2MNJB

Nmr solution structure of the yeast pih1 and tah1 c-terminal domains complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
PHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPSYNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERTLYIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title Structure/Function Analysis of Protein-Protein Interactions Developed by the Yeast Pih1 Platform Protein and Its Partners in Box C/D snoRNP Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18482 Pih1_fungal_CS Fungal Pih1 CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4160 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2mnjB00
4CGUB 2MNJB
chains in the Genus database with same CATH superfamily
4JM2A 2UXTA 3JTTB 4N8VB 2NMSA 4U1SB 2Y06L 3OJDA 4QY8B 1BD2E 1JFQL 1H3UA 2DL2A 2J43A 3RJDA 3MRIB 1RVFL 4PW3A 5E1GA 5MHSD 3E6FA 4HBCH 3TLRA 4F7KA 5JNYB 2JCWA 4R4BB 4H40A 3U7WL 1OTSD 1AQDB 4WUKL 2WLIA 1IL1A 4KOCA 3VFWB 1TEYA 4YHML 5F7FA 4HIQA 3B83A 3UACA 3TV3L 1J1PH 1T80A 3EJJX 4P46D 4TSBH 4FFWD 4NO2A 3FQXB 1TVDA 1WVZA 3WYRA 1RZ7H 3FQTB 1NKGA 2WO2B 4U0QB 3RX7A 4AIZA 3H7BA 4U4BA 1KGIA 4U49A 3N1GC 1A5FH 1XGYH 3HN3A 3FU0A 4X7DC 4YHLH 3PABA 1V3KA 1MWAA 4W9DC 3FU6A 4MJ6A 4KY1H 3RVUC 2DLFL 4B9IA 4RFEB 2JMRA 3ZDXE 1XTMA 2QADC 3MUJA 4FQHB 4J2QA 2ZUYA 5F88B 4UAOC 1NMCB 3W39B 4P07A 3EYOB 4PJCE 3QJTB 4PJEB 4PGDA 2HMIC 2GTZB 3MRFB 3H9SB 5F1OB 3FAWA 3NVQA 4XVUD 2N4IA 4CRPA 2WYIA 4YPGA 5FUZH 3KWXA 4IQHA 1BA9A 4OFIA 1SDAB 2I9TA 1P4IH 4MJHA 4GEIA 3X1GA 5DK0B 4WV1B 2VLRA 2BOCA 2IG2L 4PJ7B 4LHJB 4ONHB 1O5DT 4RSVA 4NQED 1JWSB 4YDVA 2FUQA 4P2RB 3BPCB 3WOVA 4R26L 4J3XA 5DC9B 1DJYA 1HXYA 1OP5K 2DOCA 2V9RA 3M1BA 2NUTB 3P0VL 4I0KA 3FO1A 3JWNC 1HXMB 1EO7A 3KD4A 2ADJB 1CLVA 5IROA 3DV4A 1T2XA 1XD0A 1O6VA 5CGBA 3BW9B 3FRUA 3IE9A 2F53D 3MOBL 4E9YA 5CO1A 5C9KA 3MA9H 1ORSA 3UAJC 1A3RH 1GZQB 2CDGB 4ZOBA 1XBDA 3P2TA 4E9QA 4ZUVB 2GITB 5EBGA 3QSKB 4KX7A 5CHNB 3D39D 5C71A 5J6GA 1P0SE 2VITB 2Y7MA 5I71C 1N26A 1J05A 3P73A 1AKJD 3VH8B 3EYSL 1N19A 4K8RD 2X2UA 4ZG1A 1TJIL 1UURA 4PJDF 1G5AA 3RA7H 4XP5H 3WD5H 4K71C 4XN4A 3BH8B 4AM0Q 2H3NB 2YOCA 3BP7A 2OZ4L 3VI4B 1BQHA 1FF5A 2N01B 5DS8A 4AH2A 1MREH 4PJBA 4LSRL 1W0VB 2AJXL 2HG0A 4YH6A 3BHBB 3K5SA 3CMGA 4BCYA 1NCWL 1X7QA 1ORQA 3T4AA 5KBKA 4JKWA 1KLFB 3DURB 4K2UH 4LMQE 1IC0A 4F3FB 2GG1A 5E23A 4JDEA 1TIUA 5DGRA 3RWFB 4HWEH 3P9WB 4PJFF 4IRJB 1YY9D 2DQHL 2VLLA 1K5NB 3PYCA 4Q0XH 1WAAA 3FU8A 1UVQA 4EZMA 4HF5H 4KY2A 1Y07A 2QVFB 1A7QH 4OCRH 4R7DA 4ONOA 4MFHA 3ZDZB 2O61A 3L95A 3K4AA 2VXQA 2WXGA 3VFGL 4BH8B 3WIHA 4XVJL 1N68A 3DX9B 2W95A 2CH8A 3ASOB 3B5HA 5GS0H 1MW2A 2ZPKL 4QXTA 5I76A 4OUOA 1BDYA 3T2NH 1QI4A 5FYKD 4AQEB 3VXNA 5GSRA 4URTB 4N1EA 2VNCA 1SQ2N 5HHOA 1EXGA 4J8RB 3QE5A 2Q86B 1PNDA 3PGCA 4X98B 5ID0A 3MUGA 1A6UL 4YDMA 1N10A 5LGHH 2OMVA 1QA9A 3AQDA 3EJPA 3C2AL 1U93A 2KPNA 1TTBA 3ZTJH 1NIFA 5ANHA 1ADQH 2IPKA 3WTUA 1FO0H 4GW1B 4G6MH 1A1NB 1MCQA 3MA7B 1AO7D 3UTQB 4PP2B 3BYTA 1Z9SB 3PP3K 2VISA 5BQ7A 3WKQA 3JT0A 2GFBA 4GUOA 3VNYA 2OS7A 2G3NA 4KTEL 4LIQL 1P4BH 3QW9A 4G5ZL 2L7UA 4PGZA 5E7FA 1HZHL 5TE4H 3B2UC 1NMCC 4HGWA 3LS5H 5T3XD 1ASPA 1IM9D 3UO1L 4AVJA 4CN1A 3MRGB 4PRHA 4YE4L 3FQNB 2AVGA 3E8UL 1AMXA 1IBGL 2XPGB 4GQQA 4F8QA 4PWKA 3OAUL 5DVPA 3OBAA 4DP7X 4OLEA 1JI2A 5I1HL 3KWUA 3QBTB 1KDJA 2IQAA 3QWQB 4IGBC 4PWJA 4WV1C 2B8OT 3Q9QA 3JWOL 5LNEA 5IJDC 1JOIA 3HMWH 3Q6GL 4RMTA 1SDYA 1EBPA 3WMSA 4A6YH 5J6HA 4Z0BH 1OSYA 4LZKA 1CYGA 4OD1L 3LNEA 4Y5YA 3WUWA 2I07B 5BRZE 5ERWA 1RUQH 1HJBC 4WWID 4PJ8A 3LKPA 2QPDB 2WNXA 4QOKB 5C07A 6PAZA 3W9EA 3V4PH 2JK5A 2J88H 1DBBL 2JKJA 2TRYA 3GF8A 4J4PD 2Z8WC 1XMWA 2AXJA 3R8BB 4E5XG 1AHMA 1WSST 4ZODA 3VRJA 3E0GA 5A6LA 4Z3JA 2J20A 3QUMH 1JTTA 4FG2A 1USZA 4PJ8C 4B3EA 1T5KA 3CK0L 2ATKA 1OANA 2WO4A 4RDQF 1WBXB 2XXGA 3NIDB 5C0DA 5HI4D 2CLZA 1SVZA 3P4OA 1M57B 2GSGB 4H0HB 1G6VK 2P4AB 2VLKA 4TUOA 1JUFA 2ZOWA 3SDAB 2DN7A 3ASNB 4R90L 4HIIA 5K9OA 1ICTA 4N9OB 1CE6B 3MUUA 4WK4B 5H2BB 5ICXB 5D1XB 3CFQA 2NW2B 4PRPE 4UMSA 4ZSOE 4R7XA 1F3JB 3RB7A 4WCYL 4DK3A 3A67L 1FPTH 1V10A 2N0KA 5FOJA 3TEZA 3LEVH 4UBDC 4LSVL 4HS8H 1OTTC 4EZJA 1FVCB 3OKDA 4E36A 1AQKL 5E7BA 1S7XA 2H45A 4DQOL 3CFCH 2P49B 2LAAA 4KNTA 1EEUA 4DP2X 2DQDH 3DXAB 1I31A 1UOKA 1KN2H 5D9SB 4CW1A 5F0MB 3AS3A 3ETBJ 3QHZH 3BP5A 3P77A 1UCBL 3QJRB 1SDDB 4G7VH 4ETQB 3I3EA 2A83A 2DTML 3GSNB 1N8OE 4IRJC 3NCEB 5SX5H 3ZR5A 4ZUSA 1MCWW 2EABA 4ZO8A 1TEGA 5F7DB 3W56A 4JAMA 4BK8A 4DTGH 1LQBC 2QQKH 1PW3A 2V8MA 4GW5A 3CSFA 4X6BB 3BRFA 1WZLA 2P26A 3TM6A 1KC5L 1N0LB 1RHHB 4PS3A 2R59A 3T3MB 3BWUF 1MNNA 3MBWB 3NZSA 2XICA 4PJHE 3DRTB 3Q01A 2R4RL 2HZHA 1SN2A 3C6LD 5BUGA 1J87A 1KXQA 3I2CL 4QHMA 1TQBB 2CWRA 2WKOF 2YHGA 4YHYC 4N2FA 5CEXA 5HVHC 2YUZA 1A6TA 3BGFB 5I0ZA 1VFAA 3EF4A 1QPPA 1U8PB 4QHKJ 3RWCA 4A55A 1MN4A 1HCFX 2OK0H 4QNPF 5DD0H 2IAMD 4OM0H 2UV3A 4HPYH 4LSTH 2KZWA 2XDHA 3SPCA 5F3HA 3MLYH 5F1NA 2QGCA 1LD9A 4U1LB 4U0RB 1W91A 1UWXH 2A4EA 2H47C 4BK5A 4UDTB 4GG8A 4HKJA 1DZ0A 1JTOA 4ZTOL 4OBSA 3FULA 1FL5A 4XP4H 5AVSB 2Y07L 1KT2A 3F00A 2PCPB 4HWBL 2WINB 3MCKB 5D2NC 4OLXL 5LG1A 1UTDA 1OB0A 3JQOB 1LXMA 