1G9NH

Hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
229
structure length
229
Chain Sequence
QVQLLESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYRNNGFLKHWGQGTLVTVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 gp120 envelope glycoproteins from laboratory-adapted and primary isolates.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120
total genus 47
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2000-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g9nH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g9nH01
4UIMB 3IJYB 4YR6A 3K8LA 1RMFH 4OCRL 2X70B 1T20B 5KSBF 1T80A 2N4IA 1EXUA 4M62L 3UPCA 4DEPB 5C92A 1RIUL 1HDMA 1EH9A 4JKLA 3RY6A 5DJCA 1AR1D 1RZ7L 5IVZB 5FDYA 2XTJC 4TNVF 5T3ZL 1UCBL 3KLHC 3NIGF 3QR2A 1HEZB 5D1XD 2G2RB 2IFFL 5EUOF 4IMKA 4L4TE 5CJOL 2DWEB 2IFGA 4JFOA 1WWCA 2HA1A 2WLYA 4NPYB 3LIZH 4JFYA 3RWFA 4ELMF 3JTTB 1GRWA 4ZFGH 5GISL 3ILQD 1EZVY 4ELKA 1S7QB 3DUSA 3B8YA 4P2QB 1G84A 2AKRB 3HN3A 2ILLA 2VDLL 3Q3GA 1UM4H 4M7ZC 2W9EL 1YEKH 4OD3L 2XICA 4HDIA 4QHKI 3RVWD 4PJIA 4Y4FC 1OWWA 4GO6B 2H2SC 3REVB 4I3RH 4QRUB 5DXWA 1B90A 1J05A 1T66C 4MQ7A 1FIEA 3GRWH 2XTLA 3CFBA 5DVNA 3CXDH 4OD2A 4OM1H 4ZUWB 1XF4A 3IYLW 3KYNA 3QUMA 5DQJB 3F12B 4LLDB 1BFVL 5CBEB 2IFFH 2GAZB 3L9RB 4HXAH 5DEGB 1Q94B 3HG1D 2HRLA 1MLCA 1S9VA 4JZJC 2H8PB 3MCG1 2HT4D 1UA6H 3RWHA 1K3IA 5DEFB 4YHIB 1NC4D 3QDHA 1KJMB 2R9HC 3NN8B 2PTVA 4ZAKA 3MUZ1 2OMNA 2GFBB 3LN5A 5FCUH 2KUTA 1WBZA 4FTVA 3IDIB 4KROD 2DIAA 3S35L 5LXGH 4DOHE 1JPGA 1AFVL 1AQDB 4UUJA 1NCWH 4I2XE 2IBGA 4H26B 1HHJB 1BVKB 3KYOA 5IW1B 2DQHH 4KK9D 5J12B 5F7WC 1FC1A 3JWDH 4GW1A 5D1XC 5K9KA 3CVHB 1MY5A 1RMFL 2A6KB 5HVWA 3MA7B 5I66A 2J3SA 3U48A 2F9BT 2A0LC 3O8XD 2VZOA 3AB0C 4Y4KB 5HYQA 1LE9B 2XN9D 3D18A 5CMAB 1H0DA 4JG0L 2MKWA 5JHDB 4Z77A 4OGZA 4KK8C 1DP0A 3QIWA 3W9DA 4G8GD 1MHHA 3ESVF 3H9YA 1TETH 1G7LB 4DKEH 4S1SH 4OFYD 1W72A 1UWGH 2GCYA 3BQUB 3MV9E 3ZZ1A 3N0PB 4PJ5D 1JUFA 2ZG3A 3ISWA 4G5ZL 2OBGA 3L3OA 1IRAY 5D6CA 2ICCA 2OL3B 5IB5B 3IETA 3QZWB 5DD5H 1H0DB 5EU4B 4R7NB 4ZTPH 4JQXC 2HTLD 4JAMB 3L6FA 1FNFA 3MV7A 3H9HB 1DJSA 3KPSB 5D7SH 1ZLUK 1C08A 1G7QB 5DK2B 3IAQA 1L7IL 2D7QA 2IAMC 4X98B 4XPGH 3VGEA 1YYLH 3VGAC 2M8XA 2HT2C 4LSRL 2YWZA 4L3EB 3VFNA 2BSSB 5TPWH 1JWSB 4IRSD 4YDLB 1I1AC 2GK0A 5E56A 5E2WL 1KXVC 4XNMA 3BXNA 4JFHE 4JRWA 1BM3L 2YUVA 5C0GB 3UCRA 1A14L 4JGMA 4X4ME 2IQ9L 1I7TA 1GGIL 5DJXB 3KLAA 4JFHD 2CRZA 5DK2A 4WW1A 5C09D 5GGTL 2XPGA 3KPLA 2X9WA 3S37H 2CLZB 1OAKH 1I8MB 3NFSL 1FZKA 2OL3A 4NN6B 4G43B 3HRPA 3V0WH 5GZNC 1BD2A 1HNGA 1QQDA 4PRPD 2EH8L 1MF2H 4RGNE 1WFTA 2JCCF 1HOCA 2OQJB 3OWEA 3O2WL 3O11B 4M1GH 2R0WH 5C0AA 1ZVHA 1VFAA 5F1IB 3EFFA 2F8XC 1XEDA 2DQUH 3C8KB 1J1XL 3ETBF 5GRZA 1QLRA 2XQYG 1VGEL 1G6RH 3ARDA 3K74B 1XGPB 4Z18A 3LN5B 4U7SA 4GG8B 2BVQA 4GXVL 1UJ3C 5F3HB 1TJIH 5JR1L 1R0AH 3PJSA 2GHWB 1WLHA 1NGXA 3DV6B 5IVXB 3GBLA 3X13B 1X7QA 4HGWA 3QQ3B 4I0PA 4LKXB 1FZOA 3W5NA 4B7IA 4MZ2A 3TVMB 4OQTH 2DQCH 4PJ7A 1K8DA 3KYNB 1V3KA 4MJID 3IGAB 3FFCA 3QNZA 4O51B 2Z35B 4Z7WF 5IMMA 1IT9L 2ZUWA 2M2DA 4O2EA 1UKQA 4PG9A 3BYTA 4NOBA 1HH6B 2IH3A 2C3XA 1AGDA 1A47A 3ILPB 4ZTOH 1H5BC 1QA9B 1HYRC 2E7CA 2BMKB 2CJUL 1D5MA 2FB4L 1XF3B 2P8LB 5DEFA 5B4MD 3W82A 3OKLA 1UACL 1PKQA 2H32B 4RGMC 3RHWK 1JGUH 4F7EA 2FD6L 3G5YB 1XGYL 3VJ6B 2VXVL 2VN4A 1QR1A 1YNLL 1T6VN 4AH2A 1T03L 1BIIA 5MEPB 4KROB 4FFVD 4KJYB 5HHPA 1C16A 4KDWA 3PGFH 2F54B 2Y25A 3MYZA 3QEGH 3BJ91 1S5IH 1T0NA 2UYLB 3FO9B 3ULSA 4JY5H 2J4WL 3GMQA 3MR9A 4G6FD 4WTZA 5DUPL 1OL0A 2DYPB 1CR9L 2C26A 5KW9L 2YC1B 4MJ6B 3KLSA 2W65B 3VWKC 1NGWB 5ESAB 3X17A 3MO1A 2XA8L 5F7YC 1RJZB 1QRNB 3RWIA 1PD6A 3EFFB 3S4SB 5DMJB 3UTTD 4ZODA 1U8OB 1P6FA 2H6PB 4I13B 5DJZA 1GIGH 1DQML 1D6VL 5F1NB 3AM8A 2A9NH 3A0OA 3MLYL 1FDLH 4PUBL 3CXHK 3KPSA 4U1NB 2GT9A 3PXJA 4GOSA 4KQ4L 3OB0K 4UIMA 2VLLB 2R23B 3U2SA 4LQFL 1NSNL 4NFDA 2W60B 4BK4A 7FABL 4GQ9L 3AY4C 3GMRA 5C0DA 4MA8L 1AXSA 1ZHKB 2WW8A 1GCFA 1U8IA 4NQED 2A77H 3JBG7 3RUGA 1CFSB 3T0ED 1WBXB 4XCEB 3ZKMC 3FOLA 2AI0L 5D2NC 3VGBA 1Q8MA 4FXKA 4M8QB 1QBBA 3BE1L 5JMRA 3EGSB 1I8LC 4U1JB 4DN4L 1JCKA 1HZHL 4K23H 1I7RA 2I60H 5F1OB 3RY4A 3KPQB 3IU4L 2Z93B 3WCYA 2EDLA 3ALWA 5GIRB 4LGRB 1IBGL 4XPBL 5FUCE 5DRWA 4FABH 3FQUA 5DC4B 4WFEE 1KCSL 1HXMA 5CS7A 4EOWL 5SWZA 4GH7B 1AI1L 5IW6A 1GVIA 2NY2B 3G5VB 3N1FC 3MV8A 3SE9H 3LKSA 5T3XL 5JIPA 1MCRA 4HS8H 1EIBA 4I9WD 1IMHC 1OAYL 3MLRH 4OD1H 3NFSH 4TVPH 3QWOB 4AIOA 4HF5L 5F8QC 1G7IA 3ZKNC 3KLHD 2C3HA 5DJYB 5B38G 5T3ZE 3MFGB 4JHWH 2Q20A 4EN3A 4J1UB 4ZMAT 3KR3H 4LCUA 4U4BA 4R0LA 4UDUB 3EGSA 5I6XC 1G7JA 2DI8A 1TITA 4TSAH 1BFTA 3QIBC 5FYJD 5CSZA 4PJ5B 4I18C 3KWWA 5IQ7L 2A6KA 3ZKXC 3TT3L 3ZKSD 1WFOA 4C56B 4Z7NE 3SDCB 2ZSVB 1PEWA 1Z5LB 1A3RH 4RMRA 1C7SA 4IEFB 1MJUH 5T33H 1CXHA 3UJIL 4W4NA 2DJUA 4NUGL 5CP7A 3LQZA 4UUJB 1CWVA 2A6IB 1CD8A 2GT9B 3B9EA 1ZSDB 5GHWL 2DKSA 4YFLI 2DQJL 3UPRA 4NWTH 4TVPL 1EMTH 4XPGL 1MNUL 4IRSB 1NGZB 1RUAH 4JR9L 3ZE2F 5IEHA 4F7PB 1MFBH 5I15H 5A43C 5J6HA 3HC0B 1MCIA 2AGJL 2DQIH 1MPAH 1FN4B 4U6XA 5I8CA 3QG7L 4NO5A 4RMTA 4U0RB 3HFMH 4Y2DD 1GJIA 5K9QG 2K7QA 2GTWB 5ETUA 