3LD8C

Structure of jmjd6 and fab fragments
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
219
structure length
210
Chain Sequence
QIQLQESGPGLVTPSQSLTLTCSVTGDSITSYHWSWIRQFPGKKLEWMGYIYNSGGTDYNPSLKSRVSITREISRNQLFLQLNSVTTEDTATYYCARRDYGTYYFDYWGQGTMVTVSSATTTAPSVYPLAPNTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Bifunctional arginine demethylase and lysyl-hydroxylase JMJD
publication title Interaction of JMJD6 with single-stranded RNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2010-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ld8C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ld8C01
4PJFA 4P23D 1UH3A 5EG6C 4QF1B 4PRNA 4NKOA 1T7ZA 2XWBA 4YUEL 4JY4B 2A6IA 4RQQB 1MFCH 3O8XC 5JOEA 2V5TA 3BGFC 1A6VH 5JUEL 2OJEB 4N5ED 3FQWA 3MJ8A 4JLRA 1UXWA 5F7LB 1ES0B 3S37X 3W0WB 3KPOA 2AP2A 3ULUH 1XF2B 2RCSH 3MC0A 4Y4HD 5IWLC 1UWGH 1UZ8B 1U8LA 2DLFL 2JIXD 4Y2DC 4WHYG 3ZTNL 3PXJA 4Y5VB 3FO1B 4P99A 3NZHL 4ZUWB 2GK2A 1TQBB 1T89A 2IG2H 2OR9L 4YGVA 5FGCE 5BVPL 3F7PC 1ETZB 5F7YC 3V4UH 3R4DA 3UTTD 2VTFA 2D9QB 2X2YA 4H25A 2ESVB 4OT1H 1CDCA 5FCSH 4OD1L 1G0YR 1MREL 5TQ0H 3ZHKA 5HXMA 1A4KB 1MCFA 1J87A 1T5XA 2AJSL 1GC1H 1YEHH 1HQ4B 3RIFF 2X4RB 4QTIL 4PGEA 5TF1H 2IFFL 4U0RC 2XA8L 1OTTC 1M71A 3D0VA 4C56B 1A21A 2OS7A 3HAEG 4PRPE 4HGMA 1FIGL 3T4YA 1EJOH 5IOPA 1F6AB 3CC5B 2B8OT 3QNXA 2EZ0D 4XGZA 3ORJA 3L6FA 2F53E 5FYLE 5HSFA 4WHTB 3MRRA 2CDEB 1A9EA 4P2YA 1QVOA 2IH3A 3OG6B 5DWUH 3QEQA 3WIIH 1VFAB 2DN7A 4RRPG 4NNXB 3DX8B 3ULSB 3DGGA 2F54A 4J3OC 4MDJB 4Z7WE 2EXYD 3NVQA 4OQ1A 3FO0L 3GM8A 4UINH 1QBML 2ZKHH 4KH2A 1B6UA 4EUPH 5F6IB 3O8XB 5D6DC 4K23H 3VFTB 3O2WL 4K3EH 1WISA 4FRWA 3L3OA 1EZVY 2W0FB 2HFEB 4H88H 2IBBA 3KXFB 5EULV 3GIVB 5I73C 1MAJA 2X9YA 3ULVC 5DD3H 4PS4H 1AE6L 3P11H 4YJZL 3ULUE 1J0KA 5I1GH 5K93A 3ZT5A 4GQ9L 2GJ6A 3MRLB 2XZQL 2X42A 4PG9B 2FIKB 3FO9B 5HI5D 2SEBB 3QCUH 4O9HH 5CUSH 2WIIA 2YPLB 3QPXL 1D3CA 3MUGB 5FUOL 1TZHB 1LDPL 5L2KE 2AK4E 3VD5A 3TCLB 3U4EA 4PLJD 3U7YL 3D48R 1U8OB 4KK9C 3CLFH 2JB6B 1NGWA 5CSGA 3UTZA 3QHZL 5IK3B 2AQ2A 4KMTL 5GS2H 5FAAA 5B3NA 3PL6A 5BO1H 2E3VA 4YHLL 3TO2A 5FUZH 1P7QB 4L8DA 1OW0A 4KMQA 4TUOA 4ALAL 5F70A 4PJDE 3M8OL 4U0RB 3VD7A 2FX7H 4HBQA 1BOYA 1QLEL 3HLAA 5A1AA 3QA3B 3NZ8B 2VLMD 3ME0A 4NBZB 3QDMA 4RIRB 3T09A 2YKLH 3DURA 4N8VB 3BKYH 1JNLH 4N1CA 4OZHE 1YEIL 4EDWH 2LVEA 1KN4L 3W0WD 4I0PD 5J13C 1OAKL 3IDJA 4P4KB 5F1OB 5D1ZC 2W65A 3DX6A 3R8BB 5F21B 2FBOJ 1CGSL 1WIPA 4RISH 5I1EL 3GMNB 3RAJL 3TNNB 5INDA 3C5SB 1JHKH 3CH1B 1B9ZA 3KPRE 1ZLUK 5GSRB 5LGKA 4MDIA 3BMVA 1JHLH 5EU6B 4CAGA 4MXVE 1KB9K 3T1FB 1T3FB 5HDBF 3BO8A 3JWOH 4KY1L 1KELL 1Q94B 1JMZA 4V1DE 5C0NC 2VLJE 3MLSL 3PWNB 1ORSB 4OAWB 4W4NA 5GGTH 2R1YB 2F74A 3KPSB 4ZO7A 3EOYG 2NW3A 1FNSH 3TIDA 1DEEB 3NCBB 3C6LC 3MO1B 5E8DH 3GIZL 4TQEH 4OIIH 3UAJD 2CRIA 3BPOC 1G6RB 2F15A 2QADC 1G7LB 2P8PB 1MCWM 2VZ3A 3WXVL 3OKNB 2ATKA 2HH0H 4MAUL 1HYSC 1AXTH 1AQKH 3MV9E 5T3ZD 3E2HB 3EJYC 3VJ6B 4J12A 5I8KH 3T0EE 4TRPL 2Z31C 3ZYZA 2DIBA 4ENED 4JB9H 3BPNC 3FQRA 1NCWH 4X7FC 5D72H 4NO0B 1XZ0B 3D9AH 1A2YB 4P3WA 1CDGA 5JZ7C 4M3KB 1UT9A 1WEJL 2WANA 4MJIA 3O8XD 4ELMB 4MNHA 5IFHL 2HJLA 4JFHE 4PLNC 1L9NA 3I6KB 1EGJH 1NANH 4FZ8L 1VGEL 2GAZB 1ZWIB 4I1NB 5J13B 1YEKL 1EIBA 2UWEF 3KJ6L 4WFGD 4K8RH 1CQKA 2WM0A 5D1ZB 4CVZA 1VACB 1UENA 3E1F1 2M1KA 3IAGC 4Y2DD 4WEMB 4GRLC 3L7EB 2ADIA 5FYKH 2X4QA 4KQ3L 3OXSB 4RFOL 1O7SA 3KYAA 3CPLB 1BGXH 3L3GB 4JRXE 3RVUC 3BZFB 4UDTA 1PY9A 5C0DA 3BKJH 3I50H 1PSKL 2FO1A 5F44A 5IB2B 3GEWB 3LB6C 3I75A 1HOCA 2UZYB 3O3UN 2O61A 5C0JA 1EVTC 3GSOB 3ROLA 1P7QD 5LG1A 4PTUB 2R39A 1AH1A 4UB0L 1OF2A 3PDOA 2OM5A 4S1SH 1OTTD 4RCAA 1CE1L 4YHML 3C6LB 4KVCH 3DETC 3P3YA 2QADB 1T0MA 4ZQKA 1A14H 4APQC 2IAMA 3BJLA 3VXUB 1NCTA 1TJGH 5FO8B 5A16B 2XY1A 3OKMA 3GZKA 2Z31B 2O26U 5D7LB 4NSKB 4WVRA 5SWQA 4G42A 1IAKA 5CIPH 1EEUA 5EO9A 4PJCF 1MFCL 3OHXB 5EB9A 2I26N 1A6VL 4JDZA 3VXNA 3DUHA 1PKQA 5JQ6L 1BAFH 2N7AA 1YMHA 3DLQR 4MGXA 1JI1A 2ICWJ 3HC4H 4JM4H 4XZUB 4YHZH 4G9FB 5FO7B 2I60H 2VWEC 3ULVD 4WTZG 3KPSD 1X5GA 4E42B 4UQ3B 4OLYH 1WWBX 4UTAL 3GSRA 3OKOA 2G2RB 1OP3K 2FSEA 3OL2A 5DEFA 5IJKC 2OSLA 4GXVH 4GRLB 1EA9C 2DMBA 4HAGA 5C0BA 3IXTA 5FYKE 4OT1L 4Z0XA 3I84A 4NOFA 3FQTA 1F4WH 4OZGB 5MHSD 4WGWB 4X83A 5DQ9A 4D0BA 3RI5K 1R3HB 3DTXA 1YEHL 4KK9D 1BVLA 4QT5B 1S7QB 4H0IA 5LJYH 3O81A 1A6AA 3LCYA 2B1AH 3OF6A 4JRWA 1KTRL 3LN9A 5F1NB 2DKSA 4N0RA 4NO0D 3B43A 5EBLA 5ESVB 3P0GB 4LHJB 4AIXA 1CD9B 4CU6A 2CIKB 2DM3A 3MRPB 4NDMB 2Q3ZA 3FL7A 3FT4A 1DP0A 4XMPH 5DVNA 3MUJA 3P73A 5DMGC 4K9EC 4M5YH 3MRFA 1CFNA 3EOBB 4OF0A 3HS0B 5D1ZD 1RPQA 2DIAA 2DI9A 5DK3A 3EJJX 5IGXL 5HHME 5KVGL 5F7DA 2VDLH 3LAFA 3T77A 4UINL 1KCRL 2J88H 2JCCF 3WV0A 4JPKH 1NL0L 3VGEA 4JZJB 1KJ2B 1QFPA 5DD3L 5C0ND 1JF5A 3EO9L 4P5KA 4XVSL 1FYTA 1MLCB 2IQ9H 4WUUA 4NN5C 3KR3H 3QO0B 5DUBA 4O9HL 5CUSL 3C6LD 5C08B 3AVEA 5I75C 2B39A 4KDWA 3LQZB 1B6DA 4ODHH 5SV4A 2QADD 3TBWB 5C7XL 2XT1B 5T3XH 3F65A 2BXYA 3EJYD 3WCYA 5C3TA 3RHWF 1D6EB 4FQXC 3MLXL 2Z31D 4KQ4L 4L4TE 3KYNB 4AYFA 1BWWA 4X4XB 3QXDA 3RDTA 5JIIA 2E27H 3WFDL 2ZNWA 5SWZE 3TBVA 1ZGLP 3BKYL 5KW9L 1AI1H 3GHBH 