 4FFWD 1OAQL 4NZUH 2HRLA 4ODVL 1RUML 2XWBA 5GS0L 1N6VA 3J8F7 1YUHB 3KS0J 2I26N 3EOBB 1EZVX 3ILPA 2JCCF 3OPZL 4O2EA 4PJ9C 2JJSA 4U4BA 4Y5XB 3QI9D 2X2YA 5I17A 1VPOL 4M6OL 4DVBB 5LGJA 2FWOA 1TETH 2BZDA 4PB9L 4LCYA 1JUFB 1FSKC 1C08A 4I2XA 1G0YR 4YXHH 1GOGA 1K2DA 1JYWA 4XVJH 2CJUH 4Y16B 1D5MA 1LO0H 4K2UL 2VDNL 1HINL 3GFUA 3KJ6H 1YEGL 2XNAB 2ORBH 5C0CE 3VXNA 5KAQG 1TQBB 3JV0A 4X8JB 4KRPD 3D69A 3VFOA 5BQ7B 3MRCB 3RY5A 1IQDA 3BQUC 3NIDE 3V5DB 3QEUA 3GSOB 2Q8BH 3STZB 4YHZL 4QRPA 5I15L 1R5WB 4G9FB 5A3IC 3WD5H 3KPRE 4UOW1 3MROA 2UVEA 3MLPA 1UJ3B 3MYJB 1F3DJ 1KGCE 1DBJL 5C0DB 4TTGA 4NKOB 2XZZA 1A6VL 3BWUC 2VZSA 5IMOB 2OSLB 5D71H 5HDQH 4ZFOB 4JZNB 7FABL 1SBSL 3L5JA 1LEKB 4DVRH 4JRYA 1UH3A 1UM6L 5KSAA 4DN3H 1RZFH 2JTDA 3MOAH 3EHBC 5DJCB 4F2MB 2I9LB 5EU4B 3BP7A 4KDTC 3S3PA 4O51B 3MCKA 2ADFH 4NWTL 1RHHB 1KB5B 1LO5B 2WV3A 1YNTA 2KKQA 4MJ6A 5IMKB 1I3UA 3BRDA 2YD8A 4JO2H 4PV8B 3W9DB 3MLVH 4XNMA 2P24A 4YX2H 2ICEB 1SYSB 3BDYL 4OM1L 1JWMA 4HXBL 3L5WA 3O3BB 4POUB 5IB2B 4XAWH 3G6JA 3LVEA 2CXKA 1B0WA 1UWXK 5DWUL 4EI5D 4TRPL 1CZ8L 3G5XA 1N4XL 2MQ0A 1CT8A 2R56H 4M00A 3PDDA 4L29B 4KKCC 5GGVH 1FLRH 4YGVB 3QAZC 3W11C 4F9LC 2YC1A 3EJZC 3KPLB 4KK8C 5F7DB 2Q7YB 4CNIA 2A9NL 4NCC1 4F58L 4PJ8B 1U93A 3CMOL 3C5ZA 5ISZB 4UQ2A 2H41A 4HV8A 5CBAB 2RBLA 5LQBH 1U91A 4B0MM 5B4MC 4MAYB 5I16B 4KJQD 3T0EA 1CG9A 1U8QB 3CDFA 5HYSG 3LDBB 4XCFL 1G6RB 3UPCA 4BSVA 4PGCB 3QIUB 4FZEH 5IBUG 1G7MA 4EI6B 4HIIB 4OZIB 1A22B 3ARDA 4H8WC 4PTUA 1AD9B 2P49B 1G9EA 4NSKB 3LH2L 4CL7A 4MJ5B 1OAXH 5DVNA 1KOAA 1K8IB 3DUSA 4M61A 5E6ID 3TO4D 3HI1A 1NFDF 3MBEB 1MRCL 1B3JA 3MRQA 5DGRA 5DS8A 5C8JB 4FTVA 4JPKL 1CD1B 3TBWA 1WFUA 5F7WC 4ODHH 4MS8C 1TQCB 2VR9A 4W6YB 3U7WL 1IC5L 4G8IA 1A8JH 4HK0B 2B7DT 4OF8A 4CKVX 4ZUWB 1RVFL 3HR5A 5E7BA 3SDXA 2BNUB 2X1XR 3QIWC 4WW2C 4DKFH 4XBEH 1T2QH 4XHJC 4PJGF 5C07B 1CF8L 5I18L 4AIZA 2X6MA 