2V7NA 3DX7A 2BS8A 3MJ8A 5A6MA 2ITDB 5JQHC 1B4LA 4NQDA 1PY9A 2ZCKH 3VXRA 2BNUA 2VDQL 2CCVA 1FNSL 1QD0A 1JCVA 3HC2A 3IBEA 3L4YA 4IBLT 4OKDA 3P4NA 4GBXA 4P5TA 4OVUA 3UPCA 4AQ8C 4CJ0A 3F58L 2GSMB 4HKXB 1RZFL 4J3UA 4HJTA 2FUTA 4PG2A 3WFCL 5D5MA 3AUWB 4ZAKA 5IJKA 3KPRD 4FQIH 1NM9A 3DJRA 5E0FA 2GJZA 4ODVH 5AAWA 4I5BA 3CLWA 4PP1C 5EU4A 4FNLL 2ZIDA 1FNGA 5EZIH 4TUJA 3CC5A 1PTZA 4PJEE 2X0WA 3SGEH 4WTXA 4EMZA 5SWSA 2DMHA 5DC0A 5DQDH 2DEXX 1BG1A 1CE1L 2ZJSH 1DCEA 3KE0A 5CF3A 3HEIB 4NUMA 3HPJA 1F3RB 4K7FB 1UB5B 4PB0L 2WYHA 2YAFA 4YJZL 5E4EC 1UXLA 5I2IB 1QRNB 4PJ7E 3JZ7A 2Y2WA 3N1MC 4I9XA 5E5MA 3ZYJA 5I19L 3SYPA 4P2RE 4YSDA 4HQQL 4PLOB 1WLHA 2GJ6A 4JJOA 1T0NB 2ZXBA 2R0WL 4JY5H 5J11B 3EXJA 4KUZL 1T4WA 1LJMA 1Q1JH 5CCHE 3IJEB 2LLNA 1PLGH 4UQ2B 1CXHA 4MAYA 2F19L 1OHQA 3FMGL 3O6FB 5C3TA 5AVXB 5JPNB 1HQRB 3ECVA 1DYZA 2H8PA 1XEUA 3NQKA 4DKEL 2YUVA 1OB1A 1A66A 12E8H 1UASA 1X5FA 5HTSA 1QZNA 4NM4L 1L0XA 3CQPA 5I1LB 2EKJA 4F5CA 1MAML 1OV8A 4MQSB 3TVMA 4KWUA 2I24N 3CVDA 3Q2CA 1NFDB 2VZ3A 4FLRA 4Y5XA 3SBQA 2ZWNA 3GTVA 5DU7A 3X11B 3CFJA 4M43H 3QIBD 1PZ2A 3COOA 5DZAA 4KQ3H 5CZVL 1HK6A 1MNUH 3ARFD 4I3GA 1WTGT 3VJ6A 1YEEL 4ELMF 2XJLA 1UB6A 1OXYA 3MX0B 1CLCA 1TKWA 3C6EA 3F01A 1Z5YD 3TVMC 5GGRA 8FABA 1HHKB 1CL7L 4NS0A 4GXVH 4JFED 1BAGA 2C9RA 1HTYA 1C08A 4I3SH 4J2XA 3NSYA 1P7QB 1V7MH 3I75A 2GI7A 5DXWA 3VI4E 2Z7UA 3TESA 2XRAL 4YL4A 1OGAE 3BQUD 3I9PA 3MJ9A 3ELAT 4Y4HB 5D7SH 1TCRB 2FQFA 4JANB 4ZUTB 5IESH 4JB9H 5A16B 1LM8V 1QBBA 5FECB 1JE6A 1VACA 1HCZA 3SKOB 2VDMB 2NUPA 4AVIA 5I18L 3ZK0A 2E47A 2MKLC 4PV9B 4XXWA 2R1XA 4TQHA 4TVUA 1JYXA 3CU7A 1U2HA 2J73A 2ZUTA 4OFYD 4Y7MA 4NNYA 4HAFA 4P9HL 1TQBC 5C9JB 5JIDA 3SD2A 2K9FB 3O9WA 2YEZA 5HGHB 4FQJL 1N5AA 3WLWC 5C97A 4PJ9A 1SJXA 2QV2A 3KG5A 3MRMB 4TRPL 3B6SB 5LQBH 3OHMB 4KFMA 3ZDZE 1CLYL 2K45A 2GBTA 4GMSL 2HFGH 1FDLH 1T0MA 1B0GA 4KI5E 4Z3HA 1JGVH 2DJMA 3O9WC 1RZJL 1BECA 1Y18A 2AEOA 5FWQA 2VAAB 4U0RC 4FYTA 1UT2A 2E7MA 4E41A 3N2JA 4KOBA 1DN2A 5KW9H 4X8JA 3QCUH 4JCLA 4PWEA 4CSZA 2FL5A 1J9CT 3NOIA 4OCXL 3SE6A 3H4FA 2IAND 4A1RA 1CDIA 4WI4A 5DUBB 3QARA 1SVBA 2AV7B 2QZ5A 2CXKA 1RJZA 1OQXA 3PAYA 4XR8C 3KYAA 4BZ2A 3FTGB 2O1AA 4N0CC 3AAZA 3RGBA 1NMAL 4XNZC 4K55A 4BZ1H 2WXRA 5AVVB 3IJYA 4P46B 3RVVD 4Z9KB 4PVNA 5SWQB 3UZQB 4EIUA 4R5XA 5JQIB 5LN8A 4U6HA 1TEFA 3RUGA 1KJ3H 3SBWA 3DJTA 2AJYL 2UZIL 1ZT1B 5DTFA 3ZRCC 2X0VA 2YGVA 1XGZA 1LO3H 1IZJA 4Q6YA 3KPNB 4G6KL 1GJIA 2CGZA 4HETA 4LQ1A 4Q6KA 4ATTA 2EDEA 2P45B 3ML9A 1A7OH 2M2DA 3KPSA 1BF5A 1BQRA 2WP3O 3DUUA 3SBWC 4FQLL 2PW2A 4JPWL 4M1CD 1T03H 3CCHB 4L8CA 2BSDA 1CR9H 3MV01 3INOA 4HJJL 5GS1B 2E9GA 4YHZL 3KPTA 4Q9RH 2CLRB 3AT8A 1KYFA 2AI0H 1G7HB 2L7EA 1FNFA 4DZ8B 2BX5A 4NQEB 5J11C 5JXAL 2IALA 4MHHG 4QOKE 1MAKA 2A6IB 2IPTH 3SZKC 5IKCA 3B4NA 1TTCA 1C12A 5D1ZB 1XL4A 5D8JL 5B1BB 3V4VL 1WWWX 4DEWA 5B22A 4MS8D 4JKLA 1CDCA 2EDOA 2H7WA 5ITBH 3X13A 4KH9A 1JPSH 4KXAA 1DO6A 1TJXA 2XHNA 1QUNB 2E7HA 2BWDA 3SY6A 4YMPA 4Q9QH 3DX1A 2ICEC 3RZCD 1IQDA 1S3KH 3R4DA 2PP9A 3F7QA 2NTSP 3WY1A 2F53B 2OW6A 1SY6L 1TQCB 2PTTB 4GKOA 1ZWIA 2XN0A 3OKNB 1FP5A 4OU3A 2F58L 4YFEA 1L5GB 5DZ9A 3H9ZA 2OSLB 5E6ID 2YQGA 1LE5A 1F1GA 5AKRA 3UZEA 4WWNA 1EK3A 4UTBH 3EYUH 3GBML 5C0AA 4ZX5A 4X7TB 1T83C 3EJSA 2ZYRA 1YNLL 3D34A 3L4TA 4PLJC 3JZYA 4WDIA 3EBHA 4LMQI 1CD0A 4S1SL 1EGJH 5D1XE 3EGSA 3K6IA 3L3HB 5BXFB 2R23B 2P46B 4OF8A 5ESQA 4ABVA 1J1PL 3A4EA 3OGCB 3S8GB 2V2WB 1R3HA 3MREB 4HD5A 3JT2A 3OHXA 3IFOB 3QRLA 5F1IB 2I60H 1MY5A 1CD8A 4Y4HC 5HVFB 1H3GA 2WQWA 4L2LA 1I9RH 3ETBF 3FQYA 3HNTH 3VFMB 2P28B 1VFBA 2XZQH 4YHLL 2BIIA 2GT9A 2IH9A 4FQCL 4KY1L 4N6RA 1IV8A 3DXAE 1V5JA 2J72A 3ECBB 1YECH 3H53A 1CD9B 2ZXEB 3G5YB 3CN3A 4KGJA 1MXDA 2XYBA 3OHXC 4J3SA 2BNRD 3FB7B 5AKSA 4E9SA 3HG3A 3V6ZA 1VF5C 3DGGB 4BWWA 3L3IB 1RJYB 5SX5K 4ISVA 3DOIA 4LT7A 2MOVA 2OXHA 5FHAL 2WVVA 3FRPG 3L48A 3T1WA 1MCLA 2YAHA 3U30B 2WYZA 5ICYB 3MRNA 3GTTA 4AMXA 3T3ME 1WISA 4HISA 5E9NA 5BS0E 1C1EH 3NABL 4CNIA 2XTJE 4I2XE 3DARA 2X10A 2KLSA 1U95B 2OYPA 5JXED 2V5SA 1MW3A 1U8HB 3HNSL 1MEXH 4KPHH 4G5AA 3IFLH 5KVFE 1M1XB 1E65A 4XMKH 1KLGB 4LVEA 4D2NA 2NX5D 1OTSC 3TYGL 3VCLA 5C2UB 5EF3A 1GGCH 3NUKA 2OYMA 1D2PA 5GGSA 1K8DA 3GLEA 4WWPA 5AKVA 4ADIA 3CZLA 2LT9A 4ICWA 3ATDA 4AYEC 1XDTT 5AQ0A 4CILA 4P46C 3HE7D 3MA9L 5DR5H 4FFWC 4C47A 4UNUA 4K3EH 3ARUA 5KS9F 3PREA 2FBRA 4HK0A 4U33A 5CMAB 2J8OA 4GFXA 1G6RH 1AO7B 3QWNA 1XGRA 3BZ4A 2E76C 3RJOA 1Z3RA 4AW4A 1UWXK 1O9WA 1TZIA 5CGYD 3X1NA 3A4DA 3VXSD 2J4WH 2Z92B 2HT4D 3HR5A 2YQ3A 3HPLB 1LLAA 3PRZA 1YEDA 1M2VB 3BISA 3WD5L 1KIUA 3GPEA 1OCZB 3HFML 4YUEL 1L6PA 2AK4B 1QSFE 3K72A 4L3FA 4YGAB 4UF7C 5ICZA 5E51A 1NIAA 4X6DF 5KSAA 2W8CA 5J56B 3ELQA 3VD5A 3FOLB 4Y5VA 4CKQA 4GUPA 3V2AR 5AW6B 1AFVH 2MCAA 2R39A 1D5ZA 4P23A 1DJZA 3S3DB 3K74B 3Q43A 3CBKB 3VE0B 1Y6KR 3MJGX 3KGUA 4LLAA 4ZPTB 1UJ3A 4E42B 4LEXL 5CR1A 1MJ8L 2JXMA 2BCMA 3V52L 4ODXB 3RKDD 6FABH 2P8MB 4PBXA 1TZHA 5KSAC 3UCQA 3PQYB 5J3HD 1ZVSB 4S2SB 5T3ZH 1OAUH 3WE1A 5KSBA 1UXWB 3O4OC 4HF5L 3F7VB 3F62A 3UPAA 2BO0A 3D39A 4OCRL 1C16A 3P0GB 2ATPA 2ESVE 2V9UA 4CVXA 5JUEL 2MTPA 3FQRB 5EBLA 4LP5A 1XCXA 4LVOC 4GH7B 4W9EC 4JFUA 1A4KB 