1G9NH

Hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
229
structure length
229
Chain Sequence
b'QVQLLESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYRNNGFLKHWGQGTLVTVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structures of HIV-1 gp120 envelope glycoproteins from laboratory-adapted and primary isolates.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 47
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2000-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g9nH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g9nH01
3MRBA 2B8OT 1WF5A 1V7MH 3DGGA 1NQBA 1CBVL 3UBXA 1CU4L 5LBSH 5I30H 2X1PA 2DQDL 2ARWA 4RAVB 1L6XA 2P24B 3RWEB 4HK3J 4MD4A 1MCWM 2OR9H 3TH2T 1G9EA 3KJ6H 1K8IA 1IGJB 3GK8L 1BZ7B 4P3WA 2CDEB 1IGTA 1YNKH 3O6FA 2ZUSA 3CLFL 2GUOB 3LDBB 1QBAA 4ZFOL 2DBLH 1PSKL 5EORL 5F7HA 3ARGB 3GIVA 4XH2B 4IIQC 3C08L 1NLDH 4LRIA 3NZHL 3DBXB 4EEEA 5AG8A 5IK3B 2APVA 1ZK9A 1PY4A 4WENB 1LO3L 1D9KB 4QF1B 1ZSDB 4PJFE 2R69H 1T1WA 4PJGA 5BO1L 4MGXA 4UUJB 5J3HD 2CIIA 5D1QD 4O9HH 2Y06H 1U42A 4EDWL 1DUZB 3BUYA 5C08A 4TQEL 4I2XA 2Q87A 3PWPD 3I9GH 4K3DL 5B8CB 3ARED 3QBTB 2Q3AA 3MRRB 4X6BA 3G6AB 4F3FA 3R8BB 2VNCA 4Q9RL 5L8KB 3HC4H 5IT2H 2EXWD 2YOCA 1A22B 3RGHA 1JCKA 4JO2L 3NABL 4O51A 4PJHE 1U3ZA 2XG5A 5A16B 1R5WA 4OT1H 4P5TC 4KROC 1HXYA 2BVPB 3C60B 2OMBA 4HT1H 4BSWA 3KYOB 4P5KA 2NQCA 1EX0A 3GEWB 4P99A 5FYJU 3AAZB 4JHAH 1XMWA 3X12B 5T3XH 4ZPTB 2DKSA 3KR3H 4JZOA 4LCYB 1FLRH 3JV4B 3QULA 4JO4L 5T1DH 3D2UB 1S5HA 5HD8C 1KENL 5DQDL 4C54A 3BPCA 3SDCD 3ULUE 4MJ6A 2HJKA 2VSCA 4NCDA 5I1JL 3O0RH 4RFNC 4UQ2B 4G80A 5D1ZD 5HDQL 3CK0H 2WANA 4ORGB 4PJDB 4YDIL 4YPGA 1BEYH 4Y16C 1LO5B 2VR9A 4GG8B 4I77L 3RDTC 4M8QB 3CXHJ 3MNZA 2IFFL 3LN5A 3QCTL 4ZUVB 4TULH 5IB1A 4H0GA 2DD8H 2VAAB 3GSNH 4QGYA 1U8HB 4O00A 3OAUL 2YMXL 3TYFA 4MD5A 3L3HB 3UYPA 1KIRA 3DUSB 2EYRB 2DQUL 3HE7A 5CMAA 3U6RA 1MCQA 1XIWD 4Y5XC 3MMEA 4LARL 3OR7B 3OB8A 4KTEH 3GMNA 1YZZA 4G8FA 1QNZH 5B21A 5KW9L 2MMXA 3G5VB 5MERB 4YIQA 1B0GB 2GK2A 2L0DA 3GMOB 4WTZA 4F33A 1QLEL 5FUOH 2X7LA 1F4AA 3EYUL 4M6OH 4CADB 1J8HA 2ID5A 5JDSA 4URTB 5I1GH 3FT3B 3D3VD 2J8OA 1QSED 2V2WA 5JW5A 3EJJX 3T4AA 1KJVA 1RD6A 3MROA 4CN4A 2DTML 2BNRB 4JN2A 1OP9A 4XBEH 3KPTA 2CO6B 4MCYA 3SKUD 1S7QB 1UJTA 1HK6A 2JK5B 1L7TH 1CD0A 4U0RB 2RIKA 3K1KC 3M8OH 2NY5L 2QKIA 3MUJA 5FDYA 3AXLB 1F00I 2EH8L 2VISA 1U8PB 3I3BA 2FX8H 4KTDH 4HPOL 1B0RB 5I9QB 1Y0LB 4ELKA 4DVBB 1J1XH 1XFPA 3LQAC 5IM7B 4D9RD 3BESR 4RGND 5TFSL 4POYA 5IHZB 1A1MA 5KOMC 5KSUA 2BCKB 3GI9H 3MCKB 4OLEA 3W11D 4YXLL 3OXSA 1MF2H 3HZKB 1X3DA 3FO1A 3STBA 3DETD 2OK0L 2DLFL 4PRBB 3CFBB 5FO9B 5TH2A 1R5IA 4AZ8A 1G9MC 1YEHH 2Z93A 5TF1L 3BD5A 1XZ0B 4LSSH 4XVUD 5GZOD 4DN3L 2DQIH 2FDBP 3OR6B 1J1PL 3SPVB 3WD5L 3LKNB 1I9RL 3WE6A 2CKBA 3LS5L 4LASL 1V5JA 2WBJB 2V7HB 5KSBF 2K9UA 2YPVL 1B6UA 4I18C 1E27B 5JW4Q 4DKFH 2CLRA 1K6QH 4K7PY 43CAB 3GMPA 3FQWA 5IW3A 2A77H 5HHXH 4YEEA 3F65A 4HKJB 2RB8A 4FTVE 2D7PA 1BQLH 5IOPA 3F12B 1IQWH 4XNZB 5EZIH 1MIEL 2NY6C 3JV6B 2HFEB 5J13B 5JW4R 4YHLH 1D6EB 4KI5C 3TT3H 2YPLE 1IFHL 3H3BC 5K9JH 1CT8A 1OPGL 4C56D 1I3RA 3IDIB 5DEZA 3DROA 2ZJSH 5KANG 1H3PH 4FQLH 4X5LA 1XCQB 5HY9A 1YY8A 3UXFA 3MRIA 3SDXF 1IJ9A 1I8LA 1EFXD 1H15B 6FABH 3O3AA 4JJ5B 4D0CB 3ARZA 2BFVL 5DMGC 3GSWA 2X09A 5DR5H 4IRSB 5T1LD 4UQ3A 3T3MF 4IIQB 3FO9A 4PJ7A 3RWHB 3BZFA 3U36B 4HCRL 5F7MC 3T2QA 4WWID 5I74C 1TETH 2KQNA 3OZ9H 4GAGH 3CDFA 2CO7B 2LTQB 1QVOA 5CP3H 4DK6A 4YJZL 4X9HA 4NJ9H 2IQ9H 4DOHB 4YHNB 2QL1A 4U1NB 3MPCA 5D7IF 2F5BH 3RU8H 3P2TA 1MQ8A 4F7EB 3STLA 5DJ6A 2ICWI 1RULL 1TXKA 4MDIA 4RMWA 2ZCLH 3DMMC 4KAQL 1KG0A 2X4PA 4O4YH 1MVUB 3BP6B 2GI7A 4YGVA 3TBTB 3QXUA 5HYQA 3FOMA 2OP4H 3KPRB 4BH8A 3S3JA 2QBWA 1A4KA 3WKNA 1NUGA 5GGVL 1FG2B 3PGDB 4OCSL 5DO2D 3O4OC 2IBBA 4MNGA 5J6GA 4PJBA 1BIHA 2H9GA 5H35B 4JFYB 1AY1L 5FYKH 1IE5A 5D9SB 4C55A 5J12B 3SE3A 1NJ9B 3QDJA 1J0KA 4MDJA 2DJ4A 3DI2B 2G60H 3ORJA 3WKMH 1MCRA 4P5TB 2HTLC 3OG6B 4KROB 3QG7H 5BCAA 4G42B 3ZTJH 2Y9RT 4Y1AD 5CINL 3PWPE 2VZUA 4JKMA 4LLDA 5EBWB 1NGZA 2IPKB 3VRIB 5DWUL 4L8DB 5D7KD 1MHEB 4LEXL 1SJHB 3WFZA 2XWTA 4OCRH 1E6OH 4HFWA 4NRYB 1I1RA 1F58L 4QXTA 3TN0D 1FZOA 3DVNA 1EHNA 1LP9B 2FGWL 4JM2F 1J05A 3SOBL 2R0ZH 4RFNB 3B6SA 2I60L 3VG9B 3W2DL 2Z4QA 1FFNA 1ZWIB 2D7QA 3P0VH 4I48B 3HN3A 3HB3D 4MNQD 2IAMD 1HXMA 5LCVL 2R39A 5EIIA 1JRHL 4UINH 5CUSH 1ZA6B 3BYYA 4HH9B 1B4JL 4P2OB 4ODHL 2VQ1B 2NY0C 4CDGC 2G5BB 1KB5A 2C3HA 4FFWC 1X5AA 5GJTL 2EDDA 4MCZB 1QSZA 1XGUA 1K4DB 1FFRA 1FGVL 4O2FA 4MXVF 4XP1H 4JKLA 1MI5D 1N4XH 2GTWB 3D48R 3H42L 5HYEA 1S7XB 3U9UA 5BW7A 4YHIB 1HN1A 4NQEB 3H9SE 5FAAA 1DSFL 1J18A 4FQQA 3VXOA 3S36H 2XXMB 4J6RL 2YUXA 3VFSA 3U7WH 5T33L 3O81A 3MRKA 5I18H 3GM0A 3V4VH 3C2AH 4OGAC 4YHPA 4Z7UE 4ONHA 2DWEA 4E5XA 3O3DA 3MX0A 4ZO8A 2DM4A 1GGUA 2GCYA 3E1F1 2WLZA 4H88H 1KB9J 4JZNA 5IG7A 3IU4L 3KJ4B 4PGJA 2O5XL 2W9LA 3GRWH 5JUEH 1KPRA 2UUDK 2LAAA 1AP2B 3VI3F 3U4BH 4PRAB 1G0XA 1G7HA 2CDFA 3KYNB 2D9QB 3KPOB 3QDMD 4M7LH 35C8H 2GJ6A 3VXPA 4OZIF 2DM3A 1AD0B 4X4XB 3ZSTA 2W9EL 4JVWA 3QIWC 4K07A 1W0VA 1CL7H 2NY4D 4N1HB 1H3GA 4HKBB 4F9PC 4YZFF 