1G9NH

Hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
229
structure length
229
Chain Sequence
QVQLLESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYRNNGFLKHWGQGTLVTVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structures of HIV-1 gp120 envelope glycoproteins from laboratory-adapted and primary isolates.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 47
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2000-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g9nH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g9nH01
5TE4L 1NEZB 4P9ML 1UEYA 4KY1L 4OCSH 4WO4D 4ISVB 3CFJB 5DVKA 4TSAL 3RY4A 1YJDH 2X4SB 5EN2B 2OI9C 4B50A 1MVUA 2YD6A 3ELAT 2ZNWA 3DXAD 1SYSA 3P2TA 4O00A 3KXFB 1RK1A 3LKOB 3LEYL 1V3KA 1H3UA 3TYGH 3E6HB 5F21B 3TH2T 3TA3C 4UIKL 5F8RC 2CRMA 2GW5A 1CLYH 2BJML 1L0QA 3NZ8A 1I7ZA 4PV8A 5GGTL 1GVIA 2ID5A 1XGRA 5D7LA 3G5ZA 1H0DB 4HFWA 2BVQB 4I0PD 3SDXF 4ORGA 4QRSA 4QCIB 2QJDA 1KUMA 2HFGL 3LV3B 4GBXD 4NC1E 3MV11 4OJFL 5JHDB 5F72S 4K23H 1P53A 1IQDA 3IJSB 3D87B 2Z8VC 1I9JL 5HHMB 1FPTL 3H3KA 4CMMB 3SO3B 3VFGL 3L5JA 5DYOB 5ICXB 3U0WL 3PWPB 1AFVL 1NLDH 4HUMB 5L0QB 3VXME 3NCJH 2B5IB 5EDXA 1L6XA 4L3AA 2VAJA 2X4RA 2BSED 1JNHB 2HLAB 5J3HC 4OCSL 3U9UA 1XGUA 5BRZB 1YJDL 1A7RH 3S37X 3UJIH 4ELMB 4GRLB 3WNPA 5GRXG 2FD6H 2EXYC 2BY1A 1AIFB 5FXCH 1EGJA 1JNNL 4LGPB 1A9EA 3ES6B 4Y89A 5I2IB 2FZ3A 1B0RA 4X7TA 3SO5A 1GZQB 3L3IA 4MJ6A 4JFOB 1HSBB 3MOAL 1V05A 4PRNB 1A6AA 3RWGB 5D96B 3VXTB 4O2CA 1T04B 3MRDA 1VESA 3TBWB 4HIEA 5F8QC 3TA3D 4L1DA 5TGBB 3SDCC 1FIEA 1SQ2N 4OCNC 5HVFB 4LVHC 4HWZB 4BQCA 5F96H 2AEPH 1QLFB 1UB6A 1M6OA 1G7HB 5FYLL 3TPKA 2MOVA 3MRLB 3TN0A 5ICZB 1FO0H 3QWQB 1MCOL 1NFDB 3KPPB 3V5HA 5D2NA 1NLDL 3N9GL 3NCJL 4FQIL 4D0CB 1G9MC 3U4EA 4OLZH 1CD1B 5DTFA 3RWFB 3RZCB 3G5VA 2VZ1A 4PRHD 1A7RL 1FC1A 3UJIL 1YA5A 1M71B 4NN7C 3IDMB 2WBWB 1HZHH 3HUJF 1ES0B 5J3HD 3PWNB 1UWEL 3MFGB 1MWAB 4JN1H 2ZSVB 1P4BH 2WNGA 3OB0H 3QYCA 4JQIH 5L6YH 3MCG1 5TF0A 3IDIA 1GRWA 3VD4A 4KKCC 1ND0B 3WN5C 4NCC1 4ETYA 2X4OB 2EXYD 1VEMA 2AV7B 1IM3B 4YHKH 5EOTA 1NAKH 5BS0B 4K71C 2CDFB 5JR1H 1U58A 2XRAH 1BZQK 4M7LH 4LHUA 1P7QA 3IAGC 3UC0L 4PRIB 1FSKC 5C7XL 5F96L 1WISA 4JJ5B 1U8NA 1VFUA 3ZHKA 5E00A 3LVEA 3FCTB 3K81A 2Q20A 1FO0L 3SCMB 3RTQA 5C0FA 3N0PB 4EI5D 1EERB 3UPAA 5GRYA 1FV1B 2F15A 3U7YL 4OLZL 1K3ZA 4ONGH 1MPAH 5DJDA 1RK0B 3HMXA 4ZAKC 4YHYB 1AI1H 1F42A 4MJID 2WP3O 1UQSA 2WWKT 1MLCB 2DLFL 4M6AA 1ADQA 1Q9LB 3FFCD 3KPMA 4HH9A 5DRNB 3RPKA 3L3KB 3VGDA 3VXUB 3BUYA 1HZHL 2YA0A 3BP7B 2EDOA 4NM8H 1P4BL 3QEHA 5C3LD 5HYFA 4JQIL 3F7VA 2OQJA 4GKNB 1AQDA 4RX4D 4OKVB 5FUZH 1A7QL 4UNTA 3Q1SL 5DMKB 5HHOA 5C0GA 4YHKL 5F70A 3UTPD 3CDGB 3KPNB 1NAKL 2OZ4H 3OMZA 4Y88A 3LQAC 2EEBA 3P3YA 5BJTB 1M1SA 5F3HA 3C9NA 3MJ8B 1BREA 1JYVA 4JZJC 4EXPX 3CD4A 3LPWA 4K3HA 4FZEH 1FFPA 4G6JH 2BY3A 3S96A 5DJCA 5B39B 4S2SB 1IGTA 1SJHA 4O4YH 4OZHB 3QXDA 3TP4A 4KKAC 1UZ6E 2PR4H 2GITB 3HZMA 1Q9OB 4CDHA 3M8OH 2XZCH 4FRWA 3D6GA 4TVPE 5ELIA 3TBVB 4IMKC 1PSKH 1CXIA 1QFOA 3JWOH 1R5VA 4EUPB 1F3DH 4NC2B 3U7WH 2L7JA 2P5EB 2H9GB 3R0MA 2WAHA 3GIVB 3DV4B 3ROOA 3WNNA 1L7TH 5DT1H 4PJCE 1NUDA 2A6DB 4ZAKD 3BEWB 3HZVA 4JFDE 4WWKB 5CIPA 3OR7A 5GSVB 4NJ9H 5FUZL 3RRQA 2BNRA 3E8UH 4E41D 5JIHA 1BD2A 2OZ4L 4PJ7E 4XCCL 5SV3A 4PLJD 3I2CH 4EN3D 1X5AA 4JFQA 3KS0J 1LO0H 1NAMB 2G2RB 4P5KA 1T0MB 3STLB 1QOKA 4LAQH 5LKNA 5DJ8A 4YC2B 3U82B 4LDOB 2DIBA 2WBJA 3VD9A 2K7PA 4WTXA 4G6JL 4Y8AA 4X4ZA 4WUUA 1XF4B 3CNKA 1U3YA 2BXZA 4O4YL 4PLKC 2BMKB 3HNTH 2PR4L 4MCZB 3V0VB 1FZMA 3U4AA 3M8OL 2VKWA 3MOQA 3LKSA 4XP6H 5F1IB 3DETD 3TH3T 5CGTA 1V8HA 1X5GA 2APTA 1ZHNB 4LSRH 2DQUH 3JWOL 2GTWA 4LHUG 3CC5A 5CP3A 3Q5YA 4KKLC 4KKAD 3QDMB 1R3KB 4NQSA 3K2MC 4P9HH 4UU9B 4YUEH 1T83C 2R2EB 3V6FA 5DT1L 2NY7H 2GFBA 4Y4KD 2ZG3A 4NO5A 2AI0H 3E2HC 4U6TA 4JG1H 4NJ9L 1JI1A 5T5FH 4QF1B 1I85C 3E8UL 2C1OA 3ZDXF 5H94A 4FXKA 5IVZA 1LO5B 2N7BA 4ELKB 3PGDA 1LO0L 2ICES 2M26A 3DVNB 3MRKA 2MCG1 1I3UA 4K7FA 1J05B 2EDQA 1RJLA 4LAQL 4L5FH 5GRVK 4KRNA 5E9DE 5C0IB 5CEYB 3QDJE 1U91A 4OQTA 3GZKA 2CIIB 3GMMA 4J3WA 4PRAB 4ZNEE 5ESQA 4QOKB 4ZFGH 1HNGA 1W72A 3MRPB 1XCQB 1AHWC 3HNTL 5CBEB 3KYNB 4TULL 1NC4A 1UM6H 2YEZA 3C60B 3QDGA 1X5YA 2WWMC 4OCRH 4XP6L 4GJTB 32C2A 1ZT7B 1VB9A 3OPZH 3BN3B 4JM4H 3MRCA 1A4KA 4LSRL 2DQUL 3L95A 4PLKD 3EZJB 3DVIA 1A6TA 1U8QB 1M05B 4YUEL 5I8OH 1BJ1H 2NY7L 4AM0A 4BELD 2Q6WB 2IG2L 1CL7I 1HEZB 2AI0L 3H7LA 5ISZD 4RIRA 4JG1L 2D2OA 2V2XB 3TO4C 3X12A 5T5FL 4LLVA 3E3QE 4JPWH 3W9DB 1VKXA 1ITCA 4UNUA 3P4NB 5F7HA 2CQVA 1UXSB 2R29H 5B8CA 5ILTL 2QHLA 1HN1A 3AY4C 1Q9KA 1H5BB 4L5FL 5F7KC 2GJ6B 3UTSB 1EO8L 4XC3L 5F7MC 4GRWF 4WV1A 4QRRE 5FGSA 1PG7W 5KSAB 4ZFGL 1VFMA 4J23A 2FBJH 1DQLL 4AY0A 3VW3L 4X5XB 1TCRA 3MODH 1UM6L 1QPXA 4XRCA 2HJFA 4M9PA 4OCRL 3X17A 4XAWH 5BW7A 4JM2A 3OPZL 3VXSD 2Y23A 5ACZB 4JM4L 4F80A 4YHPB 4Y19B 1F2XK 2HJLB 4FQXD 4TUJB 5J11B 3T0AA 3SPVA 5F7WC 2VC2H 4R97C 3SGDI 5IEKA 1ZT1B 5JDSB 2X4QB 3DHMA 4NWUL 1Z9LA 4L3CB 1R3IH 1CGTA 4N5UA 2WWMD 2GK0A 3KPRB 4RRPG 2ZUQB 3DI2B 1LDPL 3MBED 5D9SA 4NKOA 3FTGA 3CUPB 4LRIA 4JPWL 1G7MA 1N6UA 43CAA 4ERSH 1ZA6A 