3WS3B

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 16
structure length 100
sequence length 100
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3B00
5I9QB 1KG0B 4YE4H 4LFHD 3ETBF 3MJ8A 4HJ0C 3MXVL 3DRTB 5IVOA 2WUBL 5BMFL 4YK4C 3C5SA 1YNKL 1ZGLP 2X4SA 4O58H 2AS5M 4MNHB 3K7UA 1C7TA 3TA3A 4G9FD 1A1OB 3KYKH 2VLJD 5JIPA 2NY1C 5IOPA 4GW5B 4MJIE 3P77A 2B1HH 4OIIL 2VABA 4R0LB 3MODL 2DQJL 4S1RL 3EOAB 4QT5A 4JHAH 4FTVD 1FFOB 2G2RB 1MHEB 4N5UA 5GS3A 4OM0L 1SMOA 3GB7A 2I27N 4XC3L 1ZS8A 3MQIA 4Z7WA 2DM7A 3DTXB 3BKJL 4NRYB 3FQNA 3GIVB 3QCVH 2DBLL 1AXSA 4B41A 5L8KB 1BIIA 3PDOB 5JPNA 1VACA 3CX5J 5BO1L 1RZGA 2Y5TB 3JUZA 5FO9A 3V6OA 3MRNA 4NUGL 5D5ME 4LSDA 4I0PB 3RX8A 3MV7A 4EUPH 3HFML 2AAVA 4MB5A 1MRCH 2X7LA 3WJJA 2Z31B 4MSWA 1CGUA 1IAKB 1S3KH 3O11B 4PJFF 2X4NA 1CDUA 3KYOB 1DSFL 1NCAL 4L8SC 3WFEL 2VL4A 2FGZA 1OTTD 3VXMA 5J9PB 4E0RA 4TOYH 4OKVA 2C4FU 1MFNA 5MP6H 4WUKH 3KDMB 2YSSA 4JCMA 1MHCB 3RY6C 1F97A 3SY0A 5DJXB 1TVBA 2F9BT 4PJ7B 3MBXL 1U8JA 4MNQA 4WI4A 3G6JB 1OTTC 4L4JA 1A7OL 5GIRA 1L6XA 1RMFL 1MRDH 2ZSVA 2FJGB 5LAXA 3TBVA 3GMMB 1NLBL 4JZOA 4NNXB 4XCCH 1ND0A 5EZLB 1OAQL 4LPTA 4IDJH 2DMCA 1AE6H 2X4RA 3MJ8B 1MUJA 2A73A 3WFDL 4LP5A 4XT1C 1S8DA 3C5SB 1KCUL 2W65B 3G6DL 1I3GL 1MJUL 5E70A 2ZG2A 3TN0D 4MQTB 1FQ9C 1Z5LB 3S36X 3TA3B 2X1QA 4OCSL 1ZVYA 4M93B 4PJXF 5IOPB 3MUY1 5TFSL 2NY7H 3P77B 5DUMH 4XBGA 2CDEA 3BKCL 3KR3L 3IVKA 2GAZB 4BA8A 1DANT 3N1QC 2VABB 3IDNA 2X5PA 3T0XA 1IAII 5EC2A 1MCPL 3HRZA 3RI5K 4QT5B 5C2BH 5CBEB 4HF5H 1K6QH 3BZFA 5AEAA 5D5MA 3G08A 3TN0C 3GBNL 1KYOJ 3GB7B 3AXLA 2Q8BH 5JXEA 4Z7WB 4C58B 3K80A 3RWGA 4HPYL 1VB9A 1BIIB 1LO4H 5I8EB 5JPNB 3PHSA 5ALCL 1RZGB 4XXDA 5EA0H 5FO9B 3SDYH 4KVCL 3MRNB 4GW4A 1NGXB 1VESA 2WUCH 4OZ4A 4YBLC 2X7LB 2R0ZH 1A6PA 1OW0A 2X4NB 5H37H 3T65A 3CU1A 1EVUA 3RZWA 1SJVA 4YHML 1OLLA 3AY4A 4O5LH 1T1YA 4Z7NE 4E0RB 2X09A 1G9EA 4OKVB 4XAWL 1JGDA 3OJVC 4CADB 5FGCE 4PJCF 2YSSB 4YIQA 3WFCH 1FG2A 4ZD3H 3HN3A 3O4LD 3TLRA 3I6KB 4H8WC 3SY0B 2VDPH 2APWA 1ZWIA 4JFDD 1TVBB 1XT5A 1U8JB 3DYPA 1V7ML 4I0KA 4MNQB 3DO3A 4RA0C 3H3BC 3TEUA 5IIEA 4KRPD 1YEKL 3BPLB 4JLRA 1FDLH 2RHEA 3C6LD 3NZHL 4RNRA 5CEZD 2DRUA 3QO1B 2IFFL 3TCLA 4MCYA 1F58H 5LAXB 3TBVB 4JZOB 1T89A 4JFQA 1CDIA 5I1AA 3PL6D 3IB4A 4PV9A 2A73B 2PTVA 1S8DB 1T3FA 4KRPC 3C6LC 1DJSA 4OGXL 5EUOE 4D0CA 4KUZL 4OUOA 4TPRH 1L7TH 2IBZX 1FE8L 3MOQA 3U4BL 4HD9A 4XBGB 4WFFD 2CDEB 1OL0A 1NKRA 3IVKB 1ZVSA 3IDNB 3PL6C 2FH8A 4OV6F 5EC2B 5F44A 3HRZB 3HC4H 5M94B 4N1CA 5F6HI 1W0VA 2XKNA 4CU7A 3BZFB 5D5MB 5J6GB 4PLJD 5FAAA 1EUTA 1VFAB 2HT4D 5F7LB 3AXLB 4GXVH 3RWGB 5HYEA 3ZL4L 4XXDB 5E8EA 3NACL 2XTJD 3ULVD 4L5FH 4OZ4B 2DQUH 4U1HA 4A6YA 2CMRH 4PIRF 1HXMA 1MI5D 2F5BL 1LEIA 4PLJC 1ITCA 4OZIE 1E4WH 5DR5L 1NCCL 2DF3A 3D2UB 2W60A 5JOFA 3T65B 1WGOA 2L0DA 1UWEL 1DBMH 1MHPH 4U1NA 1G7JA 2EEBA 2XTJC 3SDDA 1TJIH 4EZMA 4HZAA 3ULVC 4M7ZC 3L1OL 4Y5XC 4ESKA 3HG1E 1ZLUK 1BVZA 3RWCA 3U6RA 3MROA 3CLFH 3WN5C 2EDOA 4YIQB 1FG2B 3V7AE 1CR9H 4Q9QL 4KVNH 1I1FA 2VOTA 2WBJA 1MCJA 3GJEA 1ZWIB 3S34L 4C4KT 3LH2H 1YEGL 4HC1A 1NBYA 4DN4H 3RX7A 4Z9KB 2AK1L 2VDML 1L0QA 4F33A 2XWTA 4XX1G 2EDFA 2PW1A 1J8KA 5IIEB 4LAQH 4N90E 4NKIL 4PJAA 4RWYH 3TCLB 4MCYB 2QHLA 5EUOA 3U1SH 1EHLL 4JFQB 4G7VH 2YK1H 3MYJA 4IJ3C 5I1AB 2D03H 1YUHA 4GRLB 4S2SA 3EYUL 4PV9B 4FZEH 1QYGL 3SDXF 5ILTH 1V05A 3BOVA 3WJLA 4BZ1H 4OFYA 4M5YL 1KTKE 2HWZL 1T3FB 5GRZA 1YPZB 3K74B 5KTEH 4P2YA 5GRVK 4D0CB 4D9RE 1EJOH 5J0BA 5TQ0H 4N8VG 5GS1C 4G8FA 3D1MC 4DVRH 3X11A 1QFUH 2F53E 2L7UA 5DD5H 2FO4A 5FYKU 2BHYA 5IHUL 4X8XA 4NFCA 4MA1C 1W0VB 3U4AA 2XKNB 1F00I 3HNTL 4Z78B 1BBDL 3T0BA 1NGQL 3NA9H 1HHHA 3WV0A 1XAUA 3QUYD 4OZIA 3QUMH 2ATPA 3C5ZA 2VC2L 1MCEA 3V8OA 5FHAH 5E8EB 1UKTA 4YX2H 3ZDZF 2FRGP 1ZE3C 4MHHG 2FX7H 4A6YB 2GK2A 3QHZH 1HXMB 2B2XL 2IANA 4X8JA 1JZ8A 1LEIB 3HG1A 5IM7A 3VGFA 1KB5L 4PJ8A 2FEEI 3JV6A 3QUYC 4JKPH 5JOFB 3JV5A 5FGCB 4AEEA 4DGIL 3WO3B 3GSVA 2R56H 3GUTA 2ATKA 1G7JB 3QPXL 3SDDB 2CRYA 2VWEC 4IHOA 4OM1H 4GAJH 3QEHA 2DDQH 1B4JL 3U6RB 5D1QD 5H35A 3MROB 1UJ3A 15C8H 4KJYA 5SX5K 3C87A 4HSQA 3VGDA 2IAMD 1I1FB 5DA4A 2WBJB 2J7LA 2WM0A 4IIQA 5IBTL 1NBYB 2BC4A 3K81A 3L5HA 4F33B 2XWTB 3R0NA 2PW1B 7FABL 5MI0B 4L4TE 4U7MA 4HX1A 1GGTA 4PJAB 1K3IA 1KFAH 5D1QC 2E6QA 5DVMA 5EUOB 4RFNB 1CFBA 4QF1A 2IAMC 1Z0NA 4GUPA 1YUHB 2C1PA 3V4VL 1A6WL 4S2SB 4WFHE 5CSBA 2OZ4A 4JO3L 1RJLA 1Q1JH 3CFCL 1MQKH 2R2EA 3SE9L 2NXZD 3HNSH 2XT1B 1U58B 3UYRL 2APVA 3GK8L 1G9MH 1G9NC 4X5WA 2F58H 5TE4H 4BJLA 4G8FB 5C1MB 1UB5A 3X11B 3MJ9A 2YOCA 2UYLA 2ICWI 1XCQB 3MV8D 1J8HB 4FQHA 4UOW1 1KT2A 2P42B 3RKPA 2UUDK 3ALPA 3D5OF 3HAEA 5D1XD 2D0FA 3I3EA 2NXZC 4IOIA 1CU4L 5D7IB 3EUUA 1J1XL 1CLOH 3RGVA 5A1AA 1KEGL 4OZIB 4K3JL 3OAYK 1CBVL 5TF1H 2ATPB 3C5ZB 1TJGH 3CSYA 1JYWA 1I3UA 3PWNA 4HS8L 4LVHB 2YXMA 2UVFA 2EDLA 5IMOA 5D1XC 1HHJB 4IOSD 1OGAB 2IANB 3O2VH 2ITDA 4G6AD 4Q6YA 3BEWB 3I9GL 5IM7B 1MAJA 1DTUA 2B5IB 3CMOH 3FCTA 3JV6B 2BNQD 3GSVB 2J4WH 4MB4A 3K1KC 4WI6A 3GUTB 1CTOA 5C0DA 2VLJA 2ATKB 4DKFL 4D9LL 5C92A 3QEHB 3B2UD 4X5XB 3MLTA 5HGAA 3N1MC 1KLUA 1TNNA 