2MNJB

Nmr solution structure of the yeast pih1 and tah1 c-terminal domains complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
PHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPSYNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERTLYIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title Structure/Function Analysis of Protein-Protein Interactions Developed by the Yeast Pih1 Platform Protein and Its Partners in Box C/D snoRNP Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18482 Pih1_fungal_CS Fungal Pih1 CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4160 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2mnjB00
2MNJB 4CGUB
chains in the Genus database with same CATH superfamily
4DKEL 1P84J 4PS4H 5C9JB 2FX8L 3L3HA 1A2YB 4W70A 4G1EB 2OMWB 3CXFA 2R2HB 3EO1B 3MRNA 1RJYA 2Z93A 5DD3H 2NQDA 2IDCA 1R24B 1EMTL 4N1CA 4K5LA 5DMKB 4MJIE 2ZT9C 4L8DA 3VAEA 5FLVA 1DQML 2AFNA 1CFQB 1CS6A 1CZ8L 3E3QC 1OP9A 4IRJD 3PREA 1J8RA 1RZ7L 2AJVL 4UU9A 3MLVH 3FMGH 3BH8B 1CLCA 3GMOA 1AGBA 3K4AA 4WSGA 4TNVK 1LJMA 5KBKA 1R5WA 4R90L 1VZHA 5F1OB 1YUKB 4AEFA 2QPEB 4M7KL 1JPTL 1GS8A 5DQ9B 8CGTA 2GUYA 4MMXC 4ISVB 5AAMC 2BNUB 2FL5A 5IVZA 1BEXA 3IMTA 4MXWL 4PRPB 1T2QL 5A6LA 4NNXB 4J3OH 3D69B 3Q3GA 4Y88A 1EA9C 1PL3A 2Z4QA 3LSOB 4N86A 4R8WH 5D71H 1J5DA 4HUMB 1NIEA 4FQCL 3DOIA 2H6OA 5FYKU 1KYOK 2EH7H 3DX0A 5KVDL 4OAWA 4N22A 1EIBA 1UADC 1NGXB 2HJLA 3V4PA 1CDIA 4NRZA 2NPLX 2Q8BH 3IVKB 5IB5A 4WUUB 4QRPB 1ZVHA 5K39A 1TQBC 1PZBA 5JQ6H 4DUXA 2RD0A 1PIGA 2H32B 4KNTA 5E94B 3D51A 3N41B 1WZ1H 1E4WH 3I6GB 4OFPA 4F24A 2NY0D 5TE4L 3LPPA 2O6EA 3RNQA 3EADA 4J8RB 2JQAA 1IGIL 4IKJA 1RJCA 1OIOA 3IWUA 3A23A 4LSUL 2H5UA 3BVTA 9PCYA 2R1YB 2CHZA 1EZUA 3IMRA 2VLJE 5DGQA 1MEXH 4WKZB 3TT3L 4AJYV 2JH2A 2A6JB 2X4SB 1ZSDA 2DTML 4V1DE 3ILEA 3O3BB 3GS4A 5TPWL 4FFVD 3EGSA 1FVEB 5AB2A 3QUZD 3ARTA 4O51B 4PH8A 5E8DH 3ZE1E 5I23A 2BSED 1BVZA 4HXAL 4WAFA 4QTHB 2ESVD 4YDLC 1UOVA 3MV9E 5GJSL 3QXDA 4XCNA 3KGRA 1FC2D 3T3PF 4N2IA 2C1OA 1J5OH 3MRMB 2OMTA 3FUJA 3N3EA 4MXQC 1HNYA 4FJYA 4U1SA 1MW3A 5BS0E 4PJ9C 3CBRA 5AVRB 5IVXA 1E3FA 1NCCL 4XVUD 3ZTJH 5IVXF 4H20L 4C54A 4GBXA 5E6IC 1JOIA 3IMSA 3PS6A 5CGBA 5IQ7L 4G6AD 3DXAE 2O6PA 1AQKL 4PRIE 1IAOB 4QMEA 1LHZA 2R4RL 2VN4A 1AKPA 5AOZA 2XPGB 3GI9H 2XZCL 4PLKD 1NGQL 1DVFD 2A73B 3CWGA 3PJSA 3FFCB 3G9VA 4O58L 4RVBA 4WUKL 1WIUA 5L4MA 2ZSWA 5DHDA 1RUAH 2DQFA 3TYFB 1U8KA 1VGEH 2P80A 1K4CA 3EYUL 5HDBB 2K8QA 2X4QB 2ZSVA 1RZGA 4MNHB 1BQ5A 1GOHA 2ATPA 2FUQA 3G5VA 5E6SB 5J6GB 1ZVNA 3U4AA 3R0MA 4M7ZC 3DX7B 1BFSA 1LP9A 5H94B 5MI0B 2XIDA 2B5IC 5DMJB 5F72S 1J0IA 3NJMA 4WWKA 3ULVC 1LP9F 2EYRB 3WNOA 2NCEA 2G2NA 1GW0A 4OJFH 2KL6A 3U36B 3NCBB 4A7TA 2VO8A 1D5BA 1H3TA 5EC1B 3MBEC 3MO1A 2EDHA 2VZVA 4ZUUB 4NKOB 2IQAB 1R17A 3LIUA 4TQEH 2WUBH 3P54A 4XNBA 2OZNA 4B7IA 4PJFA 2VDOB 3B5GA 1CE6A 5AB9A 1LEKB 5HHVH 3BFWA 4U3CA 1CG9A 2ORBH 4XPAH 2VE6A 2A9NL 3HI6H 1QSEB 2C9AA 1OPOA 3EDEA 2QLYA 3MBWA 1G6RL 4V33A 1MCBA 5KUMA 1G4RA 1F58L 1KJ2B 2RCSH 3J2PA 4M4RB 2CBPA 4M5TA 5EOCL 4JPVL 3S3JA 4AG4L 1RUMH 1ORSB 2BVYA 4WV1C 4NZ8A 2I9TB 2NUPA 5KYXB 2FD6H 1FL3B 3LD8B 2K70A 2JXMB 2LHAA 5LGHH 2PXYA 3BP7A 3IXTB 4PEEA 2R2CA 3CH8A 3QFJA 4AKQA 5FA3B 3JWNE 4QDGA 2QSCL 2G0KA 4OGXH 2L0DA 1BM7A 1GGIL 3COOA 4I3RH 1B4JH 2E6QA 4TVUA 4DAGL 2ZWZA 4PY7B 4FE9A 2R0ZH 4LOFA 3UO1L 2AV1A 3MODH 4PRBA 2EINB 2IEPA 3U1SH 4Z76A 3MRFA 5A43C 4ES9A 4EIGB 1WP6A 1UCTA 2WLZA 3KHOA 3WFBH 3ZT7A 1F3DH 2BVOB 1OTUD 1S5IH 1L7TH 2YJLA 3Q43A 3ARFD 4I0PC 4P4KC 1PCXA 5FFLA 1LTXA 1KJMA 2DWYA 5IMKA 1YEGH 3DVFA 2EDJA 2EABA 3HC3L 4HCRH 4U7SA 3V0VB 4O2CA 1FAKT 2ADGB 3D7PA 1IC4L 1S7XB 3CVCA 2MCPL 5HY9A 3L1OL 4TUOA 3NG5A 3VQMA 4H8PA 2DYPD 5DLLA 3QO0B 4CVXB 5GS0H 5FO7A 2JWYA 3HRZA 4FLRA 3CCHA 1MVUA 1G9EA 2Q6WA 5AKSA 3FUKA 1NC2A 2X1XR 1E8XA 4LSQH 1XV8A 3GC3A 4JDVA 3ZTJG 4GUCA 3VDBA 3BHBA 2WQAA 3RFZA 5C0AD 3LYRA 1U2HA 2Q76B 1XR8A 4TVPL 1ONQA 3P4MB 5EF1A 1PZCA 3A4EA 4FQQA 2BHFA 2C34A 4JFVA 2J8UE 4XVOA 3UP1A 1JNHB 3IN2A 5E9DD 2XKNB 1XGQB 3FYIB 4MKTA 4I88A 4X6DA 4X6FB 4ZO6A 3X17A 1LO0H 4PGBB 2P43B 5MENB 4X6DF 3RLSA 3U83A 1CI5A 2BZCA 3S98A 4G1MA 1GXEA 5HHQA 4BZ2L 4IGBB 4PJHA 2A5UA 3CU1A 4Q9RH 4ZMNA 3SGJC 4IDLA 3L3KB 5C0GA 1ETB1 1K8DA 3RX7A 1BVKA 1HXMA 4P5SA 4PJHF 5CR1A 5KJ7E 1JZHA 1YN7B 2WNGA 2YAMA 3KW7A 4ZPVA 4HPYH 5EMYA 4UTCA 3AU1A 1E28B 5FGBA 3ZDXE 1Z3GH 3CFKB 3DVNA 2YSTA 2YD4A 4G7YL 4YZFF 4JRLA 3KDPB 3N06B 1DFBH 4PJGB 2R51A 4PN6A 5JOPD 4TULL 3KXFE 1G94A 2JJTA 4G5ZH 1SJHA 2JKLA 1U3NA 2R9HC 3HE6D 4KUZH 4LNVA 3ILQC 4MTMA 4W9CC 1XGYH 2WUCH 1LE9A 3IETB 4DP6X 4PRNA 5EIIG 3FB6B 3SQOL 4QHLB 3QRBA 3SOTA 2IQ9L 3NJKA 3QISA 1JIBA 3BLBA 3QE5A 5IFAH 1AQHA 3DUHA 4LPCA 5DUBA 1SMOA 4M6AA 4XB3A 3E8UL 3NN8B 3H53A 4OIIH 1FNGB 1NGPH 1TEFA 4PTTB 4OBSA 1KLGA 2X6VA 1MW0A 5D93B 3FBQA 3ZKND 2DQEH 3TJEL 1JHKH 3RDTC 4Y2DA 3QUYC 4NAQA 5I8KH 3RWDA 1O5DT 3KYKH 5GGUA 1UA6L 3DV4B 3WGVB 2VR9A 2XNAA 3HLAA 2HLEB 1DN2A 4PJ8D 4JO1H 3SE9H 1ZE3C 4N0UB 3WFDL 4QXGL 3B56A 3Q9PA 1IUZA 4TQHA 5AW9B 3RL1B 3VRLF 4BUHA 2VXSH 4ACTA 2WCGA 3JXAA 1LE5B 3IJYB 2ROXA 3OC5A 4ZOAA 3LPFA 4YGVA 5HVHC 