5C09B 5IOPA 2EO1A 1FNSH 1S7TB 2W91A 2J8HA 3PL6A 1DSFL 2WUCH 2P49B 4DKEL 1TETL 4KUCF 4WY7H 3SOBL 3REWA 1UKTA 3RPIA 1W0WB 1YEEH 3IXTB 3ULSB 3AU1A 4YC2C 3QRGL 4QXUL 3PGDB 5EN2B 3ARWA 4OKDA 2J7LA 3I9GH 1OP9A 2NZ9D 3LKRB 3MNZB 2DDQL 5I1LA 1BBDH 4EVNB 4JPIB 1Y18A 3RY6C 3LVEA 3MA9H 3Q6GL 5D96C 4RAVA 1LK2B 4KJWC 5E8NA 4XPTL 1CT8B 1R5IA 5E9DE 1RZFH 1ZWIA 4YHKH 3D1MC 3G5YA 4DKDC 4GFTB 4H25A 3EYOB 1BGXL 5HHNB 5KSAA 3IXTA 4MAYC 1N59B 1Y6MR 4XWGL 4MA8H 5CCKL 4MCYB 4OB5H 3DX9A 4LFHG 1IGML 3IFOB 1HDMB 5SWQB 4HFWA 1MVFA 5GXBB 1T04A 3WFCH 2YRLA 3F58H 3VRIA 4I48B 1RAMA 1FBIL 5E8PA 1F4WH 1N26A 4OSUH 4BQ6A 5HYJE 4J4PA 3C08H 4N8VA 4MNHB 4O5LH 1URLA 2EDKA 1MSPA 4WVRA 1NCBH 3OJMB 4HXAL 3OAZH 4XRCA 5L6YL 1JWMB 2VNCA 3LOWA 4QXGH 2OXGA 5FA4B 2P7TB 3ARRA 5E8OA 4C57C 2ESVE 4MWFB 3VFSB 1S7RB 4X99B 3S34L 4F7PA 5GS1A 2EE2A 1YEJH 4AT6B 3DVIA 1IZJA 2MMXA 5IHUH 2YD9A 1U91B 4D0BB 1R3JB 1VSCA 2WP3O 1NLBL 1T2QL 4FHBD 5EORH 4OLXH 1U8PA 4KU1A 3TFKC 4KXZH 3MLZH 4KTYA 4ZNEA 3BWAB 4CMHB 2B7DT 2YSSB 1G7PB 4DN3H 4G6FB 2A6DB 5ISZE 1MCPH 3LPGA 4PJ9B 5LJYH 2FH8A 1Q9WB 3KPMB 3QIWD 1XCTA 4G6AD 4Y5XB 4HUVA 2VDQH 4JO2L 2KKQA 3CMOL 3QUXA 4LDLB 3K80A 3FB6B 5CLWA 1EVUA 4E42A 1K4CB 3KYAA 1S9YA 1D7FA 1LK2A 5E2UL 5DRXB 2Z8SA 3LEXB 4OF5A 2WM0A 2MHAA 1IQWL 4IDJH 3KYMB 5FGSA 2XZAL 4CMHC 2VR5A 4EIZC 4ORGA 3O2VH 4K7PY 5E4EC 1OARH 1S7UA 2DBJA 1WT5C 3GJFK 1OAXL 4WO4C 4L8DB 4JB9H 3SDAA 2QQLL 4MA7L 2VDMH 1ZHNA 5EIIA 4BYHA 2DQEH 2HFTA 2Z93A 5C8JB 2BSRA 3EDDA 3SOBH 2Y9RT 4Z7OF 3O9WB 1MIML 2JKXA 5BRZD 1EPFA 4LEOA 3CFEA 4QTHB 5F88B 4FXKB 1NMBH 1MFDH 3BT2L 1YJDH 5DD3H 4G80B 1NLDH 4XMPL 1RPQA 3A6CL 4WWKC 1JL8A 1PAMA 3QEQB 4H0HB 2QHRL 1DVFB 3L1OL 1NL0L 1QPXA 2R69H 4JKPH 2YD1A 4L3CA 5BVPL 3THML 3S3PA 1H3VA 1A4JA 3HC0A 1T89C 4P46D 1ZHKA 3FO2A 2BOBB 2F8OA 5ESQA 5C9JB 2BERA 5F3HA 4LLAA 4HPYL 3QXAB 1EGJA 3TLRA 4AK1A 4PV9A 1Q0YH 5DD0H 3V6FB 1FAKT 4YQXH 1UT9A 3UROR 5I1IH 2Q76A 1F4HA 1I8KA 1AGFB 4OLWL 4Z7UE 2IG2L 4PIRF 4Y4KA 4Z7WE 3TF7C 1V3LA 4FZ8L 4ONHB 5F7DB 4BFGA 3QA3B 4Q9RH 5F71A 2E8ZA 2JB5H 4P9HC 5E95B 3P4MA 3LEYL 3UX9B 3ORJA 3MSPA 3SKNB 1NUDA 1YQ2A 4QYOB 1FGNL 5ILTH 1E4XI 3UYOD 1TCMA 4I4WA 1PZ5B 3DO3A 3I84A 3HE6B 1MCWW 2JLLA 4YPGA 4AM0A 3BPNB 2FCBA 2G75B 2H3NA 5GGVY 1RZJC 4NKOB 5C0CB 1U3ZA 3CSBA 5J7CC 4JVUA 4GG6A 2CLRA 2V5SA 2Z9TA 4QLRA 3UTSD 5JIHA 4KVCL 4X5LA 3MV8B 1QPPA 5JXEC 1C7TA 5E03A 1EFXB 4D9LH 4R90H 1CXEA 1T4KA 4W6YB 1NC2B 1KNOA 4R8WH 3UTSA 4U0RC 2Y5TB 5F9WB 1Q9OB 4M6OH 4RNRB 4HKXA 1VESA 5F1KC 5FUZH 5J4MA 3SE3C 3KXFD 5K9JH 4L9DA 3QXTA 4OGYH 3VRLE 1EK3A 4N9OB 3SCMA 4TUOB 3MRGB 3WHXB 3KXFA 1INDH 3E6FA 1R3HB 2UWEA 5CEYB 1LO3L 3LB6C 1LDPL 3ULVC 4S1DD 1N0XL 3TA3C 3CFCH 5L0QB 3RHWF 5BQ7A 1HSBA 3JUYA 4MJ5A 1XH3B 3MBEB 5KZCD 3IAGC 5TGBA 1AXTL 2APWA 5GSRB 1KTLA 2VQUA 3HI6L 1K5NB 1J8HE 3RI5F 2W0KA 1RY7B 3CZFB 2W9DL 4JJHA 1A2YA 2NNAA 3SDCD 4F15C 2CKBH 4PJCE 3QUKA 4NP4H 2AJVL 1D5XA 5EBMB 1CFTA 1NANH 4RQQA 3U79A 3CVHA 3HNVL 1AFVH 1NBQA 3V5DA 4KHXL 1T2QH 3BZ4B 3K7UA 3ZHDA 3L3HB 4WHYG 4ZSOB 3VWJD 2QADC 5E5MA 4KRLB 5DYOA 4GG8A 4HIEA 3STBA 5IHUL 3BVNB 4Z95H 1A0QH 3OXRB 1GAFH 3MBEA 4FFZH 2BNUA 3MNWB 2FJHA 4QYOA 3M17A 1KFAH 5FGRA 1NLBH 4NNXB 5I76A 2XKSA 3IFPA 1LP9A 4GAGH 4HCRH 1ACZA 3CGTA 4X8JA 5DJ6B 4GKZA 2QSTA 3VD5A 2X4OA 5F7EL 3V0AC 3GJFH 2NY7H 3FO1B 1CFNA 1OW0C 4DKAA 3ZTNL 1UGNA 2JK5B 3F7QA 4LPTA 5E24E 4F3FA 1ONQB 2MOVA 4HWUA 5E6IB 1HHHB 4L8SA 4S2SB 1PW3A 5INDB 4FXGB 1QSFB 1EEZA 5IFHL 4Z7NF 2B0SL 5DHVB 3S35X 4A2MA 1UM4L 1J05B 3C2AH 1P9MC 1K4DA 4GS7C 1A0QL 4TTDC 2FX7H 5HYJD 1KLFA 4EIGB 3WDJA 3F7RA 1IKFH 4QXUH 3VRJB 4NQVB 2WNGA 1QBLL 5JXAL 3VCLA 4N8PA 4DUXA 1B4JH 5ANME 3GMNB 5EPMA 3MV7B 1F6FB 3RU8L 1CT8A 1JF1B 3SKJH 2YA0A 5I8KL 2BXYA 1WZ1H 4L8DA 3DX6A 4LMQE 4MZ3A 4U1HB 3HRZA 4PB0H 3E6HB 1CDHA 3P3YA 2Q87A 3EO0B 2EYRB 5T1DL 3VWJC 5F89A 3FO0H 1BX2B 4WV1B 1WAAA 5IVZA 2MCPL 3VFMB 4E5XB 1MELA 1IE5A 4KKCC 4PJ9D 1LK3L 5I74B 3LEVL 3K3QA 3KHOA 3ARQA 1ND0B 4FQLH 1T20A 5I75C 1S7TA 4EXPX 4YXHL 3MRIB 1FNSL 2BSED 5JUEL 3GBMH 5AEAA 2VXUL 3C8KA 1Z2KA 4F7CB 2WBWB 5FO8B 3EAKA 4HFUH 4Z0BH 4U49A 5HHMD 4HUXA 2CLVB 1JFQH 3MJGX 1FFNB 2J2ZA 3NZHL 1EGJH 1KCVL 1K85A 3KYOB 5DRXA 2CDEB 1UG9A 2CO7B 3JV0A 5IGXH 2IQ9H 5K9KB 1E6OL 4U1IB 3CH8A 3MV8D 3BD5A 4NUGH 4ZAKC 4PRID 2NW2B 4Y2OA 1CDCA 1ZANL 1I8MA 4HUVB 5HYQB 1O7VA 1NQBA 1BJ8A 5D71H 2ICES 3F7VB 1EEYB 1RVFH 3HAEB 3ZDXF 2VSCA 2QR0B 1HNFA 4APQA 1FYTD 3MROA 3HLAB 1U41A 1DE4B 1ZLVH 1LD9A 4CDHA 1PZUB 4UT9H 1U36A 4P23A 2EH7L 2C4XA 2YA1A 4L4VA 3QDJB 4LF3A 4L4VE 1IARB 1YN7B 2DAVA 4O9HL 4R4ND 1NGPL 5IJVB 4LHUD 4NZDA 3QDGB 3B6SB 3RIAK 3MLRL 3CLEH 3P40A 4OD1L 5FOBA 4XMPH 2A1WH 4QRSB 4ZUWA 4HG4J 1QO3B 3CFDB 5DVMA 3H9HA 5I1IL 5EA0L 1S7RA 1ES0A 4YK4B 4F3FB 1HE7A 4GT7A 4YAQB 5DEGA 2CUHA 3KYKH 2AJUL 3DSFL 2NLJA 3VGDA 3L7FB 3LS4L 4XP1L 4OZGB 4Z8FL 3TNMA 4JPWH 2X09A 1AJ7H 5FM5M 1U8MA 4JANB 1JPTL 2BP3A 3DETD 1N5YH 1N6VA 2YUWA 2I60L 3VWJB 1D6EA 4FS0A 1CXKA 5TDPB 3OG6B 3RVWC 3PP4H 2FJHB 1JI2A 2NXYD 3V6OC 3C6LC 5DMGC 5GGSY 3MV11 3TIEA 4GRLC 3IXAB 2Q6WA 5DDHB 5C0FB 5GRVK 4X7SH 1B2WL 4CADA 1GPOH 3OF6D 1EFXD 5CSGA 