5CGYD 5EPMB 2FJHA 2R29L 3CVIH 3MRFA 4I18B 1MCWM 5IBUG 4UT9H 1K8DB 1KCLA 1A3RL 1VDGA 3D2UB 2Q76A 5KSUB 5DJYA 3TO4D 1LMKA 1HXMB 4U1JA 3FHQA 4BH7A 3O2WH 3C5ZA 3RL1B 1QRNE 2PYFB 3IDNB 4D9LH 3U36B 3WMSA 3EAKA 1GGUA 2FBJL 4TNWK 5DVLA 1OP5K 4OCLC 2BOBB 1BGXH 4UNVA 5C9JA 1G7PB 4R26H 3MODL 1EAPA 1NDGA 1R0AL 1JBJA 3WSQL 4NFCA 2YXMA 2F5AH 5DJ6A 4XAWL 4Z77B 2GY7B 3E6FB 4RGNB 5CEZH 3GGWA 3SO3C 5BCAA 2FJFA 3QIUA 3LY6A 3DXAE 2CKBH 5L0QC 5IFHH 5FM4A 2B5IC 1R3IL 3MRNA 4P5TA 1N4XL 3DX6A 3PWUA 35C8L 1PZUB 4ETQA 2XACC 3HG1B 4MLSA 4FQJL 2H2SC 5ESAB 5IVNA 2ICWB 3KYMA 4OB5H 5EO9A 4HS8H 4GRLC 1X4YA 3RX8A 2R0KL 1RVFH 5HI5D 2NTFB 4X6CE 3N85H 2XTJD 4UT9L 4LLWA 2J5LB 3VGEA 2AJVH 1EFXA 2P43B 4NIKB 2YKLH 2MCPH 1T80A 2JE8A 3HE7D 1K2DB 4ZFFA 9CGTA 3VGGA 5J9PA 4L8CA 4QYOA 5D96C 2EE3A 2IANA 2BSSB 3KXFD 3S36L 3MPCA 1FBIH 4D9LL 4MAYB 4H20L 5KS9A 3GSVA 5KN5A 5F9AC 4YO0B 1CXKA 3Q3GA 2CMRH 4R26L 3CVHA 1P9MC 4OZGF 3NACH 2F5AL 1BOGA 2DIJA 2DI7A 2WUCH 1T7VA 3ME0A 5M7QA 3FQNA 2WWKO 5GZOC 4U3CA 1OF2B 4X6DA 1N2RB 3V6OE 4GG8B 4L4TA 1EUTA 4O51B 4HKBA 3VFMB 3CFBB 2VDPL 3T0XA 3ZL4L 2CKBL 2RGSA 3AFLA 3GSUB 4M4PA 5IFHL 3QQ9C 4N8VB 1WBYB 2C3VB 4WI2A 5IM7B 2R1XB 5JHDD 5HHMD 4P2YA 3BESR 4XCYB 5ERWB 4IM8A 3PWPD 4OUOA 4ALAH 1BX2B 3ZKMC 1I8MB 3F65A 4GW4B 4LNRA 4PJXB 2HT2C 1LEKA 1H15B 3B5GA 4OB5L 4HS8L 1WBXA 1RVFL 4NSKA 4XGZB 3WDJA 4DZ8A 5C8JB 3N85L 1FL6B 2BC4B 1N8ZB 1FRGL 1U8KA 5BRZD 2AJVL 2BVYA 4KC3B 4X4YB 2MCPL 3HMXH 3SGDH 4HIXH 1HOCA 5JW4Q 4UB0H 4ZDHB 1SYVA 1RI8A 3ULUF 4N0UA 5EBMA 2E8ZA 4KVNL 5MEQA 3DRTB 2ITCB 4QRTB 2YUXA 3KPSD 2VR4A 1RJYB 1TFHA 2NQCA 2YPKB 2X4PA 2A9NH 1GIGH 2CMRL 3IJYB 1MH5B 4RAUA 1FO0B 3NACL 1QVOA 1KJ2A 3G5XB 2YSSA 1T5XA 2WUCL 3LKNB 4JPKH 3LB6D 4PRHE 4LPWA 3QO0A 1CK0L 3SCMC 1NGXB 4ZQKB 4LSUH 2YRPA 3U30B 3JV6B 2ESVA 4QXUL 1NGYA 5GZOD 4YHYC 1OW0A 5IF0B 1TZIB 5IB1A 2YD3A 2I60H 5CZXD 3L3DB 1IGFL 2IADB 1YNKH 3UPRA 4LCWA 2D31A 3QQ9D 5GRWA 4WHDA 3TJHC 4P3DA 3OKLB 2J6EH 3VFNB 3DX7B 4D9RD 1G7JB 1EEZB 4S1SH 1E4WH 1DANT 2CDGA 5E8NB 3SE4A 1BJ8A 1G9NC 4QRPB 5IFJB 4OV6F 2Z35B 2R9HD 3ZKMD 1U3ZA 1NKRA 2HT2D 1CDJA 2VLJB 3BHBB 4HIXL 4K3DH 4NKQB 4UB0L 5SV4A 3L3JA 4OKDA 3SKNB 2JKXA 2R0WH 1UXWA 1QSFA 5FGCE 3IU4L 5HVGB 1GIGL 3SBWC 5D4QA 4IRJA 2EYTB 1AP2A 5F9WC 5KSVB 5HYIA 4UQ2A 4JPKL 1D5MA 1A6ZA 3FFCE 5BS0D 3M1BA 5JHLH 4W6YB 1HWGB 2HWZH 3PDGA 2H6PB 4LSUL 3L5WA 1YMMD 4OCYH 1TNNA 3K4AA 5FOBA 1JZ2A 3VE0B 2PXYA 4YDJA 1KPUB 1VEOA 1BBDH 2X10A 5C07B 3UMTA 1LNUB 1FGNH 1IGJA 1RULH 4NQCD 4Z7VE 4C55A 3UCRA 3SCMD 12E8H 1BQSA 1U93B 2W65B 1YYLH 1MAMH 1UVQA 3EFDH 5C0AB 3QNYB 3GMOA 3I3DA 3PIQB 1VSCA 3UTPE 3GMPB 4IIQB 2J6EL 3V0AC 2FEEI 4GG6E 1OPGL 4CBPA 5C0DB 1BAFH 3BP5A 4BH8B 1ZWIB 3AAZB 1E4WL 2XKNA 4WWKC 1UWGH 4JB9H 2I27N 5LWYL 1YEFH 4PGBA 3MR9B 4MA3B 2NTSP 2R4RH 4K3DL 4J1UA 4YGVA 3TJHD 3OTTA 3VXUD 2ZCKH 2R0WL 5L2KA 5CMAA 1X7QA 4Y5YA 3E0GA 3MNZA 1LILA 1F11A 1DUZB 2XN9A 1VACA 2EYSB 1AO7B 4H1LA 1IFHH 5DSCB 4EI6B 3MRJB 1A7PH 3O3DA 1RU9H 1QA9B 1DE4B 1RUPH 2D3VA 4MDJB 3PJSA 3MGOA 1ZGLP 5T1LA 1Z0NA 1J18A 2ZUVA 4NNXB 1VENA 3RY6C 5JHLL 4XHQA 2HWZL 5E8DL 4LBEA 4MWFB 1NBVH 1E4XH 1QR1A 4UDTB 4HQQH 5I1AA 3MLTA 5DHVH 4F7PA 1BBDL 1OVZA 2Z8SA 4NQDA 1FGNL 1RULL 4S10A 5F1NA 3NA9H 3NIDE 3SY0B 3FQRB 2OP4H 1OGAA 3D1MC 5AUMA 4N0RA 3EFDL 1MAML 4E41E 3VFUA 1FZOB 2F74A 3Q6GL 4JVUA 5EO1B 3SE8L 4OCMC 4Z7UF 3W2DH 5DHXB 3KNBA 1X5LA 1A1OB 1BAFL 4LLAA 5DC9B 1WAAE 4ODXB 4WEUD 2Q1EA 2YD1A 1UWGL 3QXAA 4JB9L 5C08A 3STZB 1CTNA 3VI4E 1JN6A 1HK6A 1HH6B 4Y2OA 3RX5A 1SY6A 1CDYA 1SJVA 1KIPB 4Q0XL 2WANA 4WWKD 4CN1A 5DD1H 4XNYH 2MHAA 2AK4A 3FAXA 3MA9L 1A9BB 2HFEA 4HMCA 1A1MA 1A7PL 1MQ8A 1RU9L 4TYUA 3DARA 1RUPL 4F37K 4NFDA 4AT6B 5BO1L 5GRUL 1NBVL 5GIRA 1E4XL 4PJ5A 1EVUA 1DJSA 5GSRB 4HQQL 1WBZB 5C0CB 4MJ5A 4H5SA 3C60C 5IW1B 4S1RH 5EZJA 4OZFA 2UWEA 3O41B 3NA9L 4RFNB 3KGRA 5I1LB 3MYJB 3VXPB 5SWZB 3K8MA 5BQ7B 1T6WA 4YHMH 4MD5A 2NNAB 2Y36H 3W2DL 1D9KB 3ZT6A 2BY0A 1XGQA 3LIZL 4DVBA 1L7IH 1TZGH 3GHBH 2EIDA 4X7DC 2ARJA 4JY5H 2HJKA 1JPGA 1QHPA 3RWIA 3QDMD 4ACPA 3FO1A 5E95B 2JIXA 3MC0A 2HLFC 1WTGT 2V7HA 1K4DB 3V4UH 3G5YB 4ODVL 3J7HA 3TBSB 1Q0XL 2IAMA 5DFVC 5HYEA 3L7EB 4XNYL 3WFDL 3BPLB 1EJ6A 1KLUA 1OSPL 5MERA 1H5BC 3ALPA 1WF5A 2VXTL 3VGAB 2A83A 4XNQB 1WCQA 5IOPA 4P2CG 3BJLA 4HEPG 1BMGA 4QTIH 3DVGA 2YUVA 3NCYS 3PQYA 4KAQH 4V1DB 5IHZA 3P4MB 2ZOKB 2VZ3A 5AZEH 1FYTA 5FGBC 1HYRC 2ZUSA 5ISZE 3BH8A 1X5FA 2OR9H 1H9VA 4IRZH 5DEGB 4KH2A 1M7DA 1T4KA 5J11C 1G6RA 4GAYA 1SJEA 1R3HB 3DWTA 1S9VB 3C60D 4YHML 3BSZL 1HINH 2ZUQC 5HHPB 1QFWL 1RJZA 1L7IL 1HH9B 1TZGL 3CFKA 4OF7A 2VABA 4L8SA 4JY5L 1JTTA 2ZCHL 4W6WB 4Z7WE 1P4IH 1ZS8A 3KPLB 5F1OB 5GHWL 3EJYC 3ARTA 3BO8A 1NKOA 5DRWB 3KR3H 2JK5B 5K9OB 4HBQA 4HLZG 4I18C 4KJWC 1NC2A 4XPTH 2QL1A 3K80A 5E0QA 5L9DH 3BZ4A 5DK0A 5CJ5A 4HPOH 3ARGD 2VLLA 5LXGH 1KCRH 2FEEL 4PGJA 3UDWC 1WIPA 4PD4K 2HH0H 2BSRA 4MQXC 5E2UH 1JGDA 4KV5F 3BP4A 1TVHB 3UTSD 4PJFB 3SJVA 4BKLA 3RVXC 2QKIA 2OR9L 4NRZB 2A9MH 3CMGA 4RGNC 1DR9A 2Q7NA 3EYVB 4LDEB 4Y2DB 4OZIE 1XIWB 3WFCH 4DUVA 1KJMA 4PJBE 2EC9U 1YJDC 1HINL 3WFBH 3ZDYE 5E7BA 5AWNH 5AZ2H 5FO7B 4YXLL 