3FB5B 3M7OA 1CF1A 1LVEA 4KZ0A 2BSRA 5CKGA 4S0HA 3NBNA 4U1GB 4WENB 4AM0Q 3Q1SL 2J5LC 3SPVA 1K6QH 4MNQB 5F7LB 3L4WA 1TZGL 1VLXA 3HZKB 2NDFA 5AOMA 3TO2A 3WMQA 1KXQA 4KO6A 3HAEH 4NQCB 3X3GL 3QFGA 5JORB 2PYFA 2NX5B 4QHKJ 4OM0L 2YOAA 4MS6A 2W9DL 1SXAA 3QP3A 4I1NB 3H2PA 5I1GH 4PCSA 1FN4A 3EO9L 1NCUA 3MNMA 4X6EB 1AD0B 1AO7B 2Q7YB 2J6EH 4PP1C 4F8QA 3CTTA 4DZ8A 4HIEA 3UBFA 1UXLA 3GINA 2KPNA 3GBLA 1SJXA 3QCVH 4LLMB 4ZG1A 2KQNA 4IIZA 4XNMA 4BFKA 2ZE0A 2XKUA 4OLWH 2AQQA 2XVLA 4JFFE 4W6YB 2XTJD 4JHAH 4OF7A 1TVHA 4OGQC 3T71A 2VL5B 3H42H 1TQCC 5FUCC 3VXPA 1T0NA 3V79C 1KCVL 3BD5A 2OXGB 5GRJH 4ZFGH 3CX2A 1C12A 2IH1B 2NOYA 2CIKA 1XIWA 2YZ1A 5HD8C 3FHAA 3MRKA 4FLOA 2KC0A 3GUFA 2A74B 4QJ3B 1A65A 2Q3AA 3MBXH 4JANA 5IJKC 1MHHA 1G4MA 5E99L 3NIDB 2FIKB 1KV7A 1BG1A 2OSLA 3OHXB 3ZE0F 1BOGA 1EFXA 5DJXB 3VD3A 1CTNA 3QJFA 2BZ7A 2O1AA 5FA4A 4N6RB 1S7QB 3Q6FA 2GJPA 4BZ1L 4J3OF 4WTQA 3WI9A 5L88L 5FO9B 3CLFH 1UG9A 1VJSA 3VI3A 1B0RB 4D9QD 4Z8FL 5FYJU 5EEXA 2LV4A 5CR8A 2BPBA 1BOYA 3VI3F 5FDWB 1G5GA 4PLOB 3D2UD 4X5XB 2MTPA 2G0LA 2K78A 3DRTB 4GRLB 4MZRA 4UIMA 3ULSA 2AKRB 1I7ZA 4PJAA 4MZ3A 2OCFD 3A6CL 4JHZA 4Z7VE 4TNEA 4R3SA 4PJAF 4Y4HB 4CKQA 3D05A 1HWWA 3O3DA 1X5ZA 3IB4A 4I1RA 3LZNA 4FULA 3UTSA 4PJDE 3U0WL 3PHSA 4MWFB 5DS2A 1I7TB 3B6SA 3WBDA 1KCWA 1T5WB 2OCJA 2ZOLA 2KQMA 1S5HA 4L1BA 5CINH 2HYMA 4MJIB 2HLFC 1BD2E 1EZVX 2GHZA 1KTDA 1P2CA 3LKNA 5HHOA 3B43A 3N40F 2DQIL 5EZOL 4BA0A 2AAAA 4YPJA 3FONB 2R0LH 1V05A 2HVJA 3NJXA 4QRAA 1EVTC 2X7LA 2FUTA 1JDAA 3EBAA 4O2EB 2PP9A 1QR1A 1F1DA 3CQFA 2BOCA 2AJ3B 5CP7B 4F7CB 3CSYB 3UG5A 3ETBF 2BX5A 1FZKB 3U6XA 3P2DA 2IG2H 1UD3A 4K7PH 2XWEA 2DQMA 3W39B 4CC0A 5L6YL 1NAML 2P49B 3NQKA 1BQHG 3O3AB 1AXIB 2PWEA 2QSTA 4Y2NA 4WW1B 3BVUA 1XXFC 3BPOC 3K2KA 3QI9D 1QHPA 4GO6B 4QF1B 4AEHL 3J27A 5HXMA 2TRYA 3LKQB 1AJ7H 1D5RA 1UENA 2BNQD 2FHFA 2XVBA 2Y1VA 2BOLA 4MS8C 5D72H 3ZZLA 3GUTA 3HAEG 4HJGA 4JG1H 1RJZB 1XBDA 2VDNB 4KK9C 4OQTH 4CAGA 3FO1A 1HTYA 1S7VB 3ZZ1A 4D0DB 1QBLL 4UZSA 3QUXA 3TBCA 4DPRA 5J12B 4MDIB 1JVKA 2GY5A 2PLTA 5HJDA 3TN0D 3R0NA 3U4EB 2VSDA 4Z95L 1CMOA 5HYEA 3BAKA 4P5KB 5GGTL 5JPMC 3SDXA 3BUYA 3M1CA 3NJJA 5F70A 3SDXF 2AP2A 2PTVA 2WIIB 4PCKA 4XP6L 3VXNB 3P0VH 1XF2A 3NTCH 2BLFA 4LHUD 3BVWA 2VLJB 4M8VA 3IGKA 3HZVB 1J1PL 1OD7A 2ZXDA 4Y7MA 4R4NC 4JFED 1J8HA 3RZCB 4KZDL 2FO4B 1F3JA 4C56A 3S3BB 2OKMA 4MCZB 3ZE1B 1KGJA 4X50A 1DLHB 4MB3A 1T2XA 2QHLA 4ELKA 1BWWA 3FQWB 5CIPB 1IC5H 2X6MA 2HT2D 1SDYA 3ALXA 1QFOA 1FYTD 1RURL 3GMMA 3MV9B 4RNRA 2Q0ZX 4P2YA 3UTPE 1EJ8A 4AGMA 2YD2A 3OQ3B 3RWHA 1CD8A 4IBTA 3ARGC 4JDEA 4ODVL 5BS0B 1PD1A 3QNYB 4Z23A 1WFTA 2B3RA 5LNEA 2R29L 3OZKA 4FXKB 3WS6A 1AE6H 3OAYK 3CK0L 4ZAKA 3GSUB 2HXAA 1TENA 2BVPB 5EO9A 2AK1H 3DXAB 1WWBX 4PREA 1OAZL 4PRIB 3BJLA 2FH6A 3SY6A 5F0MB 5TDNB 1FL5B 2XQYG 5F1IB 5TF0A 1QI5A 1XCTB 2NSMA 5HJBA 1ZT1B 3V6OE 3WJJC 2FR4B 2ENSA 5E6RB 5AWNL 4I8DA 1K9TA 3S36H 4S2SA 1J88A 2R27A 3F2LA 4EI5D 1MWAB 2BNRB 4QHMA 4QYOA 4QRUA 1UUSA 3SDCC 1FBIL 1BFVH 2EEXA 3P11L 3GBNH 4IQHA 5JW4N 5J1AA 1KY7A 1NM9A 1ILSA 3T2NL 5T1MB 4PCTA 1NFDA 1FNLA 1E9OB 3Q2CA 4Z7WA 5JA9A 3SJVD 4NUQA 5FCUL 4R4BB 1L0PA 1ZWIB 3HKFA 5FYKE 1NFDF 2MCAA 4XO9A 1A6WL 2VZTA 2O5YH 2Y0SA 5BRZD 4Z7WF 5J6HA 3ME0A 5FB8A 2HT4D 2JFCA 4KJQD 1Q90A 2A9MH 2BCKB 3BSZH 2DLEA 1FAIL 3I75B 4HCRA 4QHUA 5I1CH 1NC4A 2DLHA 1CK0H 2UXGA 4OFKA 2QDWA 1AQ8A 3GSQB 2FEDC 3VB8A 3DK2A 4F37K 1MRCH 3FN0H 5DJ6A 1QI3A 3UAJA 4WFEE 3WENA 2CO6B 5CLTA 3NSXA 3OKKB 1QRND 3UZVB 3GHBL 4RGNE 5EU4A 3QEGL 1L0QA 1KFAL 4MJ4A 3KPSA 2IWEA 5F9WC 4E42A 2VC2B 1JG9A 2FZ3A 4AYSA 5MHSD 1DFXA 2V2XB 1UXSA 4XWGH 4BFEA 3KR3L 2FK9A 5B39G 1DJWA 1SUHA 3PWUA 3GSNH 3L48A 3VFNB 2E5EA 3QEUB 1P5VA 4FQJH 4HIXL 5K9OB 1H3PL 1QFPA 1N68A 2FLBT 4LKXA 5CAYB 3MSPA 4GSRA 4EZJA 3PWPD 4NHUA 1JTPA 2K6ZA 3UTTD 3HRPA 4TNVF 2X38A 4UT6H 1IM3D 3B5HA 1TYRA 1JF1B 5I66B 5LO7A 4YIQB 1LO5B 2P5EA 2WXOA 4I5BA 1XGPA 1T0PB 2YPVL 3CFJB 3UIZA 1XDTT 4LDLB 4QJ4B 1P53A 3O41A 1WDAA 1A7OH 5EBMA 3NFPB 5IHUH 4U6XB 5JUEL 4F80A 1M6UA 1AY1H 1DVSA 3OKNB 3CVIH 1MAKA 4MNGA 1J1XH 1KTCA 2XPZA 2PR4L 3V6BR 3ZQ9A 4B9JA 4UOW0 1CFNB 2FH8A 1UWEH 2ZZUT 3KBPA 3LDBC 4GAJL 4J6RH 4MMYA 3ZDZB 1V3MA 2EXYD 1D7CA 3DJZA 1ZT7A 5D1XC 3MNVB 1KIRB 2CDEA 2YIHA 1BLNA 1SJEB 5AW8B 5JXED 2DQ6A 2VLMD 3FRUA 4G71B 4JUSA 3VG0H 4FLSA 4M48L 3ZN6A 2GYSA 1SYSB 3H9SD 5BZZA 4HAGA 1ETZA 1YEFH 2BHYA 3EG9A 3U1QA 4ZMLA 1A7PH 1DQTA 4S1RL 4HIPA 3QDJB 2OX5B 1PSKL 1MPAH 1UCBH 3IFLH 4BJLA 3MLSL 1I3GL 2E47A 4HWEL 5E8NB 4LF3B 4YDVA 3GJFK 2LGNA 3BZDA 2IBZX 2WQRA 2P24B 1H5BC 4U6YB 2VAAB 1RJLA 3NOIA 4ZW7A 2VISA 3W0WB 3MRCA 1E9PA 3P2TA 3TBWB 3JV5A 2J8UB 4N0CC 3MRGA 4WW2C 5HHPB 3PHQB 4N5EC 2F61A 3RI5K 1M7DA 3ARUA 3JT2A 3QPQD 4LDEB 4LRIC 1N4XL 3FQ2A 4LLVB 4MD5A 4PJBE 4L3EE 4L4TA 5C1MB 1AGFB 4U0RB 1S8DB 4KK5C 5TFSH 3ZDWA 1D7FA 1DBJH 1C5DA 1WGOA 1S7TA 3FFOA 3QZBA 2Q5BA 2YD9A 4BHUA 3VE0A 2K6WA 1DQJA 3SBPA 1N6QH 1UXWB 4G8EA 5ANHA 4R2GB 3QYNA 4RA3A 4W9LC 1NKRA 3V0DA 1COBA 2FCBA 1BQHA 3DOSA 5C0CD 1G84A 3M88A 5I1EL 3W3BA 3IDJA 1A1NB 3NQIA 4KJYA 1FL6A 1GC1L 3ESUF 4IRJA 3E6HB 3MLTB 4GKSA 3L3GA 4L9DA 1FZOB 1RZPA 1JWMA 4FFYH 3QGVA 2WLJA 