3U0WL 4AXWB 3DTXB 4WF7A 3FUJA 1JF6A 5IOPB 1OY3B 4G8AC 5G4MA 2Q7YA 5LAXA 2X41A 1QLFA 1Q38A 2DEYX 2R1YA 2VXVH 2Z7YA 3LKSA 4K8RC 1DSFL 1MLCA 5C2BL 2NXZD 4MYPA 4NB7A 5DRNA 3GMOA 2P5EA 2ED9A 3P69A 3QDMA 1NFDE 4L3CA 5DA0B 4N2AA 2HPOA 3A5VA 4NO3B 4AL8L 3CQQA 4XGZB 1RUAH 2E27H 4WI5A 5DQJB 4BSVA 3ET9F 3TO4D 1KB5B 4H88L 1G9NH 3MLRH 2KZ1B 2IBBA 1M7DB 4KRLB 1IEBB 5D2LA 4IBUA 2Q1EA 2X7LA 3BAYA 3Q2VA 4PN6A 3OKOA 2B9AA 1ML0A 4AE1A 3GS0A 1Z66A 1OO2A 1GH7A 1P4UA 4QRPA 2L7QA 4P5KB 1WBZA 4TSCH 2PW1A 3VDBA 1BAFL 1Y1DA 4L1DA 1C5DB 4LNRA 5T1KA 1YY9C 3WS6A 4EI6A 4JG5A 3GBNH 4QDGA 3U30C 1QACA 2PMZA 3TTYA 1K2DB 1H19A 4G8GD 4BFBD 3C5SA 2OTUB 3VMNA 2D8KA 3APCA 4N8UA 1CG9B 4Z0BL 3FOMB 4D94A 5I30L 4DCQB 5JIKA 1CS6A 4YZFE 3H2QA 2WQVA 3LD8C 4RGNC 4XP1L 3UBXB 1Z5LB 3D0VB 3EYFA 2MIZA 1WWBX 1BGXH 4LCYB 4E9WA 1TENA 1DQLH 5ADPH 1K85A 1AC0A 3C6LB 4O2EA 2AS5M 2W9DH 1FBIL 3IXAA 4L05A 5FF6B 3WXWH 1B0RB 1OPOA 2VYRE 4UT6H 3EGDB 3L1EA 2J2ZA 4S0HA 5EEXA 1CVRA 4XBGA 4G70B 3VDAA 3FB8A 3Q13A 3DJ9A 1A1MB 4HWZA 2MMXA 2C9PA 2IAMB 4F57H 1G7JA 4XXCA 2B4CL 2G2RB 3MXVL 4IIQA 4NPKA 4P3DA 5FFLA 2VM9A 4I89A 4NOFA 3CFTA 2JQMA 3GINA 1JPGB 3SGDH 4H2CA 3UC0L 4R0LC 3T65A 3T0BA 3ZO9A 3E2HC 3WU1A 1EFXD 3KLKA 3T6WA 5KVEL 1A9EB 3LNIA 2CBTA 2FJSA 1S9XB 3EG9A 2XKNB 4UQAA 5CIPB 2VO8A 1U6AH 1BWMA 3IDYB 1YC8A 2IPUG 3S3PA 1S8DB 3ZPDA 4QHLB 2UXGA 1RK0B 3LZRA 4PW4A 2C3VB 1F6FB 4M61A 4CA4A 5LLIC 4LCWA 4HJ1A 2R27A 5I17B 4KAQH 4GQZA 5FUOH 5DD6A 3BAEH 4J4PA 2FX7H 1ED3A 3CFBB 3EOTH 2UWEA 3DPBA 5J8OA 4I77H 3KPRB 1KN2L 4JW3A 3QHZL 2DYPA 1PD1A 4DW2H 5L0QC 2FECL 1R3KB 4WW1A 5HYFA 2NZIA 4J1UB 4C4KO 3SDXA 4XVOA 1IE4A 4NRZB 4J4PC 5KSUB 1WC7B 4N8CL 1MG3C 2FJFA 4AEIL 2IV9A 4WU7B 5J4MA 2L8AA 1BBJA 5I8KL 4W4OA 2HYMA 3P9MB 4JRLA 2YA2A 1Z9MA 4KUCD 5IK3A 1KELH 1QWUA 2HG5A 2DAVA 3CLFL 3VVWA 2GJPA 4KX9A 5I1AA 2EYSB 1MFEL 2WBXA 2YGPA 4TVPL 5E6YA 3MC0A 3B7YA 2DY2A 2EC8A 5DK2A 1UENA 2W07B 3FO2B 3ESPA 1XH3B 2D4DA 4OM0L 4HPYL 1CDGA 1KGJA 1T1WA 5DGQA 4HIEA 2ZXQA 3QEQA 3KLQA 4OZ4A 4KZDL 4UOJA 3D7PA 3TIDB 4L0YA 5EIIB 3U9PH 4JRXE 1KGWA 4BA0A 3S7GA 2B9BA 3QIBB 4G7YL 4WI7A 3MNZA 4JDVB 3ARFB 4NHCH 5DJ6B 4HJ0D 3LNGA 4PRAB 1AZNA 5IR1B 3QZBA 3JYCA 4XOEA 2QZQA 4OZFH 5JPMB 1IAIL 2R2BB 4ENED 5DSCB 4NZTH 5I8CB 4JFEB 3IGAA 4S11A 1KCRH 2EEDA 1AG0A 4M7LT 1A7RH 1SOXA 1QFWL 3KYMB 2I27N 4G1EB 4GOSA 4LLUA 3WO3B 1H3XA 4R97B 3BQUB 5F72S 1ZTXE 1FAIL 1GR7A 4EI5A 1CFQB 4FMKA 4F8PA 2QHRH 2Y36H 4FQIL 2HTKD 4MJJA 5SWZA 3RVWD 3VTMA 4JFYA 4WFED 8CGTA 5KN5A 1FH2A 2G60L 3EO0A 3LOWA 2AAVA 3QIUA 3HUJA 2HX8A 5A2AA 3B9KA 4TL5A 1W16A 3I6LE 4K9EC 3ALXA 3C6LC 1I3RA 3ZT6A 1SEQL 2EKSA 5F7KC 5E08L 3GD1C 3MUY1 3A21A 2WBJD 4UTAA 2OBGA 2DB8A 1LDSA 3F65A 4GRWH 4HBQA 4X99A 5FYJL 5G4NA 5KBLA 3NGBB 3QIUC 1P5VA 2X6BA 5JHDD 4P04A 5DEJA 4X8CA 2IAMC 3US1A 3BH9A 3PXJA 5LB1A 1L9MA 1XZ0A 3VSQA 4EDWH 5CD3B 3K4ZA 1CXEA 4QHNA 4XHQA 3FO0H 2MCG1 1Q1JL 3HBQA 1RCYA 1PLBA 5HHVH 1J48A 3IRCA 3ZE1F 2H41A 4JFQB 3ABMB 1S5HA 1TQTA 2UZYB 4OM1H 3ULVF 1KPUA 1D7BA 1R1CA 3HI1B 2QT6A 1AAJA 1ZS2A 2IANB 3B2XA 4GAGH 4HU8A 3LSOA 5JO5B 2Z91A 3EFOB 1MH5A 2IBZY 2VERN 2BCKA 1OALA 4OR1A 1GC1H 1BFTA 3D3VD 2ENPA 1KPVA 4PRDB 3QIWA 3JV4B 1VKXB 2BP8B 1SF5A 2JLLA 4M43L 9PCYA 1JYWA 1DQKA 4D8PA 5AG8A 4DF9A 1XF5B 4V2BA 4J3TA 5CP7A 1KCSL 1IKFL 2NPLX 4UV4L 4X7SH 3JV6A 1E2ZA 5I16B 2WXJA 2VMJA 3DC0A 3AY4C 2XN9E 1Z0MA 2AK4E 1AHKA 3T4YA 4X5XB 4XMPL 1WA0X 2VXUH 1NC2D 4R2GD 5DUPH 1GAFL 1YJDH 1N9PA 2VB5A 4PJIB 2JB6A 2EDMA 4NO5B 1SM3L 1S9WA 4OQ1A 5DHVA 3Q05A 1A64A 2CHZA 1NGWA 5G2NA 4EXPX 2K4WA 4KJQD 3RIAF 2WLLA 3GSWB 2ADFL 2WD0A 3QEHB 1IGCH 4NAQA 4Q14A 1Q0XH 3SE4A 3PQYE 4WO4D 1WBYB 3MGTB 4F20A 4GKSB 2KPWA 4AEHL 3HMXA 2BHZA 4MCYA 4PB9H 4XC1H 2CHNA 2A9AA 2EH8H 4P4KD 4JHVA 5LQBL 3QNZB 5HXMA 2IMMA 4HCRA 2O93L 1ET5A 4IIZA 3QYNA 1IT9L 1FDLL 1MWAL 3R7QA 1GYUA 1OQOA 2QQQA 3CZNA 5IIEB 3KPMB 1JGVL 3CVCA 3RZCB 5BV7C 3D4CA 4XE0A 2E3VA 1AR2A 4NUQA 3L5WB 2QL1A 2NNAA 2GY5A 3LPWA 3R7RA 5C0FA 1H15B 1SXZA 3HCVB 2HFFB 1ZA6A 4U1JA 3HKZA 2GBVA 3QIBC 2AXGA 3GJFH 4U2YA 4MQTB 1TG8A 2WZ5A 3MCLL 4OJYA 4YEEA 1JHKL 1XF2A 5T8IA 4GS7B 1TOXA 4LLWB 3BI9X 3QUKA 3SPHA 2ENYA 3BCFA 1R3JA 2JWYA 4PI0A 1NCIA 3GEWB 5I74B 1WHPA 4AV4A 3GI9H 3REVB 3T8XA 1QR4A 2XG5B 3ISWA 1QR1A 3ZYOA 3SEPA 2QDWA 3RWGB 1U0QA 2AEWA 3BQUC 4PHXA 2ARJQ 5HPMA 3CFDB 3QXAA 1GJWA 1L9RA 2YJLA 1LO3L 1LNUB 1GCYA 4JZNA 2OJEB 4PRBB 3S3SA 3RPIB 3VFUB 5DRZA 2JCCB 4Z1PA 3MV7D 4X4YA 1GGBL 3QG6B 4UAHA 4ODWB 1J9SA 4GSRA 2VMCA 4O2CA 2JI2A 1KJ2A 2E5EA 2F1EA 2A7BA 3NACH 4KKCD 1ZA3B 2HAZA 2A6DB 3BKML 1ROWA 3C5XA 1DUZB 2B15A 4PRNA 2ODHA 5JDSB 5EBWB 1PL3A 4G72B 4GKNB 2QR0A 4APXB 3D48R 4TTDC 5DJAB 2W9EH 2Q76B 1JWUA 3HA0A 3NGBC 4H7VA 4DP0X 3S96A 4Q9RL 5AYTA 4AT6A 2OR9L 3O45B 4KRPD 3ZIMA 5CLWA 4A39A 5EO9B 4TPRL 2Y7QB 5AVQB 4M6MH 4AQZA 5D4JA 2JJSA 4S1RL 4NO0D 3FZUD 4L23A 3D6GA 1FNEB 1KLUA 5I1EL 5MEPB 4NENA 2FJGA 3CFNA 4MRCA 3VXTB 3WV0A 3CFEA 1EZUA 3PWPD 3R18A 1DBAL 3OG4B 1SZNA 2GTWA 2NX5B 1MELA 4TQEL 4Q56A 4ZDHA 3L1FA 4PJAB 3Q0HA 1CT8B 2AMGA 1E27A 5FA4A 4MBOA 32C2A 2HJFA 3U4AA 2JJSC 3NBNA 3L6FB 1UFGA 5E2UL 1CBJA 3HE7B 3RVVC 2C9QA 