5FUZH 1U91B 4NZUH 3GMQB 4PG2C 4PJCF 2WBWB 1QLRA 4NO0B 4IOFC 4XCEB 3AY4A 1RJCA 2CDGB 2A6DA 4OSUH 1A64A 1KPUA 4XMLL 4NQSA 4Y5VC 5DJAB 5EOTB 5F9DC 4XAWH 1HHIB 2Z31C 1UA6H 5CGMA 4XNMB 1AR1C 5GZND 4P5MA 2X9XA 1NCTA 2VTFA 4ZUTB 3MV7D 5IUSA 2IADB 4PY8I 1A4JB 2K7PA 5T5NF 4P46A 5HGAA 2GTZA 5CIPA 3QUKB 3ZDYE 3QNZA 1DVFD 3UTZA 1VKXA 2DQFA 3UMTA 4UZGA 3KWWB 4ODUA 2FHFA 2DKMA 3KG5A 1EGJA 2YD1A 3DO7B 3N85L 3FCTB 1T20B 4R0LA 2YRLA 3MV8A 4HWBA 5F6HJ 5JW3H 1I8IA 4FQ2L 4DGIH 5DD0H 4U0QB 4O2EA 1EJOH 4LSRH 1YJDC 4O2CA 5F70A 2DMKA 4NP4H 5DD1L 4JKPL 1TZIB 3BFOA 1A9EB 4OZFH 3UJIL 1UM5L 2P5EB 5HGHB 2FLRT 4EJ1C 3SE4A 4HGWA 4LCIL 1Z0MA 4M7ZC 4X4YB 4N90D 1JWMA 1Q72L 2VZ3A 3RY4A 4V2BA 1OAUL 1H3WM 3WL9B 1J88A 1RUKL 3MLUH 5DC0A 3BDYH 1HH6B 2Q20A 5F9JB 3SCMD 3DX9A 3W0WB 1HILB 2QSVA 5ICYB 1QYGL 4JG0L 5C0CE 1NC4A 3EYOB 4X4ME 4XPAH 4AIZA 1AE6H 3CFDA 3IU3B 2A6JA 4XXDA 3VE0B 4NM4L 4BQ9A 1MFBL 4PB9L 1ZE3C 5IFHL 1P4IH 1KFAL 2VXUH 4JDVB 4F8QA 4MXWL 3MLYL 3EO0B 3NIGF 3G5ZA 5I1CH 1HZHL 1YQVL 4TSAL 4JCLA 4Y16A 5DJ2B 4KDVA 3RDTA 5HHOD 1HDMB 2KBGA 3MZGB 4IJ3C 1CBVH 1CU4H 2HRLA 4XWOD 1NMBL 2DQDH 3RWGA 3LEYL 3DMMB 5KSBA 2PO6A 4ZS6C 4GH7B 2VDOH 3WFBL 1AKJA 3GK8H 2FCBA 1SY6A 2R1YA 1M7IA 4KQ3H 4HS8L 1M71B 1MFAL 5I66B 2W59A 1X5KA 3ZKMD 3CLFH 3L3IB 1CDCA 1KACB 3G5XB 3MACL 4KGJA 2GSIB 4DZBB 5A3IC 3FFCB 3QYCA 3ZTJG 1OGAB 3VFRA 1PSKH 1AGFB 5EORH 5F6IC 3C08H 1QZ1A 4PRIB 3VXSA 5D5MF 3NZHH 3D0LA 2AEQL 4RFEA 1BOYA 4V1DE 1UCTA 1JMZA 1HNFA 4YAQA 1D5XB 2EYTA 3QUML 4GT7A 4PYHA 2VLJE 1LO3H 5AZ2L 5GISH 5DXWA 3P0YL 4M61A 3ZHLA 5FYLD 1OGTA 1Z2KA 2ADJB 5BO1H 3SDXA 3M17A 1A8JH 5FCUL 4QGTA 4XP5L 1ZT7B 3NPSC 3MXWL 2ICWB 2DBJA 2FYYB 3MCG1 1UB5A 3WS6C 3D25A 2J6EL 4MMXC 4N68A 4EDWH 2OJEA 4FXGA 4TQEH 4KWUA 3TCLB 5F7KC 4Y89A 3WUZA 4K3DH 1KIPA 1MJUL 2OJZL 3GSQA 1MJ7L 4DCQB 4NDMA 4Y4HA 2VDML 2F54E 2FGZA 1JZ3A 4Q9RH 5ICZB 3KYKL 5ID0A 3SO3C 2X44D 4X7FC 1MY5A 3MRFB 4P2QB 5DA0B 5D7IA 4JO2H 3R0MA 3VXRA 2O26U 3NABH 2XZAH 3OKLA 2DLHA 4Z7WB 4LHUG 5T3ZE 4OLYL 2AERT 4P4KC 4BH7A 32C2B 1JHTA 5HJ3A 3BH9B 1C5DB 5HHMB 3LEXA 2X42A 5E94A 2NY2C 1QSFD 2H2SC 1W0WA 2XPGB 5DUPL 2XN9D 3K4AA 1JYWA 3CGTA 4JO4H 5F9AC 3ULVL 4RQQB 5DI8A 1TZHB 1KENH 5DQDH 3VWKA 3SKNB 1T2QL 1U92A 3CIQA 5I1JH 3OX8A 2BHUA 3VD5A 1BVKA 5KVEL 4BSJA 4QOKD 5C0EA 5HDQH 5EU6B 4LDOB 2EICA 4YDIH 4Z8FL 2EC9U 4XPGL 2IFFH 2P8LA 3QCTH 3BEVA 4J3UA 3RVXD 2YA0A 2M26A 3B4NA 1RJYA 1G6VK 3QO0A 3IDJB 3OAUH 2YMXH 1RK1B 1QR1B 3BT2L 1QACA 1WWBX 4FQXA 1JTOA 5TE6L 2DQUH 4M7LT 2XTJC 3H6JA 1I8KB 3JWDL 4X6CF 1ORSA 4LARH 1Q94A 1JWUA 5KW9H 4JM2A 1I1AC 5GSRB 1F4HA 1NBQA 2FO4B 4PJIB 1QLEH 5I1AA 3QDME 4N9GA 1HWGB 3EYUH 3MGOB 4LDEB 2VLMD 3O9WC 4JN1L 4Y5VB 2ZUXA 5FYKU 4GLRH 4G8EB 1GGTA 3O6FD 3OKKB 1K85A 4PB0H 4EI5D 2AXFB 4MXQD 5E8PB 2DTMH 3QQ3B 2AGJL 2DLTA 3DURB 4D0DB 3SBWA 3RTQC 2IMMA 1I7UA 2ENYA 4MLIA 1KJ2B 2NY5H 2JIXA 3VH8G 4NO3B 2X4OB 2EH8H 3CSYA 1FYTB 3VXQB 4HPOH 2H32H 2NLJB 3UPRA 4QHUA 4I9WE 4G9DA 2EDOA 3L3DB 5TFSH 2X4NB 4F7PA 1FIEA 4JPKL 5BV7C 3TF7C 5HYJB 4KJWD 4L3CA 5F7WC 4JQVA 1U95A 3BJ91 2HVKA 3DX8B 4YXLH 2HLFD 4I0CC 4LCUA 1Q9WB 4K55A 2DLFH 2OK0H 3T0EE 3ARFC 1NCNA 3W9EA 2ZP0T 1X4ZA 1MPAL 5A1AA 3EKCA 5ANMB 4RBPH 3VJ6B 5TF1H 1WBYA 4J4PC 4UU9A 3V5DA 3FN3A 1T6VN 4KXZI 2V9TA 3DOSA 4OZIA 4AH2A 4M7ZB 4Q2ZB 1H5BC 4DN3H 1IEHA 1J1PH 3WD5H 4KRNA 1I9RH 1DBKL 1EBAA 3LS5H 4LASH 4LCCC 3P73A 2YPVH 2EKSB 4FN0A 5CGYC 4PJCA 2C5DC 2G75B 4Y19E 5TDNB 2PTUA 3KPNA 1GSMA 3UJJL 3R06B 4N0RA 2NTFB 1BAFL 4LLWB 1CYGA 3VFMB 1VFOA 4JRXB 3BP7A 3SKMA 1MIEH 3ZE1F 1NBYB 2Y23A 5IKCA 5ISZB 5AUMA 1Y6KR 4C83B 3GBML 2NW3B 2XZCL 3K4ZA 4NRZB 3MYJB 4AEIL 3RQ3A 5MEOA 1IFHH 1VEOA 2JJSC 1VACA 1OPGH 3FJTA 1JGVL 2EEBA 2CLVA 3CSPA 3I3EA 4KKLD 1Q9LB 2UZIL 3OB0H 4J3TA 1KC5L 2EDYA 3FB8A 5E08L 2C3VB 1PX3A 4OCLC 3ROOA 12E8L 4YC2C 2BFVH 1JL8A 3FT2A 1BFSA 3MGTA 5JIKA 4ZOEA 2F19L 2F53B 5F6IB 3TO4A 3WFHA 1GRWA 1HQ4B 4B41A 5ID1B 3HE7D 3WNMA 4HCRH 5LAXA 2OL3A 2P8PB 3P4OB 2B5IC 1IM3B 2BMKB 5IQ9B 4LMQE 2YPKB 2VN4A 4NYLB 4UDTB 5IJVB 5DD3L 1WV7T 1QO3A 3FRUA 3OGCB 5FXCH 4X8JA 1J8HD 3NPSB 4PJ8C 1T1YB 2DM2A 2C7UB 1RULH 3WXVL 25C8L 5B4MD 3QAZB 4JFFB 4KAQH 3EJYC 3CSGA 4M62L 2E9BA 5B38G 5DEGA 2FIKB 2A6IB 3MNWA 3QHTC 5GGVH 1AIFB 4W4NA 4OCSH 5CLWA 5E8EA 1MFDL 2ZOLA 4E0RA 4MD0A 5FYLE 1CE6B 2D03L 3SO3B 1AY1H 3ZE0E 3KXFD 4EQ3A 1E4WL 4QLRA 2C9AA 3OKNA 1UKTA 5DFVC 2B7DT 1OP3H 5EO1A 3O4LB 4M1CC 1S9WB 2Z31A 4P4KB 2BY0A 4CBPA 3J8F7 2QEJA 5CINH 3BIKA 3LB6D 1AR2A 1HCFX 4XPBL 5DWUH 4G8GB 4YR6A 3QUXC 4LEXH 4LEOA 4KKCC 3VWJA 5BS0E 3F7QA 4HLZH 4PV9B 1TVBB 4Y5YC 4TTDD 5I15L 5BZDB 4BQCA 1HWHB 5INDB 3ARWA 1F58H 2QLVB 4TOYL 4KV5E 4F15C 5D5MA 2FGWH 2BHYA 1INQA 4MJIB 4E41A 1RJLB 1WFOA 2XWBB 5EUOE 3SOBH 5L2KE 1GAFL 2I60H 4UIKL 3W2DH 5KBNC 2V5RA 5ICXB 4GAFB 3EYVB 4XRCB 5LCVH 3U2SA 4G7YL 1JRHH 5EOCL 1AXSA 4ODHH 1I75A 3HC0A 5DVMA 5GJTH 2ATKA 1YPZF 1FGVH 5IR1A 5KSVB 3FONB 3GO1L 3QEHA 4NNXB 4YX2L 4ZNEA 4X9GA 1YYLL 5DUBB 1WITA 3KPQB 3L3GA 2KL6A 3RHWK 1DSFH 4JY5L 1IL1B 1F42A 1XF3B 3O3UN 3DVGB 1T7ZA 2V9RA 4J6RH 1N6QL 3PL6A 3SN6N 2Z91A 3VW3L 1UZ6E 5T33H 3U7YL 3I84A 1KIQA 3QJFB 