2MNJB

Nmr solution structure of the yeast pih1 and tah1 c-terminal domains complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
PHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPSYNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERTLYIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure/Function Analysis of Protein-Protein Interactions Developed by the Yeast Pih1 Platform Protein and Its Partners in Box C/D snoRNP Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords TPR repeat-containing protein associated with Hsp90
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18482 Pih1_fungal_CS Fungal Pih1 CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4160 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2mnjB00
4CGUB 2MNJB
chains in the Genus database with same CATH superfamily
5CUSL 2WJ7A 5F8RC 1EO7A 3MRGA 2ITCB 2IFFH 4Z3FA 4A04A 4U6TA 2WO4A 1LMKA 3ARUA 5GS3A 3ULSA 1IU1A 2CBMA 3WN5B 3DOHA 2ALAA 3P2DA 3DETD 3RUGA 3V0VA 3O0RL 3L3KA 5I66B 4UM8A 2FBJL 2Q6WB 1PKQB 4GQ9L 4UT6H 3B3IB 4UQEA 3HG5A 4YPGB 2PMZA 5FGBC 3UYPA 4XN8A 4B53A 4P46C 2PO6C 3AS0A 2G30A 5E5UB 1T0PB 1ROCA 2ZICA 5I1LA 1WISA 3KEDA 5F7EL 5SX4H 1TEGA 4WWKA 5J13B 4R26L 2ZUYA 3F62A 1WO2A 4PRPA 1EHAA 3WIAA 2E8YA 5KBDA 5I76A 4H0IA 1WZMA 3KPRD 3ZIMA 4WI5A 3NP3A 1N59B 3S36X 3V6OC 3LV3B 3A6CL 1JHKL 1G1YA 1VCBC 1VLXA 4N86A 4OT1L 2ITDA 2XX0A 5FO9B 1KLUB 2EO1A 2DQMA 3GRGA 3IS0X 4G80B 4JRYE 4HCRA 1MFNA 3VB8A 3HG1D 1RJYB 3LKRB 5IMKA 3N1PC 4JJOA 1TYJA 4P99A 2W5PA 3O6KH 3W57A 3V5HB 3QJQB 1HTYA 3MJ8B 3UTTE 1GXEA 5AYUH 35C8H 4KQ4H 3U9PL 5CHNB 4NRZA 3GXDA 4TULL 5CJXC 4NQSA 1XX9C 3CZUB 3QFJB 2NW3A 3CVBA 5DMGC 3SKMB 3D5OF 3VG9C 2BHZA 4WGWB 3JTSB 2D8KA 2VLKD 4FD0A 2DF3A 3WY4A 3E0GA 1JWSB 2R29H 4X9FA 1B0GA 1HESA 3H42H 1R0AH 4NC2B 3B2UD 1IGFH 2XRAH 1BZ9A 4ZFOL 5DGRA 3G9AB 3GLDA 4TOYL 2HRPH 2N59A 3ZKND 5GS2H 2LFEA 3C09B 3UOAB 4MAYD 4NAQA 4K5MA 3VXMD 4HGKC 3PFUA 4PY8J 3UAEA 1IC5L 2ZKHL 3HE6D 5K39A 4KZ0A 1X6NA 2ZT9C 3UTOA 1QBAA 2EECA 4PIRF 2KLRA 5FYJH 3P0YH 3JTTA 5JORB 5D7IB 5E8EB 2LTQC 4GKNB 2YXVA 3K72A 3GI9H 3X1EA 1ES0A 3LH8A 1ZLSH 1DVFC 2BS8A 5FOBB 3CDZB 4QRRD 5FM8A 2RFXB 5LN4A 4EVNA 5BV7C 4HKBA 4WW1A 3LJ3A 3B6SA 1DBAL 4KTDL 5D2LA 1C9SA 4HBCH 4ONFL 2W91A 4GUPA 2MQCA 5L7XH 4FNSA 5D9SA 4IIQA 5EDXA 2KQNA 3PQYA 1NIDA 1FDLL 1N59A 1A3LH 2C3VB 4FNLH 2PCXA 5GGSY 2XQYG 3FRPA 3UJIL 1MDTA 3P0GB 4BFGA 4LRNL 3A6OA 3BAKA 3LAFA 1NUFA 1XGUA 5EU3A 1OAZL 3FONB 1MJJB 3FQUB 1L7TH 4XO8A 1IBZA 2V5MA 5FYLL 1NC4A 4I4WA 4OCNC 4CVZB 5I5MA 4FCHA 3I3BA 4DVBA 3LZLA 1BVLB 4YDMA 1H19A 1U4FA 4XHQA 3KCWA 4P5TC 3EBHA 4E5XG 1VEOA 3AS3A 5DJDA 2MCG1 1JI2A 1GPOL 3LRSB 1VFBB 3EJRA 3PWLB 4H26A 5D70H 5EUOB 5SWZE 1TMCB 3TTSA 4OV6F 4B0MB 2ZNWA 1I7TB 3O45B 1CGWA 1F0LA 4CBZA 4ODTL 1CDJA 3FAXA 3I50L 5ISZB 4LEOB 1OTSC 1RVFH 4LQ1A 4M6MH 1MXDA 4YHIB 3EG9A 4BH8B 3DMMC 4AUJA 3R19A 4PJDE 3I6LE 5AAWA 5DR5L 5I5JA 1BXVA 4ZD3H 2DMHA 4HEMA 3GRWH 3FRPG 4LQFL 3QG7H 4YDVA 4L3FA 5E7BA 5IR1B 1FNGB 3L54A 2QZ5A 4KTYA 3LKQB 5AYQA 1JCVA 5EC1A 5F9JB 5I1AB 1KENH 1BF2A 2Q1EA 1KN4L 3ECQA 4G59C 3ML8A 4GIOA 4Q6IB 3N42B 2WCGA 3BDYL 4DVBB 3U46A 4E42A 4NZRL 1XXDC 3RLSA 1U91B 1YNTB 3VD4A 4Z7VF 3PP3H 3PWJB 4RWYL 1G7IA 1K85A 2VLKA 3M6DA 2J6EH 3CXDH 3O41A 2QHRH 5E00B 4YS4A 5KSBA 5JPMA 2DICA 4IM8A 4PMEA 3RILA 3HFMH 1NCIA 1XT5A 4LU5L 2R59A 1PD6A 1WBZB 3KVQA 5I71C 4PLJD 4OF3A 1DQJA 3NDYE 4N90E 4ODUB 4P2QD 2CKNA 1P9MA 2BSCA 1U8KA 3PWNA 4ZTEA 1NCNA 4H7VA 3UGEA 3VFRB 3S2AA 5A6MA 2E59A 3QRLA 4D0CB 1R24A 3RB7A 2N01B 3CTTA 4AG4H 5K9QG 1MRCH 2EVFA 1ZHLB 3HFFA 5JA9A 2GK2A 2PKDA 1QBML 5LNGA 3K72B 4ZK8A 1PKQA 4ABWA 3QZWB 2JKRM 1F02I 3MLZH 5CAYB 1F56A 4BXVA 1Y07A 2O6PA 4B5EA 1ITBB 3DYPA 3D4ZA 1G1CA 1L9PA 4YWGL 1GJIA 4PVNA 3ZDYE 4WGKA 2EXYC 3S5ZA 5D7LB 3GSUB 2HT2D 3KMDA 4YQXL 3K0WA 4MD0A 1I1FB 2CLVB 4WAFA 4HGWB 3NP4A 5IM7B 2X44D 3SODB 5EPMA 3CZJA 3I3EA 1IV8A 5TQ2L 4N26A 2WQ8A 1OHQA 1H8LA 1OP5K 3MJWA 5FWRA 1VERA 3RWDA 1O6SA 2AJVL 2AJXL 2VDPL 3ES6B 4JCMA 2IDFA 4N9OB 5EN2A 4IOFD 4NHUB 2YEZB 2BXZA 5KVEH 1HYSD 2GYSA 1EX0A 2Y7MA 3OXSB 4ES9A 4H44C 3P9WB 3RZCD 1N5YL 4PCKA 4K0OA 1FL6B 2YPVH 5J6GB 4X8JB 2QGEA 5AVUB 1N3NB 3L1EA 5D8JH 2ZWSA 4I0PB 4L23A 4OF8A 4F8LA 4EQ2A 4TTGA 2XV3A 1I3GL 3DSFH 5AZEH 3QUYB 4FQ1L 3QNZA 4LCCC 4WHCA 3MRNB 3QAZC 4OZGB 5BRZD 3DRQA 3BEVB 4MCZB 4N2DA 4OLEA 4YHNB 1YAIA 2CK0H 5HDLA 4X80L 3IPBA 2BVPB 4LPVA 1MAML 1DBJH 2CKBH 3UEZA 4U1KB 4LASH 1RSFA 3VFSB 5KZCD 3VA2C 3C60A 4IBTA 5IW6A 2FNBA 1EFXD 2Y23A 3Q8AA 1JDCA 4ZX6A 2H6PB 2QR0B 2EVHA 2NY6C 1EZUA 5SWZB 5ANMA 1S9YB 4QTIH 3BVWA 2VZ3A 3RGBA 3HBPA 1HE8A 1NCDL 4B9FA 4BKSC 3DECA 3NTCL 4PJ9C 5ADOH 4XXCA 1T0NA 6PCYA 4I85A 3N0AA 3RTQD 4ALAC 1HZKA 3WCYA 3L4ZA 5KTEH 2CRZA 4JFXB 1BXUA 2V9RA 1ZY9A 1CICB 1I9IH 3KYNA 3GJFH 1J1OH 2WWKT 4P5MA 3FTGA 4MYPA 3C6SB 4NKIH 4YSQA 1EXHA 1UD2A 4PRIB 5C2UB 1BBDH 1S3KL 2EICA 2F8XC 3GQFA 1BLNA 2OJ1A 5DJXA 4EBQH 1XGTB 2FATH 3QAQA 4DN3L 4HUVB 4XCYB 5LAXB 1S9XB 2XZAL 5I73C 1DN0B 3TA3C 4L3EE 3WIIH 1JOIA 2PPCA 2RALA 4FLRA 3R7QA 2VSKB 3HHRB 4JHZA 1H15A 5IB3B 3F7QA 4BFEA 1PZDA 2DQJH 1UTDA 2IH9A 2JLPA 1DQLH 