3LD8C

Structure of jmjd6 and fab fragments
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
219
structure length
210
Chain Sequence
QIQLQESGPGLVTPSQSLTLTCSVTGDSITSYHWSWIRQFPGKKLEWMGYIYNSGGTDYNPSLKSRVSITREISRNQLFLQLNSVTTEDTATYYCARRDYGTYYFDYWGQGTMVTVSSATTTAPSVYPLAPNTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional arginine demethylase and lysyl-hydroxylase JMJD
publication title Interaction of JMJD6 with single-stranded RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ld8C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ld8C01
1RU9H 3T2NH 3ULSA 4OD1L 5IB2A 1XGYH 3OR6B 3KPRB 4PJDA 2V2WB 2NY7L 2MJWA 4P2OA 3S3JA 2DIAA 4DUWA 4WNQA 5DRZB 3TN0C 1B4RA 1VACB 2XWBB 5B38G 4JR9H 4YHOH 3HZYB 2GJ6D 3BKYL 1UJ3B 3QQ9C 4X7TB 4Y2OA 5HPOA 1P6AB 1JNNL 4ONHB 2NX5B 3HMXH 3R1GH 3S6CA 3GSNL 4M7ZB 1OW0C 3CDGA 2IAMC 1CFBA 4UQ2A 5CJOL 3BH9B 1BM3H 1XGQA 1ZVSB 3LPGA 1YUHB 5TQ0H 3M17A 2AXHA 4HLZH 1Q9KA 2OZ4A 4OQTL 4MQ7B 1FFNB 3MOAL 3TT1L 4HUVB 1HHJA 3NCBB 1OB1A 4N8VA 2MHAA 5HGHB 1UEMA 3WE6A 3QFJE 3UPRA 2AW2A 5ALCL 4F7EA 2KL6A 2JJSA 5IBTH 4FFZL 3UJIH 2P5WD 5M94B 3LMJH 5DHVH 3MRCB 4OLWL 4ODSH 4PJAF 4BZ2H 4B0MM 5A3ID 1CFSA 1YY9C 3N85H 5EUKA 3VMNA 1EFXB 1C1EL 2LE9A 3LH2L 2CRYA 4AEHL 4QRRB 3D87B 3TJHD 2Q3ZA 3EOBA 1JWMB 1OAKH 3VCLB 3ARDA 4ALAH 4ESKA 1JFQH 1SEQH 1WIOA 2YWYA 4OTXL 3ZYJA 4ETQB 5B39A 1FG9C 4ACPA 3IFLH 1UB5B 4HDIA 4KGJA 1XR9A 3EYFA 1X6NA 5K9OA 1UXWA 2VWEE 1V7NL 2E6JA 2O61B 2FGZA 3OJ2C 3OAYK 3VXPA 5B3JF 5JXEC 3MFFA 4WJ5A 4IIQA 2E7MA 4AG4H 1FNLA 5JW4R 1OAXH 1N2RA 5D5MA 1CICD 2HRPH 5FM4A 2R1WB 1CDJA 2GJ6B 1FJ1A 4HAFA 4UQ3A 5SWZD 3O9WC 1WBYA 2R0LH 5EUOA 2XIDA 3TZVC 2F54A 1MQKL 2AK1L 5H8DA 3AU1A 5I1JL 4XHJD 3T3PE 1ZV5A 4NKMA 5TDNA 2IPKA 4RGMC 1B9ZA 1UACH 3CU1A 3CDCA 4HUUB 5I15H 4RISH 5GRXG 2I5YL 2OI9C 1YMHA 3DGCR 3HI1B 3B9KC 4NOFA 4OZFA 2VE6B 3CXDL 1EHLH 4XNZB 5T1DH 1OP5K 4YFLF 2HYMA 3MRDB 1XR8B 4AQOA 4HPOL 5FYJL 3EIFA 1FL5A 2P5WB 4K2UH 4K9EL 4JRWA 3BZEA 2Z31D 5FYKD 4OM0L 5B4MD 2XG5A 1HDMA 3OJDB 4HJ0D 4NZTL 1JWSB 1CR9H 2P8MA 4PIRF 1GZPB 3V6BR 4LRNH 3O4OC 4P5TA 4QOKA 3QPQD 5B8CA 1BGXL 4LCCA 1S5IH 1NQBA 2YKLH 5I17B 2J1KA 2X4UA 2EDQA 3Q6FB 1XGUB 4MD5A 5GRUH 3W2DL 1QEWA 4PTTB 5F9WB 5JA9A 4G9FE 3BPNB 4HKZA 1AP2A 3QUYA 2DICA 1O7SA 4BFIB 3GMRB 4U0RC 4CW1B 1KUMA 3HR5B 2YXFA 5IEKA 4Y2DA 5LBSH 2ATPB 3STZB 2PTTA 3QXVA 5E2VH 4C58B 4OZGF 4N1HB 4BQBA 1CICB 5F7FA 1OAZL 4X9IA 4DKDC 4ZUVB 5I30L 5BVPL 2Q76B 4NKIL 3P4MA 1F4XL 4BKLA 1IGCL 3QDAA 3RA7H 3FN9A 3I6GB 4R90H 2R2EB 5SV4A 5FUCE 3LN5A 1R5WB 4I3GA 3BMWA 4PS4L 5J1SC 4JY5L 3BN3B 4NOBA 2ITDA 2OTWA 2VZ3A 2BRQA 2WLZA 5HGGS 1W0VB 3S88H 3IDMB 5CEZD 3U0TA 1KOAA 3OR7B 5C09A 3HS0A 3MO1B 3I2CL 5HHQB 4JY4A 4M1GH 4Y5YB 1IGML 4ODHH 4XVTL 4XI5C 5F7DA 2EKSA 5IEHB 2Z31B 3HPLA 3QEQE 1A0QL 1DEDA 4H1LG 1ZHLB 1LEGB 4X80L 3VD9A 3IJHA 4YNYB 2DWEA 1KT2A 3PGFL 2W9DH 3RY4A 4F33A 1WSST 5CBEA 4UV4L 1WEJH 2FSEB 4MQXD 5KOVC 5C0JB 5L2KD 1DVFB 3SDAD 4EDXB 1Q9WA 2HT2D 4R6UA 1RIVH 3EYSL 3PDOA 3MLZH 4P59L 1X5JA 2ZUQB 3L5XL 3MOQA 3W9EB 1PSKL 4XCCL 2NY0B 1RZIB 3FRUA 3AY4A 3MC0A 4N90D 2VXUH 3C6SB 3L9RB 2D7TH 3CSYB 4WV1B 2E7LC 3RNKA 2B8OT 1PYWA 3BT2L 5IB5B 2ICWI 3FHAA 5C07E 5F6IB 4X5XB 2NPLX 1TJIL 3MCLL 1OY3B 1BD2E 3QO1B 3U2SB 1TTFA 3H0TA 5FKPA 1KPUA 1QLEH 2C1PB 3NZHH 5SWZA 2WNGA 5KTEH 1P7HL 5DVMA 2PXYC 5HY9B 4K3HA 5MEPA 1SM3L 2RQ8A 5L0QC 1UQSA 2DL2A 5DMJB 3WLWC 2BRRH 1JN6A 1HILA 4XPBH 3RI5F 3RGHA 2GTZA 2NY6C 3OZ9L 5EBMB 3UEZA 5DJAA 5E2JA 2A9NH 1LEKA 4OM1H 3MJ8A 1MCWW 3UCRA 4RMUA 1FNEA 3V0WL 5C92A 3FT3A 3MGOA 43CAA 1UH2A 2VZVA 4WWKA 1DQQB 2Y7QA 4XAWL 3O3BB 5EU4B 4HEPG 3QCTH 1PAMA 5EO1B 4ERSH 4NCDA 1JE6A 4HF5H 2J8HA 5I9QB 3BKML 5L2KB 2D2OA 1DUZA 4HLJA 3F7VA 4YAQB 1MHPL 2NXYB 1H3PL 3PWNA 4FQXD 4PJ7B 5JDSB 1HSBA 4M62H 4YFDB 3GSNA 5J1AB 1HN1A 2HWZH 2WAHA 3EYOB 3HZKA 4P5KB 4ODXA 5D6DA 3V5HB 3O3EB 1VGKB 4CMMB 4I77L 5E8DH 5EU3B 1F6AB 4OQTA 3OXRB 4G6AC 3VJ6B 3JV6B 3BI9X 4M7LH 3QI9A 1RIHL 4HWBH 2W91A 1U8OB 5C0FB 2Z4QB 4LLWB 1YC8A 2KPNA 4TYUA 1GOHA 1JYNA 2YPLD 1MHCB 3KPOA 1AQKL 5DS8A 2FDBP 3MNWA 4JO2H 5JO5B 1DN0B 4NQVB 3ZT5A 4LF3A 4AMKL 1IQDA 4UDTA 2IH1A 1T5XA 3GI9H 5EU7E 2QHLA 2J88H 2VDQH 1MJUH 1C5DB 4I0PB 1WTGT 4R96A 2BFVL 1W72B 4ZFZA 1I75A 1GH7A 5IHZA 2OL3B 1VA9A 4N8PA 2A83A 1MNUL 1KG0B 1CGTA 3N9GL 4UAOB 1P6FA 5DK0A 2WQ8A 1YQVH 3OKNA 3TNNB 4JFED 4ZG1A 4JRXE 2YPVH 3OQ3B 1WBZB 1NEZG 4MXQC 5CGMA 3JTSB 4IMKC 1KCSL 4PB0L 1N7MH 1C5CL 1ZOXA 2JJTA 3RWFA 1ULVA 4M7JL 1IFHH 3JWDH 5DHXB 3S3PA 3GRWH 3VXTA 4NUGL 1K3ZA 3H9SD 4POZC 3SDAA 2MSPA 3QZWA 3O2VL 4YGAB 4FQXB 4KJYA 3HE6A 4ZO6A 1H15B 4DVBA 3UDWA 4XNMB 1JYXA 3HPJB 5HBBA 3MREA 4KQ4H 4JRYD 4GAGL 5D1QC 5DUML 4MB3A 3HE7B 1OCWL 4XPAH 4OFYA 3FHQA 5ID1B 1FQ9C 1XGRA 3F7PC 3K8MA 4IBLT 2BMKA 1R3LA 4G6FB 4LVEA 1YNLL 1VADB 5E8EB 1IAIL 4B53A 4EUPG 3VRIA 4PJ8D 5CJBA 4N0UE 4WHYH 3GBML 5CD3B 4P3CH 1IZJA 1NFIB 1LEIB 2YPLB 3JUZA 4H0IA 2A6DA 4OQ1A 3UJTH 4JM2F 1S7WB 4JO4H 5GIRB 5FHAL 3MV01 1U36A 5FXCH 1U3HD 3CLEH 4PGCA 1H3VA 4R4FL 3R0NA 1SHMA 4GXVH 5T1MA 2XTJB 2AXGB 2X4SB 3QDME 1T1YB 4KTEH 1MF2L 2G9HB 1OAUL 1DLFL 5T5NG 