2AXGA 2VNCA 3L7FA 3G5ZA 4D8PA 5DJCB 3Q5YA 5C6TH 4X6BA 2ZG3A 4GS7C 5CBAA 5ICZA 4JVPA 4WW2A 1YY8B 3VXOA 2QV2A 3MV7E 1A64A 2I07B 4E0RB 1ZA6B 5HHPB 1TTGA 3U46A 2EC9T 3IFOB 1FCCA 3QNYA 1CLOL 3X12A 4IDLA 4L3AA 4FFZL 1KTLA 4JN2B 4XBGB 4TVPL 2VZ1A 1E28B 1CE6B 1DE4B 4X9FA 5ACZB 4PFEA 4ZOCA 4PRID 3RVUD 4DKAA 1WFOA 4EI6B 5D70H 4HIHA 5KVDL 3NA9H 1NGXB 1IQDB 2WBJA 1D6VL 4NM8L 3QUKA 1WZ1L 3CK0H 3LB6D 4EOWH 4CW1A 5IHUH 3DECA 4OUUB 5DK0A 4ZPVA 5E8DL 2KZ1B 4TQEL 1B0WA 4M03A 3KLAA 3QWRD 1ADQA 5DHVB 3RTQA 5I76B 5J89A 1KB5B 2K1MA 5IT2L 4JG0H 1W72A 1BECA 3DETD 4LCWA 4HCRA 5I75B 4CRPA 2VDRH 2CRMA 4G43B 3IFNH 1CVSC 4EIGB 4APQD 1Y6MR 4JB9L 5FYJL 2H3NA 3WJLC 1NCWL 2YPVH 2VQTA 3S98A 5GZOC 3O3DA 1JPFB 1RJYA 4FQXB 1U8IB 4E5XA 1C5DB 3DHMA 3OV6A 4R0LA 4DK6A 2VN7A 2B4CH 2P5ED 3QDJB 3UTPE 3BXNB 3LKRA 1Q9OA 4RNRA 4RWYH 4I18B 3P77A 4GS7B 4BQ6A 4GUPB 3V95A 1BIIB 3BQUC 4XP6L 3RX5A 1D9KC 3GMQA 2PW2A 4OF3A 3JV4B 5K9KA 1FGVH 3OKYA 3HI5L 1LQSR 2CKBB 3ALPA 3OJDB 4HS8H 2WWKT 2QQKH 5IV2A 3PV6A 5EC1A 5C08D 1AY1L 3ZT7A 3B5GA 4HXBL 1TITA 1A6ZA 1TIUA 3WDHA 3V79C 2IPUK 1NMAH 4K07A 4MQ7A 3I02B 2YSSA 3HNSH 5CEZE 5HGAB 1ORQB 1T7XA 5B4MC 4NFDA 1OAYH 1U8JB 5KS9F 4HFUH 3L3KB 2W0KA 1MRDH 3K3QA 3RY6A 1U3HB 1DUZB 4CADB 3HR5B 1RZIB 4LLUA 4O51A 3QIUA 1N6UA 4F9LC 1YNTA 5J06A 1WWWX 5DMGD 5DRZB 4NGHH 5L6YH 4ZFFA 4M1DL 2AJ3A 3FB5A 4X4YA 3EZ8A 2Z8WC 4LKCA 3PDDA 4QGTA 4LMQI 3GSQA 4N9OB 5E8PB 3WN5C 1MAMH 4HD9A 4QY8B 3HZYB 1Y0LB 1S9YA 1IGML 4LARL 2F58L 2FATL 2FZ3B 4HUXB 1NDMA 4PRPA 4PBWD 3MBXH 3MROA 5MEPB 1SY6H 4HWZA 5FDYA 3MLUL 2G75A 4DFHA 2IC2A 1MFAL 1JGLH 3RVVC 4BUGA 4LCCA 1HDMB 3LKQB 3MXVH 1GOHA 3QIWA 2IADA 2I60L 2F53A 3THMH 3D18A 3RWDB 2VDQL 3BQUB 3BE1H 5T1LB 4PJ5B 2DOCA 5CZXC 3TIEB 4LSTL 2JJUA 5DJ8A 4Q9CA 5J4MA 2R0ZL 3ILPA 2CSPA 4GH7B 3QNZA 4Z7WA 4UAOC 3RPIB 5TDNB 4Q9RL 1ZVSA 1Z5LA 3M07A 4M4PA 5EA0H 3PWUA 2JK5B 3TF7C 3VWKC 3HUJF 2MHAA 4NYLA 5GGRB 5TPWH 2FJGB 2PNDA 3TFKC 2XXMB 3CCHA 2AJZA 1W8OA 4X5LA 3S96A 1YDPB 1CXFA 4FN0A 5IB1A 1PLGH 1BFOB 4FQXD 1BVKB 1I9RH 2H32A 2BZDA 1Q9WA 2ICES 1PG7L 4URTB 2EICA 2G5RA 4ZSOA 4NQDB 3QDJD 3AM8A 3AREC 3K8LA 3UTSE 1BEYL 3CXDL 4R97B 2X4NA 4P2QE 4DW2H 3BVNB 2C1OB 1EHAA 5L2KA 2AK4A 1RZKC 1C7SA 4YR6A 1KJMA 1D7FA 1JZ5A 1CK0H 1OHQA 4UDUA 2QQNL 3RY4A 5DR5L 1OQXA 2ENYA 2P8LA 3CVHL 3DV6A 1A6TB 3P9LB 1NBZB 4WI5A 2AAVA 3WN5B 2MTPA 2KH2B 1DQLL 4CBPA 3VXME 4YIQA 3V9FA 4PJDA 4YLQT 5F89B 4WFFD 4GKZA 5HGDB 4QRRA 5MEQB 3BT2H 2MQ0A 4EI5C 4AEHL 1I7UA 5ISZD 1C5BH 3NABH 2CMRL 4OZHA 3AXLA 3ETBF 3D6GA 3MRJA 2VN4A 1AR1C 5EIIA 1I3GH 4HKJB 5E5MA 2ZUYA 1T0NB 4RA0C 1HHHA 1DBKL 5IG7A 1S7SB 3AB0B 1HSBA 3KPRA 1URLA 2ADGB 3JUYA 4K94H 2R2HA 4FQQA 5T3XL 3UPCA 4BYHA 3T0VA 2JE8A 3MJGX 4Z7VE 3VWKB 4D9RE 4DQOH 2CGRL 4EUPA 3BESR 1I9EA 2VLJA 4PJ9C 4PYHA 5GZOD 5D9SB 3G04A 2XKNB 3S7GA 3CIQA 1HILB 1JTPA 2YEZA 1EFXA 4Z7QE 3QZWB 1LMKA 4S1QL 3V5DA 2ZP0T 4DKFH 3B2UC 1K8DB 4XRCA 3KPLB 4Y8AA 3OR6A 3JV0A 3QG6B 4QRTA 3AREB 1IC5L 3U0TB 4Z8FH 4PP2B 1FE8H 1K5NB 3QEHB 3HE7C 4HSQA 3KPMB 3MV9A 2NY0C 4ZUSB 2Q8AH 5A2IH 2RR3A 1ZEAH 3BQUD 3NAAH 4JFFB 4ODXB 1D9KD 1MUJB 3UBXB 5T1LD 2X89A 2HKHH 3T0EA 1KBGH 2QKIB 1S78C 3DO7A 5L2JB 2EDDA 5D93C 4POZC 4QEGA 5GRJH 2IBZX 4PY7B 5BRZB 1GZQB 2VLRD 2Q8BL 4NKOB 4AIOA 5IHUL 2XWBB 2J6EL 4KMLB 3VG9C 3DSFH 2NCMA 3ZE2E 3FQWB 4JCLA 3V5KA 1UXWB 5B4MD 4YDIH 1MIMH 2H1PL 1CDBA 3KPOB 4IRSC 4JPIA 3P0YL 4FS0A 1TNNA 3GKZA 3D0LA 3FONA 4JRXA 5D7JC 4XPBH 3MRDA 9CGTA 1AJ7L 4M02A 2WBWB 3IU4H 4QHUA 4YGVB 5D7IE 2PTVA 3MACH 4OKVA 4WI6A 4MA8L 4H25B 1NCAH 3RL2A 3FB7B 4PJ9B 4Y19E 1II4E 4W6WB 5AZEH 1R0AL 1A7OH 5FV2A 2OP4L 2XZCH 3RU8L 2ZSWA 2QSQA 3D39E 1T5XB 5DD5H 2RQ8A 1V7NL 5GS0C 2VXSL 3VD9A 2DAVA 1OWWA 3VI4F 5IJVA 3MUY1 4PGEB 4WFED 4XVUC 4L4VB 3LRSA 3RVVD 3D0VB 1MCCA 3IDUA 3M45A 3VFOA 2JB5L 2BJML 2BMKA 4UV4H 4PGDB 3BHBA 3T4YB 3FQXA 4BZ1L 3NFSL 4JHBA 1OT1A 2E9JA 3DX7B 3QNXB 5CZXD 4XGZB 3EBAA 3L6FB 5D1XC 1EBAA 4ONFL 5EORH 5IIEA 5ALBH 4MQTB 3EDEA 1A9EB 1ACYH 2IH3B 1LK3H 4WEBH 3Q3GA 3QEQB 4U6YB 1YNLL 2APWA 3GSUB 1NCCH 1NFDF 1DBMH 3DGGB 2DM7A 3TFKD 4XHJC 4NQCB 4PJXF 5IHBA 1UM4L 2OCFD 2LTQC 5CJXA 1G7JA 4I9WD 3VG9B 4M00A 4OZIF 1JGEB 3QRGH 3JBG7 2L7UA 1FGNH 3L3OB 2BOBA 4XP5L 3UX9B 1RUPH 2EIDA 1MIEH 3U2SA 3ARED 1TVHA 3C8KB 5T1KA 4ZYKA 2FNBA 5D1QC 4D94A 1PG7W 2X44D 2GJ6B 3FQNA 1EUTA 1G9NH 2DTMH 3MOBL 1AXSA 4QHKI 5DRXA 3QIBD 1N0LA 2WIIB 1MAML 1QFWM 5E1HB 1T2XA 3X3FL 1QACA 3V4PH 3U4EB 1FO0L 1MHPL 3CFKA 5HDQL 1NGWB 1I7RA 1F2QA 3UTZB 4FABH 5E2VL 1MRCL 3E6FB 4YHOL 3PL6B 4KROC 1FCGA 4JEGB 2BVPA 1B88A 3IJYA 1KTDA 4L8DB 1G9MH 1WUNT 1UC6A 4PV8B 2XA3A 3QCTH 5EO1A 2QEJA 4EI5D 4TUOB 1TCMA 3EYQC 1QR1A 1OD9A 2Q7YA 3LH2H 1YY9C 1QKZL 4P5MB 1L0XA 3HLAB 5HHOA 3UJJL 3MYJA 2P5WB 1LWRA 2IEPA 3H3PL 1MH5A 4RFEA 4XNZC 1AR1D 4MSWA 3V6OE 5M95B 5D1XB 3IDJB 5B22A 3TESA 1UA6H 1WV7T 3CLEH 3O6KH 3RVTC 2W65B 5FA3A 4IRJA 1J1OL 1BX2A 3DX6B 5CIPA 3WS3A 5JR1L 4O2EA 2YUXA 4PV9B 4O5LL 1DANU 3TBYA 1QQDA 5MP6L 3DO3A 3NIDE 4K3DH 4MDIB 4PJ9D 1C1EH 1U8QA 5IVXE 4K55A 5K9OA 3VGGA 4U1LA 4BQCA 4PJIF 2QBWA 5DJYB 3LN5B 2HT3C 5KN5B 4LFHD 1NCBL 1XGYL 1ZHLA 1LO0H 5CSZA 