3QXWA 3H0TA 2LAAA 1JGDA 3GJEB 1Y6NR 5GGTA 4G8FB 2K1MA 1X5HA 4PBWD 2DQHL 1OAZH 4LLUA 1JHTA 4U6YA 3HS0B 2IQAA 4MJ5B 3V5HA 3GO1H 5KVGL 3AREA 3GSUB 3BIBX 5I8CB 5C6PB 2A2QT 1B0WA 4QHMB 5IKCA 3ZKND 2XQBL 2GITB 1I3UA 2R4RH 4JFXA 1CG9A 1L6ZA 4ELMA 1HH9B 1KLGA 4WDIA 1S5IL 5IK3B 2VDOH 3AMKA 3MUY1 3PWNA 2VDKH 5DQDH 4P46C 2ATPA 1INQA 2VWEE 2A9MH 3L3KB 3ZYIA 3OKOA 2V9TA 4U6VH 5GSVB 4C4KO 2X42A 3LN9A 4XPHH 3NOIA 5KAQG 2VQ1B 1CS6A 4PJ5A 4X9FA 2DLFL 3QQ9D 2C4FU 5HHOE 4XVTH 4MX7A 3TWCH 2IBZY 4K3DH 3OAZK 2XN9A 4IRJD 2IPKA 3F7YB 1MI5E 1IGMH 4NQEA 1YNLH 2G5BB 2WIIA 3LQZB 3VXOB 5C0JA 4LASH 2W9DH 3KHQA 5J1AB 4RAUA 4TSBH 2CGRH 4R2GC 2XZCL 2EC9U 4HKZA 4Q6IB 1C5BL 1YA5A 3NACH 1RUMH 4LCWE 4WJ5A 3TBSA 3UZVB 2VXVH 3LDBC 3STZB 2F8VA 3W2DL 2R1YB 4WDIB 1KB5A 4UTBH 4XGZA 1G7JB 1MOEA 5FHAL 4C54A 4PYHA 5HHVL 2CIKB 1ED3A 4HIHA 5SWZD 4HZLA 4PJEB 5EOQH 5L88L 4WFHE 1JI1A 3SDXF 2E9BA 3U7AA 4YE4H 1IC1A 4XP4H 3QWOA 3I6GB 3OBAA 2EDEA 1CVRA 1T0MB 3BDBA 1HILB 5CP7B 2OX5A 4YHKL 4ZUVA 3TBYB 5F9WC 3JTSA 2IALB 5ID1B 4JRYE 5FB8A 1S5HB 3I50H 4MVBD 1JZ7A 4PS4H 2R0WL 4D0CA 1MQ8A 4UZGA 3RJQB 5AAWA 4P57A 5J6HB 1U8JA 5KVDL 5C0DB 2NY2C 1DR9A 2B39A 1W2KT 2H32H 4XBEL 1MFBL 5I15L 5JOPD 1CFBA 4K3EH 1RUAL 4HT1L 2I27N 3QG7H 1JGVL 4URTB 4M8QA 3OHXA 3L7EA 5E4EB 4OZGF 3MOBH 3RAJH 3RWDA 3O4LE 1C5CH 1FO0L 3GNMH 4GG6E 3CU7A 5BRZA 2FSEA 1KC5L 4ZDHA 1YMMD 2HFGL 5BVJA 3BPCA 4Y1AB 4OZGA 2E7LA 4R26L 2AW2A 2AJXH 3BGFB 2RHEA 3BP4B 1YMMA 1HXMB 2AEQL 4LSVH 3RVUC 3AS2A 4XCYB 1U8NB 3UJIH 1DBAL 4N0UB 2ZUUA 1ZEAH 5IVNA 2Z8RA 1A7RH 5A3IC 5KJRL 5J1AA 3VFOB 4YPJA 3T0XA 5C0ND 3HPJB 2VSDA 4PJ9C 3B6SA 2DYPA 1YEHH 1INEH 3G5XB 1RU9H 1CE6B 3EYSH 4K94C 1KGCE 1YEFL 1G9ML 2X9YA 4EDWH 1LEKA 3WMSA 3IKKA 3R0MA 3MGTA 5HHQB 3AS3A 4QCIA 3GBML 3AXLA 4U3XA 4AIZA 12E8H 5DUBB 4L1HA 1UXSA 5BOZG 2P8PA 1FV1A 5E6ZA 2X40A 4Z0BL 2VZTA 1IQDB 5IM7B 5F8RC 3U7YH 1Q9LA 4PJGA 1YY8B 2PW2A 3S5LB 2BJMH 4M7LL 3GMOA 5KS9A 1JZ3A 2X1PA 5HHXL 4YUEH 1U91A 1K8IA 4RIRA 1I1YB 3FO0L 1KPRA 1HH9A 5ICXB 4APQC 3C5JA 4W4OC 3GMLA 4ZAKD 3KNBA 1F45A 3P9MA 5BS0D 4K94L 5K9OB 3IFPB 2WBJC 4OZHE 5HJ3A 4LHUB 3I75A 5JUEH 2P45B 4X8JB 4GMTL 4OFDA 4IDJL 3SY0A 3WS3A 4JDTH 3VI3F 1F97A 4LVOB 2OLDA 1TENA 5D7JD 3FQXA 1DUZA 2BOCA 1KYOK 1S78C 4NQUA 4M5YH 1IAIL 3TPUB 1BOGB 4RFOL 5L2JA 4LKCA 3P9LB 4AMKL 4R0LC 4E0RA 2VXSL 1T1ZA 3ARED 4PRNA 2YPLD 5EBMA 3QPXL 1NCDL 4NHCL 2MSPA 1A02N 1J0YA 5IIEB 3RWGB 2XT1B 35C8L 3ARUA 4C55A 2AVGA 4U7MA 1EHNA 1J1PL 4KKCD 1GXEA 4LDOB 2AQ2A 4ZFOB 4DZ8A 3K1DA 4MAUH 2YD5A 2OSLA 1NBVL 2XOTA 1EHLL 4TULL 1GGYA 1MCEA 1IGFH 1UCTA 4NRZB 1OF2B 5K9OA 3QIUB 4RRPG 3HAEG 2I5YL 4NM8L 2X4SB 1FL3B 4Z7WB 3UYRL 1JPSH 3QDGD 2JF1A 3ZTNH 5DJ2A 3G6JB 1RIHH 1EJOH 3SGDH 1YEKL 3U9PL 2CLZA 5AUMB 5JW3H 2CKBA 5HPMA 4U1SA 1MCOL 2VYRE 2F54A 4PBXA 5T1MB 1DLFL 2F54E 2Z35A 4P3WA 1N7MH 1QSFA 3C5ZD 4XCNB 3MREA 2V2WB 2O5XL 1GGBH 3EYQD 3IB4A 4OLYH 3LRHA 5HI4D 1J87A 4XPFH 4G6ML 1M7XA 4OCNC 1I4FB 2FEDC 4G6KL 4C83A 5DJ2B 3ULUC 3ALPA 4FFVC 5HYEA 4ZXBB 2FATH 4LAQH 5ERWA 5T1LB 4UOW0 4LOUD 2KBGA 4I4WB 2Q8AL 3QIUA 3EYQC 5T1KB 2E7BA 5HGBA 1DQJA 2EXWC 2WQRA 3MXWL 1CK0L 4YDJB 1CQYA 1S3KL 2J8UE 4YHOL 1SMOA 2XTJD 4UV4H 3NMEA 4GBXA 3IRZA 4G8GB 3TVMA 1NMAH 3GKWL 4OLUL 4LSUH 3K1KC 4Y4HD 3CH1B 4EDXA 2DI9A 2B1HH 4ONHA 5I30L 1JMZA 1A7BA 2O5XH 5F9JA 2CKNA 1MCWM 4E0RB 1OHQA 4H5SB 1DLHA 1O0VA 1N0XH 4KZEH 4OGYL 4K3HA 4JM4L 3MLXH 4YHLH 4ZUTA 5KOMC 4LRNH 1XGPA 5LGJB 4WW1B 4Q9QH 1JUFB 3QZWG 4JO4L 3E8UL 1A4JB 3SDDA 3SY0B 3WS3B 3FONB 5DWUL 1NCAH 2X4UB 1WFNA 3JWOL 1VKXB 1M05B 3WHXA 5HHXH 5JOEA 1FJ1A 4JO3H 3LKSB 4PP2A 3T0WA 2Z4QA 1QQDB 3HC4H 1MQKH 2NYYC 4ZUVB 1RZJL 4NFCA 1MJ8H 4DGIH 4F37K 4PJ8B 4R8WL 4HJ0D 5DLMH 1UFUA 2HTKC 3PHOA 2P8MA 4WIQA 1QLEL 2DTML 3O6KL 1I85A 1IC7H 1XF2A 3VMNA 2VRAA 3MRFA 5I1HL 5ID0B 4P9HH 3MZTA 1IM9D 4HWEH 1GGIH 1H3TA 1HHJA 3AB0B 1KEGH 2X1OA 3BYYA 3FMGH 2MHAB 3H7LA 3K4DA 2UWEF 3R06B 1WCQA 4JN1H 1GH7A 3OKYA 2NCMA 4QNPF 3IJHA 4XC3L 5KG9A 2SEBA 5ILTL 3RA7L 1IC4L 3ZE2E 1CLOL 4YNYA 2NY1C 3LMJL 3MRJA 4QRUA 1I1AD 5IB4B 5AUMA 3RWHB 2V5RA 4KDVA 3VG9B 2A38A 3QNYA 3DXAA 3OF6A 1QLEH 4P5KA 3G08B 5AZ2H 1MWAL 1AC6A 3DVFA 1P4IL 1Q38A 1NAML 4OZHB 2XXCB 3QUMB 4G5ZH 2YBRA 5BRZB 1INQB 2Q86B 2QHRH 3HNTH 3UO1L 1VADA 4PRPE 2YD3A 2YA2A 1YC8A 2BHYA 5C9KA 1BZ7B 1TZGH 2FH6A 3BVNA 4K71C 1CI5A 5HY9B 4GKOA 1HI6A 3RIFK 2BNUB 3MNWA 2HVKA 4KH2A 4YEEA 1BF2A 2F19H 1Z3GL 2EC9T 1INEL 1WWWX 4F80A 3HZMA 4DAGH 1JK8B 2HKFH 4OJFH 3HKFA 2ZCHH 3RGVC 5JDJA 2HAZA 1J11A 5ABDE 1X44A 1IILE 3MRHB 3R1GL 4H8WC 1U58A 5D8JL 5GSRA 3GFUA 1MWAH 1BVKA 3B2UD 2LFGA 1HHIB 4L5FL 4M5ZH 1QKZH 2ID5A 3RZCC 3TYFB 4BH7A 1OD9A 3RZWA 4FMKA 1HXYB 4FZEH 4EBQL 2FL5A 4JKMA 3G04A 1N5AB 4NCC2 4ZAKB 1TJHH 3RNQB 4RA3A 5FCUL 4KJPD 1K2DA 1S7WB 5KJRH 4YO0A 2A9NL 3HE6D 4X4YB 1D6VH 4WU5A 1TNMA 4Z78B 2YWYA 4P3DA 1KT2B 2DQFB 4OBSA 1B0RA 1PFCA 3I85A 1HQ4B 4IMKC 5J0BA 3O45A 4FP8H 4N90E 4LCWB 1S7XB 5B8CA 4XMLL 5IFJB 5C6TL 1FVEA 1T4KB 3S34H 3TP4A 1KN4L 3QUXB 5JW4R 5CILH 4ACPA 4F58H 3VWKB 1W0WA 3VXUD 1JGVH 3UTTB 1RUQL 2CH8A 5DRNA 1YN6A 1GZPB 1OGTB 3Q48A 4KGLA 1NANI 43CAA 1FG2B 3OX8B 