4NO2A 3O9WB 1T5WA 5DK3A 1YMMB 2CKBL 3HAEB 3BX7C 4TUOA 1GZQA 1ZHKB 4OF7A 2NNAB 3L1OL 3GDBA 4WHCA 3EDDA 4U7SA 4OZGE 3UTTB 1FCCA 3C8HA 5IVNA 3IU4H 1ZGLM 4LQFL 2O5XH 3ALXA 4U7MA 4EN3C 2AXHA 1CFTB 3RTQB 4ZNCD 4JFZL 2ZSVA 4L8BB 1ED3B 2R1WA 4L4VB 2AK4E 3SJVB 3CFIC 1GHFL 3MA7B 4JFQA 3HMXA 4NN7B 2X05A 1HKLH 2NZ9C 2PYEA 4G6AD 3MSPA 2D3VA 4D9LL 5IQ7L 4NZTL 4QHKJ 4BM7A 1J1OL 4OCMC 1C12B 2ZOKB 2OI9B 2J8UB 2O5ZL 4LPCA 3O2WL 4KDTC 1IKNA 5I76A 1EAPA 2HLAA 3FO2A 4XMLH 2FEEL 1WEJH 1S78C 3WHE1 1W8NA 4XWGL 4JE4B 2W07A 1I1CA 2E6JA 1S7TA 3KPLA 5IBLC 1ZLWK 1YEIL 4YDJB 5BJTB 1HQRA 3BH8A 3BHBB 1QTYT 3BKJL 3QDJD 4JGJA 3RX8A 1KLFA 2A38A 2X10A 1CGTA 1NANI 4WU5B 1JMXA 4IMKA 5EU3B 5C08E 3NFSL 4IRJA 1XR8B 1EEYB 3KPSE 3HS0B 1X5FA 3T0WA 5KZCB 1IM9B 3N85H 2KKQA 1TVDA 4PJ9A 5TE4L 4AY0A 3LN4A 3MUGB 1GGIH 4FQ2H 4OUOA 4WJ5B 4APQB 1N3NA 1D7FA 5EIVA 1ACYL 3DGCR 3ILQC 5DD1H 4JKPH 3ARRA 1ZHBB 3UJIH 1CK0H 3GSUA 3VD4A 5EULV 4LAJH 1UM5H 2YUZA 2YKLL 4E42B 3LH2L 4WWKC 3HFML 4LCIH 4R2GC 1BZQK 2BNQB 3VFTA 1Q72H 3VXTA 1OAUH 5F3HA 2E9WA 2NY1B 2BSSB 4PS4L 1RZ8A 1RUKH 2QHRL 4DAGL 1MFEL 5IJKC 4CVXB 4D2NA 3AROA 2QADD 4JLRB 3PWNB 4J3WA 4MB3A 3TPKA 1QYGH 4JG0H 4X99B 3QUZC 3MQIA 1OF2A 3G08B 4J3SA 5HHPB 1G7JA 1N2RB 1E4KC 4JDTL 2B5IB 2OTWA 4NM4H 1MFBH 4PB9H 1XCTA 1G6RA 5IFHH 1KFAH 3LS4L 1BX2B 3CVHB 3TVMD 2R0KL 1V3LA 5HYIA 1QRNA 3P30L 3MLYH 4MXWH 3N1FC 2P4AB 4EUPB 1YUHB 3HAEG 4JRYB 1HZHH 1YQVH 4TSAH 3VD3A 4PP1C 4TUJB 4NQDA 5D1XB 2W60B 3LAFA 3LEYH 5GGVY 5JHLL 3X14A 3DYOA 3WFBH 1PYWA 1QBBA 5EN2A 3G5YA 4HS8H 4RAUB 1AQDA 1MFAH 3L3OA 3MRGA 1KB5L 5C0AB 4TVPE 4ZXBB 3B5GA 2WUBL 4BKLB 3MACH 4HDIA 2YK1L 2GJ6D 3MRPB 3MRNB 3IKCB 1I1AA 3A0OA 5M95B 3GI8L 3N1QC 1EUTA 2P7TB 4CJ1A 5LGJA 3NGBC 2E8ZA 2QQLL 4R7NB 1DQJA 3BPNB 2AEQH 1JNHB 3QUMH 4XCYA 5AZ2H 3VA6A 5C0RL 1JWSA 3P0YH 1BPVA 3CFJB 1SMAA 3BRDA 2N7BA 1R3KA 4ZSOA 2EIDA 5FCUH 4DZ8A 4XP5H 2VE6A 3VA2C 3MXWH 4PJXF 3O8XC 2VLKA 2ZNXA 4Y5YB 1G7PA 4GBXC 1G7MA 2P5WA 3VXUA 2J6EH 5SWZB 1BD2E 1OB1A 2XRAL 2VWEC 4UAOC 4F15B 2IQAB 3TO2B 3VFWA 2VQUA 1U36A 2JJTC 4P46D 2PR4L 5FA3A 1MJUH 2OJZH 2X4RA 4IEFB 1MJ7H 4GSDL 3GM8A 2FR4A 2XY1A 2VDMH 1XH3B 5KN5A 3KYKH 1UWGL 1FNGB 2X9WA 2BXZA 1BFTA 4Y4KA 1N8ZA 5KS9F 2WIMA 1BF2A 4KK5D 1OAYL 5ACZB 1RJZA 1CGUA 4FQCL 1VFAA 2Q76A 3MV8D 4OCYL 3QWOA 4MS8D 4L8CA 3SE9L 5IGXL 4OLYH 3TWCL 5DUML 3VFVB 1IGMH 3MRCA 2XT1B 4PGEB 1JN6B 3T09A 1QBML 2PF6A 1SJEB 2ESVA 3EDEA 1A3LL 4M5ZL 1IGJA 5DUPH 4FQHA 1GZPA 1TLKA 2E6PA 3PIQA 1BFVL 4MQXC 1TIUA 3ULVH 4HWUA 2VUYA 2GEEA 1T2QH 3ARGA 4XH2A 1A7BA 2ARJB 3MRMB 5MEQB 5KVEH 1NC4D 4D9QE 3G6JB 1EVTC 1I3GL 4O58H 2YA1A 4QRRA 1NL0L 5I16A 4Z8FH 3TP4A 4XPGH 1D9KA 4PRDB 2IAND 4EUPG 5DJYB 3UEZA 5FV2A 4RDQG 3BT2H 5DVLA 4Z78A 1WCBB 1YA5A 5MI0C 1HHKB 4UUJA 5TE6H 2X4SB 5DFWH 4Y16D 5DQ9B 1OWRM 4JZJA 3JWDH 4XB7A 4PUBL 1LO2L 3X13B 3VXMB 4U6HA 2PO6D 4PJ7E 3REVB 3MLWH 4WU7B 1NFIB 2X4QB 2Z8VC 1BLNA 3IETA 1AKJD 3FT4B 4JN1H 5E5MB 3MRRA 1FL5A 5MENE 3G6AA 3NH7L 5E9DA 3MRJA 3UTPD 4G9FE 5I1DB 3O45B 3C87A 1I7TB 3GJFB 5GGUA 5CGTA 1YPZA 2AGJH 4PJDE 5HGBB 2RFXB 3VXSD 1BBJB 1A6PA 2N56A 1N5AB 3SDAC 4KU1A 5E6IB 2BVPA 4HIXL 2APTA 3FKUS 5HDBF 3ARBA 4LCWA 4M48L 3IFPB 3FFDB 1VERA 1WLHA 4XCNB 5FB8B 3AAZA 4J8RB 2A74A 4UTAL 5HDLA 4ZPTA 2W9DL 2NZIA 3B9AA 4JPKH 1NDGB 1I4FB 1JI2A 1V7NL 2R0LL 2AJVL 3WHE0 4XX1G 1KCVL 2DI7A 3RHWF 2OR8A 3QDJE 5HGDA 3EYQC 3THML 3PJSA 1T89A 5JW4M 1MPAH 5EZLB 3U0WL 3DLQR 1OTSD 4HIEB 4F7MB 5DGRA 1D5MA 2JCCF 3QEQE 4GG8A 4WWKB 5C0BB 4Y4HD 3G04A 4I5BB 3AS1A 1CICC 1MCEA 5FDWB 5SX5H 1O7VA 2VAAA 2CRZA 1BVZA 1DBKH 2CK2A 1RFDL 4QRPA 3WCYA 3QUXA 3VXRD 3DUSA 2EYRA 4NKQB 2VIRB 1HYSD 1MJ8H 5EUKB 2V5YA 3OL2A 3LKRB 3QT2A 1MEXL 3FQRA 5DD6B 3UJJH 1MCCA 2V2TA 2AJUL 3WEXA 3G5VA 2HN7B 1UC6A 2A9NL 4H1LB 1B0GA 1BAFH 4K94L 1AGCB 3ZKSD 3OKEA 4ZUSB 5I1IL 2AJYL 4IS6A 3X11B 3L95A 2DQTL 5IMKA 4DUVA 3GBMH 4AEIH 2XZCH 4NGHL 43C9B 2P49B 3V95A 1JGVH 3VWKD 3PABA 1AGBA 2FJGA 4MWFB 1G0DA 4HUUB 1A6ZA 2GY5A 1KC5H 2D0HA 2IPTL 5E08H 4ONOA 1RZKL 2ZUWA 2FZ3B 2BSRB 4PJ5E 3NN8B 4JFEA 2DYPA 1ZXQA 3AXLA 12E8H 3OJDA 3PWVA 4NPYA 1B0RA 3S8WA 1Y0LA 1N6VA 4DVBA 1DQQA 1Q9KB 2F19H 5IM7A 1ZKAA 3QXAB 1B90A 3BP5A 3QZWB 4FQXD 3VRJB 1CIDA 4LAQL 2E8YA 1CZ8L 2RQ8A 4ELMF 2GAZB 4Z7VB 1UXSB 4PRBA 3T3PE 4JM2D 1NDMB 4XBPA 5DD3H 3SKOA 2QR0B 3N1PC 1XZ0A 2DQCL 4KGLA 5IB2B 1N5YL 1Z9MA 1CE1L 1GVIA 4LLUB 4P2RB 1AD9B 3OR6A 4LPUA 3TH4T 4PRPD 3WFDL 3WXVH 4FG6C 4F7TB 5F7UA 4YHML 3Q3GA 1TTFA 4M62H 3TIDB 1LEGB 1F90L 3N1MC 2V7HA 4UT9L 2EDWA 2ITCB 3CSBA 4UAOB 2WSKA 3GSNA 5GIRB 3QP3A 3QRGL 3QNYB 3INUL 1MFDH 5CBEA 1RV6X 2JIXD 2D03H 4UOW1 1F13A 1TCRB 5F6HI 1FIGL 3BRGC 1E4WH 3F12A 5CJBA 1OW0A 4CGTA 2NR6C 4RX4A 4N9OB 3FQTB 5C0FB 3T1WA 1BJ8A 2IGFL 2R4SL 4DOHE 4WV1C 3BAEL 1MNUL 2H26A 3ARSA 2AABL 4XPBH 3WLWC 1CDGA 3OF6A 5IW1B 3UPCA 3H3KA 4WW1B 3MYZA 4X7CC 4Q9CA 5I73C 5B3JF 1RZJH 4D0CA 3OKYA 4GJTB 2VC2L 3WYRA 5I15H 3BKML 4TOYH 4IRSA 4K9EC 4PJFB 4QXGL 3JUYA 2EDLA 5ADPL 1T66D 1GAFH 3U36A 4UIKH 4MNHA 4M03A 1Y6NR 3B43A 3EOBB 4OGYL 2B2XL 1KTDB 2IH1B 3KPMB 3SGDH 1MRFL 4G7YH 4H1LG 5GGTA 5EOCH 4PGDB 2YUVA 5ABDE 2VXSL 