2F74B 4L4VD 1RIHH 3PGFL 2NW3B 2VXUH 5IBTL 5I9QB 3HE7D 3OAUH 1D5IL 2W59A 4JM2F 2NY0D 5DZLA 3RWCB 4EKXA 3SDCC 2NLJA 4L4JA 4S0TD 1J05A 3PF2A 1IVLA 1FL5A 4LGSB 4UT9H 1R3KA 3TA3A 3I2CH 3OB0H 4U3HA 1FZKB 2ATKB 4QRUA 1S78D 4L4TA 4HWEL 1K6QL 3BT2L 5L8JB 4POZD 4Y4KC 5SWZA 1RFDL 1WTLA 3SEPA 4KROB 4YFDB 5EOQH 3OPZH 1AQDA 3MV7A 4U6VH 4Z7OE 3MLVL 4NQCD 2MFNA 5E1AB 5F1KC 4OTXH 1I3GL 4L3EB 5GISL 3L1OH 3BN9C 2Z8VC 2CLZB 1IL1A 4MJIB 4F7TA 2HJLB 2E9BA 3NTCL 4D3CL 3PXHA 1LGVA 2IALA 3KYKL 3NIFE 4IRSD 4EDXB 1JZ3A 3A6CH 5BXFA 4X6DA 4RMSA 1S9VA 2YD6A 4CVZB 4JFDB 1ZMYA 5D7JD 1BZ7A 4WHCA 4FFYL 3HC0A 2ADIB 3MLTA 2X4QB 1IM3B 1CGXA 2XTJC 4ZD3H 2H41A 4DAGH 1AGEA 4N8CL 2W60A 4UDTB 4ZPTA 5C0DB 1F8TH 1FLRH 3ARRA 1MFBL 3DGCR 4Q2ZA 1FV1A 1V7ML 3I75B 3GFUA 1HOCB 2VZUA 1FVDA 1FE8L 1CICC 1NGZA 1QBBA 2O61B 5DGQA 3ROLB 5GS0D 3SDYH 3RX8A 1A4JB 4XVUD 1SEBB 3PDOB 4HIIA 4M8QA 2BY3A 4GG6E 2HT4C 2P5WD 4PRBB 3WJJA 3MRBA 5JMRA 2EYSA 1JPSL 1K2DA 2AEQL 1T0MB 4ZQKB 1FC1A 2IAMB 1CF8L 5D1XD 4HPOH 1KLUA 3KPTA 3OKMB 4OGYH 4DGIH 2BSTA 4Q0XL 2IF7A 4PJAE 2ZCKL 2RAMA 3IF1B 3AY4A 1CCZA 1K9TA 1IAKB 5EO9B 3G6JE 2VABB 3U0WL 3LVEA 1MI5A 4OJFH 2W9EL 4JDZB 3DSFL 4XHJD 1PKQB 1MNUL 1RULL 2VL5B 1KULA 5E08H 1IC1A 1NSNH 1F4YH 5AG8A 1YMHB 3GSNA 1HHKA 4V2CB 2BFVH 1HKLH 1BFVH 2NY2C 2N56A 5I17A 3PGDA 4G6ML 1YEFL 2GY7B 1TETL 1PY4A 3H9SA 3AU1A 5D1QD 4DKEL 3LDBC 4JQXC 3GSRB 3OKOB 2OSLB 3BPCA 4F80A 2XTJB 4UNTA 3IXTB 4JANA 3W5MA 2I9TA 3LMJL 2G9HA 4YQXH 3TNMA 4PJ7B 3FQTB 2XZCL 2Q76A 1NFIB 4DVBA 2WK2A 3DTXB 1F13A 3BWUC 3VXRE 2MKLC 1BVLB 4LVOC 3Q6GL 4XBEH 5HYFA 4KROD 2CK0L 3UEZA 2R4SL 2IPTH 4OFIA 1K3IA 4NZRH 5EBLB 3EYQD 5C0FA 3GKWH 4ZFOB 3RVWC 1YY9D 2VXTH 3O2DH 4L3ED 1BQSA 4MJID 3ES6A 3FT4B 4O4YH 3ISWA 3RZCC 4JKPL 4WW2C 3MRGA 1JL8A 5ALBL 3RNKB 3MRFB 3SDDC 1UYWH 4KKNA 3U0PB 2XZAH 3T65A 3MX0A 5F1IA 4H5SA 1CFNB 1HXYB 4NQEA 1QSFE 2D2OA 4R4FL 1MJ8H 1NCCL 2F5AL 3RVTD 4F7MA 5I16B 4JFDD 1WFNA 3DVIA 4OD2A 5F7DB 2AJYL 1FJ1A 4N0YL 1EH9A 4WCYH 4XPGL 3H3BC 2AI0H 1JN6A 2X1WL 1WBXA 4U1IA 2AV1A 4OQTA 3LIZL 1FGNL 4NRXA 5SWSD 1KN2L 1YPZF 4TSAL 1JZ6A 3LSOA 1TXKA 2EDTA 1RUPL 4YDVA 3V7AG 1MIEL 4GAGH 4DOHE 1EO8H 4NRYA 5I1KL 5DLML 4NQSA 4P5KB 1FYTB 2Z35B 1OAQL 1B0RA 1RZ8A 4WUUB 3RQ3A 1CTOA 4HC1H 2HT3D 4QRSA 3QUML 4XWGH 2J4WL 3QG7L 3LDBB 2FR4B 2LAGB 5L9DL 3MREB 1WFUA 3SDCD 3MLYH 5D71H 4AEIL 4MZ2A 3HNTL 1MCWW 2XNAA 5FGRA 3EYFA 3RBGA 4F15C 4P9HL 5I2IB 5GPRA 4QRPE 4XXDA 5JW4R 2CUMA 4Y4KD 4LVOB 3VFSA 3HG1E 3UTSA 1FNLA 5GRVL 2XZZA 4P2QA 5GZNC 1J10A 3CSGA 1FDLH 4HCRL 4R0LC 1RZGA 3QXDB 3RDTB 4H1LG 4MNGE 1MF2H 2E6PA 2NTFB 4NQVA 3TBVB 5DF0A 1BD2E 1X5YA 2AXGB 4ZUVA 2DQGH 3L7FB 4D8PB 3QULA 3BN9D 4DTGL 5CBAB 4X6BB 3J7HA 5ICZB 4U3XA 4WW2B 3RZCB 2FRGP 1TJHH 2AJXH 4QWWC 1C5CH 1CWVA 3SDDB 1CLZH 1AGDA 3U46B 1BQHG 1G1CA 3D3VB 4FP8L 1FNEA 3QNYB 2A74A 4LGRB 5KOMC 4DN3L 1OWRM 1KTLB 2O5XL 4G8GD 2OL3H 3B2VH 1SY6A 1L6ZA 2DQIH 5ICYA 2XTJD 4KKLC 2Z8SA 4C4KO 4MHHI 3UTTE 4HIHB 1GZPA 2GHWB 3AUVA 4PJGB 3QFJA 3DIFA 3QUKB 4LVHC 4M7KL 4KGJA 4CW1B 4KZEL 3OF6D 1DQJA 5DK0B 1BVZA 1CICD 3EFFA 3OAUL 5DEZA 3KLAB 4NWTL 4Z7VA 1T1XB 4OFKA 3QIUC 2CKNA 2HT4D 5I15H 3STBA 3I2CL 1W72B 1FPTL 3G08A 5LBSL 2YD1A 5DMIL 1IC7L 1Q72H 2EDLA 1CU4H 3ARGC 4YXKH 5I1HH 4U1GB 1A6WH 1WWCA 3DARA 1U0QA 1A0QH 3R1GH 2ORBH 5EOTA 2EDRA 2H3NB 4M8VA 1FRGH 4L8CA 4KXZH 1RJYB 3DYMA 4XMKL 3JWDL 4DJMA 3GJEA 4E5XB 4R0LB 2WAHA 1VEOA 1WLHA 2AW2A 3MPCA 4OLUL 5C71A 4TSCH 5D4QA 2DLIA 1QZ1A 4GKSA 1Q9OB 3PWLA 1Q1JL 4LLYA 4DUWA 4O58H 2APBA 3QIWC 4H8WL 2HFFA 2NY2D 1EXUA 3OAZH 4OCSH 3S3PA 2PW2B 2FLBT 1FHGA 4XPTH 1OLLA 5KZCB 1NC2D 1XGTB 4X4ME 3SOBL 1TPXC 1HE7A 5FUCE 3A0OA 4G7YL 5LAXB 2W38A 3O45A 5IV2B 3PV6B 5EC1B 1U91B 1NDGB 2ILLA 4I3RL 1R5IB 3RBSA 1J9CT 4OSUH 4M7LH 2B1HL 1I1CA 1NLBH 1DQML 2E7CA 5CD3B 3GUTA 2GEEA 3EDDA 4MQ7B 1KGCD 4G80B 3DROB 2EDJA 1T2QH 1A7RH 1FBIH 2MCPH 1NKOA 1R24B 2VQ1B 1LNUA 1UM6L 3ULUC 4P9ML 2P45B 1A3QA 1TMCB 5T1MB 1KUMA 1UB6A 1QUNA 1N3NA 4OZFH 1VADA 1PX3A 1JGUL 3RVWD 3EO0A 5FGCB 1QOKA 4Q9BA 2P44B 2VLME 4LLUB 5D7IA 4F3FA 3QIUB 1BOGA 2HP4A 3RZCD 1YNTB 3BDXA 4HPOL 3EDFA 4Y19A 2G60L 1AFVH 3SDDD 5AUMA 4ZFFB 3ARGB 2AJ3B 3FB5B 3L5WA 3O3EB 3V8CA 4X4YB 3D3VD 3G6DL 1S7RA 4LKCB 5EUKA 4ZTPL 4NJAL 5BW7C 2NPLX 3GSQB 3P9MB 1X4YA 1GC1C 4ZS7H 4AM0A 4NO2A 1S9YB 2EDQA 2IQAB 1OAXH 2VLKB 2H2SC 4XPHH 2NW2B 1F4YL 5H37H 1LEIA 1GOFA 5KG9B 1NDMB 4PRPB 2FX9L 4K3GA 2EEAA 4RZCA 5CSBA 5B21A 2G75B 4NBXB 3TN0A 4DEPB 3NIGF 4JO4L 3A6BH 1GGIL 3QIWB 2IADB 3SE9H 3QFDB 1TFHA 2XFXA 2CRYA 1LHZA 2F53B 3QUZC 3D18B 3OKKA 4AT6A 1UKTA 4EVNA 2A0LD 3GMMA 3QUXA 1P5VA 3S5LB 2JJSC 2OZ4H 5I30H 1TPXB 3L5IA 3FOMA 3ILPB 4XNYL 3MV01 4QHKJ 4N0UE 1SBSH 2EEBA 4Z7WB 1F45A 4OZ4A 2HFGL 1E4XH 1LE5A 4ZG1A 1XCTB 3PWUB 1I1RA 2MHAB 5I1AA 4RMRA 4CJ1A 4FTVE 4B41A 3CCHB 4UV7L 2QHRL 2AJZB 4XI5C 1OAZH 5FIEA 4XX1G 3S96B 4E41E 1U93A 4U31A 2Y5TA 5IB1B 1NAMH 1NEZA 5F9WB 1RJLA 1P9MA 2D7NA 5GZND 3IFLL 3O2DL 1J7VR 2DD8L 4KTEH 5IQ7H 5EZIH 4JO1H 4O4YL 1KIRA 2JJWA 4Y16C 1H8NA 2X4NB 3B5HA 3GRWH 4GFTB 4OFVA 1FH5L 5L2KB 5KBNC 2AK4B 1YYML 4PB9H 4U7KA 4QWWD 4UDUB 1IGFH 1JGVL 4LU5L 4JFYA 