3VH8B 4FG6D 4IMLB 4P4KB 4AM0B 1RD6A 3QHFH 4P2QA 1SMAA 4JB9L 3HE6A 4WV1C 3IJYA 5FHBL 4ZUTB 3TV3H 4HK0A 2JCCA 4LSQH 2QBWA 25C8L 3PDDA 4JQVC 1BZ7A 1ITCA 4NJAH 4X6FA 3CC5B 3LPWA 4BH8B 1ZTXH 3SKNA 4OCWH 4LEXH 2IPTH 4S1QH 1FL5A 1SY6H 3MPCA 2EE6A 3SDAD 2DRUA 4A6YL 1RFDH 4CVUA 2QR0A 1PX4A 3T0EB 4JE4B 3MJ7A 2PTTA 5LGKA 4WWKD 1FZKB 3GSRB 4XC1L 5EZOL 4XWGH 1OD7A 5H2BB 3QUYC 2NR6D 5DJ8A 3ROLB 4LPYA 4GAYA 4XNUL 3FN0H 4UMGA 1KCUH 3WL9B 4UBDD 2CIIA 4JZNB 1AIFA 4RMUA 4I5BA 1KJVA 3B9DA 5E1HB 3AXLB 4NN7C 1CXLA 1FNEA 3C5SB 4D0CB 3QEQA 5CSZB 2EYTA 5HBBA 4PTTB 1YECH 4RFNC 5JPMA 1DN0A 1CCZA 3AS0A 4PYGA 3FCTA 4D9RE 5D70L 1OTUC 3V5KA 4MA3B 3MCLL 3S96A 1DQLL 4YH6A 3NGBB 3PE9A 4YUEL 4CN1A 4DWHA 3WE6B 4H1LH 1MPAL 3O3AA 4JAMA 4NC2B 1SHMA 3X3FH 1BZ9A 1X4YA 3L3JB 2ATKB 1MREH 4Y5VB 5FKPA 4NWTL 2EH8H 4WEBL 1L9MA 3G6JE 1OGAD 2Z4QB 1RIHL 3MRPA 3DX6B 1ZHLA 1XIWA 3OKNA 4CL7A 4NYLB 3V0WL 2ZOLA 1N64L 3JSSA 4NN6C 4P23D 4OGAD 4PB9H 4X5XB 1G7LA 1K4CA 1M6OA 3WEXB 2CXGA 4NKDB 4P49A 3KPRE 4WHYH 1YJDC 1UXWA 4O2FA 1SBSL 1YY9D 1WTGT 9CGTA 2GSIA 3WKNA 5IESL 5AD0B 3GSNH 4GRWF 3QO0B 3JV4A 2VISB 4P5MB 1KIRA 5T33L 2YRZA 1QYGL 2OL3L 35C8H 3NCYP 1QSZA 5IQ7H 1RHHB 3N9GH 4M7KH 2W38A 4Y0GA 3RUGE 3RTQD 5CJXC 5J1SC 5EWIL 3HC3L 1JN6B 1KJ2H 3GSRA 2MFNA 3ZL4L 3T0AA 2C1PA 3ROLA 4DAGL 3RDTC 3RX7A 5CHNA 2AJUH 3NZHH 3UTQA 4QGYA 2V7NA 1MHCA 2EDOA 1KTDA 4LHQB 4WO4A 3B3IA 3ECBA 2P44B 2UY6A 5HGAA 5GGRY 1T5XB 4X6FB 5T3XH 3RWIB 3BQUC 2BVTA 2AK4D 1TTUA 1H8SA 2NY4C 1GHFL 3DTXA 1XMWA 1I8IB 2IAMA 1UH2A 1BFOB 2HJLB 3WO3B 1Q72L 4NQXB 4JRXD 1SVCP 3HUJF 4LLUB 1CGSL 1KXTB 3QHZH 5JHLH 1F4YL 4F8QA 1A6WH 2OCFD 2HLFC 1HWGB 3WNPA 1M7IB 3IDYB 4U1GC 3GMQB 3MR9B 3B9KA 4BA8A 1T89A 3MCLH 3QJFA 4PGEA 4P4RB 3IU4H 3O3EA 2PYED 3ARDC 4FQQA 2A74A 3OAYK 4Y4KC 1OP3H 3D39E 2CDFA 1XGQB 4QRRE 1N0LA 5J06A 3HPJA 4Z7UF 2DWDA 2VLRE 2HFFA 4JO1L 4U1HA 1SVZA 3VMOA 1NC4A 1NGPH 2K7PA 5CEZE 1YMHA 1MFAL 2R56H 4RAHA 4X6BB 1KT2A 5MI0C 1MFNA 3EOBB 4KAQH 1LO5B 1KCVH 2CRMA 1B0RB 4TUOA 3T4AA 1CICA 1GIGL 4OFPA 1KCKA 3B2VH 1KLGB 3MLSH 3EOTL 1ULVA 1N5AA 3KDMB 1Y0LB 3UMTA 4PUBH 2OK0L 3W39B 5HI3D 2KPNA 4Y5YC 3LPFA 1F3DH 3C60C 4JZJB 2DMBA 5KSAC 4WWKB 4OCYL 1LVEA 5GGQL 4QEGA 4WGWB 3CLFL 1LK3H 2NY6C 3O9WC 4JY5L 1C5DA 3DTXB 4N0CD 4AEIL 1YEIH 5IMLB 4A6YA 4CJ1A 1A1NB 4WO4B 5FA3A 4PR5B 4OIBA 1G6RA 5D2LA 1KTDB 2P5EE 1YEJL 4M03A 2EEBA 3M1BB 4LLMB 4K8RC 4XVUC 3VG0L 4HKJA 3S5LG 4MB5A 3QWQB 4HWZA 5GS1C 1L7TH 1A6ZB 3QUXD 1HQRA 4ETQA 2OXHA 3QG6B 5MHSD 5C0AB 5J11B 1A6TA 5ANMB 1FC2D 4TNWF 5BOPA 1BWWA 2VKXA 4OFVA 2XYCA 5I8KH 1ZVSA 4QRPB 3ZSTA 1RQ5A 1MWAB 3FHQA 5D5ME 3MRBB 3CC5A 4HUWB 4OFYA 2ADFH 1NCTA 4DEPC 2DMKA 1NAMB 1A3LL 1UXWB 4O2FB 5L2KE 5C7XL 2GSIB 2O5ZH 3WEXA 5IBLC 4BM7A 4DZBA 1IGYA 1P4BL 1UACH 4IMLA 4EBQH 1OLLA 3IJHB 4XMKH 4KUCD 4HLJA 3HI5H 2R0LH 2CK0H 5IR1A 3RKDD 1FZJA 1WAAF 2NX5B 4XPFL 4L8CA 3QHFL 3CSPA 3MYJB 5AZEL 5DA0B 1FIGH 4PREB 1JPFB 3V9FA 4NRXA 4KRNA 4X9GA 3N50A 3HLAA 1DVFD 5FK9A 5EU6B 1AGDB 4YHNB 2YPVL 3E0GA 2FX9L 3IFLH 3S36L 4MHHI 1MHPL 4K3JH 5C0AE 4F58L 1M7DB 4HGKC 4NM4H 4MA3A 1XIWD 5A2KH 3ET9F 1RUQH 3RP1A 1HINL 1AGBA 3BN9C 4L4VD 1DN0B 3TT1H 4ZUSB 1T1YA 5K59E 3HTLX 2DJ4A 3QULB 3TO4D 3BP6A 1W0VA 1BQUA 1MVUA 2NX5E 3OAUH 3TZVD 1OAKL 2H2PC 3S37L 3T65A 4ZUUB 5E6YA 2FDBP 4HIIB 5KAQF 4PGDA 1IL1B 2AK4B 4MAYB 5KSBB 1IAIM 2DM3A 4KHXH 1D5ZB 4Z7VF 3PQYA 3BDYH 4MA1C 2D9CA 2XWBB 3SDXA 5IHBA 3BEVB 4FZEL 3SGDI 1T83A 1BQHA 3VXMA 2OK0H 4LIQE 3NAAL 2N7BA 2LVCA 1CL7L 5FUZL 5EU7E 3S4SG 2AXGA 3VXSA 4C56E 3PABB 1OPGH 2PYEB 1MCNA 4G6JH 5HPOA 5C0CD 4R4BA 1FLRH 5CD3B 4JPVL 4DQOH 3RNKB 5DMYA 2NQCA 4PRDB 1OTTC 3QO1B 3O41A 5F3BB 3QQ4A 2PCPA 1DUYB 1WFUA 3BEWA 5J11C 2QEJA 1NCNA 3OJVC 2YEZB 1CICC 3NABL 1RJZA 3VXQA 5GS1B 4N8VG 32C2A 1AE6L 4AEFA 4RSVA 1NLDL 1WIOA 1MLBA 4M6OL 1AP2B 2XN9B 2P5WA 4PTUB 3NFPA 2V7HA 5AWNH 1F4AA 2A73A 3OZ9L 4MNHA 3UP1A 4D9LL 3QI9C 1KCRL 1VERA 4H1LG 4PLKC 4KJYA 5HHPB 1NJ9A 5EZJB 5HD8C 1PSKH 4JO4H 3LMJH 3MMEB 3FOMB 5CZXC 4OFKA 1G9MH 4FTVD 4KI5D 4F9LA 3F7PC 1MAMH 4ZO9A 2MQCA 4OZFB 4P23B 5KSAB 1WC7A 2GEEA 3FFDA 2J6EL 3QPQC 2R29H 2WWMC 2H1PL 4LPCA 1UZ6E 3RNQA 3T2PA 2GCYB 4H88H 3ZKXB 3CAFA 4X6CE 1K2DB 1S7WA 1NAMH 1FO0A 5C08B 1MHEB 4M3KB 4QRQB 1CIDA 3VXRE 4P2OB 1PVHA 3ILPA 4M6ML 3HMXA 3CFIC 4I2XA 4WUKL 5ITFA 2FX7L 2JJTC 4OZFG 1BJ1J 4HQQL 2BK8A 3MUGB 3OB8A 3DO7A 1CE1H 5ESVB 2ZOKA 3L3HA 3BZ4A 3ZYZA 3KPMA 1B4JL 5FYJU 3MLVL 3Q5OA 4JGUA 3OV6A 4XP6H 3SDDB 4JFPA 4JRYA 3GJFA 4HWEL 5KSBE 1JBJA 1PX3A 2FEDD 2R2HB 3OKMA 4RMSA 1OAQH 4PRHA 1FVDB 1F42A 1FN4A 4NM4L 4U6XB 1IAKB 4PRPB 3JWOH 5DHVH 4YHLL 1MAKA 2NY4B 1ZXQA 4KZEL 4BFIB 4F8TA 1GGTA 3UPAA 2Q1EA 4W4OA 5DK0B 3LEVH 3MBXH 3X14A 1NCAL 1J5OL 4ZOBA 2ADFL 3LZFL 2FYYA 4CNIB 4I77L 3SGEH 1SBBA 1FNHA 2OZ4H 3GSWB 4J7RA 1CTNA 3VXNB 3QFJB 1DQDH 1I7TB 3OKEB 1PKOA 3BH9B 4G9DA 5DUMH 2R0LL 4YFLF 1QVOB 4M8VA 2VL5B 3EIFA 4L3EA 3VFNB 4H8WH 1I3GH 5IR1B 3TVMD 3GDBA 4Q2ZA 3QH3A 3R0NA 3VG0H 4GLRI 2C7UB 3FT2B 3P30H 5GS3A 3EZJB 4WU7A 1PQZA 4WI9A 2H26A 3C6SA 3CSYA 4GAFB 1JRHI 1EEYA 3T0EC 4HAGA 2CKBB 4MQXC 1L7TL 5IB5A 4QRPE 2R1WB 3PNWA 5SX5H 3CVHL 