1G9NH

Hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
229
structure length
229
Chain Sequence
QVQLLESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYRNNGFLKHWGQGTLVTVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structures of HIV-1 gp120 envelope glycoproteins from laboratory-adapted and primary isolates.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 47
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2000-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g9nH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g9nH01
1CZ8L 3MLWH 3KJ6H 4JFXA 3EJYD 5I8EB 1HSBB 2V7NA 3JV6A 3NFSH 5L6YL 4MQXC 3OHXB 3TC9A 2A77L 1BJ8A 1YYMH 4K7FA 3QFJD 3TF7C 1IEHA 3ZDYE 1LO3H 5DD3L 2MOVA 4M7JL 5ADPL 5KS9B 1C5BL 4NO3B 1FNSL 1U8LB 5GS3A 5J12C 3I9GL 4TVPD 3UTTE 3G6AA 1O7SA 5TGBA 1RZJL 4O00A 3Q5YA 4I9WE 4LSVH 5J13C 3RX8A 1I8KB 1GOFA 3MRKB 3PGCA 5GQBA 5CSGA 3N85H 1T5WB 5DJ0A 2Q7YB 1JI2A 2VLKD 4JJHA 5F9JB 4KJYA 5F1NA 1G7LB 3ZDXE 2OL3A 3TLRA 4ODSH 3RY4A 4J2XA 2ZUQB 2APWA 4HIJB 2R1WA 4G80A 1P53A 3HUJF 5MHSE 2XTJB 3WDIA 3QB7C 3GZKA 1V05A 1FAIH 5CWSA 4CJ0A 5GRWA 3SCMC 3QDJA 3WE6B 3DWTA 4OAWB 4WWKB 1SJHB 3PDOA 3N0PB 4I0PC 1NJ9B 2V7HA 2WWMD 3RU8H 1JWMA 5IB2B 1UJ3C 3ZKXB 5C0RL 3O3BA 2R2HA 2DLIA 3CMOH 3FB5B 3M17A 3WJJA 1HINL 2B1HH 2ARJA 1QRNA 3JXAA 1C08A 1IAIH 1UB6A 5MP6H 1IAOB 1K4CA 3BH8A 3C09B 4H1LB 4OBSA 2HVJA 2DKSA 1F4WH 4X6FB 4PJEE 2J8HA 2BNRB 5DJXB 1MREH 3ISWA 3NTCH 1RULH 3QH3A 4KRLB 1JGUL 2NR6C 4JFFE 4RZCA 3W11C 5IVNA 4IRSB 4GG6A 1A5FH 2BJMH 1HH9B 3HI6L 5AUMB 4AL8L 3ALWA 3PL6A 4S11A 2WBJA 3UZQA 4M02A 5FYKU 3UDWA 5B22A 3AY4A 4GH7B 4E5XA 3KYOB 2NY0D 3BPCB 1D5ZA 4YHLH 1S7QA 4NKOB 5DURD 3KG5A 4HKZB 3M8OH 1N6VA 5TE6H 2OTUA 2IALB 2J8OA 3IDMA 1ZVHA 2XWBA 3I84A 1L9NA 3EYFA 4F7CB 5BZWB 4JZOA 3MA7B 1ZLVK 3EJZC 4J23A 1DVFA 2H9GB 4Y89A 2ZCKH 1WTLA 1ZOXA 4BFBD 5DFVD 5IR1A 2W9EH 1EBPA 3UZEA 1EHXA 3V8CA 3D2UA 4MXQC 2MTPA 3EYUH 4HIIA 3DIFB 4XC3L 2JELH 5GSVA 2DQJL 4XPFL 4RFEA 1B3JA 4GKNB 3TJHD 4AZ8A 5DQ9A 5EO0B 5ESVB 4M93B 4PBXA 4XAWH 5I66B 4JHZA 2J7LA 3QO1A 5EN2A 2CXGA 3LCYA 4UAOB 4NSKB 5LJYH 3ULVH 4JPKH 1MQKH 4E42A 2P5EB 4YFDB 1RURL 4X9FA 1I3VA 4GW4A 4R26L 5EOTB 5EWIH 1GCFA 2AK4B 5GRJL 2YN3A 4R4ND 3CLFH 4FABL 2P24B 3CCHB 3U36B 4DN4L 1P7KA 1MAJA 1FFPA 5LGJB 1N2RB 4M6ML 2ZUQC 5F3HA 2A9NL 5C0CD 4WCYH 5D5MF 2XTJC 5E4EB 1A7QL 1K2DA 3GMPB 3HC3L 4XNMB 5D7JA 1M7IB 3MLZL 1UQSA 1GGCH 3TNNA 4OCRL 5DUBA 2WIIB 3HA0A 3ZE1F 4WWKC 4EDWH 1B0WA 2KKQA 1PZUB 2GAZB 5AWNL 3FFCD 1AQDB 5E2JA 3ZKXC 2W0LA 5C9JA 4LGRB 1OP5H 5IEKB 1UG9A 5JW4N 3SGDI 3QT2A 3HN3A 4HS6A 2EH7L 1PG7X 1PG7W 3NZHH 5I8KL 4HWEL 1GPOL 3K3QA 3C09C 4OIIL 3GSRB 1TTGA 2DQEL 3IB4A 3HG1A 4W81A 3BDYL 1VA9A 1NGWB 4XPHH 3P9MA 4MCYB 1WBYB 4OKVB 1CTNA 5D2LF 1BJMA 1FE8L 3LB6C 5FKAB 1EHNA 4WO4D 4ELMF 4IRSC 1G0XA 5DYOB 1P9MC 1UB5B 4KI1A 4W4OC 3MA9L 2EO1A 4DVBB 5IT2L 1U95A 1KN2L 4LP5A 2EIZA 1FRGL 3IAPA 2YA2A 1FC2D 3ILPA 4BZ1H 2IH3B 5F9AC 1G7PA 1RZKL 5AD0B 3O6FD 4DGYH 4PJ8B 3IDYB 1BD2D 1AQKL 1AHWA 1DFBH 2EE9A 1QSEA 3IXTA 1OAXL 2R2BB 1KT2A 4Z7VB 2VH5L 4XNQB 5I15H 2BX5A 3O9WA 3FFDA 3MODL 2F74B 1JTPA 5SX5K 5ICXB 5EB9A 4GBXA 1PY9A 5TE4H 1P5UA 4RNRB 1GC1H 2ZUWA 1HIMH 5I0ZA 3A6BL 1EFXA 4W70A 5HI3C 1FIGL 4PJAE 2BVTA 2R8SL 3C60A 4YXKH 2P5WD 3MRRA 5DZNA 4CNIB 2FJHB 1H8OA 4HK3N 4QXUL 3S36L 5FKPA 5HHOB 3CX2A 1ETZB 1F3DH 1RK0A 2HJLA 4JDZA 1MWAL 1DUYB 3P0VH 1U8QB 4FG6C 1UACL 4XHJD 3IFPA 3LKQB 1BREA 4JQIL 1E4XL 4TUOB 1GGIH 1T3FA 5E2WL 1CXEA 3SE4C 2V2TB 1A4KA 1MI5E 2YPLD 2A73A 4NO2A 5H35B 2ICWJ 4JQVC 4NN7C 2R29L 5C08A 1MCPH 3IF1A 5EA0L 4WFHD 1CGYA 2NY2D 5F7LB 3A67H 3EOAA 1TCMA 1NGXB 5E4EC 3UAJC 4PS4H 4Y8AA 2P46B 1J0IA 1Z0NA 2IPTL 5T3XL 3KPLB 4RRPG 1DBKL 2CDGB 4IDJL 4JJ5A 5LBSH 5GGTL 4X6CE 5ERWA 4TN9A 5I1DA 3SDAD 4UNUA 1G7MA 3K74B 4HMCA 4QRSB 5EOCJ 1LK3L 2J4WH 2X70A 2R23A 4LGSB 3TZVA 5JHDB 1VACB 3QUXD 4XBPB 1DLHA 3WIFB 2ADFH 2EO9A 1I4FB 5HPOA 4OD1L 3FQRB 4XX1G 4DN3H 4OCYL 1A0QH 1ZK9A 3LRSB 1NCUA 5ALCL 2VQTA 5IHUH 1CF8H 5F93C 2OK0H 1ADQH 2FSEA 4H8WL 4UTAH 2YOCA 1WITA 2HTKD 3QYCA 3TA3A 1H3PH 5D72L 2VLJE 1I3RA 4GQ9L 4JCLA 4RX4A 3N50A 1PYWA 3TT1L 5T1LD 1AC0A 3QDMD 5EBMA 3DROB 3LKNB 3TCLB 5CJQH 4HIHA 2HKFH 1P84J 3RIFK 3JBG7 4CMMA 1DQMH 3MJ8A 5HHMD 1OB1A 1OQOA 4KQ4L 2X4PA 3B2UC 1YJDH 4I77H 4QRUB 3TO4D 5I18H 5HDQL 1ITBB 4BSVB 2VWEE 1GAFL 2YMXL 1RUAL 3FO1A 4OZHF 2EYTB 4ZFFB 1HQRA 2IFFH 2QL1A 3CFJB 3IDYC 2RFXB 5D1QC 5BOPA 3WUZA 3ARED 1T2XA 4G8GE 3L5XL 4OLWH 4A6YH 2GJ6A 3KDMA 1HI6A 3WHXA 4PRHB 2IBBA 4N8VB 4RGNB 2ESVD 4P2QE 3MV8A 1L7TH 5I71B 5J4MA 1WBZA 3DMMA 1KPUB 3NN8B 3F12A 3HTLX 3B9KD 4OV5B 2FCBA 3E0GA 4JKMA 3N1QC 4QRQA 2MHAA 2LV4A 5IBUB 4PY7B 1NGPL 5FCUH 4TPRH 5I76B 5D1ZA 3DURB 2EEAA 1GOGA 1TJGL 1SM3H 2NY1B 4APQB 2CGRH 4R7NB 2P7TA 5IESH 1R0AL 4U0QB 2X4QB 3Q6FA 3QUMA 1E28A 3BIKB 3MRIB 5E5UB 1XEDA 2BCKA 3QHFL 1ACYH 4OTXL 2XFXA 3WIHL 3BKJH 3TH3T 1IAKA 1ZGLP 1G6RA 1LMKA 3B43A 4EUPH 3O6ML 1HEZB 3X3FL 4KY1H 2VITB 3QXAA 3MXWH 1JNHA 5IMKB 4JRXE 3ZDZE 2DM4A 2DLFH 3DHJA 1N5AB 1FDLH 4UT6L 5IKCB 5F6HJ 5ISZD 3MLRH 3W2DH 4JZNA 2AQ1A 3BAEL 4CN6A 