5HHXH 2VERA 3ECWA 4Y19D 5FXCH 1IFGA 2IXQA 1IKNA 3OJ2C 2Y0SA 2R0KH 2NSMA 3HLKA 4J3OH 3UTPE 4TLTA 4BFIA 3DMMA 1DEEA 4MJIA 2DM7A 4PGBB 4YNYB 1H3PL 3L45A 2B0SH 3MMEA 3HAEB 3RY6A 1LO0L 3R1GL 4YSUA 2VXQL 4PTUA 5HHNA 4HGMA 3WIHL 4X5QA 2ARWA 4TXVB 2PCFA 2I60L 3GMRB 5IMLA 1PYWA 1I9RL 3DMMC 5HBBA 4M1CC 2GK0A 4BBWA 4ECNA 1ANUA 2VSKB 1T2QL 4JQIH 1F2QA 2E7CA 2AEQL 1EBAA 1FE8L 3RY6C 3EDKA 3I9GL 5CD5D 1Z3GL 3GSXB 1YECL 2NZ1A 1HKLH 1XHHA 4NM8H 3HHRB 1DLFH 1R3IH 5E5RB 1CIUA 3O0RH 4R5TA 1UH3A 3LY6A 2J71A 3KL0A 1AD9A 2VZVA 2VC2H 4L3ED 3GSVB 4J6RH 5J06A 3O3BA 4PWGA 4YGVA 1HN1A 5F0LB 4MS8C 3RVXC 1YEJL 4G9DA 3SJVD 1OCRB 3L3GA 5F6IC 1TCMA 1CK0L 2ZSVA 1RLWA 3CH1B 3IPEA 4CADB 2NY6B 3RZCC 2A9DA 4MSWB 2V3EA 2P7TA 1YPZA 4EE2A 3TBVB 2CNZA 3NPZB 3G5VA 2OP4L 1PG7X 4A2FA 1H6FA 2QLVB 5BRZA 4KPHL 1KMGA 4JM4H 2WQRA 5E6IC 2WQUA 4OLUL 1USQA 4RAUB 4C83B 1UOVA 3ESVF 1LP9F 2ED7A 2EDNA 1N6UA 1WWAX 2F5BL 4OB5L 3AU1A 3UFIA 1GGCL 4GS7C 1BQHG 3RDTA 1ZSDB 3KDMB 5A2FA 3DDFA 4YAQA 2ILLA 2NXZB 3FH5A 2AQNA 5DR5L 2FWSA 4MCMA 3WEMA 2RGSA 1L3WA 1DVSA 4Q6IB 3STZB 4YVNA 3MLVH 3OV6A 4TLSA 1SYVA 1L9NA 1P69B 1YG9A 1NCDH 2W0FB 1I1AA 3DROA 2J1ZA 4GSDL 4NQUA 1F1AA 1MJUL 2OXGB 4FX5A 3KGTA 4M5SA 3X14A 4LLQB 5IW6A 3ARBD 1DJXA 2FLRT 3IJHA 2VJ8A 3AG3B 4Z95L 1SJHA 3P1VA 5D7HA 3VXPA 1OM3H 4JFEE 5F44A 5E2JA 4PRPA 5EU7C 4ZOAA 2JELH 2KDYA 2OQJB 5ELIA 4TULH 1PIFA 3Q1EA 1YEGL 3PU7A 5DD5L 1KJMA 1YMMD 1I1RA 1HNGA 1KXTA 4RMWA 5I26A 2Z4QA 5F89B 2NNXA 4G8GB 3H2PA 3BE1H 1I7UB 1AXSA 2WLNA 4W68A 5TQ2L 1P9MA 2TSAA 4TQIA 3SN6N 5PCYA 3KLHC 5JXEC 4HJIA 5DEFA 1JF5A 3RILA 1I9JL 4N2IA 3QQDB 5CKAA 3NJHA 2HFTA 4PRIE 5DJZB 5FYJU 4DN3H 1K6QL 3BUIA 4KHXH 4Z7NB 4B96A 4Y16A 3E1F1 1F42A 1FIEA 3CC1A 5DLMH 1RU9H 1FYHB 3FB5A 1ZPUA 4K94L 1NCCH 3OJMB 2A73B 2DIBA 2VQ4A 1KYDA 1YN6A 3QHTC 1JXGA 2BRRH 3N3EA 5DJ8A 3BCDA 4O2FA 1KPRA 2DWTA 3TPKA 1T5WA 3QRFM 3HE7C 5KVDE 2AK1H 4QTHB 3ULUH 4JZJA 3MRQB 3VA2C 3VU2A 1M3IA 4ES8A 1HI6B 1XR8A 4ZZKA 3SQBB 2ZT9C 4IBSA 4MA1C 5CGYC 1F11B 3LV3B 3T3PB 5IEHA 4Z5RA 1ZT4A 2IANE 2VQ1A 3DUSA 4QT5B 5F9OL 2HT4C 1ILSA 1F4HA 3UG3A 1P1ZB 1EFXB 1X5IA 4GAJH 3UTSD 4Z7AA 3ORJA 1G1YA 4XAKD 5DMKA 4ZJ9A 4EUPH 3IDMB 5LCVH 1N7ML 3WUWG 4QY8A 4GPVA 2GB2A 3CU1A 4Z7WE 3AMLA 3QULA 4J27A 3MRIA 2H4EA 3AREA 4H8PA 4NHUA 4U3XA 5AZEL 3WN6A 3MLRL 4JFZL 3CZFB 4UOZA 1JL8A 4P2OB 4R4BA 2YD4A 4OV5B 5BJTB 4KROD 3RX9A 4KMTL 5LJYH 4MD0B 1OF2A 1DQJA 3IFNH 4KKNA 4OFKA 5GGTA 4ZZFA 2AC0A 2R83A 3ZR6A 3N91A 5J3HC 2I9LB 1KEMH 4W9JC 1UCTA 3VG9B 2XTSA 2R69A 5I6OA 4HD9A 4L1HA 3CVHB 1L9PA 1QI3A 1GY2A 5GRVK 4LPCA 1SHSA 4RQQB 5EOTB 1J5OH 4JPKH 4KKZA 3L9RB 5CP3A 3QZWA 1XGUB 1B3IA 4FI8A 3D18B 1QTYT 4JHWH 4L29B 2NDGA 4FQHA 4BYHA 2IFFL 2UY6A 3Q3GA 5F88A 4Z0XA 1FA4A 4YSRA 5ADPL 4OZGB 2H26B 1UZ6F 3FCTA 2W9DL 5I6LA 3H3PH 3RQ3A 2CJUL 1OAXH 1QFUL 3DX4A 2UZXB 4LCIL 5K69A 4WENB 5E9DD 1GGIH 4LLDB 3WS3B 8PAZA 4LF3A 2GY7B 1PKQB 1A6WL 3UCRA 4PJ7A 3KYNA 4F57L 4PGCB 6TAAA 4QRTB 1FFQA 3DHUA 3TPUB 4LPVA 3BPCA 1A7BA 1VPOL 3EDDA 4OCWH 1CLOH 3AS2A 4QKTA 4JO2L 3TO4C 1YNKL 4U6TA 5E2TL 3PDGA 4MCNA 4WGWB 3GJFK 1AOHA 2V5YA 1HXMA 3U83A 1C8QA 1NMBH 2ADJA 2WNGA 4KXZI 2QELA 5IVXE 4JN2B 2J55A 3AACA 3IVKA 1U6AL 3X17A 2CDEA 4ZMPA 4LCUB 3FN9A 4KTGA 1MHHB 1NBVH 2CDGA 3HZKB 3KL3A 4FFTA 1ZKAA 2GITA 3DHJA 4FXKB 4MNHB 5FUOL 3QUXB 3OF6D 2X1WL 3BAEL 4PGJA 5EBMA 2FATH 4Z76A 1XSJA 2ZG1A 4WFHE 3RWDB 3GSUB 2OMXA 4GP8B 5EIVA 2NYZA 2JCCE 1XSKA 4X5WB 5A1AA 3DSFH 5FYLL 1L0PA 2MCMA 4RLDA 3VRLF 3GK8H 2OKMA 2AEPH 4B7LA 1THAA 2PABA 1E50A 3GM0A 1INDL 1HU8A 4AGOA 1DBML 2YAEA 4PLKD 3O4LD 3RNQB 3V95A 2NDFA 4KK8D 4LOVA 5E1AB 2FEEL 4NQXB 5FEBA 4H44C 1OGAA 2FQGA 2CHXA 3CJJA 2O5XH 5E2VH 2WBJB 3RL2B 2R4SL 4AYFA 3WFEL 3IAPA 1W0VA 5EFIB 1PG7H 4FFZA 1UQSB 4WW2A 1TMQA 4FD0A 1REIA 2H0FA 1RFDH 3UJIH 2K6WA 3NFPA 1NAMB 1TETH 5IJVB 4CAGA 4G82A 3BMWA 5AYUH 4Q4EA 2UXVA 5SX4I 1MCSA 4NAJA 2RB8A 4PJAE 3MJ9L 1K5NA 3JWDL 2ZUQB 5IB2B 4FKKA 1ET7A 3GSQA 3PWNA 3VI3A 4POZC 3QFDB 3ZUCA 1BVOA 1LK3H 2AJZB 1PGRB 4A6YB 4JZOA 3MLXH 1LHZA 2VDRH 1KIPA 4JM2F 3RTQD 3QQ9D 3N50A 5EIQA 4WUUA 3QUZD 2B20A 4EF3A 5JMOC 3FT2A 1AQMA 2ZAGA 3TGXA 4AQEA 3FAXA 4QJ5B 3C8HA 4J8RA 4OIFA 4FNPA 1H0DB 4RMBA 4P59H 5L4FA 1ZHBB 4X98A 1IMHC 1DN0A 1FG2B 1BQKA 3CN0A 3IU4H 1GYAA 3AROA 2ZXCA 4BRVA 1DFBH 1Z6JT 2I5YL 5E8EA 2MHAB 1A7RL 5DHYB 3ZE2F 4GW1A 3MO1A 4R2GB 5HDQH 4A7TA 5C7XL 4JG1H 2YPKA 1YA5A 3M8OH 1R0AH 2OX5B 4H4NA 5J1AA 5TQ0L 3BWSA 2Q3AA 4QO1B 5GJTH 5JLZB 2BSSB 1SBSL 2J8UA 3KWTA 4PJDB 3VXMD 2YGNA 4XX1E 4BZ2L 1JGDA 5B3JF 3IM1A 1DBJH 2UY7B 4ZUWA 2EVIA 3WHXA 3MRGA 4WO4B 5KYWA 3HKFA 1Z9PA 3QDJE 3FQNA 4LEOB 2IADB 3RFZB 5CINH 2EUXA 3AWEA 3MRDB 1NJ9B 3VVVA 4AMWA 2G4EA 5BRQA 3H9HB 1OAYL 2IV8A 3L4CA 5GGVL 4N2DA 4P4KB 4E9VA 1BZQK 4NI6A 3TH2T 4KDVA 4FKHA 3KCPA 2FT8A 1ND0A 3K80A 1C7SA 1DDHB 4OD2B 1BZDA 1U92A 3FO0L 2KYIA 5IF0A 3MN8A 4FF9A 4PJFB 5DMIL 4IOIB 3PXHA 1J8HD 3DX3A 1HDMB 2MQ0A 3VWJA 3HE6A 2FTAA 1EAPA 4HJ0C 3HS0A 3V6FA 1EV2E 2H32H 4BUHA 2BZ7A 1HEZA 3TIEA 3V9FA 1UGNA 4ENEC 1GC1L 1KFAL 4JHZA 5LVEA 3LQAL 1PKOA 2O30A 4HFUH 3HHSA 4L5FE 5D72L 3WEXB 1D6EA 1QHPA 4HX1A 3VWJC 3WKMH 5B39A 5I1CH 