1QSFB 1UZ6F 2V8LA 1WQVT 5ICZA 3HAEA 4JAMA 3KVPA 4K8RH 1ZLWK 1MCJA 3DUUA 4XO4A 3H0TA 1DQIA 4ODSH 3X1FA 3MUGB 4AL8H 1MZYA 4P5TC 4N8CL 3HPLA 3KNBA 1IQDA 1JFQL 5E2TH 2J6EA 1CXFA 4XVSL 4BH7A 2HFGL 5F93C 2XHNA 4UQBA 3HHRB 1T0MB 5E2UL 5D2NB 1BAFH 3OB0K 2QFRA 5IROD 1T83A 1TMQA 3G5YA 1RZQA 4ZOBA 3ARZA 1M4KA 3PABA 4M9OA 1IE4A 2EIBA 4JBSA 1QQDB 4E68A 3NIFF 2I7OA 4GUQA 1SLXA 1F56A 5KVGE 1I1AD 1THAA 1GGTA 1NOLA 1SHSA 3VWJC 4OY9A 3AXLA 2F8OA 1XH2A 5HDRA 1OP5H 3T0WA 3VSQA 1BZ9B 3B34A 3SHSA 4M1DL 1JD7A 1JHLH 4ZMYA 3DI3B 4OFQA 4UT9H 3O6MH 1YY9D 4Y1SA 3S2CA 2OTWB 4J1UA 3BPCB 4U1HB 4CL7A 3BQUA 2P8LA 3OXSA 2X1QA 4PVLA 1OEZW 4MD4B 3CDZB 1W72B 1E5CA 3OAYH 2OZ4A 1FDLH 3IFNL 2GVYA 3HS0C 3JUZA 2G9HB 1P84K 1IX2A 1AZUA 4U1LB 2OTPA 3P69A 3D0AA 3OMAB 2ZWYA 4YVUA 1CYXA 1PLBA 2NZ9C 3QUZA 2VQ1A 3R1GL 2BP5M 5A1AA 2FO1A 4BEIA 1TKWA 1RUPH 1XH3A 3BZFA 4PB9H 5T3ZL 4IRSC 2MQGA 4LASL 5IMOA 5CEYB 5EUOA 2ZKHH 4RFNB 2CO7B 3LNEA 2E6PA 4P5MA 5EUOF 3WUWA 1EK3A 5AVZB 4WNJA 1AI1H 4UYQA 1C7SA 4MA3A 1WBZA 1GCYA 4GMSH 2YD3A 4IBSA 4YHZH 1MIML 4GOSA 2VDOL 3L5JA 3DHUA 5FX3A 1E9QB 5CJXC 4JW3A 5GISH 4HWZB 3M1OA 1QFWL 5E5MA 1JWUB 1Q0YL 3BLPX 3MQIA 1XGUB 3ZRSA 4PLNC 1AOZA 2F68X 2HJKA 4LL1A 1WZAA 4FTVA 1YN6B 5E0FA 2R69L 3HB3C 2VIRA 4PV9A 4JE4B 4RGMB 4XAKE 5ALBL 3LKOA 4XP1H 4LP4A 2OTUB 5BZWA 2BSTA 1KDJA 5DHVH 2ZCLH 3PXJA 2CMRL 3F04A 4Y5XC 5ISZD 2J71A 3OR6A 5KN5A 5IBTH 1IGMH 1X5YA 3TM6A 1H8LA 3VFPA 4Z77A 4GP5B 3SBWC 5B39A 2DLIA 4NN6B 3SYPA 4KZCA 3BGFC 3T3PE 2AQRA 1W15A 3CZJA 1FNSL 3HG1A 1BIIB 2GBVA 2JIXB 4Z18A 1MJJB 4JHUA 5J8OA 2D3NA 1XF4A 4OQTA 4X5WB 2VJ0A 1RZKL 3AW5A 3MACL 1HXKA 1K3ZA 3CC1A 2ICEA 5DD1L 5IVXE 2YUZA 2NT0A 4JPKL 4HZLB 3RUGA 4FADA 2K6YA 3P77B 5G5DA 4Z7VB 5AUMA 3RUGF 2J88L 4XCYB 3T0BA 4PRHD 3KCWA 4ANKA 4H2CA 1A3QA 3ZKXB 1MI5A 43CAB 4UWQB 5IHZB 2OI9B 5AVUB 3V5DA 4I48A 1ZK9A 1ZDSA 2UZYA 1OOAA 1BD2B 3DX6B 2E4TA 4KVNL 4M1CD 2WKOA 1QA9A 5EU6D 4LPVA 1OARL 2V9UA 5JPNA 3DKHA 4G72B 5G55A 2WKOF 3KLSA 4Q9CA 2YN5A 2VNCA 3FZUD 4I0CC 3NCMA 3NACH 4WNSA 4UTBL 5DMIL 1LP9E 4KKLD 5B4MC 2GBTA 3ZUNC 2X0UA 2WXGA 1YMMD 1HILB 2OMZB 1KYUA 2F7OA 1FZJB 3GJFH 4E5XG 1CD1A 4M8QA 5FECA 2VYRE 1HHJA 3LEXA 3ECBA 3QIUC 4FFZL 3KPMA 5TGBB 4IHOB 4HC1A 1BFTA 4DOHB 4LRNH 4PVMA 2GT9B 4L9LB 3ARFA 5AAWC 2BW5A 3QPKA 4PJFE 5B8CA 1PX8A 3KPNB 4CUCA 3CDYA 2Y2YA 4HD9A 4TOYH 2YUWA 3MI6A 1T66D 5F7FA 3CSTA 3IMWA 3PJNA 5MEQA 4QXTA 4F7MB 2Y5EA 4NZTL 3OG6B 4ECNA 1QR4A 2CA4A 2AEPH 4F92B 3KBHE 1PEZA 4KI5C 3HZMB 4A37A 4FDWA 5FYLD 3G6DH 2Q86A 2L8AA 3CPUA 4G43B 2E9BA 1S3KH 1HOCB 2ZKXA 3AREB 4KMTH 3VJ6B 5IM7A 3FN3A 4F93B 2FQFA 2WLIA 4LHQB 4U1IB 4HS8H 4KO7A 3IFPA 2ZG3A 1KXTB 1XVSA 1CF8L 1KEGH 2R2BA 4LHJB 1O9ZA 1DBML 5KZCB 3QFJE 3QJHB 2FBJH 2DQJH 1KGCD 1A6VH 1HFUA 1NSNH 4GB9A 5E9DA 3LXCA 5IW1B 5FYJE 2DYPB 2W88A 3BSZA 2DI9A 5JPMA 2DH3A 1MUJA 1PFCA 1U8NB 1TU2B 3OF6A 3OPUA 4HP5A 4GSQA 1R0AL 4IKKA 4ZYKB 4DEWA 4AYEC 4FAAB 2O5XL 2YAFA 1JWSB 5DK0A 4ZT1A 4EI0A 3LNGA 3MCYA 5F1KC 5KYWB 3CNKA 3K6OA 1H3GA 1S9VB 4I9WD 2BMKA 5FK9A 5C0AB 3T8XB 3I9IA 5AOIA 2G2PA 3D9AH 4QRSB 3NEEA 4LHUG 3QNFA 3UABA 3CPLB 3F00A 3GSVA 2BOBA 1OLZA 3GSNA 2HCZX 4MCMA 2IAMB 3FJTA 4N3UA 5AYUL 5I1DA 4MSWB 2J5WA 1GZHA 35C8H 4KTYA 4JY6B 4GAFB 3V4UL 4KDTC 2Q2EB 3OSVA 3RWCB 1RP8A 4YQXH 4U3SB 3VFMB 1YYLH 4UT6A 3WLBA 2H2PC 1WTGT 4HOZA 2WK2A 1I53A 4AIEA 3UROR 5C0BA 3T77B 3QYMA 1TCRA 3HPJB 1N0LA 4F7TA 2OFQA 3H4FA 5EB9A 4Z7UE 3FU3A 1CXHA 4X6DE 3B3IB 1TYJA 4P2QD 1UWYA 3QORA 2PETA 5JIMA 5F6HJ 3OAWA 1P9MC 3AUWB 1YEEH 3NK3A 3SE8H 3BAJA 2WBJC 1HH6B 2NQ3A 3HE6B 4RISL 2NY7H 1L9RA 1CE1L 4PJHE 3VXSA 4KTEL 3KWUA 4QXUH 3M17B 3MYZA 3IKKA 4MJ5B 1MCSA 1G7QB 2GBUA 2DBJA 3BIKA 4TLKA 1JL8A 4HSAC 4MXQD 3A22A 1SZNA 3UJTH 4H88L 3QQ3A 1A6AA 1I7UB 4PJ9D 3NSDA 3K8MA 4EUPG 3RIFK 4C47A 3PHOB 4K3DH 4Y2OB 1MFUA 3H2WA 4YZFE 5ABAA 4KHXL 3O8XD 2E9JA 1HQ4B 4NRXB 4X7TB 5E6ID 4JFUA 4YHML 3MX0B 4XNYL 4RGNB 2DYSB 3D39A 5F3BB 4NUPA 4O5LH 1K8IB 3BZ5A 1JNLL 2XG4A 4GINA 4P59L 3ZSTA 5JHAA 1IQWH 3R19A 4XZ4A 3GM0A 3UPAA 1AQDB 1FRGH 1N9PA 1IARB 4FMFA 2R59A 1JGVL 1RHHB 4W9JC 4AQZA 3T0EA 1A3LL 2DQTL 3PL6B 3VRIB 4ZXBC 4LU5L 4WEUD 1RU9L 2ZXEB 4UOZA 1IGYB 5TDOA 1HYSD 2JK5A 2YPLA 3LS5H 3O3EB 2EIJB 4N2HA 4NGHL 5D8JH 4AXWA 1B0GB 4BK4A 1J9TA 5JIDA 2EYTB 2OBGA 3SE4C 4ZFOL 3ULVD 3IDYC 4R83A 1ACCA 2XZQH 2ZX5A 3QNXA 4I4WA 4CADA 1IJNA 3GSWA 4O00A 4CRPA 4F9LC 3IFOA 4YSPA 4B0MB 1OE2A 3WTWA 3H3PH 3LRKA 2OMNA 2ED9A 3MBED 1CFVL 5GS1C 4U2ZA 3HHSB 3RA7H 1FFNA 2VXUL 4OIAA 4HPOH 5F7KC 2V3DA 2VM3A 1WCBA 4W1TA 3SD2A 5I5IA 2VUYA 1SMDA 1LD9B 1E27A 1LK3H 3VRLE 1E5ZA 3DYOA 2HTKC 4HWBH 4NO0A 3QJUB 4OZFH 3DROA 4WHYG 3L5XH 1BJ1J 1KENL 1RZJH 3QDGD 3BXNB 3OAZK 4OD1H 4XRCA 3U4BL 2UYLB 3ZX1A 4LESA 3VWKC 5K9JL 4FFYA 1HINH 1KB9K 5F1NA 5I19L 3BUIA 4W9HC 5CFAA 1AFVH 1HJCA 1KN2H 5T3XE 2CBMA 2ED8A 3A6BH 4UB0H 3ILPA 5DD5H 2EC9U 3RWIB 4H25B 4YS4A 3DTXA 1HZKA 1QTYT 2UX7A 4K3EH 4YVNA 4ALAL 2OK0H 1IGCL 2VDQB 3P4OB 5INCB 4TTDC 4XCFL 4MAYD 1PZAA 4AUUA 2Z31B 3HNVL 4L48A 3S35X 2MCMA 4K2UL 3BJ91 4PMEA 4N2LA 4IJ3C 3SGDH 3VI4A 3QZOA 2ARJA 3VA2C 3KW8A 5F0LB 3LS4H 3VI4F 2N1TE 2OL3H 4WY7L 4PJBB 