1RURH 4Z0BH 4G6AC 4L4TA 3PIQA 1P4LB 3VWJD 2H45A 4KJYB 4ZFGH 3WDJA 4N9OB 5INDA 1HEZA 3HUJE 4TSCL 4IIQB 3U9UB 2BC4B 1NBVH 3PWUA 3MUZ1 3WNOA 1B4RA 3A6OA 1EEYA 1KTRL 3B2UC 4LU5L 1HILA 4KY1L 4YGAB 2OR7A 4ISVA 4HX1B 4K23H 4FFYL 3IAQA 5J06A 3G5YA 3T0ED 3VWJC 1B0WA 2ZUQB 4QF1B 3SHSA 3CLEH 4GUPB 4K9EC 2BFVL 4GAGL 1KJ3L 3R06A 2C1PB 4YHOH 3MXWL 4AEIL 5FEBA 4GXUN 5E8NA 2R4RH 3BW9B 3RY6A 3HI5L 4NFBA 1F2QA 5I1KH 3EOTH 2VN4A 3EIFA 2R2EB 1MWAL 1MCRA 1GZPA 2DI7A 2FIKA 4U05A 5TE6L 3T0EC 1A6VH 2H2PD 4PJBE 1JTPA 4XPGL 4OGAD 1KJ2H 1U8LA 1UB5B 4OZHB 3J8F7 2UYLB 1KELH 2IQAA 5D2NC 4FQHB 1KT2B 5GZND 1TJHH 3FQWA 4YHYB 2CR6A 3O6FD 4LPWA 1F13A 3HAEB 5IEKA 2BJMH 1FORH 5C0AD 3PWPE 4IOIB 3IDYC 4Y4KD 2BK8A 5F7MC 2H2PC 4YK4B 5E4EB 1MCWW 4UINL 2DQEH 4HH9A 4OGAC 2MQCA 2MCPH 4D94A 1KF9B 3PWNB 4WFGE 5JORA 3VXOA 5GZNC 5IHLB 3GSOB 3M8OH 1I9JL 2VXTH 1FN4A 5C86A 5IMOB 3O6FC 4FABH 1DANU 2E9WA 4U31A 2ZUXA 2ITDB 5KS9A 4Y4KC 1TZGH 3UAJD 4JVWA 3H7LA 1A3RH 3FCTB 1QO3A 2VO5A 2ICCA 5DRWB 2ZCKH 2VN7A 1NAMB 4Y1AE 1MCKA 2JF1A 1J5OH 1P2CA 5CZXD 5C0DB 3FRPA 3CH1A 2VLJB 3HUJA 12E8L 3LKRA 4Q9RL 1UJTA 2X10A 5CZVH 1MFDH 4IRSD 3MLTB 5HGAB 1KLUB 1WIPA 5C0JA 5C70A 3PIQB 4FQ2L 3UAJC 2F74B 2R2BA 4FTVB 5INDB 3QDGE 3RRQA 5J11C 4JO4L 2VRAA 2FZ3B 3BP7A 3QHTC 1HEZB 3UTZA 3O3UN 4MA8L 3CDGB 5CZXC 1YEDA 2R4SL 2BVPB 4I18C 1YJDL 3EYSL 3PWUB 4XNYH 1HZHH 3SOBH 1EEYB 4IRSC 3AB0B 1HILB 4ISVB 4XP5H 4I9WD 4NDMA 4UT9H 3G5YB 2OR9L 4QNPE 1RU9L 4YO0A 1L9MA 5T33H 1U6AH 1UXWB 5DC9B 5C8JB 2DQGL 4GSDL 1KTDB 4PJBA 25C8H 3R06B 1GPOH 3LEVL 3OPZL 1WSST 5HGGS 1DQLL 5F6IC 1BX2A 4M5ZL 2AEQH 3WBDA 2FIKB 1GZPB 3ZTJG 3IJHB 3PF2A 1T66D 5HHXH 3VXRE 3KXFD 2J5LC 3WMSA 3C8HA 2QKIA 1U8LB 4MJID 1ZTXL 3FB7A 4HBQA 2IQAB 3QISA 3VXUD 1KN2L 1UEMA 1G6RH 3FQWB 4OLXL 4WTZG 3MYZA 1AR2A 3KG5A 3QDJE 5EZJA 3THMH 3SKJL 3SO3B 2RJMA 1X5IA 1W72A 1T66C 1S9VA 3D18A 5FYLD 3EFDL 4OF7A 4CAGA 4HH9B 3D39D 3LQAL 3C6SA 5FGBA 3OKMA 5GRXG 5JORB 4YHZL 3VXOB 1HQ4A 4Y1AA 3QZWA 4K71C 4UV4H 1FN4B 2VUOA 5SX4H 4E5XA 2JELH 1GC1L 2YRPA 4Z7UF 2A6DA 1LO5A 3T2PA 1IFHL 5KS9B 4JN2A 5C0FB 1S7UA 1QO3B 2Z4QA 1I3VA 5D7LD 2GJZA 2PETA 5DVNA 5F9WC 1EV2E 3TN0B 2DLFL 3QDGA 1P2CB 4QOKE 3CH1B 3ZMRA 3WKNA 3QG6A 3LKRB 5B8CA 4XC1L 3UTQA 3WUWG 4MXWH 4JB9H 3Q5OA 5C0JB 4P3DB 1ADQA 1RUPH 4P9MH 1OTUD 2R2BB 4YBLB 1IC7H 2DQIH 2F54D 3U7YH 4Y4FD 3B5HA 5IVXA 1YEDB 3QXAB 1PSKL 4F8QA 4LSRH 3U36A 4JO2L 3PWJA 3KPLA 4WI2A 3JWOL 4UTBL 1JZ4A 1BVKA 1GJIA 1L4IA 5I19L 3MA7B 3F65A 3QBTB 4YO0B 5ETUA 1OTUC 3TT3L 1U3HA 3DSNA 3OR6A 1J05B 5I8KH 1R0AL 3FHQA 5D96C 3VXRA 3AREA 4JY6A 4PJBB 1JN6A 4RMVA 1T7ZA 2J3SA 2VLKE 1VA9A 4S10A 1Z9MA 3O8XA 1BX2B 1K85A 4OF6A 3ARBD 3OKOA 4WWID 1Z9SA 4ONOA 3QNXA 5T1LD 3B9AA 4NKOA 1ZEAH 2QKIB 1N26A 4EI6A 3AC0A 1PZUB 1PGRB 4G9DA 3FB7B 5GGUA 5I75B 3VI3E 2ADGA 3EW3B 5FV2A 5EZJB 1MY7A 1UADC 1C5BL 4Z6AT 3ARBC 4X6DE 1W72B 3C2AL 3GSNL 4EN3D 5D7SH 1S9VB 4X9GA 5DA0B 2YMXL 1BIHA 4PJ5E 3IAGC 4KXZI 2IC2A 3LKOA 3H8NA 5E94A 5DMIH 1M71A 3C6SB 3S35H 4AG4H 3OKMB 5T1DL 2I9LA 2IH3A 4Y1AB 3QZWB 5HXMA 1JGUH 2EE9A 3KVQA 4NQEE 4QOKA 1O0VA 5DQJA 3SDAA 4E5XB 1R3KA 5GS1A 1M7XA 3MRHA 3QCUH 4D9QE 1LO5B 1EO5A 4EN3C 1RJCA 4JN2B 4X4ME 1S7UB 2Z4QB 2GJZB 1KIQA 4AT6A 5KSBF 35C8H 2VXUL 3QDGB 2VLME 2CRIA 4NO5A 1A0QH 1X44A 5DDHA 3QG6B 2AABL 4D3CL 4LGRB 1YNTA 4JFFD 1NCNA 3IGAB 5I30L 3T04D 3KPRE 5IVXB 3I3BA 4FQ1L 5HJ3A 4KZDL 3U36B 2IH1A 1JL8A 4K55A 1WITA 3PWJB 5AG9A 3KPLB 1A7NL 2VLKA 4J2XA 2EDXA 2ENSA 1SYVB 3MLUL 3SKOA 2J8UE 3OKKA 3OR6B 4Y5XB 5CLWA 3VXRB 3AREB 4M8VA 4JY6B 1JN6B 4I1NB 1NCBL 3QDME 1UCTA 2H8PA 5E2WH 3RUGE 2A2QT 1OAXH 2AQ2A 4Y5YA 4ONGH 2WWMD 1Z3GH 4WY7L 3O8XB 4XCYA 1KCSH 3OKOB 1RVFL 4U33A 3FB5A 2DBJA 4JN1L 4X6DA 3QNXB 5T3ZL 3QEGL 4NKOB 2NY2D 1AR1D 2BY3A 4PJ5A 1AGDA 5D1ZC 4TNWK 3UCRA 4EI6B 4G9DB 2ADJA 2IQ9L 3JBG7 1EMTH 4WHCA 5E8DH 1WZMA 3OZ9L 3IDIA 2ADGB 3B9VA 5EC1A 1H3VA 4J23A 2WWMC 5TE7L 3RU8H 4NQEA 3BI9X 5I16A 4QXWA 5FUZL 5H94A 4DOHE 1IGJA 5FUCE 1FNEA 1CCZA 3LKOB 2NY2C 5MENE 1AR1C 1X6NA 5E94B 3NZ8A 1KNOA 1QFPA 4X4MA 4Y19E 3E2HC 1A22B 1M71B 4ERSL 3E3QE 3VFOA 2VTFA 2OXHA 2I9LB 3L95A 5ANME 5GS1B 4QOKB 5DQJB 3SDAB 4DEPC 5C08D 1R3KB 5DJAA 4RAHA 1HXYA 3F58L 4WEBH 1RUMH 3MRHB 3JWDH 1LK3L 1F4WL 5FK9A 4P23D 2VXVH 1GZQA 2VSCA 5F7KC 3B9KA 1KIQB 2QQLL 4AT6B 1NMAL 4MJ6A 4G3YL 4I0CC 2DQTH 3KPPA 3ZDXE 2A83A 4NO5B 5F7EL 3KPRA 5DDHB 5C6TL 2ERJB 3O9WA 4GS7C 2NY6D 2RCSH 5MEPA 4WW1A 2NY4B 1YNTB 1N4XL 4QY8A 1FPTH 4P23C 3BD5A 1BJ1H 3NABL 2A9ML 4R3SA 3VH8B 5F96H 3LOWA 2B4CL 1I1YB 2WWKO 3UJJH 2ICEB 4TNVF 1A1NB 2DJSA 1P84K 3D6GA 4PRNA 1H3UA 5HJ3B 5D70L 2IH1B 1V3JA 1MRFH 3QDMA 3QULA 5FCUL 4XCNA 3C60A 2NY6C 5EZOL 4Z7VB 3W2DL 2VLKB 1OPGL 5JOPD 2W9DL 3MFFA 4M9PA 3SKOB 3OKKB 2BNUA 4YHKL 2C1OA 3IF1A 3IFLL 4YXHH 3HMXH 5AYQA 5J7CC 2EKSA 3RDTD 2FDBP 2OI9C 2EDYA 1FL3A 4J3XA 4P2OD 3SE8H 4MLIA 4X7FC 1I75A 3W5NA 3CFIC 4JQXA 4XCYB 3G5VA 3RA7L 3ILPA 1CFNA 3UPRB 3FB5B 4HWBL 1MCOH 4X6DB 1DBKL 4NN7B 1NGWA 3W9EA 1G1CA 3EFFA 4PJ5B 1AGDB 3RDTC 5I1HH 2ADJB 3G5XA 5MENA 5D1QB 3VWJA 5I8OL 4P2OC 4Y19A 