4RGOL 4QRPA 2EDFA 3B2UC 3NIFE 2AABL 1DLFH 4XVJL 2DLEA 2APXA 3CFCL 4G8IB 4XAKD 4YX2H 2IC2A 2ARJQ 2P24A 2PN5A 3IT8D 3NZ8A 1LWRA 4QRPD 4LRIA 3UBXB 3BPCB 4Y1AA 4N0YH 1NDMA 1ZA3B 3C5ZB 3SE4A 3V6ZB 5DGRA 3N85H 5D72L 4LNRA 5INCA 4XAWL 1E4XL 3VW3H 2OSLB 1U3HD 4JQXA 1T5WA 5FYLL 3HE7B 4HUMB 4P4KC 2I5YH 3M8OH 4NM8H 4LLMA 1MHHB 3HG1E 2GUOB 3CLFH 3GSQA 5DS8A 2BJML 1N2RB 2XFXA 5EZIL 3TN0B 5H35B 2AJYL 2JTDA 4R4FL 5LQBH 2C3VB 4JZOB 4RMWA 1LP9F 1YPZB 2RR3A 3RTQA 1FYTB 5FB8B 3QUXC 1MFCL 1V3MA 3PQYE 1MF2L 3ARPA 2B5IB 3KJ4B 1K5NA 1GZQB 3KJ6L 1UZ8B 1SYVA 3MLSL 1ZLVK 4KMTH 1YEFH 1DBBH 4HWZB 4AMKH 2VE6B 4Z7UA 1HILA 2HMIC 2CDGB 3QEHA 4KAQL 1T83C 5E00A 3K8MA 5SV4A 3U9UA 4HBCH 3KPOA 5D7IF 1WBZB 4FTVB 4NT6A 1ZS8A 1TJHL 4HWBL 5C0BD 4L9LA 5I73B 1FAIH 1S7UB 5CAYB 4ZO8A 5HGHB 3T3PF 2VDNL 4KC3B 1SY6A 5AYUL 2R8SH 2ZKHL 5TE7H 3ZDXE 3ZT5A 3V4UH 1A8JH 1YDPB 5CIPA 1Q9LB 2NX5D 3MFFA 1UJ3B 3PP3H 5DC0A 4OF8A 4EUPH 1F8TH 4K94H 4XCNA 3S6CA 4OD2B 4ALAH 43CAB 3DRTB 2LU3A 4HBQA 4LCCB 2O5YL 4U6HA 3UBXI 4Y8AA 4LHUG 2HKFL 3H42H 2F53E 2V2XB 2A74B 3KS0H 5T3XE 2VR4A 4WTZG 2E7MA 3TFKD 4R96A 3LV3A 5D1QA 4PJBF 3PIQB 4HGMA 2ESVA 3BN3B 1W8NA 3DUUB 4UBDC 1NAKL 2CD0A 4YDVA 5D7LD 1V8HA 4JHZA 1A4KB 5C0CE 2DL2A 4NBZB 2VDNH 3ULUF 2UZIL 4G9FA 4NQDE 4PRDA 5GPRA 2AI0H 2FO4B 5FYJL 2V9RA 5CEXB 3BPOC 1FFRA 4MQTB 1A1MA 5HDBE 1YEDA 4N9GB 1UB5A 5KVFL 4YFDB 3KR3L 3LRSB 4PRNB 2Q7YB 4X99A 1RZKH 4MXQC 2V2TA 3NA9H 1NFIA 3ZLQC 1KJ2L 4P4RA 5ISZA 4RMVA 5EG6C 1F6LL 3QDAA 1I1AB 5DURB 3V7MA 4LU5L 1QSED 4HUUA 4DKFL 2I07B 4LQ1A 1V3JA 2XKNA 1SYVB 4PJAF 4OZIB 3V6OA 4LVHB 4FFWC 4KVNH 5FYLE 3EFDL 1FLRL 2XV6B 5J1TC 4JN1L 5B3JF 3RFZC 4M02A 4CVZA 4GRMA 5EORL 3DVGB 2Q7YA 4LPVA 3OGCB 5D9SB 4M7JH 4M1CD 1V7MH 3UEZA 4PJDB 4P9HL 5D5MA 1NFDA 2AXHA 2QSCH 2EYSA 2YN5A 5HHNA 4J3VA 3WUWG 5CJQL 3TO4C 3DXAE 3RVVD 2V2XA 4HS8L 1TCRB 4Y8DC 5LAXB 4HW6A 2DLFH 4IRJA 5KVEL 1NFDF 4J4PC 5IQ9A 1T0MA 4GMSH 5IWLC 3U0TA 1RULL 4GKNA 2Z0BA 2CR6A 1F90L 4JQVA 4UT7H 4K71B 5DUBA 5FK9B 1DDHA 3DGCR 1BF8A 4Y2DB 4OZ4A 2ATKA 3E2HB 4NZTL 4FQXC 1B6DA 4LL9A 5JLZA 5IHZB 1Z9OA 4OQ1A 5AD0A 1X3DA 3MRJB 3WNOA 4A2LA 4Q6IA 1DANU 3NCCB 5MERA 3MV7E 4JN2B 3W11C 4YHYB 1BGXH 1WBYB 3WLWD 3GO1L 1YN7A 4YBQD 5ICZB 4M6AA 3MZGB 2LQRA 4PGCB 5C08D 2NY4D 5L7XH 5DJAA 5DRZA 5C0RL 4LASL 2GIYA 4G9DB 4ZDHB 2BHZA 4MMXC 2W9LA 5ANMA 3L5JA 4AJ0A 5HHVH 2JJUA 5FHBH 1MHCB 4HC1H 3F7VA 3GI9H 5EFIA 1G7HB 4QHUA 5CINL 3BZEB 1TZHB 4ZS6C 1FFQA 4XZUB 1MIEL 3U9UB 3LY6A 3ARBA 1U6AL 4BSVB 1KIUA 1FH5L 3V4VL 1DBKL 3NPZB 4YIQA 3EO1A 4AT6A 4M7LT 5JW4N 1U8JB 3EJYC 1WEJH 1DQQB 1A7QL 5C0BB 4WUUE 1FNEB 3C5SA 3VD9A 3DV6A 4OGAC 4Y4FB 3OPZH 5H35A 4YDIH 1B3JA 2UUDK 3RL1A 5CJBA 5HHOA 3D0VB 4N8VB 3I6KB 4PJ7E 1AC0A 4C4KT 1T22A 4RGNB 4XNXL 3SDXE 4TUKH 4KTDL 2DM7A 1VFAB 2HWZH 5GHWH 4PJAB 1ZA3A 3V6ZA 5CIPH 1KTRL 2EC8A 5DHYB 5EC1A 2EIBA 4HJGB 4KKAC 5TFSL 3LH2L 1KB5B 4K8RH 1U8KB 2EYTB 4PJDF 1JWUB 3CIQA 4I0CC 4AL8L 2FBJH 3QRFM 3SE4C 2UWEE 2Y7QB 1ZGLM 5TQ0H 3BH8B 4WGVB 1P1ZA 5IP4A 2PNDA 4KTEL 4JN2A 3V5KB 3AM8C 5D1XA 3BPLB 2H41A 3BI9X 4YGAB 5E4IA 3TN0D 3T1WA 3H3PL 2HTLC 5I1AA 5D5MF 3CDFA 2PTTB 1Q9WA 4NJ9H 1L6XA 1LNUA 3LD8C 3FT3B 2XRAH 1JWSA 3PDOA 1TTGA 2QL1A 2NXZB 2R4SH 2HLFD 8FABA 3FZUD 5HXMA 4LVOC 5C86A 1FL5B 3OSKA 4JZNA 2W0PA 2CIIB 1G7QA 5DZLA 5B39A 1BQSA 1KCSH 4QHKJ 3K2MC 2UZIH 2DQFA 3B5HA 3BMWA 4Y1AE 1DBML 3MBED 2RFXA 3WKMH 4G9FD 2C1OA 1KBGH 5F1NA 1VFOA 1CBVH 4NQTA 3UBXG 3UJTH 5IBUB 3ARGA 1G9NL 3WXVL 5C0BE 2YPLB 1JTTA 5T3ZD 4LBEB 5IHLB 4NJ9L 2Q8BL 3VXUE 3W9DB 3MRMB 3DX7B 4GBXD 3FAWA 3QISA 4IRZL 5IUSA 1FVEB 1F8TL 1HKFA 4Z5RA 5IIEA 5BCAA 4WCYL 5TPWL 3IU3A 3D48R 3ZE0F 4MSWA 4LSRH 1Z6JT 3CX5K 3BUYA 2R2CA 1YPZA 3RTQB 5D1ZA 4POZD 5DJDA 5JW4Q 4F37F 3TT3H 1RVFL 5EBGA 1MFCH 1T7VA 5D7LB 5EBLA 5DD1H 5FO8A 4J1UA 4LCYA 1W72L 2VLME 5HYJA 5CEXA 4V2CB 5IFAL 4Z7QE 1KJ3H 5IT2L 3RL2A 5IV2B 4JFZH 4UU9A 3LKPA 3TZVC 5KSBA 2EIEA 3ARXA 3RGVD 4TTDD 2FWOB 4JKPL 1CGTA 4BQ9A 2D31A 4R9HA 3ZO0A 2AK1L 1HOCB 1OQXA 2EECA 3P9WB 1U3HC 4NRYB 1DL7L 1QSFD 3C5ZA 3V79C 1NMBL 3GKZA 3D69A 4OAWB 4OIIL 5M94B 3VH8G 4XNYH 3O2DL 4JANA 2WUBL 3PV6A 4RIRB 3GMMA 3IJSB 1AO7D 2OJEB 3G6AA 1MLCB 3L5HA 2IADA 3MACH 2HVJB 1J1OL 5E7BA 3IFLL 3S36H 1CGXA 2VLJA 4ZXBD 1CLZL 4XCFH 1H3XA 1KIPA 2BCKA 4JJ5A 1SEQH 4K07A 2PUQT 3GMPA 1A9BA 3HUJE 3DURA 1JNNL 4NQVA 5ELIA 3RGVA 1M05A 4PJEF 1E27A 4AG4L 2VL5A 4YGVB 1QVOA 3E3QE 3CPLB 1N4XH 2FGWL 3QUML 4PRIA 3VDBA 4UNTA 3JWOC 3PJSB 4JG0H 1QFWM 2MCPH 2BY0A 4OLVH 5JNYB 4YHPB 3FB8B 1ZT1A 4OUOA 1D9KB 4JDVA 1WCBB 3H9SB 4I0KA 1REIA 2DWEA 4JFOB 1ZOXA 2OM5A 3MXWH 4RGND 4DOHB 1UZ8A 2FZ3B 3QO1A 1MEXH 3GKWH 4OLUH 3B4NA 4MJ4A 2ZUXA 1P4BH 5EULV 4LLQB 1EBAA 5DURD 3U0PA 2O5ZL 3VI3E 1WJ3A 5F7DA 3V0VA 1QSEB 2P4AB 5FYKU 5E9DA 4XXCC 3KPRD 4X6CB 4ETQB 4WI3A 5FO9A 4Y16D 3A67H 4PRHB 5D96B 1MCOH 4JDVB 3ES6A 4HK0B 1SJEB 4NDMB 3M1BA 4PJ8D 4U1GB 1MRDH 1O7SA 1MCKA 1RZ8B 3QUZA 2G9HB 1PEZA 2OZ4L 4WO4D 4F7MB 2FNBA 1ND0A 4GSDH 3TV3L 1RZGA 4G6MH 5DQ9B 2DQUL 1CFTB 4XVSH 2JIXA 2EDBA 1RIVH 3QUKB 1NGYA 3FQRA 4Q97A 1NCCL 4KXZI 1BX2A 3ILQC 1EHLH 3P0VL 3EO0A 1IM9A 5CJQH 2OR7A 