3S37L 4C55A 2B5IB 5DD1L 1BOGA 2XZZA 5GS1C 1PZUB 2E6QA 2IWGA 3HI6L 3QEUB 4AENA 4NT6B 3VGAC 4X9BA 3TM6A 4BH8B 2LU7A 2BHYA 4QHNA 5LQBL 3C08H 4JFEB 4TRPH 4MX7B 3IXTA 4I18C 2D31A 3LD8B 3MV8D 4OD2B 2V9QA 2H8PB 3WFDL 1NFKA 1E27B 5LVEA 3TBSA 4BH7A 2AQ3A 3T0EE 3BJLA 1R5VB 2FIKA 3MACL 4NP4L 5EPMB 5DJ2A 5JOEA 2H32H 3WJLC 3H9SB 2KQMA 2IPUK 5EN2B 2DD8H 1B0RB 1L7TL 3GJFA 3C09C 4QY8B 3RDTD 4H88H 4U1GC 2GCYB 3DHJA 4HG4J 4XH2B 4PJCF 4LHUB 5C2BH 1BZ9B 5JUEH 1KLFA 1OPGL 2ITCB 5CIPA 4CDGC 4OLZH 4OZHB 3MODH 4PJ8B 5JMOC 3LKOB 1MHHB 4NQEA 1A6AB 1BX2A 3ZT6A 1DQML 5D2LA 1NMCC 3BQUC 4I48B 4Z0XA 3UYOD 3P30H 4ODVH 4I3SL 2HLFD 3H9ZA 3ORJA 2OTUB 2QSCL 3QJFB 1XF1A 1GC1C 3QIUC 1IBGL 4JCMA 1CLYL 4DKEH 3DECA 4F8QA 2CLVA 5KVGH 1ZA3B 1U3HB 5IJVB 4ZAKB 2R1YA 4L8DA 1J87A 5E99H 3EFFA 4Q9QL 1RUKH 4FQLH 2VL4A 1CFVL 4G8EB 1G7PA 4LU5H 3EFDL 5DRNA 4ZPVB 4NQCA 4X6BB 4YBQD 2GW5A 4WFHD 5CWSA 3U4EA 1QACA 3TEUA 3WO4B 1NLBH 4NYLA 1PD6A 3OHXB 1TCRB 2ZUUA 3WDJA 4FQCH 4JO1H 4D0BA 2OL3H 3MV8B 1HK6A 1U92B 1XF3A 1NANI 1DUYA 4S1DC 3LKNA 4HIHA 5DMGC 3CFCL 2YOCA 5LGHL 4R4NC 4LOUD 1JPGA 5C0EB 5EOQL 1O0VA 4PLKD 3MRRB 1H3GA 3AB0B 2W07A 1TLKA 1ZLUH 3K1DA 3FFDB 5DJ8A 3RDTB 3RWDB 3U7WH 1BREA 3QHFL 2DQUH 3WEXB 1PKOA 3LAFA 1KTRL 4WW2C 5D2LF 5TJWK 2GFBA 3ZMRA 3FT4B 1G9MH 4P57A 1A6ZB 4M1DH 5DXWA 4ZTOH 3O6MH 3ZDXE 4Y4KD 3MR9A 5GS2D 3R06A 1F90H 1N4XL 3DGGB 1CFQA 3KLAB 4JN1H 1CLOH 5KS9B 1RUML 4HBCH 3AROA 5JPMB 5SWSD 2BCKA 1O5DT 1OW0A 2PYEE 4X5LA 5CINL 1WV7T 3HMWH 4OGAC 1NL0L 1LDPH 4PJIF 3HFMH 2H9GA 3D5OF 3K3QA 3O11B 5D8JH 2DQGL 4DFHA 1MFDL 4N0CC 4U3XA 3CFBB 2XA8H 4MLSA 3IDXH 3IJSB 2EDJA 3MNZB 1B4JH 2AXFB 3LKRB 3FO9A 4YO0A 2ZOKA 5KSAA 4GKZB 2EC9U 4LLVB 3JSSA 1N3NA 3TVMC 4YXLH 3EYUL 3VXUE 2VLKA 2OJEB 1F3JA 2DLFH 3NACH 5JDJA 3WUWG 5DJCB 3NPZB 1TNNA 2BOCB 4JY6A 25C8L 1YMMD 1KIPA 1HHGA 2NR6D 2FJFB 5I73C 3RAJH 1VPOL 5C71A 2G2RA 1NAMB 4HIEB 2DQTL 1DL7H 1YNTA 1RZ8A 3VFGH 2UV3A 5HI4C 5C0DA 3QB7C 1AGEA 4L4TE 2W92A 3GNML 4MXVF 4PD4J 1U6AH 2AK4A 2YXMA 3GKWH 5JXEA 2BY0A 3U0WH 4F9PC 4U1KA 2L4OA 4WHTA 4P2RD 1T1XA 1QKZL 4U0QB 4NIKB 4R0LC 4X6DE 1OGAD 4DVRH 2FJGA 4PGBB 1MLCB 3V4PH 2B1AH 1U8PA 3X3GL 5ISZA 5KSBA 2CD0A 5SWSB 1T5WA 4DW2L 1RVFH 1FIGL 1KTDA 2WWMD 1T2QL 5IR1B 2MCPL 1S8DB 5JOPD 1KEGH 2H2PD 1S7VA 2OS7A 4KK9D 3TIDB 3D0LB 2H45A 3RVWD 2FX8L 2P8PB 4R8WL 4H25A 5HHOE 3NH7H 2ZCLL 2BVYA 5HYEA 3NA9H 2XQBH 5DR5L 4HIIA 1T04B 3FOLA 2A6JA 1CGYA 2DQJL 4WW1A 1I9RL 4QHUB 1C16B 1WT5C 1IEBB 3C60D 5DVLA 1QHOA 4YIQB 4BZ1L 3IU3B 4L9DA 5IFAL 4M9PA 2JK5A 5BMFH 3HZMB 4TUJA 1IAMA 4U6HA 1YMMB 4MA7L 1K4CA 3QFJD 1S7UB 1A7RL 2W9LA 3PE9A 4B7LA 1CBVL 5D71H 1GGIL 2I9LA 5ESQA 3ZYOA 1K8DA 3SDXE 2YA0A 3PL6D 3TO4D 5E8PB 2NY5H 3BP7B 3NZ8B 4MDJA 1QR4A 5E94A 2KUTA 2Y25A 2YMXH 1QFOA 3L5WB 1EEQA 4NUJA 3MLWL 1P5UA 2AVGA 4PBVC 3IFNH 4KUZH 3MJ9L 4UINH 4X99A 8FABA 2HMIC 4NKDB 5GRZA 5ENWB 1JUFB 5I19L 2DMCA 2FYYB 2D03H 1YC7A 1SBSH 1BOYA 1Z0NA 3MCKA 2JJWA 1SJXA 4HJJH 1PDKA 2RFXA 1OGAB 4KXZI 1S9VB 3ULVE 1JPSH 3G04A 3IB4A 1OAYL 2VR4A 3FCTB 3HUJB 2VDPH 3GMLA 4ONFL 4KV5E 3TCLB 5I76B 3D3VD 3ARFC 2ZWLT 3HNSH 2A9MH 5BRZE 2ADJA 3ZTNH 4BUHA 4K94H 2JB6A 3CZFB 3RVXD 1MCJA 3MXVL 2GK2A 3KWWA 3O3UN 3J7HA 3TT3L 1AGDA 1HQ4B 1IGFH 2QKIB 4Z18A 3BEWA 2Q7YA 4MJID 5I1LB 4PR5A 3P0VH 5D1ZD 4JN2A 1UB6A 5CHNA 1ORSB 2HT3D 3D69A 3IVKB 2EDHA 5E5UB 5DQJB 3CLFH 1GC1L 1KN4L 4NGHH 5DWUL 3C60B 2X1OA 3QP3A 5ETUB 1I9IL 1JNJA 2B1HL 4I0KA 1QR1A 3Q5TA 3IKCA 4N5ED 3INUL 1BQUA 5E8NB 5FOBB 1UENA 4JFOB 3PNWA 2J6EL 4X7SH 4XVJL 4AEIH 1AE6H 4FMFA 4DGIL 3KDMB 3RVTC 3VH8A 3KS0H 4XMKH 4YUEL 5C1MB 2VDRL 3GSVA 3ROOB 1ZGLB 2NY3C 3TO4B 2P49B 1ES0B 1OTTD 5DC9B 4CAGA 5A16A 4NO0A 1MIEH 3HAEB 3FFCE 2HFEA 3TWCH 3L3JB 1UKQA 1I7RB 4O51A 4Q9RL 1A1OB 1A5FH 3G5VB 3EOTH 4JDZB 2DTSA 4DQOH 2N7AA 5I74B 4O00A 4GG8A 5I1GL 1D6EA 2HH0H 3DYOA 4LBEA 4XRCA 2JJUA 1BHGA 4MCYA 4P2RA 4WHYG 1R0AL 1S9WA 3WV0A 5F3BB 3L3GA 1A21A 4G43A 3O8XB 2NTFA 4HK0A 2PXYA 4OCSL 3SDDD 2YD2A 4HS6A 1A4KA 3D3VB 3PWJB 1BLNB 3S4SA 4EEEA 2DQIH 4U2ZA 2C26A 5IB3A 3T0VA 3QXAA 1WIPA 1C7SA 4LDOB 4TVPH 2R0WH 2XZQH 1HWHB 2MPAH 3MXWL 4FQ2H 5B22A 3PIQA 4S1SL 3OKKB 4MJIB 4KUCF 5BVJB 1NCAL 3OKLA 3BHBB 3BXNA 3GGWB 1EO8L 1GGYA 3ZDZF 1AY1H 2H1PL 1B88A 5DYOA 4OI7A 4NQSB 3QUXD 3RU8L 2L7JA 3IFPB 4JQXA 1JNLH 4C57C 1Q0XL 2VABA 4MVBC 2WUBH 3O0RH 2DTML 3RTQD 3TJEH 4HUXA 3FB8B 3QFJA 5E0QA 4LSQH 3MRLB 1E4XI 1NCWL 5JXAL 4IM8A 1FH5L 2E9IA 4GUPB 2I9TA 1CGVA 3GMNB 3GHEL 4OF7A 4RBPK 3RL1A 3G5ZB 3CVIH 4Q6YA 1BMGA 4FQQA 4ZTPH 2FEEI 3VFSA 1FBIL 1BPVA 4RAUB 5F6HI 2Q8AL 4G7VH 4LHQB 4QHMA 1MFAL 2VDNL 3RKPA 4PGEA 2FHFA 4JFYA 3PGDB 4BSJA 4PV9A 4L3EE 4RFEA 1UT9A 5I1AB 1WFOA 4JKKA 4I3RL 4KJPC 4CU7A 4EJ1C 4KRPD 3CC5B 3E3QE 1F4HA 1RZJC 5C07D 1MI5E 1J1PH 1IGYA 5T3XL 5I71C 1K6QH 1QO3A 1ZT1B 3QQ3B 1JTPA 4X4YB 1NFDE 1NBZA 2YR3A 3A6OA 2XNAA 4K7PY 2CLZA 4LSUH 3W11D 4GLRH 4LNRA 4PJAB 4YGVA 5C0GB 5JW4M 3S3SA 1Q38A 3PHOB 4LVHB 5SX5K 1MIML 4LSRH 3W0WB 1R3JB 3JBG7 2FECI 4AH2A 4GRLC 4JG0H 1EEUA 4E0RA 3V52H 3KPTA 4LSPL 3PXHA 4LMQE 5J57B 3B8YA 5HDBE 4CVXB 1NBVL 3FQWA 5GS0C 1HQRA 4IMKA 2QR0A 5IB2B 5I8OH 3RTQB 