5C08E 4YDZA 2V4LA 1IGIH 3UBXI 4ZMWA 2HTKC 4U1MB 3SDAA 3RVWC 4H26A 4X7SL 5JHLA 2X53A 2OLDA 4XPHL 1QSZA 3MV7B 2RJMA 1Z9LA 5D1XA 2WSKA 1FFRA 4M6AA 4TUKL 4UIKL 1S7VB 3AZUA 1F3JA 3CDYA 5JQ6H 5ID1B 3KPOB 2WZAA 3D2UA 3OTTA 4U05A 5DJ0B 1BM3H 4HW6A 3B9EA 3DI3B 4X50A 2WBJC 1F8TH 2WXQA 3ARDA 1HWWA 4JUTA 2GAZB 1RAMA 5HGDB 4KRPB 4PJBF 1AS7A 2XA8H 1QO3A 3VSTA 3KNBB 3SBRA 3V0GA 2LTQB 3ILEA 1F13A 1NFAA 2JKNA 4Z7NE 4NO0B 3QQXA 1YMHB 5D7JD 1IBZA 1S7WB 1FWXA 1QMUA 4HSCX 4XC1L 3AXLA 2ZUQC 4DP5X 4OGAD 2CCLA 3MFGB 3PWPB 2X4QB 1JF1A 1A47A 3KEHA 3ENEA 5IW6B 1WAAF 3SQOH 3PP4H 1YVLA 4MMZB 4X4KA 2YWYA 2FWUA 4OLYH 3FUEA 4JRYD 3S9DB 5BS0A 2CXGA 4DKDC 4ZD3L 4I2XA 4N2GA 1GYVA 3VG0L 3U2SB 4Y19B 2VWEC 4ZOCA 3B3IA 1KACB 1IGML 3T3PE 1J0IA 3N1PC 4I4WB 1AY1H 1PZSA 4RMRA 4YSOA 1X9QA 3EW3B 1NOLA 1UA6H 2IMNA 3OLGA 3WNJA 1HQ4A 4AMKL 3O2DH 3GUFA 5I1IH 3PE9A 4IBYA 4R2GC 1AVAA 4XO9A 1QNZL 1TJGH 4R96B 4ZS7H 1RMFH 4PG9A 4M7LH 1DL7H 4JDTH 2WAHA 2LGNA 1KTDA 2FGWH 4HZLB 4UDTA 4Y2DA 2YD6A 4JVUA 4JN1L 4KJQC 5J9PA 1TQUA 1FL3A 4B7IA 2R2EB 4RGMC 5A2IH 5C0BE 4B53A 2PLTA 2MSPA 1EHKB 2PCPA 1U8OB 1ZDQA 2K8MA 4MCZA 2EYTA 4WO4C 1U36A 3QDGD 4FFYA 1DTUA 4EN3D 2GC7C 3K1KC 3RFZC 3PIQB 1A6PA 2ITDA 3FFDB 4L3EB 3ZT5A 2F74B 4YDLC 1QSFA 4Y2DC 4HLZG 3R8QA 4MD4B 4Y8DC 2ZOTA 4RISH 2N7AA 5F21B 5IBUG 1U8MA 3LXAA 1WUNT 1E5CA 3OG6B 1FL6A 3SJVB 2WNKA 3WTVA 3NIGF 1LO5B 4R8WL 3JWNH 2DWDA 4DAGH 4BCZA 2FO8A 1F18A 4F7CA 4XO4A 3UYRH 3CAFA 4N90D 4L1BA 2YBGA 3JSSA 3QJUB 1J0JA 2HLFD 2CPCA 3ZL2A 4Z23A 4JGJA 4M5ZL 4CJ1A 4QLRA 1LYQA 4XCCL 3V5DA 3VGAC 5J13C 3QR1A 4HK3N 3K71A 4LRIA 43CAB 2RQ8A 1EDHA 1PKQE 3OB8A 1MRCH 5EO1B 3TV8A 4PJ6A 3Q1SH 2ESVA 4YHPA 1V7NH 4JS7A 5KVGH 2GBAA 4ODSH 4FNRA 1EH9A 1Q94B 1UWEH 4FHJA 1VFMA 5C09D 3ZSSA 1IAKA 4AW7A 3QJQB 5IB5B 3L5XH 3LIZA 1FFOB 4NWUL 4F7TA 4RIRB 4LRIC 2QHLA 5LBSA 1YEHL 3X3FH 1A21A 1IBFA 3GMNB 4IRSA 5ANMA 2HRPH 3LZFH 3NJMA 2NXYD 3O6FA 4F2MB 5F7HA 3ARBB 5JPNA 1HQRA 5TDOB 1INQA 4KKCC 3AQZA 3QS2A 4IU2B 5I1LA 4M7KL 4H1LA 2P8LA 2ROYA 1OGSA 3HN8A 3J27A 4DP6X 1EERB 1NLBL 4RAVB 3SYCA 5AB0A 1MCOL 1YMMB 1MFBH 1ZANH 2IBGA 4DKFH 4KU1A 4XMWA 1B4JL 4Q74A 1F56A 1Q0EA 2DQEL 3U0TB 4KRPC 3L1OL 1HKLL 1KCUH 2GIXA 3K81A 2FCBA 2WTRA 5BW7A 1R3IL 2CBPA 2P47B 5HGBB 3ROOA 3S3BB 2DYRB 1QBLH 2YMTA 4M5YH 4XPBL 5A2CA 7FABL 4MZIA 2VC2L 4O4YL 3FZUC 1A8ZA 3VXUB 3BUYA 3OKMB 1D5RA 5ILTH 1P7QA 3V7AG 5B4MD 7PCYA 3CSGA 3B7UX 2OMYB 3B8YA 2QPFA 4BCXA 1XR9B 4N5UA 3S36L 2Y1ZA 5B38B 5JDJA 2RALA 2HUHA 4JANA 1KTLA 4MMZC 3Q2NA 1MXGA 1W0WA 3SPGA 4FZEH 4LXFA 4PFEA 4NT6A 4Z7UE 3POCA 4B97A 2ZUSA 5GZOA 4LBEA 3NCMA 2VXTL 1MUJB 1TVHB 3TT3H 3L54A 3WAKA 3FTZA 1U8JB 5T33L 1IEAA 1J0KA 2CK0L 2OZNA 3BAXA 4P48A 2ZOUA 1CFTA 3MRPB 4PR5B 5F9JB 1VEOA 2QEJA 5GS3A 1YUHA 1ACYL 3CZGA 3ML8A 4LL9A 5K59F 1Q9OB 2EH7H 3UTSB 4XH2B 3LEYL 2WXOA 4NKQB 3H9YA 2E86A 1ONQB 3LKQA 2FIKA 3GJEB 3BD4A 2RBLA 3F85A 1I1CA 5CGTA 5JA8B 4QYOB 1BPLB 1Q4NX 4ZK8A 1JNJA 3W38A 4WNJA 5IBLD 5CD5C 1MCKA 3MHZA 1Q72H 4ONGH 3AJ7A 5DHEA 5AVUB 4KROB 2PXYD 4XAWH 3V4UH 1OM3L 3O3DB 4HV8B 1P5UB 3TT1L 1BVLB 4AZ8B 1AOZA 1UJTA 4WGKA 2ZXDA 2GCYB 1QI5A 4TSAH 5DEGA 1F4XL 2XV6B 5B8CB 3U46A 4HKZB 5EU5B 1MCBA 5SWQA 3UZQA 2VDNL 1UUNA 1CYXA 3P0YH 1UKQA 4YC2B 5C0CD 4R4FH 4ELMB 2QDVA 4ALAC 3U4EB 1T1YB 5T1DH 1WZ1L 4DZBA 1R5VA 1I1YA 1JGIA 1QKZH 4GB9A 1WS7A 4JREB 4KXBA 4ODUB 5CZXD 2Z7WA 5F71A 3QG7L 5L2JB 4LAJH 3UH8A 2YPLD 1AQ8A 3C9NA 2IQ9L 2V3DA 3WELA 1S7TB 2XSKA 1GZHA 3E3QC 1RU9L 2FX9L 1XCTB 4PD4K 3Q6FB 4H20H 2B3RA 2LV4A 4QR7A 3PAZA 2RIKA 3VFRA 2F1AA 5C0IB 4DP4X 3CCHA 3NFSH 3P3TA 1MDAA 4XCEB 5E9DB 5AVRB 4WWOA 2YSSB 3GXPA 2WTOA 3KR3L 2AK1L 3DSNB 3ULUL 4DZ8A 4FQXA 1J18A 4X4XA 1MCHA 1UKSA 2C1PA 3I3DA 1GZHC 3M17B 3K2KA 5BCAA 1CO1A 1QEWA 2A6IA 2JKIS 1NDGB 2X3AA 4ANUA 1JMZA 3WGVB 3D09A 5D1ZA 1I8LA 1TO4A 2X89D 3QEGH 2C3WA 5C8JA 3S5LG 4D0BA 3BT2H 3QJFA 4ODHL 4GAJL 2ORBH 5CJ8A 3CDGB 3FONB 1QUNA 2CPUA 5JW5B 2CUIA 3MFFB 1YDPB 5T5FH 1ZXKA 4JHUA 3ZT7A 3R19A 1WZKA 3D69B 3UC2A 3TX4A 2VRAA 3ZRSA 1M05A 3D5OF 1E4WH 1S3RA 3E7JA 1L5GA 4XPAH 1WGVA 2OSLA 2NY4B 3ULVD 1T1ZA 4WJ5A 5H37A 4IMKC 4G6FD 4JRFA 2DWEB 2WZ0A 3EH5B 4JRXA 3GDCA 4MMXB 2DQTH 1T89A 5FA3B 3SYQA 3BPOB 1CFSB 3MV7E 4YWGL 3TYFB 4YSEA 1TQWA 2W60A 3L3HA 4UCFA 4BHUI 4MQ7A 3U1QA 1KEML 5DZVA 1AI1H 2K1MA 5GRUL 2ZYSA 3T09A 1FZOA 2PWFA 4YHKH 1XTLA 5ABAA 4BFEA 4U1IB 3MRKA 1O6TA 3IFOA 5CBAA 3UXFA 1G6RB 1RQ5A 1UM6H 3O4LB 4YFLF 1UD8A 2D3LA 1J5OL 4JPKL 1FJ1A 3FB6A 3QC5X 5HHPA 3X3GL 3AB0B 3FCSB 1W6WA 3RI5K 1SN0A 1YEFL 2QSCH 3D25A 3FO9B 2FR4B 3QCVH 1MFAH 4S1QL 4P2CG 4P8QA 3MBED 1CDJA 4I18B 2B77A 5I1DB 4AZUA 2R2HA 3IAGC 4XWOC 3G3LA 1A4BA 3S97C 3N85L 5CSZA 5F7WC 3DGGA 1OAXL 1Q0YH 3PWPE 4A38A 2W59A 3FFCD 1JK8A 4R5VA 4DHLA 3QUYD 1DJGA 4NKOA 1GGIL 2NZ9D 3AM8C 1XGPA 5CSBA 3Q44A 3KWVA 4JKKA 2WXHA 5ICYA 2VL4A 4JQVA 3BGAA 2XLLA 2CE6A 3NSJA 4MWFB 5MI0B 2VR6A 3LN5B 4PUBL 4ZNCD 2X1OA 5HYJD 4FAAB 1I8AA 4OCWL 3RTQB 2Z64C 4Y19E 4HKBB 5EV7A 4W9HC 1U8HA 3QUZB 1S7RB 4A7QA 1L4IA 5FUCC 3UERA 1BG9A 3KPLA 5DC2A 4NUGL 2EACA 4RMQA 4AIOA 4OQTA 3GRBA 4JQVC 4UM8B 4UTAL 3MCYA 3TBSB 1ACZA 1PZBA 1P5UC 4U7KA 3TJEL 2BVPB 