4Z0XB 4CBPA 3QDJD 4LCIL 5ID0A 4L8CB 2NXZD 1TZIB 3O3BA 4DTGL 1IGFL 1YEIL 3WFDH 1U95A 4F7MA 4TULH 43C9A 4P2OA 1HYSC 3B5GA 3Q1SH 4XMLH 2DLGA 4LSDA 1DCLA 4B41A 4NQSB 3BHBA 3QWRA 2FJGA 4U2ZA 1ORSA 4PJFE 4X6EB 4X6DB 1OF2A 5CBEA 3VXSD 4HKZB 1PYWB 2WAHA 1NBYB 2X4TA 4OF7A 2Z92B 3AGVA 1EEZB 4RFOH 5FYKE 3QG6A 4M5YL 4Z77B 5LGJA 4NQEB 5I1EH 5FGCB 4I18B 4P2YA 4WUKH 4WY7L 5K9JL 5F9JB 3OR7B 1P2CB 5AWNL 5CEZD 3MNVB 2BVQB 1JZ5A 3TIDB 3DNKA 2E7LC 4GKZB 2NMSA 2FWOA 1DUYA 1U3YA 3BEWB 3OXRA 5FAAA 1KB9J 5EUKB 2OTUB 2QSQA 2NY2D 1H9VA 1RZIB 4WI2A 5E99H 3ARFD 3SQBA 1LEIA 3V5DB 2F5BH 3V8CA 3LB6D 4KHTH 3EYFA 3GSVA 5I71B 4WHDA 1J0JA 4RFNB 2XRAL 3CZFA 1B6UA 3T8XB 3EW3B 5IMLA 1IFHL 2ZJSL 2VDPL 3CCHB 3WNNA 1AKJD 5D7IE 4EN3C 4CVXB 3BFOA 1AE6H 1S8DA 1JHLL 3SBWC 2EDHA 4E41D 1RJLA 4P2RD 4XVUD 5D93C 4AH2B 1PYWA 1KELL 4GRLA 4Q9RL 3MGTB 3EYSL 1I75A 4HFWB 5J89A 3RA7H 1CZ8H 3QUYB 3R06A 1FFPA 5GRVL 3VGFA 5D5MB 3PL6C 1YEDB 2BY1A 1IC7L 3P4OA 4NCDA 2ORBH 5FO7B 2ICWA 1PY9A 2PW2B 4N0UE 5EO0A 1UVQB 5C8JA 4LAJH 1RJLB 1D9KD 1KB9K 2XWJA 3QFJE 5CKGA 1MIMH 1TVDA 4WWID 3P0VH 1MRCL 3QHTC 4EI5A 1KEGL 2HN7A 4P46A 1MFDL 3BT2H 5LBSL 1EHAA 3D0LB 4TRPL 1H8OA 3OG4B 2HMID 5CD5D 4XPBH 1VEPA 3I75B 2I9LB 2P5EB 3NCEB 5MEQA 5IVXA 3PHQA 4JFFB 3P73B 4KDTA 1HHGB 1PG7H 3SHSA 1CTOA 3QCTH 5I1GH 1NCCH 3ARFC 1GYAA 3IDMA 1RUPL 2FX9H 3AAZB 4CKVX 1R3IH 4YX2L 5D4QA 2BVPB 2VIRB 3OJDB 5D2LF 1N6UA 3VFUA 3EDKA 3TA3D 4LRNL 4OSUL 4MA7H 5GRWA 4WUUA 3KS0J 1F4WL 2Z91A 4JO2H 3ABZA 4GQ9H 4MNQA 3TH3T 2KH2B 4X9BA 4CRPA 1YNTA 4KKBC 1Q9KB 3D3VA 4KK8D 4OQTA 4BUGA 1J7VR 3JXAA 4PJAA 2A6IA 1HQRB 2NXYB 1P6AB 5IB2B 5GGSA 2EDJA 1JRHL 4M62H 1AO7E 2AQ1A 4NBXB 4Y16A 1J12A 4R6UA 5IM7A 4ZS7L 2LTQC 2FATL 4LAQL 5BXFB 2RCSL 5T1LA 5H94A 2D2OA 4K8RD 4JCMA 3BH8A 4PJCB 3Q6GH 5EUOA 3VFSA 1AH1A 3PG2A 1C5BH 4HV8B 3O0RL 3T77A 1LO4H 4IM8A 1ORSB 4X6DA 5D93B 3PWPE 3RGVB 4AEEA 1EJ6A 2VIRA 4FFYH 4XP9L 3VU2A 4JEGB 1A9EA 2EDQA 1KSRA 3SKUD 5D7JA 5E6IC 1DZBA 1YC7A 3L3JA 4BKLA 2VDOL 1BZ9B 3VFOA 2YUZA 4I48A 4DCQB 5J13C 3QUZC 4J3SA 2Z31A 4LVNB 4NJAL 3MRPB 2ZUQC 2ZOLB 2PF6A 3BP4A 4G6KH 3VFMA 5FKAB 1I1CA 4RMQA 4U6VL 3K81A 3Q3GB 3HZKB 2V5MA 4JHBA 1TMCB 5IBLD 2YMXH 3FRPG 1KG0B 1NUGA 2YS4A 5TE6L 3RKDC 2R1XB 1L0XA 4PBVC 5FYKH 3HZYB 5DZNA 1J0KA 3MLVH 4X6BA 1CLZH 5LAXA 2C7UA 2DQJH 3VGHA 5IROC 5ACZA 1KENH 3VRLF 4X4YA 2OTWA 1P7HL 4GAJL 1FLTX 4PJDA 4AEHH 5KTEH 4NN5B 3BZEA 4D8PB 1U8IB 2NR6C 4FQQB 5T3ZH 4XCEA 5C07E 1WV7T 1XIWC 1X5FA 4G8IA 4L5FH 4M5ZL 1HHKA 5BS0B 3FQNA 4CDGC 2BNQD 5L0QC 3GSNA 4GS7B 3FN9A 1JV5A 4HLZH 4IIQB 2J8UF 2CMRH 3C2SA 2BC4B 1U2CA 3IRPX 3LKNA 4JO1H 3UC0L 5EBWB 2W59A 5IB2A 4GMTH 4F57L 1KPUB 4C58B 2BNQE 4U1NA 3KPRB 4CU7A 1R5WA 2AXFA 5HJ3B 4DVRH 1FNGA 1KBGL 5E2JA 1G6RB 1EDQA 5D2LB 2FECL 1KCRH 4PJ8C 3FN3A 2C1OB 1NAKH 3DETC 3OGCA 5D9SA 3BW9A 4TPRH 2F5AL 5E2TL 3STLA 4BH8A 4ODBD 3V52L 2D03L 3AREB 3GSUA 3SGJC 3OKEA 4Q74A 3RX8A 3CUPA 1Q72H 4IS6A 5BW7A 3MO1B 5JZ7C 2BY3A 5EBWA 3O8XA 5ISZD 3P11L 1FV1B 4LSSL 1Z3GH 4HWNA 4U31A 2P8PB 4P5TD 1BLNB 5F9AC 5EO9A 2ZWLT 1RK1A 2VLJB 3DGGA 4KKNA 1MJUL 1ZAGA 3PWNB 2J1KA 3MQIA 4P5TA 5IK3A 4L8BB 3DLQR 4PV8B 2WBJA 3STLB 1OCWL 4YO0B 2VC2L 1JNHB 4O02H 5GS0L 2VJXA 5I1JL 1WF5A 4LSPL 3HC3H 1MNUH 3H3KA 4JFDB 3KG5A 4HPOL 1E6OH 4JKWA 4FNLH 3RZCA 5MEPA 2Z92A 3LS5L 5IFJA 4S1RH 2DJSA 3KPPB 4K7FB 5FO7A 3WS6C 4Y4HA 4M1CC 4OCXH 1QP1A 1A1OA 3DX8A 2RAMA 4CU8A 1ZGLB 4HF5H 3TA3B 1AGEA 1JHKL 3CCHA 4X0KA 3F5WA 5C0IB 2FECI 5F96L 1C12A 2PO6D 5EN2A 2X4RA 3VFVA 1KLUA 4Z7OE 3GHBL 1X5GA 1ZHBB 3MUHL 1ERNA 4TSAL 2DLIA 5AG8A 4ZNCD 4KKAD 3X3GH 4G7VH 2IQAB 1MQKL 1I3VA 1LO2H 2IEPA 4NQXA 2FJFA 1F2XK 4U1LB 5IOPB 3T4YA 1CBVL 1LHZA 4R26H 3RBGA 5KBNC 3D39B 3UYPA 2JJTA 5IJVA 3THMH 5HI3C 1SM3L 5GGVL 3T2QA 4MJ2A 1U3JA 4HUXB 2FR4B 4OCMC 2PTUA 4FABL 4ZSOE 3OR6A 3FTGA 1ZLWK 4IRSA 1A7PL 4JFQB 4P5KB 2C1PB 5BZWB 5F1IA 1MHPH 4K3JL 4F9LC 3BP7B 1I1RA 4D9QE 4PJHA 4JQIL 4JREC 1T66D 1OARL 2FIRT 4KQ4H 2UUDH 1G9EA 1PDKA 3BP5B 4PB0L 4PS4L 3HR5B 1CDUA 1QFUH 1CVSC 3U0PB 1AKJB 3QNYB 4GAJH 4MNQB 4QKXB 4D9QD 2BZDA 4J23A 3HI1B 3QDJA 4UQ2A 3WLBA 3S4SA 5A2JH 5I0ZA 2GQHA 4DW2L 2CO6B 2VABA 1W8OA 5F70A 1ZA6A 5EU6D 3PL6D 1S7SB 4RBPH 4KPHL 1XGTA 1E4KC 3UAJD 1NMAL 4QRSA 5C0GA 5GRJL 3T2NL 4XMKL 2BOBA 4NZTH 5DMKA 2Y23A 5DGQA 1E4KA 4N5EC 5EOCL 5C7XH 2RQ8A 5ITBH 5FKPB 3AY4A 5MENE 1IEAB 5F88A 1IM9B 3BZFB 2NTSP 4RDQF 1TXKA 1GAFL 2F53A 3O6FB 4L8SB 4S2SA 1TQBB 2D4FA 2FYYB 1B88A 1U0QA 5FYKL 4K7PL 3AS1A 1QR1B 4PJBA 4UDTA 4AG4H 5EU4A 4YDIL 3SGKC 4KKLC 1OVZA 4WHTA 1RI8A 5F7EH 4EKXA 1GGBL 4JDZB 5A2LH 4PJ8A 3BKML 2E6PA 4XVTL 4U1IA 5HGGS 3PWJA 2X10A 3LN4A 1YEGH 2V17L 3JVGC 4JVWA 4XPHL 4V1DA 1XCQA 4X4XA 3DUHA 2D7TH 4JFFA 5DQ9A 3FONA 4V1DE 3U4EB 2NY0D 4MAUL 2J4WH 1T0PB 1FVDA 3ZTJG 1L9NA 2B4CL 2XQYK 5T5FL 4S10A 3QULA 4Y88A 4CJ0A 1U6AH 4TQEH 4HKBB 3T3MF 5EOCH 3U2SB 3P0GB 1U8LA 2BNRE 1JJUA 4HC1L 1INDL 1JHKH 3DHJA 2R1WA 2NY3C 3T3ME 4JY6B 3VXPB 5HYJB 1NKRA 3ARBB 4OTXL 2OTPA 1QFPA 2AJVH 5I17B 1OQOA 3MV9D 4RQQB 3WO4C 3T0EA 3MRDB 4ZTOL 1H8NA 3EKCA 4WFHD 3IF1A 4GW1B 5F7MC 3BSZL 1BREA 2DLHA 4DKFH 3BUYB 4DGYL 5FFLA 4IHOB 