2BP5M 1O75A 3SOTA 1CBVL 1NM9A 3BWUF 4ODBD 3DMMA 3L95B 4TVPL 3Q05A 1P1VA 1YEIH 3IJYA 4HIJB 2WLIA 2E6JA 2YEQA 2FSEA 4X6BA 5CZXC 3LHPH 3PV7A 1U36A 1WPCA 5D2LE 4HK3N 5F21B 2ZPKH 3VFGH 3GM0A 2IWGA 2ZAHA 3ZMEA 4ZW5A 3W5MA 2HWZH 1VFOA 2FEDD 4K3EH 2XWBA 2BNRB 2VSMB 2Z8VC 2DQFB 4LDCA 1SLXA 2VISA 3QEGL 4V11A 4AGQA 3MI6A 4RX4D 5IREA 2JXMA 1FO0A 2EYRB 1VHPA 3UTSA 4HWBA 1A6ZA 2HVKB 3ZKXC 5KBPA 2XTJB 1J0YA 2H6PA 5I74B 2DJMA 3FJTA 2IAMC 3PWUA 5TH2B 3TCLA 5GS1B 3D33A 1M7IA 1Z9OA 3BAWA 1NCHA 5C3TA 2ADFH 2XPGA 5B38A 1Y6KR 4ILDA 1GH7A 3U7AA 4L1BA 1CLCA 5LCVA 4KZDH 3VD2A 4X8CA 5T1DH 1A22B 3Q9QA 3WFHA 4X6DE 3WIHA 1EAQA 1UWYA 3MV01 3GO1L 3ECUA 4Y5XA 4L3CA 4V1DD 2IBBA 3L48A 3RKDD 3T8XA 4FNTA 4WWPA 3MA9L 3BC9A 1IAIH 4NNXA 1AE6H 3ARYA 2Z3FA 2QKIB 4U4BA 5D1XA 3ZPDA 2YGPA 3SDXB 2ICWA 2B3RA 1DO5A 4KHTH 1TNMA 5E95B 5AKTA 2OYPA 5ACLA 3VMPA 4JFOA 2BIHA 2WN3A 5KSVB 1JNHA 1EFXA 4JM0A 4RGMC 1XH1A 3LQAL 1NDTA 2GCYB 5CIPH 1UWEL 4WI7A 2J1ZA 4GRMB 5KWYC 3G08B 3WDHA 2OJEB 4ZXBB 1OP3K 2EUZA 3IS1X 2DWTA 2O5YH 3PP4H 4NENB 5HVFB 3RTQA 1WTLA 1CVSC 2E6PA 5FO8B 3MX0B 1WFJA 2ESVD 4JFFB 1IX2A 1M71B 2CR6A 2VSCA 4QOKB 5C2BL 4NWUH 1MEXH 4MCNA 2IOOA 3MHZA 5FDYA 4JM2B 3IU3B 3C6SA 1XSKA 2JMRA 3EGDB 3NH7L 5IP4A 3V0JA 3AADB 3MRBA 4F9PC 5A43C 4EI5C 4MJ6A 4DH2A 3BPLB 1N8OE 1BFOB 2DTMH 4D9RE 4GW4B 2DBLL 5EC2A 4UQ9A 1JZFA 4FNUA 5IVXF 3MODL 3VXOB 3HLKA 5C7ZA 4F20A 3HE7C 3RL1A 5HYSG 2IC2A 3SGJA 4HKJB 2MQGA 3SDCA 2N4IA 4QHMB 1E0OB 1HNFA 2JJVA 3CLEH 3X13B 1Q1PA 2EDTA 4HUUB 4M29A 4X5XA 4XMPH 3SB3A 3G5VB 3LIZA 5ALBH 3IJHB 2ORBH 7FABH 5HGGS 1UD3A 2VQUA 2K3TA 4QXGH 3FQTB 1CFTA 2BVTA 3PAYA 4Y5VA 4PVMA 4JRYA 4YVNA 5A16A 1NZRA 1LEIA 4R2GD 1B2YA 4NKOB 4JGJA 3L1OH 5CU5A 3HNSL 3WDJA 5ID0A 4PJGA 4M3KB 1N3NA 3ZTEA 5DJCA 1WD8A 4ZX4A 3RBSA 2O6DA 4PW4A 5AW7B 2YUWA 4PJFB 1AKPA 3O2WH 4LCIL 1ZLDA 2C9AA 5F1IA 4DP8X 5L0QB 1OGSA 2BZ7A 4A67A 1Z1WA 2ZG3A 1U9KA 1AHWA 1L9OA 1T0MA 2BSSA 3ZK0A 3K71A 2WBKA 4JKKA 1LHZA 1TYRA 1S7TB 5E9DD 5KSBF 5AYTA 5I1IL 4JRFA 3FB8B 5CKGA 4QRPA 1AFVL 3MV7D 4HX1B 1FZJA 4NRXA 4POZC 5JIPA 2CR0A 1AR1B 4HHWA 4L2LA 3QQNA 4UAOC 3SKOB 4V1DE 2D7QA 4Z7VA 4MNHA 4PS4L 3SGEI 2VKWA 3RZCB 2R0LL 4BZ2A 4H8HA 3WNNA 3AG4B 1GCYA 1BQUA 1UD5A 2AXFA 3RDJA 4J23A 4XBPA 5CP7B 4ZDHA 1Z3GL 4NM4H 1IE4A 4FAAB 5JR1H 4PW9A 2B20A 4I3SL 4V1DA 3VFUA 3C75A 1BVLA 5IEKA 1RMFH 4W9IC 1IAOB 4YSOA 3TN0C 1AZCA 3ROOB 4K8RH 5C0CB 4NT6A 3SE8L 1GL4B 2NW2A 3O4OB 1IM3B 2WOBA 3NZUA 1J9QA 4JFHD 3MLPA 2FECI 3EJYC 3GS0A 4ZFGH 4HCRL 4ODUA 3CN1A 4LGRB 1QSVA 3TXAA 1S7XA 4AJWA 1K5WA 4HKXB 3MXVL 1F4HA 3AXIA 5I1HH 5E9AA 5IW6B 3BUIA 3US1A 1KGXA 4OUOA 2J4WL 3CHOA 2VW6A 4EI5B 3MRIA 1WC7B 3DTXA 1H3XA 3FUJA 4LPXA 1N5AA 4WUUA 4L4VA 3DO3A 2X9ZA 4CGTA 3PWJA 4OSUH 4I88A 3QUYA 3HE7D 1KLGA 1VSCA 3JUYA 3CN3A 4IBZA 4BHUI 1DBBL 2YLKA 4K8RC 2DQIL 1OCWL 4UCFA 1FV1A 3QH3A 1GAFH 3WKYA 5I1AA 3II1A 1E6JL 5J89A 5D1QE 1D5IL 2VITB 3FUEA 1OSEA 2WBJC 1TVHB 4GO6B 5DI8A 3H3KA 4XO5A 3IDIA 1A9EB 1RUPL 3LXCA 3M17B 4LL9A 5F44A 4L29B 1MFCH 2N1KA 4PV1C 2C9PA 1S9KC 4DO5A 12E8H 2V7NA 4UMSA 3B9KB 3A3YB 5AW3B 3DUSB 4R4NC 2E9BA 2PW2A 3HN8A 5IESH 2J1KA 4P23B 2OCFD 3KPLA 3TFKD 4U0RC 2IF7A 3W1ZA 3ULVD 5JW3L 2LLNA 3AXLB 3WNPA 1G7HB 4E9TA 3B7SA 1TNNA 2A74C 3DROB 3ASWA 4AM0A 1AOZA 5AKSA 2VN5A 2R39A 2WINB 4HC1L 1R24B 4Y4HB 4HPYL 1OPGH 2B2XH 2B59B 1MNUL 5T5FH 2XV6B 3E1F1 3RKDC 4BZ1A 2EDLA 1LO2H 4ATTA 2V2TA 1X5GA 3QH3B 4NC0B 3RX8A 3FTZA 2GIXA 2GK0A 2MPAL 3NJKA 3SDDA 3GSNL 4JDVA 4IMLB 4ZOAA 4ZO8A 5TDOA 2B4CL 5IG7A 3CFNA 4JO1H 2QVTA 2Y3NA 3GEFA 3I2CH 3MACL 3KM1A 1U8IA 1IQWH 2DI8A 1IFRA 3RPIB 4OAWA 5E99L 1F18A 2CCVA 3MU3A 3SCMC 1TZHA 3V52H 3MBEB 2YK1H 1T03H 4ZSOB 1H3GA 4EAEA 1CDBA 4FZEL 5DK0A 3BVXA 4PIBA 4Y4FD 1ZJBA 4Z7WE 3V9CA 5KSUA 2FHBA 4OZ4B 2WIIB 4IGBD 4FYTA 3OB0K 2OKMA 4OKVA 1RJZA 2JFCA 5LDUA 2X0UA 2AJ3B 4L4VE 3DJ9A 1YNTA 2NNAA 4FYQA 2NY3C 5H8DA 3DV6A 5HPOA 3MRLB 2P5EE 1U8LA 4NKDB 4ZAKC 1FNLA 2BM3A 4UANA 4V1DB 1C5CH 3VFUB 4GMTH 4PSRA 5C6TH 3D18A 4PREA 4ZXBC 4FNQA 5KS9E 3MLYH 5I1GL 3GWJA 3OVUB 4DUVA 4P3CL 2YFOA 4EIBA 1NBVL 3OX8B 4NFDA 3GHEL 4WTZG 3NCXA 3HPLB 2CIIA 2FEEL 2AS5M 5CBAA 2OL3B 5CJOL 4NQCD 2YAEA 3UXFA 5IVOA 3L7EB 2ITCA 3H56A 1YY8B 2H9GB 1QUNA 2G9HA 3OV6A 1NDGB 3LQMA 5CJ5A 2KZ1B 5TJWK 1UA6H 3K2IA 4APXB 1Z5LB 1LEGB 4P3WA 2FGWH 1JZ2A 3QHFL 4O58H 1JG9A 1U58A 1MFVA 3O6FD 3AY4C 1T2QL 1EJOL 4YNYB 4KMTL 1WGOA 2AQ3A 3IMTA 5D7JA 4I87A 2AK1L 4N2NA 2NW3B 5DD3H 1VCAA 2A5UA 4HIXH 1DVXA 5DFAA 2ROXA 4CL7A 1B0RA 4HSCX 2Z7YA 3UMNA 3V4VH 3FRPB 2YUXA 3MFFA 2FTAA 4M9PA 2OM5A 4RMSA 4UUJA 5JTWA 1E50A 1PS3A 1ESOA 4LKCA 1ECZA 1ZGLB 1U3HC 3E3QE 2F19L 5L8KB 3TH2T 4H1LH 1SYSA 4D9RD 1FHGA 3VI3E 3L08A 4IOSA 5EU5A 3ZSSA 3F7VB 2NUTA 3IFLH 3VM5A 1MCNA 3EH1A 4XBGB 4XNUH 2NY1B 4WY7L 1J88A 2VAJA 3C08H 4UILL 2Y1AA 1S7UA 1P84J 3KBHE 2GTWA 4JFZH 1T04B 1L4IA 5F93C 1P6AB 3RA7L 2FBRA 4MBOA 4QHKI 5F7DB 3SE3A 3OAUH 5B4MD 3I02B 1QPPA 1RHHB 3FS9A 2MKWA 4MXVF 1AQ8A 5TTRA 3LS4H 2LABA 3GM8A 4OB5L 4X6EA 3SGKC 2BNQB 4QRRB 3SDDD 1XAUA 3VA6A 1EMTL 2ADJB 4FG4A 4ORZC 4A6YH 4UNVA 2DQUH 2K78A 1AZZC 1F58H 3N91A 3VWKB 4DUXA 4XO4A 2H1LM 4YSRA 4HJ0C 3BRFA 5H2BA 