2E7LC 4G5ZH 5K93A 1ZHLB 3HE7D 2H2PC 1J8HA 4HLZG 1SVZA 2BOBB 3KAAA 4XP1L 3ZT7A 3DVGA 1M7DA 3VCLA 3AROA 1I8MB 1KPRA 4IBLT 1ES0A 2CKBB 4FN0A 4ODUA 3SQOL 3I75A 4OZ4A 1CT8A 4MA3A 2NY7L 3QZWA 4K7PY 3VG0H 2G9HB 5DLMH 3C5SA 3UTSD 1A9EB 3QWOA 1JZ6A 1JGLH 3GO1L 3FRUB 3M1BA 4Z7OF 1V3MA 2KPNA 5LCVH 1NFDB 3VXRD 3KYMA 3LY6A 1F13A 2XV6B 1NBVL 1KIRA 4TNWK 4F9LA 4Y5YB 4G9DA 1IGJA 4P4RA 4OGXL 3P73A 3QFDB 5CEYB 4AENB 4OUOA 5GS0L 3PV7A 5ICZA 1I1RA 4PJGE 1U2HA 2LABA 3K46A 3MV9A 3MRHA 4TNWF 5IBLD 3P9WB 3S4SA 3QEQA 5E2VH 2JCCA 4JKWA 2RCSH 4WNQA 2CLZA 2QSCL 1CE6A 1IC5L 2YXMA 4RGNC 4HPOH 3VH8B 5I71C 1DL7L 5DUMH 1CFNB 4BFGA 4HQQH 4WENB 4ZOCA 2CO7B 5DD1H 5DJ6A 5EC2B 5KTEL 1JNLH 1P1ZB 3ULSA 3BHBB 2FEDC 1JFQL 4NO0D 1KENH 4UILH 3VXUB 4JFDA 3V5HB 3SGKA 4Q97A 1D3CA 2YEZA 4O2CA 1NANI 1IM9D 3U9PH 1LILA 4NQDB 1FFNB 4XGZA 1NGYB 4NQSB 1YEJH 2NY1C 5CBAB 1IC7L 4MAYC 1OSZA 4LAJH 4NWTH 4HWNA 5EULV 3TBYB 1K4DA 2EDFA 2BNQB 2CDFB 4FQ2L 2R2CA 5FYKH 3NAAL 4N1EA 5I1EL 3QIWD 3MNWA 2OS7A 3U2SB 5TQ2H 5DWUH 3ZKMC 4A6YB 1NUGA 3PNWA 5CEZE 1Q9OA 2FHCA 1NQBA 3MLYL 2ICEA 5D96C 4G8IB 2NZ9D 4LLVB 25C8H 4WIQA 2VDMH 3JWNC 5TE7H 4HJJH 1GC1C 1K6QL 4L3EB 1T1ZA 1YUHB 1OAQH 4BSWB 3O2WH 5L9DL 5IJVB 1EVUA 1GSMA 1MCWM 2Q7NA 2X2YA 4HH9B 1IFHL 4NPYB 3QUZC 3SGJA 4D8PB 4L3CA 3KLHD 3OF6A 3SJVA 2W65A 4A2MA 1I7TB 4XCCH 3WNOA 5EZIH 3MUGA 4JY5H 1N0LA 5GGVY 3HZMA 1XGPB 1C12B 1HH6A 4PRBB 3PIQB 4PRDA 5ID1A 1SBSL 2OQJA 3FB8B 4LRNH 3HE6B 3RVTD 4EUPB 3C2SA 3T2NL 4MJ2A 5KANI 2BVUA 4MQ7B 2V9RA 4N8CH 2GITB 1Q94B 4J6RH 5D7LE 4M3KB 1E0OB 1MFDL 3RWFA 5FHBH 4JO4H 4EZMA 1H3WM 4Y5YC 3FQNA 3GI9L 2FDBP 2F53B 2F54B 5DC4B 4NWUH 4J3WA 1WEJH 5E08L 5K33A 4F37F 5T5FH 5I2IA 3PWPA 2DB8A 4M5YL 1G1CA 3PQYA 3MRNB 2HFEB 1NBQA 4MNHB 1XGQA 5H37G 3WXVH 43CAA 4EI6A 4QHKJ 3C6SB 4AT6B 5ITBL 3G5ZA 4NUGL 3PWJB 2D0HA 3KPRB 3OKOB 4LOUC 5E94B 3S8WA 1ZT4B 4F8TA 3QJFB 3BGMB 2AJZB 1P4LA 1J5OL 3S5LG 5SX4H 3VFMA 4R6UA 2Z93A 5I16A 2O5XH 4K71B 1LNUB 4Y4KA 3EYOA 1KC5L 4PGCB 1MLBA 4YAQA 3IXAB 4Z7UB 4KHTL 2YD1A 2DDQL 3NCYP 5IVXF 4X6BB 3MZTA 1IILE 4XBGA 1CGWA 1VSCA 5JA8B 4HCRA 5D2LA 2ZCLH 5F9OH 3O3EB 4ZNEA 5IB5A 4AIXA 4PJFE 1KBGL 1JUFA 3REWB 1BVLA 3I6LD 2X1QA 3PABA 5GJTH 1QQDB 2A83B 1A6ZA 5C0AE 1P2CA 1UA6H 3L3DA 4LSUL 5HGAB 3SDXB 5I0DA 1BVKB 2A6IB 3ALPA 3QFJA 4WUUA 5T3XE 3CSGA 5I1IH 4XWOD 5LWYH 5T1MB 1QA9A 3JWOC 3VWKC 5TDNB 4R8WH 1Q0YL 3MACL 3DRTA 3BDXA 4Z7QE 3ARGD 3UJTH 5FUZH 4X4YB 2IF7A 1RFDL 1A14H 1E4KC 1EZVY 1S7RA 1ZLWH 2EC9T 2VXSH 2W1NA 3P4NB 1UXSA 2JIXA 2Y07H 2Z8WC 3QRGL 4H20L 1I7RA 4JLRB 3AC0A 1U3HC 4L8SC 4ZXBA 2KZ1B 4WU7B 5FO9B 4WHYH 4NT6B 4AYFA 1AKJA 3DTXA 1V7NL 4EOWH 3MMEB 3QI9D 1MAMH 4XBEH 1LO4L 1R3JB 1BOGB 3OL2A 4PREB 1OAKH 3EJJX 1RZKC 3N9GH 4LQ1A 5CGYD 1KJ2A 3MRBA 3VXMA 2OBGA 2W91A 3FONB 1QFUH 5DA0B 2OL3H 1FORL 3RUGB 3VGAB 1I7ZA 1HCFX 5GRYA 1FO0L 5HPMB 2UZIH 3MROB 4XCNA 1PKQE 3IJHB 2NTSP 3K2UH 3GSXA 2E9WA 1I3UA 1IGMH 4KXZI 3ZYJA 3SHSA 4JHAH 2CK0H 4CU7A 5EO9B 4U3CA 1PD6A 3L6FA 3PE9A 4Z7WF 1VFUA 2ILLA 4WY7H 1Z9OA 5HHPA 1FNEB 3X12A 2JJWA 5IK3A 4JFZH 4MJ6B 2YZ8A 3AS3A 5FO7A 5IFHH 1QR1B 3P40A 4GFTB 3V7AE 2JJTA 3O8XC 1R5VA 1YY8B 1E27B 1VGKA 4LCWA 1I3GH 4S1SL 3SOBL 5FM4A 1MVUA 4U1HA 4MA8L 3QNYA 4UQ3A 3WLWC 4HK3J 5EU3A 3D18B 1BOYA 3BKCL 1PVHA 4GRLB 2GJZA 3DETD 5DRNB 1G7HA 3SY0A 5EU7E 3LSOA 4G7YL 4HGMA 3VRIB 2WINB 1MHHB 5LAXA 7CGTA 5ACMA 1I85C 1MCNA 1R3LA 3ZE2F 5EUOA 2F8OA 5BZDB 5C71A 5SWZB 5E9DD 1XCTB 1NCDL 1AFVH 1MCFA 3MC0A 4UDUA 4K23H 3OXRB 4P3DA 3M07A 5JIKA 3MV7E 4V1DD 3HRZB 4NIKB 1FQ9C 1JMXA 4QGTA 3QUYB 4ODHH 1A1OB 3HI5L 2P42B 3V52H 4P9HL 1FN4A 4MCZB 2BY1A 4M03A 1X4XA 2A74B 2Q86B 3NACH 4G6MH 2PYEE 1D9KA 1ZANL 1ZEAH 4RQQA 2FEEI 4JN2B 4OZHA 4F58H 1YEKH 1NCCH 3TVMD 3SN6N 5ALBL 1EEYA 4KRMB 3T1FB 3MLTA 5KSBF 3GMRA 4YHML 3TBVA 4X99B 2AJSH 1FVEA 2AJUL 3CH1A 1NCAL 2Q8AL 4M8QA 3TCXA 1B0GA 4LF3A 1FCCA 5E5MB 3U83A 2VAAB 1QFWM 3I85A 3TBSB 1MIML 1NAKH 2H8PA 2R9HD 4HUUB 4WDIA 4EI5A 1QBAA 2IBZX 2GUOB 5FYJH 3VGAC 2H32H 4ZD3H 3SDDD 4JFXB 2J6EA 1VEPA 2V7NB 3FFCA 3JV6B 3REVA 4WRLA 3SBWC 4E9LA 2XXCB 3RY5A 4NCC1 3H9SA 4ONGH 1FGVH 4OT1H 4TQEH 4K7FB 4PJCF 1HZHH 5D7SH 4GAGH 2XRAH 2IPUG 5BVPH 3VXSA 3DUHA 2DL9A 4NRYA 1BFVL 5EU7C 3LEVL 3LD8C 4YO0A 3WFBH 4NKQB 1YC7A 5D2NA 2QEJA 5TGBB 5HGBA 3A6OA 4IRJA 4K2UH 2EXYD 2LFGA 4S1DD 4N0UA 1VKXB 3PGFH 2FJGA 1PFCA 5IQ9A 3PGCB 4Y1AE 2DTSA 1E4WL 3CSPA 3QPXH 4GRLC 5DJ0B 1OP3K 5JXAL 4KJYB 4F2MA 5F1NB 4OFYA 2ZCHL 2OL3B 3SEPA 4N90D 3NIDF 1U6AL 3RTQB 2EIDA 5IBTL 4LHUB 3QHZL 1PSKL 4G80B 2A1WH 3T0DA 5BV7L 5DD0L 1PAMA 1S9VB 1SEQH 5CWSB 3HLAA 1D5XA 3TIDA 1QSFE 3PDOB 5JZ7C 4JY6A 2V7HB 1JWMB 3ARRA 1UYWH 2R0ZH 2R2HB 3O3BB 4ZO6A 4D0CB 2B7DT 3RA7H 2EYSA 1NFIB 1OTUC 3M17B 1IKFL 3QUYC 1CLYL 1Q1JL 1QRNB 4HUVB 2F5BL 1C08B 2Q8BH 4TTDC 1UB6B 1KELL 1K4CB 3BH8B 5SWSD 2VXTH 4J1UB 2HVJB 3QDJE 1AGCA 3GKWL 1MCIA 1RU9H 4M4PA 2J8UE 1TPXB 3VMNA 1YMHA 5CZVH 4PV8A 2FECL 4DK3A 2O5YL 5F44A 4M7KL 4G42A 4GAJH 5TFSH 1MCWW 1JPSL 1GGTA 4PJIA 4WFFD 4RZCB 1NCTA 5TPWH 3MCLH 3SCMD 4HPYL 5TQ0L 3VFNB 3PL6B 1YEIL 4D9RE 1IGCH 5KOMC 1A3LL 4JO2H 1GXEA 4I0PD 2AAVA 4E5XB 1LDPL 