1HWGB 4P46C 2ADGA 4XNUL 4C83B 5GPRA 1FGVL 4XPTH 5GZOD 3HHRB 4FFWC 4XCEB 1YEDB 1TDQA 3Q48A 4YLQT 1GGBH 3H8NA 1SY6H 3IRZA 5GGSY 4D9RD 4LIQL 5FUOL 5D1QA 4XPGL 5CILL 3CDGB 4M5ZL 1XGQB 3PWPA 3RZCD 4M7LT 4DUXA 3AAZA 1J0IA 1KLGA 1MH5A 5FGCB 3DROA 2X4PA 4PUBH 4G9DA 4XP5H 4ZUTA 2IMMA 1HHJB 3ZDZE 2GAZB 4G9FA 3T65A 1TQBC 4KKAD 3RWHA 1PKQB 3WE6B 1FZMB 4KRPB 4F37K 3BMVA 3SDDA 4KK8D 4F7EB 1F8TL 2ED7A 1ED3B 1Z9MA 1IRAY 3MV7E 4N5UA 3STLA 2NW3A 3GIVA 4QGTA 5DRXA 4J3VA 5F21B 3U46B 4WTZG 3VFMB 2AAVA 5BV7H 2F53E 3THMH 3MGTA 4NN6C 3C2AH 5J56B 4O2CA 4ORGB 5DT1H 2X4QB 3D1MC 4FQIH 3ARTA 4XNQB 2ADFH 3I6LE 1MRCH 2ZUSA 5DRWA 4Z7OF 3DHMA 3RJQB 3L7EA 4HDIB 3MJ9A 4I18A 4KKLC 1A6UH 2YPKA 3C87A 2XWJA 1QP1A 4OLYL 5H37G 5DI8A 3D9AL 4YDLC 3NGBB 5HSFA 5KVDL 1QNZL 5DDHA 3DMMD 1I7TB 2YS4A 1J88A 3WJLA 4S1QH 4X0KB 5MENE 3QDJE 4JRXD 3QEQA 2XQYK 1RZKC 1WBYB 3DX8A 1MCHA 4OZGB 4HMEA 3TFKD 1WBXA 5I6XB 1PW3A 2VDML 5MI0B 1LO5A 4NHUA 1LE9A 2GTWB 3LRSA 3ZKNC 3RZCB 4GSDL 4WFFD 1IEHA 3Q0HA 3S5LA 2F58L 3UTQA 1PG7W 3WXWL 2AERT 2P8LB 2CH8A 2PTVA 3WXVH 3P9LB 2UVEA 1U8LA 3BQUA 1Q72L 4LCIH 5HVHB 5I1HH 4LSTH 3ARWA 4WENB 3OXSB 3FB7A 3QIUA 1D5MA 1P4BL 5DD3H 5SV3A 1AIFA 4IHOB 2EYRA 4X6EB 3NABH 4M5YH 2R9HC 1LO0H 2J6EA 1PZ5A 3DI3B 8CGTA 1S7SA 3GJEB 1BD2A 5GGVY 2YK1L 5DK3A 4XVUC 1S9XA 4MQSB 3BSZH 5EOCJ 2FO1A 1ZE3C 4JPIB 1TCMA 1Y6KR 1TJGH 2A77L 1KLUA 5FB8A 2IBGA 3O6KH 3KVQA 2B20A 3QDMD 4M7KL 1EXUA 4M43L 4XTRD 1MJJA 4J4PC 5BO1L 3QUYB 5C0CE 1Q9OB 4JQVC 4NQUA 4WEUD 3LKPB 5KW9L 3NCCB 4Y1AD 5IEKB 4IS6A 4JPWH 1MCPH 4RFOL 1I9JH 2PTTB 3DMMB 1U8HB 2HJFA 5IB4B 1QFUL 1FL6B 2YC1B 3PWLB 3ZDYF 1RSFA 2NXZC 4HKJB 3C5ZB 2W0FB 4JRXB 3UROR 4OIIL 4HBQA 5EU6D 5C0NC 2EZ0D 3O3DA 4PRDB 4BKLB 1JHLL 1Q94B 3X14B 3MQIA 2DWDA 2FX7L 3V6OE 4G8GA 3T0ED 2EDTA 4Y4FD 1EBAA 2Q6WA 3SDCC 3O4LE 4K7PX 2WINA 4BQ9A 1NJ9A 2EYTB 4L29B 2DQEH 2ITDB 2MCG1 3SGEI 5ADPL 3NFSH 3VD7A 4XC1H 4E42A 1A02N 3UBXG 3I02B 1AGFA 5DC4B 3GKZA 4MNQD 3QHZH 5IVXE 1OD9A 3G5YA 2F74A 3BW9A 4GRWH 4P99A 3GMQA 3QEGH 2EH8H 2OZ4H 5EZOH 4N0UB 6FABH 1UA6H 1ZSDA 3IJHB 3IU4L 5C7XL 2DWEB 4NBYB 4QTIL 1FCGA 1CL7H 4ODWB 5ADOH 1PEWA 1I3RA 2VKWA 4FFVD 3C8DA 3CSPA 5HYJE 5ELIA 2VZ1A 4LVOC 4AM0B 1QBBA 5DJXB 5IV2B 5EZJB 4EKXA 4H20L 1MCBA 5BS0D 3PDOB 5DK2B 3TVMA 3GBNH 3P0YL 2NYYD 4NO5A 1ERNA 3I75B 1RZJL 3Q3GA 4U1JA 3IAQA 4NJAH 3SKNB 4Q7DA 1EEYA 4KHXH 3EW3B 4AY0A 4R7DA 4Y1AB 2GHWB 2AEPL 3TPUA 1N5YL 3V7MA 4NC1E 4W4NA 5D7IA 4ENED 2MNUA 3X3FH 4MS8C 3E8UH 5A2LH 4HIJB 4K3JL 4YZFE 4D9LH 5T33L 4HMDA 2F5AL 2YA2A 5TPWL 5EU6B 4WW2F 4ZUWB 5IBUG 1P84J 2R0ZH 1AHWC 2GQHA 1ZGLP 5IW3A 4I13B 3O45B 5MEPB 4EI6B 1KPRB 4PLNC 1AO7D 5GJSH 1XIWC 3L95B 4XHQA 3GSQA 3JWNC 4Y4FB 3ARGD 3F62A 4AYFA 4IEFB 1R6VA 5GS0L 3CU7A 4LSVL 3MRGA 4ZUSA 4D0DA 4JM2D 3RWIB 2P43B 4BA8A 4OLXH 4F7PA 1VKXB 3TBWB 1GZQA 2X4NB 4MNQB 2Z9TA 5JW3L 2HVKB 1RFDH 4G80A 1SEBA 3DV4B 1OARL 4HWNA 3CPLA 3FT3B 43CAB 1KB9J 4FG6C 1A7NH 2C1OA 3ILPA 5BZDB 4JZJC 1J9CT 4Z9KB 3MBXL 4LEOB 3ULUC 5C6PB 4NFBA 1DBKL 2VLJE 3SDYL 4QRUB 1AFVH 1HXYA 2PYED 1DUZB 3K2UH 3QO0A 3UTPD 3BAEL 3T1FA 3F7VB 4M1CC 2DQCL 5BS0B 3OKDB 1WT5A 3DUUA 3PWNB 5D7LA 1JRHL 3L5JA 1TQCC 2NMSA 4RRPA 5D7IF 2IJ0C 3S36H 3HZKB 3FO2B 4ODXB 3LEYH 4YHML 3PP4H 2I27N 4LQ1A 3IFOB 1U8IA 2ICCA 3OKYA 5E1HB 4WUUD 3SGJC 3RX5A 3TA3D 3DRQA 3I3EA 3QI9B 5F96L 3MTRA 3VXUD 1CYGA 3NPSB 4OFKA 2F8VA 3OTTA 3B4NA 5ECJE 4LLQA 3LB6D 1PJ9A 4E5XB 1AO7B 1YEEH 2G5BA 3DURB 4POUB 4Q6IB 1U8JA 3FMGH 3TYGL 5AUMA 3PXJA 1FNGB 4TOYH 5D93B 5HGAA 1DFBL 2IH1B 3P11L 2VDKL 4JM2B 5BXFB 4CN4A 5C3TA 4R96B 1CE1H 1UKTA 3HCVB 1NUDA 1S7XB 1U8QA 1NMBH 1U3JA 1IAKA 5K9JL 4L4TD 5KVMC 3IYLW 5GRJH 5FYLL 3BP5A 3GIZH 1DBBL 3BDXA 1RZKL 4V1DE 4CVUA 1F3RB 3OAZH 5DK0B 3ARFA 1S7TA 2F19H 2C7UB 3BO8B 1E6OH 2I60H 3SJVA 4ZOCA 3DNKA 4HX1B 1M6OA 2CUHA 2OP4L 5CJXA 4KI5F 4DGYL 1TZGH 4B5EA 1CT8B 3RVVD 4NNYA 1SBBA 1R3KA 1T2XA 2YEZB 4JFXB 2V5RA 4Y4HD 2D7NA 1SJEA 4GBXC 3HE6B 4NCC2 3KYKH 4NRYA 2ZUVA 2ZG3A 3V5KA 5E2UL 3P9MA 4NPYB 3WS3A 3B9EA 3WN5C 4U1IB 2BMKB 4K3EL 3FT2B 1IQWH 4WUUB 3TA3B 2EIZA 1H8SA 4PJCB 3W81A 1IC5H 4EQ3A 2XWTA 4ODUA 1YEFL 4XZUA 2Z35A 4YHKH 4OCMC 4EBQH 2EDRA 3FQXB 3VI3E 5CS7A 1PG7H 3FZUD 2CIIA 2X1QA 2FLRT 5TF0A 5LAXA 4OCYH 5BW7C 2QL1A 4DZBA 3ARGA 3EDKA 2WANA 1D9KC 4R3SA 2QTEA 4DN4H 5C0RL 43C9B 4L5FH 5DO2D 4OZIE 4IRJC 4YBLC 2GK0A 3SE9L 5L7XL 2BSED 1IC1A 4DOHB 3P4LA 1DQTA 3DARA 1BOGB 3WHXA 3NBNA 3C8KA 4S2SA 3PJSB 4PV8B 1N6UA 2VITA 1IAOA 2A1WL 4PG9B 2CDFA 2BNUB 3IXTB 5EU5B 2DQHL 2P5EA 4TUOA 2LABA 1KYOK 3ULVD 3G6AB 3DYPA 5LJYH 1XEDA 1YEIL 3ZKMC 3TBSB 3P77A 1DQLH 3CCHA 4KMLB 1MCEA 3D39A 4JFFD 4IDJL 4PB0H 4OB5H 3NFPA 3ARQA 1CXIA 4P9HC 4Y4HB 4CU8A 2BNRE 4OD1H 4F7MB 3L3KB 3D2UD 3LEXB 4K8RL 2NY7H 2Y5TA 1YYLL 1XCTB 3HLAA 3MRFB 2W9EL 5LGKA 4WEMB 4ZYKA 3BKYH 1SJHA 3V5DB 4FP8L 4CVZA 1MWAB 1KPVB 1G7HA 4JAMA 5CIPB 4NWUL 3TN0D 1JNNH 2XY2A 1VHPA 2R0KL 1BX2B 4NQEB 3GSNH 1QTYT 5D2LB 3VA6A 3ZKXB 5CJOH 5ESVA 3BWAB 1T1WA 3UTTD 2QLVB 2YSSB 4OQTH 4MMZC 3VGGA 2CLVB 3MOAH 2IAMD 3TT1H 4M8QB 4L8DB 5C0AD 4KI5E 4RIRB 2V2TA 2Z92B 1G7PB 3UTZB 2BVOB 4G8FA 5ALCH 2APWA 3IXAB 3HRZB 