3E6FA 4U1NA 2AI0L 4LBEB 3GO1H 4NNYA 2NY3B 3PP3K 3PV6B 4PJXA 4RAHA 4YX2H 4OZHB 2VZOA 4F7EA 1YYLH 2DTSA 4Z7WF 3QH3B 2XYCA 4UILH 1NGXA 4JY5H 4BUHA 4OCWL 3TBTA 1I7ZA 1MVUA 4NKOB 1N6QH 3KPRA 3UC0L 3VW3H 1X9QA 3KLAB 3U7YH 2DS4A 5J3HC 4R96A 1FG2A 4NKMA 5FOBA 5I6XC 5D1QC 2CKBH 3VI4E 1WVZA 4LDLB 4QY8A 5H35A 4JFPB 5JPNB 2WINB 4JFYA 5KS9A 2X70A 4HIIA 2X41A 3L1OH 1X5YA 4GRLB 5F21B 3QZWG 1QFWI 5D9SA 1TCMA 1NJ9A 3AREC 5HGGS 3TO4D 4LQFH 1IAKB 5MHSD 1A6UL 4AIXA 4JFZH 4G42A 2EXWC 3KHQA 4BFIA 3F5WA 2B4CL 3JWOL 4HGMA 2ZUYA 1GHFH 2IPKA 2BOBB 1T21B 4L8DA 3NIDE 4NQEE 1A9BB 1JTPA 4RMUA 4D9LH 1S5IH 3UTPE 4PTTB 1IQDB 5IQ7H 2NX5E 3V6BR 7FABL 4NZTH 3T77B 3FB7A 4GKNA 4NRYA 1J1OH 1YN6B 4LKXB 1DZBA 1BWMA 1RUAL 3EGSB 2AEPL 2O5ZH 1T4KA 5DURB 3O2WH 2VABB 3PHQB 4QRSA 4FFYL 5CEXA 3MOQA 5E00B 2H8PB 4XC3H 5GGRB 4F37F 4PJIF 4NM8L 1ZWIA 3P77B 1DE4B 3IDNA 4XWGH 1NC2B 1ZA6A 5DLML 4QTHA 3SDCC 3UX9B 4P2OA 1IAMA 5D2LE 2VQ1A 1UJ3C 2H3NA 4UT7L 2G5BA 3DPBA 4F7CA 1S7SA 3LKQA 1Z5LA 1RHHB 3VGFA 1YEIH 3NFNB 2GJZB 2OL3L 4I4WA 5CP3A 5F1KC 5D1ZC 4ZFZA 5H94A 2GTWA 3IVKA 3BKJH 2HG5B 4LRNL 5IMMA 5ACMA 1CGVA 2MCPH 5DD5L 1ZLUK 3FRPG 4X9IA 3O8XA 5FF6B 3RWFB 4OD3H 4QT5A 3NFSH 2WLYA 4M02A 5EBLA 2NY5C 3EBAA 4MVBD 4R6UA 1I8MB 3WHXB 1XIWC 5TE4H 1OD7A 1QLFB 3TV3L 1K5NB 3CC5B 3MRHA 3VWJD 1KJMA 3AM8C 4N8VG 3QIUD 5I8KL 1YDPB 3P9MA 1ACYH 1R3IL 2R29L 1IGIL 3VXRE 4OLWL 3VMPA 3DXAA 2R2EA 3ZYIA 4E41D 2C4FT 3LSOB 5MP6L 3QI9C 5F3BB 5DEFA 1AP2A 4JDZA 2YKLH 2ORBL 3U30C 2VDKH 3LH2H 1T03L 3KYNA 2IG2L 3KPOA 4P2YA 3HFMH 3IJSA 5E4EC 2GSGA 1DEDA 4X4XA 4PS4H 2QHRH 4JANB 4DAGH 1MFEH 4LVHC 1QA9B 2AV1B 1B3JA 4Q6YA 2JE8A 1CXHA 1TDQA 2BSED 1G7IB 3KHOA 5I8EB 3WIFB 2Z92B 4NO0A 5JHDA 1I1FB 4HUWB 4NZDA 5DJDB 4XCEA 3B3IA 5JMRA 3ZMRA 3PL6D 5K9KA 3LS4H 1X5GA 1U2CA 2R0KH 3LPGA 4R7DB 4RGNC 4KI5E 3P30H 2JCCA 5DJAA 4OAWA 4Q9BA 3W11C 3QA3B 1OCWL 4JCMA 4XNMA 3DETC 4QCIA 5I71C 3HG1A 1A3RL 3KVQA 4ZD3L 1NBZB 3CMOL 5JHLH 1ZT4A 2Q7NA 4KTYA 4XVUC 1ZVSA 5GZOC 5CWSA 4K2UL 1D6VL 1LEIB 1KB5H 1MCJA 1M1SA 2QHLA 2WUBH 2MQCA 3W0WE 1BP3B 2YK1H 2EKJA 2YPLB 3HZYB 5DJ0A 4DVRL 1UXWA 4PP2A 3BI9X 4Q7DA 3DO7A 3GI8H 2GFBA 1IC7L 4PTUB 1CXIA 3Q0HA 2QQLH 1TQBB 1J86A 3MLTB 1WJ3A 4H26A 2PTTA 4LHUA 3MNVB 5FYJD 2WW8A 3ZT6A 3HNTL 4KMTL 5C0RH 1A9EA 4U1JB 3MO1B 2ED9A 3HPJB 1D5ZB 2ERJC 2P5EA 4X5WB 1U0QA 4FHBD 4AT6A 2EE6A 5I73B 3BKYL 4G6JL 4KUCF 3ES6B 1UGNA 1MWAB 1P84K 1P6AB 2ZWLT 1T0MB 4R3SB 1W72B 5F8RC 1FNFA 1HH6A 4QRTA 1DQTA 2YD6A 5F9JA 1I1YA 2CGRL 4UOW0 2XRAH 5FGBC 1HILA 3P4LA 3TEUA 1T04B 1DFBL 5ICYA 4P59L 5EG6C 2FHCA 2PR4H 4GRMA 3QPXL 1D5BB 2FX7L 3RKDD 4ELMA 1OGAE 2AK1L 3IU3A 5T1KA 4GSDH 4IDLA 5GGQL 3GUTA 3VE0A 4UBDD 3DIFA 3HMXL 1KTKE 1TNNA 1UWGH 4IRJD 5IBTL 5JNYB 2I25N 4HC1A 4JDVA 2C4FU 3DRTA 4DN4L 1OAYH 5GS3A 1U3JA 3EO0A 4M7JL 3E2HB 4FQCH 3IDXH 4PJ9D 4X5XA 4OCYH 4OZIE 3C09B 4RFOL 5DJ2A 5IGXH 1ES0B 3BN9D 4PBVC 3TWCH 1HDMA 5DUMH 2ZSWB 5GJSL 2H1PL 2UWEE 5DTFA 1CICA 1JUFB 5L8LB 4FZEL 1N59B 1WCQA 2D7TL 2E27L 5CCKL 1U8NA 4PJCE 1A3LH 3RVWD 2XG4A 4M5ZH 3HUJE 2DQHL 4HW6A 3RJDA 3QEUB 4AENB 5I6XB 4YBQD 4GG6F 1BFVH 3L3IA 5D1QB 4DZBA 1HH9A 4OZ4A 3FFCA 2H6PB 4XPFL 2ED8A 1AGFA 3SEPA 3BGMB 3GJFK 2A73B 5CIPH 1K9TA 3PWPB 1TMCB 4QO1A 4PRIA 1LDPL 1NFDB 5KG9A 1ZEAL 3T04D 1QEWA 5IVOA 5DO2C 4NC0B 4LVEA 1I3GH 3D85B 4ZFFA 1J9CT 4LF3A 2WWMD 4CMMB 1NL0H 1RI8A 3AS2A 5BXFB 3SO5A 2V17L 5J1TC 4JY6B 3VH8A 1RZ7L 4V2CB 3ECBA 1QRND 1ZT7A 5FGRA 3EFFB 5HHME 2FYYA 3H7BB 1ZA3B 4NQDD 4PUBH 3RFZC 1MCPL 1LO2H 4JM4L 4RZCB 3CPLA 3KS0H 2EIZB 3BYTA 5MHSE 4PY7A 2AJ3A 4Z7OF 2WQ8A 3S97C 2J7LA 5I0ZA 1VESA 1KXVC 2Y7QB 3I2CL 4POZC 3FMGH 5AG9A 5IF0B 3NH7H 4N0UE 1CXLA 2DMCA 5C07A 3SDCB 3H9SB 3TN0C 1JNLL 4X4ZA 3ARDA 1U8OB 1IC4H 4P2QA 5JLZA 3Q5OA 3OSKA 1GIGL 3HB3C 4WO4D 4XMKL 5FM8A 4IHOA 1KCSL 1XGRA 3QJHA 3V8CA 32C2A 4HIXH 1H9VA 2KZ1B 4Z7UB 1AHWC 1YEFL 4TNVK 3GIZL 4M48H 1C5DA 3QCVL 2R0WL 5I8CA 1IAIL 2UY6A 4OCNC 2MCG1 5IMLB 4UTAH 2W9DH 1V7NH 2R0LH 2AJVH 1TZHA 4ZUUB 2EDQA 1KCVH 2VLKD 3P4NA 3BWUC 1CWVA 3VXUD 2P5WD 2HT3D 3NIGE 1IEAA 3PHOB 4XXCC 1DEEB 3SKNA 4YBHA 5I1HL 4PRNB 2J8UF 3THMH 4CU6A 1WAAF 2FJFA 2XKUA 4LOUC 4M93C 4GS7C 1X7QB 2CIKB 3U0WH 2A1WL 1QSEB 4LQ1A 1T0NB 4WIQA 3I02B 1F8TL 3K8LA 3MV9E 5DRNA 5K59F 1EFQA 1A6VL 1U3HA 4Q6IC 5HHQB 4Y4KD 3TIEB 4YNYB 1FVDB 3IDJA 3EW3B 1RK1A 1Z6JT 1RFDH 4NN5C 5E7BA 3L3JA 5DDHA 5JOEA 2IJ0C 4LHJB 5GHWH 3BZEB 5DZOA 1FYTE 2YN5A 4BZ2L 1NUFA 1MEXH 4ZQKB 3MV11 3C2SA 4D8PB 1S9XB 4E41E 3TBSB 4NSKB 1KTLB 4XNUL 3SDYL 2A9NH 1KCUL 3GMLB 2I07B 2NY4C 4K94H 3SY0A 1LWRA 5I1IH 5DJ8B 3L5JA 2AJYH 3MGOA 1FDLL 1MLBA 1HHGB 4TVPL 1J11A 2DQTH 4G7VL 5ESAB 1Y18B 1KGCE 1CFSB 4NGHH 2P8MB 5I71B 2VSDA 2GYSA 5ANME 3ARGD 2VERN 5B38A 2BVOB 1CGYA 2IPTH 2JF1A 5TPWL 4QRRD 2ZUQC 4X8XA 5GZNC 1KJ2A 2QSCL 2VO5A 2YBRA 4Y88A 2WZPD 1MCOL 1BOGA 4PYGA 5F7NC 1D9KD 3VXQA 3L7EA 2NLJA 2ICEB 3TZVA 2YEZB 4QHKI 5BZWB 3HE6A 3BEWA 3L3DA 2X4NA 4DEPC 5IMOB 5F1SA 5HYJA 1GPOL 1A2YB 4JPWL 4LAQH 5I17B 3IXTA 3ROLA 1CZ8H 1K3IA 2R2BA 2EZ0C 1Q9WA 5CEZE 1F3DH 3LCYA 1CGWA 3JVGC 4HHAB 5ISZE 2HMID 3AREA 4PGBB 2ERJB 2HFGL 3UTQA 4Q97A 5LQBL 3OKOB 