3ESOA 3V6OE 1I8AA 1XBRA 4R7LA 5HGDA 1LDPL 1U8CB 5IJCC 5DVMA 3O6MH 5C0ND 43C9A 3B9KA 5I1DA 4I18B 3N40P 4XNQB 3SKMA 3QJHB 1EAJA 4O5LL 2ADIA 3C6LB 4QRAA 3UJTL 1P4IL 2TRHA 4I18C 5GZOD 2C1PA 5CZVL 3V8OA 4M5YH 1UXLA 1S46A 2OJZH 2NQ3A 3SYPA 3GD1C 1QZNA 5JYMA 3EUDA 4JFEB 2OQJB 1EBPA 1CO1A 2XNAA 5KOMC 2B5IB 2DD8H 4BFRA 1XR8B 4KVCL 2QT6A 5EULV 1NEUA 4JBSA 3EFDL 3BVUA 3MGTB 1WH0A 5I1JL 1J10A 4OCSH 4WNQA 2C3GA 2DIBA 3U1PA 4FP8H 3QDGD 1F3RB 1RJYA 1R17A 3LKRA 3IKCB 3QEQB 5DZPA 3RVTC 4GBXC 3U7WL 1SBBA 4FFZH 4IHOA 3BH8B 1J7VR 1SYSB 3A24A 2DB8A 1RZKL 5C0GA 5L0QC 1TETH 4NBXB 4N2AA 1V3LA 4M1DH 3TT3L 3QXWA 2D73A 2APFA 2ZUTA 3TA3A 2YQGA 1A64A 5B8CA 4NHCH 1IT9H 3CFCL 3QZMA 3RJOA 4ACTA 3J8F7 3U4KA 1QFUL 5C0FB 2V9QA 2Q6WA 1XGPB 3QQ9C 1UB6A 1SXSA 2J8HA 1QFOA 2CGYA 4WI4A 5D2NA 4U6XB 1AHMA 1FO0H 4G9DA 3HBQA 3FCBA 1YEKH 4KK8C 4CKQA 2A9ML 3VXPA 1HOCB 3INUL 2UY6B 1ZANH 1TENA 4JPVL 4KNQA 4I5BA 5DRWA 3M45A 4NXKA 5EEZA 5EH1A 2D31A 5A2LH 2XYCA 3EZ8A 4IJ3B 4UIKL 2WWMD 2FHFA 4AT6A 5JW4R 4PB0H 1X9LA 2A77L 2MTPA 4BSWA 4NQEE 4KDTC 4PJGF 4K71B 3HVNA 1A1OA 5IW3A 1CQKA 3RWJA 3RY5A 1A0QL 4FULA 1KIRA 1AHWB 3SQOL 3HOGA 2E0PA 2JJSC 1WCBA 3A4EA 3DX9B 4BFOA 1N12A 3LQZA 4IK7A 4QRSA 5KYWB 2X5PA 3B2XA 2VXQL 1EO8H 5IB4A 4AK1A 4NO5A 5AVZB 4ZUUB 3ZE2B 4CC4A 4QKXB 3QK0A 4WU5B 5DFVD 2D4FA 2XN0A 2OXHA 1X4ZA 3KXFD 4MFHA 5FM4A 5DMKA 1L0PA 1U3JA 2E74C 1KTLA 4OKVB 1GZQB 4IEFA 4HF5L 5D1XE 1N2RB 4O2EA 4WSGA 4LHUA 3QS3A 1TU2B 5FCUH 3GHBH 5C0BE 3DBSA 1QFWH 4WV1B 3UPAA 5KYUB 1IUZA 4MDRA 3ZMRA 2AFNA 3BUDA 4NCC2 4HIHA 2PO6D 1TJIH 3G5WA 4JL2A 4RGOL 4ENZA 1HQRA 1JF1B 1X5MA 4OGYL 1S7WA 3HEIB 4NAMA 1EO5A 4Z9KB 3RNQB 3S3DB 1NLDH 4IRJA 3P4NB 2VDQL 1MRFH 1TQVA 1Z5YD 1E43A 2WKOF 2JJTC 2K7QA 1A5FL 4F33B 5IBTL 2NY5L 5M95B 2FQDA 2QSCH 4JANB 2BNUB 5G55A 1FORL 1D5RA 4MZ2A 4WTZA 1D7BA 3O4LE 4KH9A 1DVFB 3PPSA 5I8KL 1LILA 3BGFB 4BQBA 4PRDB 4JM2A 3FOLB 1J1PH 2JB5L 1A14L 2V5RA 3I75A 1FPTL 1IARB 3LRLA 3QO1A 5GGVH 3UAAA 4F8NA 1BEYL 2DYPD 3LN4A 2I9LB 4KUZL 3X3GH 7PCYA 3QNZB 2JQAA 4WDIA 1J9SA 4HT1H 4KX8A 3T2PA 3WJLA 4R7NA 5BV7B 2ODIA 1F2XK 4E9YA 2Z93A 5B1JC 3UIZA 3UPRA 4OZHF 5EU7E 3JYBA 4PRHB 1ADQL 3UBXI 4Z77A 3KPSD 5DXWA 3INOA 3MLVH 1QLEL 2DEXX 3BIAX 2DQEH 1J8RA 3G08A 4CSTA 4X9HA 3NK3A 3OWRA 1KIRB 2ICWB 2HMID 4NN5B 5SWZD 2GJ6B 2XPZA 2MQ0A 1VGEL 2VXTL 1P0SE 5GJTH 1ND0A 2HSIA 1FA4A 1V8HA 4WHTB 4KU1A 1YZZA 4ZOCA 1T89C 1ID2A 5DDHB 3UG3A 3GGWA 4FHBD 3T0BA 1ZT4A 2F7RA 1HH6B 2IPKB 3IB4A 5FUZH 2JCCB 2Z8SA 3IMVA 5E8OA 3I75B 2G3ZA 4JGUA 1QYGH 3TBVB 4ZUSA 4Y5YC 3MNVA 2CO1A 4MD4B 4IDLA 3LV3A 2IPUG 2VN3A 5EG6C 3TOPA 1MREH 2AKRA 1S5IL 1E2VA 1KNOA 2CO4A 2B1AL 1SYVB 2A4ZA 3PWPD 2HVBA 1UOLA 3D87B 3REVB 1ROWA 2JJUA 1Q1JH 5FS5A 2JI3A 4JZOB 4QXTA 4XBMA 5TH2A 4DPBX 2XVBA 4CSSA 2UXFA 2WP3T 5AENA 4XAWH 5CP3H 1II4E 1IAMA 3TO4D 5LKNA 4OZFA 1T6BX 3FTSA 1RUQH 2VLJA 3GSVB 4PRAA 2OULB 2ALWA 3GINA 2ZP8A 2F6AA 1NCOA 3RURA 1XGQA 4U1SA 3VRLE 4E9QA 4J8RB 5E2VH 3DIFA 5C6PB 3BLPX 3HB3B 5GGQL 2JCCA 5I18H 4CU8A 5JW4M 1FYTA 3POCA 4CVXB 3DTUB 5ITBL 4CDGC 5ESQA 1DTUA 2VH5L 1QR4A 3TPUA 4CU6A 5DJ2A 4KKBC 4P4KB 3QBTB 5F6HI 1FAIL 1X6LA 1TTCA 3OG4B 3U0TA 1H15B 3CSPA 4NQDD 1H8NA 2GBTA 2YSSA 4Z76A 3UC0L 2BIIA 3L95A 1PPIA 4DGVL 3APDA 4KDWA 1UJ3C 4DQOL 3V9FA 2WTPA 1CF8L 4Y2OA 2VLKE 3SJVE 2BMKB 2F8IA 5DJXB 4DVRH 2W60A 5DZAA 4H8WL 3M86A 1CE1H 1REIA 3QEQE 3KVDD 4MXWL 5HBBA 5I30L 1D5XA 2O61A 3V0FA 2BS71 2DWDB 1OGAD 4PLJC 4GP5B 3VE0A 2R51A 2IANB 5CFHA 4E41D 4A66A 1LO4L 4CJ1A 4Q0XL 1YC8A 5MEOA 2DRUA 2R1WB 2CIKB 4F57L 5C0RH 3VXPB 5A2AA 4MDIB 4HEPG 2BVQB 3MV9E 4KC3B 1UEYA 4OLUL 3ZO0A 4X5PA 3NPSB 3KPSA 4DKFL 2ITEA 4Y4FC 1F4WH 5KW9H 3AZUA 4Q52A 1PD1A 1OZTG 2YAHA 1ZA3B 5T1LA 5DK2B 2J1WA 2R4RL 4PG9B 3RNQA 5SWZA 2EH7L 4ZTPH 2EO9A 4QCIB 3AW5A 1M6UA 1SJXA 2X9WA 3O3DA 3PGFL 4QPEA 4XP9L 5ESAA 3U6RB 3BVNA 1YYLL 3JWOH 3NQIA 1R5WA 4FQCH 4HS8L 5EU6D 4NDMA 1JYWA 2HTKD 1JGLL 1HNGA 3VI3F 2OSLB 2X1OA 3ALXA 1A3ZA 1NKOA 1MW3A 5DTFB 2E4FA 4CSZA 1R5IB 3MFFB 2A99A 3VGAC 4ZMQA 3CMOH 1NLBL 4ELDA 3GJEA 1YQVH 1H3VA 3QA3A 5ALCL 2GJ6E 5G4MA 1MFAL 1WS7A 4YMPA 3S35L 2G0KA 3ASOB 2ZUUA 3H9ZA 5BW7A 3OHMB 3VFMB 3WJJA 4DKTA 5I16B 4EUPB 4GG6A 4BA0A 3TP4A 3E2HC 1X4YA 2HN7A 4AV4A 1AS7A 4LEEA 5AOMA 3P11L 1HKLL 1MF2L 1SOKA 4LEBA 2DQHH 3LOWA 1UUNA 4PLKC 4MD5B 2QL1A 2R2HA 2XQYK 3JWOC 1GS8A 4KO7A 1NDGA 5CR8A 3VFNA 4H2AA 5F1SA 1GA2A 3S98A 3O0RH 3DVGB 3EH3B 2W88A 2R0ZH 4GQ9H 1Q9OA 5JOFB 2ZTBA 4LL4A 4GPVA 3OX8A 1RIHH 4MNGE 1IM9D 5C0IB 4HOXA 4R97C 5JIMA 3HB3D 2EUWA 1Q9KA 1U92A 5F7EH 4KRLB 2WM0A 1QACA 2OR9L 2AV1A 3BGAA 3Q6FB 4TNGA 4R26H 1NCBL 4EOWL 1T7YA 3BZ5A 3L3GB 2GHZA 3ETBF 4EDXB 3QFJA 1J9RA 5GS1A 1O9ZA 2FVNA 4KK9C 3D0VA 1MCCA 5AOLA 3ESUF 1DQJB 3VFTA 5JMRA 2ESVA 2XQ0A 1HIML 2P80D 5D4QA 1JN6B 3EYVA 5DHVA 2LFGA 1X5ZA 4OLZH 3BT2H 1N4XH 4W6YB 1J0ZA 1ZOXA 3JUZA 4G7VL 5LUMA 4AEIL 5TK2A 1U4EA 3SO3C 2VJXA 3FT3A 4QKTA 2LTQB 4XB8A 1GMEA 1QSEA 4OAWB 5EOCJ 5IIEA 2DL2A 3H4HA 3H6JA 4DGWC 1MLCA 4KQ4L 3B2PA 4R2GB 5JPNB 5CN2A 3KXFB 4TULH 4OD1H 2DM3A 3CN4A 4A39A 4FTVB 1BBJA 4KRNA 3ZKXB 4Q97A 1BJ8A 5I28A 4KI5F 5IFAH 4Y5XC 1BM7A 2FWOB 4JPKL 2F54E 1E5ZA 2ED6A 3N3EA 