4HHAA 4MNGB 3TBVB 1FNLA 3BGFC 2AV7A 4Q0XH 6FABH 1ORQA 4HS6B 2DQGH 1XF1A 4OJFL 1ZK9A 2HVKB 4U7KA 4NC1C 4XB8A 1QSVA 4NQCE 4D0BA 5F6IC 1ADQA 4XNZB 1E4JA 5FGBC 2D0HA 5I9QC 4E9LA 1TVHB 3DWTA 2NZ9C 4QO1A 3FB7A 3VFPB 1QKZL 4TRPH 2R56L 3HAEH 3CPLA 1R24B 1KCLA 2JK5A 2EXYD 3T1FA 4BK5A 4KQ3H 3DXAB 4HKXB 1A22B 1G0DA 1RULH 1Q94A 3IJSA 1G6VK 4RGNC 4PY8I 1P4IH 1V05A 1TZGL 4JM2A 3DRTA 1F4YH 1MUJA 4P2RA 2X4SA 1NEZB 5HDQH 1BFSA 2AJ3A 4W70A 4C59B 2BSTB 3EYVA 1T04B 2QADB 1A6ZA 4JM2D 5EA0H 5HHMB 4MD4A 4O9HH 2YR3A 2HRPH 4OZHF 3O6ML 4R4NC 4QRQA 2XXMB 3DSFH 1OB1A 1N6QL 3CLEL 4MLSA 4HX1B 3IFNH 1ZLWH 2BSSA 4ODWB 1HKLL 4PLJD 1XAUA 3OR6B 3VWKD 1I7ZA 4FTVE 2R4SL 4KI5E 4KVNL 4WW2A 2X4PB 1K6QL 3CX2A 5DFWH 3V52H 3F6LA 3LD8B 4Z7WA 1VACA 3GI8H 2Y5TA 2ZG1A 4OCLC 4JFYB 4YDKH 2P8MB 5F3BA 1KYOJ 3PWUB 1HHIA 5ALBL 1NUNB 5FEBA 5AYQA 1ORQB 1XF5A 1JNHA 1GZQA 1XGQA 1JE6A 1RZKC 3DRQA 5ITFB 4UT9L 2IBZX 4G42B 1T1ZB 1X7QB 3D85D 4P99A 2E6QA 3B9KC 5SWSD 3EDFA 3NIDE 2MKLC 3L95B 5TQ0L 3MRDA 4ZFZA 3VFVB 1AGFA 4FXLA 2VC2H 2XWTA 4IOSD 1FORL 4KJQD 2YZ1A 4ZFOL 5C09A 3WD5L 1JYXA 1OP5H 4L4JA 1IGJA 1OAXH 4G9FB 3CUPB 2EIZA 4MMZC 5E8EB 1SEBB 3WFEL 1IZKA 3V7AG 1T5XA 2DQEL 3WFHA 3QNXA 4ODSL 3RWJB 2X9XA 2P24B 3NZ8B 4E5XA 3WYRA 3NFPB 3TM6A 4JFEB 3QEUB 3ULUE 1H15B 2FGZA 4OZGE 5E2TH 4GBXB 4L8BA 3OPZL 5AZEH 3B9KB 3O6FD 4JM4H 4EUPG 4G7YH 5EOCJ 1RURL 1SYSA 1RZ8A 3WUZA 3RX5A 1FE8L 1WGOA 5DJXA 4Q2ZB 4XNQB 3QQ4B 5HYSA 3PWLA 4X83A 3W0WA 4ZYKA 5IMKB 1MJ7H 4KY1H 4BJLA 4L4TD 3HI1A 5JQ6L 2N1KA 3WV0A 2OTWB 4LVHC 3MJ8A 5BVJB 4A6YH 3AFLA 2WV3A 5INDA 2E8YA 3KPRA 3KJ6H 5DUML 3TESA 1EV2E 3QEHB 2CDGA 4JY6A 3VXPA 2WBKA 4OLXL 1AO7B 2YZ8A 4UQ2B 3H8NA 3NTCL 1FYHB 1AHWC 1N4XL 2FGWH 1RIVL 2ERJC 3GSNB 4HSQA 4OM0H 2R39A 3MV9B 1DQMH 4MX7B 4OZ4B 1AY1L 4J6RH 5FKAA 2X4OB 3FO2B 3RGHA 2ARJA 2B0SH 2HYMA 1BOYA 3RIFF 3QA3A 3SDYH 3W0WD 2VDKL 4RZCB 4KRPD 1WQVT 3WFCL 1J5OH 2P48B 4XAWH 3GSXB 5DSCA 3HZVB 4Q6YA 2E9JA 3VGGA 5JW3L 5CGYC 1BBJB 5GISH 1QRNE 1LP9E 1PJ9A 1VHPA 4ZSOA 4XNZC 4LSQL 2OYPA 5F6IB 3CDGB 5L6YH 5E1AB 1RV6X 2P7TA 3DARA 1I9IH 2HVJA 3JVGA 1E6JH 4ZFGL 2IADB 4P3CH 4NO3A 3H9SD 4NNPH 4PJIE 4ZFFA 1OAQL 5D2NB 4TTGA 3UAJC 3HS0A 4XXDB 1BEYH 2QSCL 4EJ1C 1AY1H 2Q3ZA 4YJZL 2IH1A 3VXME 1FVCB 1ZGLA 3SO5A 4XP5H 2NY5C 2QSVA 1LO3H 4NGHH 2W0FB 3ARBC 1XGTB 3DX9B 4H88L 4QRTB 3QJHA 4JDTL 3RTQC 1Z9LA 1JNNH 2NY0B 1WTLA 2BRRL 2XZQH 3DIFA 3WLBB 3TPKA 1E28B 1A1OB 3DX8B 4XBPA 1IT9H 1QRKA 3LZFH 1KJ2A 4HUKB 3TVMC 5ESAA 4PFEA 1CFQB 4R90L 5T1MA 4HC1A 3VH8A 5D1ZD 2IBBA 1A6AA 4WI7A 4MDJB 2XN9E 5E8DL 1IGIH 5I75B 3LKQB 1J10A 3K0WA 3D85B 1EUUA 5SWSB 3FL7A 1GL4B 3SJVE 1JNLL 5SX4H 4OGXH 1FL3A 2AKRA 2DKMA 1CD1B 1FGVH 4HIXL 5I74C 3FB7B 3T0BA 1PBYA 4EDWL 3BWAA 2FR4A 1CFQA 2RFXB 5LBSH 3RIAF 1L0YA 2GSGA 4M7LH 3U4AA 3HUJA 2JCCB 3U0WL 4BSJA 3FQTA 1YMMB 4MYWB 1D5MB 1B0GB 1HEZA 3DI3B 3OX8A 3WD5H 3AU1B 5D1QC 5DO2D 1LD9B 3KPNB 3G04B 2P5EA 1WICA 1JP5A 2AJXL 3LQMA 3QJFB 4KJWD 1JIBA 1MRFL 1KPUA 1MJJB 5AYUH 3ARBD 4FZ8H 1J8HB 4PV9B 5L2KA 4U1MA 2J8UB 3F8UB 5F97E 3TJEH 4HG4K 4APQD 3QXVA 1J86A 1XR9B 3LEYH 3BX7C 4OTXH 1BAFH 4MXQD 4M1DL 1QSEE 5JOPE 3HPLA 1MCHA 2B8OT 5JXEA 1OLZA 2A83A 1N8ZA 1W0VB 2ZJSH 1K6QH 2ZPKH 1YNKH 3TNMB 5C3LD 2VAJA 1EO8L 1IGCH 4UIKH 1HI6B 4LEOB 5BJTA 4X4MA 4H20H 4KUZL 2VZUA 3HE7A 1ZE3C 1UADC 3RAJL 4D3CH 1A4KA 5K33A 1YUHA 2ADJA 3PWVB 4NKQB 4NYLA 4OUUA 3AREC 2R1XA 3DXAD 2AJ3B 1S8DB 3O6FA 3IAPA 3HMXH 4B5EA 3DBXB 4G8EA 2X5PA 3A6CH 5HDOA 2WZPD 4YE4L 4PLKD 4QY8B 3U4BL 4F57H 4M9PA 4JRXB 4MXWH 4E41B 5J3HC 3LAFA 1FIGL 5ACLA 5TDOB 4F15B 5JXAH 3MX0A 2OTUA 3FT4A 2UVFA 4JPVH 3SCMC 4ODTH 5CBAB 4I0PD 3B83A 4K8RL 4WTWA 2Y06L 5ICYA 4HUWA 4BZ1L 1XIWB 4GRWB 5KTEL 2HT3C 4G6AC 3I02B 4HS6A 1G7HA 1A7OL 3MCKB 1OY3B 4L4VB 3BISA 1C1EH 4EI6A 1BD2E 5DMGD 3D3VB 1GGCH 1A6TB 4FQ1L 5DHVA 1G0YR 1NGZA 1UB6A 3QFJA 1TFHA 2XA8H 5EO1B 5ADPH 5LGHL 3D2UA 4ODHH 3VGAB 3QO0A 4EQ2A 4GKSB 4AL8H 2BXZA 1FHGA 4HZAA 4S11A 4UILL 4UV4L 3VFTA 2UVEA 3D2UD 1Y6KR 3VI4F 1VPOL 4JFFD 4YBHA 5DT1L 5HI5D 5DSCB 3E2HC 3VXSE 4C56A 4PGDB 1NEUA 3I3EA 3RVTC 5F7NC 4NHUB 4HLZG 1H3UA 4XPAH 2AEPL 2EXWD 2LV4A 3DV4A 3TN0A 4XNXH 3MOAL 5B8CC 1DBKH 3QDME 3V4PH 1T03H 2I9TB 3QUZB 2P5WE 4MD5B 5LVEA 2P43B 1T1YB 5JOFB 1N7ML 5KS9F 3QUMH 5F89B 1IGJB 1L4IA 3MV9A 2YPLE 2YPVH 2ZNXA 4RBPK 3QDMD 1UWEL 2PO6C 3AC0A 1KEML 3K46A 4Z9KB 4RWYH 3BMVA 2QQNL 4ETYA 2G60L 2RCSH 2PXYC 4OCYH 4ZD3H 1P84J 1DQTA 3SDDC 1CGVA 1R6VA 3U83A 3T2NH 1CICB 3OGOE 3H9ZA 1KTLB 1Z9MA 5IMKA 3CNKA 3W0WB 1MIEH 1NBVH 4HIJB 5CINH 3H7BB 2VUYA 4NN5C 4NP4L 4XI5C 5T1KA 2E5EA 4UINH 3VWJA 1JGEA 2CJUH 4FXGA 3W0WE 1I8LA 4GXUM 4L4TB 1ITBB 1BVZA 5KSUB 3GEWB 4FN0A 5H2BA 3FFDB 3CFJB 5HVHB 4PV8A 1MJJA 2Y06H 1HH6A 2IH3B 4PG9B 4QRRB 1VGEH 4LLDA 5IVOA 4QF1A 4U1KB 5DD1L 1UM6L 4MA1B 3RWEB 3MRLA 4WUUB 3O2WH 2EE3A 3GM8A 4PJHB 2R23A 2ZUQB 1JPTH 3QXDA 1ZV5A 4LVNC 1NMCC 4F7EB 2BVPA 4GUPB 3X13A 1J1XH 2E27H 3PP4L 5J13B 2X2YA 4D3CL 5BZWA 2YHGA 1YEEL 3X3GL 2CLRB 1RJCA 2DD8L 1I7ZB 2NTFA 3W9EB 2HP4A 3QJHB 1G9NH 4LNVA 3UJTL 4O2EB 4X7DC 4M61A 4KROC 3QYCA 3CK0L 4G9FE 1HCFX 4W68A 3ZT6A 3SQOH 5EU3B 5FIEA 2WLZA 