2FBJH 4AIOA 2WW8A 5IOPB 1D5ZB 2ZUTA 1S7QB 3NH7L 3UPCA 4YUEH 3C5ZA 2OTUB 4R0LA 3IDMB 4KMTL 2NNAA 2XWBB 4C4KO 4PJXF 1EA9C 4PRIA 2OM5A 4GG6E 1NEZB 4HGKC 4JZOB 2DM3A 4MNQD 5DRXB 5T1DL 2HT3D 1DVFB 4KKAD 5IROA 2HVKB 5T5NF 5EFIA 1WZ1H 4GW1A 4KMQA 4OZIF 2VABA 3T04D 3WNNA 5IR1B 2NR6D 1LK2B 4HXBH 4PLJC 4L4TE 3D2UB 2A9MH 3AXLB 3BWUC 5I74B 5J56B 3OG6B 5C07D 5HD8C 3SGDH 5FDWA 5GSVB 4LPTA 4RFEB 1AO7B 4JDVA 5DQ9B 1MPAH 3IJSA 1RUPL 4GAYA 4QRTA 4C83A 1X5HA 3QO1B 5EN2B 4H25A 5B38G 5KZCD 4OCWL 2J2ZA 5IMMA 5T1LA 4LCUA 4JM4H 2AEQL 1MCOH 5CEXB 1LVEA 1RUKH 1RHHB 2B8OT 5BS0D 4E42B 5I1LA 1QEWA 2HKHH 3QCVH 4GW4B 1T6VN 4PY8I 2DQGH 1P7KB 1BEYL 3RRQA 2B4CL 5F88A 1X7QA 1KCVL 2WUCH 5CFHA 5E8PA 3TO4A 3IU4H 3L5HA 5D7JB 3O4LA 1UQSB 3TNNB 4UINL 4W6WB 1P69B 1NBYA 4LDOB 5L7XH 3RWDA 2OP4L 5KVDH 1JHTB 4DK6A 4N0RA 4NKDA 2DL2A 1RJLA 3WJJC 3FQXA 4BK4A 1YPZF 5CCKH 4HS6B 5B21A 3T4AA 5GRUH 2DI8A 2QTEA 1JGEA 5JPMA 4NQEA 5EORL 3HG1B 4D0DB 2JJSA 3BISA 5H8DA 3BZFA 5C0DA 4LFHD 1FNGA 2APFA 5E2UH 4NNPL 5KSAB 4NC2B 2XTJD 3OV6A 2B1AH 3VFRA 3WFEH 1IBGL 1Y6NR 4YHYB 5FHAL 1Z3GL 3NA9L 5TF1L 3D9AH 1D5IH 3PL6C 2WBJC 4WWKD 4B53A 3BP7A 4K3DH 2V5YA 3AY4C 1U95B 2EECA 2EC8A 2ENSA 2GTZA 3VRLF 4DTGL 3QUMH 1J88A 4DKFH 1QLEH 2VNCA 3QDHA 2JB6A 1UZ6E 3O81A 4ZO9A 2HWZL 2WZPD 2YUVA 4RISL 1G7PB 2Q87A 5ISZA 1ZT1A 4YDVA 1QSEB 2X89D 3IXTB 3HE7A 1IT9L 4G6AC 3QP3A 1A3RL 2FX8L 3AGVA 1B2WL 3O9WB 1VEOA 3FFDB 4XNXH 1JNNL 2VDPL 1KTLA 1DVFC 4GBXB 3V4PH 2BNRD 1A7OH 1FZMA 1AIFA 4U1SA 3SKUD 3ZKSD 1YC8A 3ZKNC 1NCBH 1EFXB 3OAZH 1WFOA 5BW7A 1UZ8A 2YS4A 2VUYA 2A6JA 3GRWH 5I74C 5HDBF 4IRSD 3C60B 4M6NL 4KQ3H 2GK0A 3CFKA 5INDA 1DN0A 1OAUL 3UTSA 4XT1C 1FL6A 1Q0XL 5FKPB 5C1MB 3TBWA 1RK0B 2HJLB 4JDZB 4HIEA 1U92B 1UM5H 4M62L 3M45A 2XKSA 4ORGA 1HHKA 3IFPB 4NJ9L 3GKZA 5E6IA 1T3FB 3DLQR 4WI4A 1L7IH 2BDNH 2VLMD 1KN4L 3HRPA 3PWNA 1A4KB 2FGWH 2A73B 4KRPB 4NO2B 4OZFG 4XP5H 1LO2L 2ARJQ 2IBGA 5C08B 1GYAA 4X4ME 4U0RB 3B3IA 3B8YA 2P8PA 1T0PB 2GYSA 1OWRM 4FNLH 5HI3D 3BN9C 2R1XA 2DIJA 5D7JC 4ENEC 2GHWB 4GT7A 5F7EL 3VDAA 4BQ9A 3LH2H 3BO8A 1TCRA 1EHAA 5ERWB 4TULH 1FPTL 5I1DB 1G7MB 4GKSA 4M1GH 2XN9A 1BX2A 5EU6E 2X70B 3SQBA 4YWGL 3FT4B 3T65A 3TZVB 4N9GA 2D9CA 2VAJA 1DLHB 2R0WL 4FFZL 4FG6D 2F8VA 1CZ8H 1NDGA 1AI1L 1YEFL 3FAXA 3V6ZA 1OM3L 2FSEB 4PJDA 2P5ED 5A3IC 5L6YH 4P46A 2DQTL 3DYPA 1PY4A 2AK4D 2VERN 3S37L 3TA3B 1A02N 4TRPH 1I3RB 2ATKA 1GIGH 3DSFL 2VO5A 5B3JE 2F8XC 4TVPL 5EBMB 2FB4H 4PG9A 1JPTH 5GGSY 4IDLA 5DD3H 3VMOA 3FRPA 1UVQA 4M7JH 4PTUA 1C5BH 1FNSH 4YHKL 4PFEA 2BSTA 4YHYC 4XMKL 3G9VA 5C09A 1F5WA 3QIWA 4P2CG 4CMMB 3MJ8B 4TSCL 2Z91A 1OB1B 4J3SA 1KPVA 4R9HA 3KPSE 2X4PB 3ARFA 4D3CL 2VDLL 2CR3A 1F6AA 2CPCA 5D7KD 3H42L 3VDCA 1BQLH 3ARSA 5I8CB 1JHKL 1HQRB 4PYHA 5ESQA 4QOKE 1AHWC 1KV3A 1MRCL 2WBKA 3CK0H 3CXHJ 3RDTA 3KDMB 4X5WA 5KAQF 4L9DA 4QNPE 1RD6A 2GCYB 1QTYT 3O9WC 1HILA 4JFYB 1FZKA 2R1YA 4GBXC 1IARB 1A8JH 2C3HA 1WBZB 2AGJL 2D7NA 3DMMB 4I0CC 3F12B 2EDXA 3V6BR 4ONFL 3VFVB 5HTSA 3MRGB 4QRQB 3ROLA 3C60C 4GXVL 3U82B 4XAKE 5DJDA 4DW2L 3B4NA 5D1ZB 4UB0H 2VLLA 4P2YA 1YMMB 2GJ6E 3KS0H 1HINH 5DUPL 2EDLA 2I9TA 3MV8E 4Q9QL 2P7TB 4KJWC 5GHWH 2XZQL 3Q6FB 2R0LH 3QUMB 3R0NA 5D7IE 2BCKB 5KS9F 2QJDA 3FTGA 5ANMA 4PJ8D 2XFXB 3F7PC 1HSAA 1G6RB 3MQIA 5AZEL 4KRPC 4DVRL 4MD5A 3ARYA 4RRPA 1X6NA 3QXAB 4U6HA 3C5JA 5KSBA 2DJUA 3LQZA 4QTIL 1JNHB 4Y16A 3JTSB 3GUTA 1BBDL 4K3JL 1S3KL 4F9PA 4P9HC 1ZGLM 2XWTA 1KB5A 4I5BA 5CP7B 4BYHA 4JZNB 2FO1A 1EDQA 4HFWA 1A6AA 3TYFA 4HS3B 3UTOA 5MEQA 2EEDA 2I5YL 2IH1A 3G5VA 4UT9H 4GMSL 4NQXA 4YHOL 1LQSR 1R3HA 3CNKA 3DVGB 1M7DB 5HHOD 2VZTA 3VCLB 3LKSA 2HFGL 2DQIL 3B9EA 1UH3A 4ODUB 1FLRH 3FMGH 4OZ4B 4XPBL 1EJOH 1CT8B 4PP1C 5CLWA 4MA3B 3QZWB 3ET9F 1MFBH 4YC2B 5H94A 5FFLA 2PTUA 1J8HE 3LDBB 3QWOB 4P2RA 1FFOA 3S3PA 1X5ZA 2PYFA 4LVHC 4G3YH 3TA3C 3M1BB 4NZRL 3QHTC 3BJLA 4XCFH 4FFVC 3ME0A 1NANH 5EIQA 1FG9C 4MXWH 2N4IA 5IFAH 2FX9L 3KYMB 2FECI 2X1XR 4XPFH 2H2SC 5JMOC 4P57B 5FECB 4NOBA 5DD5H 4ZMAT 3R8QA 1XGUA 2DBJA 1KIRB 4JREB 5M95B 2Z9TA 3EBAA 2V2WA 4G9DB 1FL5A 1IGJB 3U4EA 4P4RB 4C56B 4FXKA 1FVDB 1EGJL 5JO5A 3O4OB 5JHDD 1ODAA 5ICZB 2Y23A 4HCRH 3PWUA 4XTRC 4JN1L 1RURH 1VDGA 3R0MA 5GRJH 3MV9B 4K3EL 3MRHB 5ADOL 3QEQB 3TPKA 2JCCB 4DN4H 4M1CC 3STLA 1RUMH 4M6MH 4NZUL 3DGGA 4WNQB 2CLZB 1CE6B 2ZKHL 5DJYA 3EYSL 3HC3H 4OCRH 4N1CA 2CMRL 4GXUM 5DJ6B 2GSIA 1NKOA 4JFDB 5JDJA 5KW9L 2YEZB 5D1ZC 3HUJE 4O2CB 4CRPA 2HTLC 1BZ7A 3G08A 4XGZB 4UUJA 5HI4C 4YDJA 1XH3A 2EH7H 4HC1H 1OSZB 1RIUL 4HWEH 5BV7C 4O51A 1K4DB 4QO1A 1R5IA 3IYLW 3L1OL 5F8RC 2DQEH 4KZDL 4PGEA 2BVEA 2OZ4A 2APTA 3BDYH 4EEEA 3MNWB 3OG4B 3WS3B 4HUWB 5F72S 2ORBH 1UM4L 4K7PL 5GGUA 3MOQA 2RAMA 4PRHD 1FE8H 1X5YA 2A6DA 3PNWB 1Q9OB 2P44B 4RGND 1LO0H 3ZT5A 2ICEB 3EOTL 2VUOA 5HHVL 1ZGLA 2OMNA 5D9SB 1SYSA 4TUKH 4R97B 2E6PA 2KZWA 1YEHL 4CL7A 2QV2A 3G6JA 4UU9B 2XKUA 5C92A 4QHLA 1GGUA 4J7RA 3LIZL 2XKNA 4N1HB 4PJXA 2NY1D 5HDLA 4APQD 1M1SA 2ADIB 3SJVB 4PY8J 1AQKH 4KTDL 1LE5A 2W65B 5GZNC 4ZTPH 3V0WH 4L4VE 4ZS7L 2DMBA 4OLYL 2X7LB 4YX2L 3MUGB 3SDCA 4YC2C 1JPGA 2NXZB 5C0FA 1DBBL 1RVFL 2ZJSL 3LDBC 3V95A 3VWJA 1RZIB 3N06B 3ZKMD 