4I5BA 2EDHA 3O3AB 4KAQL 4JFHE 3OWEA 3CZFB 3KYKL 5CEXA 2KZ1B 3QUXB 4UBDD 5DUBA 1ZMYA 5HHMD 3BHBA 4NYLB 5JORA 5IJKA 4G8GE 3MFGB 5LXGL 5E03A 1K4CA 2QADC 3LMJL 1T2XA 5SWSB 3MCG1 5ITBL 3ULVD 4WWKA 1JPGB 1EK3A 1L0XA 1QRNB 2MMXA 3B3IB 1RU9H 1IGTA 1QQDA 5EU7C 5DJXB 2IANB 4MLSA 3OJVC 2BHUA 3RZWA 2DI9A 3B9KD 1I1FB 4Y4HD 1GSMA 1MVFA 5A1AA 5EBWA 4JZJC 3ZLQC 1B4JH 4FXKB 3BI9X 2FX7H 5TF0A 1DQML 5DVOA 4RRPA 3LN5B 1SHMA 2CRYA 1YEEH 1KNOA 3X3FL 2W65B 1D9KC 1S78D 1JWUA 4JM2F 4R7NA 5GS0D 2O26U 3NACL 1O5DT 4Z7UE 5DJZB 2P5ED 4KZEH 3LEYL 3KYOB 4CMHB 4H20L 4NC1E 4YHOL 2XICA 4PTTB 5HJ3B 1RK1A 3GSNB 4E5XB 3ZKNC 4Z6AT 1QBLL 3TPUB 1MIML 1FBIL 4QHNA 5GRWA 1CL7I 2G75A 4H1LG 1MWAL 3W5MA 3BOVA 3EYSL 5F88B 5J6HA 4P23A 2EDWA 4I0CC 4O58L 2X4QA 4HIJA 4Z95H 3VW3H 1F3JA 4GAFB 1ORSB 2R0ZL 4JQIH 1JI2A 4KU1A 4LLUB 5IW1A 5IVXF 3S9DB 4MXWH 3IDIA 4YBQD 2VXVH 3NMEA 4PJ7B 4JRWA 3PGCA 2YEZB 5E4EB 2A6JA 3ZMRA 3GMPB 2F5BL 1BFVL 3H9HA 4P5KB 3D18A 5GS3A 4WJ5A 5HHOA 3OKDB 1BD2E 1T66C 4JO3H 1QSFE 2XPGA 4I3GA 5HI4D 4M62H 1AXTH 4ZFOL 4Y19E 5KVFH 2WBKA 2XTJE 1AC0A 3FFDA 3QI9C 1A4KB 1DANU 4NQEA 1WCBB 4GSDL 2AVGA 3LKOA 4KRLB 3ARGD 3K0WA 5A2FA 4XBPA 2L4OA 4PJ5E 2QSVA 2ICES 5F96L 1KB5L 2Z8WC 3LQZB 4ORGA 3MJ8A 2QEJA 1CD9B 4JFFB 5IHLB 3OKEA 5GISL 5IT2L 4MA3B 3DI3B 5JIIA 2P7TA 4R96A 4QF1B 3CFCH 2ZKHL 5KVDH 5CUSL 4FQJL 4KRPC 1EAJA 5IQ7H 5C9JA 3MUGA 3OKOB 1HCFX 1ES0A 1NDMA 5DK2B 3QA3A 4OFYA 4Z7OE 1S5HA 4MQTB 3VWKA 1FZMA 3N1MC 4EVNB 3G5YA 3WDHA 5TE7L 1JL8A 3IJSB 1O7SA 4OCNC 2Z35B 1U6AL 2VIRB 3O4LA 2XQBL 2C4FU 4HEME 4IDJL 3VFRB 1BWMA 5MHSD 1JZ5A 1S7TA 1SMAA 2YUVA 2HTKD 2YPVH 5CIPA 1A3RL 3TESA 4N9GB 4HJGB 2VMFA 3ZE0F 5IR1B 2DWEA 1HI6B 4U3XA 4R2GD 3QUML 3GKWH 1JZ7A 4RMRA 1RQ5A 1U8MA 3QULB 1KCRL 1AD0A 4HFWB 2H3NB 1NCAL 1NC4B 4JKLA 3KR3H 4YZFF 3NH7H 4IM8A 4N1EA 4JPVL 3GI9L 5DYOB 5BO1H 2B20A 4YIQA 1DQLH 4L1DA 3N9GL 