3TO2A 3WU1A 3MNWB 3H42L 4UZGA 1R0AL 3ROOA 2HTLD 3MRDA 4PJ8D 5BV7H 1NC2A 3VH8G 4TOYH 4KO5A 2C9QA 4AQZA 1P5UA 2HRPL 3IJSA 4HPOH 3HNVH 4UT9L 5KJRL 3FYIB 3S96A 5T3ZE 3DX9A 2IDTA 2LGNA 2OFQA 3ARDB 3K2KA 2JJSA 4R84A 5JHBA 1EJ6A 3FH7A 1BQHB 2WLYA 2DLFH 3QUHA 5I8CB 2XN9B 3VU1A 1SOQA 3FO0H 5FYJL 5MENA 3CHXA 3N6YA 5EU6A 2ENYA 2W80C 2X88A 3BLBA 4XVUC 5ANME 1U2HA 1A2YA 3CH8A 3FCSA 2CKBB 4A6YA 4QHNA 1YEGH 4MQ7B 2AP2A 5FW8A 2DYPB 4JFXA 3PF2A 3HZMB 3QZWG 3SKUD 4A55A 3CH1A 4CVZA 1DBAH 3AM8A 3HI1A 3CFEB 4YGVA 3M1OA 1H3PL 1XVSA 4G8FA 1MPAL 2CLRA 2X1QA 4J3XA 1XF5A 2CDEA 3U0WL 5C0AE 3CFQA 3CHQA 5D5ME 1PYWB 3BP5B 1FDLH 1A3LL 1YAZA 2ZX7A 4RAUB 2HLAB 2Z92B 2X0WA 2ZD0A 4QY8B 1AXIB 3SBPA 2MSPA 1JTTA 3RVUC 3UO1L 4U1KA 3MBEA 4XVTL 3FFDB 2L7JA 4A2GA 4AGMA 1YEFL 1L9SA 4HJGB 4RGNC 3T09A 3T5WA 1E3ZA 4DZ8A 4MA7H 4N4YB 1KN2L 4GH7B 5JA8B 1I53A 3HE7B 4YFLF 4LSTH 4A2LA 1UM5L 5DUPL 5FM5O 1Q0XH 3G6JB 4I2XE 2YPLB 3V0DA 3EOAA 2EUXA 3ATBA 3H7BB 5D70L 4X4KA 3KH4A 2Y2TA 1PGRB 1VACB 2PW1A 1DEDA 2VN6A 2AEQH 1C7TA 2UZIH 1KTKE 1AP2A 2ICEC 2YKLL 1YECL 4RRPG 4YGVB 5E1AA 2J6WA 1U8JB 1RVFL 4LOUD 2O5ZH 1E4WL 3QDJD 2B14A 4Z7VB 1OB1B 4JFDE 3BN9C 2Y4SA 4KMLB 1X5XA 5C09E 5E8PB 3ARDA 3GMNA 4R5VA 5DJZB 4XE5B 3FQNA 1S78C 3QG7L 5IMMA 4PR5A 3MX0A 5E2TL 5IMMB 1ZTMA 4G5AA 1DVUA 5DUBB 4PGCB 25C8H 2OMWA 4NO0B 4WO4B 5AVTB 2DIAA 1XCQA 4L9DA 3MBWA 3ZQXA 1Z9PA 1Q72H 1A6UH 4Z7NB 2NNXA 4O00A 1Z5HA 1LDSA 4NZRH 4R5TA 2EO7A 3IAQA 2Z4TA 3MFGB 3ILPA 5JZ7D 2H2PD 4PJAF 5HI4D 4PBXA 4RWYH 5IB2B 1WRFA 3MN8A 2J6EL 2SEBA 3O4LD 5B21A 2FJHA 1EXUA 2OI9C 3TO2B 2QHRL 1T1ZA 3ZE2E 4E2OA 5TFSH 2XWZA 4I8DA 2ZP9A 3D25A 4JCLA 4LARL 1YYML 4PJ8A 5H94B 4KXCA 3ZHNA 3TEZA 4WFHE 3VGEA 2O72A 3H3PL 1WUNT 1ZRUA 2FUTA 3MA7A 4EXPX 2BIMA 3IU4H 4PJEA 2QZQA 4M48H 4Q9CA 5FFLA 3CZKA 4L4VB 2KHAA 5DD0L 4ZSOA 2IBZY 4RBPK 5DHVB 2PWGA 4G7RB 4OCYH 5DC2A 3L3IB 4OH2A 2W0FB 3BQUC 4OF5A 5JHLA 4PJHA 1ZA3A 2FB4H 3HN5A 1FZOA 2J8OA 2F7OA 3C2AH 1GZPB 1A3RL 4IYKA 4N5UA 4MASA 5L2JA 1QBMH 4D0DA 5HTSA 4ZW6A 1GCFA 4Y19E 1A25A 5MP6H 3ULUF 2YC1A 1PG7X 2YN3A 3EDFA 1UKSA 4CBPA 3MJ9H 3ILPB 1JCKA 1YCSA 3FU7A 4UV7H 2XX1A 1EUTA 4Y1TA 3VXSE 1IKOP 3WXWH 5I6OA 4Y8AA 2VABA 4FQLL 2ICES 4YHOH 5E08L 5JPMC 4J5VA 3GZOA 5F6HJ 3ZE0B 5EU4B 3DSNA 3Q44A 4RGMB 1IFGA 4KROC 1RL1A 2YZ8A 5TQ2H 4AZ8B 5I1CH 2ZCLL 4ADGA 2NX5D 2Y9RT 3CIAA 4GXFA 2AJVH 1SEQL 4CU7A 1KYOK 4HALA 4X5LA 3RWCA 1B90A 2V7NB 3QFDA 1JYXA 5KVEL 1BQHA 2ICEA 2J44A 1F90L 3OSKA 5DT1H 1M2VB 2YSSB 4G1EA 1NMAL 3ZUNC 3V9EA 2NY2D 2QKSA 2L0DA 4ALAH 1SJMA 3DSFL 3JV5A 4YHYB 1I8KA 3G6JA 4O2CB 3O2DA 5I1KL 1CDHA 2VW7A 5MERB 2Z93B 1S8DB 2QDWA 1K6QL 4M56A 1K8DB 4F1SA 2VR5A 4HK3J 4JGMA 8CGTA 1M1XA 1OTTC 2VJ8A 4OFPA 2AJZA 3S6CA 2GC4C 5T3XD 4PG9A 1NBZB 4PJ7A 1OW0C 1YEHH 4JQVC 2QADD 5ICUA 4Z3HA 2Y36L 2QHLA 3BVNB 5BRZE 2E7BA 2K4WA 2VC2H 3NTCH 5ADOL 2Y1VA 2VGLM 5J7CC 3QULB 4JL1A 1DZBA 2RFXA 1P7HL 2H6OA 2BNQE 2JKXA 3G5VA 2FD6H 1LO5B 3VI4F 3CFEA 2VDML 4KNSA 1KNOB 1NGXA 4F15B 5BS0E 3ERXA 1AJ7H 1M1SA 4DPAX 4CMMA 4P3DA 4ZFQA 1ZK5A 4EBQL 2EXSA 5JDJA 4Y4HA 2VDKH 4IU3A 1TVDA 1Q0YL 1FG2B 2YS4A 3K46A 2M2DA 4I0PC 4Y9CA 2NY0C 1BG1A 1IKNA 1PJWA 2ZF9A 1E67A 4C56D 2ATKA 3KGTA 4ZQKA 2VLMD 3QI9C 5CP3A 2IQAB 3C60C 4K5NA 1YEEH 5FLUA 3RWHB 5HYJD 3O3UN 4YR6A 1AZRA 1TQUA 1I7RA 4LSUH 4N24A 3K74B 5DJ8B 1OWRM 1F5WA 3L1FA 1CBVH 4H0LC 2IH1B 2VR9A 1UGKA 4TV3A 3KLAA 5E03A 3WMPA 3VFPB 2IWEA 2ICCA 2BP8A 2WLHA 3T2NL 3F01A 2UZYA 1JMZA 1M2VA 4DF9A 1YPZF 2NSXA 3O3AB 2O6FA 4A2EA 3BD3A 2FWOA 3K4AA 4L3CB 3CHSA 4Z5RB 1SZNA 1NINA 2Z1PA 3T6ZA 2C7UA 1BZQK 3T0WA 2L04A 4GIPD 3OMZA 3BGFC 3B9VA 5LN8A 4OKDA 1AD9A 2NY3B 4WI0A 4P8QA 4OVUA 1T7VA 2XFXB 4XO9A 1U95B 5GZND 5IZ7A 5EU4A 1QQDA 1ZHNB 2J3SA 1UFUA 2YA1A 1DVQA 4Y5XB 5C9JB 1JTPA 3VXRD 1MJ8H 4PJDF 5GJSL 3ARZA 2I5YL 1MCBA 1OD9A 1KUMA 4GI8A 3GIVA 2J21A 2JE8A 4WK0B 1N0XL 3EH4B 2QPDB 4OZIF 5DWPA 4QHKJ 3ZE0E 4N1HB 4XPAL 3TA3B 4X99A 4UF7C 1EDQA 4S0TD 3WE6B 1XTMA 2VRAA 3LN5A 3IFNL 3WHE0 2BRRH 4KZDL 1CC3A 3FQYA 3PNRB 4BZ2L 1BQRA 4FG2A 4U31A 3KJ6H 5E8OB 2X1PA 2EYRA 5DU7A 3P3SA 1BFOA 1CLZL 4KI5C 4TNEA 3UTZA 3FB6A 3V4PB 3UTTA 2FIKB 1SUJA 3VXNA 3WHXB 3HG4A 3MA9H 8FABA 4NQTA 3BMWA 2VISB 4JQXC 1ZS8A 3V0GA 3PL6D 1I4FA 3DXAA 5EIIA 1JK8B 1XSJA 1D2OA 3HUJE 1KIUA 1HSBB 1NFIB 1N68A 3ZOAA 3KPOB 2LT9A 4H25B 4ELKB 3QARA 4C47A 3DPBA 4E9WA 2WIMA 3U0PB 4GRMA 4TLKA 5K9OA 5HI4C 4HCGA 2X1XR 4YO0A 1OPOA 5E2UH 1NANH 3U1SH 1QI4A 3F84A 3US0A 2XWJA 4QYOB 3F8UB 1QAWA 4F2EA 1QSZA 5E6IB 1BAFL 1SHSA 1UCTA 2BDNL 3Q1SL 2BS9A 3ZJAA 5E6IC 3D39A 4PGCA 5A40E 1MEXL 3QEUB 1CT8A 3BUBA 3QUMA 1MWAH 1TFHA 1CPUA 3E3QC 3GJEB 4FJ6A 4M62L 5AAMA 4AQ1A 2FR4B 1PTZA 4J4PC 1HEJC 4A7TA 5I26A 2DTML 4P57A 3WS3A 3NRPA 1NEPA 3HPJA 4KUCD 1A6AB 2H1PL 2XC8A 5AB0A 2XKNA 2IADA 4JAMA 1OK8A 3V95A 2F54B 1A4JA 5HHMD 4L9LB 1TLKA 3FT4A 3H3BC 2DKUA 4X83A 2DM2A 2X40A 4QRRE 3QULA 5F3BB 1ZEAH 5FC9A 5FYJD 2DQTL 3PWUB 4HOZA 4KROB 2XTJD 2G5BB 3MXWH 1C1EL 4QXTB 3WUWB 2BVQA 4OIIH 3LNFA 2PPAA 2OTUB 3OLGA 3FT1A 2WYZA 3CHRA 2X05A 1PG7W 3QIBA 1F4YL 2YRLA 4NZUH 4PJCF 2VLRA 4Y1SA 2B5IC 3HNSH 2IANA 1YY9D 1QKZL 2VDPB 1B6DA 4PBVC 3WV0A 2P9RA 4A7UA 4LKCB 