3NCJL 4LP4A 1IGFL 3LKOA 2RHEA 5AAMA 2DQCH 4YO0B 5C0CB 4RDQF 5E9DD 5B39B 1OT1A 1N5YH 4XZUA 1CE1H 1VEPA 5E2TH 4Z7QE 3WFDH 3NCBB 2R23A 3RY6C 5F7FA 4YHMH 2PYEE 3DARA 3U0TB 1F90H 3C8KB 2XKNA 1SEBB 5CFHA 3DVIA 4LMQI 1A7QL 1EFXB 2FECI 1DBBL 2EDXA 2G75A 2WAHA 3QRGH 3BRFA 4NQVB 5TDNA 1AO7A 4GKZB 4H25B 3INUH 3SGJA 4KRPB 3ARBD 3U46B 3LQZA 3SCMC 5M94B 3B9KA 1NGQL 1B9ZA 1FIGH 5T1LB 2PXYB 4RNRB 1JGDB 3VFMA 4JRXA 4JRWA 3PQYE 2YD2A 3MJ9L 1NBYA 1A02N 5CJOH 5E8DL 3P9WB 4NRZA 1RZGA 2NW3A 3MYJA 2XACC 3D2UD 4L8SA 4QKXB 2IGFH 2SEBB 4WGWB 2MSPA 3ZDXF 2OXHA 1K4CB 3AU1A 3BAEH 2GT9A 5FK9A 3DRQA 1MNUH 4P9ML 3CCHA 4MLSA 2AABH 1EPFA 4LGRB 1IEBA 5D6CB 1S9VA 2C3VA 2MKWA 5CSBA 1HHHB 4JQXC 3BJLA 4XWOC 1IGCL 5FM5M 4V1DB 3CFCL 2VC2H 3BKMH 1JPFB 1SBBA 1YEKL 3S88L 1FGNL 1K2DB 4QRPD 4QXGH 2H32A 2X4TB 1HQ4A 5ADPH 4POUB 5J57B 1T7WA 1U8LB 4OGYH 4KKCD 4DTGL 2B2XH 2P8PA 5EBMA 1MRFH 2BMKA 2IPUK 5CKGA 2AKRB 2F8XC 2VXSH 4NYLA 4X7EC 3O4LE 5TDPA 2AV7A 1OP5H 3QI9A 2AI0H 4KQ4L 3FZUC 1NBVL 1ND0A 4HAGA 1FVEA 3D39E 1T1YA 1AI1L 3HZMB 2F54B 4NQXB 4OCWH 3EHBD 3VGHA 2D2OA 1NLDL 3FQXB 4RMTA 4NHUA 3UC0H 1JNJA 3S98A 3BPOC 4NHCL 1BJ1H 3W39B 4XGZB 5J4MA 2YD8A 2DYPD 5CS7A 5H2BA 3VCLB 3ARXA 5T1MB 4LLAA 1A6UH 5CEYA 1Z3GL 1RUPL 4A6YB 2IAMB 4QHNA 1S9WA 1CFNB 3G6JF 3OPZL 1FSKB 3RZWA 2RGSA 2B4CH 4ZYKA 3JWOH 3PGCB 4NRXB 3BMWA 2XTJE 1MI5B 2EDHA 3ARUA 1CD8A 2WWKO 4GG6A 3MJ7B 4GKSA 1CFQA 7FABH 1C16B 1TVBA 4LPYA 2EIBA 5SWSA 2FSEB 1O0VA 3JWDC 3UBXI 3C5JB 1RUAH 1T3FB 2AEPH 1FAIL 2WBJD 4MJIA 5A2LH 1RJLA 4FFYH 4L29A 3OKDA 3WDJA 3WDHA 5DRXA 4GS7B 5ICXA 4NM8H 4WI7A 5HI5D 5EO0B 1MLCB 5DLMH 4HCRA 2F8OA 4UT7H 5J06A 5JA8B 3QDAA 3LRSB 2OL3H 2DL2A 3ETBF 4X7TA 1HSAA 2Q6WB 2FX9L 4LRNH 4RX4D 1FZJB 2VLKE 2R1XA 3SJVE 5DD5H 5DUBA 3QDMB 1DUYB 5IFJB 4YQXL 2LU7A 4LK4A 2I9TB 4XVTL 4OV6F 3DVGA 2M8XA 4NCC1 2BDNL 5DK2B 2ZCKL 3O0RL 4QNPE 3N50A 1U58B 3QJFA 5D96B 1WGOA 3MRQA 3OF6D 3QIBA 1HIML 1KB9K 5FEBA 3TV3H 1NKOA 5I2IB 3HAEA 1C1EL 1ZHKA 3CX5J 4ODXB 2DWDB 5I8KH 1R3IH 4QRUB 2R29H 2FRGP 2W0PA 1YC8A 1IGIH 2GK0B 4OLWH 4W6YB 3ULVF 1ZANL 4IRSD 3WN5B 4M9PA 5F88A 5EH1A 2V2XB 5MP6H 3OKMA 2ORBH 3O6FC 3IAQA 3QCUL 2FB4L 1T03H 4FA8A 1ED3A 1M7DB 2ZUQB 4GW5B 2ESVE 4L4VA 5AYQA 4EI5C 4MXQC 4HS6B 4OQ1A 3MR9B 4LRIC 2BXYA 2XQYG 3CAFA 4G8IB 5CD5D 3T0EB 1VPOL 3EO1B 4DEPB 3BE1L 2NYYD 1DVFB 5IB4B 4RSVA 3H8NA 4BQ8A 1C12A 4L9DA 4Z7NF 1FJ1A 5BVJB 1AXIB 2CRMA 2J8UA 4TNVF 4ZO9A 5F89B 4OUUA 5E8NA 5K9QG 4WRLA 1WAAA 3GMMA 4DGVL 3KPRD 3KPPB 3QXTA 4I8DA 3UDWA 3K8KA 4HUMB 1ZHNB 2HLFC 2FWOB 2YN3A 4JPVL 3T4YA 4AEEA 1OCWH 3GSOA 2J3SA 2YXFA 2FX8L 5CILL 2WBKA 5BRZA 1A3RH 4YDJA 1J1XL 5BJTA 4ZD3H 1HHJB 1G84A 3CMOH 1E4XI 3BHBA 4GRWB 2EDNA 3U9PL 2AW2A 5GGTL 1FC1A 4K2UH 1D6VH 5EPMB 1MF2L 5JIHA 1RY7B 5EU3A 5ESQA 4CW1B 3I6LE 3SCMB 3HS0A 4DVRH 1F2XK 1NEZB 4YUEL 1IC7H 3F62A 1GC1C 4DUWA 5E9DE 1ZLVK 2FLBT 4WJ5A 4HIJB 3V5KB 3FB6B 3HNTH 3TN0A 4Z7VF 1M6OA 1ZHBA 3DYMA 4JRYE 1A0QL 1A6AB 3ZLQC 1K6QL 3MJ8B 4LCWE 3BKYH 4G6JH 2O93L 4XAKD 1QSVA 1P7KA 4P2OD 1Q0YL 4I1NB 4KKLC 3O2DL 2CGRH 1LK2A 4JLRA 1GH7A 1DFBH 5C0AE 4P59H 5DRWB 1NH6A 4X99A 3ZZ1A 1A1NB 2HFTA 3QPXH 2FX7H 2AK1H 3IDGA 4P3CL 5GGQH 4L4TA 1I7RB 1RIHL 3HMXH 4XXCA 5IBTH 3WUWG 4DN4H 3LOWA 4M7JH 3HE7C 4EUPA 5DS8A 5A40E 3UTSA 3I6GB 4RFOH 4KI1A 4FXKB 4H20L 4TUJA 5GJSH 2H1PH 4OBRA 5D1XA 5F9WB 3RWIA 4QRPE 2VL5B 4FZEH 2D7TH 3BISA 1HCVA 2E27H 5CCKH 3DXAD 5FYKD 1LE5B 1DJSA 5EFIA 4JEGB 2DQHH 4S10A 1HOCA 4RAUA 5C0IB 4PBXA 1M4KA 4ZXBA 4U3HA 2C1PB 5B4MC 2C26A 5I1LB 3TBVB 3MRNA 4YDLC 4HAFA 4XPFH 1JFQL 4WUUE 4LVOC 1T0PB 3QUYB 4QYOA 2P7TA 3TBYB 2VXQL 1LDPH 1M05B 2F5BL 2VJXA 1A7RL 3HPLB 1ZEAH 1T83A 4R7NA 4PJFF 4PJEF 4PG9B 1LVEA 3L9RB 1WZ1L 3A6BL 1T5XB 4NO0D 1NSNL 2A6KB 5FA4B 4Q58C 2ILLA 2V17H 1A6TA 4LSUL 1RZ7H 2B1AL 4NUJB 5HHNB 2DJUA 4UTBL 4BFGA 4JFEE 4U1HA 4RGMB 5JZ7D 5EUOB 3GBLA 5L2KB 3FAWA 1MSPA 4ZDHA 1DLHA 3WDIA 5D2NA 3IRPX 4HWZB 5SWZA 4M1GL 1ONQA 1MCPH 3LB6C 4JM4H 4Z5RA 2CXKA 1QSFB 1AGDB 2FJHA 5T3XE 2XN9B 3F7PC 5D71L 3AS0A 4QTIL 3MGAA 5E1AB 1UEYA 3I2CH 3T0VA 5IB3B 3QG7L 4TTDC 1F02I 4PJHF 2G9HA 2Q7YB 3DWTA 1FL3B 3R4DA 1FNGA 1NEZG 3LQAL 6CGTA 1YEDB 1JNLH 2EYSA 4PLOB 3C5ZB 1U41A 1JPGB 1TQCC 4YXHL 2I24N 3AMLA 1GIGH 2P43B 3MFFB 4QOKB 2W65B 5E2JA 2MNUA 4XMKH 1KCSH 3DVFA 1L9MA 5IBUB 3NA9L 4HQQL 4LHUD 1IILE 3TGXA 1YEFH 3VMNA 3ARQA 2A83B 2NXZD 3QCVH 2AJZA 2R0WH 1IAIH 3LKSA 1CR9H 4S0SD 2BC4B 3ULUF 4OZGB 2P5ED 5D7LE 1F4YL 3RWDA 4ZO7A 4U6XB 3SDDB 5FKPA 3DGGB 3EOYG 3P40A 3UBXB 3NAAL 4QRQA 2UUDH 1X4YA 2AK4B 4JFOA 4WFGE 3STZA 4CAGA 4AIOA 5I1HH 3MRMA 5BMFL 4P9HC 1K8IB 2HAZA 1I8LC 1IGTB 2XZQL 3G6JA 2A1WH 3OB0K 3O6FB 5T1KD 2FD6L 1F8TH 4NJAL 4HKXB 1A6VH 5GRXG 4C4KT 3QUMA 1V3KA 2OXGA 1TPXB 3V4VL 4TNWK 2WUCL 1XF5A 1HHKA 3GNML 5C9KA 1WK0A 4BZ2H 4ZAKA 1CICD 2E7LA 1NGPL 1CTNA 4DKAA 3SDYH 4XNUH 1T1WB 3LV3A 4PJGB 2J6EA 4WU7A 4G6AC 1KCUH 3S3PA 2R8SL 1DQLL 5KAQG 3SGKA 2F58L 4LPXA 1T7YA 2CIIB 4TVPH 4KPHL 2HWZL 2BERA 2XTLA 4G7VH 2OYPA 2Q8BH 5ACLA 5SX4H 1CCZA 3FOLA 5I1DA 1A14L 3FFCD 4H8WL 1LO0L 3BUYB 4OI7A 5C08B 1T1XA 1PZ5A 2X1OA 5DQJA 5HGBA 1C8PA 4OF0A 2RFXA 1LQSR 