4HKXA 4WEMB 4MNGB 2NY3B 2F5AH 1UC6A 4JDZA 4IRJD 4ZS6C 2R8SH 4B7IA 3VXRE 2IAMD 2FIKB 3GDBA 3MR9A 2X70A 4LSSL 3O45A 3FTGB 4EI5C 1NPUA 2A0LC 3RIAF 2QQQA 5F3BB 1PY4A 3CPLA 1LK2B 5IEKA 5C0BA 3BRFA 5FCSH 4XP4H 2YPLE 2OP4H 3WO3B 5HVWA 2VXUH 4ZAKB 3HZYA 1D6VL 3WIFB 4NBYB 1WWWX 3TWCL 5FO8B 1HXYA 5CINH 3T0XA 3TCLB 2R0KH 4XAKE 2YA0A 5E8PA 5DC4B 2N7BA 3BH9A 4D9LL 2IFGA 3SGJA 5K33A 3IKCA 3DURA 1I9IL 5I1AA 2CO6B 1FGVH 2OR9L 3IETB 4KJQC 3IF1B 4LLVA 4BK5A 1U92A 5ESAB 3KWWA 2FYYB 4RBPK 3ZL4L 4ZO7A 1IAMA 1WEJH 2V2XA 3DOSA 4OZHF 3P2TA 3O0RH 2Z0BA 3SDDA 5I66A 2CUHA 1RIUL 2R2HB 4OLXL 1OL0A 3IU3A 2PXYB 5DJ0B 3VH8B 5DD1H 3MNWB 2NW3B 3MO1A 3C9NA 4LSRH 3E6HB 3TO4C 2XY1A 5F72S 3RZCD 1BREA 1UKTA 4GW5A 2DDQL 4P57B 5DR5L 5E99L 4DUWA 4JHBA 5KS9F 1NGXB 1ACYL 1DN0B 1JZ2A 1A1OB 5DRZA 3AREA 1BZ9B 2BRQA 2Z8RA 2AJVH 1HH9A 2DWDB 3JV5A 4ONHA 4IMLB 3D3VA 4IJ3B 1NKOA 1XF2A 1VKXB 4M5YH 1NCCL 1A6ZA 4KTDL 3MBXH 3GSNL 1FV1A 2GEEA 3OQ3B 5JNYA 1YMMD 2P43B 1OGTB 3QIWB 5T5FH 1F4AA 3VXQB 2PYFB 5IM7A 3EFFB 5IMMB 4Z7VE 3MRDB 5JHDA 5ESQA 4OCSL 1K3IA 3UJJH 3J7HA 5FM8A 1IARB 3UAJD 1S7VB 1QSEA 1KTDA 2BVEA 2PCPA 4NZTL 2APFA 4PJFF 4R8WH 2EKJA 3KPSB 4D0CA 4UBDC 1FE8H 4FFYH 5GRVL 5E2UL 1WTGT 1YMHA 4LSVH 3MV9A 1I8KA 4NJ9L 3QJHB 1I85A 4P2RB 3RWDB 5IG7A 4I3SL 4X7TA 3ULVC 4K9EC 2Z31A 5FYKE 3QXTA 1NL0H 3WL9A 1MAJA 3KDMA 4Z8FH 2EKSB 2Y25A 1CGSH 3B9KC 4EN3B 2MNUA 2XZAH 4LGPB 3LRGA 4ZODA 3C08L 3UTZB 4Y1AB 2FJHB 4S1QL 3HNVL 4KWUA 4OD1H 4XPFL 4P99A 5FDWB 3FB8B 4OKVB 2E7HA 3ZDZE 4M1GL 5FM4A 4OCLC 1FFQA 2HAZA 4AL8L 5FUCE 4OGAC 1AP2B 5INDA 2JJTA 2VDLH 5HVHB 2QQNL 3K3QA 3O2WH 1J1PL 3MLUL 4PLJD 1NBQA 2R15A 4ZTPL 4EDWH 4U7SA 1F00I 1XH3A 1T1WB 1ZK9A 2X4PA 4QKXB 4MDJA 3VXUB 3FAXA 3PUCA 5CGTA 1T4KB 3LKSB 3RWEB 1BQUA 3DJ9A 5EOTA 5MEQA 4PJDB 2R0WH 1S7RB 3INUH 4X6CF 2DJSA 5EBMA 5HGDA 3ULUL 3SKOB 4S1RH 2OBGA 4FXGB 5ESVA 4P4KC 