4FFZH 4NQCB 3WD5L 3FFCD 2DIBA 4PJIB 3ILQC 4HKXA 2D0HA 1R5IA 2FBJL 4OLWH 2ARJB 4U7KA 4Q97A 2NY2C 1P9MC 3Q6GH 1C1EH 1MVUB 3Q1SL 3LH2H 4J3TA 4AEHH 4GAYA 4YE4L 1ZLVH 4OAWA 2G75A 5IG7B 4KROD 2PCPA 5F9OL 1KELL 3ARPA 4UBDC 2DLEA 2P45B 3LQZA 2OSLB 2YD5A 4OTXH 4QRQA 4N8CL 5L9DL 32C2A 1I3UA 4PJHA 4JFFB 1MUJB 1BBJA 1BZQK 2XG4A 4PRIE 1TTGA 3L5HA 1V7NH 3EGSA 4GRLA 3D2UB 2IGFL 5HHVL 3U9PL 5HI5C 4GG6F 3MMEB 2ZG1A 1R3HA 1TZIB 5DEGA 1MAML 1MLBA 5HHOA 5IGXL 4P46A 3ULUL 4G8IB 2O26U 1L7IL 4P57B 5LKNA 3VRJB 3TN0B 1Z9SA 4RFNC 1IGJB 1MQKH 2AK1H 1D5XB 1WZKA 5I1JH 4MAYC 3R06B 5F93C 3O9WD 5TE6L 4O9HL 5D70L 3TZVD 3UTTB 2I5YH 5ICXA 1YPZE 4S10A 3VWKC 2IAMB 5DJ0B 4MJ5B 3CXDH 5C0AB 5F8RC 1QA9B 1S7QA 3EO0A 2Y1VA 4MWFA 2NZ9C 3SDXA 4Y8AA 4HPOH 3B9KD 3HC4L 4PGJA 5FYJH 3CFEA 3UTSA 4K9EH 5JHDD 3FFCB 4JFHE 3QA3A 5DD5L 1F58L 3TESA 1H0DB 3BN9C 4OM0H 3FO9B 3VDBA 4TNVF 2QHRL 4NZTH 4QWWC 2AJ3A 3VXME 5JOFA 3TIEA 2A0LC 3CX5K 2FGWL 5DJ6A 2XXCB 3W5MA 1WZ1L 2X4TA 1I1RA 4QXTB 4IRSD 4KROB 1BGXH 2R2BA 3K4ZA 4L3ED 4PJHF 4N8VG 3PWUB 2EEBA 4KJQC 1KIPB 2MOVA 5CSZA 1S78D 4P4RB 3WFBL 5HGBB 1CVSC 3W2DH 2IG2L 3WHE1 1U3ZA 5EO0B 2G2RB 1P7QD 1AGBA 2FATL 5JA8B 5HGDA 2EO1A 1IE5A 4ISVA 1F97A 5BRZA 4NC0B 4EQ2A 1JGUL 1FYHB 3EO1A 2Z8SA 5TH2B 5TGBA 2RCSL 5I2IA 4ELMF 4U1SA 1OAZH 3NCEB 4PJFE 5IMLB 5I30H 5BVPH 3DXAE 4U1KB 4NKIH 4HUWA 5B39G 2OMBA 1F4XH 3GJFH 1IGCH 4UILL 2CDGA 3CSGA 5T5NF 5I8CA 3O9WB 4PS4H 4DN3L 1J0HA 3VXSA 3MRQB 5J12C 4JY5H 5FA4A 3TZVB 3SCMA 3W39B 1SYVB 3VFWA 1T5WB 5CIPH 3ZLQC 5JORB 4X4XA 4RGMB 3SPVB 15C8L 3A6CL 5EOCL 3I2CH 4C54A 3B9KB 1IGMH 4XVTH 4UIMB 1MELA 4H25B 5JHDB 1GL4B 5L8KB 1WUNT 4J6RL 4LEXL 1A0QH 2ZCHL 2VNCA 2MMXA 1NGXB 3V2AR 2A6KA 1KF9B 4X80H 4ZS6C 3U36A 3S9DB 4PJ5D 4JGMA 3PGFH 4XI5D 3VFRA 1JGDA 2GI7A 1LO2L 4TULL 1B2WL 2IBBA 4UV4H 4ZSOE 4KUCD 3KYOB 4OZFG 5D1XD 2AEIT 4U6YB 1OSZB 3CZJA 3M45A 1VEOA 1X5AA 2V6HA 2QADD 1ZHNB 1J1XL 3KPSA 3EYSH 4D9QD 5IF0A 2WW8A 4P59H 3L5XH 3O4OB 1K2DB 1AXSB 1JK8A 1PSKH 2I07A 5DA4A 4DUVA 2I9LB 4JVPA 5ESQB 5MEQA 4XCCH 1K8DB 1Y6NR 1FCCA 1CDIA 4LPUA 2XICA 2ZUXA 1XFPA 2V9TA 4MDJB 4PJBF 1QSEE 2SEBB 3OAZK 3VWJD 3QWOB 3NIFF 2PO6C 4BQ6A 2IFGA 3MA7A 4J4PA 3BT2H 4MHHG 5IW6A 2F53D 4RMRA 2AJXL 4HWZA 2LTQC 4CDHA 5JLZA 4U0RB 4C59B 1TJIH 4X99B 3MCLH 4YQXL 1IT9L 3RI5K 1LP9E 3I6LD 4Y5VC 2BVPA 3F8UB 4Z7NE 2YD9A 3CH1A 2XACC 3V9FA 1SM3H 3L7FB 3T3ME 2CIKA 2QEJA 4QYOA 4P9HL 5FUZL 5HHNB 2D0FA 5F9DC 2X89D 2HP4A 4YWGL 1ZK9A 1T0NB 4HKBB 1N8ZA 1VFBA 4I4WB 1LD9B 2E9JA 3OZ9H 4I9WD 1KXTB 3RP1A 5MEND 4XBEL 2Z91A 1YEHL 2JB6B 5C0BA 2AJYL 5HD8D 3V0WH 4RMVA 1RQ5A 2RAMA 1KN2L 4H0GA 1U3YA 3WKML 4XAWH 1FN4B 1NKRA 4GKNA 3UTOA 5CHNB 4PJ5B 3HC0A 5MP6L 4PRHE 3QBTB 1YA5A 4FNLL 2HTLD 5D1XB 3IKCB 3BKMH 3UZQA 1WAAE 4JEGB 4Y5XC 3BPOC 3O3AA 1EVTC 3TNMB 1KXQE 3MZGB 4UDUA 1MHPH 1H3PH 3KPPA 3JXAA 3IDYC 3GSXA 3SY0A 3VH8B 1CK0L 1PQZA 4OBRA 1E4KC 2EDFA 1MI5A 4O02L 1P7QA 1G6RL 2R23A 4I77H 4Z7VE 3KGRA 5A16B 1CD8A 3P73B 3QQ4B 4NO0B 4DJMA 4X98A 4F3FB 4HPYL 1NFDA 2JCCE 1RIHH 4U1MA 3JV4A 2QQKL 1ZWIA 1EPFA 3RGVA 5KN5B 3H6JA 1WLHA 1KSRA 4GG8B 1N5AA 2HJKA 1BVLA 4MCYB 2VC2L 2ZSVA 4Y16C 1UXSA 2UY7A 1AQKH 4P3WA 1F13A 1MJ8L 4AMKH 3AS2A 5ITFB 2DLTA 4G43B 5DFTA 1ZLWH 4WU5A 2M8XA 4HK0B 3NCYS 5ID0A 3G9AB 3SGDI 5L0QB 4HS3B 4JM4L 5D96B 4R2GD 2BFVH 5HI3D 1MNUH 4LCUA 5MENB 2Q86B 3I50L 3N9GH 4M61A 5KZCD 2BSSA 3GEWB 2NY6B 3OAUL 2EIBA 1DQJA 2EICA 2ZUWA 3FO0L 4D8PA 1WQVT 2BOBB 4PY8I 3I84A 4YJZL 1OHQA 2P48B 2RB8A 1CXKA 3O4LD 1KCSH 3QNYB 3X12B 3MRNB 1C5CH 4HXBL 4JZJA 4M7JH 3LN4A 3T0WA 4NUGH 3PHQA 4NFCA 3DI2B 1EUTA 3O2VH 3VGFA 2OR9L 2HN7B 5GGUA 4UNVA 2DLGA 3VFOA 2CRIA 2V5YA 2BNQD 4GAGH 1ZS8A 5DUMH 4POZD 2FBOJ 1J0YA 1OCWH 3MV7A 4NWTL 3RL1B 1QFWI 1YNLH 1BVKB 4HK3N 5KVFL 5HYJD 1IAIH 4FQHB 4C56A 5I1DB 4MYWB 3F65A 1A9BA 5IIEB 4LMQI 2EDEA 3GBMH 3WNLA 1KIRA 3WS6A 5C8JA 1RK1B 3SGJA 4R7NA 5ALBL 1UWGL 2H6PA 1JPFA 4P2QE 4UT6L 4HHAB 3BDYL 5FHAH 4XMPL 3G5XA 4X9FA 1HI6B 1S7RA 4R4FH 1P4LA 5GRWA 2VXTL 4PRAA 1I85C 1WJ3A 2QSQA 1MF2H 4MDIB 1IGYB 1OAUH 1DLFH 1UC6A 1KB5B 3S37H 3ZHDA 4MNGE 1QSFA 2A38A 1FO0L 1QO3B 5DD1H 1U8NA 4GT7A 1JJUA 2YUVA 3HI6H 3QDJA 1WCQA 2WIIA 4FQJL 5LQBH 3KPRE 5CZXD 3QIBD 2X9WA 3JVGC 4C4KT 4OGXL 3WFDH 4W6WB 4I5BA 1CZ8L 5DVNA 3A0OA 3ZE2E 3IDJB 4OKDA 3MACH 4PRPA 4NP4H 4YHIB 2V2XB 1IL1A 3C6LC 1HQRB 3V7AE 4HAGA 5J9PB 3EHBC 1AXTL 1L7TH 4L9LC 5D7JC 4LPVA 4JHWL 1EDQA 2BNQB 3KYNA 3FB5B 3QDHA 4UT7L 1X4XA 2K3TA 4ZS7L 4X5WB 4QHKI 1FV1B 1AR1C 1OPGH 3UP1A 1HYSD 3OKEA 3SE4A 5GSVB 5D1QB 4OF8A 1DQMH 1FSKB 3OV6A 4BK5A 4B41A 3WN5A 3PWPB 5HHPA 3QZWG 4I3SH 3CFDB 1KLGB 2QSCH 4XXDB 1ZT4A 1FYTE 3P4OB 4GW5B 4WDIB 4XAKE 2V9RA 1IBGH 3EDFA 4G9DB 1CLYH 3P4NA 5FO7A 5DEFB 2APTA 1JGEA 1G0XA 3KJ4C 4N1EA 1JI2A 1IC7L 4QRRE 3IDNA 1BJ1H 3RWHB 5C0CA 4TSAL 1CFVH 4OSUL 2GUOB 3EFDH 2R56L 5BW7A 3ROLA 1I1CA 3REWB 1H3TA 5FECA 2XKNB 4LLMA 2E7HA 1KCRL 4HV8A 1OGTB 4IRJA 4G6KL 4AL8L 2BZDA 4FS0A 4UNUA 4S0TD 5DC0A 3AGVA 2BVQA 3EJZC 2FL5A 4Q9BA 3V6OA 3QIBB 5GS1B 4M02A 1NGWA 4WVRA 3F12A 5TDOA 1OM3L 3VGAB 2LVCA 1I8KA 4ZD3L 5JIIA 3O4LA 1A6WL 3V6FA 2H26B 3CFCH 2GJ6E 4I18B 5LGHH 