4PRID 3BOVA 1BBJA 1INEL 3RL2B 1V05A 2DN7A 1RURL 4YHKL 5E6IA 5TPWH 4F3FB 4HC1L 5IIEB 1CQKA 2QSCH 3IFPA 5CJQL 3ZSSA 1N7ML 2L7UA 3FFDA 1MCOH 1Z9LA 4WI8A 1CXKA 5FB8A 4J8RA 3SE3C 4IM8A 4O51B 1YECL 2X1WL 1R5WB 1GPOH 4YE4L 5KS9E 2XICA 1OP3K 4R90L 1FZKA 2F8VA 4PJAF 1MUJB 4XP4L 3TPUA 4P5KB 3QDGA 1J7VR 2MTPA 4L4JA 4MJ5A 2DAVA 4K8RD 2HFGH 4NQCE 1R24A 4JZOB 4JKWA 5LQBH 3QULB 3FQNA 3NCJH 4PRHE 1IGFH 4ZOBA 5C0BA 4I5BA 3NOIA 4BZYA 3BPCB 5C07D 5JOPD 1MCKA 3ARDD 4P2QD 1AC0A 5HVFB 1CG9A 2J5LC 2VIRA 5EWIL 1JZ8A 1A7QH 3QFDA 1DQML 1DBBH 4U33A 3LKRA 1OLZA 2NY7L 2RJMA 5DD6A 1CVSC 3MNZB 2D9CA 3LN5B 4K3HA 5IB1B 3RZCA 4H1LA 2WIIA 4OCXL 1FVCA 1NGQH 2QADC 1AGCA 3TYFB 4ZUSA 4M5YL 1S3KL 3MJ9H 1FLTX 3X11A 5CMAB 2XQYK 5BW7C 1YYML 1QR4A 2XY2A 3MMEB 4EI6B 3GMNB 3WIHL 2AJXL 4G8FB 5CBAB 4JVPA 4JHWL 3ZKXC 3GKZA 4K8RL 1PVHA 3SGEI 3TVMC 2M2DA 4GO6B 4EQ2A 4F33B 4ODBD 4P9MH 2MPAL 4MWFA 4I13B 2CD0A 1J8HB 5JDSB 2BSRA 2VLRE 3BP4A 5ECJE 1IGCH 2V2WB 5JW5B 3CFCH 3T4AB 1OSPL 2VWEE 2VXUL 4YDLB 1U3HD 2VDQL 3RVVD 4WHTA 3IDYC 1MFCL 1Q9KA 4MCYB 1FGNH 3S88H 3QZWA 5I1CL 4OM0L 1FO0H 1GGCL 4DTGH 2GAZA 2QKIB 4Z7VA 2DIBA 4XI5D 2VISB 4MA7L 5EB9A 4HX1A 2VDOL 1P69B 3UZEA 1NDMA 1BD2B 2BOCA 4MA3A 4WFEE 4DKEL 4KQ3L 5HDBE 2QR0A 3MBEA 5FIEA 4P48A 4OD2A 4KQ4H 1A1MB 1EHAA 5KSUB 1NBVH 1U8KA 3K74B 1R0AL 2X4UA 5EC2A 3OXSB 4L9LB 4P2RA 3U0PB 1AI1H 4EI5A 4CN6A 2OX5A 3AY4C 4MJ2A 3T65A 5JORA 5D7JA 5TH2B 1R5IB 3HRZA 2IALB 2Z93B 5FO8B 5GIRA 2B20A 3IFNL 5FHAL 4NHCH 3CZJA 5LWYL 5JHDE 5C09A 4AEHL 3REWA 4OTXL 5GISL 3LVEA 3BO8A 1QUNA 3QFJA 3H9HA 4HS3B 1TCRA 3DV6B 3WE6B 4W70A 2DMBA 4L5FL 1L6ZA 3CU7A 3LKPB 4P46C 3TZVD 3HE6D 3QEGH 1VSCA 3WJLA 3IDMA 2CLRB 1S8DA 1Z3GH 1RUPH 5HYJD 5C0FA 1JYVA 3GMPB 3MUZ1 3FQWB 3MTRA 3HG1E 3OPZH 1PKOA 3L7FA 3FRPA 3U7AA 4HXBL 4KK5C 3VGAC 1QP1A 3DTXB 4R0LC 1DDHA 4OZHE 4MS8C 4YK4B 3CMGA 4KKBD 1CLZH 1VADA 3L3KA 4X6FA 4Z0BL 1I3RB 4S1DD 4N8VA 3DROB 4L3EA 3TJHD 3HR5A 2NPLX 1UKQA 1ETZB 1FAIH 2XZAL 4PJFA 1YY8B 4PJEA 1KJ2L 3MRIB 4WUKL 3EOBA 3SE4C 4P3DB 3O3AB 1FL6A 1KTDA 3KPMA 1CQYA 4TUKL 3FQUA 1AO7D 5F7DA 5J8OA 1FO0B 5DJCB 3GSWB 4DW2L 1OTUD 4I0PB 3B9KD 3R0NA 4UQ3B 4JRXD 3FO9B 4PJ7B 3UPAA 5IESH 2FX9H 1S7RB 1YJDL 3BZFB 5E0QA 5IFAL 1INDL 1FP5A 2Q8AL 4YQXH 4XVTH 4XHJD 4HG4J 5MENB 4XMPL 4Z7UF 1WSST 1QVOB 1FYHB 2BDNH 3PWLB 2ZCKH 4G9FB 1SBSL 3H9ZA 2E7CA 1HIMH 1U93A 4PJHA 5E2WL 4U1GB 3STLB 5DJ6B 1BVLB 1AJ7L 1C1EH 4KKNA 5L0QB 2WINA 2BY1A 4GRLA 2PO6C 3GJEA 3ISWA 4FFVD 2X4PB 4YGVB 1EH9A 1Q9OB 3FOMB 4J3XA 1ZANH 4N1EA 4P2CG 3IRZA 5IVXE 4GW4A 3F7VB 4PV8B 3QCUH 2FB4H 2DQJL 4MNGB 5F7EH 5J6GB 2H9GB 1QRKA 3RWCB 5CEZL 1IC5L 3RUGE 3IFOB 2BOBA 4MA8L 5TQ0H 1NEUA 1T21A 4HIHB 1DL7L 3QDJB 4PLJD 3IYLW 1XF4A 3QI9D 1VPOH 4MDJB 4OF8A 3IDUA 4R97B 1WBZA 2LV4A 3BE1H 4KUCD 1CDBA 1S9KC 1MH5A 4UB0L 3QEQB 4PB0L 1YN6A 4LKXA 3EGSA 4LLDB 3IF1A 1CDIA 1NGZB 4DGVH 3RIFF 2H8PA 1K8DB 3OAYK 5JQHC 5CJXC 3P77A 1DE4A 3BDBA 1L4IA 2PW2A 1KCKA 4JPVH 4HFWB 4XP6L 4NBXB 1DBJL 3ZDYF 3KXFA 1UQSA 4RA0C 5CILH 4PGCB 2EH7L 3U1SL 1FZOB 1QKZH 2GJZA 1R3HA 1OTSC 2J5LB 2Z4QB 3RGVA 2BVYA 3U9PH 1FFNB 5GGTH 3QHFL 1F11A 4C59B 5A43C 4Y4HC 3K80A 4JFHE 3RWFA 5L2JA 1JPSL 3NCCB 2EDJA 5C0DA 1WISA 1RZKC 2YZ8A 2LVCA 2CXGA 5IEKA 1PW3A 1BFOA 4JVUA 1I8MA 1HYSC 1U8IA 4YUEH 5EDXA 3WHXA 3OXRB 1QLFA 3U9UB 3CC5A 1RZIA 3NFPA 1TFHA 4PJ5B 5KOVC 3L5WB 5SWSD 3VFSB 2A0LD 3V9FA 3PG2A 1A0QH 1H3VA 4MJID 3MRKB 4WFHD 3LSOA 5F3BA 4FQJH 1P4LB 4YHPB 3VFOB 4ISVA 1KSRA 4ONHB 2DWEB 2J12B 4E5XB 3O3DB 4X0KA 3VWKC 2OZ4A 2GCYB 3DUUB 4Z0XA 3TLRA 1Q0YH 3O2DH 5IG7B 1QA9A 2AV1A 2QJDA 4LP5A 1KPRB 1KN4L 1G7HB 2CDFB 1NUNB 4PJAA 1I1FA 2IC2A 2ADIB 2GJ6B 4HUWA 1DTUA 4P3CH 5DJDA 1RIHH 3RAJL 4M6NH 2EO9A 5JOFA 3HI1A 2KPNA 1W0VB 1R5VB 1VFBB 5FO7A 3PDDA 3JV5A 2XKSA 4FQXC 1RK0A 1MCDA 3X3FL 1JHLH 2GITA 2XZZA 3QIBD 3MLVL 4XTRD 3VRLE 1QLRB 2LE9A 4H20H 3W9DA 3B8YA 3CD4A 4HJJL 4JM2C 1KELL 1ODAA 3UTTD 4GXUM 4HV8A 4YXKH 1SYVA 2A6DB 5KSAC 1KPUB 4NQSB 2YSSA 4FTVA 5IEHA 2VN7A 3GMRB 3A6CL 4NKDB 1QOKA 4L4VD 4P5MB 5FGSA 3C6LA 2YPLA 1JFQH 1REIA 1MHCA 1LNUA 4LPWA 2VXQH 4PTUA 5HGAB 3SBWC 2GTZB 3QWQB 1A7RH 1ZS8B 2O5YL 3MLTA 3BWAB 3QNZB 4GUPA 5F1NA 3BDXA 3UTZB 2DQFB 1WZ1H 3A6BH 2VZTA 3PWJA 3V8OA 5E8OB 1NSNH 1BZ9A 3FHAA 1KCRL 3MO1A 4LSUH 1YMHA 3VGAB 2B1AH 3HPJA 4KK8D 3BXNA 4X5WA 2R2HB 2XWJB 4UTBH 4ENEC 2OM5A 1LO4L 4JQVC 4FQIL 3ESUF 3BZDA 5C0GA 4O2EB 4O2CB 5HVWA 2C3XA 4M1GH 1T0MA 4R3SA 1W72A 3S35X 1I3UA 5BRZD 4CNIA 1UVQA 3P9LB 4KJPD 1T04A 4ODTL 4UDUA 5D71H 1Q8MA 4QTIH 4XNYL 5TDOB 1KV3A 3RNKA 1JGEA 5F1IA 1F45A 1JWMB 5EO9B 3ZO0A 5ERWA 5EU7C 2C1OA 4JY4A 3RIAF 1BJMA 2DLEA 1NFDE 3BVNB 3LQAH 3DX9B 5KZCD 1T66C 4YXHH 4ZTPL 2JB5L 3RL1B 4M7KL 3GSVA 5LVEA 4CU8A 1I85C 4X6DE 4POZD 4AIZB 3CFDB 1KNOB 3SE8L 2A6JB 3NA9H 4HQQH 5DHYA 4XXDB 3S35L 3BN3B 1JUFA 3IXAB 3DX6A 3LIZL 1N59A 3O3BA 5HDOA 3T2NL 4GXUN 1JV5A 4OGZA 2B4CC 3JWOC 4IDJL 3CFEB 1AO7E 4AQ1B 4Y16B 1F4YH 3ZKQD 5GGSA 4NUGL 3RDTB 3BQUA 1Q1JL 4ODWA 3NAAH 3RWGB 4U7KA 3AGVA 2NY1D 3BGMA 5KSBB 2A73A 4LLVB 5ELIA 2VITA 2ICWJ 3U82B 4RWYH 4WNQB 1T2XA 5BMFH 3GGWA 1M7IB 3ARTA 2VR5A 2XZQH 4Y5XB 3D85A 3WO4C 