4YBQC 3PQYD 1AH1A 3BZDA 5BMFH 2V5RA 3Q0HA 2XV6B 3RDTD 2I60L 25C8H 2CDGA 4K94C 4PB0H 5C0RL 2BFVL 1C5DB 3KLDA 3DXAE 1QKZL 5EIVA 3QH3B 1TJIH 3P9LA 2G60H 5DT1L 5T5NG 3LQMA 3LIZL 5E24E 2BVYA 3QO1B 1VESA 1IAII 2NTFA 3QDHA 3D85B 5HI4C 4HXAL 4XGZB 3PIQA 5E8NB 1H8OA 2IPKA 1QPPA 1MUJA 3O9WA 4G9DB 4PJ8D 3BYTA 2GTWA 2PNDA 4TUKL 3SE3C 5FV2A 4WO4D 2ZNXA 4PJHA 4JGJA 2IFFL 2F8OA 4DWHA 2HVKB 1BGXH 3NABL 5CJ5A 4DW2H 2EDJA 2NY0B 4WU5B 2AI0H 3VMPA 2FGWL 4QRTA 4HIEB 3WFCH 1VGKB 3HNSL 2VN4A 4KY1L 3VI4E 4HCRL 4LQFH 1G7QB 3OGCA 2AS5M 2BVOB 4RNRA 2JCCE 4IIQA 3N85H 1LO2H 2ZUUA 2AEPH 1C5CL 1II4E 3QZWA 5JUEH 5F1KC 3O6MH 1WZMA 3MXVH 3MBED 3MLRH 3O8XA 4M6AA 4LLAA 4XWOD 4QO1A 5FKAA 1EFXB 4X0KA 3QIBC 1T7WA 4Z7WB 5D72L 3NTCL 3U0WL 5IBTL 4JHWL 4UUJB 3MV7D 2JB6B 2BRRH 2HTKC 1MJ8H 1EA9C 1OW0C 2DQDL 4LEXL 4YBHA 2HWZL 3RY6C 1IC7L 3G5ZB 1K6QH 2PW1A 5D9SA 4TSAH 5FHAL 4FQXB 1C16A 1P4BL 3QXAA 4JZOB 1QFUL 3VD5A 5D5MF 3QJFB 4OCYH 1NLDH 4R2GC 4TVSa 4Y4FA 2EIBA 2AK1L 3T8XA 4X83A 5HGBA 4X9IA 3SKJH 3JWNC 4YHPB 5JOEA 1VSCA 4MNQE 2ED9A 4JGUA 4G8FA 5KVGH 5F9AC 5ITFB 3QO0B 1PKQA 4JRXA 4U7MA 2ERJB 4K94H 1HEZB 1DEEA 3WJLA 4IRJC 5D7JA 4U0RB 1H3WM 4HULB 4NQCE 1S9YB 3DTXA 2IAMC 1N3NA 3AXLA 1P7QB 3NFNB 3LEVL 2YSSB 4R0LB 3ARFA 3NCEB 2I25N 4HUWA 3VRLF 2DQJL 3CX2A 3MUJA 4PLKD 5C0CB 4BH7B 2C4FT 2D7PA 1OARL 2UWEE 2OI9C 4LCUB 2J4WL 4KXZI 4X4MA 2A74B 3OXRA 5GPRA 5C7XL 5KSBA 3B6SB 1YEJL 4G43A 3MREA 1CD8A 3BT2L 4DUXA 2HJFB 2AV1B 3KPRB 2Y5TA 15C8L 4ZXBC 2AEWA 1A2YB 4Z76A 1MCOH 1E28A 3L3DB 3JVGA 4EDXB 2HT3C 4FN0A 2OMBA 1R3LB 3PJSB 3DPBA 1TZIA 1ZWIB 3MMEB 3PHQB 2BSSB 4ALAH 3HE6B 4LCIH 3V52L 2WBJD 2OZ4A 4D8PA 4R7DA 1FVEB 4HLZH 1J0YA 3X3GH 1FRGL 4IBLT 4MA1B 3SY0B 4Q9QH 5LWYL 4LHUA 1RZKC 4BZ1H 1IAOA 2PETA 3VD4A 1KLFA 1DL7L 4LHQB 1MHEB 4P48A 1FYTD 3QCUH 3D0VA 1U8NB 4U1HA 5ALBH 2D7MA 2B0SH 1BLNB 2XA8L 3CCHA 4HC1L 5EIQA 