5SX4I 4DVBA 3L5WB 3IDIB 4U3HA 5DQ9A 5EC1B 4YDLC 5KVEL 3JVGC 2IAMB 4LSQH 2IWGA 5ANMA 3U9PH 5I16B 4DAGL 2W59A 5GJTH 5H94B 4QRPE 1IGJB 1B0GA 3Q6GH 1FNEB 5F3HA 4JZNA 3NZ8B 5HYQA 2AJXL 2ED9A 5IMKA 3VFOB 3V6ZB 3L95B 1TVDA 5DJAB 1U8KA 1HXYB 4OSUH 5LGHL 4XXCC 1FJ1A 3V5KA 1FV1A 1GZQB 5I1JL 2E7LC 2GIYA 2DQDH 4UUJA 3B9KB 4M7JL 3QG7L 4MJ6B 5T1KD 2KH2B 4BSWA 1RZJL 3KPPB 4GAFB 2BCKA 2A83B 3LHPL 3KPRB 2J12B 4HDIA 2N56A 3S4SA 3ARYA 1AI1H 1BVLA 4WW1B 3MGOA 1IMHC 5DZLA 1UH4A 3C5JA 2EE6A 4R3SB 3ZE2E 4NC2B 2D7MA 1KN4L 3LQMA 3I50H 5DFTA 5DVOA 5BJTB 2VZ1A 4JRXE 5DYOA 5L2KE 4PRNB 1PYWA 1AY1L 2DQHL 3QDMB 3QULB 4F7EA 4X6BA 4M3KB 3MFFB 3QIWD 4IMKC 1N5AA 1CVSC 2BNUB 2C1OB 1GGBH 1XGPA 3GHBL 3IF1B 3P4OA 1ZLWH 1GC1C 3BKYL 4X6EA 3RWIA 1YEJL 2EKSB 1T03L 5B38A 3FRPG 3MRJA 4I3SL 3TVMD 3MOAH 2CPCA 5K9JL 1IM9A 4AM0A 2X1XR 5AZEH 3MREA 3V79C 2BNQB 1RZFL 5GGQH 3DETD 1P7KA 3G5VB 1CFNB 3QIWC 2XTLA 1S5IH 2FL5B 1NGWB 3W9EB 4QRPA 3EFFB 2HN7A 1NFIA 3DUSB 3G5XB 3VWJB 4Y19B 3TVMC 4DVBB 2R69H 4L4VD 4JM2D 5DQ9B 1N64H 2XG5A 3DETC 1YEFL 3FO1A 5F8QC 5A2LH 2J8HA 1B0GB 5F3HB 1LEGA 5IWLA 2VITA 4JZNB 5IMLA 4M7KH 5HYQB 32C2B 1WZLA 3JTSA 2X89A 1QLFA 4RMUA 5IMKB 1ES0A 2LFGA 2IADA 4FZ8H 5F71A 5DK2A 4JM2C 4HKJA 4RCAA 4KZEH 2WQ8A 1KGCE 5D2NB 3NIGE 1FJ1B 3PDGA 3V5KB 4AEHL 1FV1B 1KJMA 5CJ5A 5KN5A 2LABA 1C5DA 3AGVA 3ULSA 1DLFL 1FIGL 2ADFL 1D5MA 2ZUSA 4UUJB 4HEPG 2CXGA 4NSKA 1ETZA 3REVA 3IDYB 2BCKB 1A7BA 4LLVA 4JRXA 4HDIB 3S4SB 1MNUL 2FX8L 1BVLB 4JG0H 4OCMC 3MGOB 2I9TA 4BZ2H 4IRZL 1GHFL 3C5JB 5C0CA 3JTTA 4HUMB 4HIXH 2BOCA 2QQQA 3CH8A 5C0AB 4KUCD 1P53A 4JPWL 5DYOB 3FO0L 3DMMA 1KIUA 2G60L 1PYWB 1OGTA 2H9GA 4XHQA 5T3XD 1IL1A 2B20A 4F7EB 1N59A 1N6VA 2NZ9D 2XN9D 4X6BB 3ULUH 1X5FA 3ARGD 4C4KO 5HGBA 3UTSE 4OBRA 1RV6X 4Z8FL 1N5AB 3HI1A 1QHPA 1EERB 1BLNA 1XGPB 5J6HA 3RWIB 4PD4K 3INUL 5B38B 5GS0D 4POZD 5F70A 1YECL 2DTSA 3MRJB 3R1GL 3BPNC 4K7PY 4OQTH 5DD0H 2V6HA 4AM0B 3MREB 3EJYD 5J11B 2NZ9C 1P7KB 3DLQR 1DFBL 3ARGC 1IKNA 3WLWD 2EO9A 2YD1A 2P44B 4K8RL 5H8DA 1WAAF 2MTPA 3S37H 1CFVL 2YS4A 1II4E 2BMKA 2HN7B 3MLZL 5K9OA 3RI5F 4ZFFA 5ISZE 1NFIB 2EXWD 1JHKH 4POZC 1ZLUH 2HAZA 2YEZA 2YD5A 1R5VA 3MLWL 4OJFH 3EJYC 2DLHA 5CIPA 3U0TA 3WLWC 3FO1B 2G9HA 3BAEH 4M61A 5JZ7D 1KB5A 4M1GH 3QAZC 3QUXD 2OMBA 5IMLB 5F6IB 4YHLH 3WNKA 1VERA 4JZJC 3JTSB 1EGJL 2EXWC 4XCFL 1QLFB 2IPTL 1ES0B 5SV4A 1NC2D 3DVFA 2IADB 1RK0A 2DM4A 5DK2B 4ZDHA 2BRQA 1OCWL 4PGCA 4HKJB 3KPSD 1LO0L 1E6JH 3OAZH 1A6UL 2C3VA 4DTGL 1KJMB 4M4RA 5JZ7C 5KN5B 1C5DB 3QUXC 1D5MB 2F8OA 4QTIH 4KI5D 4NSKB 1ETZB 3REVB 3VI4E 1CTNA 4NQDD 1I7UA 3KLSA 4XNUL 4LLVB 4JRXB 3EO0A 1DN0A 4JVPA 5EWIH 4KKLD 4XPTL 2G5BA 4KTEL 1A14H 4KMTH 1BZ7A 4NBZB 5LG1A 5C0CB 1AC6A 1K8IA 5DMKA 4R96A 3P30L 2BOCB 4KI5C 2P48B 1IEBA 3UXFA 2HJLA 2UZIL 3NIFF 4ELME 1OGTB 4KAQL 4X83A 2NQCA 3UJTH 1IL1B 1S7XA 1N59B 3IDUA 4HBCL 4KKLC 3SBWC 3NGBC 5HGBB 2F5AL 4MD4A 4OLWL 3RZCD 3HI1B 5IB4A 1BLNB 4ZMAT 1ZK9A 5J3HD 3H9YA 5J6HB 5AG8A 3RNQA 3BMVA 3Q2CA 1F3DJ 4U0QB 5ISZA 4MJ5A 2Q3AA 3JWNC 5D7LB 4PP1D 2DI8A 2D7NA 5D8JL 3CDYA 1ERNA 8CGTA 3OF6A 3RZCC 4ZNCD 5C0ND 4U1MA 2BMKB 1NBZB 5J3HC 1K2DA 2NX5E 1XIWD 5K9OB 1KACB 4B7IA 4YFEA 4ZFFB 5HVWA 4KRLB 3ZKXC 2V5YA 3NIDF 2YEZB 1D9KA 1C08A 1R5VB 4PP1C 5SX5H 2YRLA 5D96B 4RQQA 5IB1A 1IGCL 4MXVE 4NUJA 3U0TB 2G9HB 2YR3A 4M61B 1KB5B 1RUQH 5LWYH 5GJSL 4KC3B 5C0NC 5DF0A 3N9GL 5EOTA 1AKJA 5IROC 1XF5A 1XIWC 3KLDA 5KW9H 3S96A 4KHTL 1YEEH 1MCFA 4ZDHB 4UILH 4PGCB 5D1ZA 1R3IL 3NTCH 1ZOXA 4HJGA 4ORGA 4XWGH 4NN6B 3SCMD 2C3VB 4MYWB 1MJ7H 3L3IB 2EH7L 4ZTOH 3C8KA 3TESA 1FYTE 1WEJH 3GSWB 3ESVF 3P0YL 1BJ8A 4O00A 5FYKL 3DRQA 4LLMA 3EO0B 1DN0B 3QRGL 2V17L 2AXGA 1N2RA 4ELMA 2G5BB 4Z0XA 3SCMC 1BZ7B 4X7SL 2HFEA 5E6ID 5ADOH 4YDIH 4KKBD 5HHQA 4RA3A 5DMKB 2C26A 2UUDH 3FFCE 4NWUL 2HJLB 4EN3B 4L3ED 4BH7A 1YYMH 4YPGB 3QQ9D 1N0XL 3MC0A 1BFOA 2E7BA 1S7XB 2QQNL 2D7TH 4BYHA 4U1LB 1S7QB 4MD4B 1TQCB 2VUYA 3B8YA 3ZTJH 5HHOE 4KKBC 4Y5VC 5IB4B 1BQUA 5C08A 1H8NA 4K2UL 4KDTA 2HMID 1FAIL 3RNQB 5KSVB 2F19H 4P23A 2NX5A 4KJWD 5DMGD 5ISZB 4KPHH 5IKCA 4MJ5B 1JFQH 2DKMA 2IG2L 4U3CA 4WCYH 4MHHI 2VKXA 2XA8H 3LRSA 5CJQL 1RZJC 4U1MB 4IRJD 4LHUG 2XKUA 3VWKD 3FOLA 1U8HA 2HMIC 4FQPA 1YEIL 3OKYA 3TGXA 5IVNA 3IJSA 3HZYA 4KJWC 1Q38A 3OV6A 5DMGC 1JPTH 1BPVA 3PV6A 1D9KB 4U1SA 1C08B 4NQCD 1I1AA 2FWOB 4PGDA 1T2XA 4RQQB 2Q8AH 4PJHF 2XIDA 1QD0A 5HYJD 4EJ1C 3IFOA 3TO4D 3UEZA 1GGUA 5EOTB 1AKJB 1FLRH 1I4FA 5TPWH 4IRJC 2X4PA 1NCWH 3VWKC 1XF5B 2DOCA 2J88H 3MRMA 5LQBH 1QUNA 5I73B 1LNUB 4PBXA 4KKNA 5D1ZB 3I6GA 1H15B 3RPKA 4RX4A 1EDQA 4HJGB 4LDEB 3NAAL 3MBEA 3PNWA 3SKUD 3TO4C 3C8KB 1IEHA 5BXFA 4I2XE 5BW7A 1ZHNA 1BQSA 4X7TA 2XOTA 2YPVL 3FFCA 1E27A 2BY2A 3A6BL 3V5HA 5E56A 4LLMB 2AXGB 4ELMB 2X4QA 5CCKL 3HC3H 3TBWA 2YD9A 3E2HB 4Z0XB 2J6EL 2ILLA 4K3DH 3FT2A 2HFEB 1IAIL 3S9DB 4HV8A 5HHQB 1H3WM 2GUOB 4QXTA 3PP3K 3GI8H 5HHOA 4XNMA 5D7JD 2CO7B 1V3MA 1Y18A 1JRHH 4BH7B 2IGFL 1CFSA 5CGYD 1A6AA 1BFOB 1PKQE 1MLCA 4LF3A 5DRNB 1MWAB 3QIUD 4TRPH 1Y0LA 2D9CA 1P84J 2IJ0C 3PGCA 1U93A 1XR8B 4X9BA 4JJHA 5C08B 1OSPL 4F57L 