4NNYA 4F58L 3T0EC 2FIRT 3KPNA 5KZCD 1P2CA 1HN1A 4PGJA 3CDFA 3DV6B 4TUJB 2W91A 1BPVA 4YIQB 4PJDB 3QAZB 3MCLH 4HK3N 4GKZB 3N1PC 3Q5TA 3RNQA 5EFIA 1T83C 4KKLD 4DZ8A 3F6LA 4X5WA 1EO8L 4C57C 2PYEE 5KSUA 4OZHB 3AXLB 5B38A 3I3BA 3V6OA 1H8SA 3MRJB 3WDIA 1IGCH 4HC1L 1V3JA 2N4IA 3KLHC 35C8H 3EYUL 3QUZB 5C0CE 2CD0A 1A3LL 3EW3B 4W4OC 4HIXH 4X5XA 4JHAL 1U8MA 5F88A 1LE9A 1Y18A 4UILL 5D2LF 4GAYA 5E5MB 2A6KA 4TNWK 5MI0C 2X4UB 3IJSA 5IG7B 1HSBB 3QIUD 4G8IA 3KPRB 2HTKC 4KRPC 4FQQB 4TOYL 3RIAF 5IVXA 4WIQA 3ARGD 3HCVA 2YMXL 4YWGH 4EUPB 4V1DB 1YA5A 2VLJB 5CP3H 4R4NC 5JIPA 1MY5A 4ESKA 3PHQA 1FC2D 1R5WA 3G04B 4YFEA 3KS0J 2YEZB 1EFXB 1P84J 3WL9A 2R56H 3V5DB 2VLKD 1OOAA 1OSZA 4YPGA 2A6JA 4LLWA 3QUYD 4XNMA 4XCCL 4PRPD 4F37K 3HZMB 3MLZL 2X1PA 2XG5A 3KPQA 3ZSTA 3QIWD 4MZ3A 3MNVA 3MV9B 3G6AA 5CP7A 2R1XA 3CMOH 3C5ZA 4KV5F 4NZTH 1JYNA 1JNJA 3T0EB 2YBRB 2OL3L 3B2VL 2P4AB 2OJZH 4HLJA 3DWTA 1H9VA 4PBXA 3DO7B 1UACH 1TQCC 1KACB 4Z76A 5DYOA 1P1ZA 3WHXA 4DGVH 2XYCA 3HI6H 3MGAA 1N5YL 4QXWA 4MLSA 2GFBA 3ARDA 1HH9B 4M61A 2MCG1 3V0WH 5IHZB 5CJQH 4QLRA 4Q7DA 5ILTL 3V5KB 2R69L 1VERA 3X3GL 4K8RC 2DMCA 3RL1B 5CEYA 2Z4QA 4Z77A 3D0LB 1FNAA 1MFNA 1T4KA 4JRXB 1UB5B 2BCKA 4G6KH 3MRDB 4NKDA 5FB8A 4KRPB 4NN7C 3DRQA 4IIQC 3LS4H 4QHUB 4XCYB 4L1HA 4IDJL 3UTQA 4M3JA 2MPAH 3LQAL 5J1AA 1C12A 5EUOF 4OKVB 1BQUA 4N68A 3RL2B 4X98A 2JELH 3TJHC 4Y5YC 2ZSWB 4G6FB 2H2SD 4JKWA 2OX5A 2B0SH 1N64L 2NR6C 5IJVB 5FF6A 4MJ6A 1AHWC 1BP3B 4JZOA 3LRSB 4YH6A 1F3RB 1KC5H 4X7EC 1WBYA 3VFOB 3QUZD 5GS1A 1AGCA 1P4LA 3BHBB 4YEFA 2CLVA 3FQXB 3SO5A 2E7HA 5FECA 1FL3B 4PJAA 1ZGLB 1T80A 5ALCH 5IIEB 3G6JA 1A3RH 2A2QT 4M7LL 1TQCB 1UCTA 3Q3GB 1FIEA 2D7PA 2JJTA 1AKJA 3BP7A 1D5BB 5IW1B 2CR3A 2NY6B 3VW3L 5I1JH 5E9DE 4OBSA 4V1DD 3EOAA 4CMMA 4XI5D 4PJEF 5HVWA 4OCYL 1NAKL 3N85H 1G7JB 1XF4A 1L7TL 1EFXD 4R2GB 5JHDD 3EZJB 4Q6IC 4WWID 5BQ7A 2J8UF 4KC3B 3TH4T 1JPST 3U2SB 3W2DH 1TVHB 1AFVL 5T1KB 4Y16D 4FQHA 3MZGB 5B39A 3PHSA 3TO4A 1PBYA 1FFRA 1AXSB 5DRXB 1J8KA 3VXRA 3U6RB 1KNOA 4PJFF 3T0ED 1MWAH 3TA3C 2CR6A 2VSCA 2X9XA 4O2FA 4JPWL 3CFKB 5AZ2H 3BZEB 4LNRB 4Y5YB 3GGWA 5HDBE 3BRGC 5E4EC 1BMGA 1HI6A 5LGJA 2BVPB 3C6SB 3IJYB 1KTDB 3BFOA 2BY0A 4PRIE 1V5JA 5EO1B 1KEMH 4OZGE 4G9DA 5BVJA 1QR1B 4JFHD 1T6WA 2Q7YB 5IFJA 1IT9L 2HWZH 2VIRA 3MYJB 3UTOA 5I30L 3CVIH 3KLHD 5HHVL 3EIFA 3PQYD 2WLZA 1MH5B 2Z8RA 4M7JL 4TTDC 3ZKMC 4A2MA 1DN0A 4MSWB 4XC3H 4HX1A 1CN4A 1RZFL 1UZ6E 3QO1A 3GMRA 4ISVA 5HHMB 4K71C 3GBNH 3DRTA 5CJ5A 3MODL 4LPVA 3E6HB 4IRJB 4BSJA 1BX2B 5BV7L 5CIPB 4JRXD 1IRAY 3WS3B 1RVFH 4YE4L 3WFHA 3ZO0A 2HTKD 1W0YT 4KRPD 3SCMC 1CBVL 5F9OH 2EH8L 4LHQB 3TT3L 1QQDB 4I77L 1RUQL 5E6ZA 2ADFH 2G5BA 1IKFH 3ABZA 1U8QB 4R4ND 4I4WB 1VPOH 1ZLUH 5K9OB 4U1LB 1IAOA 4G6FD 4M6NH 1G7PA 4Q6IB 4GT7A 2Z9TA 4JFQB 5BZWA 2P5EE 5DZOA 4O02L 1ZHLB 5CSZB 2DQUH 4JPVH 1GH7A 2HLAB 2UWEE 3TVMA 4NBYB 4L8SC 1DDHA 1SM3H 5EWIH 2A9MH 4XPAH 1MCOL 1J05B 5DT1L 3HG1A 3U1SH 1R3KB 3TA3B 2VWEE 5L88H 3QJHA 4WTXA 4L4TB 1JPTL 1MCQA 4P23A 1RY7B 1U6AL 1LEGA 5FYJD 4MNGA 5C08E 2BVEA 4X7SH 4H20L 1BD2A 3RWIA 4JJHA 3ESUF 4J7RA 5FCUL 1AQDB 2QSCH 3MV7B 4GLRI 4RGOH 5TQ2L 1ZLVK 1MJ7L 1UXSA 3GI9L 3VG0H 1IL1B 4J8RA 4M6MH 5IFAH 2WINA 4PGZA 4Y4HA 4F7TB 1NBVH 1QYGH 2JIXA 3L95A 1CTNA 4GAFB 4K8RD 2IALB 2DICA 1N2RA 4K71B 5BXFB 1S9VB 1OP5H 5T1KD 4HS3A 1GIGH 3UTTA 3GSNL 4X7CC 3HC0B 1NBYA 3MLTB 5GRWA 4LDOB 2OTWA 3AMKA 1WF5A 2ARJA 4TYUA 1ZHNA 2FHCA 4PJCE 5F6HI 2W60B 5EBMA 2R56L 3MJ7A 5ESAB 3LN4A 1MPAH 1N59B 1UH2A 4Q2ZB 2GTWA 1FV1B 3GJFA 3TJHD 2AGJH 2IPKB 2YPKA 1KEGL 1FVDB 3HMXH 1NGZB 1J1PL 1JNNH 1A5FL 4YX2H 4ZNEA 1J8HB 4HIIB 4M8QB 5T1DH 5KSAA 4AL8L 1RK0A 2NY7H 4L8SB 3OWEA 4LQFL 2ZCHL 1K2DB 1X3DA 5IVOA 4M62L 5DI8A 3FRPG 5ENWA 3U48A 5I8CB 4GXUN 5FM5M 1KLUB 3RWFB 2A9NH 5CILH 1ED3A 5TJWK 2BSTB 4X9HA 5DC9B 4D0CA 3IXAA 2APVA 2BVTA 3U7WH 3MLRH 3NCMA 2C7UA 4JHWL 2X70A 3NA4A 1Z0NA 4HZLA 2UZIL 3A6OA 4X4MA 1HHKB 4FA8A 1EHLH 4AMKL 3PGDB 1QHOA 4OM0L 4M7ZB 3V6FA 3WMSA 2RB8A 3GO1L 1NUDA 4XXCA 3BEWA 1HZHH 3HNVL 2EH7H 1FG9C 4KK5C 4G8EB 5AWNH 3TEUA 3QSKB 3BPCB 4ODUA 4M9OA 1FZMA 2AXJA 1JBJA 2E7LC 3ECBB 3MRCB 4XP9H 4JANB 5E8NA 1OP3H 2I9TB 3TNMB 2Q76B 4UT7H 1KJ3H 5E00A 3ZE1F 2D4DA 2YK1H 3WUWG 5E6YA 3NPSC 4BZYA 3EFDL 2B7DT 4JY4A 4RQQA 3C87A 1NUGA 3IFPA 5ISZE 3BWAA 3N1MC 2OJEA 5KTEH 1ES0A 3DVNA 4ODTH 2DB8A 3W0WA 3K80A 4I0PA 4GW1A 1KXTB 3L3DA 3ZKMD 1A3RL 2BNQD 4TTDD 5SX5H 3H7LA 1FNFA 3K74B 3T65B 1CYGA 1B4RA 4Y5VA 4H5SB 3REWB 3LRGA 1HHIA 5E2JA 5ELIA 3CXHJ 5I1JL 1JK8A 4M9PA 4OD2B 3OZ9H 4XPFL 1Q9KA 1XGRA 4F8TA 2PXYC 3VGFA 2C9AA 1UFUA 2DLEA 3SCMD 4GAJH 1JN6B 1A4KA 4U1IB 2AV1B 1ZT1A 3MTRA 4BFGA 1B2WH 2LE9A 1OSPL 3DHJA 4ORGB 3LSOB 1CDUA 5D7SH 2HKFL 4YDVB 5ANME 4JR9H 2X4RA 4HBCL 4NRYB 3D69A 3UO1L 1NLDL 4NQSB 2VH5H 4N0UA 5DD6B 5I8EB 2I9LB 4OLXL 1LILA 5GGSY 1RZ8B 2WIMA 3WUZA 4QRSB 4QHLA 1J5OL 1P7HL 2ZPKH 1J8HD 3TV3H 3Q0HA 4U2ZA 4CMHB 5T3XD 4ZTOL 1VFAA 3EYFB 3DXAB 1INDH 4LNVA 4R4BB 4XXDB 1DBAL 3ULSA 1XGPB 2NY5H 3HMWL 4LASH 2XQBH 3JXAA 3NPSB 2OR7A 3UTPD 3UTSB 4JG1L 4PJ8A 3IB4A 4OZFA 4P2QB 2NZ9C 1IQWH 2VLRE 5TE6H 4OFDA 1RZGB 1L7IH 4ZAKC 4NQVB 3PP4H 4BK4A 