1X4ZA 3U4BL 1MFAL 1DDHA 4CMMB 3EZJB 3FO2A 2NX5A 2CR3A 1CVSC 4FZ8L 2EC9U 4LSQH 1FP5A 3IDJA 4Z9KB 2I9TB 3SGEH 5IVZB 3IKKA 2HVJB 4HFUH 5I6XC 4P3DA 2C7UA 1NFDE 1UZ8B 3MJ7A 5E95B 1U8LB 3WLWD 2EDBA 4JFEA 2F54E 1AXSA 4D2NA 1X5AA 2E7LC 2AXGA 2DB8A 4KVNH 1BQHA 5TDNA 3GM0A 1CFQA 4YNYA 1KEGL 3PWVA 4EXPX 1LO3L 2F53D 2ARJQ 4HPYH 3BSZL 1MAML 2UZIH 1L7IL 5JXEC 3ULUD 3GBMH 2HLFD 2VABB 5BRZD 3I50H 4UQ3A 4PJGE 4ZSOE 5FYKU 3BKCH 1YEFL 4IOIA 2GHWB 4MGXA 5E4IA 4WUKL 1BOYA 4LVHC 5JDSB 4PJ9A 4KV5E 2I24N 4I48B 2ADGB 5IK3A 1A6AB 2ED7A 3PL6D 1Y6MR 4XP4L 3V4VL 4JVUA 5EUOB 5H2BA 2SEBB 2ARJA 4HWEL 3QQNA 1ITCA 2B5IC 1RULH 4DN4L 3WDIA 2A9ML 2Y7QA 2CLRB 3AS1A 1X5YA 3QEQE 4PLJC 4R4FH 5DLMH 4LKXA 1RZKH 3I3BA 1TJGL 1EVTC 5HY9A 1CLYH 4XZUA 5E1AB 5L2KD 1LDPL 5C3TA 4ELMB 1U8OB 3TCXA 4XWGH 3VXSD 3WFHA 1MH5A 2AKRB 4HWZA 3ALXA 4K3JH 1NMCC 1S5IH 2BNQE 1SY6A 1OAYL 2X4SA 3QCTL 1CLOL 4M4PA 4WVRA 4YH6A 3BQUA 3ROOA 2J8HA 2DYPD 3WFEH 1S9WB 2AXFA 4F37K 4C4KT 4JEGB 2OL3H 2BVPA 2OTUA 3K2MC 5DJDB 1G1CA 1ZHLB 3VG0H 3D2UD 3WNNA 2VLJE 4Y8AA 5CBEB 5DMYA 5J9PA 2C3VB 1BOGA 4QHMB 3CFIC 3TVMB 5C09B 5BS0A 3M8OL 2IEPA 2LU7A 3BP5A 3TFKC 4JY6B 3TNNA 9CGTA 3O81A 1HILA 4POZC 4HKJB 4ZAKD 4EJ1C 2NZ9C 2PYED 4QOKB 3TYGH 5GS2H 1PD6A 3O3UN 3RUGA 3DWTA 4FFZH 2VKXA 5IVXE 4WO4C 1P4IH 3VXOB 1GGCL 2ZPKL 4WGWB 4Z7UB 1KTLB 3VDAA 4UT7L 3V4PL 1B6DA 1RZ7H 2QSQA 2UZXB 3B4NA 4Y88A 1HQRB 2Q86A 4NN6B 4JO1L 3SJVA 4I0KA 1HHJA 3V0VB 3BH8B 5ANME 3P11H 4RDQG 2BJML 3UTSD 2EE9A 1RV6X 3T1WA 3C60B 4AY0A 4JG0H 4WHCA 5HPMB 1DLFL 3UZQA 5CWSB 2VLLA 4X5WA 4F9LA 1IEAA 1A7PL 4XCEA 3O2DL 4XPTL 1F02I 3FO1A 3PP3H 4GQ9L 4XWOC 3RPIA 2AXJA 4ZFZA 1F45A 1T6VN 2VLKE 1DVFB 5FA4A 1OSZB 3QIBB 4KUZL 3AGVA 3WE6A 4YXLL 5L6YH 1CFNA 1MPAH 5EFIB 1CBVH 2PTUA 3DMMB 5K9OB 4CRPA 4ZUSA 1BD2B 1VCAA 1R24B 2XTJB 5ICZA 3WFDH 3QQ4B 4WV1C 5J7CC 1EIBA 1JGUL 3IYLW 1ZHNA 1L7TH 