5FF6A 3K8LA 5EOQH 5T3ZD 2YPKB 1QBLL 2ICWJ 5KSVB 2WP3T 4V2BA 2H2SD 3WFHB 3H3KA 4P23D 1CFTB 3HZVA 2Q8BL 1JHTA 3QHFH 4WI4A 3QH3B 4NZJA 4FQ1L 3C09B 3CXHJ 4U1GB 4LCYB 1WBXB 3ZE0F 3E0GA 3LDBC 1GVIA 3LRSB 1CXHA 1DP0A 1XCQB 4G3YL 2IFFL 2DB8A 1C12A 1N4XH 4E41A 2HTKD 1U95B 1RUMH 4GKOA 2AJUL 1NMCB 5CINH 1RZGA 1NL0H 1OLLA 3WYRA 3GSOB 5MERA 1HXMB 3QIUB 1D5MB 1AIFB 2DQGH 2EYRB 1INEL 1MFDH 2DBLL 5C9JA 2OQJB 2C4XA 1F4WL 4OGAD 4P4KC 1S7SB 1HHHA 3MX0A 5EBGA 1MQ8A 4EI5A 2VLMD 3LIZL 3BGFC 5I16A 3QPXL 3S96B 1A6VL 3RIFF 3QWRA 3TBVA 3EYUH 2ESVD 2RGSA 1U93A 1G6RA 3DBXB 2E6PA 3CMOL 4EVNA 1PY9A 1P9MA 5FB8B 25C8H 2QQNL 5DSCB 4CRPA 2FB4L 5B38B 3C5JA 1VPOH 1UG9A 1S5HA 2W60B 4U33A 2DQTH 1X7QA 4LKXA 5GQBA 2VISB 4JVWA 1U8KB 5SX4H 3BH8B 3CFKB 1AD9A 3T8XA 4JDTL 4HGWA 2EDBA 3I6KA 2FR4B 1XMWA 4P2OC 4O2FA 5LWYL 3GNMH 5J3HC 2FZ3A 1MFBL 1J8KA 6CGTA 4PJGE 3QUML 1INQA 3OJMB 1MFCL 5DD6B 5EBLB 3REVA 1G7JA 4GXUM 1I7ZB 2DQFA 1RHHA 4Z77A 1KTLA 1QKZH 1TVHB 3NN8A 4PY7A 4X4ZA 2A74A 2VLJA 2F8XC 5ERWB 4WW2B 5DZOA 4JKMA 4WI3A 4RNRB 4XGZA 3RWEB 2BNRD 2P7TB 3ZL4L 5DMKA 1VGEL 3X3GH 2GT9A 1DTUA 1FIGH 4MAYA 4DW2H 4DAGL 4HXAL 1T2QH 3Q5YA 4PRNA 5EWIL 2MCPH 2VLRD 3PWVA 4WTZA 4PLJC 1XF4A 4WO4D 3G5YB 3BW9B 2FX8H 4R8WH 3VWKA 2E8YA 4K3DL 3L3IB 1T66D 3O6FC 2VQ1A 1WWAX 3QCVL 2O5ZL 2ZCLH 2GJZB 3T77B 1NC2A 5DR5H 2DQJH 2XOTA 3NCYP 1I9RH 5F8QC 2ESVB 4L3CA 3TGXA 1X44A 3ARDC 4ZDHA 4BZ1H 5IFAH 1ZLWK 4KKNA 5CMAB 2YD4A 3TVMB 4KI5D 4MA7H 5GZNC 5HPMA 1XF2B 1A7RH 2C4FU 1ZLSL 1T83C 2C5DC 2NNAB 4PJXA 1CBVH 1GGIH 3GMOA 1UWEL 4H8WC 4ZXBC 5ESAA 5DUPL 5I73B 4BSVB 3DETC 4X7CC 1CTNA 5A2JH 1FG2A 4IIQC 4V1DA 2W0PA 1M05B 3MLWH 1P69B 3MLSL 2J8UA 3MJ9H 5JW4Q 3MRKB 3DX9B 5CD5C 5CEZE 2DIJA 5I19H 1Y6MR 3BEVA 3BPCA 3CGTA 1A6TA 5GGVL 5HVFB 3EOYG 2G5RA 3M1BA 1FO0A 1CFNB 1VFOA 4PRID 4U31A 1OF2B 3WHE0 2WV3A 1WCBA 3ARUA 4R0LB 4DTGL 4ONFH 4GO6B 2AKRA 5FO9A 3E6FA 2VLRB 4UTBL 5CCKL 3ECBA 3DV6A 3T2PA 4Q0XL 1JF1B 1UH4A 3CPLB 2IALA 5L2KE 4NJ9L 1IM3B 3MXVH 1JNHA 1RZFL 2XZAL 5FKAB 3TT3H 4DCQA 4KWUA 1A47A 2CQVA 3QUZD 4GQ9L 4PJ7E 5DJYA 2I24N 3QEHA 5IMMB 4YHPB 2PYFB 3PABA 1GC1H 1KN4H 5DWUH 1VEMA 2NLJA 4R97B 3RY5A 5B8CC 1I9IH 2CPCA 5KOMC 2B1HH 2PETA 4LCCC 3B2UC 5M7QA 3INUH 2UZYB 4PJXF 1K8IA 4F7TA 2J6EH 4F7CA 3RKDC 4U6XA 4XVJH 5D7LB 4DGIH 1AC0A 1PVHA 4QXUL 2BHZA 4YUEH 2VDRH 4L4VA 3MRPA 4JFHD 5C70A 3V6ZB 4OZIA 1UJTA 5E24E 3BYYA 2J8UF 3CX2A 2FJHA 2BXZA 3U79A 3DRQB 3FRPA 3VXMD 5DLML 5F7EL 2NY3D 4Q9RH 3MNVA 1A4JB 4JJ5A 2PO6A 5EFIA 5DMYA 2K9UA 4Z0BL 1FL3B 1PX4A 1R0AH 1Z5LB 5EG6C 1YDPB 1IGIL 1KC5L 5F3HB 4O4YL 5D2NB 5HJ3B 4OCSH 5DJDA 1EO5A 3SKOA 1H5BC 2BNRA 4W6XB 5JMRA 2IF7A 1QQDA 4H1LB 4BQ8A 3ZE1E 3RUGF 5GISL 1AR2A 1M7DB 1GSMA 1NC4D 3L3OA 3DXAD 4OD3L 4A2MA 4NM4L 3MXWH 4HZAA 4S1SH 4XP1L 1OAQL 5GGTA 3QUZB 2E7BA 3SJVB 2X4OA 5ACZA 2IMNA 1BIIB 1NCAH 1TENA 1W0WB 1EO8H 5MEOB 5AD0A 3FQUA 3RFZC 2H1PH 1D5BA 4NQDD 3U48A 3TJHC 3RU8H 4MMXC 2Y23A 1T22B 3D18A 3KNBA 3HC3L 5IHUL 1Q0XH 1EJOL 4M6ML 1SJEB 3VD3A 2DTMH 4TQEL 4P2YA 1I1AD 1A2YA 1ITCA 1FGNL 5F9WC 4Z7WF 1NCWH 3WS3B 5JXAH 2YN5A 2YPLE 1FH5H 4MVBD 3BESR 4QCIB 4AK1A 3GHEH 3OF6D 2CGRL 4JLRB 4NNXB 1DBML 3VXMB 5IOPA 2NY3B 4RMSA 4XBGB 4XZUB 5HDLA 1FBIH 2XTJE 5IKCA 2Q8AH 2OXHA 4PREB 2D0GA 2WQRA 1MFAH 2DKSA 2VDNH 4ZUUB 5DJZA 3UPCA 2ICEA 3FQTA 1E28A 3U0PA 3F7QA 4XHJC 5EIQA 5LAXB 1NDGB 2VZUA 5JNYA 3PQYA 1KXVC 3CUPA 4I3RH 3MLXL 1QSED 4JFEE 4J8RA 5GGSA 4BSWA 1QRNE 2XYCA 1NPUA 5T3XH 1T03L 3EOAB 3VRLE 2CRMA 4V2CB 5INCB 5I15L 2NY4D 5H2BA 3C8KB 4S2SB 3DXAB 1TMCB 1ZMYA 1YYML 3GB7A 1DDHB 3H9SE 3WIFA 4WWKC 4BQCA 1VERA 4JHBA 1QLRA 2APBA 2CDFB 3E1F1 2D4DA 4NN7C 5CSBA 1BFTA 2W65A 4NO2A 3W9DB 1MIMH 1A7PL 3U6RA 2ORBL 3FQRA 4GW4A 4NQDB 3S4SG 1P4IL 4LSPH 1F11A 3CCHB 3D39B 2AEQL 3QPQC 3QUMA 1YPZA 3NFPB 1NBVH 2JJVA 3BGMB 5AYUL 4RAVA 3VE0A 4OZHE 3KLSA 5HYFA 4Z5RA 2EKJA 3QNXB 1FFOB 1I1AB 4XNUH 2X5PA 5T5FL 5HDOA 1I9EA 3HLAB 2YRLA 4JPKL 1FGVH 1JYWA 4LSSL 2X4RA 1SJHB 4CVZB 3MYJB 1AD0A 4GG6B 4OCWL 3T0AA 4TTDD 5JQHC 3PP3H 1J1OL 4LIQH 5FUOH 5F6IC 4XPGH 5CILH 4JFDE 2NW2A 1GCFA 3DVGA 4Y19D 2BSRA 3BIBX 5ESVB 2P24B 1W0YT 4M5ZH 5T1KD 2Z93A 1JZ5A 4X6FB 3IF1A 2AV1A 5KANI 4M00A 4RX4A 1X5YA 2M26A 4H8WL 3VGHA 3MRHB 1WZLA 1M71B 3NIGF 3LRHA 3G6JA 1QSEB 5K59F 3NIDE 4WY7H 3MROA 5FK9A 4UZGA 5BQ7A 4G8FB 4UV7L 2VXVL 3QIWA 1F8TH 2M2DA 3MV8E 4OV5B 2BY1A 3T0DA 2FNBA 1NEZB 1CGSL 1R5IB 5L2JA 5L8LB 3QFDA 4KKCC 4GAYB 5C08D 2V7NB 1HYRC 4OAWB 3O41B 4PP2A 5IQ7L 1RPQA 1NGZA 5D7SL 3RPIA 4HWUA 4LASL 1JBJA 32C2B 5DTFA 4CN6A 5J6GA 1DANU 1BBJB 3JVGA 1HOCA 4OLEA 3SDAC 1RUQL 4OLYH 1GXEA 3CFJA 4GRLB 2YRPA 2YZ8A 5DURD 3D9AH 5F44A 3UDWC 1JF6A 4UMGA 4EUPB 1RK0B 1ONQA 3S98A 5KVDH 1QNZH 5HHXL 4KKLD 3MRIA 1KGCD 5E4IA 3IETA 1CXEA 2HG5B 4AZ8A 3C6LA 4GQPH 2ARWA 5KS9E 1RIVL 4P46B 1CCZA 5D7JA 1QSVA 3DOSA 1KACB 3T2QA 3OF6A 1FVEB 4ELMB 2VDMH 1OQXA 5L88L 2ZSWA 4Y19B 3UZVB 4ZSOA 3F5WB 2Z0BA 2OR8A 1QYGL 1KJ3L 4GSDH 5HYSG 5T1KB 5FO8B 2F58H 1CDBA 1RJLA 3WXWH 3VFPA 4RSVA 3WLBA 5ICXB 1Q72H 3UX9B 3OX8B 4DKAA 2W38A 5ANMB 1S3KL 1V3MA 1XF5A 1S7QB 3EO0B 5DHVB 1UADC 1BF8A 1P4BH 4UIKL 1RMFL 1X9QA 