3TV3H 4LHUD 1RIHH 1U8IA 5D7JC 5F1OB 1P7HL 1YMMD 3LCYA 2PCPA 2NX5B 4OZFA 4P23B 4UQ3A 5IKCB 4HC1H 3CDCA 5CGYC 1DQJA 3QIBA 1KC5H 4BFIA 2E7HA 2FX9L 3HZMA 2B1AL 3AS2A 4ODTH 5GGVH 5D6DC 1A5FH 3QIUC 3MLRH 2D9QB 4XVTL 2E9BA 5JW5A 4P0DA 1ZLSL 2NY6B 3FOLB 1DP0A 5FXCH 1U8HB 2V9RA 4RBPK 4PG2C 2Z35A 3HZYB 3IJSB 4ZO7A 4OZGE 5JW3L 3PV6B 4U1SB 4DZBB 1I1AB 1FCGA 4PGDB 2O5YL 2CK0L 5CJBA 3P4NB 2OI9B 5KOVC 2XZCH 4R4BA 2D31A 2ZUUA 1G1YA 3BDYL 4QTHA 3QFJD 2X4PB 1BECA 3V6FA 3QIWA 4MAUH 3FMGH 3O4OB 4YDVA 4I2XA 4AENA 3MRMB 1KENH 3EO9H 4K8RD 2NY5L 1UM6L 2YZ8A 3DX6A 1I8IA 3I6GB 3RDTB 3KS0J 4EOWL 2E6PA 5AZ2L 2CRZA 3B6SB 1CWVA 4FHBD 3MBEB 3K4ZA 3PNWB 4TQEH 1ZHBA 4F8TA 5BXFB 3Q48A 5EOCJ 4WW2C 3T3MF 4X7TB 1EXUA 3FFCB 4K8RC 1E27B 4NZRL 3V5HB 2Y36H 3FL7A 5C0EB 1AH1A 4NNPL 3TBWB 1W0WA 1PKQA 3QSKB 3FT2B 3W39A 4HV8B 3WSQL 2AVGA 4QGYA 4G5ZL 1XGQA 4QXTB 5HHOB 4XNMB 1SEBA 1LEKA 2P24A 2MOVA 4NPYA 1AGFB 1DBJL 1Y18B 4XVSH 2YXFA 1FLTX 4ZO6A 1Y6NR 1ZLVK 1NQBA 4PJIF 1WF5A 1A6AB 1Q9LB 1U95A 1MLCB 4HUNB 2YD4A 1Y0LB 2EKJA 3C8DA 4RRPG 5DJ6A 3PGCB 3CCHA 3DGGA 1U93B 2B0SL 3F6IA 4PJ9D 1CLZH 4ZUUA 1U8IB 4ZOAA 4YDKL 2YPKA 2PCPB 4OZFB 2OJZH 1MPAH 1D6EA 5A2FA 1OAUH 4XNQA 3EYQD 4NOBA 3QIBB 4BFIB 4OLZL 4OZGA 1CL7H 5I17A 3GSNA 5C0RL 5T3ZE 1BEYL 4K7PL 3GBML 4JFED 4UNVA 4Z7NF 1WIOA 4PJ9C 3CUPA 1CGSL 2HT2D 4LIQL 1CLYL 3L9RA 2Z35B 5CJ8A 4POUB 1AQKH 1G7QA 3EYQC 4K3EH 3HNVL 3UJIL 4YE4L 1MF2L 1R3LA 4WRLA 1TXKA 5EIVA 1KCRH 4R4BB 3TZVA 3NFSH 1I9RH 4I8DA 4QTHB 3FT4A 3ARGA 2ZUWA 3VXPA 2X1OA 3V6FB 3MJ9H 3QIWB 2NW2A 4YDVB 2HT2C 3TYGL 2JJVA 3KYKL 3T0DA 1Q0XL 4OUUA 4RMTA 1IILE 4DGVH 3P0VL 2XZAL 1I8IB 3HAEH 4NJAH 3NCBB 4UAOC 1D5IH 3I6LD 3V9FA 1EUUA 5J57B 4ODBD 4GQ9L 1XGUA 4JHAL 4PJDF 3S3SA 4P9HL 3OGOE 1EXUB 4MMXC 1O5DT 5D72H 4M48H 4OT1H 5F9AC 3O6MH 1A7RL 3BWAA 4S1SH 1VFMA 5JLZA 3P11L 3W39B 3OKEB 4L4VB 3MRQB 1U36A 1I8KA 5BS0D 2E8ZA 3TNMA 1XGQB 1VCAA 1QA9B 5JXAH 3GGWB 1LEKB 2P24B 4NPYB 1TLKA 4LVNC 3VGHA 4GOSA 1BBJA 4FQCL 4TSBL 2R0LH 3T1FA 4KQ4H 4ZTPH 3SGEH 3P0GB 4O4YH 1MCIA 4AYFA 1NUFA 5HD8D 4O2CA 3FO2A 5DWUH 3HZVA 3BESR 3ARUA 5AYUH 4OLVH 5DJ6B 4K94H 2YBRA 5EZIH 3CCHB 3DGGB 2DJ4A 3DSFH 5FYKD 4FS0A 2GTZA 4FFZH 3VE0A 1KPVA 3N85H 4TOYL 2VL5A 3PHOA 2ZWLT 3TBTA 5MP6L 2HJFB 4WUKL 2V5RA 2YPKB 1P4IH 4QHLA 1LP9B 2P5ED 1H5BA 3UZVB 1D6EB 2HTLD 5FHBH 4XNQB 1F4XH 2FEEL 4OZGB 5GPRA 3B2VL 5HD8C 5ADPH 3LKNA 3WXWH 5I17B 3QNYA 4PD4J 1QR4A 3MGTA 5FA3A 5FF6A 1DZBA 3JV0A 5E9DD 4ZXBD 3VD9A 3RIAK 5C0GB 1BF2A 3CUPB 3M1BA 1IGMH 3L9RB 2HTLC 3MCLH 1G7QB 2DQFA 4LSTL 4XCCL 5SWZE 4NGHH 1P6AB 3WEXA 1U8PB 1FCCA 3BPNB 2N1KA 3TZVB 4ZXBC 1B0RA 3FT4B 1SY6L 3ARGB 5CP3A 3VXPB 5INCA 2NW2B 5EBLA 1FH5H 1JZ2A 5FYJL 5BZDA 4EDWL 2NY7L 1LGVA 3I2CH 4HKXB 5E6YA 3OHXA 5E08H 2JB5H 4J8RA 1NMCB 1OM3L 4R97C 3BDBA 3QP3A 4P4RA 4HF5L 1GAFL 4OTXH 1K6QL 4JY5H 3GJFK 1JRHI 4KV5E 5E2JA 3PHQA 4ZQKB 4ZOEA 4MD5B 1QZ1A 3D9AL 4XAKE 2A6JB 2GHWB 3BWAB 4L9LC 3MACH 1LO4L 3DXAE 5KVFL 3H3PH 3L3KA 1LK2B 5EA0L 3A6CH 4N0RA 4OLYH 3SDYL 5B39A 5LCVH 4ZNEE 3TNMB 1YDPA 3PXHA 4R4ND 5GRJL 5TQ2H 1AJ7L 3UTTE 4ODSL 5I15H 1R3JA 1BBJB 4P3CL 3T1FB 4JAMA 3U0PA 4PRID 2GYSA 4O2CB 1M7DB 3FO2B 5F7YC 2WBKA 2QSCL 3HZVB 2Q20A 3F6LA 3TC9A 2YBRB 4HWBA 1PG7X 2ZZUT 1A47A 3VE0B 1KPVB 3O2DL 4R4NC 2VL5B 3PHOB 4Q74A 2H2SD 2GK0A 5GS0H 3BYYA 3TH4T 1OB1A 1T0MB 3WFCL 5DTFA 1LDPL 5I74C 1PD6A 4WHYG 1JZ5A 2CDFA 3U30B 1T04B 5SWZA 5FA3B 4YC2C 4HIJA 1OY3B 3C2SA 4H88H 4PY8J 2FSEA 1AXTH 1BJMA 2H2SC 3M1BB 4P5MB 4XNXH 1IEAA 3HE7D 4Y5VA 1F58L 1YN6B 3IDXH 1QPPA 2DQFB 4MB3A 1IARB 3R8BB 4BZYA 2Y07L 3H9ZA 1JNLL 2QBWA 5JUEH 1UACL 3WEXB 1XCTA 4ODUA 4ZAKA 3Q1SH 1B0RB 5INCB 3W0WD 4FA8A 4O9HL 4GMTH 2ARJA 4NN5C 4WWKD 5EBLB 5EU5B 1TNMA 5C0BE 4TPRL 3HE7C 4PRHE 4G6FB 1RJZA 3OHXB 3L7EA 3DX8A 2VZTA 4J8RB 1EBAA 1W72H 3CXHK 5DHVA 1J1OH 3DXAA 1OARH 1J0JA 4J12A 2ORBL 3F7VA 4YHNB 4P4RB 3BWUC 3FN0H 3NPSB 3EZJB 5GS2H 1MEXL 4WWKC 4JFHE 3PHQB 1PLGL 2WQRA 4MDJA 4GXVL 3TPUB 3EOBA 4Y2DA 2O93L 4JM2F 4XBPA 4GMSH 3L3KB 4APQA 3ARDD 4J4PD 1RZ7L 5IV2A 1YDPB 4N8PA 1XGTA 5I1CL 4KHXH 2CIIA 1WISA 1JUFA 1CL7I 1NL0H 3JSSA 3U0PB 1ITBB 3KS0H 4X5LA 3ARDC 1IC4L 4J4PC 3L5XH 1ADQH 5HDLA 4XMLL 3T1WA 1L0YA 1G7MA 1J0KA 2LAAA 1RZKH 3E6HA 1CF8L 5EB9A 2GK0B 1RIVL 3ARFA 3CLFL 2D4FA 3PGFH 3CAFA 5DTFB 1CR9L 3GO1H 1NFDE 2MNUA 3GMRB 3FN9A 2CDFB 5SWZB 4TYUA 5HI3D 4DN4L 5J12B 1RULH 1OWWA 3UBXG 4TNWF 3NCJL 4HIJB 3QWOA 4LAQL 4LEOB 3QB7C 1JTOA 1UGNA 2FSEB 1WQVT 3AAZA 4LLUB 3ZYIA 4RWYL 3B8SA 1IEAB 4Y5VB 5C0BA 4EUPG 2I60H 3U0WH 4DGYH 4NHUB 2CJUH 4LSUL 4G7VL 4PRHA 2D03L 1GOFA 1BFSA 3F7QA 4H0GA 1U8OA 2VDQL 1IC1A 4G8IA 1XCTB 5HI3C 4ODUB 3KYNA 4ZAKB 5GGRY 1JP5A 4EQ2A 3Q6FA 2HVJA 3C9NA 3NFNA 3UYPA 1I8MA 1INDH 2ARJB 1EJOL 5DK0A 2NW3A 2MHAA 3RQ3A 2QLVB 3OJDA 3HE6D 5TQ0L 4XZUA 1RJZB 5BRZE 3L7EB 3DX8B 3MUJA 1FC2D 1QFWL 4PG2A 4PYGA 3VMNA 5K59F 5DD5L 5KBNC 5DHVB 1UM4H 3RWHA 3HPJA 3F7VB 1MSPA 4UV7H 1IJ9A 1NC4A 1BM3H 1OF2A 4BH8A 4LHQB 3SGEI 3HE6C 3SE4C 4IRJB 2VR4A 3EOBB 2V5MA 5E2TH 4JRYE 5EU6E 3TIDA 1OT1A 4Y2DB 4XBPB 2XWJA 4APQB 3OXRA 2MPAL 