1GGBL 1MCHA 3T0AA 2Q76A 2FIRT 5D1XD 1CXFA 5IKCB 3FFCA 1LE9B 4OLYL 1I7UB 3P40A 2PO6C 1OF2B 1IGCL 5FM5M 5C70A 2AXHA 5BVPL 4X9HA 4P2RD 1RJZA 1KJ3H 5GSRB 1ZT1B 1XF1A 2X9WA 4PJCE 3ZYZA 1KCVH 3Q3GA 1N7ML 4MDIB 2FO4B 4OZFH 4PLKC 5LBSL 3LN4A 4OLZH 1Z5LA 3ZDXF 3QWQB 2WQRA 5FB8A 3HB3C 3FMGL 3SQBA 5HYEA 1C5BL 4Y1AD 4WFFD 1WFNA 3WXWH 2KDGA 3JWOC 4WW2A 4MWFB 2W9DL 4CVXB 1FG2B 2VXQL 2HFGL 1QRKA 2R69H 4PR5A 2BC4B 3G6JF 3HUJA 4QHLA 5HDBF 4OI7A 2DQHL 5E9DD 3OAUH 1Z9OA 4G6MH 2X1PA 3GUTB 4OI9A 2XRAH 2GY7B 4K7PH 3U46B 2NY6D 4E41A 2J6EA 2D31A 5EN2B 3V6ZB 2AJUH 3DROB 4O2FB 5JW4M 4X6BA 1F4YL 4GKOA 5DEFA 1I8IB 5TE6H 4GOSA 2WBJC 2MOVA 3I6GB 2OM5A 3RP1A 1KB9J 3EUUA 4LU5L 4MCZB 3T77A 3C8KB 3ULSA 1J8HE 5C6TH 4P2OA 4UT6L 5HYJD 4WEUD 1BX2A 1N59A 5IHUL 1JV5B 4JZJA 3U4EA 2X4OA 5C0FA 4PY7A 3RRQA 4RGOH 5EU6E 3S5LG 4YDVB 1ZE3C 1EO5A 1IGMH 3HMXA 4YDLC 3VXRB 1D9KA 1I9RH 1EERB 4PG9A 1RUAL 5AAMA 1MFCL 4PRBB 4A6YH 1TZGL 1X44A 1IM9B 3NPSB 3SDYH 4L4VA 1OSPL 5CMAA 2YPLB 3V8CA 3DVIA 2P8LA 1R3HA 4KC3B 3VFMA 5IMLB 5I9QC 3BKJH 3LEXA 2EEAA 1F6AB 2QKIB 1T7XA 3L1OL 4LOUC 3GK8L 1H0DA 1QFWL 2H1PH 5I19L 4XNUL 2WQ8A 3R0MA 2OJZH 1PZ5A 2C3XA 5D2NE 4Y4KD 3GSVB 1WAAA 5I1GH 2BNRB 4U1JB 1JPSH 3SDXF 4BKLA 3E3QC 3CXDL 2VYRE 6CGTA 2IBZY 4OKDA 1YYLH 4NDMB 5TQ2H 3CFBA 1TNNA 3MRHB 4WCYH 3CC5A 1YYML 4PRIE 1CFBA 4YHLH 4E0RB 3D48R 4WU7A 2HLFC 1BVKB 3GSXB 4MD5B 4LLMB 2CK0H 4RIRA 4O00A 1GL4B 2RIKA 3O2VL 1P4LA 1RSFA 1S7SA 4QT5A 3DETC 1XZ0A 2RHEA 2W59A 5DF0A 3C5JB 3QI9A 3NGBB 3PL6C 2EC9T 5ICXA 5IGXH 3G04A 3DV6B 3HAEA 4I4WA 3FB5B 5DUPH 1AQKH 2VQ1B 2UUDH 5B39B 5GGTL 1PG7W 5KTEH 1RAMA 3HZKB 5KN5A 4KROC 4YHYB 1BWWA 5DURD 3H42L 1S7WA 3CLFH 3VFWB 4JDVB 2AK4E 1JPFA 2H32B 1A7OL 1DE4B 1T7YA 3ILQD 3LY6A 1P84K 4U1GB 4W6XB 3FHAA 2Y06L 4TSBH 2ADJB 1FORL 2AABH 3I75B 4CADA 4RZCA 2FB4H 2DLFL 3VXPA 3K81A 2AJXL 1I1YB 4QNPF 2X4RB 4NC0B 