2WZ5A 4UTAL 1JBJA 5IMOB 4KTEL 5E4IA 2AJZB 3WS3B 1TTBA 2A1WL 1PYWA 1LK3L 1M42A 1U3NA 3C5ZA 5CIPA 3V4VA 3QXTA 1NWPA 3PYCA 2O6EA 3BQVA 5D4HA 1E9QA 1WG3A 2ZXAA 4D7PA 2EE3A 4WO4C 5LVEA 5DA0B 3BISA 3V55A 1DFBL 1AFVH 1EHNA 1FL6A 2DQCH 2JK5B 2VDNB 1MN4A 1M56B 4HUCA 2Q8BH 4A7GA 1TJHL 1USQA 2NOYA 1UACL 1LQBC 2AJYH 1CWVA 2D3LA 2X7LB 4ZMPA 5T1KA 4PS4H 4UNTA 4OM1H 1QUNB 2G9HB 3IGKA 1JPGA 4RVBA 5EZLA 2V7HB 1Z3GH 3OTTA 4J28A 1WAAE 4YUEL 1U8OB 3ZE1B 4ORGA 3CN2A 3NACH 1RIUH 4HEME 1FC2D 4BFKA 2YPLE 2YGNA 2CRMA 4K8RL 3SE8H 5HVGB 4AW4A 4AZ8A 3OKOB 2C9RA 5EUOF 3APFA 3B7TA 3HE6A 1J0IA 1KXQE 3QC6X 1E4KA 1OE1A 4MB1A 4ZS6D 1UHVA 4FXGB 2Y1ZA 4PJHB 1TXKA 2CHZA 4N3UA 3T6XA 4U4IA 2E7LA 5I0XA 4MWFA 3TZVC 1BQSA 1TDQA 3NN8A 4Y16A 3S37X 3JWDH 4P5TA 4M6NH 5E94A 5JHDE 5I6LA 3D39D 4FXGC 5IK3B 5I2IA 3L3IA 4PWEA 3U1QA 5I2IB 2MOGA 4GMSH 4A38A 4F2MA 2DQIH 3CVDA 2JELL 4G8GD 1KJMB 4ZOBA 5FYLE 1JHLL 1R3HA 4JUSA 3F3HA 2CUAA 5H35B 1GW0A 5FUOL 3HJ0A 4FJZA 4L0PB 1QHOA 4P4KD 2N0MA 2OMXA 1MFCL 3MOAH 4N2EA 1MJUH 3DHMA 4NKQB 1Z3RA 1EEUA 1PZ3A 1M05B 5ES4B 2WSPA 4KROD 1P69B 1SQMA 3JWDC 1CVRA 4X0NA 1KBPA 2HT4D 1DQQA 1M9SA 4ENED 2X38A 3RUGB 3V0VB 3MNZB 3VNYA 3BE1H 3FCUB 3CZSA 4WJ5B 5T1LD 4KH2A 1DVYA 1Q9OB 2EE6A 4PGEB 1URZA 3AU1B 1FP5A 3OB0H 3T65B 3VH8B 1DN2A 4X2UA 2D2OA 3UO8B 4YJZL 4A2MA 3W0WB 2YIHA 4K2UH 3NIFF 3MBEC 4PP1C 5EIVA 1CGXA 1SMOA 2GI0A 4U05A 2VLLB 1MQ8A 4DN4H 4XAKD 2IQ9L 4JRXE 1NA8A 3BUQA 2WBJA 4O02L 1RUKH 2G2RA 4PCSA 1Q9WB 4C56B 3EGXB 2B4CH 2CMRL 5HHVL 3MACH 3MRMA 3SQBB 1MRDH 2CE6A 5F1NA 3V5HA 3VACA 4K4KA 4MS8D 1OIOA 1BF5A 3ESMA 2C4FU 1XL6A 2NY0B 5FM5M 1T03L 4PJFE 4FZEH 3LEYL 3IAGC 1ZPUA 1CU4L 3ELQA 4IBWA 4N9GB 2IAMB 3BP4A 3BVDB 3KPNA 2EKSB 4ZNCD 1QLEB 4QJ4B 1OVZA 5DRZA 4D3CH 1BMWA 3HUJB 4PI2A 3F12B 1KBVA 1VZGA 3GSRB 1P4UA 4IEFB 3WN6A 3MRNA 1ZIAA 3Q01A 1JNLH 1W16A 2JJTA 3LIUA 1D7CA 2BSRA 4WW1B 3L5IA 2XZCL 2B4CC 5JMOC 4XI5D 4RZCA 5IGXL 3CFIC 4JFTA 4UYPA 3AUVA 4BKLB 1UA7A 5HI5D 2OR8A 1X5YA 2E7LC 3D69A 1T1XA 3MLYL 1PAMA 5I1GH 1FSKB 4OM0L 1T21B 4B7LA 1G0DA 4PRHD 2B08A 4QXUL 4Y16C 1AO7D 1OAKH 1G9HA 3C5JA 5LNDA 3W2DL 5JW4N 3RX5A 1E9OA 2AEIT 5C0DA 3KPQB 3QORA 2H9GA 4OQ1A 4WVRA 4TNWK 4Y2NA 4YZWA 4G42A 3SGDH 4EKXA 1GR7A 4M5TA 1G94A 3SPHA 1UA6L 2ENSA 2V37A 3MOBL 1KEMH 1OQXA 3WJJC 4DP6X 5C07B 2WOYA 1L3NA 3CDGA 4YAQB 1LVEA 4WWID 4S1RH 2H32B 3Q48A 4O58L 3OJVC 5FYKD 4YAQA 4YXLL 1ZGLM 3EBGA 1T2QH 5D4IA 3DK0A 3IRCA 4PY7B 1Z9NA 2B1HH 2AK1H 2X6UA 1DUYA 2WZ6A 1QSED 1E30A 1MLBB 1CE6B 2EDFA 2H0JA 4GXUM 4N2HA 5INCA 4P59H 1NCTA 4H26B 4E0RB 1U8LB 1K4DA 3BIBX 3V4VL 4RZKA 1FH5H 4ZMNA 4AXWA 1B0GB 4L0ZA 1ORSA 1SLUA 1BVZA 1NKGA 1DVZA 1E5AA 3TIEB 4XCFH 5KSUB 3NZHH 4B41A 5LCVL 5TE4H 3N44F 3AQDA 3PGCA 1BG9A 4DKAA 1NC2D 3RGVA 3QB7C 3H54A 3L3OC 5FDWB 4ZFZA 1S7UB 4WY7H 1HWGB 1N6UA 3ISRA 2K6ZA 3RQ3A 4R4FH 4F5CE 3TZVD 4PS3A 4YHMH 3N42F 5E6ID 4DPRA 3QIUD 5AKRA 4JG0H 5FGCE 3MA7B 3NEXA 1O7SA 1CD9B 1F86A 4GKSB 1TEYA 1SGKA 1MCDA 2EEFA 4U6HA 3S5LA 2BSTA 1CJYA 4R90H 4LSRL 1JI1A 1UA3A 1NICA 2VLKB 5FWQA 4S11A 4MDJB 4H1LG 3CZNA 4WW2B 3DI3B 4KJYA 3BAEL 5B1AB 2VE6B 4GBXB 2X89D 3UPCA 4PJIB 2AEPL 1KELL 4A6YL 5FHBH 4KJPC 3GZPA 5T33L 1F58L 4HWEH 3QDME 4GT7A 2I25N 2VCOA 4KKPA 5ECJE 1F97A 5HGDB 1YMMB 1J1XL 3VMOA 2TSAA 4A7VA 3NPSC 4YPGA 4AV0A 2XN9D 5DZNA 4X7SH 5FO8A 3S3JA 1X5IA 4CRPA 4C56E 5F8QC 5LNEA 4PLOB 5I6XC 1FZJB 1SUHA 3LPFA 4NRXB 1E40A 1P4IH 4O5LH 1ZTXE 1CFQB 2GB2A 2OJZL 8PAZA 4GP4B 2ZUQB 3NSYA 3ZT7A 4L3AA 4DTGL 1FGNL 2MH4A 2B39A 1HZHH 1JMXA 4X4ZA 1IFHH 3FQWA 1LGVA 5DHDA 4YVUA 1AANA 1QPKA 3V6ZB 3BEWB 4X6CB 2HUHA 1A6PA 3N06B 5I1JH 1OAQL 2XVGA 4G6ML 2FSDA 4PJ5D 1XGRB 3DURA 5MEND 1MH5A 3N50A 3DX3A 1QSEE 1J11A 3CLWA 2W8CA 3SDAA 3SDXE 3O6FC 4K7FB 2XWRA 4NQVA 4BZYA 2WIIA 4POYA 2NUTB 4TUJA 2Z31C 4R0LC 1RLWA 3F12A 3QDJA 1CG9A 4JLRA 1NPUA 1I9RL 2OV0A 5FO9A 4OZIA 4IJTA 2EIZA 3SY0B 1ML0A 3VXUD 4AKQA 2PWFA 5HI3D 2WXHA 4LCCB 1I1AA 1KXHA 3QDGE 4M5ZL 4MWFB 4YLBA 2VM4A 3S9DB 3SYQA 2VM3A 4KK6D 4OGZA 3A6BH 5GGTA 3L4WA 4J39A 5LDSA 3P9MB 1FO0L 1YHPA 2CRIA 3BKML 4HIIA 5KN5A 4NP9A 2A9MH 4TUOB 3PIQA 1ZWIA 4HS3A 5FYKL 3HE6B 4N8CH 2V2TB 1R9FA 4KBPA 3TN0D 4EIZC 4M7KL 2V3FA 1ONQB 5DJYB 4ODWB 2BP3A 1HXKA 4CW1B 3RFZA 3AC0A 2BY0A 1I1YB 4PHXA 5IV2B 5DQDH 1LP9E 2IPUK 3PAVA 2FO8A 3SQOH 3WFBL 4F7TA 5D1ZA 5C6WH 2ADGA 5H37H 3B7UX 1DVSA 2APSA 2PW2B 3L7FB 3QDMA 5E6IA 1RZFH 1JZGA 2C3HA 2R23A 5MI0B 3SPCA 1J5HA 2FEJA 5AOIA 1CT8B 4AUYA 2AVGA 5KSVA 1ACXA 1EZVY 1BWMA 3Q7JA 1O7DE 4G71B 3A67L 2AQSA 2H0EA 3DIDA 1TVHA 4R3SB 4PP2A 3IN0A 2X89A 4FFZA 2PTTA 1JK8A 4N2MA 1DQDH 4XMLH 1QFWL 1W0VB 5FW7A 3L5JA 5KOVC 3DJZA 2KPNA 2X4RB 3WFCH 5KVDH 2E7DA 1KGJA 4JKPH 3B9KD 3QO0B 2FT7A 5CD3B 4P5MB 1DSWA 1A4CA 3FT3B 4Z7OE 1MRFL 2IDSA 2X4NA 3N55A 1F6LL 4A7QA 3CSBA 4F1ZA 5KG9A 4Y16B 4RMUA 1X9RA 4FJYA 2QSCL 1BQ5A 3QRGL 1NFDF 2F7PA 4JRLA 3PHOA 4ISVB 3HW7A 1KSRA 5I8KH 3EYQD 3HIZA 2EIMB 4XN7A 3JVFC 3G04A 5E1QA 2OXGA 4S1DC 4XP6H 2G5RA 5ICZB 2VXVL 4OFYD 4F37K 3SDCD 4HT1L 1BJ1J 5I74C 3BQUA 4Y1AA 3KLHD 2AKRB 2MRYA 5HHOA 5LQBH 4WFFD 4FNRA 2FT8A 1ZT4B 4BELD 1QA9B 5JIKA 3IYLW 3LKNA 3VXUE 4ZODA 1ADQH 5KVEE 2BZDA 5E8NB 3MLVL 