4L3EB 1LO2L 3GI8L 1ND0A 3MTXA 4I0PD 4P4KD 1RY7B 4OCXL 1PY9A 4YSEA 1MCFA 1PEWA 3NCCB 4AMWA 1UHVA 2H9GA 1PZ5A 1HEJC 2QGCA 4UT9A 1B90A 2X9ZA 2R39A 5D7JD 5DS8B 3FB8A 1E90A 4L37B 1QASA 3OKDB 5AVTB 3ZR6A 2BRRH 2Y7LA 2Y24A 3HE7B 1U3ZA 5IJDC 1PY0A 4WW2A 5IFHH 3IKCB 2NYKA 5HYJA 3QDAA 4L1HA 5DQJB 5BUGA 4EPSA 1I8MB 1MCLA 2E74C 2JF1A 3ZO9A 3FQXA 2LLGA 2ZYRA 3ZE0E 3D50A 3N42B 2WYHA 5GRUL 3M1BB 1B2WL 5G4MA 5TF1H 4HW6A 5IB1A 2P1YA 3ABZA 1IC0A 3EDKA 4QKXB 7FABL 3FYEB 4H0GA 4Z7NF 2I9LB 5CN3A 1JFHA 4E5XB 2VW7A 3VI3E 4EF3A 5IJCC 5KVFH 1JRHH 1I9RL 2WWKT 3O6FB 2CGZA 2A6IB 5L8LB 2I26N 1BGXL 2ZXAA 4XWOD 2CM6A 5TH2B 3HIZA 1ZSHA 4N0YL 2AV7B 2VDKB 3MV11 2WBXA 4PJAE 4ZTOH 3PQYA 3QZLA 4BA8A 4KKNA 1HXYA 3N1MC 2H6PA 3IGAA 1HEHC 3K2UL 3UTSE 1QBMH 4D0CA 2WVTA 2BFGA 4N2EA 4Y5VC 4ZS7L 5F9DC 2J4WL 2G5BA 3L5WB 3OLIA 4KHTL 4RA0C 3TN0A 1Q9KB 2MEJB 3LEVH 3LN5B 4TRPH 5FLUA 3FN9A 3C60C 1HQRA 2ZUVA 1HSAB 2R9HD 4OGAC 3PU7A 3ILQD 1U8JB 5HHOE 4UT7H 1R33A 3W5MA 1ED3B 5DHVA 2IOIA 3OJDA 4JZJC 4OZGA 4LAQH 5ADPL 1DJSA 5CFHA 4F8TA 2IAAC 4KQ0A 3JV4A 4OZGF 2WTOA 2BNQB 4LHUA 1R5WB 1L9PA 3B5TA 2WB7A 2WXIA 2AMGA 3SZ6A 4GY4A 1GR7A 5C0DA 3TO4C 3MCKA 1NEZG 1MWAL 3SKOB 2A6DA 5DJ2A 2UY6A 5AZ2H 5CBAB 1E6OL 3S34L 4IS6A 4OFYA 4W81A 5HHNA 3VXUD 1UYWL 1XB3A 2WSDA 4C4KO 4BUQA 2K3HA 4PJ6A 3QAZC 6PAZA 1YUHA 3U2SA 3RDTD 1CC3A 3ECUA 3QUYD 5LWYL 4G6FB 3U6XS 4AGPA 3SEPA 1TNNA 4IBZA 3EOTL 3QXVA 2FNBA 1OAKH 4MAUL 3VRJB 1NANH 2WP3O 2HJLB 3SY0A 5T33L 3HS0A 1UURA 4NRZB 2DWDB 2R4SH 1FUNA 1RXLA 4N85A 5J7CC 4XC3L 1GYCA 4QRQA 5JHLL 3EOAB 1T89A 4I3SH 2NXZC 3IPBA 4M6ML 3PV7A 3ZTNH 5HP5A 2WZAA 2VC2L 4KX7A 2MPAL 2PUQT 3RNQB 1E6JL 1FYTB 3SDXE 4I2XA 2ZQKA 3JBG7 4FQXC 5CSZA 1SFDA 2GJ6E 1KB5H 2V3FA 4BBWA 3O4LA 4DGIL 3BISA 2H26B 3T9WA 1PKQA 5I1AB 2EDMA 5IIEA 2GSGB 3ARDD 4JM2A 4PG2C 5EBLB 5TQ2L 3DHMA 3GJFA 4W9FC 4BE6A 1NCDL 3LVTA 5HYSG 3ML9A 1J8HE 4JM2F 1FHNA 3BESR 3EGSB 4TSAH 4UQAA 4C56E 2QPFA 3LNFA 2KZKA 1OQOA 3QHZL 3Q8EA 1KBGL 4LSRL 3WFHA 3MA7A 1T7YA 5D1QA 3QXDB 1EXUA 1F00I 4NZJA 1HT6A 5BXFB 4X8XA 1NMCC 5ID1B 2JSFA 3RI5F 2H7WA 2ZIDA 3EXLA 2CKBH 2H2SC 1IEAA 1JUFA 5EU3A 1CFSA 3RVUD 3OGCA 3U0PA 1OSYA 2DDQH 3OVUB 4X6BA 5KTEL 1RK0A 4EI5B 3S48A 2IOOA 1GZPB 3VSVA 4GBXB 3T8MA 2AJXH 4O2FA 1BM3L 2G4GA 2C3VA 1N6VA 2BP0B 5I1LA 4LCVA 4GQ9H 5KSAD 1CQKA 3SJVB 2XWCA 4AYMC 1X5HA 1H9VA 2F54D 5CO1A 3P9MB 1ZLSL 3RIKA 4BSJA 4Y1AD 3PJSB 5GZOC 4H5SA 4B0MM 3OAZH 4EDWL 1QW9A 3LNDA 3N1GC 3DMMD 3BKYL 3ZQXA 3MJGX 2ZOKB 5H8DA 3FFDA 5F0JB 3L1GA 3LHPH 3PWPA 3G5VB 5EZJA 5CJQL 3UTTA 2IV8A 3L3DB 1QFHA 3NYKA 4F27A 2Y3AA 1HHHB 3AQZA 1CB4A 4E2OA 1RZIB 1PG7L 1I7RA 1NFDE 5EORL 4Z7WE 3DJTA 5DFWH 2QGBA 2HG0A 2EDFA 4HEMA 1YQVH 2NNAA 4F7EB 3QWNA 5DJ0A 2PW1B 5CEZD 4MJHA 4XBPB 5GGRY 2Q7NA 4HJSA 2QGEA 1FG9C 3JV6A 3OLEA 5FOBB 4XXCC 1CU4H 5ICXA 3SDYL 1HCFX 4MLIA 2F58L 15C8L 1D5ZA 2O26U 2Q20A 3MUHL 4F91B 4PJFB 1CE6B 3SDAB 1K2DA 4X7SH 4APQA 4BKLB 3IDGA 3ZHFA 3KS0J 5F9AC 2HRGA 4CVZA 5E5LA 3OR7B 3CIQA 2HFFA 3DDFA 1RIHH 4ZTPL 4NBXB 4W6WB 3DRQA 1YNTB 2HLFD 1ZHLB 2YRPA 5C08D 4KKAC 4A38A 3EJCA 5DZ9A 4ZOEA 3NJGA 2E7LA 3GF8A 4Z3JA 4FA7B 4OLZL 5AAWA 1GC1C 4M56A 1C7TA 4P2OC 5J56B 4M03A 4BKSC 1FP5A 2YOCA 3RY6C 4Z3TA 4JO4L 3QFJB 1MWOA 3IAPA 3KL0A 2JQZA 4I87A 2R0WL 1FJ1A 4PU2A 2V7NA 4PRBB 5GSRA 2D4DA 5D1ZA 4Z76B 1DDTA 1V3KA 3HLKA 3O3UN 5IKCB 2E8YA 3CN1A 3RY4A 3NT0A 5E9AA 1A4CA 3QW9A 1FZMB 2VMFA 4DCQA 3KE0A 1WIOA 5IBUG 1L7IL 4MS8D 4V2BA 4PJ5A 4WCYH 2E27L 1TVBB 4P3WA 3X13A 4XMLH 4KK9D 2PW2B 4ONFL 4ORGB 1I9IL 5SV3A 2R8SH 4OD2B 1QNZL 3UL4A 5I71B 4XCCH 3LQZB 1ERNA 3MR9B 1UQSB 1S7SA 5HVGB 2HWZH 3FCBA 1P7QD 4XNQB 2IANA 1MVUB 1YG9A 3C6SA 1Y1UA 1W72L 1NC2B 3GXUB 3CZLA 1J5HA 1NL0L 1N7MH 4JDVB 4NDMA 5DF0A 1MFEL 4N25A 3BHBB 3SPHA 1FWXA 1DQLH 1FVCA 4E36A 3RFZB 1PCSA 4YMPA 3WJMA 3WY2A 1CICA 1XR8B 4XPBL 1J1OH 2J21A 3H6AA 4R4ND 2NZ1A 2WQVA 5SX4H 3S8FB 1IV8A 4Z7UB 4LPTA 5GGVY 5FUOL 2A9BA 5C0CB 1WFJA 3PWLB 3FULA 4HUCA 4E9XA 3BYYA 1SY6L 3CIAA 2C9PA 2Y7QA 3C08L 5SX5K 5J1SC 3BRFA 4F3FB 5B1KA 4HWBA 4OZFA 4KWUA 4A63A 1GVIA 5K59E 5CUSL 1RFDH 3OC8A 4L3AA 1AG0A 1NEZA 1NCAH 4EQ2A 3ULUH 3N6YA 4ZPVB 4G3YL 2XTLA 2OSYA 2BZDA 3VXMD 1CLOL 3TX4A 3AU1B 5I1KH 3AG1B 3SOBH 3MGOA 5JHDA 4G9FA 1CDGA 1C16B 4RQQB 2IF7A 4NN7B 3RAJH 4A1RA 5ACZB 2C9VA 3FCUB 3ZTEA 2D31A 2X4TA 1NIAA 4P07A 3RU8H 2G75A 4I3GA 3GBEA 3VFTA 4AQOA 1UZ6E 1OHZA 1ZLUK 2W8CA 1LE9B 3IMBA 1EEUA 3HI1A 4ODHH 1KPRA 1UASA 2AERT 1G7IA 2UX6A 2VOTA 4PRNB 2F6AA 3D5OF 3KPQB 4QPEA 2DKMA 3IXAB 3RHWK 4CKVX 4PHXA 2VLRD 3LPWA 3NEXA 1MNNA 4L8SC 4TQIA 4LCWD 5CZVL 4HKJA 2R1XB 3VFWB 5EBWA 2LW3A 4XNUL 3SDCD 1C08A 1TR7A 5K5YA 2OL3A 2DQGL 4HF5H 4RSYA 4AW4A 1DO6A 1DUYB 1C5CH 2R23B 1T22A 3UC0L 1ORQA 4Y2DB 4CDGC 1QUNA 3MV7B 1J10A 3NIFE 2XLLA 2J2ZA 1UD8A 5GGUB 1T5XB 5T1LD 3AM8A 4UAOC 1NCNA 4MQ7B 4QRRD 3AS1A 4AVIA 2JQMA 1OXYA 1KJ3L 4PGZA 2UUDK 1HHIA 2HSIA 3TURA 2GIMA 2WINA 4YX2H 1E8ZA 5JW5A 1S7UA 3BPNB 4OLXL 2B2XL 4FG0A 1G1CA 3DETC 2CJTA 1KC5H 1E0OB 2FTAA 2IPKA 3QUMH 3RB5A 4BFFA 1I8AA 5IQMA 4NHCH 3SPJA 1IZKA 5KSVB 4FX5A 3SPVB 5A16A 5HYSB 4HV8A 2O5NA 5FGCE 3GSXA 5ETUA 4UILL 4DKTA 5I30L 4K94H 2ODIA 