5I1JH 4HUWB 3DRQA 4Y19D 2R1YB 2CLVA 1HYSC 2AP2A 5TE6H 1P4IL 5H35A 2R2BA 5FO9B 5EULV 3I6LD 1REIA 5F9OH 1ZLUK 2SEBB 3KPRD 4XX1E 4Z76B 1DBJH 3KR3L 3QFJA 5TDOB 5JLZA 4AZ8A 2VDRH 5DA0B 3ULSA 2J5LC 5IVXE 4M8VA 5KSBE 2CLZB 5IUSA 1J0IA 4M7LT 4MZ3A 2Y5TB 4H8WH 5L9DL 4PJEB 43C9A 1Q94B 2W38A 3UP1A 4HPOL 4F33A 5MI0B 3K74B 5LXGL 4HJ0D 2DLGA 5DQ9B 4YBLB 1AD0A 1RZFH 3DMMB 4MAYC 4MNGA 3VD3A 4M00A 5DMIH 3BI9X 5GS1A 5DJ2B 2W0FA 4DGVH 3D2UD 3GB7A 5E2UL 1C5CL 1FN4B 3FQTB 4HWNA 3RGVA 1VPOH 3QQ4A 3LH2H 2P5WE 1JTPA 4G8GD 5FFLA 4YH6A 2EE9A 4Y5XA 2DOCA 4J8RA 2CKBB 4OQ1A 2HN7B 2ZSWA 2VXVH 4OIBA 2JJVA 2KKQA 4GAJH 3X11B 2OX5A 3VD5A 4MQXD 4B41A 2OSLA 3WFCL 2WLZA 3LEXA 3LKRA 5DVNA 2BNQD 3CSYA 4OGZA 4R3SA 3QUXB 4GQPH 2XTJE 3BRDA 5AWNL 2J88H 4O2FB 3RVXD 3DURB 5I1JL 4RGND 4WFGD 4D9QD 2X1QA 2A2QT 2JJUA 5CUSH 3QUYB 2P8MA 2KBGA 5TE6L 4BQBA 5J4MA 1EHXA 1CQYA 4M93B 5T3XE 4HMDA 3QEQA 1IRAY 1JWMA 5KVDH 4QKXB 5F9OL 3EGSA 2V2TA 4PREB 3MXVH 1DBJL 1A4JA 5GGVY 3TVMB 1R24B 4XBGA 4CVZA 3WE6A 2VDRL 3MV9A 1HYSD 2X1XR 1T89C 4H8WL 1CWVA 5TDNA 5IQ9B 1MCSA 5D6DC 4MXQC 1RZFL 4UQ3B 1RPQA 1IILE 1FNHA 3PABA 3KPOB 1PQZB 3SDDB 3HMWH 1SVZA 1VPOL 3LH2L 2G5BA 2DQDL 5MEPB 3UYPA 1AR2A 2WMPA 5FHAH 2W60A 1AGCB 3QEGL 1KIQB 5K9JH 1QPPA 5HHME 4PJAB 4Y4HB 4NQEB 3L6FB 3MSPA 3OKEA 1TVBA 3QHZH 4Y1AA 5J06A 1EVTC 3QULA 4M62H 4GAJL 2PTUA 3IDXH 2EDFA 3O6LH 4OIAA 4XPFL 2F9BT 5T3ZH 4XPBH 5KG9B 5DO2D 5FYLD 5JUEL 3UTTB 1R3JA 3U30C 1T1XB 3PWJA 2CSPA 1TVDA 4ZOCA 4Q74A 3HZKA 1MRDL 2J88L 5BRZE 2A0LC 3EYUH 3GMRA 1P84K 3L3GA 4X6EA 2G75A 3MV7B 2AXGA 4LU5H 4PB9H 2H8PA 5KVDL 1U3HC 4NUJA 3O6FB 3QXUA 1IGYB 3KPSE 5GRJH 2VDKH 4QXTA 5C0JA 2UY7A 1DBML 4QEGA 3RNKA 4NDMA 4M7JH 1B6UA 3CLEH 3STBA 4HJGB 5D1QB 1KB9J 2XIDA 4ZSOA 3X13A 1PG7H 4U0RC 4PJ9A 4W68A 2IPUK 4D0BA 1XCTA 1N59A 1YNTA 1Y6MR 5JO5B 1KENH 4MQ7A 5DWUH 4GW5A 4DEPC 3SKMB 2OYPA 5HHXH 3IJHA 5K9JL 3W5NA 2YD5A 4C56B 5FO8A 4L29B 4MXQD 3OKNA 3QHZL 4HS3B 1NFDE 3S34L 4M62L 3IDXL 3O6LL 1IM9B 2X4TB 1WIOA 1MJ8H 4ZUSB 1CD9B 4D9RE 1HIML 3EOAA 1I4FA 4P2QD 1CG9B 4UTBL 1KB5L 1RZGB 3O81A 2P8LB 2LVCA 5LVEA 3EYUL 5HDLA 1CE6B 1MI5A 5EC1A 3BZFA 1QLRA 1MHPH 4LU5L 4PB9L 2DQJL 3TGXA 4YIQA 2JCCE 5GRJL 4Z78A 2VDKL 4N0YL 2A0LD 4P4RA 4IMLA 5FECA 5CD3A 1S9YB 3ECBB 1AKJB 4M7JL 2X4UB 4CAGA 1K5NB 3UO1H 2O5YH 4CNIA 3IVKA 1U3HD 4ODTH 4HLZH 4JFPB 3PP4H 4PJ8B 1DQQB 1I3VA 1HHJA 2GSGB 1PG7L 1R5WB 5D7SH 1A6PA 1YMME 1AQKH 5I66A 1KENL 5JW5A 3ZE0F 4P48A 3VRIB 4YFLI 1MEXH 2GTZA 4RWYH 1IL1B 1KSRA 1GL4B 1MHEA 5HHXL 1PY9A 4ZS7H 2F19H 5HPMA 4NQCE 1N6QH 3GUTA 1KTRL 3PL6A 4KQ3L 2PW2A 4RA0C 3LN4B 1X5IA 2VZVA 4HC1H 3JWOC 3B8YA 2AEIT 3TIEB 5IMKA 3VFTA 3QO1B 3WD5H 1C12A 4NP4L 2CJUH 3NCCB 4NO0D 2PYEA 4P3WA 1MHPL 3QUZD 4I5BA 4OLVH 3D3VA 4YLQT 2YD4A 4PJIA 2AABH 4I48B 5I8KH 5CWSA 2KZ1B 4P2RB 4AENA 5DI8A 3TNNA 1DUYA 1DVFB 2XZAH 3GM8A 3L3OA 3RWEA 2CK0H 3KLSA 5J1AA 4ODTL 1XGYH 4NRYB 4ODBD 3PP4L 2P48B 3GSRB 4JM2F 4MNQB 1HHKA 4C57C 5I15L 5FB8B 1LP9B 2HTKC 5D7SL 1BFOB 1SBBA 3MROA 4JFEA 5GGRB 2BCKB 5C0EB 3PXJA 1JL8A 1MEXL 2BK8A 4RWYL 3HUJB 3X14B 2LTQB 4L4JA 2JJTC 3FRPA 3U2SB 4P0DA 1NGPH 4LPYA 2F19L 4UDUB 4ZS7L 1N6QL 5TPWH 5FUOH 4G6FD 3UJTH 1JV5A 2X89A 3S4SG 4QHKJ 1AO7D 1N0XH 4LPXA 1OAYL 4LPUA 4KZDH 3FO0H 3MNWA 4G80A 1ZOXA 4HC1L 1A1NB 4FQ2L 3FB6B 2IH3A 3I75B 5EC2B 2X9XA 4R4BA 1KULA 5E2VL 3BMWA 4TVPH 4PJDA 3ZTJG 2FHBA 3ULUL 5HDBE 4JN2A 4RFNC 4X7SH 5EOCJ 3MYZA 1UKSA 3P77A 1ZK9A 3EYQC 5IROC 3SDCA 4OV5A 4OLVL 5INDA 4NHCH 4HPYH 4TTDD 5FM5M 2QR0A 2KQNA 5IHLB 4PV9B 2J7LA 1KTLA 2VDQH 5I8KL 2Z0BA 1QSZA 3MRBA 5JMOC 4JANB 4MJIA 1DN2A 3MRRA 1TJHH 3DROB 4HWBA 3V2AR 5EFIA 5IV2B 2XZAL 3H9SA 2YK1H 2CK0L 5TH2A 4PJGB 4F7EA 1S7TA 4HMEA 3RVUC 1OT1A 4PRDB 2VZOA 2LV4A 3RZWA 2DQFB 3BPLC 1RUAL 4P5MB 1N7MH 3VGAC 3D69B 3EKCA 4XNZC 5F71A 1NGPL 4ZD3H 4OAWA 2OL3A 4MXVE 3CH1A 1R3LA 2QSVA 5FUOL 5TPWL 2BNUA 3FJTA 2HTKD 3UJTL 3UAJC 2DQTH 4ZXBA 1N0XL 5BOZG 1FH5H 3ALWA 4KZDL 2G9HA 4TTGA 3FO2B 3FO0L 4P2OB 3WIFA 3P9MA 3BD3A 3TT1H 3WN5A 5A2KH 2HT4C 2BVTA 4TVPL 4ESKA 5J6HB 3L5IA 4HZAA 3I3BA 3FN0L 3ARDD 2QQNL 4LCYB 4FFYL 5I0ZA 1AGFB 1FGVH 2LE9A 4L3EA 2C4FU 1UB5B 4H0GA 3MO1B 4NHCL 4HPYL 2ERJB 1WZ1H 4N0CD 1DZBA 1GAFH 3B9KB 3RKDC 3HC0A 3IKKA 5ITBH 1Z3GH 4I0KA 5KS9F 4PP1C 3MRIB 5E24E 3FQUA 3P4OB 4Y4FB 4PTUA 3HFMH 4PRBA 1TJHL 2BDNL 3D39A 3BPCB 3EYQD 2YK1L 4U2ZA 3S36X 3AM8C 4X9GA 1VGEL 4OFIA 5FM8A 3RU8H 2FATH 1N26A 5LCVH 5E94A 2APVA 5EU5B 4G9FA 3QNZB 4ZO9A 4X6DF 4X9HA 2F54E 2VQ1A 1I7TB 4XC1H 1U8MA 2C3GA 4M43H 1CDCA 4OI9A 5J0BA 4OLUL 1WUNT 4ZD3L 3O2VL 4YEEA 4LNVA 2OTUB 2DQTL 1QBMH 3BWAB 1S8DB 2BVPA 1FH5L 2A6IA 4YBHA 4KK8C 4P4KA 1T3FB 4OUUA 1KLFA 3F7QA 1FZKA 3L5XH 3TJEH 3NFPA 3JUZA 4GXVH 3QUKA 4Z7QF 1RZ8A 4Y2DC 3EOBB 1FGVL 1CE1H 3VWJA 4Z7OF 3BVNB 1XIWC 1CU4H 3HZYB 2F53B 1JE6A 1GAFL 4JZJA 5C2UB 1CF8H 3ARFA 1YY8B 4ZO8A 1Z3GL 2YPLB 5DJZA 3BPNC 3HFML 1FFOB 3FRUB 3SDYH 5ANME 3AS1A 3F12A 4L4VB 2UUDH 1S9XA 3REVA 3RUGE 1I1AD 4LKXA 4PJHB 3RU8L 4I0CC 5LCVL 2W0PA 4Y16B 3THMH 4M8QB 3RKDD 1D5BB 2AKRB 4PP1D 1KTKE 4H88H 4QO1A 3ZKSD 1KCVH 3U0PB 5DK2B 2MTPA 4IMKA 3EYFA 3MJ7B 4YHZL 1CGXA 5IMMA 