4N5ED 4QHLA 5CD3A 2A1WL 3TZVB 3UTSE 5F93C 1F6AB 3C60D 1IKNC 2FIKA 1H5BB 1FFNA 4MQXD 5GGTH 4G8GE 4ZPVB 3GSNL 4PPTA 4HBCL 4Y5YA 4CVWA 4YR6B 4UAOC 4WW2F 1KIQA 5I8EB 1T5WB 3KPPA 4K7FA 3QIBA 4LVEA 2Q86A 3B9AA 1OWRM 3SQOL 1HIML 5C2BL 1FPTH 2HFEB 2Y72A 3OKLB 1I1YA 1MJ8L 4TUJB 4DGIL 2BMKA 3T8XA 4JRXE 4X98A 4PY7A 1U3HA 3E6HA 3WXWH 1FYTA 1XT5A 5A1AA 5C6WH 4P5TB 4FQJL 4ODVL 1OTSC 5L2JB 4HFUL 1ZT7B 1J8HD 3TZVA 3WKML 3C6SB 3CSYB 5GRYA 4EOWH 1CGYA 4DVRL 1MH5B 4K23L 4L3AA 3U7WH 1L0QA 1JNLH 2YEZA 3MLPA 4N1EA 5CKAA 4KI1A 4YHMH 4KK6C 4Z76B 1PGRB 3S88H 5E8DH 4MLIA 4BFEA 3ZYJA 2WQ8A 3HMWH 3X11B 3DV4B 1QBLH 3P4MB 3GMRB 2Q3AA 1AIFB 4XP5L 3IVKB 4G43A 3UTOA 5JW5A 5M7QA 1UWXH 4Y16B 4AEHL 1D5IL 3RWCB 5F72S 5L7XL 4PJFF 5KSAD 5F7LB 1RSFA 3KLAB 2W92A 5CP3A 4NO0D 1I3GL 4S0SD 1MY7A 3RWEA 8FABB 5IEKB 3NCFB 3QFDA 2GTZB 2AK4A 4P2OD 5DJZB 1I1FB 4BZ2H 4NO0A 2X4UA 2ZCKH 1KEMH 5I76B 1F3DJ 4S0TD 1MCDA 2H9GA 5HYFA 2RGSA 4XNUH 2E9IA 5GZND 3TBTA 4JFQA 4XWOD 1CR9H 4OD3H 1CD9B 2YC1A 4JPKL 1M71A 4M6NL 1WZKA 1UWEH 5T5NF 3RVUD 3WIHA 4DUVA 5FA3B 1OM3L 2KDGA 3SPVA 4J4PD 4ZQKA 4I3GA 4YXKH 2OJZL 3HB3C 3WNMA 4PGBA 5D6CB 4XXCA 4P4KD 3DROB 4NRXB 2HFEA 3BKMH 3BZFA 1AKJA 4J3WA 3M8OL 1OSZA 1TNNA 3X12A 3KYMA 4Y89A 4IRSC 2Z8WC 2MWCA 3PP3K 5DQDL 3K4ZA 2PETA 3L5XL 3IDIA 1JGUL 2Y07L 3QXUA 4QXWA 2R2HA 3HB3D 4H8WL 3QDJE 3FHAA 3SDAB 1S7SA 4DK3A 5DF0A 3RL2B 5JOFA 3C08L 1UENA 4ODHL 2FLBT 3NPSC 1DQDL 4HX1A 1X5AA 5D6DC 3BGAA 5DD6A 3FN0L 5C6TH 1KJVB 1KN2L 3MMEA 4FP8L 4X80H 3I9GL 3IU3B 3TBYA 2BSTA 4M4RA 1WWBX 1UWXK 3LKRA 4P2OC 2XACC 1R5VB 2V9QA 4BUHA 3D9AL 3EJZD 4QHLB 3PWUA 1WWAX 1FRGH 5FM8A 4PJIB 1DQJB 4XPTH 4G7YL 5EFIB 3N1MC 4P23C 2FIKB 1Q0XL 5F7KC 1H3PL 2F19L 4LKCB 5D8JH 1J8KA 3NVQA 1CICD 4WW2B 5JPNB 3BAEH 4PR5A 4FQXB 4NNYA 5B3NA 2HG5B 3L3KA 5EH1A 3UTTE 1WC7B 2ZCHL 1E27B 3NA9L 2J88L 2H2PD 3N06B 3HUJB 3H42L 3CXHJ 1Z0MA 5JXED 1J0HA 3W81A 5BZDB 2B1AL 3L5WB 3O2DH 4JHAH 3U4BH 5K93A 4M7ZB 1OGAB 1XGUB 3WUWB 3MRLB 2AK1H 1FNGB 1JWMA 5BRZE 4YBQC 3IF1B 3QUYD 1U3HB 3HE7D 2DM4A 5FA4A 2X70A 1HSAB 5IB4A 2Y5EA 3U36A 4NZJA 4PRBB 4N8CL 3GI8L 1LEGA 2BC4A 1I7UA 2C4FT 4PJFA 4YXLL 2IF7A 1RHHA 3V6OE 1CLYH 1QBML 1IL1A 2E9WA 3E6FB 4KRPC 4M48H 3FT3A 5IJKC 1UYWH 1FFOB 2EIDA 4NN7B 3FB5B 1IM3B 1DVFA 1E4WH 3JV4B 2VLRB 2E6JA 1A1MB 5ECJE 4IRZH 3W11D 1DEDA 3N9GL 4M7KL 5D2NE 5DJCB 1FFPB 1FQ9C 1MCQA 1NL0H 2R69L 5E2VH 3DECA 4GRMB 4LPWA 2AXGB 5DHYA 4F33A 1YYMH 5E5UB 3TC9A 4OLWH 4DK6A 1M7DA 1OGAE 2AS5M 5I17A 2JELL 3EJJX 3TO4A 3Q1SL 1T22B 4FQ2H 1J8HA 1FGVL 1HKLH 2I07A 1WVZA 5HDQL 1OP3K 2HJLA 3MRHA 3I2CH 5IWLA 5HTSA 2HRPL 3CMGA 5JDSB 3B43A 3T65B 1N64H 4QHNA 2ZSWA 2A6JA 4Y5VC 3O2VL 1M1SA 1YQVH 4JO3L 2G9HA 4NFBA 1F58L 5IG7A 2QQLH 3MFFB 1PZ5A 2KZWA 5FYJE 3ARVA 5EUKA 4UOW1 1ZA6B 2VWEC 3EO1B 4HMDA 4YZFF 5I1EL 5I1KL 2I9TA 3MOQA 1U8QA 3NIGE 4RGOH 5I8OL 2E27L 1FNAA 1MWAA 4ZOEA 4S1SL 2BHUA 1GC1L 4POYA 3ECBB 3DUUA 1EBPA 1JTOA 4X80L 4EI6B 1A6UL 3TBWA 5L88H 1QHOA 4KV5E 4MQSB 4LLWB 4R7DA 1X9QA 3AMLA 5SX4I 3S35H 5F1SA 3SKJL 1BQHG 1IQWH 1U8PB 1CE6A 1FZJB 3MLYH 2VDQL 4GKSA 3SE3A 5FGCE 3EO9L 1KN2H 2AK4E 4QOKD 3ZSSA 5CIPB 1MCSA 2AV1A 1WITA 3RU8H 2X1XR 1I9RL 4X8XA 4XBGB 1OTSD 1QOKA 2B5IC 3KJ4C 3ULVF 1N2RA 2XFXB 2R2BB 5B39G 2Y07H 2P42B 1P53A 4KDTC 4OM1L 2NY7L 1QG3A 4NT6B 3CX5J 5D1QD 4KK6D 3P4NB 5GRUL 3TN0C 2Q8AH 3PWPD 2EDWA 1U95B 5DUPH 2EICA 3MGOA 4RWYL 2A6JB 5TE6H 2OI9B 4JRXA 5GZOD 1E6JL 1I7RB 2Y1VA 1ED3B 3UBXA 4MXVF 1T1XA 5CGTA 5L9DH 1N8ZB 3VFGH 3MBXL 1NFDB 4JPKH 4JZOA 1A1NA 2XG5A 3SE8L 1EJOL 4GXUN 3K2UL 3STZA 3U9PH 3WJJA 1LDSA 4PJCF 2FD6H 2GY7B 3EOBA 4HMEA 3JV5A 2F74B 3S7GA 2IALA 1SEBA 3TYGH 5ID1A 3DOSA 2GUOA 3HCVB 4OM0L 2BNQB 1Y18B 4PRHE 2W60A 3QBTB 4U3CA 5IG7B 5JPMB 1CE1L 2ICWI 3RWGA 1X6LA 1TPXC 1VCAA 3O0RH 1HHGA 1CFSA 3BRGC 4X6CA 1ZHBA 4XCCH 1FSKB 3IS0X 3ROOA 2CIKA 1M7IA 4HCRA 5MI0B 2DQCL 1MFEL 1A3LH 2HN7B 3ZDZE 5GS0D 1QLFB 1HHHA 4K9EC 2BFVH 3O4LD 5JO5B 4TSCL 2CKBL 2DDQH 5ICZA 4NO2B 2XWJB 1I8IA 2IAMB 5HVGB 1YMME 2MQ3A 1IGTA 1N3NB 1UEYA 1KPVB 2FEEL 8CGTA 5ISZB 1AXTH 4X5WA 1MJ7L 4KY1L 2P1YA 3CD4A 3DMMD 1LILA 3HZMB 1BQLL 3QEQE 3MJ8B 2BDNH 4BFIA 1J0ZA 1IEBA 2VLJD 4OCRH 1T7XA 2ZG2A 4YHML 3WN5B 4NNXA 4R96B 3WFEH 5J9PA 1RHFA 5IB1B 1IC5L 5FDWB 1SM3H 5GGVH 3WIHL 1EMTL 1AD9B 2AJSH 3NH7H 3GJFB 4LSTL 4GXVH 3TO4B 2YBRB 4CVXA 2AGJH 1YUHB 2ADJB 2DQIL 4OUUB 5B8CB 5JPNA 1GZPA 1K3ZA 5L2KD 3Q6FA 2J12B 4UNUA 3GK8L 4CADB 3NCJL 3SKMB 5JORA 3G6AB 2OJEA 1PKQB 2VLKE 3BUTA 3MACL 5FUOL 4UTAH 3OZ9H 5BMFH 2EEAA 2QQQA 5DJ6A 2KQNA 2WUBH 3QQNA 4XNYL 2YD4A 3L5WA 2V7NB 4NRYA 3VG9C 2ED8A 5BV7C 4KZDH 4LFHD 4WEUD 1NDGA 2H32A 3MNZA 1F5WA 1CLCA 2JELH 5F21B 3RDTA 4KTEH 2Q8BH 2VZVA 5D2NA 1LEGB 4G8FA 3SN6N 2DQDL 4PRBA 2XWTB 5IGXL 2FLRT 1MCCA 4DQOL 5DJDB 3EYUL 2YK1H 5D1ZB 4XC3H 2J6EH 5C0FA 2C3GA 3GK8H 1X5XA 2DQTL 4G6JL 3CDGA 2B2XH 3QPQD 3JZ7A 7CGTA 5ETUB 3SDAC 1RZIA 1LEIB 4HIXH 3IETB 4JHWL 4HPYH 3WJLA 5DI8A 2V7HB 2H9GB 2GSGB 1ZT4A 2CDEA 4FQXD 3U0WH 2LABA 6CGTA 5TF1H 3ZMRA 3O3DB 1FO0B 4EUPB 4AQ1B 3X3FL 2COQA 1EZVX 4FQXA 4NNYB 1TJGH 3DVNB 2MCG1 5KVDH 4F7CA 1M71B 4JLRB 1KF9B 3VI4E 2CMRL 2BDNL