4EBQL 4PRDB 5ID1B 5C2BL 2QADB 3GBMH 1S7TA 3DV4A 1F4HA 3NA4A 4FA8A 5F1OB 5I1GH 1BF8A 3MLVL 1O0VA 3NOIA 2NX5A 4HWUA 1SQ2N 3PJSA 5IP4A 4UDTA 3RWFB 2DQHL 4JREC 4NM4H 4F9LC 1MWAH 3BE1L 5CJOL 4QKXB 3ARUA 1NL0H 4V1DA 3X17A 2UZYB 4JQIH 1CQKA 3O4OC 3ARBA 5I2IB 2LAGB 3P0GB 1J1OL 3BSZL 3PQYB 2V9QA 5C9KA 1XGQB 3S3SA 1MF2L 1KTRL 5EA0H 3IGAB 5ILTL 1DLFH 1GHFH 2D03L 5E99H 4HBQA 2H3NA 4EN3A 3VDBA 4FQLL 4OCXH 4QXWA 5EUKA 4KVNH 3EDJA 3N1FC 1PGRB 5T3XH 2DS4A 2ADGA 3MLPA 1DBKH 5JQHC 5GGTH 4C57C 1P4LB 3IDGA 3ARDB 3PWPE 1DQLL 4Z7VF 3VA6A 3VFMB 4TOYL 3RI5F 2Z93B 5I16B 1LK3H 3LZFL 1XCQA 4Y4KB 3EYOB 3SGKC 4FQQA 5D5ME 1MLBB 4YAQB 2F5AL 1EAPA 2CRZA 4OCYH 1ZVYA 1F11A 2HN7A 4G7VL 3ZE1E 1RMFH 4AQ1B 3LS4H 4XBGB 3HNVH 3O2DA 4H8WH 4GRWB 2OXHA 3ARVA 2AERT 2LE9A 1CGSH 3D3VE 5HYJE 2EEBA 3ARZA 4UOW0 5IB5B 1FZOA 4WUKH 3NCFB 3O6LH 1JUFB 1BVLB 1WGOA 5GGVL 4PR5A 3PABB 3SDDA 1KOAA 4NN6B 4LOUD 3DX9A 3U0PA 2XNAA 3NABL 1P2CB 3L3DB 4MAUH 3UPAA 4OBRA 1SJEB 1JP5A 3W0WA 1WSST 4KXZH 4WUUB 3VXUD 4KQ4H 2J6EH 2UYLA 5D2LE 1DEDA 1QA9B 3OGCA 1BLNB 2F19H 2CR6A 3ARPA 3HNTL 3RNQA 2EDTA 1GAFH 3DRTB 4NQDD 4ELME 3K4ZA 4MSWB 4QRRA 3SGJC 1MCLA 2GK2A 2OJEA 4LLWA 5DQDL 2VDKH 4ZFOA 2BNQD 1HHIB 1S7RB 4OD3L 4UBDC 2JIXB 5DEFA 3BUTA 3QFJE 4NZTL 5E00A 2NXZC 4ZXBB 4JDTH 3VGHA 4Z78A 3QXUA 4ESKA 3P0YL 4KHXH 4ZYKA 1NMBH 1AKJB 4JVWA 3DTXB 3FO0L 4QEGA 1I1YB 4G9FA 3WSQL 4DFIA 4TVPE 5KJRH 3VXNA 1U42A 1KJ2B 4OFKA 2A2QT 3VXMB 4L3ED 1MUJA 4RA3A 2YUZA 1I7ZB 2AABH 1MCSA 4OM0L 1NSNH 1R0AH 4XCNB 1DBJH 5E8DL 2VLKE 1XF2A 3GSXB 1CGXA 4WW2A 1EMTH 1OP5K 3TBTB 1TJIL 3R06A 1JRHL 3UJJH 4TTGA 4MMZC 3F62A 1DZBA 1I8LA 5CMAB 4FQJL 4HZAA 4LKCA 3L6FB 4OQTA 3X3FH 4YR6A 5A2FA 1U93A 5HHPB 1OF2A 5GS1A 2X44D 43C9A 4HHAA 5IK3B 4GW5A 1YN7B 1S8DA 4MX7A 3ORJA 1FYHB 1CXKA 1N59A 2E27L 1NKRA 4UT6H 1N64L 1R5VB 4Y5VB 3HE6D 3BPOB 1VGKB 4LCWB 4XNUL 5FB8A 3UC0L 5EIIA 5L2KA 1MVUB 3HCVB 4U1HB 4GLRI 3QNYB 4XP1H 5EU3B 3IT8D 2HH0L 3GJFK 4OB5L 5GRVL 3H3PL 3H6JA 1WWBX 2EIBA 5FIEA 1WISA 1V3LA 2GJZB 4Y4KC 3VD9A 4X9HA 5C0BB 3SY0B 1PG7H 3LSOB 2F53D 2F54D 1MWAB 5LAXB 2XXMB 4Q9RL 4K3GA 2BY0A 4LARH 5EUOB 1TIUA 2YA1A 5I1CL 3KPOA 3HMXA 4UDUB 3C6LA 4JR9L 4P3DB 4J12A 1TXKA 5BOZG 1EPFA 3QWQB 4F80A 5DJ8A 4NCDA 2LTQC 3KPRD 2Y36H 3BXNA 3L3KA 2DYPB 2FX7L 3ROOA 1NBVH 5FK9A 1HYRC 5E95B 4HWBA 5MERA 2DKUA 5C07A 1I9IL 1YNKL 5GIRA 3PXHA 4DFHA 3TV3L 5GS0H 1D9KB 3DVFA 1D6EA 2R15A 2QSTA 4YBQC 2VC2L 3A0OA 2ZWLT 3SKMA 1G9ML 4LSRH 4NBZB 3D87B 5HYSG 1EEYB 3HNSL 3GMRB 4ISVA 5DTFA 3HKFA 4W6YB 3AFLA 1FVEB 4WEMB 3U30B 5BS0A 4QWWC 4ZXBC 2VXVL 4I2XE 4MXVF 1CFQB 4X6DA 4L8BA 2FR4B 1JF1A 4Y19A 1QBLH 3CVHA 4OZHE 3DX7A 4DKEL 5KTEH 3NCJL 1B0GB 35C8L 1JFQH 4LF3B 1T7VA 1OCWH 1U8OA 4EI5B 2H8PB 4WDIB 5EH1A 5C7XL 1DBAL 1EIBA 5C0ND 4JG0H 4NQCB 1IC7H 4M9PA 3RHWK 3PHQA 3VI3F 5C86A 2C4XA 4NYLA 1NFDF 4PJHB 2NYYD 1U8LA 3L9RA 2EC9U 1R5WA 4OZGB 4FQ2H 5KAQG 1QFHA 3NAAH 3H9SB 3GI8L 5C0CE 1R3KA 3GSOB 3VXSB 3E1F1 5FDYA 4NRYB 3OKYA 5FYKD 3HAEA 4YDIH 5GGRB 5F9JA 4YO0B 1UGNA 5D2NB 2JJTC 1IQWH 2UWEA 2AK1L 1P4IH 4EIGB 3BPOC 3FFCE 4IRJB 5HGBB 3S7GA 3WO4C 5JNYA 3BPLB 1ZHKB 4H0HB 4PP2A 1W8NA 4N0UB 3AUVA 5L9DH 4ODWB 2FJGB 5IQ9B 3BFOA 4KAQL 1OSPL 3RVWC 1IFHH 2ED8A 4F2MB 3P11H 4YEEA 4OAWA 1SJHA 4X7SH 4KZEH 2C4FT 1ONQA 2YPVL 4JZJA 5CJXA 1JTTA 3HLAB 2AQ2A 3ZHLA 1D5XB 3T0AA 4ZG1A 2X89A 1J9CT 4IOIB 4JY6B 4U1KB 1DUZB 3EOBB 4KH2A 4L1HA 4X6FA 2EYSB 3MLXL 4DQOH 2X42A 2M1KA 3CFEB 1YNLL 1SY6A 4LU5L 5IWLA 1KXQE 5DRWB 4GRLD 1KYOK 4Z7OE 2APVA 4D9LL 1AGCB 1D9KC 4Z8FH 1BBJA 1BD2E 1J1XH 1Z5LA 1B6UA 4ODVL 3V4VL 1YMHB 2AJVH 3U0WH 4PV8B 5CSBA 4G42B 2L4OA 3E8UL 4NKOA 4PJIB 5SWZD 3MBEA 3GMMA 3ECBA 3SGEH 1DJSA 1IAIM 4LLMB 3B8SA 3KPQA 3C08L 3U30C 2NY5L 5JZ7D 2P5WE 4IEFB 2DLTA 1CLCA 3ZMRA 4Y0GA 2MPAH 1J5OH 2H9GA 1D6VL 2DICA 1OTUD 4LSTL 2ITCA 3QUYD 4N68A 4PRAA 3C5ZB 5T3ZH 4R0LB 5CILL 2NNAB 1B0RA 4EI5C 2MJWA 4U2ZA 4PRIB 1KC5H 3HFMH 2DWDA 3U7WH 1QPPA 3FN0L 2XY2A 1AR2A 3PWLA 1MIEL 2DDQH 2YPLE 1ULVA 5EO0A 4P4KB 1I1CA 3MRPA 4FFWC 5EFIB 3T2PA 4GW1B 2ITDA 3DO7A 2VABB 4WFHE 4IIQA 4NGHH 2ICCA 4KPHL 5FDWB 2YD4A 1CG9A 4XMPL 1TTFA 4JDVB 5EBLA 4DZ8B 1CD0A 1QUNA 4GAYB 4C83B 2E7HA 3CMGA 5IVOA 3T8XA 5D2NC 2DTML 4IRJC 1NLBL 4G6KH 5IMMB 3QG6A 4EKXA 1AXIB 4LCIL 2FIKA 4XNMA 3MACH 1K9TA 2V5RA 5I1LB 1QEWB 3OZ9H 6FABL 5AYUL 5F88B 1J11A 4LLDA 1AQDA 3L7FA 3JTTA 4X0KA 4H26A 5E8PB 4PJ7A 2F15A 4KWUA 3QRGH 4RAVA 3O4LB 1T5XA 3QDME 4E41A 4OGYL 2R0KL 2RGSA 5HD8D 1NBYB 1CD1A 4Z7UF 3RWDB 3NZ8A 1N7ML 1XGRA 2VXQL 1II4E 5HHME 2PTTB 1H8SA 2YD9A 4NKDB 3DYOA 4XPAH 1RJLB 2MCPH 3ETBF 4NCC2 3MOBH 3EO1B 5K9JL 5BRZB 2W38A 4I3SH 2D0GA 3T4AB 3R1GL 3QRFM 3K81A 2XZAL 5JPMB 4WHDA 1G7IA 4NQEB 5ACZA 4FQIL 1TLKA 4F7PB 4S2SB 4QXGL 5DXWA 4TSBH 3BZFB 2FLRT 5C0DB 3SDXF 2VSCA 1UH4A 3RTQD 1FNGB 1HOCB 4LKXA 4HULB 5KVEL 4LHUD 1WQVT 2ESVE 5L8KB 3T77A 2L7JA 2XI9A 4JG1H 1NDMA 2IH3A 2HLFD 3GMLB 4LVNB 4PJ9B 3V6OA 2XACC 1I9RL 1RI8A 4HS8H 1MHPL 3BP7B 3ULUH 2R2BA 3W9DA 1UCBL 1UWEL 3SOBH 2NZIA 3K1KC 5DDHB 1ZHNA 4JGJA 4K3HA 4MA8H 4MNGA 2JB6B 4EXPX 1CFVH 5D1XB 2NY2C 1QRND 3QXWA 3C5ZC 3F7YA 1CQYA 2X9XA 4R0LC 5CSZB 