1BVKA 2PTVA 3CFIC 3RKPA 4B5EA 4DOHB 1MLBA 4M43L 4MXWL 4OCXL 3OKOB 5MI0C 2P8PA 3HPLA 3RDTB 4KWUA 1A14H 4U6HB 2BRRH 4YBLC 3DMMC 1F6AA 1QBML 1MREL 1I7UA 4QT5A 2G5RA 4HW6A 5SX5K 1G7IA 4XMLH 3U0TA 1CXHA 1GH7A 3BE1H 1MRFL 3L5XL 3UBXA 3TJEL 4Y19E 4GXVL 1B4JH 5D1ZB 4V2CB 5CZVL 1CE1L 1P5VA 5FDWB 3I6LE 4KK8D 5J6GB 4KJPD 1CU4L 3KPRE 1LDSA 1QQDB 3MACL 3S8WA 1JWSA 3QUXC 3QEUA 2I24N 4FTVD 1HXYA 3CLFH 1NGZB 2M1KA 4WY7L 1H3WM 3SDYL 2FEDC 3D25A 4Y2DD 4X6BB 4LGRB 3LRSB 4XVTH 2HMID 3QUYC 3KG5A 3RX7A 1XIWD 5DMGC 3OKDB 1YPZA 4M93C 4TPRH 3GSNH 1YUHB 5MHSD 5AD0A 3BXNA 5GISH 5JIKA 3TVMC 5A43C 2ED8A 4H88L 4JAMA 2Y4SA 4MA8H 4YNYB 1A22B 5H8DA 1JPSH 3PWLB 1I1YB 1MAKA 5EU6A 1FCCA 4LMQE 1GZPB 4G8GE 4F7TA 5AYUH 4AG4L 3DLQR 4CDGC 2E7LC 1A14L 1T83A 4HGMA 4OGYH 1JNLH 1RUQH 3O45A 3CSGA 4NQTA 5DDHA 4PGCB 3MLXH 1BEYH 3SDDC 3VU2A 2BNQE 4JHWH 4LEOA 1NCAH 3BE1L 1I85A 3KJ4B 3ARBB 4RGNE 4WFGE 3PGCB 2YZ8A 4D9QE 1BQHB 1MJJB 2V5SA 4Y4HC 4NM4H 1B4JL 4ZPTB 1D6VH 3DNKA 1J0JA 5B38A 1OP3K 1D7FA 5HY9B 5FK9A 2QSQA 2IBGA 4GRWB 3VH8A 1BWMA 3I02A 1HI6B 3CLFL 1UFUA 4JRXA 1TETH 5T1KD 3BH9A 4NYLB 3VXSA 3S5LA 4XVTL 1G1YA 5IW6B 1AXSB 1DTUA 1G7LA 1M7IA 4X8XA 5TQ2L 1ZT4B 4ODUB 1AHWA 3DX8B 1FP5A 4TPRL 3PV7A 1JPFA 3GSWA 4PG2C 3O6FC 3QUXD 1OSZB 5IGXH 2N1KA 2C26A 3QI9C 5IQ7H 1JPSL 2ZCLL 2FEDD 4HKXB 1EGJL 4HUKB 1PBYA 5FA4A 1ORSB 3JTTB 4BA8A 5GS0D 3IU3A 5AYUL 2NCMA 4MGXA 5D1QC 4I4WB 2IPTH 2X9YA 3MOBH 4BSVA 3SE3C 5D2LA 1KT2A 3DTXA 1IEBA 3TVMD 1QUNA 5FYLE 1CLCA 3G6JE 5ALCH 3RIAK 3FONB 1NDMB 3MLXL 3ULVF 1BEYL 1PD6A 4JHWL 1FAKT 5EG6C 2Z93A 5FCSH 1NCAL 1XF3B 2B2XL 3B9EA 2AJ3B 3VFPA 3ET9F 4JLRA 3VXMB 3DPBA 4B53A 2E5EA 4NM4L 1D6VL 1URLA 5ADOH 4U6XB 4YXKH 4E42A 3AY4A 5JXAH 1AD9B 1VCAA 1KB5B 2XWBB 5JPMA 4L9LA 3QPQC 1ONQB 1S5HA 3MMEA 1A5FH 4YHIB 4QRQB 5LAXA 4RISH 1YEKL 4XMKH 1V7NL 3AU1A 4Y4HD 1TETL 5GJTH 4CVXA 3VMNA 5D5ME 4QHUB 1FG2B 2X70B 4PR5A 3UTTD 4APQB 3L3HB 1MHHB 5H37G 3IS1X 3ZTNH 3T65B 2FIKA 3I6KA 3RA7L 1T0NA 1S7XB 2C7UA 2ZG1A 2NLJA 2DYPA 2XV6B 1QFWM 1F45A 3MA7A 1WT5A 2GIYA 3TYFB 3OX8B 5IQ7L 2VSCA 2BXYA 3DO7B 1UJTA 3MV7D 3W0WE 3K8KA 3MOBL 4PJ8C 5ID0B 2IPUG 2UWEF 4AEHH 4DK3A 4G43B 1X5KA 1EV2E 3QI9D 1NEZA 1FFNB 4LVNB 1W0VA 4HUNB 4ISVA 1KCKA 4UV7H 5KBNC 4PRPD 3VGBA 4P2QE 1QFHA 5EN2A 1MFDL 1V3JA 3LKOA 4TNWF 3U83A 3E6HA 4YXKL 7FABH 1J5OL 2XXCB 1JGVH 1A6WL 1HQ4A 3T1FB 3RPIB 1KEML 1M4KA 1IAKB 4RISL 4XMKL 3WJLC 3HLAB 5ACLA 2BVQA 4QHLA 3VMOA 4X8JB 5A3IC 5B4MC 1U36A 4QCIA 1ADQL 4GKZB 3C6SA 1U8OA 2HKFL 4RNRA 2E6PA 1FVEB 1XR8B 3LV3A 1QSEA 4I2XA 3OKMB 2GCYA 3IJSA 2P4AB 4KFZC 5EH1A 5CHNB 2ILLA 5CAYB 4CMMA 1YECH 5ICXA 4NN5B 3INUH 4LP5A 1DVFC 2DWEB 3HTLX 2MMXA 1UJ3A 5HHVH 2HFFB 4AEHL 3S5LG 2V5TA 2VMFA 5I71B 2NY1B 2PO6B 1F3JB 4TVSa 4TQEH 5FM5O 4ELMA 1T5WA 2LTQC 3HS0B 4KDVA 1BLNB 4QGTA 4HDIA 4PJ8D 4GRLA 2GKIA 1CLZH 1FZJB 3FO9A 2YA1A 4U1HB 3WIHA 2VSDA 1AIFA 1BZ7B 4KTEH 7FABL 1G9MH 3QRGH 4RMWA 3ES6A 3P40A 1JF1B 4QXGH 5I2IA 3NAAH 1J1OH 1UH4A 1GZQA 3C8HA 4HKZB 4N0FA 4JFOA 1HSBA 2EDRA 4PRNA 1DQDH 3RWGA 5I1KH 5ICYA 1T04A 2JB6B 2OR7A 1IBGH 4XB8A 2EDNA 1BQLH 5C92A 3VFSA 5TGBA 3D85B 1P9MA 1OL0A 2DM2A 2FR4B 2AK1H 1QLFA 3T2NH 1ZKAA 4JFXB 1G7HA 3H3BC 3MRLA 2EKSB 5ICZA 1QD0A 2IBBA 1UKQA 3IRPX 4W81A 1YECL 3GDBA 2X1WL 3INUL 1U8HB 3KPPA 4LARH 4R96B 3MREB 1YEJH 5HHVL 1A0QH 4PYHA 4D0CA 1WEJL 5LJYH 3ZE1F 3CGTA 5IB3B 1CD1A 4WIQA 3RWFA 3RZCA 4U1MB 3D18A 4P2RD 2N7AA 3QIBB 3NN8A 3G04B 3TLRA 4WTZG 4F2MB 4TQEL 3DV6B 1J88A 4MNQD 1CLZL 1M71A 1FVDB 4RSVA 2O61B 2Q86A 1C16B 2XY2A 4KTEL 4M48H 4FXGB 3MUY1 1ES0A 3PWNA 3QRGL 1MWAA 2ZSVA 4GRMB 2KPNA 1J1OL 3VWKB 4P2OC 4I3RH 1NEZG 1ND0A 4XTRD 3C87A 2AV7A 3GI8L 1NLBL 4K2UH 3WO4B 5FYJL 1J8HB 2NMSA 4JFDB 3B9AA 2CDFA 2EIZA 1BIHA 2ERJC 4RWHA 1B2WH 3O6KL 3T0BA 4PRIA 4MMZC 2OXHA 3ALXA 3B9KC 4JJ5A 4WJ5B 4R4NC 3T2NL 1P6AB 2X40A 5JW4N 4Y4FC 2DMBA 1BWWA 2VNCA 4PJ7B 3EJZD 5CLTA 1UA6L 1ZLWH 1S7WB 4WI6A 2AJXL 3WKMH 4TRPL 2E9BA 5DMJB 3S88H 2F5BH 3LQAH 5C6WH 1A0QL 1KBGH 1FV1A 3A6OA 3O4OB 4KJQC 1RK0A 5L2JB 5D7IE 1GOFA 1MLCA 3MQIA 2NY0B 4G7YL 1Q9LA 2E27H 1S7QB 5BXFB 5L88H 2PUQT 5DS8B 5DRNA 4GXUM 4MA7H 1F4HA 1HDMB 4X4XB 4O58H 4M48L 1VHPA 1RY7B 3KYOB 1F00I 5CJQL 3FB8B 1ROWA 4GKNA 4ODHH 4OKVA 4I3RL 5JZ7C 3CZJA 5DMKA 1MAJA 3CDGA 3KPNA 4K2UL 5KANG 2NX5D 5DD0H 4RFEA 1AY1H 1QR4A 3MJ8A 3DYMA 3TC9A 3WFZA 3ZSSA 4DCQB 3SGKA 4OF6A 4P2OD 4X6FB 5C0BD 4U3XA 4Q97A 4FOMA 2V2WB 5B39A 4S2SA 1O7VA 3IXTB 5H37H 5GGSY 4J3XA 3IF1B 4OZHA 1ERNA 3WBDA 3HCVB 5A2IH 2GITA 4WHYG 5DJAB 4FQHB 2IQ9L 3D9AH 4Y16C 5E9DB 3B9KD 1IC7H 5C0RH 4L9DA 4R4ND 4X5LA 4KTYA 5F7DB 3MLWH 1I1FB 3QH3B 3BPOB 1N3NB 5ESVB 3U4BH 2IBZY 2ZUTA 5L88L 4KKBC 2P5EA 3GBLA 3F7YB 2D7TH 2H9GA 3VXRB 2J2ZA 3VDAA 5EZLA 2YMXH 4MA7L 3G08B 3RDTC 3DV4A 1IC4H 2FWOA 4O58L 2A6DA 1ZHKA 3BEWA 2CPCA 2CO6B 4K8RC 3QUMA 4RMSA 3TZVB 5GSVA 3RWHB 3FT3B 3WXVL 4ODHL 4N9GB 2HT3D 2DKSA 2ORBH 1QLEL 1ZHBB 2DLTA 4GW1B 5D1ZC 5F7YC 2LFGA 3I85A 5DZOA 1CVSC 1AY1L 1NAMA 2X9WA 1AJ7H 2VN4A 1T0MA 3STLA 1U8IA 5JZ7D 4YPJA 2Q8BH 3OB0K 4OLXH 2VUOA 1XF4A 4E5XA 4RFOL 2IJ0C 3SDAD 1S3KH 5SWSD 2BMKA 4MCZA 3V0VA 2F53D 3QIWB 4G7VH 