3GKWH 4CJ0A 5IV2B 2FX7L 3CVHH 3QHZL 1UZ6E 5EU7E 1H3XA 1C1EH 3OMZA 2XACC 2AEPH 2CIIB 1CGTA 1NAKL 5CHNB 1JUFB 1YC8A 3TT1H 2JJTC 4LPXA 3W5MA 2NXYB 1NFDA 2DLEA 3NFPA 2VISA 3L7FA 4OM1L 1VHPA 4PB9L 4GAJL 2DDQL 1S9XA 3B5GA 4UBDD 1ZHLA 4AQOA 1WT5C 3E6HB 2W07A 4DN3L 4KI5F 3ARFB 2VLLA 3MXVH 2WUBH 5BMFH 1FZMB 4YHIA 3VA2C 4XB7A 4XB8A 1D7FA 1YNKH 3LAFA 3MSPA 3MZTA 4D0DA 5DC0A 3QWOB 2OK0L 1C7SA 1EGJA 4UBDC 3MODH 1AHWC 2DLTA 4U6HA 5ACZA 1KFAL 4G6JL 4PBWD 4U1GB 5BV7H 2KL6A 5C0BB 4S1RH 1RIUH 4PRHB 5D7JB 5BRZA 5LJYH 5C07D 4EVNA 2XZQH 3DVNA 4HH8A 1WCQA 4G8IB 4XP1L 5H37G 1ZA3B 3KYNB 1FZKA 3BKJH 2HRPL 3Q6FB 1HHKA 2DBLH 1MQKL 1ULVA 2HVJB 3AROA 3C9NB 4ZS7L 1I8MB 1CXHA 3HNSL 5D2LE 4G80A 4U49A 1MCDA 2MHAB 4GRWF 3OJDB 1G9ML 1VDGA 1BQHA 4XZUB 2F58L 1HCFX 3MLYH 1S5HA 1REIA 1GGIH 1W8OA 5M95B 4HCRL 1C5CH 4JRYA 2AJSH 5EU6A 3B9DA 4PGEA 3RWHB 2CKBH 2WBWB 5DURB 3HPJB 3U79A 5ICYA 5HDBE 4WO4A 4PLNC 4WV1C 4WUUD 2ZNXA 3WXVH 1DSFH 3OKLA 4PRBA 1NC4B 4BH8B 1CLOL 1V7NL 2IBZY 3CD4A 3HMWL 5TF1L 3ES6A 4ENED 3TIDB 4Y16D 2ZJSL 2XWJB 4GAYA 4ZUSA 3OXRB 1WLHA 4FRWA 1HHGA 4UT6L 3WE6A 1OHQA 5TH2A 1A4KA 5IJKA 3O2VL 3PQYE 5FB8A 5DI8A 3MBXH 4OI7A 1XF1A 5ID0A 2AP2A 1A7OH 4ENEC 3GMOA 1RMFH 4Y16C 1T22A 3L3GB 1NFDB 2QADD 4ZO9A 3NFPB 2VISB 4MCZA 2R0WL 1NLBH 2IBGA 2ED8A 5MHSD 1S9XB 1ZHLB 2H32B 5I71B 2VLLB 4ZFGL 3SJVD 3WFDH 4YFLF 3E1F1 4YHIB 2DQCH 1KCUH 1SJEA 2JJUA 3ROOB 3R8QA 1MJUH 4WHTA 2QADC 4OCSH 3CFJA 4RMRA 4D0DB 5DSCA 5I1EH 3BKCH 3VCLA 3ARVA 4K23L 1NCDL 1MCPH 2AQ3A 2GJ6E 5D2LA 2MCG1 4XPAL 4G8GE 3CLEL 5BRZB 4YHOL 4EVNB 1I7TA 3DVNB 4EQ3A 1OSZA 3GBNH 4BQ9A 1FZKB 2OJEA 4ZFOL 1HHKB 1FC1A 2JCCE 4R90L 4V1DE 5ALCH 4G80B 3P73A 3QJHA 2AJ3A 1A6VL 1PEZA 5J1TC 4KVCH 5B22A 4OI9A 4XBEL 3BE1L 3DNKA 1JYXA 1KIPA 4DUXA 1XGRA 4MDIA 5E0QA 3ZE0E 1S5HB 1KELL 5EU6B 2DYPA 1TJHL 4PGEB 1MVFA 1YEHL 3STBA 5ICYB 3SQOH 1JNJA 4WO4B 1ZVHA 3QUZD 2XXCB 3PWLA 1FORL 3OKLB 4PRBB 1NEZG 2KPNA 1IQWL 3PQYA 1OWRM 3DYOA 4X7EC 3VXSD 3OX8A 5CJXA 3HA0A 2MCPL 4GAYB 4ZUSB 2LVCA 3VI3F 2HA1A 3WFBH 1HHGB 4FABL 1H3GA 3WE6B 4UAOB 3G9AB 3BHBA 3QUZC 5SWSE 5TH2B 1P1ZB 1ZHKA 3FFDA 1PX4A 5FB8B 5DI8B 3M45A 4YBQD 2OL3A 4JQIL 1V7MH 5MEQA 4ZPTA 3LEXB 1BGXL 5ID0B 1FNSL 3S88H 2VLRE 2XQYK 3X3FL 3GMOB 1YEKH 4TVPE 2V2WA 3QR2A 4H26A 4HAGA 1J5OL 4WI5A 1T22B 3TNNB 4HUWA 3VFVA 1RI8A 3O6LL 2IFFH 2APBA 4WENB 3VRLF 2P47B 5CZVL 1IZJA 2E5EA 3E0GA 3LPWA 4E9LA 1MIML 4YBQC 3F7PC 2EE2A 2VZSA 2GJ6A 1SJEB 5T1MA 4NQXA 5B39G 4G8GA 4KUZH 5JHDD 3GHEL 3CFJB 2APFA 3U4BH 3KLAA 4NQSA 4XNYL 5DSCB 4XP5L 3LB6D 4Y88A 4NKMA 2LU7A 4CJ1A 3GNML 3O2WL 2JCCA 1D6VL 4X9FA 4LP4A 5T33L 4CUCA 4RGOL 4V1DA 5D2LB 4RZCA 1W8NA 25C8L 3S6CA 4GRMA 1GPOL 1I7TB 3FZUC 1FBIL 2GY5A 1OSZB 1U3ZA 4PJFE 2OJEB 2P5WE 2AEQL 1WWCA 2BDNL 3LB6C 2J8UF 3Q3GB 4ZUVA 3P73B 5HHXL 3QJHB 2AJ3B 3OL2A 5GRWA 4DUWA 1KIPB 1XGRB 3BYTA 2J6EA 1DEDA 1T2QL 2F5BH 3RUGF 1MFCL 4LCYA 1G6RL 2DYPB 1MAMH 2VH5L 1NCCH 1L7IL 1X5XA 1UWEH 5DT1H 4E41D 3UZEA 2AK4D 3BT2L 5SWSA 3CX2A 2GY7B 5HVHC 3X3GH 4ZXBB 1U2HA 2H3NA 2CKNA 1J10A 3OX8B 3LKPA 3VXNA 5JW4Q 2VLRA 2LE9A 4X6CB 1LO2L 4UV4L 3RL1A 1MFBL 5AWNL 2JELL 4Q9QH 3LD8C 1CFQA 3BHBB 4LCCC 1ZHKB 3M17A 2PUQT 2VMFA 3FFDB 2CUHA 3EDDA 4R97B 5IR1A 4WW2F 4Y8AA 4ZPTB 2AK1H 3A0OA 2VDMH 1DN2A 2V2WB 1RFDH 4H26B 4HEME 5K33A 4NKIH 4WWKA 1OAYL 4DFHA 4Z77A 4HUWB 4EDXA 3VFVB 3D0VA 5F1NA 1RZIA 1E4KC 4PJXE 3ZE1E 1EHLH 2VDKH 4JB9L 1CXIA 2EDHA 1X4XA 4JDZA 4XNZC 3EYUH 4DZ8A 1QYGH 1GH7A 3PJSB 4M5YH 2HWZH 2PYED 5T1MB 4X0KB 4HWUA 4NQXB 4G8GB 4RGND 1MJJA 4HAFA 1QSFE 3KLAB 2OSLA 4NQSB 3DBXA 4PJFA 4JFXA 5B3NA 4NKMB 1TTUA 5FKPA 5IHUH 2Z91A 4V1DB 1WC7A 3IFNL 3KPMA 3H6JA 2GT9A 3HNTH 4RZCB 3T77A 3PP3H 3B4NA 3QYCA 5JW4N 1BBDH 4GRMB 4RGNC 4NNYB 1NGQH 3N1PC 4P5TA 3O3EA 3QWRD 3LRGA 5I74B 3OKNB 4LSVL 5JQ6H 3BD3A 3JV4A 2QHRH 2VC2H 2AW2A 3OB8A 3ZHLA 4QXGL 5K9KB 3AS3A 4ZUVB 2COQA 3QXDA 3TBSA 1C12A 5FO7A 4J3SA 4YC2B 1ZEAL 2BSSA 3LPGA 2EXYD 5CIPH 1VFBA 4HKZA 3BQUD 2B2XH 5EU3A 3TO2A 3UROR 3B3IA 5GRUL 4LCYB 2HKFL 5JIKA 1YZZA 4XGZA 3EO1A 1KB5H 4O51A 5EULV 5FUOH 4PJCE 2XQYG 2A6KA 3ILQD 4DGIH 3VG0L 3AS1A 3VD7A 2LQRA 3C08L 4Z5RA 1SHMA 5EFIA 4LK4A 1A7QH 3QPXH 4N8CL 4CVZA 3VFSB 2H3NB 3HLAB 3VGAC 4NM8L 8FABA 3LKPB 2BERA 2OM5A 5DMIL 2PTTA 3S35L 3BQUC 1B4JH 1JWSA 1NDMA 4AG4L 1ZV5A 3OAUH 4RBPH 1Q94A 4YUEH 3S36L 2C3WA 2RR3A 3RL1B 4Z7QE 4ZYKA 5CGMA 4I77H 1CFQB 2VE6A 1BMGA 5HHNB 4PJXA 1OOAA 5D7KD 3M17B 1M7IA 5IBTH 4JEGB 1KB9K 5IR1B 5ITFB 3QI9D 1YY9C 7FABH 1P7QD 35C8L 3ELAT 4WWKB 5K9QG 4Z77B 1J87A 1SM3L 5FKAA 4EDXB 1RUKH 3ARXA 4HIIB 5F1NB 1UA6H 1G9MC 4JCLA 1RZIB 2VIRA 5BVPL 1QSFA 1MIEH 4FFWD 4JDZB 3V4VH 4N0FA 4P4KD 1B9ZA 5L88L 2VZOA 4YEFA 3QI9C 2RBLA 4JO3H 4YH6A 3SE9H 4HMCA 4J3VA 3MUGA 1MJJB 5EO9B 3GK8H 3KHQA 3MCG1 2OSLB 5HHME 3K1DA 3DBXB 3UDWA 2C4XA 3LS4L 3ARDB 4G7YL 4JFXB 4PJFB 1A9BA 1QEWA 5CEZL 4FFWC 4DUVA 5F9JA 2AJUL 1NGYA 3HKFA 3RGHA 3ZE2F 5FKPB 4P2QE 4IEFB 4Y4HD 3T77B 1YC7A 3S5LA 1GIGL 1OAXL 4P5TB 1J1XH 3O3EB 4ALAL 2Y06H 1KEGH 4ORZC 4K3JH 1CBVH 1KTLA 2MKLC 4MJ4A 4PY8I 5FYJE 1PY9A 4PJCA 1DVFD 