1V3MA 1A5FL 4G6FD 2FD6H 4CMMA 2YXMA 3GB7A 2NX5B 4L4TD 2VUOA 3VGGA 4NJAH 3AB0C 4OQTA 3VFRB 1YEGL 3TVMA 3V0VA 3JTTB 4U6TA 5CZVL 5DSCB 4QHLA 4LPVA 3K2MC 1ZOXA 3TO4C 5IP4A 3VXSB 4LOUD 2WUCH 3D0LB 3FTGA 3GNMH 3UTSD 1WC7B 2VZ1A 2EYTB 1VEMA 4OFPA 5D1XD 4RZCA 4M61B 1EEZA 3QNXA 2EIZA 1NGPH 1OGTB 5D2LB 3ZHDA 4HEME 3SQBA 3M17B 2R8SH 5I1KL 1DQLH 4BELD 2F58H 4B7IA 4RMSA 1ZLWH 2E9JA 3GHEL 4KPHH 1IT9L 1L7IL 2HWZH 3PXHA 4ZXBD 4M4RA 3D25B 3P4MB 1A14H 3H9SA 4H8WH 5IV2B 5EC1A 3KGRA 1LO0H 1J0IA 2OJEB 1HKLL 4FXGB 5C92A 3LQMA 3D3VE 1QSEE 3T08A 1INEH 1PKQE 4F2MA 4YHKH 1RURH 3BMVA 4HC1H 4Y4HB 3CVHL 1BM3L 1UYWL 5CJQH 3JBG7 1N7MH 1JYXA 2HTKD 4K7PL 5D7IB 3QO1B 3Q5TA 3VXRB 1WEJL 1SMOA 2XOTA 4R26L 1C08B 2IBGA 1YECH 3IJYB 1CFVL 2XA8L 4XBGA 2V5TA 1EVUA 5DRZA 4YE4H 1XAUA 4BH7B 4R90H 1YNLL 1UH3A 5HI3D 5HSFA 5SWZD 4D9RE 4XP4H 2MJWA 4RGNE 4N5ED 4MVBC 4PRNA 4EVNB 3VFGL 1W0WB 4I18B 2CIKA 3VWJC 5ITFA 5J11C 3G9VA 1L0XA 3QIUC 4BSVA 3N9GL 4CDHA 5DI8B 1CS6A 3H0TB 1S7UA 3VWKB 2EZ0D 1FORL 4N8PA 3HTLX 2YD3A 1E6JL 1BWWA 4GG6E 4G6ML 2NY6B 1BVKB 5HXMA 3D0VB 5EWIH 4XVSH 1GGIL 1DQMH 4JPIA 3BZEA 4O02L 5EOQL 2NY7H 4YHYC 2AXGA 4H5SA 5GRUL 1OTTD 2P8LB 3BEVB 3RI5K 1KTLA 4WFHE 1CK0L 4OCXH 3QO0B 3GMLA 2WWKT 1FNLA 4M5YH 5T5FL 1S3KH 2DI9A 1YYMH 1ZGLB 4BA8A 1Q94B 4X7DC 3WIHH 2AJXH 4JHWH 3PL6C 4K8RH 3E6HA 1ITBB 1KCLA 4S1SL 3JXAA 2OS7A 2MPAH 2Q86A 5I1AB 4CMHC 9CGTA 4C56E 2MHAA 2GQHA 2K3TA 5I74B 4UNVA 1YN7A 1OSPH 1P5UA 2IANA 4OLUL 5ALCL 3BW9A 2XV6B 3MODL 3NA4A 1SEQL 2VDQH 4YDKL 5EZJB 5C8JB 1MFCH 2YEZA 5DHXB 5BZWA 4KZDL 1NAMB 4OM0H 5IMOA 4PY8J 5DT1L 1GGCH 2O61A 1I7UB 1BQHB 4Y4FA 2EC9T 3UTOA 4MA7H 1JNNL 4ZAKD 3CSYB 1HNGA 5HVHC 5CD3A 4QHUB 1R6VA 2FBJL 4DKEH 4F7PB 1JK8A 1OQXA 4WW2F 3V6ZB 3O4OB 2VYRE 4YO0A 5CZKA 5C0CA 1U95B 3KNBA 1MREL 4HGKC 1R0AH 4X4MA 2CKNA 3ALWA 4LCUB 3WS3B 1UCBL 5IWLA 1WIUA 4S1QL 3R8QA 3U0TA 1IKNC 4FQPA 1G0YR 1A7PL 3CDGB 3ZE0F 1WBYB 4MAYA 3IFNH 5FHAH 1LE9A 4UU9B 4DKDC 1P1ZA 5LWYH 1I9JL 3FZUD 4NQVA 5E6ID 4MB4A 1IRAY 4AEHH 4H25A 4OZIB 4OTXH 5KAQF 3WO3B 3S37X 1W0YT 2UWEB 2CK0L 4L5FH 1RMFL 2PXYA 4RNRA 4MHHI 3P73B 3QB7C 3O6KL 1EIBA 5CJXA 3RKDC 4PJCB 3FN0L 3HUJB 4UBDC 3QQ4B 4IMKC 5C9JA 5L88L 5BRZE 3GSRB 4IRJC 4OFIA 4AEFA 3ULVD 3QDGD 4HXBH 3TNMB 4PJ9C 5TE7L 3SKMB 2Y72A 4KV5F 3BN9C 1HHHA 4Y1AE 5DHVH 2VL4A 5AUMB 2NXYD 3ZHKA 4V1DA 1QQDA 4K71C 2YD7A 5C0BD 3S37L 5AD0B 2NY0B 1FAKT 5D7KE 4Z0BH 1PZUB 1FZMB 2VLJA 3RVWC 4BK5A 1WWAX 3HA0A 4D3CL 2OSLA 4P57B 1S7WA 1K2DA 1RUML 2X4TA 1KJ2H 4WUKH 4YBQC 1GOFA 1IGML 1J0HA 4TUKH 3VFUB 1WBXA 2IBZX 1FFPA 2AKRA 3FT2B 3MGTB 3RZCD 4DW2H 2PUQT 5FV1L 4MNQE 4K3JL 3V4UL 4HK0A 4R4ND 1WQVT 3WFHB 3QQNA 5E5UB 1KXQE 1YJDH 5IFAH 1INDH 2WWMC 2AEIT 2Q8AH 4ZG1A 3OJMB 5GRVK 4QHMA 4U1MA 5C86A 3HZMA 1XGTB 4N0UB 2CSPA 2F54A 4XMPH 1MI5E 3RRQA 1JYNA 3PNWA 2BHZA 1KLUA 2X6MA 4U1KA 4YBLC 3UP1A 2V7NA 1SBSH 3WJJA 5DA4A 4OB5L 4O58L 4X8JB 4BJLA 4L4TE 1F3JA 5E2WH 4NZRL 5JXAL 5JO5A 1AJ7H 5E24E 1AQKL 1MELA 4HLJA 3VCLA 3QIWB 3TBWA 5DZNA 3UTSE 2B0SL 3IKKA 5DEGB 3MNWB 4OFKA 1BQHG 4HF5L 2ZOLB 3TA3A 2DQJH 4JO1L 2CLZB 4QWWD 5CEZH 1IC5H 2FL5A 3MLWL 5CSZB 3H2WA 4MA8H 3KDMA 3Q2CA 5AYUL 5KSAA 1DL7H 4WO4C 1A7NL 4TSBL 3S5LA 3MBED 5EO1B 2Z35A 3MJ7A 2Z31B 4X98A 2HA1A 1DR9A 4PRPA 1JPTL 1URLA 4P2RD 4UB0H 1UB6A 5DHVB 3K0WA 2ATPB 4NN6C 4P23A 5EU4A 4OIBA 5D7JD 3BIKB 3MV9B 3ZYZA 4YR6B 1XGPA 4J2XA 4NCC2 4LEOB 4OI8A 3VWJB 5IROA 5J1SC 4ESKA 5C09D 1I9IL 2HT3C 1XGYL 3NIFE 4XP6H 2DLIA 3QPQD 4KJQD 1AGEA 1DBJH 3QFJD 1J0JA 2EH7H 3CXDL 3U1SH 4FMFA 5D5MB 3G6DL 3LRSA 3RP1A 4E41B 1FRGL 2Q6WA 2BVQA 2JELL 2HVJA 3AFLA 1FZJA 4X6EA 4A2MA 5FUCC 3QHFH 5C3TA 5IFJA 2PYFA 3MV7E 3U2SB 3QWRA 4TVSa 2QTEA 1JPSH 5E6YA 1NCUA 3K4DA 4Y4KC 4YHZH 3MA9L 3HC0B 1FNSL 1EAJA 2ATKB 3MRDA 3WUWA 4X7SL 5IR1B 2EE2A 4NBYB 4ZUWA 5I2IA 3L3GB 4U3XA 1VFMA 5FKAB 4IMLA 3ZT5A 4QRUA 2GK0A 4AQOA 3PL6B 4L3ED 4XC1L 2Z91B 4AK1A 1MJ8L 5EA0L 1XF2B 3DYPA 1I85A 1ZHLA 1T5WB 1WFTA 5ETUB 1JIBA 3CVIL 3LDBC 4TUOB 1T7VA 4U49A 4GRWE 4W81A 4EOWL 1FPTL 1KLGA 3ARGC 3MR9A 3V5HA 5ESVA 4CJ0A 4G8IA 4N90E 1KN4H 5C6TL 2NY3D 3B5TA 5GS1A 2HJFA 2ZSVB 3RJQB 5IB4A 5JMOC 4IJ3B 2R1WB 2PW1B 1D9KC 1HI6B 2IWGA 3RAJH 1MRDL 4PLKD 4JFQB 4X9BA 1KXTB 2PYEB 4LLMB 3ZYOA 3X3FH 2BJML 4JZJC 1ZHNA 3MLVH 2YS4A 4Y19A 4HJJH 1KELH 4GRLD 5DF0A 5LJYH 2HMIC 3WMSA 5I76B 3VDBA 5HHOE 5MEPB 5KANI 3PQYB 3F8UB 5EPMA 3OJVC 5I75C 1GL4B 3A6CH 5J6HB 4JKKA 4HZLA 3ZE2F 3KPLB 5CHNB 1HQRB 1NEZA 4J1UB 3T1FA 3ULUD 2DIJA 2ZKHL 3BH8B 4CVZA 2O5YH 3E0GA 2AS5M 3PV7A 2XNAB 3F6LA 3ARBC 4ODVL 2GY7B 4MQ7B 4IRJB 4UMGA 3PDOB 5DMKA 1KCRH 3OGOE 3VMOA 3SQOL 3IGAA 3HAEH 1FFQA 1LGVA 3MJ8A 1LO4H 4FQIH 5KTEL 5TJWK 3LEVL 4HKZA 1N3NB 2C3GA 3CFKA 1T89C 5HI4D 5IHLB 4ODTH 3RGVD 5D4QA 4XNYH 1FE8L 2ICES 4N5UA 3T2OA 3ULUL 3ULSA 1I7RA 3EOAB 3FB5B 5F3HB 3D39B 1RZ8B 4FABL 3C5SB 3PP3H 1FC2D 2NY2B 4HUVB 2AQ1A 2FATL 4WW2A 4ZTPH 2JB5H 4M7KH 3I6GA 4U6YA 4OD1L 1RZJL 5C0NC 2FO1A 5JIPA 3QIUA 4FXKA 2WK2A 3SE8H 4TTGA 1T22B 5CJ5A 2OTWB 3NZ8B 3S35H 1XCTB 1G6RB 3BD4A 1KPVB 3LIZH 2VL5A 3OJ2C 4YBLB 4I3SL 3T2NH 1LE5A 4FP8L 5EU5B 4IDJH 4Z7NE 1H3XA 5C0IA 5IHUL 1FFOA 