2XPGB 4MCZA 4HZLB 1OP3K 3CFEB 2IC2A 1BF2A 1ZXQA 3K80A 3UTSB 3TF7C 5FGRA 1WFNA 4X7DC 1TQBB 2IEPA 1RJYB 5KSUA 4J1UA 1QLFA 3ZO0A 4LARL 4UAOC 2AJ3B 4GKSB 3TIEB 2YK1H 5C08B 4AT6B 1LP9A 2UWEF 5DJ6B 5HYQA 4N0FB 2X4TB 1ZT7B 1NDMA 2A9NL 5ILTL 3RL2A 5IM7A 2QQLL 2A77H 2ZOLA 1HCFX 3D0VB 1EFQA 3OGOE 1H3WM 3QXTA 4NN6B 2HVJA 2BC4A 3MBED 2R1XA 1GAFL 4M7KH 1D7FA 1Y0LA 4M43H 5BO1H 2YHGA 2UY6A 4K71C 4QNPF 2AXJA 3ZT7A 5KW9H 5DURB 2FHCA 3VFNB 4RFOH 4TVPE 1QFUH 5TGBB 5KG9B 1J0JA 3C9NA 4PJBB 4OIIH 4M9OA 2DI9A 5SWSE 3KPRD 4I1NB 3RNQA 2X70B 4YDLB 3KPQA 3V4VL 4HUWB 1OSPL 1JHLH 4KKBC 2FX7H 4NRXB 4PRHA 2CDGB 2VRAA 2VSDA 5C0ND 3VXSB 3U9UB 1F2QA 1WAAA 1XGPB 5I8KL 1UZ6F 4APQD 1B0WA 3VFWB 5ADPH 1GGTA 4M7LL 1EHXA 3HG1B 1B6DA 1KCVL 2COQA 3VDAA 3SDCD 5F1KC 2FO4A 5DUBB 3E6HA 1FVDA 5FDWB 3MJ7B 4QTHB 1G7LA 1WTLA 1JWUA 5EC2A 1YMME 3RWCB 1CE6A 2GITB 4OZ4B 2JCCA 3S5LG 2B5IC 2CK0L 4P3DB 1ZEAL 3IU4H 5C7XH 4IOSD 1AC6A 4OIBA 4QTIH 1KFAL 3VXRD 3HRPA 1C08A 1FYTD 4P4KA 4RA3A 3T4YB 3DX7A 4NDMB 1BZ7A 4H20H 5INDA 3J8F7 4QRRD 3P0YH 5HHME 3D85D 3LEVL 2CDEB 1JK8B 2PW2A 1RZJH 3FN0L 3LSOB 2IBZX 3SQBA 2VXQL 3RBSA 1I8IA 4J7RA 5D4QA 3M8OL 5I66B 1CU4L 1KIQA 2AEPH 3MV9D 1N5YH 1OGAE 5F6HJ 5FYKL 4K3JH 5F7KC 2A73B 5T33H 2F5AH 3HUJE 5TPWH 1HEZA 5E6IA 3CH1B 3DWTA 5JOPE 4MS8D 4KU1A 1MRFL 3ARED 4PTUA 2NXZB 4EUPH 5ABDE 4PJ8C 3X11A 3S36X 5GS0H 1T7VA 3TYFA 4LSVH 5CSGA 2UWEE 4APQB 1FZOB 5CJ5A 4O2EB 1N8ZB 2K7PA 5CAYB 1VFBB 5F7NC 2R4SL 3DO3A 2VIRA 2EDWA 3SDCB 5JW3H 1U3HC 1J8HA 5ICZB 2E8ZA 1OARH 3OB0K 1JRHI 1YEGL 1QBML 4PGDA 4XP4L 4QNPE 4EN3A 2YZ1A 3WUWB 1A8JH 1KJVB 1N59B 1MY7A 3MBXH 3SO3C 4ZO9A 4PPTA 5KJRL 3VXRB 5KSAC 2ED9A 5F1SA 2VR9A 3K0WA 1DBKH 5CZKA 1FYTB 3SDYH 3O6FA 5IQ9B 4RZCB 1YY8B 4JO3L 2FLBT 3BAEH 5JPNA 4P2QA 3BKJL 4UDUB 4MAUL 2DQCH 4LHJB 2IH3A 1RJZA 3KPPB 1Y18A 3D85B 4LVOB 3WUZA 4XC3L 1JRHH 4OFDA 5JQ6L 2EC8A 3GSXB 4KDVA 3SY0B 2LFGA 1XGTA 5FYJU 3MBEA 1CGXA 5CEZL 2XV6B 4M1CD 2VQTA 2X42A 4X6CA 3QULA 1VEPA 4YHMH 5EIIB 3VXNB 1NGPL 3MV9B 4MNGA 1GJIA 4PJDF 1T83A 4MD4A 4MXWL 5GXBB 1EZVY 4LVNC 5IB1B 4FXGA 5E5MB 4ZXBA 5F96H 5I8EB 2HLAB 1L0QA 3JV4B 1BQHG 1ZWIB 2A6IB 3OR6A 3D3VE 3KPRA 2EDNA 4F8TA 1ACYH 3QCUL 3AREB 1RUAL 4CUCA 1A1MB 5DRZA 3RBGA 1FIEA 3OKMB 2WBJD 2OMNA 3TYGH 1DFBH 1GGCL 1UCBL 3HZYA 4GRWF 1AHWB 3P11H 1UJ3A 5JZ7D 2HLFC 2VDKH 4X7TA 4MJIE 1XIWB 4JFPB 4JFQA 1HH9B 2NX5A 3U30C 5CBAB 5J11B 5LGJB 5K9JH 3B2VL 5FYLH 3K74B 1ZVSA 3QXDA 4MSWB 4KHTL 1DBBH 1RZKH 1QVOB 2BSSB 2EC9T 4MQ7A 1FFNA 2PTUA 1QFPA 2X1PA 4HUVA 3QQNA 4YBQC 3V4UL 2CMRL 1N0XL 4RGND 1UWXH 4IRZL 2OP4H 4DGYH 3NCJL 4CMHC 4M93C 5A2KH 3FO1B 1A3QA 3MRCA 3LN4B 4GMTL 1EH9A 1F00I 1EFXA 5CJ8A 4FTVE 1DVFD 1EAPB 1W72L 4LOUC 3ZKQD 5CJQL 4PLKC 5E2UH 4GBXD 4ETQA 4ZNEA 2UYLB 1TQCB 4YHZL 4K3EH 2NY0D 1UB5A 4YXKL 1XH3A 1WK0A 5IW1B 5D5MF 1YEFH 4YDVA 1U58A 2JTDA 2YBRB 5TE4L 4XBPA 3QWQB 4LCWE 2O61A 5FGBA 1KIRB 3ARSA 5EUOF 1BVZA 1FE8L 4BUGA 3SQOL 4M6OL 4RRPG 1BFOA 2WBJB 5AZEL 2ATKB 4M3JA 3DIFB 2YD7A 4Y4KC 2R1WA 2GJ6A 3BKCL 3G5XB 1HZHL 1MFEL 1FVCB 1FPTL 1P4LB 2ICWA 4PJAE 4YC2C 4QGYA 4WFGE 3U7AA 5C0RH 4NKOA 3SE9H 3W0WE 5L7XH 5CKGA 1QSFB 1D9KD 4PJGB 4HUUA 1H5BA 2HAZA 3QDGD 1UEYA 1GHFL 2X40A 3HI1A 1ZA6A 1X5FA 3ARYA 4BZYA 2VE6A 2A1WH 3QNZA 2DQHH 3ABZA 4RGNB 3MRDA 3EUUA 1WWCA 1XR8A 2D7OA 4JB9L 2ADIB 1YEIH 4NQXA 2P5WA 2DLIA 3KAAA 1OT1A 5B3JE 1AXIB 5HTSA 5J1TC 4IDJH 4XX1E 3VI4F 1IL1B 3HNTL 5GSRA 3OJDA 1KCUL 4NN5C 1JWSA 3PG2A 1P7KA 3GBLA 2WWKO 2NR6C 2UUDH 1GZPA 3TPKA 3UC0L 1T21A 4K8RH 3UJJL 4GRWE 4NO3B 1TPXC 1YYLH 2W9EH 2NXYD 4GBXB 5I17A 5FGCE 3PV7A 4FP8H 3Q6FA 1XGUA 4PRBB 4PTTA 4NWUH 4KAQL 4KPHL 3BP6B 2R0KH 1PKQE 4PJ9D 4TVSa 1TVBB 3GMRA 3WN5B 4CW1A 5HHPB 1DLHA 3HR5A 3VFGL 2ATPA 3WIIL 3STZA 1NUNB 2R4RL 3VMPA 2RHEA 3P4NB 3PDGA 1CICA 4ZMAT 5K33A 4EIGB 4OCXL 4UUJA 4RWYL 4ZUVA 3OL2A 2Q76A 3IDNB 2C3HA 5CFHA 2DQDH 3I6GA 4M3KB 2R2EA 4XWGL 1H9VA 1IVLA 3WD5H 2WWMC 3MCG1 5IVNA 1D9KB 4WHDA 2FBJH 5FHBL 5FECB 2H2PC 3QDGB 1MEXL 4I0PD 4X4MA 4KK9C 1QRKA 3IS0X 4LKCB 3RVWC 4IRJB 1UFUA 4YBLB 1W0VA 1UM5H 3Q1SH 1NAKL 3IDMA 4GOSA 2FL5B 4YE4H 3OR7A 4P0DA 1QUNA 1L9NA 2W0LA 4JZNB 1NGWB 3CJJA 3F12B 5F9OH 1KELH 5TDOB 1JMZA 3ZTJH 2QV2A 3BISA 1OL0A 1EZVX 3MRBA 4Y5YA 5MHSE 2H32B 3K4DA 3V6FB 5IEHA 4N8CH 5L9DH 2Z31A 2EXWD 4JQXC 4YDJA 5FF6B 1ZHLA 1LEGA 4OZGE 4AIOA 4YNYA 4D9RE 3QJHB 2F54E 4PYHA 4ZOAA 2IGFH 4RMWA 5HHVH 3HZVB 3U9PH 4K7FB 2FSEA 5C0JA 1WITA 4YPJA 1UYWL 4EDXA 1MAMH 4FABL 3PL6C 5IGXH 3ULUH 1L7IH 2GIYA 3VMOA 4BYHA 3W9EA 2JIXB 1VDGA 3HE7D 1RZIA 1IM9D 4PJ9B 3VD5A 2R69L 2HT4C 4NSKB 5J6HB 5TE6H 3L9RA 1X4ZA 4K3GA 4G6FD 4E41B 4O9HH 3CSYA 5FA3A 4PD4K 4WV1A 5D70H 4Y89A 4X5XA 2E9WA 4YBHA 4YEFA 2XZCL 1A9EB 3DUSB 3H3BC 4I2XA 2WSKA 4P9ML 3U2SA 4TNVK 3S35L 5MERB 2D03L 2FRGP 2VWEC 5HY9A 3DO7B 5TQ2L 3HC4H 4ZPTB 3RHWF 3ZYZA 2GJJA 2HKFL 4OUOA 5DD5H 1F58H 2XTJD 1DE4A 2QHRH 4UOJA 4IOIB 1LO3L 4FZ8L 4OFVA 3ES6B 2FHBA 3TBVB 2FGWH 2H3NA 1WZ1H 1G6RB 2NY2B 4NRZB 5D1ZC 1PGRB 2EDLA 3TBYA 2DYPD 3UPAA 3WFBH 2IG2H 1DQQA 1QRND 3O3BA 1S5HB 4N5EC 2FATH 3V0VB 4LKXB 1X7QB 1CF8L 4JANA 2KZ1B 4ODTL 2ZPKL 1OTSD 1JGUH 2J5LC 4WFFE 