2A6JB 3D9AL 5C0RL 1IC7L 3NZ8B 4H8WC 5F1IA 3O8XB 5HYSB 3GIZH 2FGWH 4QRRB 2E8YA 3U4BL 5EZOH 1F3RB 3O2DH 3Q5OA 1HKFA 1KPRB 2UZIL 1MSPA 1R3KA 3AS2A 5KANI 3GJFH 4UU9A 1IC4L 2R2EA 1S9KC 4OGXH 4UT6L 3P4LA 2FB4H 1RAMA 1H8OA 3TM6A 3LS4H 2CDEB 4KKBD 2VQTA 4FTVE 3VA2C 4QF1A 5IT2H 2ORBL 4NKIH 3KJ4C 3ARBC 4LF3A 3RDTD 1OOAA 4RMUA 5EWIH 1LO5A 4ELKA 4UAOB 4K8RD 3IFLH 4XBPB 2VXUH 3VRLE 2X4RB 3WUWG 3HAEH 1AJ7L 2O5ZH 5MHSE 3ESUF 1MCPH 2NW2B 4BJLA 5C0IA 1MCKA 4R6UA 2Q8BL 1AGBB 2CIIA 1MCLA 3RAJH 5HVWA 3HI6H 3B43A 4OLXL 2BVOB 4PRAA 5I73C 4QOKA 3K1DA 4MA1B 1BZ9B 1S3KL 1NBZB 3MRPA 1XCQA 3QSKB 3QDAA 5CBEA 3KYNA 4G7VL 3FMGL 1PG7X 5IB2B 5IR1B 1EEYB 4MJ6B 3GIZL 1ZT7A 1QRNB 2FGWL 4M1GH 4XXCA 1A6AB 4KK6C 5INCB 5EZOL 2WZPD 3O2DL 3MRDB 5CGMA 3JTSA 4NRXB 1M05A 1HQRA 4U1KB 5KOVC 5IFAH 4WFHD 5C86A 15C8H 2XNAB 2AXJA 3V7AE 2XPGA 4KMLB 4OGXL 4QHMB 1NFKA 5B39G 2Q6WA 4WO4B 2FB4L 3S4SB 5A2JH 2VLKE 3LS4L 1YY9D 4ONHB 2L7UA 5D7JD 2V2XA 5DGRA 3CVHL 1D5ZB 5IT2L 4N8CH 4PJIF 3DXAB 1TTUA 3W9DA 4NKIL 5DVMA 5EWIL 5D2NB 4KHXL 1P6FA 1UXSA 2B0SH 5GGQH 4EUPG 2VXUL 1JGLH 1FG9C 2O5ZL 4AEEA 1H5BA 4BFIA 2YD8A 1MCPL 2IFFL 3UJJH 2VXSH 1UADC 2F58H 2GJ6A 2NY2B 3UTSA 3K8LA 3ARBD 3RAJL 3WS6A 2HG5B 3BW9B 5K9QG 1NMBH 1XGPA 1YQVH 4X6CB 4Z7NE 5KSAA 2Z9TA 1H3VA 4PD4J 4APQC 4X5XA 3OG4B 1GGBH 1LE5A 4NN6B 1CYGA 2VDOL 1SHMA 3VRJB 5T33H 4YHPA 2GUOB 2HJLA 4WNQB 2Q3AA 5EOTB 4UV4L 5IFAL 1ZT1A 15C8L 2X4QA 4NKDA 4PJDF 2YRZA 3R1GL 3OF6D 4LVNC 1X5HA 4KK6D 1U8NB 2VUYA 3RWDB 3H9HA 1ZHLB 4MB3A 4YXHH 1KJ2L 2Q8AH 3RTQB 1ZAGA 5GGTA 5GGQL 2UZYB 1E4KC 1YC8A 3UTTE 1JGLL 2E6QA 4KZEH 4Q58C 3LCYA 5KSUA 5DEFB 3SGJC 2OI9B 1DBKH 1HXMA 1I1CA 2V17H 4EIGB 3UJJL 5LBSH 3RL1A 4CADB 2PYFA 1NMBL 3TA3B 3ZHLA 1JUFB 3U36A 3UDWA 3QQ3A 5T3XL 4JY4A 1G7PA 1GGBL 2D03L 5GGVH 3F7VB 1JZ7A 1LEIB 5IJKA 1X4ZA 4PRPE 5T33L 1OQXA 3W5MA 4X0KB 5HHOB 2VN7A 4WHYH 4F7MB 4R2GB 1LVEA 1YEIH 3C9NB 3MLVL 4NOFA 1DEEA 4S1DC 4OF0A 3WLWC 2BHYA 1II4E 1W0YT 4X4ME 4PRHB 4S11A 5I71C 3BP6A 4TUKL 3HG1A 2XYCA 2XFXB 2PO6C 3S96B 4KMTH 1IGTB 4YXHL 3LMJL 5K9QI 1CDHA 2FGZA 2Q8AL 5ESAA 2BERA 2ICWA 4JFFD 4IJ3C 4JKWA 1JFQH 2NTFA 3CXDH 4KZEL 4UT7H 3VI3F 6FABH 1Z6JT 1INEH 2JELH 1KYOJ 3SDXE 3ULUC 3HI5H 5CJOH 5LBSL 1K2DA 1R5VB 4LEXH 1K3IA 4FP8H 4HSQA 2W9DL 3VA6A 3OAUH 5MEOB 5IHUH 2BSSA 2K9UA 4MD0B 3VXOA 4MAYA 5E5RB 4CVUA 1A7OH 3ROOB 3BKYL 2P47B 1WWCA 3G9VA 4LLMB 1GPOH 1T1WB 5J7CC 3FN3A 5GGVL 4HCRH 1EAJA 3EYSH 2OTPA 1OF2A 4EQ3A 5DD3L 1N2RA 4GG8A 4O51A 3VFMA 2C3XA 5FGCB 4GMTH 3CFBA 4W4OC 1X6LA 1JWUA 1YEIL 4EI5B 4JFQB 4BSWB 4UTAL 3GSUA 2D7OA 4YAQB 1WBYA 2C3VA 2R1XA 4IBLT 1KIUA 4YHNB 5DRXA 1ZE3C 5GGRY 1FORL 1J9CT 1GC1L 4XCYA 3FFCB 1JJUA 1P84J 5ERWA 3EBAA 3L1OL 1BX2A 1I8MA 4PJXA 1H15A 2DICA 2DQIH 5TF1H 5DUBB 4S1DD 1FZMB 4XGZA 3CXDL 2XXMB 3FOMB 3W82A 1FL6A 5C8JA 4UT7L 1NSNH 1INEL 2J8HA 4HH8A 4Z7VB 2PO6D 3HI5L 3OJDB 5CJOL 3KAAA 3VWKC 1U8PB 2GTWB 3TFKC 4LEXL 4FP8L 5D6DA 4ZDHA 5I1GL 5IHUL 1LO4H 1ZSDA 5EU3A 2XZQH 1A7OL 3DRTA 4QRTA 4GG6B 4L1HA 2DM4A 4CW1B 1RJYA 2YPKA 4F15B 4HV8B 3ULUD 3T0ED 3AVEA 1MH5A 2VDNH 5HYQB 4HCRL 1FO0A 1UCBL 4LSDA 3G5XA 3QWRA 3EYSL 4KXZI 3LKNA 1PKQA 3RI5K 4K3EH 3OKYA 3H9ZA 1NMCB 4GMTL 1NGXA 1TJIH 4IRSD 4ZQKA 5FYJU 3JV6A 3C6LA 5IB5B 3QCVL 5F1SA 1F90H 3O4OC 1WCBB 3V8OA 1RJLB 4POZD 2HRPL 4M6OH 5IF0A 1TZIA 3HUJE 2NY0C 1CICC 3L3DA 2IADA 3M17A 5IP4A 1W72B 2E7HA 2DQIL 4G6AC 3SKOB 3OKLA 3VFNA 4ZAKB 4DKAA 3O11A 4I3SH 1EEZA 2OR8A 3LOWA 3O3AB 3OKKA 5E8NA 1XEDA 4KK9C 4QRPA 1YPZF 3MRCB 3F62A 5HGGS 4EDXA 5KTEH 2CRYA 2APBA 2VLJA 2NY3B 5ALBL 4XPGH 4ZUWA 1WLHA 4EUPH 1LO4L 2XZQL 3SKNA 1G84A 5HXMA 5E08L 4EN3B 1NUGA 4IOSD 1S7UB 3CX5K 3MLRH 1KPVA 1KEGH 5I1CL 2VDNL 1FAIH 5B3JF 3O3EB 3TFKD 5KSVA 3W39B 1FL5B 1VKXB 3WNMA 4K3EL 1JPST 2QEJA 1J8HD 1H3TA 1S7RA 2ZJSH 2G60H 3KPQA 4JFDD 3AC0A 4FQQB 3ZKNC 3O4LE 1WZKA 4DFHA 2PETA 2H6PA 5K59F 4MX7A 4XP5H 4Q9CA 5JPNB 3AREB 4KI1A 3VE0A 4LPTA 1KPUA 4N1HB 3NOIA 4I13B 5C07A 4FFZH 1E4JA 4M6OL 5MEND 1S7SB 3DYOA 4WV1B 3CK0H 1U93A 2W65A 1T22B 5H2BA 3AMKA 3CMOH 5C0AA 2NX5E 4IIQA 4Y4KB 3NPSB 1WGOA 4I3SL 5DD6B 2ED9A 5DEZA 5D6CB 3TZVC 4BH8A 3AAZA 3W9EB 2UVEA 3NBNA 4UIMB 4Z5RB 1CICD 5C0BE 2OZ4A 3IFPA 5KTEL 3MR9A 4N8VG 1MIML 3ESVF 4XPGL 3KLHC 3JWDC 5I17A 1W0WB 4ENEC 1TCMA 1DUZA 2COQA 4LMQI 5HHNB 2EYSA 8FABB 1OT2A 4KK9D 1KV3A 3MLRL 4DGIH 2V7NA 1CFBA 2OJZH 3MGTA 5IWLC 1KEGL 5D9SB 2VZSA 4NKOB 1R5IA 2ICCA 3MRJA 4EI6A 1FAIL 3H0TB 1DN0B 3WIIH 1QA9A 2IMNA 3E3QC 3EOYG 5D2LF 4PY8I 3KJ6H 2CGRH 1DE4A 4MDJA 3HRZB 4ONOA 2ADGB 3T3MF 1G7MB 2R15A 1LWRA 1TNMA 4V2BA 4KK5C 1ZA6B 2ZJSL 2G60L 3B4NA 3RWCB 3MRFB 4HF5H 4MWFA 5FEBA 4XP5L 1RZIA 4UDTA 3QIWC 4EDWH 3GJEA 4X99A 5JA8B 3O8XC 2GYSA 1P5UA 4BH7B 3SY0A 3FQRA 3EOTH 5CD5C 2Y5EA 1D5IH 3CMOL 4MJ2A 1FZOA 4TUOA 4KXZH 4NWTL 1EAPB 5EO1A 1A1OA 5ISZB 3QPXH 5DJ6B 1A3LH 3V52L 2ICWI 1IC5H 4ODXA 1OB1B 3IRZA 2J8UA 4JZNA 4P23B 4DZBB 3GGWB 3VXRD 2AJUH 4YR6B 4IHOB 1KELH 1HSAB 1S78C 1KC5H 1I3RA 4UAOC 3TZVD 1LO2L 3DO3A 1BFVH 1KIPA 5SWSE 2EDXA 5C09D 1J12A 2F53E 4DGIL 2OJZL 1A9BA 2P46B 4ETQB 4GLRH 5DQDH 1CDUA 3WIIL 4L8BB 3KJ6L 2CGRL 4X9IA 4JO4H 1OM3H 3AB0C 