1UADC 4NUGH 4KC3B 1CD1A 4NQDB 1QSFE 1Q1JH 2D31A 3DV4A 1HSBA 1Y6MR 2XN9E 3EHBC 2NW2B 3QUYA 3X14B 3DX7A 1M05A 4G5ZL 5EN2B 3BGFC 3RPIA 3ARVA 1QPXA 4U0RC 1AQDB 3MRLA 2XTJB 4PG9A 3L3OB 3MRGB 3L9RA 4NOBA 1A5FH 4UILL 1KEGL 5BS0A 2A6KA 5HYSB 1I1AB 1YEGH 5CZVH 1XGQA 4QOKE 1FG9C 1LEKA 3RNQB 1E28B 5LGJB 1N26A 5L9DL 4OBSA 1DQJB 5JPMB 4PJ7F 5L2KA 4IBLT 2EE9A 4HWZA 3RVTD 3RKPA 4XCYB 5TGBB 4KXZH 1JWSB 2Z8RA 2X2YA 4NN6B 3W82A 3QXDA 1WT5A 1AGDA 1UM4L 5KVMC 4GAYA 3UJTH 1O5DT 3C9NB 4FTVD 4DZ8B 5I1KH 2OZ4L 4ONGL 1MRCL 2UY7A 1H8SA 4PJDF 3GHEH 1IT9H 1L7IH 2VLKB 2WP3O 2HT2D 1FL3A 1G7PB 3VXUB 1G7MB 5CJ8A 2CH8A 4RMVA 3C6LD 1JJUA 1YEDA 2YPLD 4HJ0D 1EHLL 2WBJC 3X3GH 2VLME 3C5ZA 1OB1B 1JPGA 1ZLUH 1S5IL 3MFFA 5BV7B 5HI5C 1UT9A 3IJHA 2X4RB 3GBNL 4I3RL 3TJEL 3MLPA 3TNNA 2FR4B 5CP7A 4OV5B 3CVHH 1BM3H 1UYWH 4Y4KB 4EUPH 1N0XL 4K7PH 2HT4D 3ARFB 3IS1X 2EECA 4M3KB 3D6GA 4XC3L 4ERSL 4Z95L 1OW0C 4XNZC 3CUPB 4ETQA 5BOZG 1RJZB 1QFPA 2CPCA 2Q76B 4M9OA 5C09E 2EXYD 3T0AA 4L8CB 1CDUA 4R26H 1FV1B 1CFVH 2M1KA 2XA8H 4U6XA 3SDDA 1JPST 3QFJE 4JFDA 1H5BB 5K93A 3D69A 4PJGE 3MRCB 1MCIA 1YNLH 3W81A 2ESVB 2AK4A 4R8WL 4LCCB 2FNBA 3VFGH 1MJJA 1T80A 2MCPL 4X6CA 1P2CA 4FQHB 3WLBA 1IZJA 1GZPB 4OD3L 3PIQB 2W0LA 4LLQA 3N9GH 4MHHG 2KQMA 3FHQA 5D7SL 4I2XE 4HKXA 3L6FB 1FORH 4IRSC 4BZ1L 1JVKA 1Z9OA 4S2SA 1E6JH 5DJXA 5LGKA 2CR6A 2YRZA 4G6MH 2FIRT 5INCA 1X5ZA 4P49A 1HEZB 1DQDL 4QRRB 3W5MA 4O02H 5EOQH 4L3EE 3RWJA 5I16B 1JZ7A 1U8MB 3AVEA 5GRUH 2LTQC 3MUHL 3WXWL 4KZEL 1PD6A 4PJEE 3L5XL 5CD5C 3ALPA 3N0PB 4Z78B 5T5FH 2VDKL 5J89A 2NYYC 1EO8L 1MWAL 3JSSA 4Y2DA 1W72L 4JZJB 1OP5K 1BMGA 3AC0A 4IOIA 1MQKL 3BQUD 4YC2B 4K9EL 1P7QA 4JAMA 4GQ9L 4U6HB 1CLCA 2X9YA 3IETB 4YFEA 1BLNB 4S1SH 3KPSA 3RL2A 1FL5B 4Q0XL 1IGYB 3D85D 5E9DB 5I75B 5HYSG 5IIEA 4FZ8L 3MRJB 4NFDA 1A21A 4KJYB 2N1KA 1BIIB 4OLUH 5ALCH 5GGUB 3MODH 1SEQH 1YPZB 4YDKH 5J12C 5GRYA 1BHGA 1EERB 3T3PF 4KZDH 1EEUA 1U8QA 5DT1H 5GPRA 4PJ8B 4OKVA 4PD4J 3ARBB 4LCWB 1MUJA 1JNNH 3I50L 3KLHD 1UH2A 4U1IA 4WI3A 2A74B 5K9OB 2FBJH 3B2VL 1G1CA 3DSFL 4WEBL 4HBCL 1MREH 2OTUB 1NCAL 2QQKH 2IEPA 5GS0D 3H9SD 2HH0H 1UCBH 2YC1A 4S1QH 5HGDB 1J8HE 2W91A 4G43A 3PJSB 1ZV5A 1A7PH 3VG9C 3BIBX 4WO4A 2P42B 4XCCL 4OQTL 1D5MB 5J0BA 1I9JH 1D5IL 4RIRA 4MMZC 4P2OC 3G04B 4JHZA 2I5YL 2CK0H 1RMFH 5ADOL 4QRPB 4XP9L 3QUXB 3O6KH 2FH6A 3FN0H 3VD9A 4EI6A 1H0DA 3FQRB 3KXFE 5L88H 5CBAA 3QRFM 2V2TB 3EYSL 3M1BA 3WEXB 3IAPA 1J87A 1GXEA 1JE6A 3OKEB 5ENWA 4B5EA 4WUUB 5TE7H 4IS6B 4YWGL 1QFWL 3L95B 5GS0L 4EXPX 5IMKB 3GJFH 4PLNC 5DJZA 3CZFA 1HKFA 3S37H 4W4OC 2E7BA 5LXGL 3PABB 1AGBB 3KJ4C 2CRIA 4D3CH 2FJGB 3IDXL 1N0LA 5DK0B 1RUMH 1A6ZB 3VFNA 4BQBA 4XNQB 3BGFB 4JQIL 3HI5L 2APFA 4JFEB 2DYPB 4RAVA 2I27N 3OJDB 3RVUD 1K3ZA 2P24A 3PWVB 3RWEA 4NPYB 4OLVL 3NCMA 3EZ8A 1BD2A 4AL8L 1DQQB 1BZ7A 2CDEA 2GIYA 3BP5B 4K3JH 5D6DA 3V4UH 4F58L 2YRPA 1KOAA 5SWQB 2GUOA 4R4FL 4L9LA 5E56A 3U0PA 3ZTNL 3C8DA 4U2ZA 4KRMB 1OAZL 1QBLL 1ZAGA 1XR9B 4PGZA 2R9HD 2VB5A 3VI4F 1LP9F 2IALA 2PKDA 3DBXA 4GW1B 4XBPB 3SKOB 5FO8A 5IK3A 5JZ7C 1EEQA 1R3JB 4EN3B 4PJAE 4OB5H 2R56L 1U2HA 4OFYA 4NC1C 3S7GA 1G7LB 3S96B 1JZ2A 4NZRH 5JXAH 3J7HA 4QF1A 1AQKH 1ZSDA 4HS3A 3DV6A 3Q3GB 1PG7W 1NANH 4M4PA 3LKPA 4KFZC 2EC8A 1OVZA 1G1YA 3LMJL 3GSNB 2B0SH 4YPJA 2HFFB 1T2JA 5F97E 4HF5H 5C71A 2IH3B 3MJ9A 3NIDF 4H1LH 1F6FB 4WI4A 5D7LB 5CBEB 1GYAA 1CL7I 4JO1H 4Y4FD 1DUZA 3MOAL 3GSXB 2QSTA 2BX5A 1PFCA 4S0TD 3DTXA 5B8CA 5AYUH 2JJVA 1A7NH 3FMGL 4TSBH 3SKJL 1SHMA 2VDNL 4G3YH 3A67L 5C0CD 3SHSA 1JPTH 2NXZC 1IC4L 3OWEA 1ZTXL 4MQSB 2H26B 1ETZA 1G9NL 3VGEA 5D2LF 4NOFA 5JQ6L 2ZG2A 3OQ3B 5AWNL 5A16A 1GOGA 4JGUA 4MAYD 4P3DA 5E7FA 3C60A 1TTGA 1I9IH 3KLDA 4M1DL 1FO0A 3HZVB 3KYOA 1KJ3L 1XGYH 4KRPD 1TJHL 5DJCA 3U4AA 4I0PA 4M3JA 4M6AA 3CXDH 3X12A 1WZMA 4H8WC 2PXYD 3G6DH 1FRGH 3F7YB 4LCYA 4MNGE 3JV4A 1S7RA 4LU5L 4MNHB 4PJBE 2JELH 4ZOCA 3D2UA 3V4PL 4LIQE 5MENA 2BRQA 1EDQA 3UAJD 3MA9H 3PWLA 4G9FA 3E6FB 4UQ2A 1FNSH 3HC3L 5AEAA 4WHDA 3U4EB 2Y1VA 3CX5K 4X7SH 2H41A 4ORGA 4NNYB 4PJDA 1LO5A 4PJXB 2AQ3A 2KZWA 4M8QA 4R2GB 1BVLA 2HRPL 4FNLL 4V1DD 4ZUVA 1DCLA 1NGXB 3MBXL 1MCHA 2MOVA 1U8HA 1I7ZB 4WTXA 5JXEA 1Q9OA 4XC1H 2VLJD 3L3HA 5D70L 1UWXK 5EA0H 2MQ0A 3F7VA 4R96B 3QUZB 4GFTB 4NKMB 1W2KT 5GHWL 5FOBB 4PV8A 3OR7A 3CVIH 4QY8B 3RWCA 5MERA 5KS9B 2X70B 4HUXB 1C5BL 4HIIB 4HWNA 4EOWH 1FPTH 3GMOA 3IFOA 4HIHA 3HKFA 2JLLA 4CADA 3F58L 4YH6A 3FT3A 5C6TH 4NQCB 3N06B 2J88L 4KI5F 5EOCJ 3QEQA 4PRHB 2VLLB 4BFIB 3F5WB 2BNRA 2F54D 3EDFA 2WMPA 3S6CA 1MRDH 1K8DA 1S7QA 4JFXB 2JK5A 3VXNB 1OAXL 1CIUA 2BJMH 3BIAX 3FB7B 5C2BL 4GKNB 1U8PA 3TFKD 5T3ZD 1IAIM 4PGCA 3LY6A 1T4KB 5GRJL 5CEXB 4QRSB 1IMHC 3O11B 3DSNA 4K8RC 3HMWL 3NGBB 5IHZA 5FHBL 5ALBL 2BCKA 3IDNB 4HMDA 3MCKA 3HZKA 1LK3L 1WFUA 4QTHB 3TA3D 4OIAA 2H3NB 5FO9A 3CFBA 2DDQL 3ARDC 4K7FB 4KVCL 4F7CB 1S7SB 3LKQB 1Z5LB 3S34H 4I4WB 4B7LA 2ZKHH 4ZFZB 5H94B 5KSAD 3IVKB 3OXRA 5IMMB 2GJ6E 2VKWA 1A6WL 2YUWA 3MLZL 3O8XB 5E2TL 3HCVB 4Z9KB 4ODVH 3SPVA 3LKNA 4QT5B 4PJ5A 4GBXB 4LFHG 2VLRB 3L5WA 1WZKA 2WBJA 4P23D 5EBLB 4LPTA 1E27A 2H2PC 3SQOH 5T3ZL 1IKFL 1P4LA 3VFOA 43CAA 3MRHB 1KJMB 4UV7L