3F7PC 4Q7DA 1AGFA 3LNHA 4FNPA 1OTUC 1NAMA 4PJ6A 3DVGA 1EZSA 3P77A 5CGMA 3L5WB 2UUDH 2GJ6A 4I77L 5CINH 3SKOA 4D8OA 1I7UB 2OMTB 4LSQL 4WEBL 1KC5L 3QZLA 2WLLA 4LHJB 2EVIA 1AH1A 4LPYA 1I1AD 2WLLB 4NCC1 5DJAB 1YPZE 4LCWA 1TTAA 2ZKXA 4KKCD 3VGBA 2N7SA 2Y6SD 3I6KB 4JQIL 3WG7B 3V4PH 2YPKA 5JHLH 3CDCA 2AQNA 1MVUA 3KLKA 1XCTB 3Q2VA 4P2AA 4FABL 5LGYA 4MB3A 1I1RA 4M00A 3T3MF 4WEUD 3NT0A 1EERB 5CN3A 5H2BB 2X42A 2QGBA 3V4VB 3RJQB 1MREL 2WHVA 5ENWB 2XPGB 4ODHL 3CE1A 5FK9B 3NABL 4ODWA 1G7LB 2HFEB 2W65A 3NFSL 5B4MC 5HJGA 3ZZQA 5HYJA 2IGTA 3S3BB 2BVUA 4GQZA 4XAWL 1FH2A 4HJIA 2G4EA 2UZXA 2X2YA 1U8KB 3PWNB 4MXQC 2NW2B 3Q2CA 5IUSA 3L17A 3BUYB 2FJSA 4IHBA 4KK8D 2GEQA 3RHWF 1RZ8A 2WWOA 4LHUD 3TBYB 4XZUB 3EOTH 5E2VL 5DHXB 4G1MA 2ID5A 4XCNA 4Y5YA 1LO3H 2Z7WA 5GGQH 1KB9J 4BQ6A 1UZGA 3SKJH 2UZPA 1KCVL 4GAJL 1A21A 2HKHL 4N6RB 2CJ3A 4QGYA 4BWUA 5ITBH 2NSQA 3D39E 4K7FA 4Z7QF 3W3BA 5JOFA 1HYSC 1MIEH 4WI0B 1D5XB 4WV1A 1GC1C 2RR3A 2O61B 4MJJA 4PJCB 3HRZA 1T7XA 4ONHB 2ZUQC 2CO7A 4Q56A 5JQHC 4GO9A 2K9UA 2HT4C 4QRPB 4X0KB 1QO3B 2EE9A 3LHAA 5KVGH 1Z9LA 2PCYA 3U2JA 3ZN6A 5HDOA 4G5ZL 5ESVA 1JXGA 3RVTD 3QUYD 4AQAB 2X3AA 3QIUB 4NHUA 5D71H 3LKPB 1OCOB 4UAOB 3Q8FA 2IG2H 1L0QA 1Q94A 1MLBA 2VMEA 5BMFH 3DXAE 4LCWB 5GRVK 4MXWH 5F7LB 4LRIA 5FA4A 1E27B 3C9NA 2X0VA 1MCHA 2R23B 4K9EH 5DJCB 2XBZA 2DWXA 5IM7A 1R1CA 2CO7B 1J5OL 1GHFL 1M9WA 5IVZA 2DMBA 1GC1H 1JFQH 1RZ7L 2JI2A 3OQRA 1O7DC 4KKLD 5LGHL 3OJMB 4S1QH 2VTFA 4GQPH 2WUBL 3VFOA 1SN0A 2YAQA 4F57H 1KIPB 1QA9A 3LVEA 1QG3A 3F58L 4JDZB 1CTMA 2RTTA 3JZ7A 1O6VA 4LEXH 2PYEB 4LCUA 3W5NA 4HUWB 1NCUA 1UH2A 4NQQA 1OSYA 4L4TE 2JKIS 2GJ6D 4I4WB 2Y7LA 5J1AA 1GW6A 4JZOA 2EH7H 4ZTPL 5L2JB 1OZUA 2VQ1A 4OD2A 1N0LB 1OARL 4K9EC 4XNMB 2D03H 2YEVB 4FQCL 5A2JH 2BSTB 1AXTH 2ZJSL 1FAKT 2DMGA 5EOQL 4DO4A 1OB0A 2AK4D 4OIFA 1JGLH 4W9CC 2ZWYA 4XPTH 3W38A 4A1RA 5HYEA 4PU2A 3D50A 3RJDA 2LAGB 5I17A 2ZAGA 1UWXK 3L4TA 1JERA 2AERT 1PNDA 2MWCA 4PGDB 4PRBA 2Q5BA 2QELA 2FGZA 3S8FB 5ALCH 3PUUA 1YNKH 1SVBA 3GLZA 1MFAH 1K72A 2MQ3A 3LEVL 4K94C 3S35H 5F96L 1ZLEA 5BVJB 2Q10A 1XGRA 3DURB 1NCCH 2XZZA 5G5DA 2NNFA 2CDEB 1J8HB 4D94A 3E8UL 3RNKB 2AGJL 1HKLH 5FXCH 1ETJA 1JN6A 3EYVB 4JDTL 2NX5B 4Y4FA 1W0VA 4E9RA 4LHQB 1IC7H 2JIXA 1ORSB 6FABL 5KBNC 3TJPA 2GCYA 2QMKA 3Q0HA 3QJHA 3SN6N 1EEZB 2EDXA 2K1MA 3DLQR 2Y2YA 5TDNA 3S37L 2R0ZL 2XG4A 5DEJA 2CQVA 4K7PH 1NGWA 3KLAB 3GMOB 5DEZA 3GEWB 4ODSH 2D9QB 3QQ9D 5F88B 3QJTB 5CD5C 3N43F 1XF2B 3EDDA 4NO0A 1LP9F 1MW0A 4UOW0 4WO4A 1P5VB 5F88A 1MCRA 2OR9H 4KHXH 1NMCC 4Y89A 3LKNB 2CLVA 2G75A 4WENB 1KYDA 1VPOL 2Z8RA 3FQXB 3HJEA 3S3CB 3FOMA 4K71C 4DPCX 2Y06L 3LZPA 3QUXC 2IAND 2VLRE 3RAJL 4BA8A 5B3JF 1JZDC 1P5UB 3M17A 3LB6D 3KBEA 2EH8L 1QEWA 2W94A 4X4YA 3HCVA 4IQHA 3LRMA 1HIMH 3WIFB 1L9MA 4X6EB 4HU8A 4Z3JA 5C1MB 1ZKAA 2Z31A 1N4XL 2IGLA 1A9BA 4I48A 1DLHB 2JIXB 5BRQA 5CF3A 2F53E 1T0NB 2XWXA 3T6QC 4TS6A 2P7TB 1A6ZB 2HVKA 1AQDA 1RULH 4GI6A 4OQTA 2WVSA 3PV6A 4KOBA 1K8IB 4B9YA 4AEIH 1F1DA 1YUKB 5D7JD 3ZRFC 4IRJB 4RA3A 3LNEA 4B9GA 2EC8A 2YD8A 1OGAA 1V7ML 5KG9B 1U8PB 4PWFA 5F0LB 1FZMB 4U6HB 4P46A 4OD1L 4XN1A 4EN3A 2VZTA 3LXUX 2PUQT 5IHHA 2X4UA 4L37B 3V0IA 2Q7NA 2XYBA 2PP9A 4X98B 1EUUA 4JPKH 1ZIBA 3ZDXE 4BK4A 5JPMB 1NAKH 3PNWA 2R0KL 1BPVA 4WU7B 1L6PA 3B3BA 4LLAA 4OI8A 2DM4A 2XI9A 2R2BB 5H94A 3G5XB 5BV7L 3SDAB 5ERWB 4EI0A 1OV8A 1FHNA 3RPBA 3WLBA 5I24A 2JLLA 1VA9A 3KM2A 4RAUA 2XTLA 1RU9L 4ZMZA 2MPVA 4OGAD 4U3CA 4XVSH 5T1MB 2GUOA 4HIEA 3MRJB 2W95A 3LPGA 2XV2A 4UI2A 1GGTA 4G8FB 2JKWA 2L7EA 2VDKB 1SLVA 4YXKL 1RD6A 3JWNC 4ELME 5EU6B 3R7RA 1O6SB 5AQ0A 1UJ3B 2BZCA 4L1SA 2KZWA 1SY6L 2X6MA 1YMME 1CYWA 3OJ2C 2WYIA 3VH8A 2V2XA 4HK0B 4MXQD 4G42B 3T71A 3W82A 5GRVL 4POZD 3KPPA 1ZVHA 2HX7A 1YUHB 3GK8H 5C07A 4AQ8A 1E27A 3C9NB 4KV5E 1UH3A 3QWRA 3RDTB 2E9JA 1RZIA 3ALPA 4AYID 4CC4C 5C0JB 3QEHB 3MRJA 2VERA 5GSRB 4U6XA 1NANI 1CR9H 4AVHA 3FTYA 2DLTA 3CDFA 2NY4C 4B7IA 3DIVA 4CILA 2X4TB 3NJVA 1E9OB 3OGCA 1OW0A 1R3JB 2VERN 4FFYL 4PRIE 3JV0A 1LEKA 3BPNC 1KXVA 3VUAA 3EXJA 3PJSA 1RZJH 4J3WA 2QQKL 3EF7A 3CQPA 3UO1H 1DJXA 2QGDA 1ETB1 4RNRB 3C60B 3FT9A 1EZLA 3NIFE 5IMKB 4RZCB 5IQMA 2B9BA 2JSFA 2VXUH 3HG1B 4LCYA 1KN2H 4GAGL 1TLMA 1QW8A 2I24N 4MA7L 4Z7UE 4Q9QL 2OK0H 3N41F 3U4AA 1U21A 4UZSA 4LSTL 2WZAA 4P5TB 1UM5H 1FNSH 3GS4A 4FRWA 2WVVA 2MCMA 3ZTDC 3NIDB 3MYJA 3IEAA 1Q0XL 1M3IA 4JKWA 3QXDB 1OAUH 3QFJD 4L8CA 1HAWA 5DZJA 3FU3A 1FNEB 1JV2B 3QZBA 3WKQA 1A1MB 3L3GA 3TYFA 1RZJC 4M7LH 5IG7B 1V3KA 2NZ9C 3KWXA 4YOKA 5AAPA 1QEWB 2O5ZL 2PPFA 3IXAA 3O6LL 3PWPB 3QUYC 3DGCR 4KJWC 4N28A 4LLYB 3UERA 3TA3D 4AENA 3OHXB 5BZDA 1A4JB 1KCRH 4JHBA 5HHNA 3ZKMD 2P5WD 3MCYA 3FF8A 1PQZB 5DO2D 1QR1B 4FN0A 1FFNB 4KAQL 3NCEB 3ULUC 3U48A 3WKML 1NPJA 4RA0C 3DYMA 5I1EH 1CI3M 5E2TH 1BZ8A 4CKVX 3D0AA 4GFTB 4XBEL 4ZPVB 1XEUA 3KYAA 3S88H 3NIGB 1FBIH 4B9KC 1FFTB 4YHKH 4GS7B 1HH6A 1W6LA 2J55A 3CQQA 1XTLA 1P1ZB 1A6UL 1TQWA 5E70A 2QKIC 1WAAF 4FTVD 4BEIA 3HTLX 4TQPA 5FKAA 5ISZA 5CD5D 5AB9A 3WFDL 4EIUA 5DI8B 3FW6A 1WEJL 5JNYA 2P49B 3QJFA 4QLWA 3KPRB 3V6BR 3EAKA 4ZMTA 4K07A 2JWYA 4KKNA 3QDAA 2R2HB 5D7LE 4ETYA 1QSFA 4LPUA 4M8RA 5I6KA 3ULUH 1KB3A 4LLDB 1J8HA 