3BEVA 5L4JA 5DJXB 2G9HB 2YRZA 3PDOB 3L4WA 4UILL 4BWTA 4NQCB 1IM3B 3QPKA 5B8CC 2DQIH 4CDGC 3KGRA 1E6JL 2C5DC 4YC2C 1ID5I 5EU6D 5IB1B 1HHHB 1N3NB 5LHDA 1D9KA 1W72H 2F54D 2BZCA 1I7ZB 3RUGF 5DRXA 2P8PB 2BSTA 2DEWX 5AOZA 5HD8D 2Z92A 3VXMB 1YQVL 4PYGA 3MTXA 4RWYH 3HPLA 3CZSA 2DPKA 2FJHA 1YRKA 3LIUA 3O8XA 4L3EE 2XN9A 3QFJD 2AK4A 3A24A 3C5ZD 3EYQC 1A7NL 5D1QD 4YX2H 1MRFL 1D9KC 3ES6A 2ZUXA 1HEJC 2FZ3A 2WXPA 3FOLA 4E5XB 2CKBA 2OMUB 3BEWB 3SJVE 1PSKH 2BPBA 5F3BA 1OSPH 4AYGA 2CRMA 1BBDH 4NYLB 2CRYA 3VE0A 4ZPTA 3U2IA 1RFDL 2APXA 2VZOA 4KK9D 1H8SA 2HFEB 4H8UA 5GSVA 1OAZH 1E7UA 1TT6A 5AYUL 4AENA 1ZVSA 4FQQB 2G2NA 3QJHB 1J8HB 3ZMEA 4LSSH 5CEZH 5EWIL 2B2XL 4NKDB 1HX0A 4M8UA 3CLEH 3IDUA 1L9SA 4AK1A 2PYFB 1ZGLP 1LK3L 43C9A 2WGNB 3NJFA 4R7NA 3MLXL 4QYAA 3EXLA 4JFFA 5K9QG 3W0WD 2YARA 3A6BH 3FF8A 3K6FA 2PO6A 4O02H 1JERA 4Z3GA 1IC1A 3G6DH 1JDCA 3CX5K 3VGHA 1C5BH 3RKPA 3TN0D 1MHEB 3HMXL 3ZKNC 1D7CA 5A2JH 4MMXC 4N0FB 5IMMB 3BPOC 4G11A 5D7LD 1O7SA 4QNPE 1TSHA 1RULH 4F2ME 5L2KD 4NRXB 1IC7H 5TDPB 1AXTH 1Q9WA 4KVPA 2EDWA 1T04A 1X7SA 1P6AB 5KS9B 3NIFB 3V0HA 1NDMA 4QCIA 1H8OA 2ENJA 5FC9A 4PLKC 1UA7A 4KK8C 1DCLA 3D30A 1X9LA 4JG1L 3IJSA 5DQJA 5DJYB 1QVOA 4F58L 5IMOB 1R0AL 2QKIA 1DVFD 3AB0C 1IEBA 3UYPA 5I66B 2O5ZL 3P30H 3IFPA 1EA9C 1E6OH 1N18A 2J6EH 1E8XA 3D07A 1GS6X 3BVVA 3GIZL 4LEBA 1BEXA 4I18C 3QDHA 2GHWB 4M3HA 3VXUE 2A1WH 1JWMB 4P5KA 4HIJA 5B3SB 4MA8H 3MGOB 4CMMA 4P5MA 1SMOA 1C5DA 4X5PA 4X6DB 4APQD 1BOGB 5D7JB 2QKIC 1EMTH 4LGSB 4GQRA 4UT9A 3HNVH 1S7SA 4X9YA 4G3YL 3LRHA 3QXTA 1SEBB 2CIKA 5KYYB 4YIQB 3CNKA 5IQ9A 3QQ3A 2XWJB 4GP5B 4CGTA 2ZNWA 3K2IA 1CG9A 1NBQA 3FOMA 4NUJA 3TEWA 3F12A 5IWLC 3RTQC 3L9BA 3WJJA 3QQ9C 4F80A 1KEGH 1KJ2L 4JRYB 2F2HA 1Z5LA 3D0VA 3LPOA 3ZYIA 1O9VA 2DLIA 5JMRA 5EUOA 4KK5D 3MRBB 2D31B 4PS4H 5EA0H 1IFHH 3BIKA 4U7MA 5EF2A 3CHOA 4NC1E 2DRUA 3G5ZA 4WGVB 4A7GA 4NC0B 1B0RA 3NSDA 4PWIA 3UTSE 4HC1A 2VO5A 3NJLA 1WG3A 4ADGA 3D06A 4H8WH 5HJ3B 4RZCB 1A1MA 5F7LB 1JDDA 3AGWA 4IS6B 5F0JB 1HIMH 3MKGA 4DGIH 4HFUL 3UP6A 2G2RA 3EHBD 5CWSB 1WT5C 3VD1A 3IBOA 4AQ1A 1U3YA 3TH3T 1TYJA 2AJ3A 3WHE1 1MCDA 1I8MB 5L6YH 2DLEA 3NCXA 1XIWA 1I8IA 3PJSB 4L4VE 4HIHA 1KJVB 3LPGA 4KTYA 1WUZA 3OXRB 3S36X 4AK2A 4FADA 1IKOP 2RCSL 2UX7A 3UG5A 3ULSA 4EN3B 4HEPA 3WFBL 5T1LA 2WTPA 3V6OE 3MYJB 4HH9A 4QHLA 1C8PA 3MRRB 4AKOA 1ZSHA 3QZMA 1ITCA 3DIFB 3S37H 1H5BB 4BH7A 4ELME 3FSZA 5EOCH 1BV8A 3C12A 4GO6B 3NG5A 4KO6A 3SPVA 1DQQA 4DOHB 3LMJL 2D7PA 1MLBB 4N86A 3QPXL 1EFQA 3BKJH 1U58B 1YO4A 4AM0A 2HWZH 1HHIB 4YSQA 5EC1A 4A04A 4RDBA 1UXSB 4EOWH 4J1UA 5E99L 1O5PA 2NY3C 1E9QA 2LHAA 5AB9A 4F9LA 1NGPH 4Y4FB 3OKYA 3FT4A 1TDQA 4H8HA 5KSBF 4Q4IA 4DUWA 1NGQL 5CILL 1AKPA 4UANA 3OB0K 4B9PA 5HJGA 5I9QB 1AGCB 4JFHD 2KQMA 1PZ3A 1X5AA 2A77H 5IQ7H 1BP3B 2X40A 4M6OH 3S8FB 2X2HA 4XBEH 1E2VA 1M71B 4HOWA 5T1MB 1WA2X 2WVTA 4HS3A 5CBEB 3D4ZA 3TJHD 4F2FA 4QRAA 4P5SA 3U0PB 1RZIA 3MV8E 2NXYB 1E4XL 3FH8A 4K3DH 4XC3L 3U25A 5J0BA 1QLRB 3UL4A 3BKCL 3PHSA 4I0PD 2A6KB 2X4OA 5EUKA 2VDLL 4XPTL 3SDCD 1VCBC 4U1GB 3WL9A 5E8OA 3I85A 3WNIA 1U91A 4ZS7L 1RMFL 1LO2H 3W9DB 4NJAL 5DLLA 4ZPVA 3TBWB 3WJMA 5E00B 5HI3D 4JFXB 2FGWL 2C1OB 1F4YL 2LR4A 3WNNA 3JWOC 2Q2LA 4GAFB 5FKAB 1V55B 3U4KA 4TNWF 5C0GB 1JHLL 4JFOA 5D2LF 2ZCZA 3N41F 4PRAA 4ONFL 1P7KA 2FLBT 3MRHA 5JPMA 5D71L 1HH9A 1QP1A 5I8CA 3BPNB 5KTEH 5D7JC 3GHPA 1WGOA 4KNQA 4GKZB 1M7IA 4D9QE 5DD1L 1HHJA 3O4LE 1VESA 1SN5A 2XQYK 4OGAC 4MXQD 4QD2E 4X80L 5EORH 3ETSA 3T1FA 1ES0A 1G7QA 1FVEB 1DLHB 2VDKL 2Y3AA 4QJ3B 4QTIL 2EVGA 3SKMB 4DAGL 4F7MB 1B2YA 5KG9B 4OW6A 2XWBB 1HH6B 3UYRL 3RNKB 4Z7VA 2YBRA 1IRAY 4I0CC 5IHLB 1IC5H 5CUSH 2GK2A 3ARXA 3UOAB 1YYLL 4TVPD 4ZXBA 4PRIA 3QEUB 1URZA 4IRZA 5EOQL 5FOBB 1FGVL 3DRQB 1UWGL 4LSUH 4AYSA 3GKWL 4DERA 3VGFA 1E42A 4CKVX 1NCHA 5DRWA 1FFPB 1MCEA 1AGBB 4QHUB 3SOTA 4F93B 5GHWL 4FQ1H 3U1SH 5FX3A 4GMTL 1AYOA 3KLAB 3GGWA 1KWGA 3K6DA 3DIDA 4OKVA 3PL6D 5HYEA 5T3ZE 4ZXBC 1WFNA 5MEND 1NCAH 2F15A 4C56B 1PCSA 3CUPA 1CFVL 3QZNA 4D7BA 1D5IH 3AS1A 4JLRA 4JFQA 5LGKA 5DHDA 1IQWL 3S2CA 1Y0LB 4CVZA 4Z7OF 1KBGH 15C8L 2BC4B 3OXSA 35C8L 1J7VR 3WHE0 3IKCB 4J8QA 2X1QA 3MNWB 1QG3A 2PXYB 2V5TA 2YA1A 3QA3B 5CJ5A 4M5TA 4EN3C 4NQCE 2J1XA 4Q58C 4PRDA 2EDJA 4LASL 3KBHE 4Z7WA 1T2JA 1D6VL 1E90A 4UUJB 1MFBL 2LLGA 4XPGH 3LN4B 4FE9A 5EEWA 2N7BA 2CHDA 3L7EB 5C0CB 3PWJB 1QUPA 5D7KD 2IIJA 2JIXB 3VXME 3LHPL 1N64L 1IBYA 1CU4H 1ETZA 2UWEF 2BW5A 4JO8A 3QORD 4JFDE 3VX1A 2FEDD 1J0HA 2ERJB 2HLFC 5ILTL 3RJQB 3LXBA 4ZQKA 1FSKC 3W2DH 5ACMA 4X5RA 1BXAA 5IVZB 3OMIB 1PZUB 2VXSL 1UH2A 5EC2B 4WTQA 5IOKA 1YNTA 5FYJD 5AALA 3QWRD 4PJ5A 5SV3A 4ZYKB 2WJ7A 2AJVH 4MMYA 4F9PA 3UADA 3LVTA 2F7QA 4HWBA 2WY3B 2HH0L 4XE5B 3LS4H 5DUML 4N5ED 3OKEA 4K8RH 1BLNA 2IFGA 4GSQA 5DYOA 2V0AA 1J8HE 4Y8AA 3ATFA 2Q6WB 3KYKH 3D85A 1TZAA 1ID2A 1U8KB 4X5LA 1NGXB 4HHAA 4UM9B 4QIRA 1JGUH 4H5SB 2X4SB 2NXYC 2DQUL 2EH7L 5AB2A 3BSZH 1PX8A 1NBZA 3GO1H 3BRDA 3A47A 2JB5L 5EN2B 1HL5A 5BO0D 1JV2B 1JVOA 3AW5A 1SJVA 2XV2A 3GBLA 3ARGD 3JV0A 4HUNB 2C26A 3HCVA 1SXNA 3ZE1B 4B9CA 3U1PA 4KXZH 4OJDH 2ICWA 3DVNB 3HZYA 3EO9H 1GTNA 3SE9L 4IOFD 1JYVA 1JPFB 3V4UL 4WLCA 1F58L 