4ZUVB 3QULB 4LHUB 2WUBH 5I8OL 2ITCB 2E7MA 1CIDA 3VXMB 4Y2DA 3WKML 4PG9A 25C8H 3SGEI 1CDHA 2WSKA 3OJVC 1B0GA 1FNEB 2A74B 1TZHA 1RZKH 1MCPL 4HWBH 3GBLA 2HRLA 4Q9QL 4FQLH 1XH3A 2PXYB 3OKEB 2JB6A 2F5BH 4LK4A 5IK3A 1T04A 4I48A 4OB5H 5C0CA 2APTA 4KTDL 4MMZC 3NGBB 1P7QA 1GZPB 4QXUH 5CCKL 1IMHC 3DIFB 3WKNA 3NZ8A 1DQJB 3RWGA 2ATPB 3EFFB 5B8CA 4WFEE 4N8VA 4KU1A 2A9ML 4K94C 5E24E 4Z7VB 5J3HC 1NCDL 2O5ZL 1ZTXH 3O6ML 3G08B 5FGSA 1GVIA 1M1SA 4DN4H 1DFBH 3SGJC 4NQUA 2OMNA 3PP3K 3BDYL 4G3YL 3K2UL 2FX8L 6FABH 1NAMA 5EC2A 1U9KA 4PGBA 3L3IA 5EOTB 3CH1A 5CJBA 1CFVH 3UJTH 4L8CB 2D03H 3RRQA 3EOTH 3GJEB 4N90D 4YBHA 2D7OA 5D6DA 3GRWA 4YBQC 2Q20A 5EBWA 3IS0X 5KS9E 4ZAKB 2MOVA 4J3VA 1Q0YH 1QYGL 4GKSB 4HMCA 4I9WE 1P4IH 2VDMH 2BOCA 3PWLB 3IDYC 1RIVL 3H7BB 4KGLA 4LLYB 4UOW1 2QTEA 5JA8B 2HFFB 3GSXA 4KHXL 1UJ3C 3RPKA 1MQ8A 4NPYA 4CJ0A 2F8VA 3BW9A 3MO1A 5ADOL 1BQHB 2BRRL 3F7RA 4QXTA 5HDOA 3O6FC 2R8SH 4KK5D 1RIUH 3OKNA 5EU5B 2FGZA 3S97C 3WNPA 1IEAA 3ZHDA 5E6IC 4A6YH 3VJ6A 3DXAD 1NCNA 1I3UA 4NO0A 1P69B 2VDPL 1X9QA 1FORL 4TN9A 2XXCB 1S3KH 1OL0A 2EE9A 5JW3L 3SHSA 4ELMA 1UB6B 1X6NA 1N3NB 4YXLH 1VADB 2Z93A 4FQIH 3NH7H 4FQ2L 1GHFL 3EO0B 1A6PA 2FD6L 5D7IB 4F3FB 3CFDA 4LHUD 4GLRH 3LS5L 1J86A 5D1ZA 1UGNA 4Y19B 1VACA 5AUMB 3VXMD 5KSBF 2VITB 5CILL 5CP3A 3L7EA 4WI9A 4X6FA 1X5HA 4WHYH 3D39B 3HUJE 2VL4A 3VE0A 3BZFA 4ERSL 4AM0B 4NO2B 1JHTA 3GMPA 3S88L 3ARTA 2PXYD 4HUUA 4NM4H 2WW8A 4RZCB 4KUCD 4MHHG 5F7EH 4H0HB 4JRYD 4U6XB 3TN0B 4N0CD 3RUGF 3HC3L 3V6OC 3IDYB 4PTUA 5I19H 4FOMA 3I3DA 5GRYA 3WNMA 2XFXB 1UJ3B 5GRUH 5GS0H 3OKKB 5DC4B 4AT6B 4EVNB 5EDXA 3GMMB 3L5JA 3C6LA 3MRKB 3O2VL 3WNKA 2NTSP 4MJ2A 1ZANL 3FOMB 2QQLL 1LD9B 3HAEH 1A1OA 3O6FB 4D9RD 5E9DA 1MQKH 5FO8A 4LSRL 4YC2C 5E6IB 3VU2A 1LE5B 3NPZB 1HIMH 3QR2A 4UTBH 3PIQA 5IUSA 2Z31A 3E8UH 2MSPA 3NCJH 1DSFL 1HEZA 2H45A 5DVLA 3IDNB 4KUZH 2Y5TB 2F8XC 4Y1AE 2VAAA 4PJBF 1NEZB 3V6BR 1JTOA 2NZ9D 3C8DA 4G8FA 5E2UH 5DJ6A 5F7NC 2AEIT 3K7UA 3S6CA 5HJ3A 3HN3A 5KVFL 1KIRB 5TFSH 2V7NB 1LO2H 4ZAKD 1G9NC 1H3VA 4J3WA 2GUOA 4RBPH 4Y5XA 4F7EA 4HQQH 4X8XA 1T66C 5KANI 3IDXL 4JE4B 1XIWC 2CJUL 3CDGA 4JFYB 4NNYB 1R6VA 1PEZA 4RGNE 4ZMAT 3KPNB 1P2CB 4JO2L 3AC0A 1YQVL 2IBGA 4NNPL 5ERWA 1KCSH 3T2NH 4P9HC 4PRIA 4OZGA 4YFLI 1G9MC 5JHLL 5DQDH 1R3HA 1S7QA 3RNQB 4DZ8B 5K9JH 1U8PB 4X5WB 2BVUA 1CI5A 1QFHA 4JN1L 4YBLC 5KSUB 5F1NA 1QLFA 3QWRA 1WCQA 2HAZA 4LSUH 3Q6FB 4X5XB 2IWGA 1U8MB 5DJ0A 1TJIL 5F88B 1LE9B 1Y18B 2ID5A 4GAYB 4HJJH 1NGPL 3PJSB 4MNQE 1SEQH 3IJSB 15C8H 4APQA 2VOTA 5J3HD 4G8IB 1Q8MA 4ODWB 1INDL 1V3MA 3HS0A 4LAQL 2DKUA 1I1YA 2AEWA 4GG8A 4Y19D 4YC2B 2XQBL 3QI9A 3U9PL 5LWYH 1R3JA 3VXTB 3NBNA 2YOCA 3N9GL 2EE2A 3D39D 2P47B 4OCXH 1QPPA 2P5EA 3CSBA 2R23A 3PHQB 5HHQB 4M48L 3WL9B 2WZPD 2VC2H 4RX4D 2EDWA 2UWEA 4GKNB 3KYOB 3O6LH 1IAIH 4YPGB 2B2XH 4X8JB 4LLWB 5HHXL 4XNMB 4YBQD 3SKJL 5J12B 1AC0A 2FDBP 1UM5H 3EHBC 4DVRH 4HAFA 2NY3B 1Z6JT 3QO0A 3KPQB 4S1DC 4HDIA 3MNVB 5FGBC 1MWAA 3G6AB 3CU7A 5IJKA 5C08A 4PB0H 5A40E 1MJUL 4J4PC 1GYAA 3QXTA 1IM9B 3O6FD 4OB5L 5I1CH 3TBWA 2FGWH 2YD9A 3IETA 1P1ZB 4XP1L 3WHXB 5C0RH 3GHEH 5J11C 3UJIL 3JWDC 5E6ID 1D6EA 2ADJA 4HUWA 2GFBB 2DYPA 3FZUC 3BAEH 3KYNA 3BKCL 4YBLB 3VI4E 4P3CH 1N8ZA 4G5ZH 3VFGL 3KHOA 3ZDYF 1X5FA 4HT1H 4WU7A 1JWSA 4H8WC 2IGFH 4MA1C 2LABA 1QFUL 4E0RA 4HF5L 3SE4C 5HHPA 2Z4QB 2OK0H 4JKLA 4L3EE 3DUSB 3TYGH 3BRFA 1T4KB 2BCKB 5GJSH 4OD3H 1VCAA 4NKDB 5FB8B 5C2UB 3DRQB 4GRMB 4JN2A 3CFJA 1JPGB 5J1AB 5BS0E 1CE6A 5JW4M 3B4NA 3LEYL 3N50A 4XVJH 3C2AL 4YDJA 4OZHF 4PJXE 5TE7H 3SGEH 2R0LL 4XCNA 3VH8G 4X98B 2X40A 2E6JA 3HZVA 4EXPX 5F3BB 1NGXA 2FLRT 4OZIE 5E94A 3HRPA 4GG6B 4WO4C 5DS8A 2DQTH 5SWSE 5FF6B 5FOBA 4F9PC 4MJ6B 4YUEH 1CT8A 4JZOB 3FFCE 2J8HA 2W0LA 2ZUWA 5JUEH 4JFEE 1WBYB 4KVNL 2NXYC 4WI7A 5DSCA 1AGCB 1P4LB 2CLVB 1MRFH 4MXVF 1MSPA 3CX5J 3OGOE 3DI3B 4PJAB 2Z0BA 3TPUA 3G6JB 1CLYL 1RU9L 2F9BT 2DLFH 3ZTNH 3MLPA 1N0XH 4LCYA 1MVFA 2V17L 3NZHH 4HS6A 5LKNA 2PTTB 4KPHL 1AKJB 2OR9H 3BP7B 4N9GA 4PY8J 4FQXA 5BCAA 3MV11 3BD4A 1T1YA 3EOAB 5L0QC 3GM0A 4YDLC 4CMMB 1YEJL 4OD1H 3PUCA 1MREH 4FQIL 1XF4B 4M5ZL 1DLFL 2AJSH 2AXFA 4MA1B 3TBSB 43C9A 1FAIL 4GUPA 4QTIH 3ARQA 1BIIA 4UZGA 2IFFH 1UADC 5AAMA 3BZDA 3ZKNC 2XA8H 3L3JB 4FQHB 5B39B 3TVMC 1OTUC 5E4IA 1T66D 2FO4B 3GBML 1FIGH 4WU5B 5DK2A 3S9DB 1XIWD 5B38G 3VXRB 1J0YA 1KNOB 2VDOL 4KAQL 1IM9D 1KIPB 1K4DA 4O2FB 5ISZA 4NM4L 3C08H 4PP1C 2PR4L 4G8GE 4X6CF 3U4BH 3GGWB 4XAKE 2YUVA 1HI6B 5LGJB 4PJIE 2WWKO 4WO4B 1J0HA 2H26A 1WCBA 4G9DB 5J7CC 3FO0H 2EC8A 1QBMH 4EQ3A 4R90L 3L3KA 1SYVA 1EERB 1P84K 2ICWI 2VIRB 3O2WH 4IOFC 2M2DA 4FQCL 1QSFB 4MXWH 3HR5A 3NCYS 5M94B 3IKKA 3WFBL 1DN0B 5GQBA 1CG9B 4HX1B 1TCRA 3QO1B 4OGXL 4ISVB 4NN6C 5LXGL 5DRZA 1AE6H 2IMMA 3DRTB 3T2QA 2R9HC 1EAPA 4JZNA 2XZQH 5EO0B 3WFHB 1CL7I 3WJLA 5ICXA 3QPXH 1UJTA 4KUZL 1LDPH 5FK9A 1RURH 4PG2A 4K7PL 3BMWA 5L0QB 4HUXA 3U7YH 1IZKA 5HPOA 2G5BB 2J5LC 2VZTA 3FHAA 3QHZH 5MEPA 4KMTH 2HTLC 4XP4L 4PJHF 4YHLH 1G7PB 1HDMA 2R0WH 5GSVA 5BZWB 4ALAH 3RWDA 3M8OH 1YJDL 1D9KA 3VXQA 3EHBD 1QLEH 5KSAC 3TIEA 3TVMB 2P7TA 4S1DD 1DDHB 4AIZA 1KYOJ 4WJ5A 1DBJH 4QRPB 4QTHB 2J7LA 1YEIH 