4GXUM 3SEPA 4Z0XB 1KPRB 3ARBB 4DGYH 5HHXL 2EYRB 5TF1H 1EJOL 2VSDA 3P77A 1PSKH 4PREA 3ZTJH 3RY4A 2D7NA 4PUBL 4G6KL 5D70H 4PIRF 3QG7L 4WW1A 5EU3B 3OKNB 3X11B 4OV5B 2VISA 5DQDL 4GKSB 4PLNC 5E8OB 5EOQH 2HP4A 2EDEA 3RGVB 4OZFB 4LDEB 1FFNA 1T5XA 2R1WA 5CP3H 3M1BA 3O3EB 4X6CE 4N8VA 4MX7B 4ONOA 1HHIA 4RAVB 5C0AD 3L3HB 1JP5A 1KGCD 3OR7A 4DKEH 5BV7L 4OFKA 4ODSL 4S2SB 3QHFH 1QA9A 1I3GH 2M8XA 1T21A 3MLXH 3U7YL 3DYPA 1Q0XH 5DQ9A 1IGFL 4EI5A 2XZCL 4BYHA 5BZDA 2LTQC 1KUMA 1QYGH 5F7YC 2EE3A 2FHFA 4K3GA 3RWFB 1GCFA 3EYUL 1MFDH 4IRSD 4LEOA 4HBCL 1TFHA 4JM2C 3TZVB 2VAAA 1P2CB 1T04A 2L7JA 3RTQB 3T3MF 2Y5EA 5JOPE 3GBML 4NQSA 1AXIB 2NZIA 1XF3B 1PEZA 2V17H 4GAJL 4P9ML 4U0QB 1I4FB 3GSUA 1OTTD 3DXAB 1UM5L 3NZHL 4GKZA 1FH5L 1HWHB 4HDIA 4DQOL 4HUVB 1QEWB 2O5ZL 5GZND 4NT6B 1A7BA 1D6EA 2B4CC 1X5IA 5IESL 4A6YB 3V0AC 4ODXA 5FYLE 1JHKH 1YPZA 5HGAA 2IGFL 1KJ2A 5JW3H 5D1XC 1JMXA 4HUXA 4FFVD 3QHZL 4HF5H 5C0EB 1VFAB 1MVUB 1Q9KA 1YNKL 2GJ6E 3C2AH 5E6IA 3TO4A 3QWRD 3UJTH 3WS3A 3HC3L 1GAFH 4PJIA 1CK0L 4PGBB 4WFGE 3WLBB 1MLBA 2NPLX 5ELIA 3CLEH 4YPGB 1MRFH 1JPST 3QDMB 4Q74A 3UBXG 2A6KB 2JCCB 1PAMA 3A6CH 1MI5D 4JFZH 1MY7A 1X7QB 3FB6A 3FCTB 3S36L 1G7JA 2YMXH 4WTZG 1SEQL 2NY5C 1S7XA 3MRIA 2BSRA 1C7TA 1J7VR 1SQ2N 3WUWB 1RUQH 1M05B 4QRRE 3G08A 3BE1H 3UCRA 3UBXI 5EO9B 3DO7A 2WM0A 2DL2A 4TN9A 1L9NA 1RUKH 3LHPL 4XC1H 3GSQB 2R23A 2DN7A 3MLZL 4N0UE 2DQEH 4AH2A 2EDNA 5IJVB 5L9DH 2RCSL 1PEWA 4LARL 3IDYC 1U36A 3U30C 4UDUB 1W8OA 3PDOA 5FK9A 5EORL 5EU5A 3IU4H 5SWZB 1EGJH 3B9KA 4Y4HA 1RZ7L 2Q1EA 2A2QT 2UV3A 4MNQB 4FQ2L 4OAWA 1AY1H 3K2UH 2AAVA 4BSWB 5DZOA 1MHPL 3C8HA 3O11B 3UTPE 1HYSD 4ZYKB 3LB6D 2HT4D 5L0QB 4UAOB 4G8GD 3BZEB 5L7XL 1JN6B 2DQCH 3EO0B 1GRWA 4DCQB 1ZLSH 1FZOA 3ZKSD 5A16A 5I76B 2O5XH 5DHYA 2P5EA 3SDAD 2VXTL 3TVMD 1KLGA 1BEYH 2HT2D 3DNKA 4M7ZB 4DTGH 2B4CH 4YXKL 1TITA 1W0WA 3Q48A 1J12A 4TVPE 