2P4AB 1R3LA 3NSJA 5FUZL 4I77H 3SDDC 4NQXA 3IDUA 1KT2A 5AKVA 5GXBB 3STZA 5CM1A 1DBBL 1URLA 2PYFB 5L4JA 3L4CA 1VGKA 1ZMYA 3CFMA 3LEYH 4B96A 3WIHH 4HVBA 4FG6D 4JG5A 3WNMA 1FN4B 4C4UA 1XTLA 2X05A 3WFCL 4N2BA 2EUZA 4EXPX 1EZSA 3MKKA 4FQLH 1MLBB 1UC6A 1GPOL 4LP8A 1OY3B 3KPLA 4UDTA 1AHWB 3F62A 4KTDL 5F7YC 2X6UA 1GW6A 1S9XA 2H1PL 2I5YH 1ZEAL 4P3CL 5ENWB 4OI7A 1YEHH 1X3DA 3KPPA 3CZSA 1TJGL 1WCQA 4P46A 3WN5B 5D1XD 2C7UA 2PCXA 4CGUB 5IJVA 1TVHB 3CN4A 2B20A 2ITDB 4HXBH 3L54A 1T0NB 3L4ZA 4WNQB 1JBJA 2VLLB 4XOAA 3VXQB 4FTVE 1QZNA 2WVVA 4GAAA 2EE2A 5D70L 1DEDA 3FU0A 1N2RA 3MROB 3MN8A 4O9HL 3W82A 1BXUA 1KB3A 1A7RH 1Q72H 4XO3A 5FW8A 4YDMA 1OSPL 3OJMB 1EFXB 1P4LB 1MSPA 1PGRB 1NMBL 5LXGL 5FA4B 4EJ1C 4NIYE 1TJMA 3KLLA 5DJZB 4PRHB 1YMMA 4N0CD 5EDSA 3S37X 5J0BA 1HZHL 3GJEB 1U3HD 1FQ9C 2Y69B 4KNSA 4N5ED 1OE1A 4N90D 4DP8X 3GGWB 2JI3A 3HG1E 3ZL1A 3O6LL 4XODA 3EF4A 4KXDA 5CJBA 5MEOA 1YNKH 1XCQA 1A0QL 3EJYC 4HOXA 1NJ9A 7PCYA 3IU4H 3ULSB 3LCYA 4I7ZC 4FQHB 2DIAA 5GZNA 1SXNA 1NDGB 3C5ZD 1ZRUA 4ODXA 4R3SB 2OW7A 3JWOL 5CJOL 4WEBH 1KDIA 2B0SL 2D3JA 3CVHB 3GLAA 3O3DB 3OB8A 3W9EB 5JR1H 1R6VA 2ICES 4HBCL 5FM5M 2EYSB 1F11B 3RIFF 5HYQA 1MI5E 3NIGE 4ETYA 1BZDA 1KB5A 3IWVA 1UD5A 2XVKA 4OTXL 1QW8A 2IO5A 3G04A 3L3IA 1S5HB 3BD4A 5DD6A 4KBPA 2K7PA 1U91B 4NQUA 2J44A 4IU3B 5HHOB 3RWJA 1ZD6A 5I8OH 2Y7SA 3N1FC 4BFIB 2AK4A 5KSBE 3G7TA 4PBVC 3CFNA 1GIGL 2JKXA 4MB1A 1I8KA 3D1MC 1A21A 2HVJB 4DVBB 3C9NB 5IBLC 5IGXL 5I1HL 4G42B 3D85A 4K73A 4X83A 4W9EC 3VD1A 4HQQH 2BOCB 3QDMA 4P3DB 4B3EA 4P5TD 5GGQL 3TBTB 1E5UI 1FF5A 3QK0A 1OSZB 1I85C 4IRZH 3WDJA 2CKBA 1GY1A 5CCKL 3CG8A 4RGOH 1IBGL 3I85A 1UKSA 4BCZA 5CCGE 4ZZFA 5FYKL 1BBDH 1B0IA 3BVVA 5T1KB 5IV2B 1DANU 4ZNEA 4Z0BH 3T4YA 4AM0B 4PJ7F 2LAAA 5L0QC 4X5RA 4XN2A 1YEDA 4TUJA 4IOIB 4HJGB 3P3UA 3VWJD 3TA4D 1EANA 4O02H 1IGFH 4ABVA 2FX9L 3FO1B 5FKPA 5FR3A 2I69A 3DIFA 5DEJA 1UUNA 5ERWB 5JDSA 4ZMQA 3WTSA 1TUPA 1N12A 2BVUA 1G7MA 3GEWB 3UGEA 4JKPH 1YEJL 4L29B 3EOYG 4Q6IC 3S97C 5FIEA 3BWSA 3QPXH 2XI9A 3S5LG 1OGTA 3RURA 1D6VL 1SOQA 1P5UC 2P8MA 1KNOA 1Y7VA 3GHEH 4I89A 2W07A 1D5XB 1UM4H 2GJ6B 3US1A 4ZO9A 3FO0H 3PNWB 3RVTC 5F7EL 2DY2A 1ZLUH 4JS7A 1M1XB 2RJMA 3WIIL 5C2UB 4U1JA 3BSHA 2QZ5A 1MRFL 1TQBB 3ATFA 4Y4FC 2NZ9D 3L2NA 1F3JB 4C56B 4P2QA 2FE0A 4Q9QL 5CP3H 2K0RA 3HG2A 4IRSD 3WIAA 1X5LA 4TKWA 1D3CA 1EJOH 4WI7A 3WD5L 1UB5A 2ADYA 3CUPB 1ZGLB 4W4OA 3GMMB 3GXIA 6FABH 1J5IA 5CU9A 2DQCH 3TBSA 3BW9B 4MMZC 5M95B 4QOKE 1MIEH 2J6WA 1ZHBA 2MOQA 5CNHA 4JGUA 5B38G 4HUVA 2XQBH 3H9HA 5A2KH 4U33A 3DGGA 2DM3A 5SWZD 2F1AA 5DURD 4FTDA 4HKXA 4XZUB 2GAZA 2B3IA 2PO6D 4Z3FA 2DB8A 1D6EB 5BO1L 2KUTA 3U25A 1PYWA 4UM8B 2CGYA 4A2HA 4RMBA 4YDLB 4OIBA 1U8IB 5C07A 4F57H 2ISDA 5EO9B 2EXSA 1NMAL 3PGFH 3MU3A 4YBLC 2UUDH 3HNSL 25C8L 3HB3D 4G8AC 3TP4A 1NA8A 3WEBA 3D25B 5D4QA 2FEJA 4OU3A 5CD5D 1MCIA 1SUJA 3HOGA 4DPAX 4PJ9B 4HPHA 5C0BE 4FZ8L 4S2SB 1BF8A 4XX1G 2K9UA 4X8JA 4P06A 1BWMA 4QYOB 1DVTA 3F64A 4ALAC 1U93B 1U8LB 3DTUB 2QQLL 1A6TA 2DWEB 3Q1EA 1MDTA 3RTQD 4N5UA 4K5MA 1NFDB 4FXGA 2VRQA 4LEBA 5J9PA 2EECA 2QKIC 3VXSE 2WMPA 3QIWA 1EXHA 4UZGA 3ME0B 3FT0A 4YXKH 3UERA 1KJVA 4UBDC 4YSCA 3L16A 4M29A 3DSFL 5F6IC 3QG6A 2WWNA 2TSAA 2XPYA 1NKOA 2Y5TB 4AKOA 1UVQA 5EU5A 4YXHH 5L7XH 3U48A 2EVJA 4M7ZB 5AZUA 5BV7L 1F90L 4M93B 4GS7C 2B5IB 3TT1L 1BQRA 4R4FL 3D39E 4OSUH 1OW0A 1UD6A 3P30L 3P73A 4E42B 3H7BA 1JGDA 4OT1L 2IALA 5DT1H 5ESVB 3KWWB 1DJGA 1WLHA 5AEAA 3MBEB 3ISWA 3SGDI 2EJ1A 3PWUB 3T0EE 4DGYL 1ADQH 1P5VB 5JW3H 4NP4L 3AMLA 1UACL 4MQSB 4X2UA 5C6WH 4NFBA 2YPLE 3CQPA 1VPOL 2O61A 4ZODA 3V9CA 3LX9A 3FKUS 3PJLA 3GMRA 4EDXB 3ZKMD 5B4MD 3D3VA 3G6AB 1UFGA 1JGUH 1NPUA 2EDNA 5D7KE 1IVLA 1A7QH 1RK1A 3WEXB 4TVPD 4UQ2A 1BVOA 1XGPB 4X8CA 4Y16A 1JZGA 4WU5B 3O41B 2WHVA 1BW8A 1DUZA 2Y72A 3QIUD 2O93L 1KXVC 3IBEA 5C09D 2ARWA 2VDKL 4OLUH 3FU6A 4WV1B 3ULUF 4JHVA 4OZ4B 5DFVC 2F7IA 3GLDA 1KV3A 3OQRA 1Q1JL 1RPUA 1E40A 4NJ9H 3ELQA 3Q01A 4FCHA 5KVGL 3G3LA 3DX9B 4FD0A 1ZT7B 5DJ8A 1SXBA 2CDEB 2N01B 3AWGA 3FTXA 4NQDA 2DL9A 4Z7QF 3FRUB 2OAAA 5DYOA 1WC7A 3LKPA 4KI5D 4HIJA 5DWUL 4HJEA 4DN4H 3GBDA 5EOTA 4FQPA 3DX8B 2VDLB 3EG9B 4FNLL 5CEXB 1R3KA 3ML8A 1YJDH 2X4NA 4I0PB 1JF5A 4P4KB 5EPMA 3FT9A 3WMPA 4JX0A 2GEEA 3PV6B 4BFRA 3BDXA 1R5VA 4FI6A 3S35H 4EN3A 2QADD 5CILH 3DOHA 3H2QA 3SGKA 1P4UA 3V8OA 1SF5A 3ZL4H 2VISB 1TZ8A 1E9PB 4O4YH 1IBFA 1MHPL 5TE6H 2VDMB 1GJUA 1Z32X 3T3MF 4RAUA 3O2WH 3VI4E 1EO7A 1CXLA 1MFDL 5EO1B 3QR2A 1K72A 1FH5H 1ZS2A 4MD5B 4OH2A 1Y0LB 1CLYL 2X41A 2G2RA 4DKAA 2CIIB 5D96B 3V4PL 3I6KB 3PWNB 4G9DB 1C5DB 5FO8A 4JNXA 3CFCL 4Q2ZB 4HS6B 3GZKA 2AAVA 2E75C 1S4IA 4XE0A 1AZNA 5IUCA 4XNAA 2IVFC 4NKQB 3HFML 2X6AA 3PDOB 2X4RA 3QUMA 5HYJE 3TZVA 1BX2B 1A4JA 1F97A 1N0XH 5B7MA 5C0NC 2AJSL 2JV6A 1SVBA 1AD9B 1FL6B 4HKZA 1JK8A 1HIMH 1ZTXH 3ASOB 1KTBA 4ODWB 4YHNB 1VFAB 2RH0A 4K9EH 2H4EA 2YGOA 2VR6A 1ES0B 4LVOC 4WEMB 5EO0A 4JFHD 2ENJA 3BDBA 2J56A 3ARBC 4HJJL 2H2PD 3MKGA 1ILUA 2GUOA 1R34A 5FHAL 4ZD3L 4Z7NE 4X98A 1LO4H 4GW1A 3STLA 5GGVL 1TTRA 2VZUA 3VQ1C 1Q9OA 1A6PA 4GIOA 1EZLA 1JVLA 4LEXH 3REWA 3WIHA 1ZS8A 4ONHA 2V17H 3K4ZA 4YHLH 2C1PA 1A4BA 2HA1A 4PVBA 3VXUA 