1KCSL 4HK3N 1U9KA 4IMLA 4WVRA 1Q9WA 5EIQA 4HS8H 2NY3D 3NCYS 5AD0A 3TBSB 1C12B 2X2YA 5FO7B 1T4KA 5FM8A 5IQ7L 2BSSB 4Y4HC 5F7UA 2DD8H 1BD2D 4HKZB 5EU3B 3TO2B 5E8DL 3B3IB 4YHPA 5I1GL 4QRRD 4XGZB 3CZFA 4O51B 1FFQA 2A6KB 4F3FA 3DOSA 3RU8L 1RK1A 1CXKA 4PJ7E 1DVFC 5B4MD 3D3VE 1ZGLA 2QSVA 5EFIB 1DDHA 2NY3C 2R9HC 4CVZB 3D85A 4JFHD 4DKFH 3BMWA 3RVUD 8FABB 2P1YA 2X70A 1JWSB 1NDMB 1GOHA 4C83B 4FMFA 2XZZA 5IMMA 2YPLD 1CQKA 4ZYKB 4WEBL 1RUML 4TVSa 3UO1L 5B4MC 4PJXB 4M6NL 4JFZH 4TSCH 2VXVL 5IVZA 1A1MB 3IU3A 1BQHG 1DBBL 5C9JA 2RFXA 3SDXE 3O3BA 3RVUC 4X4ZA 1PEWA 4LU5H 4KY1H 1OP3H 2EDEA 3OSKA 1VEOA 4FFYH 5FKAB 4WHYH 3DIFA 4XMPH 4YXLH 1QSED 3RWFA 6CGTA 1DUZA 3P2TA 3IDGA 4NRYA 2VIRB 1QSFB 1OLZA 3NIGF 2ZP0T 4GAGH 3B43A 4UNTA 3MXWH 4N0FB 2FO1A 4AEIH 4WI7A 4M62H 4WUUA 5EO0A 3P9LA 5LKNA 3HI5H 4P2QA 4NM4L 3MUGB 5TE6H 4NRXB 5J89A 1FGVL 1IAKA 4MAYD 1KLFA 5DC4B 1SY6A 3IAPA 3VMPA 3KYOA 1CK0L 4TSAL 3V0VA 3QEUA 1A9BB 1QEWB 1X5HA 5F9JB 1A9EB 1NGYB 5HI4D 4YXHL 3ZDZE 5J9PA 3HMXL 2IEPA 1CGXA 3RIFK 1G84A 3S5LB 3WS6A 4MAYC 4PJCB 4MQ7A 4IMLB 4R2GD 1Q9WB 2HFFA 3D3VA 1I9JH 1S9YA 3KJ6L 4C55A 5HI4C 1LQSR 1MOEA 3A67L 1S9KC 5F93C 2GITA 2ICWA 4NP4L 4YHPB 5IBUG 4FNLL 3CSBA 3CZFB 1KCLA 4LDLB 3OWEA 5EZLA 4F3FB 5I6XC 4ZUWA 4YLQT 4MX7A 1RK1B 1TZIA 3ZO0A 4MNQE 4TUOA 1LE9A 1ZGLB 2A0LD 4R2GC 1DDHB 1K3ZA 3D85B 12E8H 4Q9RH 1JPSL 2NLJA 2PO6A 2W65A 3SDXA 2X70B 4HS6A 1Z5LA 5IMMB 4C56D 1T21A 3O2DA 4OSUL 4Y2OA 4JO4H 2GAZA 4F58H 2A0LC 3QFDA 2R4SH 4H20H 4P2RD 5IVZB 1FZOB 3IU3B 5ICXA 1YJDH 5C9JB 2RFXB 3O3BB 3O6KH 5CBEA 1NLDH 2VYRE 3QT2A 4YBHA 3CNKA 2OR9H 1BFVH 1RU9H 2HKHL 3DIFB 4JPVH 3RWFB 1DUZB 4EIZC 3F5WA 4WU5A 3IDGB 4F9PC 1HYRC 2DQGH 3M07A 4OF0A 1IRAY 5L0QC 5HHMB 3K8KA 5I8EA 1ACZA 3LEVH 1N7ML 3OPZH 1I85C 4WUUB 5EO0B 4LBEA 3P9LB 1NGXA 1FL5A 3I50L 1DQLH 4P2QB 2EIZA 4LSPL 1LE5A 2CRMA 3GJFH 3L5JA 3RVTD 2DS4A 4LMQE 3V0VB 3QEUB 4F7CA 2VZVA 3SGKA 4OZFH 1KN2H 3EZ8A 1BAFH 4OLXH 3WIHL 3IXAA 1G9NL 3AFLA 2X40A 2E7MA 2WWKT 3MOAL 4CADA 4KGJA 3EFDH 5AZEL 3HC0A 2IPUK 3B83A 3RVTC 1GXEA 3D87B 3I6KA 3LQAH 4OFDA 2FR4A 4MQ7B 1KEML 2QADB 5F8RC 1XF4A 1S5IL 2HFFB 4YHZH 1H0DA 3D3VB 1S9YB 3LS5L 1U91A 2GITB 2ICWB 1OAZL 2EEAA 4W70A 3VFMA 2FB4L 3QO1A 3ZDYE 2LU4A 3SJVB 1A3LH 4LCUA 4AH2B 1N64L 4M6OH 5I0DA 2JIXD 4N5ED 5CBAA 1NMBL 1HHIA 4ZUWB 4MX7B 1TZIB 4MLSA 1EFXA 4TUOB 1LE9B 2DLFH 3VFGL 4FOMA 2NLJB 5FA4A 2PO6B 4M7KL 1AGBA 2BNRD 3SDXB 3QPQD 3S35X 4Y8DC 4R7DA 5IHBA 4HS6B 1T21B 2QSTA 4N5EC 3AMLA 3C09C 1S7SA 1AD9A 4P48A 3QFDB 3AVEA 2UY6A 4UB0H 2AKRB 5ICXB 4JO2H 1YPZE 4WI3A 5E2UH 3JWOH 3QPQC 5J6GA 1VFUA 1JF5A 4NWTL 5I19H 3TYFA 4ODHL 1VFAA 1U42A 1EO8L 3TT3H 3EDKA 2VSDA 3F5WB 2XQBH 4WU5B 4ZOCA 5C09E 3V6BR 1FFPA 5ESVA 4BZ2L 1F4YH 1HNFA 4U7KA 1ZLWK 4LBEB 1FL5B 3H9SD 2EIZB 4K9EL 1LE5B 3QWQB 4NO0D 1AGEA 4CKVX 3QEQD 3RIAF 1YNLL 2EDJA 4LKCA 4PRDB 4CRPA 2VDOL 3D2UA 2UV3A 1UYWH 2JTDA 2QV2A 3TP4A 3KYAA 5DO2D 1E0OB 4F7CB 1J0HA 1JGEA 1DQTA 2BZDA 1E4KA 3IXAB 4MJ2A 3V95A 2OP4L 3C2AH 3GSNH 3TJEH 3HC0B 1DE4A 3QCTH 5DO2C 2O61A 2FR4B 2UWEF 2HLAA 2X44D 1XF4B 4LEXH 1H0DB 5KSUB 5DJ0B 3DV4A 4FP8H 3GZKA 1FRGH 1JHKL 1U91B 2D7PA 2H41A 3VFMB 1XF2A 4Z76A 2BY0A 4LCUB 4G8EA 4OJFL 5FOBA 2CXKA 3WD5H 5B3JF 5CBAB 1HHIB 1WIUA 2PYEA 4WGVB 1EFXB 4OF5A 4GRLA 4CBPA 4QRUA 2VXUH 5JHDB 3VFTA 2KQMA 2AABH 4XVJL 5FA4B 2ESVD 5HHVH 4PJAE 1AGBB 1YPZA 4PRPD 3BZEA 4R7DB 4NZTL 4JGJA 3IS0X 5HYSG 1J1PH 3GM8A 5I30H 3JXAA 3CFEA 5C09A 1S7SB 3GI9L 1AD9B 3H42L 4FQ1H 4KZDH 4L1DA 4QTIL 1A7NH 4S1QH 4Z78A 5GISL 3KGRA 2ZUVA 3RTQA 3MLUH 5GRVL 3TYFB 1U3JA 4F9LA 4YFDB 2JJSA 2ZKHL 1MAKA 4GBXA 5D9SA 1J8HE 4NC1C 5CD5D 4KMTL 5F72S 2FNBA 4CNIA 1TCRA 1FFPB 5ESVB 3SDCD 2Z93B 1FNAA 4F2MA 2IPUG 3LD8B 5D7IE 3X12A 2MKWA 4PGBA 1AGEB 4POYA 4JN1H 4LKCB 3UJTL 2HT4C 4FQXA 3IKCB 5T3ZH 3QEGH 3DI3B 2WZPD 2JB6A 2OCFD 1H3PH 5CD5C 4CN4A 3G6AA 1JGEB 2H26A 3SDCC 3OZ9H 3MTRA 1OGAE 3LZFH 2IANE 4NZDA 1D5ZA 2K3TA 3JWDC 4Z7UE 4HCRA 5FUZH 1GSMA 2J8OA 5DD6A 4R7NB 1P4BL 2VXSH 1DE4B 1P7QA 3SN6N 2DLGA 2O61B 4MNGE 2HLAB 5T5FL 1JYNA 3QUMB 2BXZA 1INEL 3DV4B 1EEUA 3F58H 4DFIA 3ARPA 1F4WH 5L9DL 5FV1L 1XF2B 4Z76B 4RISH 1P5UA 4G8EB 5FOBB 1HINL 1T83C 3JZ7A 7CGTA 3OAZK 5CP3H 2PYEB 5C3TA 2WMPA 2EE3A 4QRUB 2HH0L 3VFTB 5FYLL 4L3AA 2R8SL 3VDAA 5CINL 3BZEB 1N4XH 1U58A 3NABH 3UBXI 4UILL 3MGAA 2B4CH 1GRWA 2PYFB 1BZQK 4XWGL 3CFEB 3T0AA 5C09B 3WO4C 3D69A 1XCQA 1J8HA 3S3PA 2LU3A 4JDVA 5D70H 4EI5A 3SGJA 4HFWA 4BFBD 1F11B 1TZHB 5FCUH 1PAMA 5EZOH 3V4PL 1DVFA 5HY9A 4AIZA 3RTQB 4WFED 5D7IA 2FJHA 1KB9J 4YHKH 4OZHE 3V2AR 3VGAB 3IFLH 4GBXB 5D9SB 3FQUA 1JZ6A 4CNIB 1TCRB 3T2OA 4YDIL 2WLZA 1X5KA 3EBAA 4F2MB 4KMLB 4JFOA 4X80L 1HHJA 3KJ4C 1OGAA 3V0AC 4PGBB 3X12B 4TULL 1N5YL 4KH2A 1YYML 3BEWA 4Z7UA 3EJJX 4WI9A 1DBKH 1TITA 4FQXB 3ZT7A 1AO7D 2D7TL 2JB6B 3G6AB 1IKFH 2H26B 5I8OH 4MNGA 3UTPD 5JR1H 1FO0H 5KVEH 1NJ9B 1D5ZB 4X5XA 2F19L 2PXYD 1QKZL 4KPHL 5DZNA 2YKLH 3K2UL 5DD6B 1P4LA 3T3PF 1CXEA 2ZUTA 3GMNA 4WCYL 2G75B 1P7QB 2GQHA 4G9FE 4X4YA 1T1WA 2VLJE 2XA8L 2AJXH 5KSBE 2WW8A 3B5TA 2VQUA 3U9UA 3CK0L 4BQ6A 2ZPKL 