5L2KA 1UM4L 2RCSH 1MCKA 2IQ9L 3MJGX 1I7UA 1C5BL 4YAQA 4F2MB 1INQB 3B83A 1OTTC 4S1RL 2WBWB 1SVCP 1G0DA 4PJ7A 5JDSA 3G9VA 1G7JB 2DQFB 1RHHB 4Z77B 3NN8B 4PY7B 1IM9B 4GFTB 4HJGA 4UILH 5J1AA 3EYOA 4LHUD 4D0CB 3BFOA 5CP7B 3O3EA 2NQCA 3V5HA 5KVEL 4DN3H 5I0ZA 1KJMA 1F6AA 5EU3A 1N6QL 3LN9A 3OXRA 3VJ6A 5DMKB 3JV6A 2PF6A 2GT9B 1U8OA 4PB9L 2Z4QA 1YECL 15C8H 1NAML 4LLWA 4QRPD 4LL9A 3A6CH 1XF4B 1NH6A 5EOCH 3SDDC 1AQDB 1MHCA 1XZ0B 1RD6A 2FIRT 5JO5A 4ZAKD 1DN0A 2R2CA 1T7WA 4LPWA 4NQVA 4J6RH 3U83A 3MA9H 2ZCHH 4PP1D 1P5VA 5K9KB 4JFDD 4YHNB 4HEME 2HFTA 4JPVL 1X5KA 1C5DA 1CD9B 1W72A 3G6DL 1LO2H 2VMFA 4TULH 1B2WH 1FNFA 4O5LL 5JIHA 4Y1AE 1KG0A 4ZDHB 3F7YB 5FUCC 2J3SA 1J1XH 5IFHL 2DYPB 2EEAA 5GRYA 1N64L 5CGTA 3RWGB 5EU6E 4PJXB 3TNNA 1QRNB 3QUXC 3X13B 1WBZA 2ZUYA 1D5IL 5ESAB 3WSQL 4Z7UA 4Z8FL 1GYAA 3H3PL 3MUZ1 1X5LA 3RTQC 1NBYB 4KZDL 4XCFL 3OPZL 3N1PC 2AJXH 2NY1D 5GGRB 3H9HA 2J8UB 1LK3L 1D3CA 4A6YL 1ETZA 3VFTA 3H7LA 4FQXA 1Q1JL 4YQXH 2X1XR 1IT9H 1H15A 1Q0YL 4QEGA 4XNMA 3BEVB 4MNQE 3HPJA 4MQTB 1EVUA 2ZP0T 3MLUL 2CO6B 5ID1A 4P9HH 5FUZH 2XFXB 4ZNCD 5DQ9B 3QSKB 2EE6A 1WCBB 4HW6A 4YWGH 5LXGL 2V5TA 4RQQA 5E8EA 1VADA 3K7UA 3HB3D 4J3OC 1ORQA 4QRPB 5CD3A 3DV6B 3WFEL 1NFIA 4XBEH 1LEIA 4OIAA 1YEHH 2YPLA 4CADB 2AJYH 2BVEA 4KRPC 1S7WA 3RUGB 3X17A 1T7YA 5GIRA 5BS0E 1KN2H 1CXFA 1RZ7L 1E4XL 3WKMH 4JFDB 3SBWC 2ZCKL 3FTGB 4M48L 4JZOB 5MP6H 1VFAA 3I3BA 4G42A 2AXGA 3TBTB 2PUQT 2X4SA 4IMLB 4MNHA 2XN9D 1F2XK 4FNLH 4KY1L 2G9HA 5CUSL 5ICYA 2EIEA 2YRZA 2W0KA 1K8IB 4NBXB 4F7CB 3QEUA 4NT6A 2GY5A 4Z7UF 1F45A 4BH8A 3R0MA 1JL8A 1CK0H 4JFEA 4OCRL 4MX7A 4L4VB 3MRPB 4HFWA 4O02H 1HE7A 2HJLA 2H8PA 2VLLA 1AO7E 1G6RH 1WC7B 1E27A 1T6VN 3FKUS 4FOMA 3NGBC 4JG1L 2HKHL 5AZ2L 4Z7WB 1R5VA 2NY1B 5EPMA 4HPYH 4PJEA 3H9SA 5EN2A 2QQKH 5GZOC 1B0RA 4CN1A 5DGQA 4AEEA 4LLDB 5T1LD 2LTQB 2WLYA 4L8BA 3UBXB 4JRYA 5DF0A 2VC2H 1TZHB 5MI0C 4XH2A 1MJ8H 2XT1B 4LHUA 3B5TA 4Y5VB 4Y7MA 3RZCC 1REIA 2ITCA 5DJDB 3U4BL 4P2CG 4Y16D 2FECL 4OZHA 4FXKB 4JM4H 4LRIA 4PJ8A 2WMPA 1UZ8B 4FHBD 1MHHA 3EDJA 4GRMA 4TVPD 4AIXA 2WIMA 4I48A 3UO1L 2FWOB 3I50H 3GO1L 4U2YA 3UTPE 4KK8C 3OAUH 3L5IA 1ZA3A 1ND0B 4YXHL 2BERA 5E8OB 1U3HA 3FO0H 5IJVA 3OGCB 5TDPB 5AYQA 1GGUA 12E8L 5C9KA 3IAGC 4Z95L 2XN9B 5AD0B 4TNWF 5EOTA 4ZPVA 1D5BB 2DM3A 3JZ7A 4X6BA 3GHBL 2GSGB 4HXBH 1CGUA 2VH5L 3S37X 3KNBB 4CNIA 4JFZL 4WUUE 2EDDA 5E08L 3QRGL 4PJCE 2OR9H 2VXSL 5EU7C 4XVSL 2D4FA 4Y5XB 3BPOB 2GSIB 3WDIA 3OHXA 2DL9A 2Y07L 5FYJE 5IBUB 3MV8A 3CAFA 5H37H 2XRAL 1U92A 4PJEF 3IDYB 4NWTH 2KDGA 1HIML 2IAND 3SE3A 5IOPB 2MTPA 5KVFH 3P0GB 5AWNL 2P46B 3F58L 5E9DD 4XP9L 4U1NB 4L1HA 3RDTA 3RWDA 5T1LB 1UVQA 3TFKC 5ALBH 5HHMD 3DPBA 1UWGH 4DOHE 1OWRM 4N9GB 4KMQA 4UT6H 4YEEA 4YR6B 3U0PB 4EXKA 1I1FB 3BDYH 1OT2A 3A6BL 4XMPH 1DEEB 5IMOB 1ADQL 4WU7B 3FT4A 1WF5A 4Y16B 1A6ZA 4KC3B 4R4BB 4BSWB 2VXTH 1NCBL 1T1ZA 1EJ6A 2D7MA 1X4YA 1FO0H 1F3DJ 3BUYB 3KLAA 4WCYL 1JZ7A 1MCDA 5KS9A 1HKFA 5JPMA 5GJTL 5IROA 4FQJH 4LSTL 5BCAA 4ZFFB 3O11A 3QXUA 4DEPC 4OGXH 1SYSB 1CZ8H 3CFBA 4GW4B 1T7ZA 2IADA 3IJSA 4NM8L 3ZTJG 2AXFA 3LKRA 3VG0L 5CEYB 3NAAL 1AXTH 4NQEE 4LLVA 5D2LE 3LCYA 3VG9C 4JHWH 4HIXL 1ROWA 1GIGL 4UT7H 4XTRC 3CVHL 3VXOA 3VD4A 4CVXA 4K23L 2R8SL 5DJCA 3KXFD 3WMSA 3L3HB 4ZS7H 4LSDA 2OK0H 2FJFA 4PYGA 2W59A 4LFHD 2IANB 5JW5B 3UBXI 1WGOA 1NAMA 4HIEA 4JDVB 2FH8A 2K1MA 3DVIA 5E9DB 3BZ4B 2NZIA 1DZBA 2EZ0C 1T0MB 4NQCE 4PJIE 5HHMB 1F5WA 4U1HA 3P40A 2AV1B 1FZKB 1LK2B 2HFFB 4OF3A 3T0EC 4DKFL 4Y4FC 4JCLA 1IC7H 1QD0A 4TSAH 5FK9B 5KSBF 3DSNA 5BQ7B 4OSUH 3TO2B 4HCRL 4Y4KA 2R56H 4KTDL 4PGZA 1F02I 3O8XD 4IOFC 3BPLC 4PGBA 1MLCA 1U9KA 3T1WA 4JFFE 3BIKB 5SWSA 1KCRH 4EOWL 4G6KH 4AL8H 3HN3A 5BJTB 5IR1A 3SKMB 2APVA 5DVOA 4PP2B 4JHAL 5GS3A 3TIDA 3D0LA 1OM3H 5I18L 1G7MA 2P8PA 2UWEB 5CJXC 4ZD3H 3RZWA 1A6WH 1C7TA 4FFVC 2EDKA 4A6YA 4K07A 5F9AC 1T04A 4MXVE 1QBLH 4JHZA 1H8OA 4QHUA 3CFJB 1IEBA 2NYYC 4LAJH 2Q8BH 4YIQA 5A1AA 3FOMB 3GSUB 3KXFB 3UTTE 3HZMA 4HUKB 4L9LB 1YMMA 4FQ1H 5D7JB 1FFRA 4XPHL 1S7UA 3MV11 5C0AE 4ENEC 5GGQL 2ZSWB 2LU3A 4NJAL 1LE5B 3ZYIA 2EH7L 1V7ML 2RJMA 5E8PA 1W8OA 2IFFH 3NPSC 1OP5H 3P9WB 3NZ8A 1JGLL 3O2DL 5D72L 3L5WA 4FTVD 2AJUH 4ZFOB 3ARGC 3ARBD 1XF5B 4NKDA 5ENWA 1JUFA 5F1IB 2G60L 3RIFK 1I8MA 1INEH 5GJSL 1ZVYA 2DBLH 1PLGL 3WDHA 3KJ4B 1MCOL 1F4WH 3RWJB 5BV7B 1OGAA 1S9VA 4Y0GA 4LCWD 1J86A 3HUJA 3DSFL 3LIZH 5H35A 1YN7B 3TCLA 3QPXH 5I76A 5EO9B 1A6VH 35C8L 4QHLB 4XCYB 5HYQB 1JHKL 1NDMB 3RL2B 4F57L 3CMOH 4TSBL 2OTPA 4ZQKB 2QQNH 3WL9B 3FONA 3PV6B 2HVJB 5F7MC 4KVNL 5HDQL 2AK4E 2FB4H 3LKSB 1HQ4A 4WFGD 3MSPA 2QKIA 4O58L 5I1LA 3W0WD 1ORSA 3FQNA 3IVKA 3C60A 4JDTH 5ETUA 5C2UB 5LWYH 2EYSA 4JFOA 5ISZE 1MFBH 1ZHKB 3QUMH 3RNQB 4XXCC 4NBZB 1MFCH 3MRJA 4P2OD 3KDMA 1Q8MA 4ORZC 3TA3C 5K9QG 3S36L 1NBQA 4LAQL 1ZGLA 1J0KA 4DK3A 3PL6A 3TO4A 1ES0A 2V7HA 5D6CA 4NHCL 1YJDL 2WUCL 1NEUA 1A22B 4JE4B 4RGOL 5JHDE 3L6FB 1OOAA 3LB6C 3HAEA 3ZL4H 1VGEH 1CD1A 4FTVB 1DN2A 1P84K 3LDBB 1MHEB 3L3JA 4D2NA 4DAGH 4HXAH 5EWIH 3ARBB 3G5VA 4JDZA 1IKNC 1U2HA 4YHYC 4WIQA 1CTOA 4GLRI 5IVOA 1SJVA 1G7LB 3LS4L 1S9YA 4K3DH 3RRQA 3GMPA 1ZLUK 1L0XA 5TFSL 1FLTX 2O5ZH 