5ACZB 1FRGH 4KZEL 4JM2D 5IVXA 5KS9E 1JMXA 3BPNC 3I3BA 3S34L 3NIFE 4ORGB 5F2FA 3NPSB 5C0JA 1UZGA 4F7EB 2PYEE 1VADB 2XV0A 2IH1B 1RH8A 1Z7JA 4U4IA 4Y4KB 4U2ZA 5ALCH 4N22A 3RWGA 4CN4A 5B4MC 4QAWA 4E2OA 5HHMD 1AZVA 1I7RA 3MRCA 4KKLD 3O6KL 2TRHA 3G6JE 4K23H 3GSRA 3FRPB 3LJ3A 3NA9L 4MDJB 3SGEI 5JW4M 1S9VB 1NA8A 1LNUA 2ZKHL 2Z35B 4JKMA 5FYKH 1ZVNA 2OJEA 3K8KA 2ZOKB 5KYUA 3LKOA 4WY7L 1LMKA 3FQWA 4H13C 2WP3T 3SE3C 3RVUD 2P52A 3TA3A 3LNHA 3MBEB 4U1HA 3JUZA 4ZT1A 4RA0C 3EDFA 3F6JA 3E8VA 1IC4L 3HC3H 3KJ6L 1LEKB 3EAKA 1QBMH 4L8SB 4M3KB 5AW2B 3FFCB 2HMID 3QUYB 2ZKMX 3FQ1A 4HT1H 5FGBA 4IOSA 3G5XB 2QTEA 1HSAB 2X1XR 3L2NA 4NKMA 3T0EB 5D4HA 2JKTM 4Y1AA 3ME0B 3TA3C 3OKLA 4FHKA 4HDIB 4JRYE 1TJMA 1C5CH 4Z77A 4AJWA 1EVTC 3BQVA 5SX4H 5HYJB 1CN4A 5I8EA 3VQ2C 1GHFL 2EDXA 5T3XH 1BHGA 4BDVB 1Q9KB 2PWDA 1YQ2A 5FGBC 2PTVA 1J10A 1T20A 4OLWL 1UM4H 4XOBA 2E9BA 4LSPH 1ETB1 4XNXL 1H6EA 3HZMA 4N68A 3UMTA 3CDCA 4XPFL 2OL3A 5DWUL 2XZAL 2PXYC 1YUKB 1FV1A 2W81C 2F61A 3IE4A 1NCJA 3OR6A 2VLRD 5I75B 1R5WB 4FFZL 3QZWG 1BZ7A 5DI8B 2VR8A 4UOQA 3I6KB 4GO8A 1NKRA 4MVBD 3SYAA 2IWEA 3RIFF 2MPVA 2CG9X 1ZIAA 1X4ZA 4P57A 4JO4L 3J7HA 1XXDC 3VYOA 3MRJA 5GGUB 2A6JB 2DQTL 3LKNB 3JTBA 4AEEA 2F54B 5IROD 3LDBB 1KCVL 2CDFB 2YC1B 4ZMTA 4GAYB 2O5NA 4OCLC 3HAEA 5CZXC 1U21A 3B7SA 3GTNA 4L9LA 3WTXA 4P9HC 4G9FB 3QFJB 5JIIA 3C5ZB 4LSQL 3MR9B 5D1QB 1NSNH 3TXAA 4DP9X 4YDIL 3B1UA 4Y9BA 4ZFGL 4FP8H 1KG0A 1SYSB 5MEQB 1PX4A 4M8QB 4DOHE 5I5MA 5EZPA 2CM5A 3N42F 4LPUA 2WQXA 1RZJC 1KNOB 1OP4A 3B7TA 3GM8A 3OMZA 3CZJA 4BJLA 2EAEA 1SBBA 3T2PA 4U1NB 3QDJA 4QRRE 5F96H 3W11D 5I5IA 1F6AA 3QC6X 4JJ5A 5EO0B 5IQLA 1MFMA 4ZNEE 1BZ8A 3E1ZA 1KB5H 4PW9A 3RX8A 2N59A 1SLUA 2Y4SA 5FO7B 1OL0A 2WPGA 4L2YA 4UINH 3W0WB 1NGYA 1G7LB 2AZUA 4XMLH 1GXEA 3DX8B 2BZDA 1R17A 4YK4B 2N0MA 4JJHA 2BNQB 1MQKH 3OAWA 1GVIA 4KTDL 3RGVA 5DZLA 2FD6H 3TN0B 3DV6B 2W38A 3G04B 1J9RA 4ZO9A 1QW8A 2AITA 2NY5L 3PWLA 5IBTH 5D7LB 2CU9A 5B1KA 1JAEA 2XOTA 4GRMA 5L2KB 4NKIL 5LXGL 1KULA 2YLHA 3V0EA 2GC4C 1M3JA 3FHEA 2FX8L 1A6AB 3QCTH 4JFPB 4YDJB 4ZOEA 3NPSC 5TF0A 3IGUA 2CO6A 5BMFL 4NZDA 1I7TB 3MJ7A 1OOWA 1ZHNB 4AVKA 3RGVC 3GIVB 2PR4H 2HB0A 3V5KA 4M4RB 1XF4B 3KMDA 1DE4A 3ECUA 5I23A 4LVNB 4RGOL 4K9EH 4XNYL 2WXIA 4FLOA 1RLBA 5HHOD 3V4VA 2W0FA 1DVFB 1J1OL 3DLQR 3HLAA 5C08A 1FZMB 1LEIB 1RURH 2W1NA 3UEZA 2DF3A 4UOW1 3ZHLA 1NAKH 3NTCH 1I1FA 1JZGA 4Z7QE 4U3SB 1MHCA 1TJHH 2C7FA 3WFHB 2OI9C 4K15A 3GHEL 4L8SC 5HYQB 4IBTA 2NW3B 4Y9CA 1NFIA 2CO4A 4MGXA 1E5UI 2VT0A 4I87A 5FAAA 2EP6A 1UACL 2NZ9C 4KK6D 4ZX3A 3HB3C 3ZGIA 4YDKH 1EWHA 1RUPH 1BBDL 5I1JL 1AG6A 3O3EA 4LKCB 4MJ5B 5JHLL 4ZX4A 5E70A 1V3LA 4PMFA 5EEUA 3DA0A 2Z31A 1GYCA 3ZKMC 3TCLA 4PRHD 5CIPH 4HFWB 4K7PL 4H0LC 4FABH 4X6CA 3ULAB 4RFOL 5BO1H 4X2UA 2BXYA 1ZV5A 3CLEL 1CFNA 1N59A 5DVKA 3OQRA 2JNZA 1KY7A 2YUXA 3AT0A 1U8IB 3EJYD 1K8IB 4LU5H 3A6BL 4P4RA 4PHZA 3WJLA 1YLBB 3BZ5A 2BVOB 3WI9A 1QOKA 4C56E 1G84A 5J57B 2EE6A 3EHBB 4PJ8D 1BJ1J 1LP9B 1SF3A 5C07D 3GSNL 1HAUA 3V10A 1AGDB 2JKRM 4L4TB 4A37A 3MLZL 3I6GA 4UT7H 4L1TA 5F7UA 3LDBC 4L8BB 2OMBA 4DVBA 1F11A 2VIRB 4LCCA 1RZGB 2VDOH 3FU7B 3PHQA 1EZVY 5HD8C 4WI2A 1PEZA 3WJLC 2OULB 3BLBA 4UV7H 4M48H 1JTPA 1X7TA 2ED8A 3PCYA 5EPMB 4QWWD 3L3DB 4OH2A 1U8NA 3OR7B 5AW3B 3C5ZC 5D1QC 5DD3H 1ERNA 4UZGA 5DZPA 5KWYC 4OF3A 4IYKA 2JJTC 3BPLB 3CSPA 3QHFH 1EEZB 3PDDA 4KC3B 4N0UE 2NTFB 2FWOA 5C0CE 3O2WL 2EDLA 5KVFL 1QSEE 2O4EA 2VLKD 1OLZA 4P2OA 2ZOLB 4OGYH 3GMLA 2KT6A 5CCJA 3JUYA 5KBDA 1JHTA 1HHGB 3OZ9H 1IGJA 5JW4R 5C0BA 4L37A 4HEME 3I02B 4UIMA 2GHZA 2VR5A 4JKPH 4ETYA 1JGLL 3HI5L 2IF7A 5GIRB 5IM7A 1EMTL 4WVRA 4RRPA 5K9KB 3UPRA 2XX1A 3MBXL 4QF1B 5BV7H 4D3CH 1XSOA 5B39G 2GJJA 1NUDA 4PGEB 3Q5OA 1IAIM 5H35A 5TE6L 4CBPA 2XIIA 3EBAA 4HCRH 1H8NA 2Y5TA 5IFAH 3LRSB 5A40E 2WWMD 1P2CA 4NZFA 4BFFA 2LVCA 2VUYA 2Z93B 1K4DA 3LNDA 4YK4C 2BVQB 2ENQA 2ZKYA 3F7YA 4FFYL 2ZXWB 1YPZF 5K39B 1DFXA 4BKTC 2P5PA 1I82A 1A6VH 2K8QA 3O2VL 5EA0L 1HS6A 3MLSH 3K1DA 1RI8A 5LGJB 2F18A 3UG4A 4JE0A 1ZHKA 2BWIA 3AFLA 5EZJB 3P4MB 1KWKA 5C0EA 2BM3A 1IAMA 2JVUA 3DX0A 4H8WL 4OF0A 2O6CA 2YD2A 4PGCA 4I0PB 1JN6B 2C4XA 1IVTA 1J9TA 3SDCB 3II3A 1I3GH 3TPUA 1RZKL 4O9HL 4YHIB 3ULVE 1EO8L 1HOCB 4FI7A 4YR6B 5HSFA 4G6JL 3N43F 4M8VA 2WIIA 4EAEA 1U2CA 4FOMA 5HDBB 3IGKA 4EKXA 2YRLA 2CIIB 4M02A 2AGJL 5AUMA 2W91A 2VDRB 1NUFA 1BZEA 3F5WA 4MA3B 1PS3A 1JPTL 2GUOB 3UJJL 2K78A 4APQC 2BOBB 2ZZUT 2KS0A 4UOW0 5KVDH 1P4LA 3LIZL 2F0CA 3S37L 4OIBA 1E9OB 1M4KA 1N0XH 4D9RD 3QUXA 5EOCL 5LBSL 3VGEA 3VD4A 4MJ2A 3UTZA 1XH2A 1GIGL 1AANA 4F27A 2OJ1A 3U4BH 2CHWA 1YSOA 3CN1A 4HUXA 1HINH 3F6IA 2FLMA 2HWZL 2BSRA 4C4KT 3BRGC 2ZYHA 4JO3H 5HDOA 4PP1D 3RWEA 3DOSA 3WLBA 1ADQA 4EOWL 2R8SL 1FO0A 4LPTA 5BOZG 1EO5A 4NQDD 3VXRD 2O6EA 3FL7A 4RFNB 2Y7LA 4XP9L 5KZCD 3EUUA 1NCNA 3FFCE 4GBXD 5E8PB 4P5TD 1MF2H 5EN3A 1NCOA 5H4YA 1A0QL 3DWTA 4JPIA 3DGCR 4ZAKD 3MJWA 3T0EE 3QFGA 5IFJA 1UOLA 4OFPA 2WMPB 3V79C 5HYJE 4NQQA 2A9ML 2B5IB 4XZUB 1OP3H 2HVJA 1RUMH 1E4KC 4Z7UA 2G5BB 5IQ7L 4ACTA 4AL8C 3TF4A 4FTDA 4KHTH 5SWSD 4XBEL 2N1KA 2CUHA 3KPQA 1TU2A 4N87A 1VZGA 2VJ0A 3QAZC 5D7IA 5GISH 4F33B 2DKMA 1NZRA 2R7EB 2X0UA 5K1VA 