4ZOEA 4ERSH 3IS1X 1DLHB 5IHBA 5J4MA 4FHBD 3GHBH 4KK5D 5DO2D 3RVTD 1KJMA 2NXZB 2VZUA 3BX7C 1ZANH 3BPLC 4Q2ZB 3RL1B 2OR8A 4NQDE 1YY9D 4YLQT 2BMKB 1JWSB 2MPAH 1QFPA 4Y4KC 2VZVA 4P3CL 3QFDA 4N0FA 4PBXA 4YDKL 1CL7L 4I0PD 1BMGA 2HN7A 4ZS7L 1W8NA 4RFOL 1X5ZA 1H15B 3UDWA 1W2KT 3PWUA 5FYKL 3MOBH 4HSQA 2NY5H 1KEMH 4G6AD 4MJIE 4YK4B 3STLB 4CN1A 1X4YA 4OCXL 1LD9A 2E9WA 1JNHA 1JK8B 2NMSA 2NY4D 2YA2A 4LP5A 1IGIL 1S9XA 3TA3D 4HS6A 1NCWH 1C1EL 1BVLB 3PWPE 4HJ0C 4NO2A 2A83B 4S1SL 1S8DA 5EO1B 5J13C 2Q20A 4H25A 2BOCA 4P9HL 2ZCLL 3X12A 4M6MH 3I2CL 4V1DD 4C83B 1MREH 5B38G 4XPAH 1G7PA 5J6GB 1QSFD 2B1HL 4KROB 1AO7D 1KIPB 2FBOJ 3DV4A 2E27L 4WI6A 4Y19D 3ILQC 3WIIL 1FAIL 2K3TA 4XXCA 2QSCL 2WWMD 1YDPA 2VE6B 3JTTA 3FO0L 5IV2B 1ACZA 1BBJA 1KIRA 1OP9A 4XVTH 5IP4A 1NFDB 1QBMH 4OM0H 1A6TB 4U33A 2QQLH 5T3ZE 1YNLL 3QG6B 4PJ5D 5CP7B 5GGSB 5GJSH 5KSVB 2APTA 1DFBL 4D9QD 1KBGL 1LVEA 3K74B 4HH9B 5DDHB 5E2WL 4GO6B 5AUMA 3EFDL 5HHVL 3LV3B 1HQ4B 5LKNA 3AU1B 5EBGA 2EDLA 1OW0A 5SV3A 1YY8B 3JBG7 3DX9B 1OVZA 4K8RL 1X5LA 4PJGB 1S7QA 5ID1A 2DBLH 3TH4T 2BSTB 4AENB 1ZS8A 3MLSL 3AM8C 2B1AL 3MRRA 5IW3A 1DQJB 3MODH 4YBLB 3O41B 1ZEAL 5A43C 3HNTL 4YQXL 3E8UH 2J8UE 4KK6D 3OKLA 4L1HA 1E27A 1M71A 4NZDA 3KLAB 4IRJA 5AG8A 4OCMC 2IAMA 4ZOAA 3TH3T 2JELL 5GSVB 4BZYA 2BY2A 3ZTNH 1UGNA 1TJHL 3RNKB 1AGDB 2BNQB 1NCDH 4IRSC 1DN2A 4KRNA 5FM5O 1A21A 1F8TL 5BCAA 4M1DH 1KN4L 1TVHB 4UINL 1H5BC 4N1CA 1E4XH 1J1OH 2YRPA 2ICWI 4TPRL 4F7MA 1WWAX 2C1OB 4NFCA 4QRSB 2VLJB 4ZXBA 3BKML 2R2BA 5CJ8A 1WBXB 3JZ7A 3RVXD 4OZGA 2P5WD 1IAKA 4R26L 7CGTA 1G7IA 1OTTC 1I9JH 3QNXB 2ZUXA 3DX7B 2ESVD 2YPLD 5FOJA 3SCMB 2KL6A 2APBA 5I75C 1QZ1A 1RJCA 1UCTA 3RWJB 4LK4A 2CLVB 4O2CB 1GZQB 3VFNA 4MCYA 4PRPE 2ID5A 4I2XE 3N1PC 4HZAA 1Q38A 5EDXA 4FFVC 5IVXB 3HCVB 1DBBH 2GYSA 3LKPB 1FPTL 3RZCA 3RBGA 3REWA 3MV8B 2E6JA 3SOBH 1MEXH 5IBLD 4IMKC 3KLHD 1BIHA 3T