1KG0A 1ZT1B 4YDVB 4K94H 5D70L 4G7YH 3NMEA 2FIRT 5IW3A 2CD0A 1QSVA 4OF8A 1KTLB 2V5SA 5KVMC 3T3PF 1JI1A 1AIFB 1FZMB 4O4YL 4ALAL 4R90H 3RX5A 3OKLA 4OLEA 4DEPB 4I3RH 1UZ8B 3RUGF 1U8QA 2A6JB 4I13B 3TM6A 3MPCA 1CN4A 3W39A 1YYLL 5ISZE 4XP9L 3WFCL 2GK0B 1R3IL 3CFKB 3PL6D 4Z7NF 5INDB 3G6DL 1DN0B 1FL6B 2X40A 5IVXE 2HTKC 3TBWB 5IFJA 4HIEB 3X3GL 4NZDA 3RJDA 1OARL 3V6FB 4ORGB 4LRIA 1HHKB 1NGXA 5E6IB 4OM1H 3GSVA 3PWNB 4G6AD 4GOSA 2ID5A 3UTSE 3B3IB 1DVFD 5DR5L 4QRSA 1WJ3A 2P8PB 3E6FA 3HMWL 3ZKND 4YHMH 3TO4C 3T0EB 3D2UD 4X9BA 3MFGB 3VXRE 1QBBA 2AXHA 3BO8B 1TCRB 1NCAH 2Q8AH 3TGXA 1FFQA 4XMLL 1T1WA 1URLA 1AO7D 2XN9B 3DECA 1H3UA 4G8FB 1KLFA 5GRXG 1UT9A 5C0EA 4DUWA 1KF9B 4TSAL 3T65B 1TZGL 5M94B 4N9GB 3TIEA 3KLAA 1IGFL 4LASH 5F1IA 4PBWD 4KGLA 3K80A 1BGXH 2I27N 4MJIA 4RGOH 3NFPA 1CD9B 1YEGH 3MOAL 3V6ZB 4PJDB 1MFCH 2FHBA 5IB3B 1PQZA 3J7HA 4P46B 3LS5H 5JIHA 3RL1A 2JJSC 5FYJD 2ATKB 3Q48A 4PRPA 4HZLA 1INDL 1YQVH 5HVWA 4PG9B 3BN9D 4RWHA 1BIIA 1X6LA 5D7JD 1UVQB 2BSTB 4LVNC 4WHTA 3U7YL 5DO2C 5DRZA 5C09B 5J7CC 3CFJA 4L29A 2Z91B 3GSNL 4EQ2A 2BFVL 4YQXH 1IKNA 1KPVB 3ARFB 4PRHA 3FKUS 5DT1H 1WAAA 4BFIA 2Y06L 1RZ8A 4Z7WE 2HP4A 3HPLB 4GJTB 1UKTA 3I3BA 5JORB 3NN8A 5CD5C 5EC1A 1U8HA 5JXAH 1C8PA 4HLZH 5ESQB 4HAFA 2ZCHH 4IJ3C 4RCAA 3HE7C 3RDTB 1TETL 1BHGA 5A3ID 2WP3O 3FT2A 1HILB 4FTVA 4G6JL 3HG1D 2R1YB 3DURA 3GJFA 5DD0H 3MR9A 4APQA 3V8OA 5F71A 1F3JA 5KSAD 5AG8A 4DEPC 3V9FA 1ZLWK 3ROLB 2WIMA 1W0WA 5DJDB 4FQCH 4DGVH 4WI6A 2BRQA 3ZE2E 1CLYH 1Q1JH 1FJ1A 3BEVA 4DKAA 2I9TB 1KELH 2Q3ZA 5IMKA 1N4XH 3RAJL 3WFDL 3VMPA 4H5SA 2XA3A 3EYQC 1N5AA 3GKWH 2HLAA 5E6IC 5ANMB 4PG2C 1FYTA 1HSAB 5IBUG 1QSED 1ZHLA 1A4JA 2O5YH 4M7KH 3O9WD 5BO1L 2ED9A 4U6HB 1JPSH 3L5JA 4DOHB 4ONOA 3LQZB 4GBXD 4Y16B 3U7AA 2X4SA 3CVIL 3GUTB 3NIGF 1TZHA 2XWTB 1EFXD 1KB5B 4HPYH 5TQ0H 1QD0A 4I5BB 1YEIH 4KK6C 4HFWB 3AS2A 1A6AB 3KYAA 3LQAC 3TYFB 3C60D 3HMXL 3D5OF 2IH1B 4KVCH 5MEQB 3MGTA 4AQOA 4NQXB 5FEBA 1TVHA 3IETA 3NH7H 1VFAB 3LKSB 3TESA 5MENA 5KSBE 4KMTH 3C2AL 4KJWD 3WNLA 4OF7A 3SE9L 5JR1H 4PJ5B 3MBXH 4OLVL 3MFFA 1ZHBB 2BSRA 5H94B 1ZV5A 3I50L 4FQXA 4P2RB 1BFTA 1FFOB 4KRPD 4P46C 4LNRA 3DVNA 2PYFB 5C08D 2P8LA 5I19H 3QFDA 1A7BA 3K8LA 3LPFA 5C3TA 1PKOA 3CGTA 1B4JL 4PTTB 4XXDA 2FATL 4XC1L 1F58L 5EO1A 1S7VB 1XGUB 3QIWC 1WFTA 2V2WB 4AJ0A 1FL5B 3U4EB 1VFBA 4FXKB 4J8RA 2BXYA 3ZHKA 3ARFC 4PJCE 5CP3H 5JO5B 3O2DH 3TZVD 1ADQA 5F21B 5BQ7A 4LCYB 5I8OH 2KL6A 3PWUB 3F6LA 3LEYL 1LHZA 4Z0BH 3O0RL 1H5BA 1MSPA 4PP1D 3UP1A 1RJCA 1BEYH 2B4CH 3RDTC 5IF0A 2OTWA 3V5HA 2D7OA 3DGGB 3TA3D 4JHBA 4K8RH 5DJYB 2YN5A 1U8MA 4RX4D 2HAZA 3I6LE 1WT5A 4FFVD 4C58B 3MJGX 2UV3A 5CBAA 3KLHC 5DC9B 1YEEL 2G2RA 3OWEA 4JY4B 2GSIB 5I9QB 4LIQL 2G60H 3MNZA 1F8TL 2CDFA 3WFHA 3NIDE 5JHLL 2ZOKA 2DD8H 1L4IA 1QYGL 2W60B 1BZ7B 3C8KA 3U2SA 3G08B 5AZ2L 2WUBH 1CXIA 4YDJB 3FQTA 1XH3B 3AU1B 1MCKA 1J87A 3V2AR 3CD4A 4A6YA 3ULUC 1FHGA 5DD6A 4YHPA 3FT3B 2ZUSA 4O51B 1NC2B 4XP6L 4XTRD 1R5IB 4KUCD 1SMOA 2Q3AA 3BRDA 1VPOL 5A40E 2IADA 4M1CD 4DGIL 5GGUB 2GKIA 5CLTA 4K94C 2A6DB 4NNPH 1ZA3A 2AS5M 3WD5L 1BIHA 4Y16C 1JZ5A 3DMMD 1IBGH 1Z3GH 4F9PC 5TF1H 1ZGLB 1NCWL 4ZSOE 1SYSB 3AAZA 5H37H 3CC5A 1VADA 3CDGA 2YD8A 3G6JB 3CSBA 3VGEA 2XQYG 4GSDH 1S9XB 5L8LB 3O45B 4QHLB 5D1ZD 2HTLD 1YMMD 1NUDA 1NC4A 2XKNB 5HI4D 4HMEA 4G6FB 4OQTH 3HE6A 1LE5B 4RMRA 5KVFH 4QT5A 4XNZB 1IT9H 1A7PL 5EPMA 1A3RH 1B2WH 3SDCB 1JNNH 2VDPH 1CWVA 1JPGB 3MCKA 1XGYH 1Y6KR 5C0FB 3IFLH 2DQUL 2WQ8A 2EE6A 4YHZH 3VWJB 3MTRA 2AEPH 1FV1B 1U8IA 1S7TB 4CBPA 4PJXE 1IGIH 2F53A 3DV4B 4ZS6D 4M6NH 1IEAB 3EGSA 1MRDH 4PGZA 2CUHA 2NX5B 5T33L 1OGAA 2AXJA 3FL7A 1Q0XH 1AH1A 3PJSB 4UDTB 1OD7A 3KYNB 2VE6B 3H2WA 4ZFGH 4OZIE 3UTZA 4QRPA 2Y5EA 3RVVD 4M62H 4LEXL 3CH8A 4P59L 1F2QA 3PXJA 3ARBB 5GS2H 1X4ZA 1J86A 5GZND 4FRWA 1UENA 3H9YA 2AJZA 3BP5A 4IOSD 4JB9L 5E9DE 1CDJA 4PRNA 1RZ7L 2W9LA 1Y18A 2H3NB 4EN3B 3TO2B 1E6OL 4V1DE 3MZGB 3D39B 4HWBH 4EIZC 3DX6A 1CU4H 1QFOA 5F7EH 5T1KB 2AJYL 2ERJB 3VD7A 2WANA 2ADGB 3IDGB 5I9QC 1FPTH 4YDLB 4E0RA 1XCQB 4FQQB 4WU5B 1RPQA 4XVSL 1IRAY 4GKZB 5C0GA 4C56D 2J5LB 1NAMH 1ZTXL 5GRZA 1CIUA 2BHUA 4ZUSA 3TT3H 2IEPA 4DWHA 3MLWL 1LWRA 3KJ6L 2G5BB 1MJJB 5E6ZA 5CGYC 3MV9D 3NFSL 3S37H 3QEQD 3CVHH 3MYJA 2DQCL 1YPZE 1YYML 5TDNA 4PR5B 3CLEL 1BFSA 5MEOA 1LP9B 1S7UB 2D2OA 5J11B 3DX9B 2QQQA 3U0PB 2XNAB 4YHKH 5DZOA 1QP1A 4XMKH 3IRZA 3DI3B 3W0WB 4TSCH 2W0FA 1JZ4A 3BD4A 4HDIA 2UYLB 4JFDD 4JO1H 3UYRL 5E8EA 3FO9A 4WV1C 4JLRA 3IDJA 4D3CH 2VDLH 4LSVL 3RNQB 3ZTNL 4QRRB 5FYLD 2OJEB 1JHKH 1RK1A 3KPPA 4LLWB 3MMEA 1MRCH 4ZFOB 4XNZC 1BOGA 1O7VA 2CH8A 1KTDB 4R96A 3VRLE 3TH4T 1JBJA 5DEFB 3SDCC 5EU4A 5E00B 1P5VA 2OR8A 4GLRH 4Z78B 3RUGA 3VWJC 1G1YA 4LEOA 5F7FA 5HPMA 1FAIL 1Y6MR 4RIRA 3T0BA 3IJHA 4G9FB 4NDMA 4WI3A 15C8H 1S7SA 3GBNH 5E56A 3TEUA 3VXNB 1FBIH 3EO9L 5EO9A 1NPUA 2ICWI 2IMMA 1AD9A 3THMH 2B1HL 3VGFA 1INEL 2XZQH 1OAZH 1TZIA 2FD6H 2P1YA 3STZA 5JW4R 4XCEA 5MP6L 1XF2B 4MJ6A 4WW2B 2PXYA 3CPLA 5HDBE 1U3ZA 3LOWA 2H1PL 3I3DA 1U2CA 5LGKA 5ESAA 3R06B 4YZFF 3ARBC 1YY8A 1YZZA 4N90E 2IANA 1F4WL 1E27A 2Z0BA 4S0SD 3SJVD 4P48A 3KJ4B 5AZEH 1JF6A 4LKCB 4EDXA 1RULL 