5DJXA 1KN4H 1WAAA 1OAKH 3HG1B 1RZ7L 2C4FU 4J4PD 2OTUA 2VLRA 1ONQB 1LEGB 1HNFA 4MNGB 1CGSH 4ONGL 5I1EH 1Q0XL 3QH3A 1BD2B 3RAJH 3RWIB 5IM7A 4Z95L 1U8KA 2UUDH 2BHZA 1QBLL 3FZUD 4ZFZB 4AQ1B 1MCNA 2C4XA 1UXSB 3PABA 3GMOB 4RGMC 4Z5RB 2OXHA 1KELH 2IBZY 3KAAA 4J8RB 2WINB 3PHOA 3MLSH 2MWCA 1SEQL 4TSBL 3L95B 2JIXB 3QP3A 4WI2A 4Z18A 4F9LA 1N2RB 4NN6B 3P9WB 4XXCC 3NFPA 4HS3B 2I5YH 4Z7UF 5A3IC 3UTTB 1YYLL 3GIZH 5E99L 4RMUA 3WEXB 5IB3A 3P9LA 1NBZA 3VFUA 3WN5A 1NBYB 1SJEA 1VDGA 3AS1A 4TULH 4Z9KB 3WXVH 2ARJB 5HGDA 5EBMB 3MJ7B 1LVEA 4HWNA 2J5LB 3ZE0F 2VISA 2DLHA 5FO9A 2GTWB 1EPFA 3GJFB 5C0AD 2UV3A 3PNWA 2QSVA 2YPKB 5J0BA 4WO4D 4MD0B 3S3SA 3AGVA 4Y4FA 5KSAB 1N5AA 5DJAA 4PJGE 1RK0B 1T0NA 4Z7NE 4IOIA 1QSFD 2NXYD 12E8L 1WSST 4FZ8H 5JXEC 1VGEH 5HPMA 5I1CL 3SY0A 3KJ6H 4UIMA 5E8OB 5AD0A 5HYSG 1GGBL 1EUUA 4KQ3H 4RFOH 5EN2A 1TDQA 5IF0A 4D0CB 5JNYB 1HILA 4G5ZL 3IXAB 4QCIA 3QZWA 3C9NB 4GOSA 3VXSE 3HHRB 2YS4A 1K8DA 2C7UB 3QQ3B 2X70B 1PSKH 2L4OA 3B9EA 3QG6A 4HZLB 2DLTA 4RGMB 2VSDA 4OIAA 3UYRL 3U0TA 3OKLA 4PRHD 4HWBA 3KPMA 3LKOB 5DFTA 4UB0H 4OD3L 3V6FB 1Z9SA 3QIBA 2DJ4A 3ZKND 4KHTL 3UBXA 4MMXC 3BEWB 3W11C 2OL3B 1CE1H 4RMVA 3CH8A 4YHMH 3TVMD 1OTUD 3AMLA 3HFML 3MSPA 1MCBA 4QRPD 1FZMB 4PY7A 1GZQA 2IPUG 5E00B 4EI5A 1YPZE 4PP1D 2DQTL 1FSKC 1S5IL 4PJ8C 4NC2B 1BD2D 5T3ZL 1KF9B 4QHNB 3EYSL 3QDAA 3IFPB 2VXVL 3BWAB 2NZIA 4BKLB 1WZLA 4NFCA 5JQ6H 4X6DF 3DVNB 1IFHL 1MRFL 1KENL 4I0PB 4GW1B 4FZEL 4IOFD 3L3DB 3HUJA 1TTFA 3OXRA 5E03A 1N0XL 5AYUL 3VFWA 3U30C 1HHIB 1PZ5A 2R4RL 1A8JH 2R9HD 4NRZA 4UTAH 3QYCA 1JK8B 1LO4L 3H42L 3FB7A 1Q9KB 1BF2A 1XGRB 4PJ9A 2V5YA 4JFZL 3RKDC 3MJ9L 1GPOH 2AJVL 4OCNC 5B3JF 1ZT1B 4LEXL 2HTLD 4U05A 3D69B 4L4VA 2VLKE 4N0UB 5JXAL 5EPMB 5HTSA 3HE7A 3MXWL 4FXLA 5B8CC 1M7DB 2CLRA 4PGDA 5IBLC 4QHLB 5I0DA 4FXGA 1ZA3B 3DX7A 5KSAD 4XCFL 4A6YA 4D9LL 4FTVB 5BV7C 4HKXA 3SE8H 4UI2A 4K2UL 7FABL 1DLHB 4E41B 3C08L 3IVKA 4U6YA 4W81A 4OCWL 3U4BL 5E2WL 3GSUA 2HT2C 3P4OA 3DPBA 3QB7C 4LVEA 5IGXH 5KVGH 4NQCA 1FSKB 2ZJSL 4DWHA 2P42B 4PJ8B 4K7PX 4OZFB 1KCRH 3BGFB 1JGEA 1NL0H 4MXWL 4GMSH 1F5WA 4WI4A 4IRSA 4F33B 1T7WA 2J12B 1E6OL 4XAWL 2EDBA 3C8KA 3V8OA 3EO9H 3VCLA 4XVSH 4MS8C 5D7JA 4Y2DB 4EIZC 1N6QL 4ZODA 1C8PA 1JYVA 1B0GB 3SKMA 3FTGA 4HUNB 1RURL 2YN5A 5A3ID 1ZOXA 3C2SA 2CUHA 3K1DA 4I3SH 1XH3B 2PYEB 5KAQG 3ULVL 1KLFA 1X5LA 1PQZA 3S35L 1T04B 3E6FA 4P4RB 4I48B 2AERT 3WSQL 5C7XH 5C0CB 2DKMA 4PRDA 2R0WL 4PV8A 4W70A 1G6RL 1KB5H 1H3PL 4U0QB 2LU4A 1T03L 3MLXH 5DEGB 4P5MA 4KQ4H 3PG2A 4MNQA 5J1SC 1HHJA 3RWGB 2P5WA 3VA6A 5I0ZA 5B8CB 3WFDH 1DBJL 2HVJB 2W9LA 3EJZC 4FXKA 3LKNA 2CPCA 3MRMA 4YNYB 5KW9H 1TVBB 1XF1A 3C60A 4M6AA 1W0VA 5D1XA 4MQXC 4IRZL 4NC1E 3U82B 2R0KL 4NT6A 1M05B 5JXED 1UCBL 5JW5B 4PV9A 1NAMB 3LD8C 1CLOH 5EC2B 4PGBB 3L3IB 2VERN 3IT8D 4FFZH 4QOKB 1JYWA 5F7UA 3WNLA 4TVPH 3NACL 3RX7A 3SKUD 4HKBB 2ZUVA 1CL7H 3CAFA 3MRQA 5EBWB 5DJYA 5KVDH 4F7PA 1DQDH 3LN5A 4LRIA 1QSEB 4KKBC 1D6VH 2BOCB 1PKOA 1CGWA 5I73B 5KN5A 4NM8H 1RK1B 1WZ1H 3GSXB 5D1QA 5JHDE 4NPYB 2XRAL 3BW9B 2I5YL 5LQBH 2XN9E 3RWCA 2X4PA 1ZXQA 3FFDB 4LRNH 4QXTB 1MLBA 1IAIM 2ZG1A 3W11D 5IT2H 4TULL 3NFNA 1FZKA 1JP5A 4FTVD 1IEAB 4LBEA 3SQOL 4PUBL 4E41D 1OLZA 1M7XA 3S36L 4NP4H 3G5VA 5GGVL 5FYJH 3CXHK 4H26B 1RJZA 4DZBA 5F7MC 3EO1B 5E1AA 3NIGE 4PJ8D 4L3EA 2CLZA 4XVTL 5DFVC 2N7BA 1SJXA 2Z93B 2Y06L 1S7TA 3SDXF 4P57B 3H9ZA 1WTGT 4EDXA 4Y5XC 1UWEL 3CFDB 3W81A 3PQYE 3R06A 1HCFX 4XP6H 4GSDL 4JFDA 4Q97A 5GGSA 3GK8L 4X80L 4X6FB 4LPTA 2DI8A 1IM3A 3LD8B 3HI5H 4OZIA 2NYYC 3VE0B 5SWSA 1AY1H 1JHTB 3GMPB 4HXBH 2PYED 1OAUL 2K7QA 4CDGC 3RKDD 4TVPE 3FFCA 4HUUB 3V52L 2IFGA 4LLAA 5C0CD 2VXQL 5CZKA 4LCIL 4LSVL 1X5JA 4JFXB 2R1WA 1MHCA 1ZT7A 1A4JA 2A1WH 1SEBA 4XNQB 1X4ZA 4PRBA 4OCRL 3VGHA 3LZFL 4JO3L 3QPQC 3SDCA 3BPOB 4CVWA 5IBLD 1P6AB 1DBBL 1A1OB 5E9DB 4X0KA 1IBGL 1XGQB 1JV5A 3U7AA 5EZOL 1S7VB 4M1DH 4Y4KA 3QI9C 3PIQB 1AO7E 3IF1A 5ITFB 43CAA 3BPNB 2VABA 2HT2D 3AS0A 5GJTH 1HEZB 5FYJE 3BUYA 5JA9A 4QOKD 1NUFA 2VAAB 1IGMH 2VL5A 3L9RA 1AXIB 4LARH 2F58H 2FATH 4G8FB 3ZDXF 5DJ6B 5D7KE 8FABA 4JJ5B 5HJ3B 4AENA 1WICA 4U6HB 3WD5H 3GNML 4MYWB 2KDGA 3MLUH 2E7BA 1MFAH 5D2LE 1QSED 2GUOB 4Y5XB 4F7EB 1IKNC 1JFQL 3OR7A 4MWFB 2VDQH 3ARUA 5CJOL 5DVMA 2ZUQC 2V9RA 3SGKC 2HJFA 4QNPF 2YRPA 4MS8D 3CDGB 4G8GA 4LSTH 4LSPL 1MFDL 1KJ2L 2R0ZH 5ERWB 4PJIA 3DUUA 4PJ7A 4LOUC 4PRIB 1GPOL 1KLGA 1NFIA 4Q9RH 4N8VG 4POYA 3ARBC 3GMLA 2RHEA 5DZNA 3UYOD 3VFMB 1CD1A 1CICA 3ZT6A 3O4LD 4UBDC 1I9JL 1QLFB 1X7QA 4ZFOA 5JLZB 3UCRA 3ZL4L 1PEWA 1PG7H 2XWTA 5DJ0B 1EMTH 2UY6A 4J3UA 4KV5E 3SE8L 1BEYH 3EJZD 3RNKA 3CSYA 3CXDH 4G6JL 3U0PA 2AEPL 4APQB 1HXYA 1D5MA 4MQXD 4AG4L 4NUGL 4MJ4A 4JY5H 1I1YB 1CXLA 4GG8B 3MFFB 5I16A 1HHGA 2QQNH 3UC0H 4F7CA 5DR5H 3QI9B 1R3JB 1QP1A 4OF5A 3CVHH 5L7XL 4K9EL 3D1MC 1DQLH 3BRDA 2P5EB 3S35X 2R23B 5CWSA 3MZTA 4GMSL 1RUKL 1YEEH 2UWEB 4NKIL 4MX7A 4AEHH 3KWWA 2CMRH 4GW5B 5T5NG 1T7YA 2Z35A 4KKBD 1NC2A 2VKWA 3VWJA 3BSZL 4WTZA 3IKCB 4JGMA 4NIKB 4HDIB 5EU4A 1MWAB 2ZUQB 5CLWA 2X1QA 4JQXA 2FR4A 1BQLL 4OLZL 1BREA 3ARSA 3MREA 4I3SL 3IAPA 1DBKH 5EUOE 4X7TA 5D5MF 5E9DD 5I2IA 3IETB 3F8UB 2YD8A 1T21A 