4N1HB 3VFOB 4F7PA 3KNBB 3P1VA 1V27A 2B1AL 3QCTL 1JPSH 5SWSA 4BH7B 4R96B 2WBJD 1LWRA 4HHWA 3STBA 5K9QG 3ZSSA 4YLCA 1Z7JA 1WBXA 3FTGB 3PQYE 3G5YB 3F7KA 5GRVL 4NZUH 2F19L 3HC2A 5IK3A 5EEZA 1UWGH 1LDSA 5DJYB 1JVOA 4L8SA 3BAYA 3VMNA 4XI5D 2P7TB 4YHOL 3B8SA 2KZ1B 4JFQB 1RVFL 4GKZB 4B6ZA 3AXLB 1INEL 2PYED 5DJAA 4XP5L 4HUXB 3S5LB 3KJ4C 5C97A 1I1CA 2F7RA 1R46A 2HH0L 3FCSB 1D2PA 3VMPA 4Z3IA 4J1UB 3QUYB 4NC1C 4GSDH 3BQUB 4OZGE 1L6ZA 3PAYA 1QFUL 1ZGLM 5B38A 4NQVA 1N3NB 5CS7A 1JGLL 1F8TH 4ZXBD 1M3JA 2CXGA 4G2AA 3HUJB 5D55A 3LV3B 2P8PA 4G8GD 5FGCB 4XCEA 4X6CB 4CBZA 4MDRA 3TF4A 2VZ3A 1AZBA 2EKJA 2FJFA 4YHPB 2CU9A 1TKWB 1XH3B 2CO4A 2N3JA 3BZFB 3UJJL 3FTWA 3P3RA 2X2IA 1M9SA 1MFAL 2N59A 2IPUG 5HVHB 3P9LB 1MDAA 3BVXA 1MHCB 1JZ5A 3WUWB 3DK0A 2ATKA 3FRPA 3D34A 3QO1A 5LNDA 1KWKA 2HMID 3QXWA 2V2TA 3EFOB 3DWTA 4J7RA 4HXAH 4JG0L 4U0RC 4KXZH 4LCIL 4U4BA 3W5NA 2HTKD 5ECJE 3SDDA 4WJ5A 3KYMA 4HK0B 5FW7A 2EDLA 3FTVA 1BXXA 4J3VA 1E50A 4YLBA 3MPCA 4F15B 3EW3B 5E5MB 5DK2B 4Y5YA 3D0VA 2YGVA 3VWKD 2MRYA 5KSAA 2HJKB 5D5MA 1KCRH 2ZCKH 1T2JA 2Z8VC 3O4LE 1OF2B 1TVDA 1ZPUA 2DMKA 2X3AA 5D5MF 1DJZA 4XXWA 2VIRB 3PPSA 2OS7A 1YEKH 4ODTH 1I1YA 1F3RB 1XL6A 5C3LD 1QPPA 4F7KA 2YD0A 5IT2L 3S5ZA 2Z8SA 4KVCH 3C6LA 5HDWA 3BE1L 4TTDD 4DN3H 1TO4A 4IRZA 2VDRB 4XPGL 1HWGB 5ANMA 1CJYA 3EDDA 3GIZL 1KIQB 2HPTA 5KN5B 4K5OA 1TQCB 2CLVA 3VFSB 2Y06L 2Z3FA 1V55B 2WLMA 3MLRL 5EF0A 3UTZB 4Z77B 3FSWA 12E8H 4MJ6A 4QUOA 5D1QE 5FYJL 1W91A 1PJWA 3ETBJ 3V4VB 4F2EA 1G9MH 3KPTA 4JN1H 2A1WH 3HG1B 2F54B 5DO2D 3CZUB 3IT8D 4J4PC 4WK2B 2DQUL 3P4LA 2G60H 5E7BA 5E8OA 2NXYC 1XF4B 2YBRA 4HKBA 4NO2B 4O02A 4UUJA 3BP5B 3IMUA 3DO7A 4KNUA 1TPXC 5D6CB 1BQUA 1OZTG 4R0LC 4RIRA 4N8VG 5G5DB 3R8BB 2UY7B 5AUMB 3IJ7A 3VYNA 3FB7A 4L4JA 4HDIA 3U6RA 1B2YA 3BSGA 3NIGB 2Q9OA 3OPZL 3MRHA 2Z6FA 5BW7A 4D9RE 1KBVA 4JJ5A 2UZYB 4ETQA 4UF7C 2O6DA 1AGEA 2QSVA 4OKVB 3JT0A 3A67L 4KUCF 5KSBB 4M61A 1P7HL 3OAUL 3Q8FA 2LFEA 4XVTH 2CXKA 3FSZA 5CP3A 3RWFB 1OM3L 3SKMB 5JOFA 2X1OA 4FNUA 4J8QA 2OPCA 1EDQA 3TWCH 1IAIL 5J1TC 4IMLA 2IOMA 3WY4A 3ZMEA 1GGUA 5A2CA 2APFA 4WI0A 3BGAA 2IBBA 1WV7T 2DAVA 3MV8D 4HEME 3HFFA 4ONGL 1I3RB 1RZFL 5FECB 5KSUA 4XMWA 4BH8B 3LEXB 1GGCH 3KPMB 3S96A 5HDQH 4RFOH 1NLDL 5MERA 2JB5H 2ZPKL 1ZOXA 4MLSA 2CO1A 2QSCH 1T3FB 3L1FA 5BUAA 1E4KA 4FOMA 2WLNA 3GM8A 2D3LA 3TASA 3ABKB 3B2UC 2Y23A 5BVJB 2W95A 4M5YH 5LGYA 1RUQL 4WGVB 4R5TA 1I1RA 4MQTB 3D52A 4OLYL 5I6PA 1Q9WB 5IHLB 5FM8A 1LWJA 3BUQA 5IEHB 3C60D 3RWEB 3T0VA 3IGUA 3T0AA 2PN5A 4OGAD 1SM3L 1U95A 2CGRH 1RP9A 3BPOB 3O9WA 5FDYA 2HRPL 5A2LH 4ZJ9A 1MHEB 5C86A 4Q7DA 4JY4A 1IC4H 1KLUB 5TE7H 2EEBA 4E41A 4HCIA 4X7DC 1Z1WA 1X5XA 3I2CL 2WQ8A 4HFUL 4APXB 1SRDA 3TO4D 5INDB 5DEGB 3VM7A 1XD0A 3AVEA 1ZK5A 5AYTA 2BSSA 3EYOA 4NKIL 1O6VA 5ICYB 3F5WB 1BPLB 5JPMB 4XPTH 1U42A 2FX7L 3QRFM 3V5KA 3A4FA 3ARYA 1USZA 3Q2NA 4R7DA 1F3DJ 5CU5A 2ATAA 1FSKC 5DK0B 2KKQA 1KG0B 4KKPA 4NN6C 5F89A 4CNIB 2GKIA 3FQTA 5I76A 4QOKB 4JPIA 2BH0A 2VH5L 4PJ5E 4Y19D 2BMKB 1U8HB 1EAPB 1UJ3C 3IJSB 4FLQA 4RRPA 4FYRA 3EYSL 1OGAD 4YXLH 1P6AB 1R5IA 1I9EA 4HLEA 2NXZD 5L4FA 3B4NA 1DLFL 3GSVB 4GSUA 2VXVH 3T0DA 5E95B 3FAXA 4PR5A 1ADQA 2QMJA 4WFGD 5HGGS 4HAKA 3I50H 4LSTH 4KKQA 1SMAA 2IANE 2R83A 3TA3D 4FQXD 3ZKXC 4OM1H 3BN3B 4JY5H 5T3XL 3HTLX 1BQSA 5HPMB 3UTQA 3IDMA 3VD2A 4JRYD 3ASWA 2XWXA 1WD8A 4LLDA 4D0BA 3ARGB 3REVB 3VXMB 3WNKA 4PVNA 5EEWA 4F7TB 3GD1C 1X7TA 2QVFB 2XN2A 1N5AB 4FP8H 2XZAL 3QORB 3KM1A 2N1KA 1M56B 2K4WA 3FQUA 2N7AA 1OANA 3LKSA 4LVHB 3C5SA 2PF6A 4BFBD 4D8PA 4P57A 3DX3A 4J23A 4PS4L 1WZKA 2H2SD 4OI9A 2YA2A 2B14A 3QQ3B 5KEZA 5JZ7D 2ICWB 5DD3L 4XR8C 3KYOA 4LCWB 3VXTA 1BYNA 5JHDE 1NPNA 1LMIA 3E80A 4G9FE 1KYOJ 3MOAH 4H8QA 3B9KD 3SDCB 5F44A 2UZPA 2K1MA 4L8BA 5DZPA 2A4ZA 2EZ0C 1YY8B 5EN2A 3D39B 3MLVL 4L4VA 2XG4B 3FMGL 4NKDA 3W38A 4UIKL 3KH4A 2XN9D 5EHFA 5B1JA 3ZZQA 1YRKA 4KROB 4M5SA 5GZOD 4QXGH 5T1LB 3EO0B 4BWUA 1ACYH 4CVUA 5TDOB 1MRDH 2YPLB 3RQ3A 1IAKA 1JN6B 2XX1A 3W2DH 4AXWB 3FT4B 4M3JA 1EPFA 3PGCA 1V7MH 1NCHA 1IKNC 1QLRB 4ZFFA 1INDH 1UOKA 2EH7L 4LMQI 5F9WB 4CADB 3IEAA 1JNNH 3GSWB 1WZLA 4K4KA 1TZGH 3NPSC 4PRPD 2Q8BL 4Z0XA 3U0TA 2WNXA 2YFOA 1CD9B 3AY4A 1Y18A 1FFNB 2ZUSA 3HW7A 4MRCA 5JQ6L 3OSKA 1WCBB 4AJVA 1SLWA 1IEHA 1CQYA 2GW5A 2F8XC 1H6EA 4C83A 1MFMA 2Q8AH 1WZ1L 1E4WL 1E2VA 2LTQB 2XIBA 2ZX7A 4KQ4H 4PJIA 3KLKA 3RDJA 4JFYA 1MCNA 4X0KA 3NRFA 4PJIF 4QRPD 2L7QA 3JWOC 3QWRD 4XRCB 1QBAA 1JYNA 1IGTB 4NNYB 5ID0A 3O2DH 3QCUH 5F1NB 5K93A 4FHJA 3ZXAC 1NGWA 4F2MA 4KKAD 4WI3A 4PTUA 3IDNA 3QQDA 2IAMC 1MEXL 4IBYA 2V9RA 3V5HA 5B3JF 1S2EA 5TTRA 5ELIA 3FQ4A 1X44A 2OP4H 2VQ4A 5KVFE 4R6UA 4Y4KA 5E8DL 3DUSB 2J3SA 3T2PA 1DVUA 3ARPA 3CZGA 4NQQA 2BSCA 2DTSA 5CLWA 2BIQA 3V6OC 1HHKB 1YZZA 2MNJB 4HFWB 1T1ZA 4HISA 4QEGA 5BMFH 4HIIA 1AXSA 3HJEA 1U3HA 4YHIA 1IBYA 1J5OL 3OTTA 3VI4B 4KMQA 4FQ1H 4FFTA 1BAWA 2ZOTA 1KGYE 1VAHA 4ES8A 4MA1C 4GT7A 3MGTA 3ZVVA 4IIQA 4A2DA 1A14H 1XL4A 1ND0B 4EI6B 2CR3A 3WNIA 2RQ8A 2NMSA 4HS3B 4ZMWA 2G3NA 3P4NA 3C5ZA 1R19A 2YK1L 1HKFA 1H5BB 3C8KB 3SZKC 2XYCA 5KBPA 5L2KD 4Q0XH 2WSKA 4G8FA 3GI9L 2AJYH 4WW2B 4K71C 3QT2A 1I9JH 5HYJB 3I6LD 1ZCRA 1CDYA 