5DJDB 5CEYB 4NJ9L 4KGLA 5IHBA 3EUDA 2XFXA 3QFDA 3V5HB 4A6YA 3QXWA 2VDML 2DBJA 2XTLA 4KKQA 5LBGA 3SDYL 3X12B 1KXVC 2GJ6D 2JH2A 4KKBD 1UD5A 2O26U 4CVUA 3MAWA 2YD8A 2KC0A 5TJWK 5CEZD 4PBVC 3V4PA 1DHKA 5K9JL 3F64A 4Y7OC 3F7LA 1OZTG 2QPSA 2F54E 4XOCA 2AXFA 3U36B 1TVBA 4MAYD 2GI0A 4NZ8A 3GC3A 5EZLB 5IQNA 3SCMB 3SGKC 5L7XL 2H6OA 3QUMA 5MP6L 5AWNH 1RZ8B 2A9NL 4XO3A 3N1QC 5FYLD 4ZFZB 1KBBA 1PQZB 3N5AA 1KIQB 3WCYA 4DSYA 1SPDA 3QS3A 5CS7A 3WEBA 3QORB 4G9FE 3JTSA 2R51A 3SZ6A 4C58B 3TVMD 3B56A 4O5LL 1NM4A 5DHYA 1E30A 1O7DC 3D9AL 1L7IL 3AABA 3NZ8A 4ODTL 4OSUH 3ZBMA 1VZIA 4QHKI 4QO1A 4FTVE 4KNSA 3HBGA 2VN3A 1IBHA 2B4CC 1HE8A 2EXYC 2V2XA 3ESMA 2HT2C 2PP8A 2MOGA 2UY7A 3MDJA 5CUSL 1R5IA 3NP4A 3IDIB 4H1LG 1UZ8B 2V9QA 3PV7A 2DDQL 3IETA 1I4FB 3GDBA 4XNUL 4X0KB 5IW1B 3TJHC 1LILA 3RBGA 1O75A 4UI2A 1CGWA 4LAQH 4OD3H 1L3NA 3W0WE 1HZLA 2C8NA 3SDCC 2BS9A 2WLZA 3NCYP 2RFXB 4MDIB 5ESAB 2BNQE 4YVUA 2FIRT 5HI3C 3R4RA 3TBTB 3O9WD 4PV8B 1R3LB 2ZUVA 4RETB 4PJ9D 3PV6B 2YO3A 4PBWD 3A23A 5L2KE 5IJCC 4P3CL 1Z1WA 5TF1L 2X2YA 4ZTEA 4D0DB 1TSRA 4RVBA 4JM2B 2YD5A 5CLYA 3S0PA 2KHAA 3MGAA 3T77A 4LRNL 3L4UA 4IKLA 1MFDL 4MXQC 4XPGL 3WEXA 1NLDH 3KH4A 3OPZH 4E41D 3NMEA 5HHMB 1JNNH 4NZRL 3FNKA 3E6FB 3BGMA 4KV5E 4GSUA 2P44B 2WLIB 3H55A 1IGFL 1ACCA 1FZJA 4QXUH 1YEKH 1A2YA 3BDYH 4ZX6A 1AGFA 4JCMA 3QXDA 1S7VA 3ZE2B 3HS8A 2L3BA 4FDWA 5MERA 3WY2A 4GW4A 5GGQL 1WF5A 5AVYB 4NCC1 2QQLH 2D7TL 4M1GH 4GEJA 4AIZB 2OMNA 2RMNA 4X9FA 3H7BB 5GGRY 2AJVL 4J3WA 1FYTB 5HGDA 4MJ6B 2FBJH 5FDWA 3PL6C 1W0YT 5E1IA 4B60A 3KNBA 3MNVB 4PYHA 2DQMA 5LGYA 5KSVA 2JF1A 2VSMB 1Z5HA 3KPSD 1J0ZA 3E6HA 4WW2F 3A0OA 1E40A 5KYXB 4G42A 3WKYA 2EDRA 4YPGB 4AUYA 4OI7A 1PJ9A 4DGYL 1G9HA 1ZTXL 3BSZL 1RIHH 3OMAB 1IIIA 1NFKA 3VI3F 2Z1KA 2VLRB 1RUKL 1TTFA 5FK9A 3UDWA 1XH0A 1A3LH 4HJSA 3HI6H 2QVTA 1A1OA 3LRMA 4YDVB 1H3WM 1MCPH 1N4XH 1FCCA 1LP9E 2Z9TA 4QI3A 4L4TE 1PVHA 4KI5F 1HXYB 4LARH 5IUSA 1HKFA 2BK8A 2LFGA 3M1BB 3EO9L 5IGXL 2P3YA 2YMXL 3FO1B 3B43A 2Y3NA 4ZTPH 2PPAA 1CLZL 1J1XL 1S2EA 3DV4B 1QATA 1KBKA 5AOMA 2XY1A 5KUMA 3UDWC 2AABH 3QORC 2FEDC 2PPCA 3FRUB 5GGTH 1WIPA 4KVNH 5TFSH 3VFOB 4AY0A 3K91A 4NN7C 1DQML 1L7TH 1ORSB 3N55A 3DJZA 5F93C 2G4GA 2ZYIA 4Z18A 3T0WA 5ISZE 3QNXA 1AP2A 2N3JA 1QSVA 2Y23A 3LEXA 4NPJA 5C0AD 3FT3A 3LH2H 4OQTL 5J6GB 3QJZA 3FPXA 1BM7A 2EILB 2DQCH 3VA6A 1ZOXA 3OC5A 4U1KA 3D12B 4JFTA 4N5EC 2J8UF 3IB4A 4IEFB 4BELD 3S4SA 5ALBL 1FFTB 1D5BA 4YXKH 4YE0A 4S0TD 3BVNA 2XWRA 5HYSA 4IHOA 1O7DE 1BQLH 4MD4A 5HY9A 2X6UA 5H37G 1BQHB 3KXFA 1FORH 5KOMC 5DS8B 2VDPH 4AGQA 4OLZH 4PJBB 1LO5A 2AJUL 2QMKA 3QI9A 1PY0A 1X7QB 1ORQB 4TOYH 5CN1A 3ARGC 5L88H 1MCNA 2Q8AH 5L9DH 1DBKH 1D5MA 2HA1A 2WJ5A 5F8QC 4DIXA 4LLYA 4JDEB 5F7EL 5DCCA 2H0EA 1Y7VA 2W65A 4LSPL 3OL2A 4HK3J 4XVTH 4IOFC 2VLLB 5I5JA 2CKBL 1QRKA 1UVQB 4R3SB 2A2QT 3RY4A 3QI9C 3DYPA 5EO1A 1B0WA 1RIVH 4JM2C 1URIA 3S35H 2O61B 4YBLC 4ACPA 3C2SA 3L95B 1CF8H 2APWA 3NCJH 4ORZC 4V1DE 1Q94A 2XXCB 3FSOA 1V05A 4GP4B 3GNMH 5C3IA 5G5DA 5A7BA 4KKLC 1E5ZA 1FFOA 4QXTB 3L7FA 1XCQB 1ZLWH 1NCTA 1F6LL 3VXNB 3BH4A 5GSRB 2HKFH 1BEYH 2Q8BH 3SKJL 3MUZ1 5HHOB 5HDBE 3GMNA 5IB3A 3DO3A 4PSRA 1BFOA 3VRIA 4K3JH 5I73C 3PGCB 5ID0B 3CXDH 2CCWA 4IJTA 4UB0H 3MUGB 5GRJL 5EEZA 2OMVB 1QA9B 5BZDB 1U93B 5KAQG 4OT1L 1G1CA 3WSQL 1SQMA 4V11A 5DQ9A 2KERA 2IPKB 2K3HA 3N04A 4B3VA 4NRYB 5KBPA 3RWJA 4FP8L 3B2MA 4OBRA 3JVGA 5DF0A 4TNFA 1MCWM 2VISB 1IGYA 3WGUB 4DJMA 2GFBB 3MZGB 4IGBB 5JHMA 3LRKA 3WN5A 4I3RL 3LKRB 4IKJA 4HGWB 4BZ1A 4POYA 1KGXA 4PRHB 3N9GH 3VXUA 5I15L 3VW3L 4U3HA 1RIUL 1ZLUH 2WVSA 3FTSA 3JVGC 5KSAD 1VB9A 1YEIH 2XIDA 5ES4B 5H4ZA 1XQ4A 3NIGB 5B38A 2DQJL 1INEH 4P23D 3H42L 3WN5C 4K5LA 2VQUA 2DBLL 2P5WA 2YK1H 3EFFA 4JO1L 1CGSL 5J6HB 4XMLL 4MVBC 4XCNA 5IHUL 1UZ6E 3WUWB 1RSYA 5ERWB 4RX4A 4PJ8B 1U8JA 4BSWA 1RSFA 4CDHA 2Y24A 4B0MB 2WUBH 3W9EB 2ZX7A 4OLVL 4UT9L 2JK5B 5IROC 3CVHH 4MHHI 1JNLL 2W0LA 4FQ2H 2NQCA 3QCTL 3VRJB 1T3FB 1JZEA 3DX6A 1Q9OA 2HLEB 1WV7T 4KDTA 4DETA 3A6OA 4R7LA 1TTUA 5CJQL 4J6IA 1IUZA 3SE8H 4FZ8L 4ELKB 2P24B 3GJEA 4XN7A 4Z3TA 2YD7A 3BLKA 5ESVA 2ATKB 4F37K 1NIEA 4QYOA 3VFPA 5C0DB 4MTMA 5GGSY 2CLZB 3FW6A 3P4OB 1QQDA 3P2BA 1XGTA 2KZBA 2VLKB 5D7KE 1YYML 3QQ4A 5JOPD 4IKIA 1BZ9A 2ITEA 4HIIB 4L4VA 5K9OB 3TURA 1BIHA 1M1SA 4HC1L 3NTCL 3VFTA 3VB8A 3KH3A 4QXGL 1BVLA 4X4ZA 4AZ8A 1TJHL 2OJZH 2P5ED 1JI1A 1VEMA 4OTXH 3TFBA 3QDMD 4UDUA 4JPQA 2ARJA 1BQ5A 3W11C 3BN9D 1A65A 3RVTC 3V6OA 1EPFA 4UTBA 1G9ML 3OSVA 4YDKL 3OKDB 4ABWA 2OW7A 5F3FA 1AZBA 4ELMA 4Z3FA 2XNAA 5F9DC 3HC0A 1EGJA 1T1YA 3PWUA 3VRLE 4FXGA 4E9TA 2G2PA 1ZLVH 3T4AC 4NP4L 3QYCA 1ZS8A 4QRPD 3BP5B 3P77B 1Z0NA 2NY0C 1A7PL 1E28A 2GVYA 4RGND 5BO1L 2A83B 5T1KD 4F8TA 2MH4A 3A6CL 3Q6FA 4PREB 4GNKB 1TUPA 3M45A 1FLRL 4HALA 5C0IA 4JAMB 4YHYB 5HDWA 2ISDA 5HVHB 3H3KA 4HXBH 4GW5B 2BVTA 2H2SD 3ZZQA 1T1XA 4UZSA 1WCBA 3CV5A 4N9GA 4EQ3A 3I50H 1G0DA 2ADIA 4G8IA 5G55A 1NDGA 2IDCA 3GYRA 4QHMB 3AITA 4GRLA 4TKWA 5CEXB 2KI6A 3POHA 5D55A 3IK2A 1ZGLA 1A6TB 3NN8A 4FA6A 3SGJA 2EUVA 5GJSH 1VFAB 4ADJA 4YXHH 1KTJA 4UV7L 3RWCB 3TWCH 3NCCB 4ABUA 4QEGA 5GZNA 3MV8A 4EZKA 1X6LA 3AXIA 2IH3A 1RK1A 2ZAIA 3BYYA 3V0JA