1KB5L 2EC9U 2ENSA 2ADJB 2CGRH 2DQCL 4HUWB 2JJVA 4N1EA 2DYPB 3D85D 5HYJD 4HUMB 1ZLSL 1J0ZA 1N8ZB 2NTFA 1Z2KA 4S1QH 4XNUL 2OYPA 4WU7B 1ULVA 1YEDA 1JWSB 3RWHB 3RZCA 1DEDA 5DFVD 4ZFGL 1AR2A 4L5FL 1IC5H 2PETA 2X5PA 3SDDA 4HK3J 5F7KC 1FG2A 2C3WA 4IMKC 5DJZA 3OKDA 4PJCB 3D3VA 5DUML 3VRJA 5F9AC 2BNQE 4LDLB 2HJKB 5KANG 3T3PF 3CFJB 3BYTA 4RFNC 1RZJL 2GSGA 4YDJB 1F4XL 2NYYD 1CL7L 4R7NB 5JIHA 4PJEE 4XCNB 4Q6YA 3SGDI 3HZVB 1DQDL 1CFBA 2CKBL 5E94B 4YZFF 4PJGA 4UIKL 2J8OA 5DS8B 1KXVC 3RI5F 2Q8BH 4Y89A 2J8UE 5FOBB 2DMKA 2J6EH 1CT8B 5LQBL 4NN5B 4S11A 2MQ3A 1MFEL 4IBLT 1XAUA 3SE3C 4LRNL 3NIDF 1T1XA 5DMYA 5DSCB 2H1PH 5IVXF 1BLNA 3P0YH 3QPQD 3WNOA 4PJFE 3TPUB 1J8HE 1VFBA 2A77L 1NGQL 4JFOB 3DBXA 4YGAB 2E8ZA 4NP4L 3W39A 4LCYB 4OFYD 3VXSA 1AJ7H 4RAVA 4HS6B 4N9GB 5T3XE 3QI9D 3RWJB 5LGHL 2Y36L 4PG2C 2C1PA 4MA8H 1T1YB 4MA7L 1XFPA 4ZUUB 1KIQA 1R0AH 3V0VA 4L9LA 2OP4H 3RU8H 5IR1A 2XI9A 2CIIA 2AXFB 4FFVC 3WIHL 1V7NH 5KVEL 2VXSH 43C9B 1ZK9A 2X09A 3UP1A 1OM3L 1A1MA 1VSCA 4KRMB 5ITBL 4MVBC 7CGTA 1XGTA 2EIZB 3VDBA 4Z7OF 1FP5A 2JB5H 2BJMH 2JCCB 1QPXA 5LAXA 5DK2B 4BZ1H 3NFSH 1YPZA 4OGAC 3T0DA 1U91A 2FEEI 1AC6A 1NDGA 2ARJQ 4LPCA 1R5IA 4ONFH 5EOCJ 4RFNB 4ZO6A 1SVZA 1K4DB 5ISZB 3O4OC 3FN0L 4LOUD 5CD3A 3V6ZB 1U95B 4IMLB 1YNLH 3OJ2C 4G80A 3DROA 3ARBD 4HGWA 1R24A 2VQ1A 3IJHB 3QXUA 2A1WL 4J23A 2H26B 1WCBB 2DYPD 5T1MA 1UM4H 3L3HA 2OLDA 4UBDD 2DM2A 1SYVB 1WVZA 3GSVA 4N8PA 3HZKB 1LP9F 5LCVL 4ELKA 4XP5H 1TCRB 1OPGL 3BIKA 1QSVA 2BNRE 2BY2A 3ARGA 2F54E 1EAPB 4JZNB 5BJTB 3O3EA 3H0TA 3MOBH 4OBRA 3P9MA 5ICXB 5GJTL 5ANMB 4C83A 1OQOA 5FK9B 2IQAA 2JTDA 4K3HA 5D2NE 2VLKA 3X3FH 1AD0A 4LPYA 2NW2A 4M1GL 5JOPD 1FO0H 3QHFL 1MHPH 1BBJA 5CAYB 1T6VN 3QUYA 5HDQH 5KG9A 2YD5A 2CK2A 2MQCA 3FRUB 3MOQA 1SMAA 5E2VH 3WD5L 1MRCH 4YHOH 4N90E 1KCUH 3T08A 5GSVB 1F02I 3O0RL 3PWPD 3QFDA 2V9QA 4X9IA 3I3EA 3CFEA 1D9KB 1QKZH 1I1AC 3RA7L 3VXQB 3S5LA 3UJJH 3WS6C 4Y4FC 3O3AA 5FXCH 3AAZA 3HI1B 2P7TB 3H3PH 5DTFA 1ZT4A 4AIZB 4WJ5B 1BF8A 5DJXB 3SKNA 2AABL 2NY5C 4QRQA 2K7PA 3EUUA 2OTUB 1XCTA 4XMLL 2VLRB 1J1OH 3O4OB 5F7WC 1A7QH 4Z0BL 5JR1H 3QH3B 4HEME 4O5LH 2DM4A 3Q1SL 5IM7B 1U8KB 5MP6H 3DXAE 3QXVA 3S34L 3PABB 1EMTL 3LV3A 4L8BA 4P59L 4H1LH 4KTYA 4OCLC 3PHOB 1ZLVH 3I6GA 5IBUB 3STZA 4XH2B 4ODSL 1NCBH 1XGYH 4HIJA 4JY5L 3QIBC 3P4MA 1YNKL 3PGFH 1PYWB 3GJFK 3NFPB 3UC0L 5IBTH 4WV1C 3ZKSD 3WHE1 5A2JH 1JI2A 1D5IH 5BW7A 2EEDA 5IB3B 3WFEL 3F12A 2DQFA 3EYVA 4TUJA 4Y2OA 3VFUB 3MLWL 3CX5K 2EDXA 1H3WM 3C8HA 1SJEB 4FQJL 3SQBA 5DDHA 4HWEH 1HXMB 1K6QH 4GRWF 2WWMC 2FH8A 1YEEL 4LPWA 3F58H 2PO6C 2VRAA 3OBAA 5GRXG 4R8WL 5HVHC 5DD0L 4BFBD 2VISB 3HA0A 1RFDH 5FO9B 3PNWB 2GJZA 1FNHA 2UVFA 4KI5F 3QUZA 4M93C 3S4SG 3MLVH 3V5HA 5M7QA 3V7AE 5TDPB 4JRYE 4JDVB 2KBGA 2JJSA 5GISH 2AXHA 4Y4FB 4HW6A 1N5AB 5DJAB 1N7ML 4PGCA 2X4UA 3NTCH 4IOIB 4D3CH 4UOJA 3KYKH 4UAOB 5HPMB 32C2B 1HH6B 3SY0B 4Y7MA 2YZ1A 4UIMB 5AD0B 2Y1VA 5HI3C 4WDIA 4E9LA 4V1DA 2YXMA 4R3SA 5KS9B 4FFYH 2DQDL 5EN2B 4ODVL 5IF0B 2NXZC 4N8CH 4QCIB 3VRLF 5JHDA 2ICEB 5HVFB 4YDKL 5C0IA 3T2PA 1MFBH 1QNZL 2R2BB 4XTRC 1V7MH 3HZMA 1F58L 2BSRA 4Y16A 3OKLB 4Y88A 4FFVD 1U36A 4NKQB 5IROA 4JDTL 3REVB 1JUFB 3QIBB 3OG4B 4CKVX 4MVBD 3BGMA 2CO6B 2YBRA 3KJ4C 1DVFD 1JPSH 3FHQA 4P5TA 2AEQH 4W6XB 4KKAC 1A6UL 2BVQA 4OGAD 1VFMA 1CF8H 3JTSB 5HGGS 1T83A 3LEVL 4EI5B 3U83A 4Q0XH 1UWXK 3NCFB 2ZCKH 1HH9A 5IHZA 1U8HB 3U0WH 3BKML 3PQYA 1FFPB 1EV2E 1QRND 2W9EH 2Z91B 1I8KB 1MNUH 2BDNH 5C2BL 1K4CB 1RULH 1ZGLM 4W4OA 2CDGA 2YA0A 5CGTA 1XF3A 4RGNC 4LLQA 3RL1A 3FT2A 4TVSa 3HUJB 3B6SA 4CNIA 3V4VL 1UB5A 4G6MH 3KG5A 2FECI 1KJVA 3OXRB 5EZJA 5KSVB 1YEFH 3OAZK 1RI8A 1ZS8A 1TETH 3EGSB 2Q3AA 4FNLL 4XCYA 3VFWB 4ETYA 4DKEH 1EEZB 1PZ5B 3E3QC 4NRZB 1KYOK 3AFLA 1NMBL 1EK3A 3I9GL 3LMJH 1DQQB 2NXZB 2DL9A 5E2TL 4NZUL 3DX9A 1GGCL 5GGTA 5J56B 1AP2B 1M6OA 5KAQF 4OIBA 5E7FA 3Q6GH 2BSED 2CK0H 3MRNA 2R4SH 4KWUA 1VENA 1AD9A 3HE7B 2NY0B 4V2BA 2CLRB 5C0BE 4P49A 1I1AD 2NY4C 4FXGB 4Y4FD 1FL3A 3C60C 1AO7A 4A6YB 1ZGLA 3KJ4B 4JKPH 2VE6A 4HKXB 1NC4A 5D93B 3QEGL 3IVKB 4Y1AB 2ZCLL 5GGQL 1CGYA 3K8MA 1D5BA 5IW1A 4R4FH 2HMIC 2F5AH 1PGRB 3T3MF 5JO5B 3V2AR 3P4OB 2AJYH 2IAND 4HK0B 4NKMA 1OB1A 4N0YH 2D31A 4NJ9L 4XPGH 3R8QA 4ZUTA 5D2LA 1LEKA 1DR9A 1EGJA 3UPRA 4I2XE 1VFUA 2OQJB 4U1NA 1P7KA 1G7IA 3LIZH 1KN2H 3T4AA 1KFAL 4TSAH 2Z92A 1YJDC 4LRIC 1XT5A 2VUYA 4IRSB 5F97E 1F90L 4RGNB 4YHYC 5IESL 5I1KH 5DLMH 1E4WH 4BQ9A 3VCLB 1CZ8L 1OAQH 5D7JB 1RUML 4EQ2A 2VB5A 3VGAC 1GXEA 2KKQA 2A73A 2J4WH 3QUMH 4IIQA 4W68A 5F7HA 3U6RA 3QG7H 3RVXC 3LQMA 3SKMB 3FTGB 3GSWB 5GHWL 5L9DH 2C3HA 4YPJA 4AEIH 4EN3C 3HNTH 1CFQA 2PKDA 2V5RA 3BZEA 1YEGL 4LNRA 1PQZB 4B7LA 2R15A 4J1UB 4Y5YA 3WXWH 4P9HH 4PRDB 4R7DB 2WWMD 1KCUL 3C6SA 1IE5A 3WIFA 2PO6D 3A67L 2RJMA 1AHWA 4MNQB 4HCRH 1BHGA 2QSTA 3HAEB 1HHJB 1PG7X 1GSMA 2FB4H 5I74C 1YMMD 3DOSA 4NO5B 3HPLA 3Q48A 1PZUB 4FXKB 1FVEB 1NANI 3LKNB 3MRMB 2NY4B 2FJFA 2KPNA 4DTGH 1GAFL 3C60B 1W0VB 3QZWG 2XY2A 3E6HA 2AV7B 4NT6B 3OX8A 1WC7A 1KOAA 5I1IH 1A7QL 3MMEA 2UZXB 5H35A 3V0AC 4FP8H 1BM3L 3LPGA 5FHBL 5C09E 1BJMA 5HI3D 3PP3H 4DN3H 4FQ1H 1T2JA 2O5XH 3C5JB 2BVOA 1NH6A 4S1RH 2LTQB 4I4WA 