4DQOL 3LY6A 5LGHH 2PXYC 1P9MC 2I24N 3S8WA 1JPTL 4FTVE 5IEHA 4H0HB 1AQDA 2P8MA 1AXIB 1MCNA 4YGVA 2Q8AL 2A77L 3LHPH 1QRND 1J11A 4MAYA 4JO1L 1EA9C 1FLRL 5TPWL 1NCWL 3BW9A 5IJVA 2AJYH 1T1ZB 4LLWB 4S1DD 1E6OH 4H1LA 3OB0K 1R6VA 4Z95H 5IUSA 4NO3A 4Y4HB 3KNBA 4OZHA 2YUXA 3D69B 4JHZA 2ZSWB 1JVKA 4HZLA 3GM0A 4JDVB 4EI5B 1I9IL 2IBBA 2DQHH 4HFWB 2VAAA 4I5BA 1DVFB 3ARRA 4S1DC 5HY9B 4AIZB 2NY3B 2FJHB 2GSIA 1F6LL 4AL8H 4LCWD 4UIKL 3GHBH 1BD2B 3FQUB 1CT8B 2CLRA 3DGCR 3LDBC 2LVEA 2I26N 1T03H 1JCKA 1X9QA 3FQTA 4I3SH 1SYSA 2KUTA 3GSOA 5HGHB 5K9JH 5LXGH 3GI8L 3SKNA 4JFOB 2I5YH 4ONHA 4I13B 1QBAA 3E8UL 4Z7UB 3DVIA 3V52L 4ZFOB 1Q9KA 3MV9D 2GSGA 5DRWA 3CZJA 4R0LC 1NAMA 4G9FA 4LKXA 4DCQA 3VD4A 4MNGB 3EDJA 4X6FB 5KSBA 2BXYA 4F9PA 3N06B 4I0PD 1X5YA 3TV3L 3ZSSA 1HQRA 5KS9E 5CJOH 3CXDL 4OD2B 1G6RA 4YEEA 4JKKA 2ARWA 4HC1L 1B2WL 4OCRH 1KC5L 2F74A 4FTVA 3GMNB 4P59H 4LGSB 4HFUL 5GGVL 4X4YB 1T1WB 1A5FL 4ZOBA 2FZ3A 1NDGA 3CDGA 3S37X 2BVPA 4NIKB 1NGPL 3ULUD 4LARL 2NYYD 4I0PC 3CJJA 1CIUA 1JHLL 4HQQH 4L8SA 1FVDA 3UMTA 2WINB 3P40A 5IEHB 5E5MA 1AQDB 2P8MB 1FIGH 2ADFH 4MA7L 5D6CA 1UXWA 5C8JA 2E7CA 4YGVB 4XCEB 1UQSA 1KTDA 6FABL 1SBSH 4U6YA 3U7WL 2QQKH 3DV6A 4MAYB 3MOBL 1MFAH 5IESH 2EDQA 3GSUA 1MNUH 3ULUC 2NYYC 5IJVB 1DR9A 5BOPA 2HTKD 3FMGL 4IOFD 5GZOD 4U6XA 3EO9L 3IJHA 4I48B 5I8CA 4IRZH 1GHFH 3HB3D 4H1LB 3K2MC 4NO3B 2YZ1A 3GFUA 3KNBB 3CFDA 1ZT1A 3IJYA 1T6WA 3HCVA 3MV01 3FO0H 1R24A 4HZLB 5CMAA 5DD3H 5I6XB 2VAAB 4I5BB 3VFRA 2HTKC 4IOFC 5GZOC 1BJ1J 4Z8FH 4G6ML 2GSIB 3HB3C 2AV7A 1JGVL 3CPLA 3ZTNL 3RHWK 2CLRB 1UC6A 2D0GA 3FQTB 1CZ8H 3O4LE 3R1GH 1SYSB 2NY1B 4JFDE 3SKNB 4Z18A 1URLA 4MD0B 2FGWH 4ONHB 3I75A 5D93C 3HZKA 2K7QA 2X9XA 2R1WA 4M93C 5C0FA 5CEZE 1Q9KB 4XP6H 2GSGB 3MLZH 4LDOB 3TN0A 1F8TL 2FD6L 2WAHA 2OX5A 4G9FB 4LKXB 3GKZA 4DCQB 5GGRA 5KSBB 1EZVX 5DQDL 3MLWH 2GTWA 3MV7D 4GLRH 1HQRB 4M6AA 1FVCB 2OJZL 1G6RB 1MPAL 3KAAA 5CILL 4P3DA 1IAMA 4YWGL 3MLXL 1KBGL 2J1KA 1HWGB 1ACYL 1EGJH 2P7TA 1NDGB 4XCFH 2V7NA 3QXAA 4K3GA 4WFFE 2N4IA 5DMYA 3VXMD 4PR5A 3V6OC 1OCWH 4Z7OE 1MHHA 2XYCA 2XG4A 1LO0H 4L8SB 1FVDB 3FO9A 1A6UH 2DJUA 5FECA 1AQKL 3WJJC 2E9JA 3MA7A 1LVEA 5E5MB 4K3EL 3W81A 5D6CB 4MWFA 4XP9L 3MJ7A 1J05A 2X4OA 5IVXE 1UQSB 3QEQA 2HVKA 4WFGD 1KCRL 4U6YB 4XNUH 5HPMA 3DV6B 4MNQD 2X4UA 1U8NA 3NFSL 3GSUB 1MQ8A 3MJ9L 1K5NA 4KTEH 2XTJE 4R9HA 5E7FA 4U6XB 3ULVE 5I8CB 3ABZA 3ARTA 1MI5E 1BOGA 3P30H 3TWCH 1ODAA 3VDCA 5CUSH 4P3WA 1D5IL 1PZ5A 3CFDB 1MCWM 1ZT1B 3IJYB 3HCVB 1EFQA 5GRYA 1R24B 4B5EA 5JW4M 2E9IA 2H1PH 5CMAB 2YD6A 4KAQH 5HDQL 3O4LA 3DPBA 4ZSOE 1XFPA 1R5WA 4Y0GA 3BPLC 2FCBA 3VFRB 4DW2L 4JFDA 2EDTA 3K0WA 2F5AH 5TDOA 2P43B 4OLWH 5DEZA 3MRPB 3BSZH 4YZFF 2AV7B 4QHMA 3CPLB 1UCBL 3CVIL 1HIMH 3TH3T 3C6LA 1KIRA 1N6QL 5IFAL 5GGTH 3SO5A 4KRMB 2JIXB 3ZSTA 3C09B 5D8JH 3PL6A 3I75B 4XTRD 1RUAH 1T7YA 3HZKB 2C7UA 2R0LL 2R1WB 2KQNA 4O4YL 3FB8B 5JXED 4UIMA 2AEIT 2BNRB 5DWUL 4OLVL 1H9VA 3NCMA 3K4AA 1PQZA 4JREC 1CICD 5GGRB 3T8XB 2GTWB 4YDJB 4XPHL 1JMZA 4LPVA 4OIBA 1NUDA 5F88A 4HJJH 4DKEH 4XTRC 1HCVA 3BZDA 5FHBL 3IGAA 5DLML 2W91A 3N9GH 5JXEC 5FFLA 1BQLL 2EZ0D 3V4UL 2P7TB 3MLSH 4KHTH 2V7NB 1CICC 4ZODA 4PR5B 1MHHB 1R3IH 3T0VA 2PKDA 3DX9A 3FO9B 3VRIB 1SYVA 2P8LA 5FECB 3MCLL 2EH7H 4MWFB 3MJ7B 4W68A 4L9DA 4Y5XA 2X4OB 4NGHL 2EZ0C 1GGYA 3QEQB 1MI5A 2HVKB 4Y4FC 4LCIL 4BSJA 3WN5A 1OAKL 3P0YH 3OJ2C 2XRAL 5HPMB 1EEZA 4Z7VE 2X4UB 3AY4C 2R23A 1U8NB 2OMNA 3QRGH 4M1DL 1K5NB 5KAQG 1X4ZA 1FH5L 1MCQA 2VWEE 4ZSOA 3WLBA 1LMKA 3CDFA 5J4MA 1BOGB 3Q5YA 3SE3C 5E08L 2YA0A 4J6RL 4M7LL 1A4JB 1PZ5B 2EDNA 4MS8D 1N0XH 3O4LB 4HXAL 4RSVA 2QQNH 1R5WB 4JY5L 4JFDB 5TDOB 4XX1E 2HFTA 1WAAE 4QHMB 3OJMB 3UPAA 4KRPB 4JKLA 1YY8A 3MACL 3WCYA 3C6LB 3H3PL 1KIRB 4MA3A 4OLYL 2OL3H 4MS8C 1FZJA 5LCVL 1KCVL 4QEGA 4OAWB 2IG2H 4IS6B 3VW3L 3PL6B 1M6OA 5I15L 4NT6A 1DQDL 4XVUD 5CJQH 1H8OA 2Q6WB 2CLVA 2C7UB 5T3XL 3LEYL 1KLGA 4UIMB 4PRPB 2CR3A 1PDKA 1PQZB 5HI5D 3WIIL 5K93A 1WK0A 3K8LA 3VDBA 1D5BB 2HFGH 5GS0L 5F88B 3LMJL 4XVUC 1DQMH 4N1HB 1A8JH 3VH8A 1CGYA 4FXKB 2M8XA 2Q76A 5IG7A 1I1YA 4FQLL 2ICEA 2WK2A 1A1NA 2AERT 3IU4H 3PV7A 3GMPA 4U1JB 5HI5C 4W6XB 4B53A 3QUYA 3SDDD 3MV8E 1CFTA 2HLFD 4HHAB 1QRKA 4Z7VA 1WBZB 2FLBT 5K9QI 3DX9B 3SDCB 2P8LB 2XTJB 2CD0A 4M7ZB 2YC1A 3WS3B 3V7AG 1MI5B 2WBJD 3WN5B 1EEZB 5HVGB 2XY2A 2R23B 4JM4H 3SDDC 2HLFC 3ME0A 5CCKH 3PP4L 4ZSOB 3T2NL 3WLBB 5GXBB 3UPRA 1IAIH 2GKIA 4I3RL 2GW5A 1WAAA 3WNPA 3ZT5A 1O7VA 5D1QA 4U2YA 2BNQE 4Q7DA 2VZ3A 3L5WA 1B6UA 2IAMA 4IJ3B 4CVWA 5MI0C 3SKMA 3Q5TA 3IDMA 4OFIA 1XGYL 1JPFA 4TVPH 3WHE0 5IT2H 1E4XL 4KK9D 1YY8B 4ODVH 4AIOA 4F57H 4XP4H 3MCKA 3TIEA 4GMSL 3ZYOA 1MELA 4MA3B 4RFOL 5HDBF 3V6ZA 1FZJB 3WIHA 3WJLC 4N8VA 1LO3H 1M6OB 4KQ3H 3QXUA 4NT6B 2CLVB 5CAYB 3OR7B 1NBQA 3ARZA 1JPGA 1ZLSH 4MA1B 4L8CA 1KLGB 5F1IA 4KK9C 3T0EE 1QFHA 3U83A 1PKOA 2RB8A 3L5XL 5JW3H 1ADQL 1IGIH 4E42A 3HI6H 3HAEG 3QXTA 4CW1A 5D2NE 2EDKA 2O5YH 4ZG1A 5JNYA 5EOCL 3MV8A 2IAND 2XICA 1YYLL 3HG1D 3PGFL 2O5ZH 2MWCA 2VDRL 3MMEA 4PJ8D 3NH7L 5D1XA 3GO1L 3KJ4B 2Q76B 5IG7B 2KDGA 3VD3A 5BJTA 5EH1A 3U4EA 