1RUAL 5IR1B 3EIFA 3KVDD 1VGEL 3FQXB 3V4LA 1AR1C 3QJQB 4RGNC 1PD0A 3H8NA 2FEEL 4IKLA 5KS9E 3U0WH 1TCMA 4K3JH 1U9KA 3SBRA 2FB4H 4IDJH 5IB1B 1N59B 2EC9T 2FJHB 3S37H 3PL6C 1XF1A 2HTLC 4OJFL 3OXRB 2ZICA 5DWPA 2KT6A 3KYNA 3I3DA 2DEXX 1BFOB 2B59A 1JV2B 4TQEL 2Y36H 3VXRA 2YKLH 4PWKA 3BUBA 2MKWA 3GZQA 5T3ZD 4YDZA 4AQEB 1OAQH 5HHVL 4YDIH 4XPAL 2ORBL 1TITA 3AACA 5E5RB 1K5NA 3K71A 3M6DA 2YLHA 4P99A 4PSPA 4I18C 2H6PB 2OW6A 3IGAB 2WIMA 2X4PA 4MXVF 4D0CB 1Y6NR 2RCSL 4X9FA 5AB1A 3K8KA 3QQ9C 3PIQB 4NKMB 4R7NB 1QTSA 2LU7A 1QSED 1RUML 2CM5A 5C0JB 4IU2A 4D7BA 2C7FA 3C5JB 5EIVA 1RHFA 4V2CB 3IGLA 2AK4E 1F4WH 3BN9C 3OJDB 1I8LA 3UYRH 5LGHL 1D9KC 5C3IA 4CU6A 1A25A 1OSEA 2O30A 5DVOA 5CD3A 1G7HA 4HOWA 4ATWA 6TAAA 2UVEA 3IF1A 4OGXL 3TVMC 3ZQWA 4S11A 4EVNB 1NPJA 2CDFA 1B4JL 4I3RL 2WOBA 4XOEA 2A6KA 3VWJB 2R0ZL 2EACA 2A6DB 1KOAA 3QDME 1UB6A 4HHAA 3PWJA 3L9RA 3U1SL 4D9LL 3R06A 4IS6B 5I1JH 3GKWH 3WFBL 2D7NA 3MRPA 1SXZA 3LRSA 1S5IL 1L7TL 2KYIA 2Z31C 3L45A 4GG6A 2XUWA 3T04D 3U2SB 3N1QC 4UQIM 1F2QA 1MVYA 4NO5B 4ZNCD 3C8DA 1YEGL 3QJTB 3GEFA 2F7QA 1ZHNA 4HCRL 4ZNEE 1HI6B 3RPIA 5CZXD 2B4CC 4LKCA 1DVZA 4LCCA 1U3JA 1PX3A 2W60B 3HS0B 3SY0B 3IE9A 4KZDH 5LKNA 5E1AB 2KLRA 5C8JB 1S7WA 1T1YA 4QRQB 5J3HC 1RLWA 4WSKA 2PO6A 5GS0L 2HVKA 1J0KA 4MCYB 3VDAA 4GFTB 4IRSB 3NA9L 2XY1A 1IB5A 4GRMA 2VGLM 3ROLB 5BV7C 1RIVH 5E70A 4LSQL 2FWUA 3EDJA 5K1VA 2H3NA 1CLZH 1QO3B 3L6FB 4RAHA 4HUWA 2X87A 5CSZB 1OAYL 1JZ6A 2KBGA 3O4LB 5BQ7B 1KIPA 4KQ3H 5SWQA 4J2XA 2XOTA 1IBDA 4N28A 1OTSC 4L1DA 1LGVA 1ZGLP 1TZIA 1LO0L 1UM5H 5SWZB 5DURB 2V3EA 3EYFA 4KV5F 4DP7X 4QIRA 1U92B 2EIMB 1WA2X 2YKKA 3RTQA 2CLZA 2CO3A 4Q9RL 5M94B 4PIRF 1J05A 3WFHB 3ARRA 3FOMA 5K33A 2ID5A 2OLDA 5D1QB 1KCUH 2AZAA 3II2A 2NY6C 2ZAHA 1G6RB 4K0OA 5J4MA 1EHKB 4BM7A 2YAEA 5MEND 3QAQA 5I0VA 5JYMA 3F05A 1Z3GL 1IEAB 1JUFB 2Y9RT 1EAOA 1NWOA 2AVFA 4LSDA 5IW6B 5K9QI 2P5WB 3PGDB 4IGBD 4J3XA 5IESH 1I31A 1CDJA 2GQHA 2PPFA 4UM9A 3O45A 1RK0B 1EERB 3AGVA 4Y5XB 5HYFA 2IDTA 1U33A 3HBQA 4Y8AA 4WWID 4G5ZL 3IGFA 2J1KA 3T8VA 3VFUA 1CDBA 1TZOA 2C3HA 4KUZL 1XGYL 2WUCL 3VH8G 4UI2A 4GH7B 4M6NH 5C07E 1IC1A 3QH3B 3RG1C 2OQJB 2F53A 3BGFB 1XQ4A 3QZWA 4IOSA 1MFCH 4P2RD 5IFAL 1ROCA 2X44D 3VVWA 3FW6A 3CFBB 3FOLA 4OIIL 1NGPL 1OE3A 4G6JH 3FUHA 3X12A 4ZX3A 3FFDB 4W93A 5LN4A 2VQUA 1T6VN 2NY4C 2DQEL 4Q6KA 3APFA 5I8KL 5LAXA 2G3MA 5C0EA 5FF6A 2YQ3A 5B22A 3KYKL 4IYKA 2M8XA 2VABB 3JYCA 1XGRA 2BCMA 2O5ZH 5DJ0B 1NUGA 4JO1L 3BFQG 3EJYD 3SE9L 5LLIC 2D3VA 2DYRB 4B97A 1K4DA 4NM8H 1UH3A 5ICXB 2P26A 1WAEA 1WFUA 4KPHH 4QHNA 3WGUB 2VXSL 4JFDE 1XGTB 4N20A 2PPDA 3MLUH 4LVNB 2YPVH 5CHNB 3QIBA 3LZQA 1K2DB 3NJLA 3F01A 1T7XA 4HYTB 2NZIA 5GJTH 5GSVA 5DC9B 3WNNA 2AZUA 3DO4A 1MCPH 1WS7A 4RETB 2NT1A 4CSSA 4CVZB 1CLVA 1LMKA 3BZEB 4FL4C 2HFFB 4GYBA 3GSRA 5I24A 3DRQB 4U3HA 4B9ZA 4CC4A 3L81A 3QIUB 3BO8A 1K6QL 3SYQA 2WPGA 4OZIA 4TPRH 2D03H 2HB0A 2IWKA 5C09B 1JDDA 3L7FB 1AOHA 3Q44A 4DNLA 4OZIF 2EVHA 4M43H 1NUDA 3FSOA 2W59A 5HHXL 4BXVA 4G5AA 5IBLD 2WXRA 5E4AA 1HCZA 1CTMA 4LOVA 3D3VE 1XTMA 4MNQD 5I1GL 2YEZA 3LZLA 3FT3B 5DI8A 4ZDHA 4C55A 1VFBB 4K23L 4NQCD 2J6EL 4J5VA 3TIDB 1E8WA 4XXDA 2BC4A 2Z1KA 5D1ZB 5DHMC 3ULUE 4M7JH 4ZMZA 1TF4A 3MMEB 4TYUA 4N8UA 4OJAA 1K3IA 5DRNA 4OLWL 2BP8A 4JHAL 4M8RA 4OFIA 5DVNA 1DN0A 2Q3XA 5T1JA 3H42L 3OKMA 5GRJL 4PJ5B 4GXUM 3PP3K 1WWCA 4WTZA 4ZFGL 4U6VH 4NQDE 1B9ZA 3ESVF 4GRWE 4OB5H 4WGKA 3VD4A 1YCSA 4JHWH 1OT2A 5I73B 3MBXL 43C9A 4GBXC 1DBKH 4LDCA 1H15A 2IANB 2BSBA 4OJEH 1MFBH 4JQIH 1WUNT 5GS2H 2H32H 3RVTD 1INQB 3ZGHA 1DE4A 3CLFL 5I1EH 3T3ME 5DHYA 4Y4FD 3ESPA 1XF5A 4W9DC 3K5RA 3UBXG 2IV9A 3WS3A 4ZX6A 4FEIA 2JCWA 2COQA 4XMPH 4U1KA 4U4IA 1DBAL 3NP3A 4DQAA 3KM2A 1SBSH 4WWKC 4ZW5A 2HN7A 4PWHA 2WKLA 1ZANH 3NRPA 1W16A 4JCWA 5HVFB 4L8CA 2HG5A 4OZFB 2VWEE 4LIQE 3D07A 1GGYA 1NGZB 5F2FA 4G83A 3TV3H 4GRLD 2N7BA 2FJUB 3O2DA 5E24E 1U8QA 1U58A 5CINL 1AKJD 3VXOB 1QKZH 4TSCH 4G9FB 2X12A 5JHDB 4TL5A 4CW1B 4YPGA 4Y4HD 3O2VH 2X4TB 1T20B 2G75B 3VFTB 2GFBA 2WBJB 1S9WB 1WAAA 2VERA 5EUKA 4ODBD 2B08A 4UOQA 1KPRB 5DZLA 2W1NA 1WAAF 4NC0B 4MJID 2DD8H 4U31A 2MCG1 2YGNA 4LSSH 3TFBA 2OR7A 3RZWA 4QTIH 4M1DH 1XGZA 5E4IA 2DQDH 1NDTA 2IG2L 4K7PL 3FQNA 4AZ8B 3KGSA 1G7PA 2PYEB 3AS0A 1LEIA 3HG4A 3GO1H 3N1PC 2VITB 2PXYC 5HHME 1HC1A 5SWSE 1EDYA 4IEFA 2BJMH 2GJZA 2R7EB 3OKOA 1Z5LA 5HGBA 3KWXA 3OD3A 1ORQB 1AJ7L 1TSHA 3DBXA 5D72L 3NK4A 1KGIA 4JG1L 4J3SA 3FTYA 4UBDD 4WFFE 3R1GH 1LLAA 3TFKC 1X5MA 1EAQA 3QULB 3GDCA 4LPYA 5JIPA 2Z92B 2CK0H 4IW4C 4EN2A 2WZ6A 5GRWA 2FGWH 1O7SA 2OXHA 2XFXA 3EJTA 3U9UB 2WINB 2WNWA 4R84A 4UANA 4E0RA 3IDYB 2CG9X 1EQWA 3CHPA 4BINA 2VDPB 5AVWB 2CKNA 2HKHH 1OALA 1YDPA 2ADJA 2KZBA 3P0VL 5DTFA 3NTCL 5GS1B 5TK2A 2XY2A 3U1PA 1THCA 3V95A 4IMKA 4CDHA 2KLSA 1Q94A 4LPWA 2B9AA 4GEIA 1T04B 1IFHH 1NQBA 1T21A 3HRZC 3I3EA 5A16B 4YO0B 4UTAH 5LGJA 1G0XA 4ELMF 3HMWH 4WHTA 2YS4A 4WRLA 2BFVH 1KJ2H 3VH8A 1KT2B 1P4IH 1U8CB 2E4FA 4OUUB 2VLJD 1VGKB 3F7YA 3GB7B 1T1WA 4WU7A 3VWKB 1ZT4A 3QS3A 4PFEA 4V1DD 4Y8DC 1NIDA 1MW1A 1JHTB 5JNYA 4WI9A 5LB1A 4XE5B 3QUHA 4NOBA 4YUEH 2W0LA 4KGLA 2VZ1A 5IB3B 2CNZA 1JZJA 4XX1E 1ZLDA 2F9BT 3MV9D 5DFVD 4UDTB 