3MV8B 4XNXH 2X1XR 2NXZD 5I1LA 3MRQB 1F3JA 4XX1E 4Q6IA 5GXBB 4F7PB 5IEHB 4JFQA 5K33A 3RIFK 5J57B 3F7QA 1JGDA 4YHYB 4XTRD 1J1XL 3J8F7 2KL6A 4M7KH 2H8PB 5D1QB 4KZEH 4HMDA 2HLAA 4LIQL 3SDAC 5DJDB 5F96L 4NWTH 2X4PB 4U1HA 3VDAA 5KSBE 1MLBB 2GW5A 3HTLX 4G7VL 4F57L 1JYXA 1FFNA 3HRZA 3FQUA 3NFNB 1FPTH 4QHMA 4XB7A 5LBSH 1KCVL 2YUZA 3G5YB 4LBEB 3SBWA 1F3DH 4EN3B 3K2MC 3F58L 4KKAD 5DMIH 1IC7H 1HINL 4Y1AD 1L9MA 4K3JL 3G5VB 2D7TL 1RJZB 4DZBB 3T0XA 4XMKH 3JWDH 1N26A 1TQBC 3RUGE 1IC4L 4JHZA 3DMMD 5E95B 2ZOKB 4LCWE 1QFWI 4OLUH 5I74B 2P24A 1SBBA 4XNZB 5TH2A 2BNQA 4WRLA 3W82A 1S7TB 1BJ1H 1Q1JH 4RGND 4H8WH 5BS0B 1NFDB 3SJVD 3R06B 3MOAL 3CVHA 2XG4A 3S3JA 1X4XA 2VZVA 4PJXB 1A7PL 4PJEA 2ICCA 5GGSB 4LFHG 1L4IA 3LKPA 3SOBH 1ZVYA 1CDJA 4WNQA 3SCMA 4OZIB 1T20B 4JQIL 4G7YH 3TT1L 2XTLA 5SWSB 3ZLQC 2J8UA 5ESAA 2EDYA 4P3DA 4I3RH 4AEFA 1WZKA 1I1FA 2LU7A 1N59A 3FFCB 4PJBE 4NHUB 2B1HH 1HQRA 2IPKA 1DQMH 4JFEB 2EKJA 4D0DA 1BZQK 1YECL 4JM2C 4LMQE 2DQHL 3BX7C 4OLWL 1FYHB 2FBJL 2R1WB 3IDGB 3QJFA 1W0WA 1UM6H 1YQ2A 1MHCB 1UQSA 1ZT7B 4J2XA 1J8HA 4P9MH 5C70A 3PDGA 4MNQD 4L8SA 3VFRB 4HH9A 3SDAB 4IJ3C 3SDCB 1JGUH 4PR5A 3QCVL 5F6IC 2NY4D 1YUHA 5I8CA 3C60D 4X0KB 5T5FL 1CR9L 1JV5B 2G60H 3RWFA 2H32H 4ZFOL 3M1BB 5FHAL 4Y4KB 3UDWA 3JUZA 1U58A 5FKPA 1H15A 3G6DH 4ZTPH 43CAB 4NJAH 2HMID 2BK8A 5K9QI 3BUYB 5FYJU 2BDNL 3ULVF 3L9RB 3MV8D 1IEBB 8FABB 2FX9H 3QWQB 4OLVL 4AENB 2DDQL 1GOGA 2VJXA 4GBXA 1QRKA 4X9GA 4JO4H 3VWJC 1GGIH 3QXAB 3OR7B 2GYSA 1R3IL 4R96A 5T5NF 2HJFB 1ACZA 1WGOA 4G6AC 4G8EA 2FYYB 4G8GB 1IGIL 4XNYH 3ECBA 3MRCA 4PJIB 3RVXD 3DUUB 1KXQE 1KLGB 4HPYL 3VGDA 3MNZB 4XT1C 1NJ9B 5EU7C 2HFGH 4EN3D 3GMLB 2R29H 2J6EA 3LHPH 4M6OL 4P4KC 4ELMF 2PTUA 1KPUA 4UV7H 2QHRH 1CD1B 1CICB 4JM2B 2O5YL 1W8NA 2Y23A 5C0AE 5MERB 1X7QB 2AK1H 1AIFB 2BNRA 4NZJA 3IFLH 2DD8H 5H94A 4F8QA 4OF7A 2XWTB 2YC1B 3K46A 4IJ3B 5INCB 3CSYB 1UG9A 1FH5H 3REWA 5D2NA 5BS0D 1D5MB 1REIA 1YYMH 3TLRA 1JTTA 1JGVH 4LU5H 1HHGB 3IYLW 1CXIA 4F7CB 4F58H 1CGVA 3PV7A 2ZUTA 3TC9A 3F5WB 3OQ3B 1P5UA 5AEAA 2NNAA 5DRNB 4ZSOE 5JW4Q 1QEWA 5CWSB 1UEYA 3P30L 2CRZA 3NN8A 4ORGA 1RQ5A 3ZDYE 2AKRA 3FFCD 4MX7B 2WUCL 2NY2B 3KWWB 3E2HC 4JFED 5I8EA 1FZOA 5DD6A 1E4WL 3TJEL 4AEEA 2I9LA 2A0LC 1N4XH 2EECA 4YHKL 4YFLF 1NC2B 1RJCA 3VWJB 2W07A 3EYUH 1QO3A 5EU4B 1A3LH 1XR9B 1E4JA 1S7WA 3LPFA 4JHAH 4PRHE 2HLFC 4UILH 3SDAD 2GKIA 4QRRE 2E7LA 2HN7B 2X4SA 4GJTB 4X7TB 1ITCA 3DXAA 1RUAL 3WXWL 4R4BA 2VDNL 2ARWA 3X17A 4TOYH 1XGPA 1ADQL 1CQYA 1T21B 2R2EB 4ZO8A 2FEEL 2YMXH 5IKCA 1OTSC 3TWCL 1W72L 3K4ZA 2FEDC 1RMFL 4LDEB 5EH1A 2FB4L 4WY7L 2GT9B 3C09C 3CFCL 4L9LC 4JAMB 2DQJL 1X6LA 1YEDB 5IQ9B 4LHUA 4PYGA 4XCCH 3MJ6A 2ITCA 5DFWH 2ESVD 2RFXA 3MLZH 1FG2B 3VXMA 5I1IL 5DJZB 3OKDB 4OZGF 3VRJB 4BSWB 3O9WC 1G0XA 3L5XL 1FO0A 4FQ1L 2F19L 2RGSA 4YXHL 2O93L 2PXYA 3OKEA 4S1RL 4XAKD 4U1MB 5IMLB 2DWDA 4C56D 4XNXL 5CGMA 2GSGB 4I13B 1UZ6F 3SN6N 3FB6A 1JZ2A 1Z3GL 4JRYA 2XWJB 5DC0A 2QR0A 4HG4J 1N5YH 4OI9A 2L0DA 1LO5A 4ZDHB 2W9DH 1P4BL 2ATPA 4JM2D 2PF6A 4FFWC 4PRAB 1LK2B 5ILTH 3WHE0 1BZ9A 4MD4B 3INUL 2R69H 3X3GH 2K9UA 3IU3A 1U3JA 1BLNB 3D2UA 1OARH 1S9KC 1QFOA 4L1DA 4MJ5A 1VFBB 1PX4A 2HFTA 3DBXB 3WLBA 3W39B 4F15B 1OP5K 3VXSB 2BP3A 1FFOA 4RAVB 3ARYA 3KXFD 4X6CE 4IDJH 3TH2T 3LQAH 5E0QA 1BIHA 2C1PB 3PWJB 4CN1A 4H1LA 3QUYC 1KIQB 1JZ7A 3V0VB 3C09B 4L9LB 4POUB 4ZAKA 2YPLD 1TVDA 4BK5A 5IR1B 3P0VL 2CIIB 3H7BA 4TUKL 1N64H 3Q2CA 3K0WA 1I8LC 1A1MB 4R26H 1PVHA 1BQHA 1JIBA 4X4ZA 4BA8A 3VWJD 3BUTA 3LEXA 1I7ZA 4HUKB 5TE4L 1LO3H 5IB5A 3O9WB 4L29B 1YPZB 5EU5A 4G6AD 3E0GA 3X11A 4LSQL 5J6HA 5FYLL 4M43L 1WBZA 5TDOB 5JTWA 1U3YA 1M4KA 4HGWB 4PJHE 3RHWK 4TPRL 1PD6A 3VW3H 4LVHB 4P4KD 3VDCA 1I7TA 1VA9A 2DBLH 5DJ2A 4OCYH 3L3HB 1NAKH 3FOLA 1L7TH 3GSVB 4YHNB 1E4KC 3CFIC 3V7MA 4ELKB 3KS0H 5EZLA 3KPPB 4MB5A 2EIEA 5FV1L 3BIKB 4I3GA 5EU6D 1S9WA 3SGJA 4JZJC 3ULUL 2VITA 3HKFA 1QFWH 3BOVA 2RCSL 1UWGL 1CFSB 3D39A 3H0TB 3DVGA 4X7DC 5A2FA 1V3LA 3VRIA 4I0CC 4U33A 5C07E 2H6PB 4C83B 4PREA 4ACPA 2IG2L 2XQYK 4RX4A 4Z78B 3NCYP 1AD0B 3V4UL 4JPWH 1BBJB 3QUYB 1H0DA 2X10A 2EYRB 1XF5B 2CQVA 4U6XA 5TQ0L 2H9GB 3VA2C 1GC1L 1UJ3A 4NC1C 4P2RE 3CFEB 4HLZG 2BC4A 3MRKA 1IT9H 5TF1L 3O3AB 3AAZB 5F1SA 5HHVH 4HZAA 1LD9A 5DO2C 5DTFB 1ZT4B 4M7JH 4Z7UE 3O6FA 4XBPA 1RZFH 3CZFA 2Y25A 3SKNB 1HNGA 2HLFD 1EJOL 1T1WB 1DN2A 4QRQB 5SX5K 3JV6A 1E27B 3MODH 5E6IA 4LSDA 4I2XA 2R29L 5BV7H 4BQ8A 3LHPL 3EAKA 1TENA 4YE4H 3ZE0E 3VXSD 5GGUB 5HHOE 2ZSVB 5DWUL 3IDNA 3WIIL 3VD4A 1CBVH 2EH8H 1Z9OA 2EYTB 3TT3H 3OAYH 2AK1L 2ED8A 1RUQH 4I77H 1XCQA 4AZ8A 5DMJB 1OTSD 5GIRA 4MA3A 2FEDD 5FOJA 5MENB 3VD3A 2A83A 2FWOA 4HMEA 3LV3B 2V7NA 4L8BB 3HE6C 1S7XA 2ZKHL 5C86A 4K23L 3I6GB 4K3EL 3STZB 2D0FA 5AAWA 5IROC 5ID0A 3NCCB 4O02H 5HGHB 4HIJB 4H88L 3P4MB 1U42A 4PS4L 3P11L 4PPTA 5I1GL 5CMAA 1O7VA 4P5TC 3F12B 2DQFB 3EYVB 4XC1H 2FECL 3O9WD 1WQVT 1MCOH 2IJ0C 5DT1H 5FKAA 3QCUL 1D5ZB 5DDHB 1F11A 1JPTH 1C7TA 4OCMC 1U6AH 1U8PA 3KYMA 1I3RB 1QLRA 1FZJA 3CLFL 4H20H 2LU3A 1N4XL 1PDKA 3STLA 2GJZB 2EIBA 3BEVA 5DRWB 5FCUH 3VXUD 5BO1L 2M26A 1NBQA 1HYSD 3V5HB 4M4RA 5FUZL 5TQ2H 3Q6FA 1MJ7H 3GI9H 3SO3C 1ZAGA 4FFWD