4PLJD 1DR9A 5F3BA 2WK2A 5F1NB 1HCVA 4LCWB 2DKUA 3D25A 3IDGB 3EKCA 3D3VA 2BX5A 4UT9L 1EHAA 4OF0A 4F58L 1BZ7B 1KB9K 1KCLA 5J13C 1J05B 3BGFB 2OJZL 5JHLL 5C3LD 2X7LB 1BEYL 3OKKA 1ZLSH 3ARDD 4MJIA 3A67L 3SGKC 5D1ZA 1UWEH 3B3IA 1ZANL 3RVVC 3GGWA 3NFNB 4JVUA 5DUPH 1T3FB 4QKXB 3KJ6L 3BP4B 1AKJB 4FFYL 2A2QT 1LNUA 3B9DA 4NQSA 2YD8A 4MA3A 1KBGL 3IFPA 2ZUTA 3ULSB 3KLDA 5HYSA 2QSVA 3MLSH 4FA8A 1ADQA 1KULA 4PJDB 2OM5A 1F6LL 4P2OB 3KHQA 4WNQB 3STBA 2VZOA 5MHSD 3FB8A 4PTUB 3TCXA 5GGVH 3MRLA 2ZKHL 4GUPA 3TYFB 1U8MA 1Z0MA 3GMNA 5CD5D 5IVZA 3ZKXC 2F54D 1RAMA 5M95B 2OLDA 3L1OL 1NGYA 2ID5A 3FZUC 3V8CA 4UQ2B 4DTGH 5ITBL 1WWBX 4BK4A 4GRWB 4PJ5E 2F8OA 1WIUA 4RAUA 5CCKH 3M17B 4UTBH 1J8HB 1Q9KB 1EO7A 4Q0XH 4NJ9H 1RZFH 2XZAH 1G7IA 5DO2C 1OB1B 4N8VB 2MHAB 4D9QE 2EE9A 5I1AA 3UPRB 4GQ9H 3LQAL 1FP5A 3S97C 3CC5A 3CVHA 2ERJC 1CFSB 3BZFA 5EUKB 5JPNB 1ZT1A 3QQ3A 3ULVC 1XAUA 2P1YA 1Y18B 4P5TD 3EOBB 4QOKD 3ARDB 3B2UD 4PJAA 4QXUH 4BELD 3OSKA 4UTAL 3HNVH 3RKDD 5B39B 3W0WA 1R3JA 3PF2A 1NSNL 1B0GA 4G6ML 1XR9B 3EYFB 5K9OB 3QUXA 4ODBD 1UXWB 3LQMA 3QUYD 5DLMH 2AP2A 4FXGB 5F7EH 2GEEA 3VXPB 1M7IA 1R24A 4Y2DD 4QXGL 3MFFB 4WJ5B 4W70A 1V8HA 4IIQB 3RTQA 4I9WE 4C83A 4HCRA 2XY1A 1N2RB 5D5MB 4Z0BH 1YN6A 3C5ZD 1FJ1B 4UQ3B 1AH1A 1IGIH 1KC5H 5EUOB 4XCEA 1YEDA 4O4YH 3SCMC 2F54B 4F9LC 1A14L 3AU1B 1J12A 3TH3T 4JFQB 4NKMB 5TDNB 4XMLL 2J12B 2IPKB 5DMIL 3WCYA 1T6WA 5IWLA 4A2LA 5GISH 3QXDB 4QRSA 1YMHB 3JUYA 4OZFB 4OD3H 1MCNA 4DK6A 4NM4H 1ZGLM 1JTOA 4R9HA 5C09D 4L8CA 4XP1H 1OAQH 5E7BA 2GAZA 4JKWA 4YH6A 1PKQA 1FL5B 1FZMA 2C3VA 3BZEB 4WWID 1D5ZA 5C07A 4ZFGL 1ED3A 3N0PB 1HDMB 3SBWA 4CBPA 5J0BA 4M03A 1MJ7L 2P8MB 4KROC 3NCMA 3HC3H 5IHUH 3U46A 1EJOH 4M6MH 5DD0L 4YHLL 3Q6GL 4MJ6A 4P5TB 4QOKB 3VFMA 5B8CB 4TQEH 1JZ3A 3LHPL 4LCCB 1OQOA 1CLZL 4ORGA 5CZVL 2X4QA 1FGNH 2X4UB 3CDFA 4WI8A 4XNQA 3O2DA 4MD5B 1INDL 1QEWB 2J4WL 1NUFA 5J8OA 2CGRH 4HKZB 1AP2B 1DBMH 1XH3B 2VDLL 4X8XA 5FCSH 4YDVB 1U58B 4Y2DB 4XBPB 3K4AA 4U6VL 1A7BA 1I7TA 2Y6SC 1BFOB 1IEAA 4X0KA 5DFWH 3P4MB 4OZGA 2ICWB 3MLXH 3LN5B 3KPNA 3FRPG 1CIUA 4NKOB 1OWWA 2GTWA 5A2FA 4U3CA 1T03H 1CL7I 3QAZC 2NTSP 3RZCA 2OTWB 2X9YA 1H5BB 2P8LA 1YYMH 3U0TB 4Z7OE 1ZA6B 3P9LA 1FRGL 4U1LA 4YFLI 5C09B 1G9EA 3E2HC 3HS0B 2Y72A 3QNZB 4JY4B 1F42A 3OXSA 2CO7B 2Y5EA 5F7DB 2BNQE 4K8RC 2EKSB 3HPLB 4IHOA 4X6EA 1J5OL 4NQXB 1A7PH 1L0YA 3O6LL 3EO9L 4WWKD 2ORBH 4S0SD 1P4IH 2OCFD 1LMKA 2AEQH 1KT2B 4IRSC 3GJEA 5GSRB 5AYUH 2CSPA 2LAAA 4F33B 5CBEB 1KJ2L 1FZJA 1P7KB 3EJYD 5DZLA 4TUKL 4XWOD 1S78C 1T21B 1BQHA 1Q9WB 3JV5A 3PWPE 5T5FH 3E3QC 4JPIA 5DHYA 4JPKH 3EYVA 4LSSH 4Z76A 2L0DA 4ZO8A 4LLUA 4OCWH 4WI5A 1BJ8A 1J1OH 3FRUB 1G9NC 1V05A 4X9HA 2VAAA 1Q9OA 2B4CC 3RGVC 3LKPA 3RNKB 1DLHB 1PYWB 1MREL 3DMMA 3QI9D 5LG1A 1U8HA 5IB4A 1FL6A 2YC1A 3H0TB 3PWLA 4HKJA 5E00A 2FEDD 3C5ZA 4UUJB 5FKPB 2W0FA 4JRXA 4H8WH 1KPUB 5SWZB 5A2IH 4PRDA 3MOBL 1Q94A 1X3DA 1UQSB 4KK6D 3X14A 4UV7H 2VXVH 1KEML 1JN6B 1HILB 1BFSA 1CGSH 1IJ9A 2EYTA 4L29A 2GTZB 1MVFA 1MWAL 3EYQD 5DJAB 4J2XA 3SO5A 2XKSA 1JCKA 1LEKB 3MJ8B 3I02A 1FNEB 3DTXA 3MGOB 3H42L 5IQ7H 1JZ4A 5D7SH 3MRBB 4KKCD 4MHHI 4WWKB 2Y7QB 4LASH 2JF1A 4OZFH 3OWEA 5KANG 3MUJA 4LQFL 4QLRA 4NN7B 4YDJB 5D1XC 4N0UA 4ETYA 4J3UA 3LVEA 4OGZA 2QADC 3ZDYE 1RUQH 1U91A 2R15A 4ODWA 1FAIL 4EXPX 4AM0A 5HHXH 1UCTA 3QG6A 5DJXA 5IV2A 5EZJA 2CXGA 3HE6D 1HSBB 3GSNB 5DK2A 2YD1A 4KI1A 3VWJC 1E6JL 3I75A 3QDMA 1FFPA 5L88H 4OFYD 2JB5L 3SKNA 1MCSA 2DM4A 4Y1AA 1QYGH 1KJ3H 1OLZA 3WS6C 5FA3B 3WNMA 3ULVL 2EDOA 1BQLL 4HULB 1FDLL 4HIJA 4I2XB 1P2CA 5EU6A 1S3KH 5JR1L 5FYJD 4ZUWA 3KPOB 1HHIA 2BXYA 5DS8B 1H8NA 3MNWB 4UIKH 1RMFH 3O45A 4EI6A 1KPRA 4LF3B 1IQDB 3L95A 1URLA 4UDTB 3HR6A 3T0EA 1T5XB 5D96C 4Y4FA 3VGEA 1DE4B 4ZFZB 1OTUD 3RWIA 5IHZB 1CGWA 1PY4A 5T3ZE 4LARH 2A83B 5HD8C 1Q9LA 1T80A 3MUGA 1VKXA 3TBWA 2H3NB 2X4NA 4MNQA 1V3LA 2HVKA 5ILTH 2QQLH 3DV4A 3TBYB 2DKMA 1NMAL 1DCLA 3OKNB 5GRVK 2HTLC 1GAFH 3UAJD 5BZDA 3MUHL 5F88A 3P2TA 3VDCA 4JANB 4LEOA 4G8GE 3RWFB 3GUTA 1K3IA 4QRUA 3VXTB 3SDAB 2KKQA 3QZWB 1I7UB 1TJHL 4KVCL 4KJYB 4DVBB 5BS0A 3OKDA 3Q5OA 3MREB 3V4VH 1OSPH 1I8LA 1JV5A 3SE4C 3T0BA 1UKSA 4HJGB 1YNKL 3FO2A 3IDIA 1XGRB 5CLTA 1R3LB 1KJMB 2OBGA 4CVWA 5I8KH 3IFOA 4HC1L 4KKBD 3VRIB 3KYMA 4NQED 3CFIC 5A40E 3B9AA 1MOEA 1KCVH 1TETL 2CKNA 3VXQA 2VLME 5E4EC 4XNXL 2A6DB 1DBJL 2ESVE 3NMEA 3ESVF 4E5XA 1EBPA 1AO7A 3AXLA 3DURA 4R2GC 4Q6IA 4PGCB 2PR4L 1LILA 1FNGA 3DRTA 5HI3C 1CDUA 5T1MB 5H94A 1JPST 2CK0H 1ZEAH 4JM2A 5BXFA 3O2WL 1KFAH 2DI7A 4NQCD 4MZ2A 3HCVA 5JIPA 1S7XA 3V6OC 5AG8A 3RIAF 4AENB 1YZZA 5D7IE 1H3UA 4QHNB 2AJVL 3RVUC 3RY6A 2D31B 3LEVH 2C7UA 3BO8A 3FN0H 2VXQH 2AGJH 4RA0C 5DFVD 3M8OH 4Z7UB 5T3XE 4HX1A 1CU4H 3OJVC 4BH7B 5EA0L 2FIKB 5DJ2B 2PYEA 5F72S 1CT8A 4HSQA 4K71B 3H9YA 1FLRL 3GJFB 5FYKH 3H9HB 2YEZA 4JFXA 1ZTXL 5F9JA 1ETZB 3VFTB 4H26A 1VB9A 1AJ7L 4W6YB 4DGVL 2VLRE 4F15C 1KTKE 5IESL 1MRFH 4NPYA 2P42B 2ZJSL 3D6GA 4XXCA 1FSKC 4U1IA 1WWWX 5DZNA 3RQ3A 5I1IL 3FT2A 4RQQB 4WUUA 1IC4L 3QISA 3TA3A 4D94A 4PJCA 4Z0XB 3QQ9D 3VXUA 2R4SH 1ORQB 2D9CA 3CDYA 3GI8L 3FQXA 4Q74A 1YEGH 1QBMH 4XP4H 2R1YB 3PHSA 1G9NL 4NC1C 2MKWA