3MJ9L 4UBDD 3FZUC 4YR6B 1U93B 1OF2B 5GS1B 2NXZD 4HHAB 4CJ1A 1BBDH 4GW5B 3SDYH 3V7AG 3B5TA 3QA3A 4EN3C 1SHMA 2QADD 4U1MA 1A5FL 3P4MA 5FB8B 2YC1B 1SY6H 4KUCF 2WINA 4NO5A 2ERJC 5EIIB 3MUZ1 5L2KB 2VQ1A 4JM2A 5SWZA 2A6KA 4YHLL 2HYMA 2HFGH 5SWSE 4OF5A 2DQIH 4ZODA 3OXRA 3JWDH 5TE6L 2XTLA 4YXHH 2YD7A 3HRZA 5JUEL 4RFOL 1CDIA 3AMLA 3EZJB 1JGVH 4M7LL 4OSUL 5HGDA 4P2OB 1YNTB 1KJMA 3PQYD 3C6LB 4WFFE 2MKWA 2R9HC 4I0KA 2A74A 2Q86A 2D7TL 3ARWA 1JK8A 2W9EL 4NZRH 4PGBB 3E6HA 1CL7L 3MX0A 4X7DC 5DJ8B 3SDDC 4JN2A 3H9HA 3EYUL 3BXNB 5J11C 1L9MA 2JELL 3ESVF 4UIMA 3ROOB 5DJCA 4Z6AT 5FK9B 5HSFA 3OAZK 3MJ7B 2DQDH 3WV0A 4XAWL 2C26A 3ARDD 1EXUA 2DLHA 2OSLB 4Y4KD 4LGPB 1BJ1J 1EEQA 4WGWB 4LCCB 1QBML 4JPKL 4MNQE 5MEPA 4KDVA 3P77B 3KR3H 1MQKL 4POYA 4K3EH 3SKMB 1NAMB 2OXGA 3EHBC 3CLFL 2PNDA 4M61B 2P8MA 1AXSA 1L6XA 3TBSA 5E8NB 5DTFB 4Y5XA 2ZKHH 5C07E 3BUYB 4WCYL 2ZG3A 3I6KB 1YY9C 4X6DB 4L8BB 1AGFA 1JF1B 4JFEB 4MGXA 4Y19B 5JOFA 2OTPA 3CVHB 1LE9B 3DX7B 3UJIL 5B39G 1HK6A 3CDCA 5IVZA 2ICWA 2ZNWA 2R2EA 4I18A 1U8OB 5KW9H 4WUUD 5E4IA 4Z18A 3QDGA 4UV7H 3PHQB 4YBQD 2OI9C 5BS0E 4JAMA 1I8IA 4NYLB 3L9RB 3NZHL 1R5WB 2Z31A 4W68A 4WW2C 3L1OH 5F6HI 3S36X 4M8VA 3MO1A 2YSSA 1J10A 1I8LC 3Q5OA 3KJ4C 3LKOA 1R3KB 4K7PH 1OGTA 1VKXA 3DXAA 2JIXD 3WXWH 2YRLA 5GS1C 5SWQB 3HAEB 3HI1A 4QWWD 4ZXBD 2VLRA 4HBCL 3AMKA 3TJEL 3EOTH 5HHVH 1AKJD 3NCBB 5A16A 4XP4L 4ZAKA 3SKJH 3MNVA 5KS9E 1UEMA 2UWEB 5JNYB 2EXWC 3RTQA 2JKXA 1GGYA 4LHUA 4PP2B 2JCCF 4HIXH 4LIQE 3VXMD 1S9VA 3LIZH 3CFCH 2PCPB 5E1AA 1WVZA 2WMPA 1ACZA 5HVHC 3VD3A 4KTDH 1IGYB 2VR9A 1DFBL 4D0CA 4ZS7H 1NFIA 3BQUA 1T04B 3LEXB 1ONQB 2G75A 4JZJB 2VKXA 4HUVA 1RVFH 2KQNA 2XTJE 5TE4L 4EBQH 1GC1L 4J1UA 5F3BA 4HUMB 2HT3C 4NJAH 1L0XA 4YXKL 3HHRB 4KKAC 4LCWD 4CDHA 3S88L 2APXA 3BE1H 5CJOH 4P49A 2CKBL 3RVWD 1CBVL 2BSSA 4FZEH 1BBJB 3VFNA 4P5MA 1Z5LB 3LAFA 5C0BD 3SO3B 1U91A 1GGIL 1J1OH 3QPQC 5CHNB 4JO3H 1X5GA 2IAMA 2VDOL 5IOPA 2O93L 2BNRE 2NW2B 4IMLA 4I8DA 1MF2H 5F89A 2YXFA 4M5ZH 3MBEB 3GMMB 3ECBB 2YD5A 4FQLH 5E03A 4UV4H 3A67L 3KPQB 2WBWB 1NEZA 2QQKH 1IC1A 1JVKA 2CXKA 4PS4L 1KCRH 5DRXA 1KCSH 2VZOA 5LBSL 4POZC 2ITCB 4TOYH 2HVKA 2DYPD 4PRAB 3GMNA 1IEBB 4OLZH 4UOW1 1LK2A 1T7XA 2W92A 1B0RB 4KFZC 4O58L 3AXLA 4K9EC 2DWDB 1D9KD 2ADFL 2VLME 4X7EC 3PWLB 4DN3L 2V17L 1AO7A 1JF5A 1FL3B 3MRPB 3UTTA 3DO7B 2ITDB 5IHUL 1CF8L 4AEHL 4IIQB 3SE8L 4M1DL 3ZSSA 4UTAL 1WZKA 5FCSH 2BVPA 1N5YL 1H3PL 3U1SH 3PGDA 1CG9B 5CEXA 4OGAC 5CIPH 5EBLB 3MLSH 1RHHA 1DSFH 4K07A 3K2MC 3JV4B 3KYKH 4UZGA 2HKFL 1TQCB 3T8XB 5CEZL 1OPGL 5AAWA 2H32A 3QG6B 3GMOA 1S7XA 4MHHI 5IQ7H 2FIKB 4DAGL 4EI5D 1I1AA 1YJDL 1OAYH 5I18L 3HZVA 4WEBH 1M4KA 4RDQG 1PZ5A 4NQCD 5D8JH 2HJFA 2EDKA 2AI0H 2P5EE 4LLDB 4XI5C 3L7FB 4FFWD 2AK4E 3JTTB 4X0KB 4H26B 4PJ7B 4OD3H 1JHTA 5CZKA 3T1WA 1KIPA 3H9SD 4RAVB 4JZJC 1VGEH 5CJXC 1T5XB 5H2BA 4E41B 1DANT 3P0YH 3VXSD 1BQSA 1CD1B 3FO0H 4JKKA 2Y5TB 1HHGA 1AJ7H 2XIDA 4P9MH 3NZ8B 1NMAH 3EFDH 3OPZH 1XGRB 2YK1H 3JWOL 4D0DA 2RHEA 4GRWF 3PDGA 4IRJD 2B2XH 2YHGA 3WDHA 5KSAA 1SM3L 5D7KE 2EZ0C 4OFPA 4QHKI 5IWLC 4OM0H 2CGRL 2NY3B 1A2YA 3GJFH 1G7IB 5IESL 5ACZB 1QACA 5J6HA 1RHFA 2C4FU 4OFYD 1E6JL 4MDIA 2EDQA 3SO3C 1ACYL 1WTGT 4KKBC 4LKXB 5BMFL 4FQJH 5F7DA 3T77B 1NDMB 1HXYA 4HJ0C 3MBEC 3MXWL 3O41A 2QSQA 4Y7MA 2O61A 4OZFH 2E27H 4X98A 2J1KA 3O6KH 3BP6B 4ZOEA 2DLFL 4NRXA 5A2IH 2AXGA 3W9DB 4XNUH 1CICB 3MLRL 5IGXL 3W2DL 1GOHA 4G5ZL 1ZHNB 4MNGB 4Z0XA 2ATPA 5HVFB 1K8IA 2IPKA 1T4KA 3DX8A 1TNMA 4P23A 3F7YB 1ZS8A 1MCEA 1KG0B 2JB5L 1U0QA 3KPNA 5F7YC 4Q9RH 3TFKD 1SEBA 1JPFA 4PBVC 4Z7VE 3U79A 4M93C 5I1CH 2CRYA 5JW4M 2AJ3A 3OKLB 5I1JL 1U92A 4IIQC 1NH6A 1QRKA 4JR9H 3W39B 1C5DA 4JKPH 4UAOC 4TUJA 3H9ZA 5FV2A 1MFAH 1KXTB 2BHZA 3PP4L 5IFJB 3H0TA 2Q76B 1G9NH 2B5IB 4DZBA 4LPWA 5JQ6L 5HHOE 4FHBD 4FQ1H 3C5ZD 1DBMH 1L0QA 3JV5A 4YHIB 3CFDA 4NFCA 4PRID 3GSVB 1K3IA 4YBLB 1P7HL 4RMTA 2VC2H 3WKNA 5DC0A 4LLUA 3WJLA 1AGDA 1JYXA 2CLRB 1ORSA 5GS0D 4P4KD 3E6FB 3FT4A 3NFNB 5FUCC 3TNMA 5E2VL 2YR3A 2QHRH 2GY5A 3RWHA 1MJ7H 2RCSL 3MGAA 4HQQL 2JE8A 1JN6B 3EAKA 1T1WB 5FGSA 3NCJH 5DD1L 5EUOF 3UTQA 5C0EB 1JNLL 4UILL 5CIPB 3Q1SH 3TIEB 3KLAB 5F1IB 2WWKT 5C7XH 1UM6L 2QQLL 2P45B 5JHDE 4POUB 1I7UA 3U9PL 3JV0A 3CX5J 4MJIB 5I17A 1YEJL 3NFPB 3HZYA 4YBHA 2VDQL 1U3YA 3L3JA 1PQZB 4NWTL 1WWAX 1NGZB 3RL1B 4KDWA 1IMHC 3EZ8A 4ODXB 1Y0LA 5CUSL 5FYKL 1S5IL 4PRPB 1UWXH 4HZLB 2IG2H 1MCRA 5B8CA 5JXED 4U7MA 4ZUVA 3FCTB 1X5XA 5TQ2L 5DWUL 1BIIB 4L4JA 3O4LD 1C5CH 4WHTB 4I48A 5I8CA 4LAQL 1N0XH 3D85B 5DRZB 3V6OC 4HV8A 4PJ8C 3RIFF 4L29B 1XIWB 1U8PA 3OGOE 2VDML 4HUKB 1BJ1H 1K5NA 5TE7L 3AVEA 4JFYA 2GCYA 1V3JA 4BFIB 2HRPL 4QHUA 1RZ8B 1FNLA 2V9TA 1OSPH 3O2WL 5BRZD 5EC1B 1U8HB 5FGCB 4ELKA 3VFVA 4XXCA 3MRGA 3B5HA 4OIAA 4MDJB 4NQED 1INQB 3FT2B 4FTVB 3GJFB 1YMMA 4XCCL 2DAVA 4J4PA 4PRHE 1B6DA 4JY5L 2ENYA 1IQDA 1WZMA 1RZFL 3MR9B 5INCA 3T08A 4RGNE 1F3JB 2YUWA 3V7MA 3BKML 1YECH 3BMVA 4G8EA 4ERSL 2E9JA 1W0WB 4PJHF 4PJ9D 5DO2D 5F7WC 3JVGA 2AJXL 3MUY1 4OZGF 1MI5A 2BERA 3MRDA 4N8CL 4J6RL 2GIYA 1FJ1B 3BEVB 4MS8C 1EK3A 2DI9A 2XA8L 5FYJU 4LU5H 5D1XD 5EDXA 1F4XH 3JTSA 3QCTL 4JO4L 1HKLH 2XWJA 