4AT6A 3KYMB 4BZ2H 1PAMA 3L7FA 4MA1C 3LS5L 1GGCH 4YWGH 4WI8A 5GSRA 1WBZA 4EDWL 5C0CA 1VERA 4NO2A 4J7RA 1OTSD 1XFPA 4WW2B 1I9IH 3O41A 3GJFB 1UACL 2BY2A 4FQXB 5HGAA 3IB4A 5I1LA 2CD0A 4NZDA 3MYJA 3VXPA 1IAOB 5SWZA 3TBTA 5KS9B 3V5DB 5BQ7A 1D5IL 3GSVB 4Z6AT 3Q3GB 3DJ9A 4RMQA 5ITFB 2NNAA 3CVHB 1GOGA 3MBEB 1D9KA 3O8XD 3ZDXE 3JVGA 5K93A 3BD4A 1IC5L 3P0VH 4J3OC 2YD7A 5D7LD 4TSBH 4OZIB 1S5IH 3T2OA 3NFNB 5FOJA 3CCHB 3HAEB 2AJUL 1JZ4A 4PJBB 3GKZA 4P9MH 5D2NC 4KY1H 4PGEB 5BVPL 4TSAH 3TO4B 3L7EA 3IKCA 3HNSH 5DQDL 3UTQB 4O5LH 4P3CL 2NY2C 4XNQA 2WIMA 1S78D 3NTCH 4JO4L 1OM3L 3ZDZF 2XKUA 2H3NB 4BZ2L 4UIKH 2V6HA 1GGCL 1K8IA 3GFUA 4WFHE 4YWGL 4ELMF 4V1DA 2BSTA 2CUHA 3P4MA 2ZOKA 2FECL 4NN6C 2VJXA 1I9IL 1BF2A 2X6MA 1IMHC 1NANI 1Y0LB 3WS3B 2HFGH 4LOUD 4AIZB 4FABH 4R7DB 3WDHA 1R3HA 1S9VA 2EDLA 4OJFH 2P5WB 1CD8A 5IIEB 5D71H 4OGAD 4AK1A 1FNGB 4RAUB 4YX2H 1QVOB 1KJ2B 1HH9A 2ARJQ 1T5XB 3P0VL 3U0WH 3ZZ1A 3WHXB 3U9PH 3V6OC 1AFVH 3QO0B 3AM8A 1KB9K 3KPLA 3BZEA 2V5MA 4F9LA 4G6MH 3RTQC 3O6ML 2XTJB 5DRWA 5CINH 3MLPA 2JK5A 5K9OA 2CH8A 1NGYB 4GRWE 4GAFB 1INDH 3HNSL 1OD9A 3HE7B 1JHKL 3A6CH 1BECA 2AW2A 4O5LL 1V3LA 1KF9B 3EO0A 1VFOA 3NTCL 3PHOA 4NBYB 4OIIH 4XWOD 2D31B 4DUXA 1JNNH 5EBLB 2CUMA 4LQFH 1AXIB 3MOAH 1TVHA 2XG5A 3RVVD 2NY2D 4PJFA 4X80H 3TEUA 5CS7A 3QHTC 4NRZA 1XAUA 3DX9A 4O2EB 4KDTA 3L3JB 3EYVA 1T7XA 3FHAA 4R2GC 1DEDA 4JDVA 1UXWB 4FABL 3T0VA 3W11C 5D71L 4IRJB 5FYLH 4YX2L 5FO7A 5E8OB 2DBLL 4HUWA 2YN5A 1MCOH 1OARH 3U9PL 5I1HH 1D5MB 1T20B 1E27B 1CR9H 1UCTA 3N9GH 3M1BB 4FQIH 5FO9A 5HGDB 3HI1B 1FNSL 4G6ML 3L5WB 4LHUD 1P7QD 2MKWA 4FQPA 4Z0BH 4Z76A 5CINL 4A2MA 1J1XL 4JG0H 1G1CA 3ZYOA 2H32H 4HWUA 4MAUL 1INDL 2CLZA 1F4WL 3A6CL 1T2JA 2D9QB 2XKSA 2Y5TA 4PJEA 3BIKB 3RTQD 2YHGA 2OMNA 4OIIL 3KPSB 3DMMA 3GMOB 3T77A 1UWEH 2RQ8A 5DJ2A 1RJCA 2HKHL 4UZGA 1FN4A 4LQFL 3BP5B 3KLAB 4XP9H 2XKNB 5LGJB 2ADFL 4QY8B 4X80L 4A6YH 2CKBA 2HN7A 2X1PA 4RBPH 4J1UB 5F88A 2CO7B 4LHQB 1PKQE 3X11A 5CMAB 4Y5YB 2FO4B 3MNZB 4JFFE 4U4BA 3UC0H 4EI5C 1VACB 1AE6L 5C7XH 5I1EL 3QUXA 4JRYE 1TXKA 1NFIA 1WK0A 3EZ8A 3DURA 3ZT5A 4OFYA 1OARL 5HHOD 2EE2A 4R2GD 5I1HL 3QUYA 1CR9L 1B3JA 4RAHA 3U7YH 4PREA 3W11D 1AH1A 3T2PA 4JJHA 4Z0BL 2QHRL 1QR1B 2EKJA 5F9JB 5DRZB 4JG0L 2XTLA 2DLFH 4OZHF 3MLTB 1HHHB 5TDPB 4XVUD 3U6RA 1J11A 3IFOB 1MJUH 1NANH 3T4AB 4G8FB 3DIFB 3EO1B 3LSOB 3V4PL 4XMPH 2E7LA 4OZGE 2JCCB 4Q9RH 3CFEA 4KRLB 4ZMAT 4UQ3A 3VFUB 2F74B 3WEXB 2GEEA 1PQZA 2DQGL 3KNBB 4IS6B 3SDDA 4F15C 1NPUA 3OZ9L 5IEHB 4XP9L 1A7QH 4JDZA 5AEAA 3BDXA 1AGCA 3Q1SH 4I77H 3G6DH 2VAAB 5FIEA 4A6YL 4PJAA 4Y4HA 4NQEA 3L6FA 3QG6B 1JN6B 5JXEA 5DJXB 1B6DA 1NMCC 5F89B 1YMMB 5KG9A 1OAZL 3DUUB 1DBBL 2H2PC 3ARWA 4RDQG 3LN5B 2EDKA 2VIRB 2XQYG 2EYRB 3CU7A 3KHQA 1YNLH 4MQTB 3QT2A 4NQCB 5FA3B 2BNRD 4JZOA 3BD5A 4M1CD 1QZ1A 3VCLA 1BD2D 4K7PX 1O5DT 4JGJA 2BOCB 5IESH 3MV7A 4GAGH 3GMQB 5IMOA 4PG2A 3O6FA 1U8LB 4WI3A 3RIAF 1IGYA 5F44A 4QRUB 1SEBB 4MJ5B 1JHTB 2GAZB 2WBJD 3T0EE 3GSXB 3ULUE 4OZFB 2FHCA 2I9LB 3QFDB 3WUWB 4BSJA 5J8OA 1MJUL 3B83A 1F4YL 4HJGA 5D1QA 5E5MA 4XMPL 1NCBL 2NY3C 2B8OT 1CFTB 1B0GA 4JGUA 4Q9RL 4PLJC 4EN3C 3S9DB 5HYJA 4HIIB 5BVJB 3Q5TA 1XGQB 5JO5A 1U42A 5FYJD 3SKMA 4I77L 3G6DL 1EHLH 1QBLH 4NHUB 4C56A 4XCCH 3NIGF 3LQMA 4HS3A 3RVWC 1IM9A 2X4TA 5F9WB 2P44B 4U6YB 4JFZL 1YNLL 1LK2A 3AREC 2NW3B 2AEQH 3DETC 1UM5H 1CG9A 2A83B 1IT9L 1RZGA 5F97E 4K07A 4WVRA 2VRAA 1CE6A 2J6EA 4WV1C 5IESL 4GAGL 3OJVC 2H2PD 3C09B 2FJGB 1OAXL 3MZGB 4Y4KC 3QR2A 3NPSC 3P9LA 4MLIA 2YR3A 3C5JB 5E6IB 1RD6A 1G0XA 4CJ1A 5EUOA 5JNYB 1ULVA 5BW7C 2OXGA 3BH8B 2N56A 2Z92B 4POYA 3ECBA 1AKJA 1Z5LB 2X4UA 4XP4H 1KFAL 1K5NA 3H9YA 3MV8A 4JFPA 4Q6IB 1J8HE 3QJFB 3MNVA 1NC4D 1KTDB 2GSGA 3QDGD 4JKLA 3SOBH 1TQBC 3UTOA 4LFHD 4JPIB 3MJ9H 1JZ3A 3FT2B 5KVGH 2GJZB 3VRIA 4L8SB 4EVNB 1IL1A 2HVJB 1EHLL 1P2CB 1QBLL 2NY3D 2ADJB 5IB4B 5MENE 2AGJH 2W9EH 4BQ8A 4J4PA 1L6ZA 2Y9RT 1WVZA 3LN4A 1I9EA 2ZUYA 5DVOA 2AEQL 3TIEA 3MJ6A 4RRPA 1UM5L 4PTTA 3F6LA 1LK3L 1MELA 2Z31B 3IDJB 3RVWD 3Q2CA 1Q8MA 4TULH 3GHEH 1N5YL 2YUWA 3PDOB 3ARED 2DF3A 2ICEA 1CZ8H 2WBKA 3C2SA 4I48A 3SJVB 2VLRA 2EDYA 4KHTL 3V5KB 4KUCD 2QKIB 4ZFZB 4KMQA 1DLFL 4XP4L 3GI9L 1JNJA 2WUBH 4P23C 1DVFA 3V95A 3KWWB 4NRYA 2YOCA 4S1QH 3GSRA 4MNQA 1ODAA 1CCZA 2BP3A 4RGMB 2IG2H 4MDIB 5FB8A 1LP9A 2M8XA 1BFOA 1NGQL 3SOBL 4CMHB 3UZEA 4JM2D 5CZKA 5GGRA 3MJ9L 5C0EA 5KVGL 3DRQB 5ETUB 4PY8J 3GMNB 3X14A 3TESA 3TCXA 3U2SA 2AGJL 4UDUA 1T1YB 2W9EL 4FXLA 4YHLH 2H41A 3AROA 5ILTH 2I5YH 3MCLL 2F54B 5I1DB 5DHVA 1Z9SA 3V6ZA 4BK4A 1XH3B 3QG7L 4OF5A 4U6VH 3ULSB 1JMXA 3BX7C 1ZGLB 1A1NA 1EO8H 4XC3H 3FB6A 3I75A 2DWDB 3MUGA 5EC2A 3H7BB 4WW2C 2IMMA 1C08B 2VERN 4FQXC 4Z7UE 2R4SH 1DQLH 3VW3H 1AD0B 3VXRE 1CTOA 1MCFA 3GHEL 3PE9A 5TFSH 1U95B 1RV6X 1YYMH 4JCMA 3T4YB 4JHBA 1CZ8L 2ZP0T 1OAUH 5C09E 3MBEC 4NZRH 3ZSTA 2ICWJ 2DMCA 4DTGH 3SN6N 4JANA 3DROA 1Z9MA 2ZSWB 4NFBA 2WUBL 2F8OA 1U6AH 4NWUH 3ZYIA 4S1QL 5BV7L 3SEPA 5CGYC 4F9PC 3NH7L 2J1KA 4D94A 1LDPH 3DSNA 3OGCB 3AS0A 1HHGB 1T1ZB 5ANMB 4NZUH 3V9FA 5C6TL 4P23D 4FQ1L 4P5MA 3RUGB 3ARGB 3D69A 3QIUD 1IAII 2I25N 4BFGA 4YHLL 4HK0B 3QEQB 1JWMB 