2R4SL 3IU4L 4M48L 2YXWA 3QGVA 2VZ1A 4Y4FB 4FGMA 1FE8H 3BDXA 1KJVB 5IK3A 1GTNA 4XBGA 4JQIA 3LS5H 3ESVF 3KCPB 5D7IF 4HBQA 1JWMB 1IC4L 1P6WA 3CDYA 5EA0L 1FFQA 5TDPA 3RVXD 4U49A 2WTRA 3O41B 4ELMF 1G9ML 1KBWA 1SXAA 4UT7H 2XDHA 2AAAA 2OXGB 1YLBB 2L3BA 1X5LA 2PYFA 4MVBD 5JPNC 4J7RA 1MNNA 3FXIC 3RI5K 3QUMH 1MWAA 3QISA 5DRXA 4ANVA 3L3OA 1A6WH 4Y4KC 5DEFB 3T3PF 1LL1A 4RQQA 4Y19D 3NFNA 4HZ1A 3RKPA 5IQ7L 1P4LA 3EO9H 2QFPA 2LW3A 4C57C 3QJUB 5I6PA 3FUKA 5C0CA 3H9HB 3MBED 4PP1D 3L3HA 2VR6A 5I1CL 1U3HB 2DDQL 1UD6A 2QVMA 4LVNB 2D0HA 5DEGB 5KS9A 3JTTB 4FQHA 1WA2X 3CLFL 4F7KA 1CD1A 3CXFA 3N1GC 4NLAA 5IJVB 4XN5A 3FRUB 5IHUL 3O11B 3EJQA 3L9RA 1FCCA 3FN0H 5KVMC 5CEZL 5K69A 1RXLA 2FWUA 3QUMB 4QF1A 4J3VA 2Y5QA 5DMKB 4G82A 5CS7A 1ZLVK 1U8NB 4FYSA 3W56A 3QIUA 4Z7WA 4GXVH 4LKXB 3RTLA 4WI6A 2W9EL 1T0OA 3ZKSD 3VGAB 4I7ZC 3DX7A 4XNYL 3L8QA 2MHAB 4FQJH 1J48A 5T1MA 4IMKA 1K6QH 3TWCH 1QBLL 3HG3A 2B15A 5DURD 1SOSA 4Z78B 5A2KH 4S0SD 4L18A 2BFVL 2W9DL 5DD6A 3IPEA 1IBBA 4UM9B 2Q86A 3UAFA 3WFEL 3KH3A 1VGKA 3WTSA 3G5XA 1E7VA 5EIQA 4QRBA 3OJDA 2AI0H 1OT1A 1WJ3A 2F5AH 2ZXGA 4GLRH 4I9WD 3HC4H 4QWWC 2HZHA 1OM3L 3SE4C 1TYEB 4XOEA 3FB6B 3KPTA 4JFDD 5JUEL 3V4PA 2GJPA 1VZHA 2VC2L 1XF3A 3HMWH 4C4BA 1Q8MA 2WKOA 4EUPH 3HE6C 3UGUA 4BBWA 4G43B 4MQTB 4HUUA 3KYNB 2Z35A 3VI4B 4MAYC 3WY2A 1IILE 4HFWB 2VDMH 5BXFB 4UOW1 3ZSTA 1PY4A 2NR6C 2B77A 3TGXA 3OZKA 3REVA 5DS1A 4DWHA 3P9LB 5IHBA 2V2WA 2R7EB 5DRXB 1G7QA 1Q0YH 4NB7A 5CU9A 3T8MA 4NOBA 5DJ6B 3U6XA 2VL4A 3EBAA 3GB7B 3KPMA 4FFYA 4XP5L 5BZWA 2OBGA 2ERJC 4YX2L 4MS8C 5I82A 2FE0A 4FQXD 3UADA 1YEEL 1IRAY 4GW1A 3KD4A 2KPWA 5GRUL 4NNPL 2HJKB 4OCWH 5GXBB 1S78D 1O7VA 3HI6H 5AALA 5EF0A 1T2XA 1KJVA 1TMQA 4J3BA 4WJ5A 3BN9D 4ZRGA 4XMXA 4O2CA 4WHTA 3V6FB 5B8CC 3WTTA 1BGXL 1GS6X 3LX9A 5EZLB 2FUQA 3WTXA 1NUDA 3MGOA 2KLSA 4KVNH 3AGWA 2NYZA 4HJJL 3G6AA 1C8QA 5LGJA 3PS6A 5AW9B 3HZVB 1DDHB 4JFED 3RUGF 2YQ2A 3H55A 4LP4A 3ZE0F 4BFIB 2WSDA 3DV4A 3MPCA 1NCJA 2DQDL 4XGZB 3QFGA 4PUBL 4HXBH 1SFHA 4OIBA 4A37A 4PLNC 2UX6A 4HSQA 4PFEA 5C9KA 1JGUH 2CLZA 2Y7NA 3DXAB 4KPHH 4OF6A 5EIIB 3UPRB 1SY6A 5DJ2B 2NX5A 1UM4L 4NQDA 2WQSA 3WLWC 5LXVA 4TRPL 4PJFF 2BIPA 2F74A 1R3HB 3ORJA 1YY9C 1UGNA 2QQNL 1A4BA 1T5KA 4HJEA 3MGOB 3A5VA 3L2NA 3TN0A 1ZS2A 4YEEA 3KBPA 5CMAB 4ZUWB 4QHUA 3ARGC 5HDWA 3F04A 3D3VA 3Q5OA 3KE0A 1J87A 5TPWH 5B1CA 4Z7QE 5M7QA 1RAMA 1UT2A 2NX5E 4L8DA 4PGZA 3NN8B 1N0XH 2UXTA 2XUWA 4XPAH 3ROLA 3MLSL 4LPCA 1LNUB 4WV1C 4HKXA 2VDRB 3CMGA 3BZFA 3X2QB 3ELAT 4DK5A 3BYTA 3LRKA 2CUMA 4GBXA 5EUKA 3CZFB 4BZ2H 5JQIB 3QDMD 3TBTA 4LSSL 1LLAA 3KJ6L 2OP4H 1EFQA 3QHZL 4OF0A 3SDAD 4F91B 2BH0A 5IFHH 4HULB 5KJ7E 1JF1A 2I7SA 3S5LB 4LSPH 1XH3B 4J3SA 3C5SB 1KXTA 4MMXB 2IWFA 4PTTA 2P8PA 5JHDD 1BDYA 5EO0A 1DQKA 1HWWA 1GY2A 3WSQL 3U9UB 3FN3A 3MLWL 2NUPB 1ZHNA 4UNUA 3ULSB 4ZAKA 5F89B 5AWNL 1IGML 1SXCA 5EZOL 3WN5A 1KDJA 1UURA 4E36A 4OZGE 3E6HB 2V5TA 4Q89A 4WTWA 1IC1A 3ARBD 2BNRA 3ARRA 2CBOA 5HDQL 3IJYB 1CDGA 2WVUA 3U1SL 4E42B 5IJKA 1V5JA 2JKLA 1HL9A 4O2FB 4JUTA 5D7LD 2VWEC 4V2BA 3Q1SH 4M93C 2WLJA 3RFZC 1MWAL 1XCQB 1ILSA 4M62H 2P1YA 1P6FA 3RIFK 3TEUA 2C9SA 2WNGA 4DGIH 3TS8A 2AEWA 2BC4B 4Q4IA 5E1IA 4BSWB 5F7UA 1FN4A 1I82A 4FTVE 1BX2B 5CIPB 3JV4B 3B9AA 5D1ZD 1OTSD 3I6SA 2HJLB 1E4XL 1MVYA 4ONHA 3D51A 2GJZA 1Q9LA 2GAZB 4TLTA 1KIUB 3FUHA 4PJAB 3RWHA 4RETB 4Y19B 4MJ5A 5JXEC 4ZO9A 2IWKA 3L3HB 2XTSA 1HKFA 3FZUC 1JUFA 2OSWA 3MXWL 4M6OL 4Q6YA 3D85D 3TPUB 1IM9A 3AMKA 2GUOB 2WV3A 4HIEB 4G9DB 5I71B 3VDAA 5K9QI 1HHHB 1VRSA 5LBGA 3LN5B 5F3HB 3HA0A 1IGJA 5DO8A 1I1AB 2OYMA 1GZPA 3VXUB 2NZ1A 2EDOA 5BXFA 5GZNA 1IJNA 3HS0C 4KTEH 1TKWA 4NO3A 1AACA 3PQYB 5HGAA 1LK3H 3OF6A 1WWAX 3RGHA 5DZ9A 3ZLQC 5EHFA 3NCJL 3S5YA 1TZHB 3HC3L 1HOEA 5SV4A 2YBRA 3D2UA 4HMCA 2WLKA 4DIXA 4G7SB 4PBWD 5IW1B 3MKGA 3RIAF 1OLLA 1VADA 3BP6B 1K8IA 4XNXH 1QI3A 2OXHB 1UACH 3H2QA 5DC4B 1B9KA 3IETB 3LKSA 1JDDA 3BQUD 3BVTA 4Y1AD 2VDLH 3D7PA 2HT3C 3QFDB 3ABMB 4D7BA 5J9PB 4Y4KD 1RPUA 5E5MB 2JKSA 3DGDA 5C0AA 3QJFB 1L7IL 5I19L 1KGYE 2FO4B 3VRJA 4G1EB 4JO5A 4XODA 2AVFA 3B37A 3CU7A 1ED3A 1EA9C 4QJ3B 5SWSE 3FOMB 3ZUCA 3NACL 3II3A 2PF6A 4LSDA 4AW7A 5I8CA 2ZCHL 3PL6B 2DLIA 4XO3A 1YMMD 5BVPH 2WB7A 4JY5H 3CV5A 2KUTA 3MRHB 4PBDA 2NXYD 4I5BB 5DRWB 4BE6A 3S96B 1PQZA 5IJVA 4OU3A 3UYRH 4EDWH 4KQ0A 4UINL 4CDHA 3UGXA 4YHZL 3JTSA 1HT6A 4HIQA 1GY1A 3GTNA 4OTXH 3FPXA 4GAYB 4OJFL 1BLIA 1IEBA 2WB1A 4U1HB 2OMXB 4TPRH 5TF1H 1S7QA 2R1XB 1GSKA 4KFMA 5HHNB 2W81C 1XGZA 4JN2B 4O9HL 4QTFA 5A2FA 2BVOA 2F8VA 2F18A 4DNLA 2QPEB 1QRNA 3JWDL 2OZ4H 3E80A 3UFIA 4HFUL 4ZZFA 3BT0A 4PJ9B 3UYOD 2YXFA 1OGTB 1G43A 3PG2A 2JELH 1AGDB 4HFWA 2GTWB 2NTFA 1MFEH 4DCQA 2R69H 1QQDB 3QR1A 3AG1B 1G4RA 1GIGL 4JPIA 4PI0A 1ILUA 3ME0A 1VFAB 3NJLA 1IGIH 3IKCA 2YD0A 3QEQA 3EFOA 4YLQT 1KFGA 2GKIA 1FVCB 5KVFE 3F7VA 3C09C 3BP5A 5E6ZA 1T1YA 1MJUL 2R15A 3S35X 3B5GA 3C5XA 4KITB 3D25B 2DY2A 4C4KO 2XKUA 3HUJF 3STLB 5CSZA 1CFMA 1INQB 1OAYH 4HEPA 5EWIL 4ZUUA 2IDQA 5JHMA 2AV1B 1J05B 5AW8B 3BE1L 1MCEA 1M7XA 2E7HA 4QRTB 3BKCH 3ZXAC 1WV7T 2EDJA 1KEGL 2GFBB 4GKZA 5K5YA 2ROYA 4LKXA 1PX8A 4OZHB 3KWTA 1F42A 2KI6A 2AXFB 3BHBB 4IS6B 1GGIL 4UT6A 2PN5A 5EFIA 