4H5SB 3WEXA 4LRIC 5CD5D 3VI4F 4D9LH 2DKMA 1DDHA 2HLAB 4LQFH 5CP7A 4R4FL 2R56H 5FOBA 1FYTB 3QQ3B 4ODVH 5I1HL 4NWUL 4PJBB 1GRWA 1A4JB 1WEJL 3V4VH 5JDSB 1M6OA 4HS3A 4X6CA 3GRWA 2XQBH 2AEIT 5IHBA 3E8UH 4U6YA 3T0XA 2X4SB 3AM8A 1KULA 4PUBH 1TZHB 3N1GC 4LVOB 1CE1L 1PW3A 5F7UA 3V0VA 5JA9A 3MGTB 1D6VH 1TVHB 3IETB 2YKLH 3ULVC 2EH8H 4CVUA 1TQBB 1TENA 4RFNB 5MENB 1OY3B 3EYQD 4JPWH 4XVUC 4MXVE 1V7MH 4ZUWA 1A6TB 3MFFB 4MA7H 5E6ID 3WNKA 5E7BA 2BSRB 4P57A 5T3ZD 5FECA 4FQXB 3CXHK 3SKNA 4LNRB 3DVNB 2M26A 4O2EA 2P8LB 4C56A 1FVDA 5ID0A 2ZCLL 5F9OL 1KLGA 3QIBA 1JHLH 3T0ED 4Y4HA 1OTTC 2I9LA 5I1AA 4KK6D 1X5IA 4XXDB 3VI3E 3CZFA 5EO1B 2DRUA 5GJTL 3T0VA 1NFDE 3WIIL 4PD4K 3UTPD 4G8GA 3UXFA 3C8HA 1UA6L 3D6GA 1VFBB 1IKNC 1MNUL 4J8RB 2XN9D 4PJIF 3VRJB 4P2QA 5I1IL 5BQ7B 5LWYL 2JLLA 5IG7A 1H5BB 3LMJL 1N6UA 5AYUH 2BP3A 2YRZA 1M7XA 4GUPA 1F42A 4OJFL 5IF0B 3V4UL 5TH2A 2OTWB 3E3QC 4P46D 4B7LA 1UH2A 4RMWA 4J3VA 3U4BH 1U8MB 3RIAK 2Y07L 4APQC 5DK0A 2G2RB 5E70A 2C3XA 3MNZB 4M7ZB 4EOWL 4H88H 3WFHB 1N7MH 1MAML 2ZOKB 5C09D 4XBEL 5DJ2A 3S4SG 3TWCH 3U0TB 3WS3A 4HUWA 3VXUE 3N9GL 3C8KB 5K9JH 1T03L 3HS0A 3FQTB 3ARFD 1SJVA 1QKZL 5HY9A 5DD6B 4YHPB 2OL3L 3ARQA 4NQDE 1CR9H 5D71H 2DLGA 2XZAH 2UZIL 4MAYA 2R4SH 5GZOC 4FQIH 4U49A 2CIIA 4QYOB 5D9SA 5C6TH 1KJVB 1IGML 2BNQE 1NEUA 4MB4A 2IADB 4UU9A 3RDTD 4ZOAA 2CK0L 1RAMA 3W9EA 1ZA3B 1QO3A 3GSQA 3H3BC 1N8ZA 1HKFA 4LNVA 4WY7L 1A6WH 5LXGH 3AB0B 1GL4B 4LVOC 5FOJA 4JFHD 3PWVA 2ADIA 4JFZL 1CLZH 3AAZB 2MNUA 3CC5B 5IFHL 1VADB 3CDGB 1OW0A 1R24A 1KJ3L 1UCBH 1UWEH 4MJ5A 2X7LA 4JVUA 5GPRA 1T7WA 4L3EE 4JGUA 3WHE0 3HR5B 2F9BT 5HYFA 1NC4B 4UT7L 1RZIA 2BMKA 4WTXA 3GNMH 4RFNC 3GHBH 3ULUD 5EOQH 4JQXA 4QT5B 1G9NC 2IQ9H 4Q7DA 5EPMB 1UEYA 5HDOA 5DHVH 4PGJA 2HG5A 3MCKB 3DARA 4FQXC 4N0YH 4RMSA 3OXSB 2WNGA 1KEGH 3U46A 3QCUH 2VIRB 1U8IB 4CW1A 1HHHA 1AFVL 4Y16D 5J06A 2ZPKH 4K23L 3EGSB 4XP9H 1R3IH 4L8DA 3BRGC 3G6DH 3GSWA 2MMXA 1OGAB 5J1TC 3RWJB 1CGUA 3DPBA 4ODHL 4XPTH 2H26A 4MJ4A 4QRPB 3UTZB 3V52L 1MEXH 3IGAA 4O2FA 1OARH 3W82A 2R39A 1JZ3A 4JGMA 3NACL 1ITCA 4G6ML 2F53E 2F54E 1ZEAL 4NHCH 2VXUH 4PJ5D 2EDEA 1H5BC 3RBGA 2O26U 3BP5B 3ARDA 4F58L 4PRNB 5DR5H 1YEKL 1NCCL 4P2RD 4OIBA 2HMID 1Y18B 4OCNC 2WK2A 5GGQL 4WTZA 2NY4B 2OJZL 2AJSL 3DX6B 1WT5C 4D0BB 3ZO0A 3KPRE 1KXVC 1R6VA 4XMLH 1Z9MA 1YJDC 3D25A 3GIVA 4BA8A 4M7ZC 2CRMA 2SEBA 4E0RB 1N6QH 2D0FA 1F90H 1E4XI 2K7PA 4WTWA 5C0GB 3DVIA 4ZUUA 1YN6A 1FIEA 3BGFB 4JFQB 4ZUSB 5FYJL 4WJ5A 2PF6A 4Z7UE 3MOAH 4ZD3L 2VSDA 1SJEA 3FB6A 4BH7B 1LEIA 1KEMH 1X4YA 4HWZB 1LO5A 3MYJB 1INDH 1CGVA 1JPST 1BQUA 4ONGL 4TQEL 3GM8A 5MEOB 5D7SL 1BLNA 4GAGL 4MSWA 3TN0A 2WSKA 3AB0C 3NGBB 4FP8H 1KB9J 3GSNH 2W0FB 1HHIA 3FJTA 4HDIB 4HC1A 4Q6IB 3SDXE 4X5XA 3QAZB 5E8EB 4K2UL 1BMGA 3FO9B 5FUOH 3IDJB 5C3LD 3PGFL 5EOCH 4I4WB 1HE7A 1IZKA 3QPXL 2DIBA 1RK1B 3KPPB 1I1YA 3HE6C 1EEUA 1J05A 1NC2D 1TETH 2BVQB 4R96B 4GG8A 4KV5F 5GISL 5D7LA 4G6JH 3PHOB 5EU4B 3VFTA 2A1WL 4HUNB 4JRYB 1BZQK 4LEOB 4RSVA 1UCTA 1SEQL 2AEWA 3OTTA 4L8SA 3OAYH 3QNZB 2E8YA 4M48H 4Q0XH 4MVBC 4RIRB 5FYKE 1T0NB 1EHLL 4NDMB 1S7SB 5J3HC 3TBTA 1CGTA 4PJDF 1TNNA 3NPZB 5C2UB 1UYWL 2R0ZL 4DCQA 3MLUL 3RA7L 3T3PE 5CMAA 1W0YT 1AD9B 1A7RL 4N5UA 1KLUA 1TZIB 3RAJH 3RUGE 3STZB 4XCEB 4HG4J 1YN7A 2B0SH 3WFDH 2PXYB 3CPLB 1SJXA 5I6XB 2ADJA 2VXTL 5TJWK 3F6IA 4NOFA 5ESAB 3BJ91 4G6FD 4Y5VA 2IANB 1CVRA 4Z7NE 1MY5A 3RZCB 4PPTA 5SV4A 3HCVA 4P5TB 4EDXB 2ZUXA 1VCAA 5CZVL 3SDCD 3CU1A 1FH5H 3IFNH 1QSZA 3EFFA 1W72H 3CVIH 4XWGH 4K71C 5C8JA 1SMAA 3QIUA 3VWJD 5DHVB 1WIUA 5TPWL 3QA3B 4YXLL 4U1MB 5C0BA 2NY4C 3P4MB 4WWID 4LMQE 2E5EA 1MWAA 3O8XA 4NO5B 1JV5B 4JO2L 2VQ1B 1QFPA 4BKLA 3W5NA 4JM2B 2FBJL 4OQ1A 2NX5D 4S1RL 4LMQI 1J1PH 2A6KB 5HYIA 4YUEL 4Z76A 2HA1A 4PJFA 1XR8A 2X4NA 3BGFC 4XPGH 4LSDA 3ARBD 5HGDB 2DYPA 3I50H 5C0AA 1KJMB 3BP4A 3WCYA 1CDUA 3FZUD 2FJFA 4WEUD 1WZ1L 5SWZE 4NN5B 1JK8B 3KPMB 5C0NC 3ULUF 5IMLA 4HXBL 5GGTA 4Z95H 5IB4A 3GGWA 4F33A 2ZUUA 3E6HB 4LSQH 3U6RA 4EN3D 1B4JH 1F02I 3H9HB 3QJHA 2NYYC 3R8BB 3D39D 1F58H 4HEPG 4N0CC 4UIMB 5DJCB 3I2CH 5T1KD 3QNXA 4U3XA 1Q8MA 1ZXQA 2P49B 3NGBC 4LDLB 3QQ9C 1KFAH 3UROR 5ICYA 5A2LH 2MQ3A 1EXUB 1OTSD 1TITA 3QAZC 1IE5A 4PGDB 4PB9L 4JM4L 4YDKH 1V8HA 1JL8A 3LEYH 2YD6A 1CFQA 4NKIH 3UO1L 5MEPB 2FR4A 3KLSA 2HKHL 3QCVL 4B5EA 1T89A 2DQGL 5CZXC 2P8MB 4HKBA 2VL5A 1AXSB 4CN1A 4Y5XB 4N9OB 3IU4L 2I60L 4NQCA 1X5FA 4QXTA 2MQ0A 1AGFB 4YNYA 1GGBH 3MCG1 5JOFB 4H0IA 2OCFD 4PJHA 3O2VH 5IVZB 2ICWB 1F8TH 4K8RD 4OZGA 1DEEA 2R2EB 4I18B 5L7XL 5AYQA 1J0JA 4RBPH 1KCUL 4X4XA 3W0WD 3LKPB 3LN5B 3HC0A 3GSOA 5CBEA 4FFYL 3GSNB 3EIFA 4URTB 3QDGB 3RNKA 5CCKL 4PLNC 4JAMB 1I8IB 4U6VL 3RWCA 5GGRA 2Z31B 2PXYC 5DQJA 2BRRL 4QRRD 1H3XA 2Q1EA 3MO1B 1F3DJ 2YSSB 1NMCB 3EHBD 1BAFH 1ZHKA 3IRPX 3LKOB 3BKYH 4DGIH 2E8ZA 3GHEH 1OGTB 2GFBB 3DXAB 3MXVL 4ODWA 4AIZA 5E2UL 3WD5H 3HI1B 2VLRB 1YY9D 5A16B 4OLUH 2YBRB 4ZAKB 3WFEL 3MNVB 1QLRB 1NCWH 5J12B 4G9FD 5EZOL 3D9AL 4HUXB 4LLAA 5BCAA 5DI8A 4K3DL 4FQHA 4JM2C 5J13B 3Q6GL 3QUML 1S9WA 4KK8C 4HFUH 1QLEL 4DKFL 4AY0A 3WIHA 5E1AB 3NIGE 2YD3A 1RUQL 3MV7A 4IOIA 1G6RL 4KMLB 4P3CH 1DUZA 4U1KA 3BT2H 