3K2UH 2I5YL 1A3RH 4P5TD 3UTZB 4X5WB 4AH2B 3RY5A 2DN7A 3FO2A 4U6VL 3WE6B 4P2OA 3TCLB 2R8SL 3OBAA 5HGBB 5D7LE 3MRHB 4PUBH 5J6HA 2R4SL 1MCJA 4LCYA 2VLMD 1AGFA 3BQUB 4XZUB 3PABB 1R0AH 3WSQH 5TFSL 5GGUB 1YYML 1WQVT 3N06B 4RQQB 1OAUL 4HUXA 4M5ZL 4NZRL 4DTGL 4Y4FA 3P4OA 4KI5F 3OKEB 3BPCA 1ETZB 2C4XA 4F8TA 1U6AL 1AC6A 3U46A 2LU3A 1N4XH 1C1EH 5HI5C 5EU5A 2XTJC 35C8H 3P30H 5A16B 3HZKB 4ZYKB 2XOTA 4FQJH 1I7TA 4N1CA 1NCTA 3HE7C 3N1QC 4NZUL 5ID1B 1G7QA 4L4TD 3FKUS 4X6EB 2VR9A 4XNUL 2R0KH 4HIJB 2ADIB 2AXGB 1XZ0B 4NUJB 3K2UL 1JTOA 2OTUA 3BWAA 3LZFL 3O9WA 3HE6A 4AIOA 1U0QA 2I9TB 3BEVB 4QXTB 4WDIB 2AS5M 1T3FA 4PJXF 3PHQA 1JGUH 4G8GB 1A47A 1BVLA 4NDMB 3S36H 5CILH 3UYRH 4H20H 4PUBL 3EOBA 4AYFA 2YBRB 3BVNA 3OJMB 2BNQB 3HZYA 1DQMH 3PHSA 1VADA 1XGTA 3S3JA 4GW5B 1YY8A 4IRJC 1NUNB 3O0RH 3VFWB 2YPLA 3IJHB 1FFOA 2VDPH 2YUZA 4L4VA 3ZL4H 1VFAB 1RSFA 4PJHA 2GQHA 5D2NE 2W0LA 2P5WD 4M5YL 1C1EL 4Y16A 1Y18B 4M8QA 4WU7B 1WSST 4URTB 1D5BA 1NH6A 4HS6A 3IETB 3P30L 1TZHA 2I07A 3U0PA 2OJEA 2YC1B 1N6VA 2WIIB 3FOLA 4J12A 1MI5B 4KV5E 1PVHA 2EDJA 3BZFB 4KUZL 5DUMH 4F3FB 2IH1B 3K4DA 4DVRL 1QFPA 1DBAL 4U6HA 3CPLB 5GS0H 3A6BL 3RHWK 1FRGH 1H3GA 2AV1B 2ESVD 3LAFA 2DLHA 4IMLB 4LLDB 4TN9A 1JGUL 3IGAB 2ATPB 5T3XD 5CILL 3UYRL 1OGTB 3LB6C 4KVNH 4LCWD 5D1ZA 1PEZA 3G6JB 5I8CA 5FDWA 4Y5YC 5J6GA 5ACMA 4LVOB 3TBYB 1DQML 1GC1C 4G8EB 1QQDA 5LQBH 1YDPB 3TNMB 1IAIH 1U92B 3O0RL 1MHEB 4NNYB 1CK0H 5CZXC 3FN9A 3ETBF 4X6BA 3LRSA 3V7MA 5E6YA 3PL6B 4HWEH 3PNWB 2H32B 3OKDA 4QWWD 1SBSL 4QXUH 1YUHA 1UH3A 4IRJD 5CKAA 2DM3A 4YNYA 1EUUA 3PWLA 1I1YA 2R69H 1IGFH 5D5MB 2R9HC 2FCBA 1GZPA 1UT9A 3VXNB 5DUML 3B6SA 5GS0L 2DKUA 1IZJA 4ZOBA 2PXYD 4A6YB 4JVWA 4Y5VB 1E4XI 4XVSL 4PGCA 1XT5A 5JW3H 5HYJE 1CFSB 4UI2A 3W0WB 3TNNB 5HHOE 1BQHA 1F3DJ 1MJJA 5J1AB 3QISA 1HHKB 2L0DA 3IU4H 4G5ZH 4R90H 4A2LA 4WGWB 4Q2ZB 4JFEB 5D7KD 5LQBL 1A02N 2NY5L 4P2QB 1WTLA 1IAIL 4R0LB 1CGSH 1ZGLM 4NYLA 8CGTA 4KRPB 1DQTA 4M7ZB 1AXSA 5IW6A 2NXYD 5L2KD 1ZT4A 4HWEL 2XN9D 4ODUA 3DX8A 3B2UD 2JTDA 2QLVB 2C1PB 4C83B 1OSZA 1YMHB 5I75B 5E8EB 3WIHL 1A2YB 1FL3B 1LD9B 4HKXA 2R69L 5T1LD 1ORSA 4PJDB 4KTDH 1GSMA 1U3HB 4JN2B 4Y7MA 5IBLD 1Q0YL 1OLZA 4GKSA 2UUDK 2X4NB 1OPGH 3MV8E 1PYWB 2H1PL 1JRHH 3T09A 3QCTH 3FONA 4WHTB 2EZ0C 1DFBL 5LWYH 5JW3L 1BP3B 4NQDD 4AIXA 3MRBB 1CXEA 4J6RH 1XF3A 1OGAD 1BQUA 2EEDA 3LD8B 2AJ3A 2BNRE 3ULVD 3VXMA 2A6KA 4JFYB 5C71A 4U0RB 1BD2E 3CIQA 4D0DA 4P57A 1S9WB 4L8DA 2XQBL 1Z2KA 4U6XA 2QADB 4F7EB 4G5ZL 4R90L 2J8UF 1AD9A 4DEPB 4JREB 4YFEA 1GYAA 1RFDH 1UC6A 1QFWI 1CGSL 1QACA 4NO0B 3I6GB 4WUUE 5E8DH 4QHUA 2Z4QB 5GRZA 3ZMRA 3QUZB 1R3LB 3B3IB 2EDBA 5EB9A 4CVWA 2LAGB 1E6JH 4APQA 3C09C 4LCUA 2Z8WC 3EDKA 3T65A 3IFNH 2AK4D 1S7XA 1H8SA 4XNMB 1ZVHA 5MP6H 3JV0A 3KDMB 3TYFA 3OX8A 2OMBA 3QZWB 5E6IC 1UH2A 5FYJE 4H0HB 2DIAA 4KTDL 3BFOA 3HA0A 3Q6GH 4PJ5D 1I8LA 3SE8H 2Z91B 5ID0A 4Q6IC 2JB5H 4JR9H 4G43A 3ZLQC 1QKZH 1FFNA 1JRHL 3QCTL 4J2XA 2DQCH 1EEQA 4PTUB 2ZOLB 1I8KB 4J6RL 4L8SC 2NXZD 3ARPA 3UYOD 1KLGB 4G6FB 4Q0XH 3K46A 4MSWA 1E4KA 3F58L 3GBMH 2EZ0D 3MA9H 4JQXC 3T1FA 2OBGA 2D7NA 1BJ1J 2VQ1B 1B90A 3RPIA 2Y06H 1RFDL 1ZVSA 3QJHA 1IAKA 4O02L 3HLAA 5BO1H 2PNDA 5GRUH 2JIXD 4GOSA 1NCNA 2VWEC 2WLYA 2Z31C 1LGVA 4PYGA 4DWHA 1N64H 2VDML 1E6JL 4GKZA 2FNBA 2IAMD 1FVEA 1XR8A 1A6VH 3IFNL 4P4KB 1BQHG 3QDGE 2EDWA 4OUUB 4K7PY 5MP6L 3OKMA 2WW8A 5CHNA 4B7IA 5J13B 1MVFA 2FSEB 2YRLA 3NGBB 5F3BA 2DWEA 3WLBA 4D8PB 3VWJB 3ZE0E 3BN9C 2IGFL 1IARB 3PQYD 4JKPH 2JB5L 3LIZH 4JR9L 4RGMC 1QKZL 2NY4D 5E6ID 5IVOA 3VFOB 1FYTD 3ARFB 1F2QA 2JJSA 4CMHC 5IMLA 2DQCL 4LKCA 1J0HA 1F3JA 3FQXA 3X3GL 3HS0A 1BLNA 4ZUTB 1FZJA 1DCLA 1NMAH 4HC1A 4ODVH 2IALB 2VE6A 1Q0XH 1UENA 3ZKXB 1BZ7A 3GBML 4WUKH 3CZFB 3WKNA 3WFDH 4JKMA 1OSPH 2MPAL 2R23B 4HX1B 5D7IB 1JF1A 2VXTH 4GQ9L 1FDLL 2Y06L 3BDYH 5IK3A 4HKZA 2Y25A 5IMMB 1BVKB 5GXBB 2P24B 2EDDA 1MLBB 3NFSH 3ARDB 2JB6A 2P8PB 1QG3A 2QQKH 4JRWA 1N64L 3REWB 5I76A 3GRWH 3D85A 4QT5B 1NC2D 1A6VL 1HHIA 1G7IB 4N1EA 4XI5C 3U0TB 1CIDA 1EFQA 4JFXA 1JF6A 5DD5H 5GS2D 3UBXB 3QUML 4D2NA 5BV7B 2Z31D 3VFVB 2NY6B 4W4OA 1ZEAH 3HR5B 1U8HA 2QQLL 2FHFA 4FQCH 4PJFF 4B0MM 3BUTA 3BSZH 4R96A 3MREA 4JKPL 1XF5A 1QFWH 4HXBH 3NABH 3FT4B 5CSBA 3SJVD 3MLUL 2CLRB 3OXRA 1HXYB 1P7KA 2ZCHH 4X7CC 5EO0B 1INQB 1NEUA 3QIBA 3G04A 3D25B 4ZO6A 4F2MA 5GHWH 2KUTA 3ARGC 3BN9D 1HILB 1FVDA 3CH8A 2O61A 1NMAL 4RMVA 1EMTH 2B1HH 2W9LA 5KW9H 1C16A 2XWTB 4WUKL 4FXGA 5AD0B 5I6XB 2BHZA 2RIKA 2D7PA 4UUJA 4K9EH 1IJ9A 4XNZB 3BDYL 3VWKA 3BKMH 3IYLW 3S3SA 3RI5F 3NFSL 4X7EC 5ENWB 4MS8D 4P59H 3T0DA 4ZTPL 4PJCA 2F54D 2QQKL 1MRCL 2B20A 3CX5J 4JFDA 3BQUC 3GRWL 4PJEF 3EYOA 5DDHB 4FQLL 1YEDB 5FUCC 2ATKA 4Z0XB 1F4AA 1TENA 4LEOB 4XVJH 3SQOH 3BAEH 5DD5L 2YD2A 4FA8A 5IW3A 5EIIA 4PJ7A 3ZE2F 1RURL 1I1AB 3A0OA 5I19L 1V7MH 4OM1H 1S7WA 1ZEAL 4XT1C 4RZCB 4FQCL 3B5TA 3PWVB 5B38B 1U8JB 5FK9B 4U1SA 4XI5D 1NGWB 3UZQA 4E9LA 4HXBL 3VH8B 4YXLH 1JGEB 3NABL 3I02B 4FN0A 5L2JA 5JW4R 5GGSB 2CIKB 1S7QA 5BXFA 1MFAH 3IXAB 5DS8A 4HJ0C 1I3GH 4HG4K 5JOPE 1HDMA 4G42B 4UOJA 1EMTL 2B1HL 2VLME 5KW9L 5FKPB 1P69B 4K9EL 1L9MA 1GGIH 3KYOA 1U2HA 4ZUVB 3ARQA 4NT6B 