4HWEH 3GMPB 2NY5H 1DUYB 1RQ5A 3KWWB 4LVHC 4OGZA 4PP2A 4Q0XL 3QUYB 4JR9H 1CFTB 4LFHG 4U6TA 4EOWH 3NCYP 3BP5B 4N90D 5HGDB 3RNKA 1VPOH 4PJ8C 1EAJA 2B5IC 2DI9A 4U1KA 5C0AE 2YC1B 4ZFZA 4X9IA 1MFEL 4OLUL 1S7TA 4LLAA 5DHXB 2HJKA 2EYRA 2Y9RT 3K3QA 3MV9A 3BKML 5ELIA 1WTGT 2BNQA 5MERA 4NNPH 3BPOC 2YD8A 3NMEA 5ENWA 1UJ3C 2FL5A 5CLTA 4D9RD 1FSKC 1E28A 2E6JA 3DUSA 4YR6A 1A64A 4IIQC 1DBJH 1UM4L 2ZG3A 2F53D 2JCCF 4LPCA 3SKMB 4H25A 4PJGF 3IDMB 1JPFB 3RPIB 2B0SH 5ALBL 4OGYH 4LNRA 2ZUQC 4LNVA 5L7XH 3MCKB 32C2A 3TIEB 3T0EA 5JHLL 2Q7NA 3MNWB 4X7CC 3NOIA 5A40E 4UQ2B 3O3AA 1JBJA 3CVHL 4N8VB 3KPQA 3FRUA 2W92A 4NBYB 1NCTA 4R26L 1C1EL 5D2NA 3U46A 5C0RH 2AXHA 3N1GC 4K7PH 1JPGB 2DL2A 3GBMH 4KK5D 3RGVD 4J3OC 4UI2A 2X1WL 4L8CB 4I9WE 5F1IB 1FP5A 1CLYH 2NXZB 4QHNA 1WBXA 3ECBB 2BVQA 4E42B 3RIFF 4CW1B 5JNYB 3HNVH 3LDBB 3UJIH 1MF2H 1CD0A 4M43H 3MV8B 3WDHA 2HT3D 2ED7A 5KVDH 1ORSA 2FJFA 5L8LB 3MMEB 3O6FA 1BZ9B 4KK5C 4RAVA 3RGVC 3EYFA 5E4EC 5D1XB 1QG3A 3I85A 3MRIA 3HPLA 4LQ1A 2Z8RA 3KXFE 4QXUL 5C0AA 3S3JA 3TYGH 4Y4KA 3U4EB 4LSSH 1GL4B 5I1IH 4LCWB 2MFNA 1Q0XH 4PP2B 1IBGL 4X9HA 2Z9TA 3P0VH 4WDIA 1CE1L 2XZAH 4G6KH 3VXUE 2YA2A 1DBAL 4OIAA 5C0CE 2HT3C 5BV7L 4L4TD 4AIXA 1J7VR 4GQ9H 3NCCB 4G42B 3RNKB 1RIUL 4U1KB 4ZFZB 4P9HH 1S78D 5FYLE 1S7TB 2GCYA 2XZQL 4QRTA 2V5SA 4XPBL 4N0YL 3H9HA 4O02H 2HJKB 2EO1A 2EYRB 3D39E 3LKQA 1FNFA 4NC0B 4KRNA 1UWGL 3MV9B 4WFHD 1A7RH 5MERB 2R0KL 2HRLA 2ZCHL 4K94C 5ENWB 1EAPA 3ZKQD 4I18A 3P11H 4WNQB 4KWUA 3MLYL 2XKSA 1E28B 4IRSA 1GGIL 5IFHL 1S78C 2YUVA 1DL7H 4JY4A 1C5CL 2AJSL 4PPTA 4YR6B 2PW2B 2CKBL 5D7LE 1IT9H 4FQCH 4TSBH 3O45A 3EJZD 3QDHA 3P9WB 1ZT4B 1ED3A 3NA4A 3VFWA 3WXVL 2DIJA 4H25B 3AB0C 2AGJH 4PJHA 1QBLL 4LNRB 3SPVA 4D2NA 2A38A 2NZIA 2VR5A 1CD8A 4PYHA 4KDWA 3T0EB 4AMKL 5E5UB 2F54E 3RBGA 3O3AB 4EBQL 3EJZC 1MCLA 3B2VH 3T09A 5F7WC 3KPQB 3IXTA 3FRUB 3U46B 3MUHL 2QJDA 3MLVL 5BVJA 1JJUA 3D48R 4HLZH 4I3GA 4PJEF 4QHNB 3D0LB 3F7YA 1TQBC 1WBXB 3KXFA 4LSTH 2BVQB 5C9KA 2FBJH 2VKWA 4MJIA 3SO3C 3VXUA 3O0RL 1ORSB 2FJFB 2E27L 3O6FB 4RAVB 1T5WA 3EYFB 4XPFL 2DQCL 1SY6H 3DECA 2X4SB 5D93B 5IGXL 1JHTA 3HPLB 3MRIB 3T3ME 4B7LA 4Y4KB 5FYJH 3QZWG 3ZE1F 4EDWH 5A16A 4WDIB 5I1EL 4OFPA 2W9EH 1MJ8L 3D39A 4WIQA 5I18H 1U41A 1OM3H 1GAFH 2FATH 3GRWL 2GCYB 2ITCA 4QRTB 3WYRA 5L6YL 3H9HB 4YQXL 5E99H 1T0NA 1WWBX 3WDIA 3LKQB 4PJIE 1CI5A 1ZS8B 3AS0A 5D7LA 3D9AH 3FQNB 4CVXA 1AXSB 4ETYA 5KVFH 1VACB 1EAPB 4I18B 1CICA 1PY4A 2RAMA 3MV7B 1NBZA 1R3HA 2R29L 1AJ7H 5FGSA 4IRSB 5GRJH 3RKDD 2APTA 1PVHA 4JY4B 4ODSH 5GS0C 4MSWB 4WU7A 3GMQA 4P3CH 3O45B 3SQOL 4NQTA 2F54A 1ED3B 3VFWB 1TETL 2QSCH 2VXQL 4OQ1A 2A1WH 4Y4FA 5EUKA 1EVTC 5JQHC 1YQVH 3VXMB 4PJHB 4LRNL 5HTSA 3PWPD 4GG6F 4RWHA 3O2DH 3SPVB 3WNMA 2X42A 4JFFE 4QHKJ 3RKDC 4IBLT 3WFBL 4TN9A 5F9OL 2J5LB 3SE3A 1SVCP 1LDPH 3IXTB 1EX0A 4Q58C 3L3IA 5KANG 2C3XA 3NCEB 3S88L 1MH5A 3VJ6A 4WTZA 5GIRB 1QNZH 1G7PA 3BX7C 2ZSVB 5BVJB 3FT3A 5GS2D 3WUZA 3ARBA 3GSWA 1TPXC 3F7YB 1Q0YH 5I75C 4Z7QF 1UZ8A 3FTGA 4OB5L 4Y1AD 3KXFB 5T1LA 1OP5H 1ND0B 2Y07H 4MJIB 1JNLH 4U2ZA 1UACH 3VXUB 2X4RB 1MUJB 2EC9T 4K71B 4UT7L 4WTWA 5TF0A 1T5WB 4PJDE 5BOZG 1JHTB 4O9HH 5FGBC 4EN3A 3QDGD 5GQBA 1DLHA 4R4FL 2B7DT 4YPGA 5A16B 3D39B 4PJIA 1HKLL 5F9WB 5IQ9A 4EXKA 4U1LA 1S7QA 3CGTA 4JREB 1L0XA 2ORBH 1CDJA 4NZJA 2FHBA 1RHHA 3WUWA 1GGCL 3G08B 1MEXH 5KSVA 2ITCB 2UY7A 4OF8A 1PLGH 2M2DA 1T0NB 5CZKA 5B8CC 4CVXB 1NPUA 3BIBX 3RVXD 3BJ91 1T7VA 5C08E 1RZ7H 1CICB 5C2UB 4BKLA 4PGZA 3VH8G 4GW4B 4KKCD 1U3HD 1T2JA 5TJWK 5DHYA 1R3HB 3W82A 1T7XA 3VXRD 1RZKC 3WHXA 3ARED 5I1CH 1EHNA 1MAML 4WU7B 3GMQB 4JFFA 2XNAA 2FWOA 3DUUA 3MRCA 2F54B 5HHPA 5DT1L 1TDQA 1DCLA 3O8XD 4RMQA 4Y4FB 3VGGA 5EUKB 3ULUF 3RVXC 3QDJD 1IC4H 3P4MA 3X3GL 3EYOA 5E5RB 4XMLH 1T1YB 4KKCC 1U3HC 3MA9L 3BN3B 5DUPL 3AREC 1CF8H 1JGDB 1RIVH 3QH3A 4JPKL 4OCWH 4HXBL 1LNUA 1S9WA 1OP9A 5EORL 4J7RA 4HULB 4PJ7F 1JNNL 3VA6A 1L9NA 1YQ2A 1H15A 3G6JF 3O8XC 3DJ9A 3BGAA 1GYAA 4W4OC 4KTDL 5JOPE 1MH5B 4M4PA 3VJ6B 2RQ8A 4M6ML 3NCJH 1G7PB 4JLRB 1KSRA 1RFDL 2NTFA 4RNRB 3FT3B 3ARBB 4PJDA 1KJVA 1J12A 4OD1L 3WKML 4F37K 4EIGB 1UZ8B 3FTGB 5T1LB 3PUCA 1HK6A 3OB0H 2VDKL 4QOKD 3SDAD 4LSUH 3KPNA 2RGSA 2VDQH 4FQIL 4K7FA 4BQ8A 1UEYA 2NNAA 1OQOA 5I1DA 3RL2A 2GUOA 1SQ2N 1CLCA 5KSAD 1QSZA 5DJYA 4M3JA 1DLHB 4L3CA 1WZ1L 4PLKD 3SDAC 1ZVSB 4PJIB 5DRNA 1QFWH 4LPUA 5IQ9B 1MWAA 2NY4D 1N0LA 2F8XC 5E6IC 5DEGA 1XR8A 5F7FA 1UM5H 3T4AA 2X41A 5E2VL 2DM2A 1RHHB 1FNLA 3WUWB 3ARWA 5KSAC 4Z7WF 1JE6A 4A2LA 4NJ9L 1HSBA 4PLKC 2XWBA 2ERJC 3QQ9C 5JQ6L 2QHRL 2VLKD 3L3JA 2NY4C 2MPAH 5ITBH 4BKLB 4RGMC 4F80A 1HNGA 1JNHA 2VDNH 5DHYB 4U1HB 5I76A 4NZUL 1JGLL 3WHXB 4ETQA 4UDUA 2PR4L 4JFFB 4JDTL 1NAKH 5FUOL 2YUWA 4DZBA 2W60B 1F6FB 2XNAB 3DUUB 2OBGA 3MRCB 2NY0D 2Y25A 5HHPB 3RAJH 4LQFH 3OGCA 3P4NA 3UPCA 1BOYA 4GKZA 4U1NB 1A7QL 3P4MB 3EYOB 3UC0L 3V5DA 3DHJA 4PB9H 4PJ5D 1FGNH 3RWCB 1IGFH 3OAUL 1AFVL 4YUEL 3QH3B 4DN3H 5BV7C 3BH9A 4HWZA 1S9WB 4Y5YC 2NY0C 4I77L 3RDTA 2AJVL 3GJEB 4NQED 5IB3A 2BOBA 3B6SA 1N8ZA 4P2OA 2DWEA 4D9QD 3JVGA 4NN7C 2X05A 2OK0H 2NTFB 4PJDB