4AIZA 3QA3A 1AE6L 1JZ2A 2C9UA 1S9XB 1P7BA 2P42B 2EE0A 3I9PA 2HVBA 4M1GL 4P46B 3B7YA 2UZXB 2AK1L 1CGVA 3WHE1 5IJVB 1YSOA 5L2JB 3T6QC 4DK3A 5BS0D 1AMXA 5LBGA 3EGDA 1RK7A 2D9CA 5FGBC 2EKSA 5CSGA 5JLZA 4IJ3B 3CHXA 4HT1H 1QEWA 1EHXA 5D5ME 5DSCA 3FQRA 4FG2A 1AGDA 5IG7A 1VENA 4QRFA 3S36L 1B6UA 3HVDA 1NAMB 2APWA 2OULB 2WLYA 3DXAD 2JJTC 4PRID 4DFIA 5KS9B 3P3YA 2VM4A 4JM4H 4PAZA 3U9PH 4MA8H 1J18A 3B7RL 1BFVL 4AQ1A 3GBNL 3TESA 4PM1A 3QSKB 4XN5A 4RZCB 2E9IA 4Y7OC 3RVXC 5ANME 1X4XA 2WN3A 1P4BL 4KVNH 1LM8V 2O5YL 5DHXB 2YQBA 3UIYA 4N2DA 2F2HA 2P5PA 3LAFA 2A9ML 1T80A 3BSZL 4JQVA 2H8PA 5I1CL 3AQYA 4MD0A 1CK0L 3BCDA 2XWJB 5I6XB 5IJBC 5MEOB 1ACXA 2WWMC 2OMVA 5DVMA 3ZTCC 2C4FU 4MB5A 5DMIH 2Z4TA 1MRCL 1V3JA 3FN0L 4JFZH 4N2AA 4Y2DC 4R7XA 4Q97A 4HIHA 5HI4D 5AW6B 3FUMA 5F9JA 5FC9A 3BH9A 1M7IB 1W8OA 2CJUH 1JZEA 2GSIB 4XWGL 5HYQB 3CLEH 3KPRA 1KIUA 3MV8B 3L2MA 5DUMH 3TTYA 5IWLC 4GQRA 5C0ND 4FEMA 4FQJL 3L3IB 2CHDA 5DD6B 4AENB 1BV8A 3PP3H 5EC2A 2A77H 1FORH 4YC2C 1TETH 4HGWA 1QATA 3CFUA 5CMAB 1OM9A 3RWJB 4PGEA 1MKFA 2AQSA 3UCQA 5ALCL 4UT6L 3ARBD 1GOGA 1JSYA 5H2BB 1B4TA 3IDIA 1ADWA 3HBGA 3V0WL 1L6PA 4P5RA 4Y5VB 3UDWA 4W9ZA 4GKLA 1A7OL 3QDMB 5IHUL 4YHYB 1N8ZA 1AY1L 4GUPA 1UJTA 2DW5A 4A7UA 3CVIL 3T4AA 4N2NA 2DEWX 3FTSA 1J1XL 2VMDA 2IWFA 3C60B 2A99A 3DVGB 4QY8A 1MCQA 3CSGA 2OMUA 1UWEL 2Z8WC 1M6OB 4J6RL 3WTYA 4PJEB 2Z35B 1UWFA 4X8GA 4UMSA 2ZUQB 1KYFA 3T4YB 2WNKA 3MYJA 2EEAA 3FQ1A 1MN4A 4N1EA 2XWBA 3VG0L 3BVNA 3MRJA 1R0AH 3DIFB 3RY5A 2DQHL 3ECQA 1YEFL 2NW3B 4NAMA 3ARXA 3KLQA 3ABMB 3BOVA 3JTTA 3WN5C 1A7PL 1LK2A 1M2VA 3WXVH 5I5MA 3QAZB 1MPAL 1UCBL 3IFLL 4ZW8A 2FLMA 2VR3A 2P8MB 3TA3A 3P3SA 3TCLB 4RFEB 3NCJH 3CXHK 1XIWC 1A66A 1A4KA 4KXCA 4E41E 5K69A 3T2OA 1AS8A 4YWGL 1BG9A 4Y19B 1UA3A 1TMCB 5FXCH 5AYUH 1HSBA 1MCOH 1I8IB 1OGAB 2IIJA 2TAAA 4PRAA 3QARA 2NXZB 5A2JH 5IMLA 5E8EB 4CSPA 4K3HA 4J3OC 1QWUA 1FG2A 5D6DA 5ADOH 1NCOA 1BXAA 2VKWA 3LH2L 3Q7JA 5TFSL 4EXKA 3CC5B 1DBJL 5C6TH 1U36A 1IBBA 1SEBA 4FQXB 5FFOA 4AIXA 2MQ3A 1NDMB 2YPVA 4ZSOB 4KKRA 3TBSB 4P23A 5I1IH 4PS3A 1T0OA 3FU7A 3OGOE 1N6QL 2GSMB 4HUVB 2ITFA 1NBZB 5D7SL 3DYPA 1YECL 3TBVA 2E3VA 1URZA 4UV4H 1WAPA 2GAZB 4MASA 4GLRH 4P0DA 3AT9A 3QZPA 2NTFA 1EZVY 2ZNWA 3OWEA 5CCHE 5C9JA 4FFYL 2BY1A 2WQWA 1A2YA 4G1EA 2OMWA 1OLLA 2R2HA 5C0IB 3ZRFC 3EO1A 4JZNA 4K8RL 2JKRM 3KLDA 1AZVA 1R24A 2NR6D 3ATBA 1DZBA 4KHXH 4DTGH 3QJXA 3CH1B 1NKGA 3KXFD 1CFQA 4ODSL 3CX5K 4I9XA 5AG8A 4AL8L 4ABUA 4X5LA 2XG5A 1J9RA 2HFEB 4X8JB 3WOVA 4DGVH 5E2TL 4ANUA 1TFPA 1A9BB 3M8OH 4Q58C 1A6TB 1I1FA 4WO4C 2EDDA 3GRWH 1BAFL 1JPGB 5DQ9A 1BREA 1OD9A 2LE9A 2V7HA 4FXGB 3LZOA 4ICWA 4ISVA 5J9PB 2IGTA 3LNHA 4Z3EA 1FFTB 3QIWB 4NNXA 2XN9B 3CVBA 1IM9A 4J4PD 5LJYH 1C9SA 3QXTA 5F3FA 1KJVB 1A4AA 1OWRM 4U6HB 2PCPB 4DEPC 4Q14A 4JFWA 4JFDB 1N10A 3P2BA 5EU5B 4UT9L 1NGXA 5IQ9A 1TQUA 2VERN 3G5ZB 2YD5A 2YPKB 4C4KT 2X10A 3VUAA 1RUKH 3IVKA 1U8OB 3WJLC 3MCG1 4WUUA 3EH2A 4QRPA 3OHMB 4AYGA 1UEMA 4JRXA 2QQQA 4L4VE 2YGPA 2Z64C 4JQIA 2D0FA 1D5MA 3H7BB 2H32A 3TU6A 1PNDA 2IALB 4FYQA 1WTLA 3QUXC 5E94A 4C57C 2WP3T 4ZUVB 5FKAA 3I6GA 3MZGB 3N41F 5LN8A 1FFOB 1AP2B 1QI4A 3D18B 1IVTA 4FERA 3U4BH 3W11C 3RL2A 1RUPL 4PB9L 1OV8A 2O61B 5DC4B 4YR6B 2R1YA 3CFDB 3D3VB 2FWSA 3CSPA 4U1MB 1RK1B 1Z9NA 4JR9H 5DQDH 2A6JA 4NPJA 3AXHA 4ZW3A 4Y16B 3O3BA 1TJHL 1FVEA 4NT6B 4O51A 4GMSL 1MELA 1DUZB 4POZC 4YHZL 4ZUTB 1KMGA 1SDDB 2NY1C 2PCFB 4QTHA 4H8WH 5ABZA 1U41A 2VR7A 4X9GA 5HGHA 1E67A 5GISL 3GMQB 5AL0A 1F4HA 3FC8A 4P2OB 2DL2A 2FWLB 1MCCA 4PJIE 3MRMA 4TLUA 3B2UD 2QL1A 1ZTXE 5KANG 1IAMA 4GRWB 1FFRA 4WY7H 4JEGB 3SCMA 3WKPA 2R1WB 4N0FB 1O7VA 3LIZH 3GI8H 2WV3A 1WC7B 5DYOB 4XC1L 4F2ME 4L1LA 5B3JE 1I4FB 4JFFD 3WS6C 4XP1L 2CJ3A 2VSKB 3MLWH 4NM4L 4ZAKC 4ZFZB 2VDNH 2ZCLL 4UNIA 1CL7H 2EEDA 5EPMB 3T6VA 5IBTL 1IGML 2A73A 4TUUA 3FFCA 2JB6B 3EH4B 3ZY7A 1XX9C 3MC0A 3TYFA 4CC1A 1V7NH 4HK3N 4IK7A 3S2AA 5L2KB 2DBLH 3NFNA 2X4QA 1NFAA 4TN9A 4MNHA 2YXFA 1FV1B 1ML0A 1D7DA 1NCIA 5J6GA 5LBSH 3N44F 3DX7A 1FYHB 5H94A 5MEPA 2EQDA 3GS7A 1KPVB 4M7LT 2EYRA 5JA8B 3DYMA 4A2EA 2G2RB 4RMWA 1S9YB 1KGWA 3DX2A 5JW4Q 2JIXD 4Y9GA 1ZHKB 1BGXH 5CIPH 1MAJA 3G5XB 3TF7C 5D7IE 1HHGB 4RMTA 1SXCA 1LEKA 5I8CB 3TZVB 1VFOA 3EGXB 4L3CA 2JJSA 4L0PB 3UAJC 3F8UB 1QSEA 5GS0C 1NINA 4M93C 2J55A 5F7DA 4EZMA 4UTAA 5ESQB 3U46A 3NACL 4ENEC 1HL4A 5LAPA 1KJ2A 4Z9KB 3NCYP 4M4RA 1BD2D 2X70B 4H26A 4Y9FA 4X98B 1IC7H 1NUNB 3KCPA 3STLB 2VJXA 3P0YH 2AXFA 2ZWKA 5DVPA 3HG0A 2C1PB 2FQEA 1ID2A 3IXTA 3UC2A 3VXRE 1Q8MA 5HHMB 4LRNL 3WKNA 3IM1A 1L9QA 4MB4A 5FA3A 5SWSB 2M26A 4OF0A 4B53A 2F08A 4ESKA 1WBXB 4PY7A 4TOYL 1HAWA 2V2WA 1L9NA 2PTTA 1UA7A 4MXVE 4L8SB 2BVOA 3HS9A 1H3XA 4CMMB 2NUTB 5IY5B 2G4EA 2AEPL 1JI2A 3NSFA 3G6DL 5LWYH 3QJOA 2EZ0D 4JFPB 3F7VB 4YSSA 1QD0A 2GIXA 1S3KL 3V0VA 4KMTL 1R3IH 2ADGA 2EO9A 4HS8L 3QQXA 3QQNA 3ULAB 4MDJA 1KEGL 2XQYK 3QO0A 4LGSB 2IBZY 4I13B 4NQVB 1UGKA 3DV6A 1BYOA 3ECVA 2FBJL 3WIFB 3QNZB 2E7CA 4M6MH 4UAOB 5I2IA 1A6VL 4KJPD 1NSNL 4AV0A 4DT2A 2Z0BA 3ARED 4F8LA 5H4YA 3J07A 2MPAH 1UWXK 2BP3A 2D7MA 1XSKA 2FJFB 3F6IA 1Q0XH 4OD3H 3P4MA 5KZCD 3PRZA 2QHRH 3EJJX 4GG6E 4JN2B 4NC1E 1JNHA 4WDIA