3EOBA 4RGMB 1A7PH 8CGTA 5HXMA 3DJ9A 3KXFB 4LHJB 2X4UA 3BQUB 1DQDL 2G75B 4XNXL 4NP4L 4AH2A 3V4PL 1NGQL 3CFEA 3PG2A 3QISA 4HXAL 4NN5C 5DRWA 5F3BB 4F57L 3HC4H 4EJ1C 2O5ZH 1T1YB 2LU4A 1W72B 3S37X 4KQ3L 4HF5H 2EXWD 5L2KD 3U9UA 2FWOA 2VDRL 5KSVA 1QRNE 5HYSB 2BSSB 5GGSB 4YFLI 4P59H 3S96B 1UM5L 1DE4B 4P5MB 1DN2A 4LLMA 3X13B 7FABL 3VFGH 1U91B 4NKMA 1CLOH 1L7IL 3IU3A 2GQHA 2IAMB 3FN9A 3G6JF 4IMLB 4XP5L 5F89B 3EO0A 4P2OD 4NUJB 5JW3H 3DOSA 5GS2D 1TVBA 3C6LD 4Y5XC 1E6OH 5JOPD 4FNLL 4OF0A 5L88H 3LH2L 4OCMC 4P4KA 4U05A 3GMNB 5FF6A 4M1GL 1AP2B 4I18C 3NPSB 2C3GA 3B9AA 3AS1A 1F4YH 4WI8A 2GTWA 3OB8A 2JK5B 1KYOJ 5IM7B 2CDEA 1I9JH 1UWGL 1FNFA 1A6VL 4Y4FA 4DZ8A 1TMCB 4QHMA 1CFSA 2Z31C 3INUL 4JE4B 2IQAB 3QPQD 3UTTB 4IOFD 4J3UA 1CFTA 1NMCC 3FQWA 2BVPB 5D6DA 3SGEI 4TRPL 2DQCH 5KSUA 3BZDA 1GIGL 4Y1AA 3CLEH 3PGDB 5DFTA 2FB4L 4Z9KB 1UKQA 1JPTL 2QBWA 4UI2A 4ZAKC 4Y19D 4JFED 1AO7E 3NIFF 1HNGA 5J6GA 4POZD 5IW6A 1P4BL 5JXEA 2H32B 3RTQC 5FYLL 3GMOB 1S7XB 5LGHH 3RKDC 3V5DA 3UYRH 3Q3GA 4YIQA 5GSRA 3LHPL 1I1AB 3HZVB 2HLFC 1FCGA 1PZ5B 2HJFB 3ZTNH 1QSFA 4YK4B 4PV9A 3OKMB 4BUHA 3L3GB 1BQLL 4M43L 4M3JA 4RGMC 5FYJE 3CK0L 2PTTA 1KIPB 3BQUC 2CJUH 5F96L 4Q2ZA 1MCDA 3EO1A 3VG9B 5H2BB 5BRZA 5I1KH 1H3GA 3MYZA 1PBYA 2HFTA 3BW9A 3TP4A 4RA0C 4UNTA 4OGAD 1HHGB 3IDIA 4LK4A 4UIKL 1OLLA 4PJEB 1C1EH 1REIA 4WFGD 4F7PA 4S2SA 2J8UA 1EO8H 1TPXC 3EO9H 2KUTA 1D5BA 1A6UH 1HOCA 4UB0L 3ZYOA 4HGWA 4JFFB 5C0IA 3QR2A 2PW2A 1W0VB 4V2CB 4B7IA 1INEH 4L5FH 3WUWG 1A2YB 3GMLA 2R4RL 1LP9F 3CXDL 2EIEA 5GHWL 2DBLH 4PJ9A 2I07B 2D7PA 5J6HB 2H1PH 2R0LL 3VFSA 4MDIB 1T0MB 1XFPA 3UDWC 1KIQB 4XI5D 3HG1E 5DDHA 5F7DB 1HXMA 2IAMC 1A3QA 3MJ9H 4EVNB 1BECA 5D1XA 1HXYB 3O41B 4NHUA 5CSZA 3GJEA 2O61B 4X98B 4M6OH 3OAUL 4NRXB 1JYWA 2AXGB 2AKRA 4IS6B 5C6PB 3GIZH 4ODBD 1J18A 4GMTH 1OL0A 4Z0XB 2ATPB 3V0AC 1U36A 3VFOA 1K8IB 1MHCB 2IPKB 1T4KB 3DX8B 1RZGA 4UT9L 4P23B 3P30H 3UBXG 3OX8B 1ZS8B 4L4TA 4U1NB 1T20A 3NPSC 1BFOA 2EZ0D 4F7MA 4OLXL 1Q72L 3KPNB 5JUEH 3SPVA 4LLQA 4RFOH 1MRFL 1T83A 4TYUA 1SEBB 1JPFB 1QSEE 4M7LH 1FLRL 4OSUH 3FMGL 1EJOL 1DQJA 2C1PA 2AJ3B 4BJLA 4KKBD 1MFBL 3RGVA 1BWMA 2LU3A 3DBXA 2D7TH 5E1HB 3V6FA 4HJ0D 1C5DB 2CQVA 3MBED 4G3YL 4X5LA 4IHOA 4TUJB 2VDNL 1CL7H 3HZKA 4JANA 2YA0A 4XCFL 4WW2F 3PHSA 4MXWL 5IFAL 3F8UB 3H0TB 1JJUA 3P3YA 4K7PX 5DD5L 4DZBB 4KJPC 4XB8A 2BNUA 4FXGA 2ZNXA 3T0EA 4BUGA 2NLJA 3VXQA 2IBZY 3VXPA 3CFDB 1I1AC 5DSCA 1QBMH 4NRZA 2PW1A 1HDMA 4YK4C 4HCRL 4LLUB 3P9LA 1AGDB 5JLZB 4OF3A 1ORSB 4NN7B 4YE4L 4G8FA 4X6EB 5CKGA 5ENWA 5C08E 3TNMB 2EKJA 5DMJB 4S1QH 5DMIL 5EZJA 1RUML 4GKOA 4I1NB 1HWGB 3RWHB 3VG9C 3BDBA 5KVGH 1IM3A 2C1OB 4MD0A 3HPJA 3UJIH 4X9GA 2G5RA 5EBWA 5IB3A 3UTQB 3MGOA 4BZYA 2A77H 4MD4A 2C7UA 3PV6B 5DVMA 4R7DA 1I7UB 5KSAC 1JTOA 5I17B 1RIVL 5ADPH 3HZYB 5JW5A 4KKCD 1VESA 4LPYA 3L3JB 4HC1L 3ES6B 3I9GH 4HKJA 2KH2B 1L6ZA 4K55A 1Y0LB 1RZJH 1DANU 3BX7C 4H0GA 5F7NC 5B8CB 3PF2A 3KGRA 4ZUVB 1BQHG 4DKDC 2Q6WA 4N8PA 4YLQT 2ORBL 3HPLA 5JORA 4D9QD 4E41D 4HBCH 3TJEH 4I48B 1LO0L 1GZPA 1CDHA 1KJ2L 4HV8B 4XHQA 4XP4H 2Y6SD 2AQ3A 5DVNA 1U8PB 4R4BA 2J3SA 4YZFE 4U4BA 2QQNL 1K5NB 1FO0A 4TUKL 5DVOA 3UMTA 3WN5A 4QHUB 4LSPL 3MRFA 2EDNA 4U33A 2W9DL 1VEMA 4P23C 1ZLSL 2BXZA 3FRPG 4ELKB 1PX4A 4PJAB 4PYGA 4X6DF 2NY3D 5D1QB 4B0MM 5C0RH 3G5YB 2W0KA 5LVEA 4ZTPL 3V0WL 2AV7B 5BJTA 5INCB 1IQDB 2UVEA 4UTBL 4QTHA 4G8EB 4JPVL 1I75A 5DMGC 2FBOJ 5IV2A 3GBML 5K59F 4ZDHA 3K0WA 5HI5D 3S35X 1MI5B 5I1GL 3S88H 3MRDB 1CICD 3STBA 3OBAA 1JGUH 4X4MA 3H7BA 1YMME 4U0RC 2DJSA 2OR9L 3CFBA 2CKBH 1CBVH 4NM4L 2XWJB 3WEXB 4LLYB 3HI6H 1DDHB 1NL0L 4AL8H 2FRGP 4Y2DA 3JZ7A 5FOBB 3ZLQC 1FP5A 1M6OB 2UWEF 4X6CB 3ZL4L 1FGNL 1RIHL 2LVCA 2VDOH 3IJYB 3WJLC 4U6YB 5EU6A 1MJUL 1VFAA 3QBTB 3TZVC 5ECJE 1DLFL 1EVTC 1GHFL 3DUUB 5E99L 1HHJA 4YGVB 3LKRA 4PJ5A 2NW3A 2V6HA 4OCXL 3QQ4A 3V0VB 1ZHBA 4KVNL 4LVEA 5DFWH 1ED3A 5I73B 4PB0L 5D4QA 3O11A 4DUVA 3Q2CA 2VLJB 4MS8D 3OJ2C 2EYRB 4JFOA 4O58H 3IFOB 4ZUWB 4BQBA 3O3DB 4PTTA 4XC3H 3H7LA 2DQJH 1BM3L 5J1SC 2V17H 1S7VA 4QGYA 2HJKB 3SKNB 1RMFL 3ZTJG 4AEHH 3LS4L 2E9BA 3HNVL 4O2EB 3SE8H 4M1DH 3KPSA 1CGSL 5ID0B 1N5YH 5B8CC 1KLGB 3QIBB 2D3VA 5I1AB 4Y4HB 1Z6JT 2I9LB 3FOMA 4WUKL 3O6LL 4LCYA 4Q9BA 3CZFB 2DQFA 3NCEB 4R26H 4QOKA 4G8GB 4FABH 5CEZH 4MAUL 1MAKA 1OPGH 3ULVD 5IW1A 5F6IB 2A9NH 4QCIA 4P2QB 1JGDB 4DAGH 3G5XA 1NBZA 4C56E 1A7QH 2J6EL 3BI9X 3DMMC 3MLZH 5IG7B 4N0FA 2FH6A 4XVUD 2F19L 2IPUK 4JY4A 3QXVA 3TYGL 1U3JA 2UY7A 4MJID 4XXCC 4GUPB 1X44A 5AWNH 3CSYA 5TH2B 3VE0B 3MV9E 2BHYA 4AG4L 2JJVA 2VDKL 3LV3A 3QEQE 2JCCE 1A64A 2W60A 4PRPD 4J4PC 3AU1A 3MRQA 5DK0B 1D7FA 1OTTD 4JDTL 1B90A 5I8KH 1GPOH 3FT3A 3MREB 1ERNA 4KHXL 1NMBL 4OIIH 5D7IA 1NC2A 4NNYB 2B39A 4KI5D 3OKEA 3D85D 3JWOH 5DJ2B 3JVGC 5KJRL 1XIWD 5FGBA 1S78C 4JFDE 1EZVX 4OF6A 3HS0B 4X7TA 3ZKQD 5CINL 3I6GA 5HY9B 3HB3D 4JRXB 1WICA 4ZS6C 4FMFA 1TTUA 2AABL 5FYLE 1CXFA 4MAYB 1NSNL 1DBJL 2CIIB 3MA9H 1E6JH 4F7EA 4IM8A 4U6TA 1EMTL 3BEWA 5IT2H 3UJJL 1KN2H 2LAAA 1S9XA 5BMFH 1AD0A 2P43B 1Z0MA 4KC3B 4FTVD 1FRGH 3O45A 3W9EB 1QO3B 1XAUA 2MSPA 3GSQB 3RVVC 1N8ZB 4X7FC 3WNPA 3AM8C 1K85A 3FQUA 4LP4A 1RZKH 5