3FB8A 1UWXH 3BKML 4NPYB 5FA4B 5DQJB 3F7RA 1PLGH 4NKMB 5HI3C 2IANE 2X09A 3QEQD 4P59L 4BSVB 2AJSH 5KS9E 5D2LB 1KT2B 1C5CH 3DTXB 5HVHC 3QA3B 4DCQA 4PJ9C 3MV9D 1DDHA 3PF2A 4K8RH 4Z18A 3RP1A 4FTVB 4X6FA 5GZNC 3T0WA 4NO3B 2APFA 3QNXB 4XVJL 3SQOL 1WJ3A 3BAEL 2V2WA 3PP3H 4JLRB 1EZVY 1T21B 4X6DE 1MF2H 4L4TE 5E99H 4JQVA 1V7ML 3BQUD 3IF1A 4OM1L 3HCVA 1CFVL 4E42B 5DJAA 5JTWA 3BGFC 2D9CA 3B8SA 2D7QA 4FQHA 4PJAF 5CBAA 5E9DA 4L9LB 4R4FL 3QDJA 3WNOA 1S5HB 2P7TB 3MMEB 3BPNB 1IGMH 1IEAB 3SKJH 5F7DA 5LAXB 5FF6B 1I1FA 3QH3A 5BZDB 2EICA 4ZNEA 1N3NA 1SMAA 4YZFF 2WSKA 4CVXB 1TMCB 4LLYB 4Y1AD 1MFAL 1FNAA 1BVZA 3F7YA 5SWQB 1I3GL 5E7FA 1BFTA 2UY6A 2IPKB 3G08A 4LCCB 5FCUH 4JKKA 3I6KB 4F7CB 3Q0HA 1T0NB 3TZVA 5EUKB 4YDVA 4NQXB 1GGIL 4LIQE 2RAMA 4Z7QE 2NZ9D 3FT3A 3HPJB 3U7AA 4Z7OE 4N9GA 2RR3A 3J8F7 4M4RA 1PLGL 1ZHBA 1QO3B 1MFCH 3VXQA 4N0UE 1A3QA 4GW1A 3OL2A 2AJSL 1IE5A 1CT8B 5DO2C 2C3HA 3IAPA 2VLKB 2VL5B 3D0VA 2DQDH 1FHGA 1W0VB 4LVOC 5IWLA 3QEGH 4K8RL 4N5ED 5CLWA 2WQRA 2O93L 4JVPA 1C5DB 3EO9H 3R06B 5T1KB 5HI3D 4M6NL 3FB7B 1Q1JH 4XPFH 4MNHB 1MF2L 4E0RA 2QSTA 5E99L 5JUEH 3PL6C 4PJ9D 1FE8L 1G0YR 3C8KB 3QIWA 1HQ4B 4H25B 1MRDH 2A6JA 5GZND 4HFUH 4XPAH 2ESVE 4UOW0 4P46A 1IGML 3SKJL 3OR6B 3O8XA 4GRWH 5HYSA 4QRRA 2WINA 5CJBA 4QHLB 1KPRA 3FL7A 1JZ6A 4LCWE 1ED3B 3C6SB 1U8OB 4LASH 3KYAA 4M3KB 4RNRB 5FCUL 1ZLWK 1L0XA 1DBMH 1Q72H 1QSEB 1KYOK 4I2XB 1F8TL 4Y5VC 2W92A 2GCYB 4NQUA 2CDEA 3L5HA 1J87A 4ZPVA 1MI5D 4WFED 3MLYH 5FYKU 3G6AB 1U3JA 1MFCL 5T3ZE 1J86A 1UJ3B 4C58B 1CFNB 5EUOF 1CGWA 2I26N 5C0ND 1QSFE 4FS0A 2IWGA 4XBPA 4YDIH 3MBXH 2P42B 2XWJB 4PP2B 3UXFA 2W91A 4PGDA 5LGKA 2EH7H 2MNUA 2NW2A 2KDGA 3GNMH 1VA9A 3EO9L 4R0LC 1AGBA 3MLSH 1MCDA 2WQ8A 5K9KA 1T5WB 3GSNA 1IKNC 3S34H 2BVOA 4HDIB 1Q1JL 4KRPC 2HVKA 3ROLB 3N1GC 2FL5B 3FO9B 4LLUB 4M7ZC 5J12B 3DUSB 5JMRA 1BZ9A 2LAAA 4WU5B 3TYGL 4X98B 4C4KT 1NBZA 1HIMH 4HUVB 5IB2A 2RBLA 5IR1A 4HFUL 1CLYL 4XPAL 1EEYA 5I75C 4UTBH 1KB5H 1FNLA 4ZUUB 1CIUA 1RUMH 4N0FB 2RFXB 1QRNA 4NZTH 4JFHD 4NQVB 2DB8A 2GSIB 3MXWH 5INCA 2BZDA 5ICYB 3IDGB 3HRPA 1CFQB 4QNPF 2DQJH 3PL6D 4M1DH 4NRXA 5JW4M 4U1KA 2VXQH 1BFSA 3MRGA 3U48A 3VFSB 2XNAA 4NBZB 1XF2B 4N0YH 4LASL 3QI9B 4QHMA 5EORH 1Q72L 4NCDA 4RA3A 4WO4A 3S4SA 1CDIA 1FC2D 4PRPB 4ONHA 4K23L 5D7KE 1F02I 4U7KA 2ARWA 1UYWH 1D5ZA 2PYED 3DXAA 3MLYL 3LD8C 5HGHA 4IEFB 3SKUD 1AGDB 3D3VD 2AAVA 5CEXB 5L2KE 1UGNA 2VDLH 1N0LA 2XN9E 2QADC 4YDIL 3GSOB 1FVCB 3WHE0 3MBXL 4JREC 4XB7A 1PY4A 3BWUC 3D18B 2EH7L 3GNML 3NN8B 3W0WD 4EZMA 2HAZA 2LU4A 1LP9F 3MLSL 4JY6A 2HG5A 3BW9A 4KQ3H 4I0PA 4OCWH 4X6CA 2FD6L 3QUZC 2Q86B 2DL9A 1IGIH 3ARXA 4C59B 4ZXBC 3SDXB 4JFED 1ACYH 1JI2A 3DYPA 4GBXA 5F93C 1AXTH 1JK8B 3AXLA 1ZA3A 4PLNC 1KNOB 1RUML 4NP4H 5F6IB 4G8IA 2R2HB 4NZTL 4NQDE 3VRJA 1JMZA 4KRPD 2PW1B 2GUOA 3MXWL 4MCYB 4MHHG 3O3BB 4BM7A 4WNQA 1OGAE 3RBSA 4M1DL 2X89D 3GMLB 3ULVE 1KGCE 2AXFA 2VXQL 1KJVB 2EIZB 5DHYB 5EORL 2EE6A 2C5DC 1IC1A 2AEPL 1I9RH 3NA4A 4JO3H 3V6OA 1UYWL 5C08E 1R6VA 1ZXQA 3RWDA 2ITDB 4WEBH 5JQ6H 2ZG2A 1ZHLA 3FB5B 3SDCD 1VFBA 2NPLX 5I15H 5HYSG 1P4LB 2LU7A 2CKNA 2VDLL 1IGCH 4TSCH 3GJFK 3WJJC 3U1SH 2IC2A 4JHZA 2AK4E 5DEFA 4HUUB 4JPVH 3S7GA 3RJQB 3CSPA 4PJGF 2DRUA 3H9SD 4CADA 1ACZA 1WIUA 5J1SC 3TA3A 4OCWL 1JUFA 2QADD 1OAYH 2MWCA 1IGIL 3CFDB 4PJ5E 4TTDC 4FQ2H 1ACYL 1F5WA 4YPGB 4JN1L 5I8EB 1AXTL 2OS7A 4LCIH 4P4KC 1VEPA 5E2VH 1VGKB 5L6YL 1LEIA 3ULUH 2UWEE 1S7VB 2ENSA 5J13C 4X0KA 4F7MA 5E2WH 3NGBC 4ZXBD 4RFEB 3VWJC 5JR1L 2XRAL 4M7LL 2UYLB 5HI4C 1I9RL 3ARFC 4KKCD 4PRHA 4QGYA 4JO3L 1KN4H 1P1ZB 3RL2B 2XFXA 4WEBL 5JQ6L 4DGYH 1DLHA 3EUUA 4L3ED 2GY5A 3ZHDA 5E8PB 5JORB 1IKFH 3ZKXC 5CJ8A 1IGCL 1K6QH 2EC9T 4ONGL 4TSCL 1MPAL 4OZ4B 3U1SL 1RUAH 4LLQA 1X5XA 4JPVL 1AI1L 3D39D 1T6VN 1IZKA 4JE4B 4MHHI 1EXUB 1RIVH 2EO1A 4HZLB 5MEOA 3ARDC 4MD0A 3FAWA 5EZLB 4GUPB 4G9FD 2YWYA 5E03A 2FWOB 3JWNC 4LLMA 1ZHKB 4N0CC 1T1WA 3QUMB 3PQYE 4NM8L 1NCCH 4LCIL 1FYTE 3FN0H 2QQNH 4FFYH 5BV7C 3JZ7A 5E2WL 2NY6C 3ILPB 4EI5A 3MCKB 4BSWA 2QQQA 4PB0H 4P4KD 4YAQA 4YHNA 1U8IB 3OAYH 1XR9B 2BDNH 3C2AH 1KN4L 3MRQB 2YD9A 3DGGB 4FZEL 3FFCA 4JHAH 2R2CA 1D5XB 1VGEH 4DGYL 4E5XB 3O4LB 2R1WB 3VWJD 2IBZX 4MZ2A 5DUBA 2Q3ZA 5HI4D 4KU1A 2O5XH 1IKFL 3IDYB 3FOMA 2XZCL 3ARFD 5I6XC 1K6QL 4GSDH 3OAZH 1PZ5B 4PJHF 4Z7VA 4RX4A 3OJDA 1D6EB 1PSKL 1U8PA 2A73B 4OLUH 1V5JA 3O2VH 3DSFH 2VWEE 3U7WL 1RIVL 5KAQG 3BYYA 2NX5B 2A74A 4CJ0A 3H42H 4GG6A 1L7TL 1TQCC 1MCRA 4CW1A 4HV8A 4I9WD 5C0BB 4ZFOL 2Q87A 5HYQA 5I16B 1IAIM 1NCCL 2E7MA 3SJVE 4UOW1 5T1MB 4XCNB 1J0YA 3DBXA 3ZE1E 4LF3B 5CP7B 1I1AC 2VISB 3I2CL 2RJMA 4PB0L 3C5SA 1DQJB 5IB5A 5IG7A 2N4IA 1WCBA 1HCVA 3BT2H 1MHCB 4F58H 3C2AL 3T3PF 5F7LB 1B4RA 4KQ4H 2NY6D 4JHAL 4LGSB 4LAJH 5HJ3A 2R39A 3SKOA 5E4EB 2Y7QA 2D4DA 5HHQB 2O5XL 1DANU 3I84A 4ZAKA 3QFJE 3WFHB 3O3AA 4YHZH 4GSDL 3BMVA 4GT7A 4AQ1B 4MXWH 4OCXH 1ORQA 4E41A 1C5BH 4KVCH 3ZYZA 3JTSB 3DSFL 1HQRB 1MREH 1BIIB 4EN3A 3H42L 2XPGB 4MNGE 1KG0A 2BX5A 4P9HL 1S7UA 4U05A 4KJPC 1WAAA 2AQ3A 4HKJA 4YGAB 3VG9B 1FNEB 5DR5H 1TTFA 1MRFH 2NZIA 3O3EA 5EU6D 4KKLD 3W39A 1FL5A 4RAVA 3QBTB 3TIDB 2HMIC 1MY7A 5CZVH 3SDAB 1J1PH 5SWSB