4LP5A 3FO9B 1OB1A 3PDDA 5BJTB 4M8QB 4JNXA 3WD5L 2PYEE 3WS6A 4P2RA 4M7JL 1UJ3A 4NAJA 2ATKB 2IQ9H 4J6RH 1C12B 2X6VA 3TIDB 1RUKL 1ZHBA 3F7KA 3M88A 1SDYA 2CGZA 4YN3A 5HHVH 2AZAA 3EO1A 4N8VG 3RE0A 3RWEB 2HX9A 2WAHA 5AVYB 3GBDA 4N22A 1BIIB 1MRDL 2OL3A 5KUMA 2CZNA 3NSCA 4HKZB 5D96C 5DD5L 5A7EA 2ZUXA 2ZKYA 4M1CD 5T1KD 1QLRA 1UM6H 2CG9X 2WXMA 4GRWE 2Y07L 4R9HA 1OL0A 3WKNA 1YN7A 2HUEA 2XETA 3NSFA 4YBLC 5T1JA 4BQ8A 4KKAC 3L13A 3O2VH 3PWVA 1E7UA 4WFFE 1F00I 4D0DB 1NDMA 4NZTL 4J3OF 1HU8A 1MLCB 5ABAA 1RJLA 3F6LA 3ZZSA 4ZTOH 5DK3A 3S34L 1W2KT 2XZCH 5TQ0L 5KEZA 2ZOKA 4J3UA 1A7RL 4L9LC 4H0GA 1E4HA 4H8QA 2NTFB 4Z3TA 2IMMA 4ZMWA 3IMWA 4X98A 1V7NL 4LMQI 5AVXB 3A21A 1JRHL 2F5BL 2YA0A 1R75A 5DK0B 3WL9B 1FL5A 1ZGLA 3B56A 4IMLA 4R7DA 2IAMA 3BP4B 4JO8A 4YSAA 3CFTA 1IBYA 2ZX6A 3W2DH 1HI6B 3V0HA 5T3XL 2OQJA 4P9HL 1INDH 4IDJH 2YKKA 3AWGA 5JIQA 2WINA 4TUKH 2FX7L 5DMJB 5GRWA 5B1JA 7TAAA 2P7TA 3O3EB 3MOBH 5CP7A 5B39B 2ICEB 5F7HA 3QQ4B 3UJJL 4AIZA 2A6DB 3CC5A 4LAQH 4MJ6B 4YXLH 4HVBA 2HFGH 3QEHA 5LWYH 2IBZX 1TITA 5C0BD 1DE4A 1A2YB 3LZFH 4HA1A 2B1HL 1XGYL 4M1GH 4KFZC 4IBUA 4M9OA 3VG0L 3CD4A 2DMCA 4P46D 4KQ3H 2EXYD 4FA6A 2OL3L 3EJZD 4XTRD 5TGBB 3BPOC 3V5KB 1OTUD 2EINB 3ZTNL 3ISWA 3K80A 4OY9A 4OCRL 1FZKB 9PCYA 3LRGA 2OCJA 1ETA1 3NZHL 5LCVH 4XHJD 3IETA 2ZXBA 3K2UH 2EDQA 2BW4A 5JLZB 1N26A 1UXWA 5IROC 4EI5D 1DR9A 2W59A 1Z7JA 4KKZA 2XN2A 5J0BA 4GINA 3STLA 4DP4X 3W9DB 3H7BA 3DBXB 2ZXEB 3LB6C 1CL7H 4JG1H 1R5IA 4WI8A 2FJFA 1PLBA 2VR7A 4JG0L 4OLYH 1JDAA 4BWWA 3TF7C 5GGRA 5EOTB 1GYAA 3HAEA 2ODHA 3KXFA 3WLWD 2NYYD 1YEJH 2YGQA 5D7EA 3UTZB 3EFOB 2WVVB 4FLOA 1AQKH 4PLKD 3BQUB 4Y1AB 2XZQH 3MC0A 2Z91B 1F4AA 3BAEH 3VFTB 5J6SA 4N8VB 1X7TA 1AGDA 1ZVYA 4PGDA 4PJ8B 1UZ8A 4N0YL 4AC2A 2C4XA 2AEPH 4U3HA 4YZFF 3MO1A 2EDBA 1XF4B 2L8AA 5T33H 2W9LA 3GBNL 4ELMB 3AUWB 3PAZA 5EBMA 5D7IE 3OKOA 4TSBL 5F9JA 5IT2L 1S7QB 2R1XA 3KYKL 4X42A 3THML 1DEEA 4EN3D 3MCLH 1T6VN 2IALB 4N0RA 5F2FA 3AQZA 4D9QD 1QLRB 1AGBB 5C9JA 4KZEH 4P5KB 3V7AG 3I74A 4JDEA 1Z5LA 4S0HA 4EI6A 1M4KA 2RHEA 3A22A 2MCPL 1WT5A 2QQLH 3ZY7A 1RURH 4F2FA 1TJGH 3REWB 1HDMA 1IB5A 4DTGH 2FLRT 2EDMA 4U0QB 2E9IA 4P4RA 5DLMH 3WEAA 3KL0A 3KWVA 3NA4A 4QD2E 5EUOA 3D52A 2C9VA 3BW9A 1JNNH 1S9VB 1MAJA 3BD4A 4G6MH 2X4PA 3K6OA 1OSPL 5I8OH 2ZP0T 1AZBA 2YGVA 4MMYB 2P28B 5DMIH 4MJIA 1VDGA 2COQA 4K3DL 1IL1A 2ADGB 5C07D 1I9RH 4JRYB 1ITCA 5I5RA 3Q3GB 1BBJB 1T66C 4X0KA 2HLEB 2RQ8A 4AH2A 2ZOKB 2B1OA 2GITB 2V33A 5ACZB 4O4YL 2C4FT 1TCRA 2PETA 4P9ML 5SWQA 3ZTCC 5GISL 1W72L 3A6BL 3F7LA 1IGTA 4W93A 4WK2B 5IIEB 4P3DB 4P46B 1RP9A 4W70A 3BKMH 4R0LB 5AD0A 3CX5K 5L2KB 4UTBH 4LDOB 4FCAA 1OGTA 1OF2B 1E5YA 3C8KA 4U3XA 3OL2A 4E9LA 4N8CL 3LDBB 3AG3B 1F11A 4M7KH 3BKYL 1NWOA 1MUJA 3BDBA 3V0WH 5A6LA 1J8KA 3EGXA 3ULVL 2W65B 4XXDB 2EACA 1BIIA 3HI5L 5K9JL 3FCSB 1JXDA 1RHFA 4ZUSB 1MDAA 5HYFA 3O6FB 4JY4B 2GY5A 3O8XD 1MFMA 5GRJH 3KPLB 3D39B 2VMCA 4V2CB 4UU9A 1AYOA 1F1GA 4WKZA 3K0YA 4HWZA 4FKHA 4PV9A 5L6YL 1SDAB 3O9WA 4I9WE 2AAVA 4R83A 3BWAB 4NQCB 4R97B 4BFNA 3IGFA 2A4EA 1TF4A 3DOSB 2FO4A 2X28A 5B7FA 3GUTB 1TEFA 1GZHC 3P30L 1F2QA 1IGCL 4AMXA 5L8LB 4UOZA 1NFIA 4K3JH 2XSKA 3HZKB 5IOPB 1LD9B 2P8MB 4LESA 4JKPL 5DUMH 3MREA 1XGQB 3FMGH 4WCYH 1KGUA 4DKDC 2OMNA 4R7VA 4CNIB 1A9VA 1I7UA 2OMTA 4OZHE 1K4CA 1ZV9A 2QLVB 1JZ5A 5JIHA 4WUUB 1YEWA 5A16B 4OZFB 2YXMA 3GDCA 1RK1B 4ZS7L 5IQ9B 3IDGA 5K9KA 4J2QA 4N0FA 1VEPA 1QSFD 4PRBB 3WFHB 2ZONA 3AT9A 1ZSHA 3FYEB 5FW6A 2XN9E 1PLGL 1G6RL 3U6RA 2P8LA 4DKEL 4X5XB 3ZMNA 3C87A 2CO3A 1XH3A 5FUCE 2NY2B 2XBTA 1N19A 1F3JB 1KPRB 1NCAL 3P9LA 4NJAL 5L9DH 2WZPD 3A4DA 1U8HB 4GKLA 5L4JA 3EGSB 2IOMA 2DEWX 4D9QE 1MCJA 3UTPE 3K1KC 1KACB 3AABA 5FA3A 4PG2A 3U7YH 1PDKB 3DVNB 5IEKB 3MLXL 2FYYA 1N9PA 4B9IA 4LCUB 3WY3A 4BUGA 5MHSE 1CGSL 4DQAA 1TG8A 3FQRB 3VD1A 4YDJA 1UH4A 5I66A 3ULUD 2H0FA 4LSQH 1GJUA 4WEBH 4B97A 2A74B 3ETSA 4D9LL 4PJHE 1G7IB 2UXGA 2BOLA 3VFNB 4ZMVA 2PCPB 4JQIH 4UQCA 1V54B 4U33A 4KY2A 4R8WL 3WFZA 5MEPB 1SBSH 5KVFL 3QUXB 2PTUA 3RDTD 3BWAA 3JT0A 4TUUA 2JK5A 2VAAB 1B3JA 43CAA 1MVFA 3QXAA 3WEBA 4I1PA 3QP3A 2KQMA 3L9YA 1E5UI 1KJ3H 3VFPA 1Y0LB 2NLJB 2O5NA 2HG5B 4ODHH 3WTUA 1UB5B 1FSKC 3NABH 5F7AA 4U6VL 4AQ8C 2A9NL 3X12B 5DTFA 3GKWH 1AGFB 1MW2A 1EAPB 1LK2B 5A6IA 3EKCA 2BOBA 3NPZB 1CQYA 1RSYA 3QZWA 4URKA 2CPCA 1HCZA 3LN4B 3SCMD 1MCPL 2VUOA 1ZD6A 3S4SB 2BNUA 4RGNB 3N0PB 4BZ1L 3BFWA 1WGVA 1NGZA 2VLRB 4HIIB 5KN5B 1YDPA 4N2BA 3GSNB 3H4FA 1SOXA 2N7BA 5EBWB 3N9GH 2XWDA 3GSNA 1UKTA 4MNQE 3G9VA 1T04A 3EOTL 4KRMB 2ATPA 3X1BA 4MMZB 1A1NB 4BIKA 1KTJA 1PY0A 3NJJA 2EXTA 4MMZA 1B2WH 2QSVA 3TNMA 3GXNA 3WIHH 5DHYA 4GAJH 2HKHH 2I60L 3Q8EA 4Z7NE 4PJ7B 5C0GB 1BFVH 1ZJAA 2WSKA 3CXHJ 5ANMB 3DX8B 1QI5A 4MA8H 5IHZB 2P80A 3GNML 3KPRE 4RBPH 2AQRA 4N2OA 5B22A 2OZ4A 1IO4C 3KPNB 3QIWB 2GITA 2NY4B 3VXRB 4J1UB 4WU5A 4P5TD 1OSZA 5SWSD 4HLZH 1ZSDA 3WEOA 4GXUN 3RY6A 3RZCC 1JZ8A 5D71L 3EYSH 2EAEA 1R47A 2B16A 3WENA 4XC1L 1HINH 4NGHL 4PP2B 4PRID 1QP1A 2BW5A 4LT7A 2V17L 3CH1B 4X7FC 1AIZA 2GY7B 4K9EL 1E28A 3B4NA 1QNZL 5A3ID 5E8EA 4MJ4A 1EFXB 1GHFH 4ODVH 4Y9GA 4ZJ9A 3IDXL 4AEHL 1JFQL 4GBXD 1HJCA 1WAEA 4P2OD 4W9LC 5J5EA 3U0PA 5FYLD 3C8HA