3WS3B

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 16
structure length 100
sequence length 100
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3B00
3A6BH 1QQDB 1H3TA 5DRWA 4CNIA 4OV5B 5E2JA 2DYPA 3I50L 4CN1A 1NFDA 5C0RH 1M7DA 2XICA 1Q94A 3MLRH 4IJ3B 1CIUA 1YEKL 4G8FA 3MFFB 4B41A 5TF1H 5K9JH 4M7JH 4JPVH 3N06B 4OLXL 4I1NB 1HSBA 5ETUA 1ZK9A 3DGGB 1ZLVK 2R8SH 3ZT5A 2CKBA 3B43A 1ZHBB 2NY7L 2JTDA 4KTEH 2ITCA 3DROB 3SOBL 5CMAB 2AJZA 2B39A 4X6CA 1XAUA 2D3VA 2NX5E 3DMMC 1MFAL 2PR4H 3GSVA 3AMLA 5CGMA 4OZIB 4H8WC 5B3NA 1EUUA 5HYIA 3CFEA 4RGNC 4TTGA 2VLRD 4NHCL 3ARTA 2YZ1A 1HYSC 2BFVL 1T89A 2FGWL 4J3XA 3GSRA 4G8EB 2PO6D 4NUJA 3BPCB 5CEXB 1G7LA 4ZNEA 3JV0A 4ZPTA 3PDOB 4M93C 4PGCB 3QUML 2XZQL 3WFHB 4YK4C 5BS0E 3O8XC 3KLDA 3DIFB 5HGDA 1R5VB 5D1XD 3QQ4B 3DUUB 3O11B 5C71A 1VCAA 5IG7A 2XTJE 1BFVL 2HFFA 1NGYA 3PF2A 2GCYB 2X4SA 3U4BH 1IGMH 1L9NA 1XGPB 4MXVE 3PP4L 4M1CD 3O9WC 4CADA 5GRVL 1P7KA 1D7FA 4I0CC 1YECH 4EBQH 2C5DC 5HDQL 1KT2A 5I71B 3QDGD 4RCAA 5DURD 1PZ5B 1UZ8B 2HRPL 4NQCE 1NSNL 2PKDA 4DW2L 3T8XB 1W0WB 1EK3A 2R0WL 5TFSH 3S3SA 1Q0XH 4QHNA 5GSVB 4G43B 4PTTB 3ZSSA 8FABB 3UYOD 3D9AL 4ZQKA 2AKRA 2DI9A 4UQ2A 4JZJA 1KJ2A 3VFRA 3MLTB 4KUCF 3TBYB 5HI5C 4UV7H 3O3DB 5CSBA 5D7LE 5KS9F 3DX9B 3TA3B 2FNBA 3EFFB 1IM9B 4ELMA 3BKCH 4U3HA 3MLXH 2WBJD 3P2TA 3PL6C 5T1MA 4G9FD 4YGVB 3VJ6B 4BH7A 3PNWA 5D1XA 4MS8C 1F6AB 3O2DH 4PTUA 4PUBL 4CU8A 3R4DA 1KSRA 2JCCE 1KG0A 3CFCL 1A5FL 5T1DL 3NPSC 4Y2DC 1Y6MR 3ZKQD 4KVCL 1D6VH 4NRYA 5HGDB 1FPTL 4J3SA 3W9DA 1QSFB 4UB0H 3H3KA 5BZDB 4PGBA 1EEYB 4X7CC 5FUOL 3W0WA 5HPOA 3JBG7 3MREB 4R3SB 1N6QH 3QAZB 4G7VH 3JTSA 2F53B 5IJKA 4LHUD 2VRAA 4PJEF 2AJXH 4MAYD 4G7VL 3TF7C 1E4XL 2GAZB 5CIPB 1VEOA 3QCTH 4OCLC 4IHOA 3OZ9L 2X4QB 1R5WB 1GGUA 2ATPA 2XA3A 3LH2H 4LHUG 3QZWB 4OFYA 3MZGB 4Y19D 1I7TA 4ALAL 5F7EL 1PVHA 4X6DE 4L3CA 3I3DA 1AQKL 2Y9RT 2X89A 3RDTC 4QRUB 2YN5A 5GHWH 4R96B 3SBWC 5FGBA 1AQKH 3BQUB 1LQSR 1D5MB 2GITB 3HS0A 4JG0H 3D39D 1NQBA 3NFSH 1N6UA 1AH1A 3O6LH 3D0LA 4X6FA 4Q58C 3H9HB 1B0RA 1Z2KA 2D9QB 3OXRA 3JTTB 1MCCA 1OAZL 3KPLA 3MV9E 3PGDB 3QDMA 1UKQA 5IV2B 1T1YB 1UEMA 4BZ2H 5I30H 2VH5L 3HZKB 1RU9L 1SBSL 4TNWF 43C9B 1AGFB 4LSSH 2IAMA 4N9GA 5LWYL 3U4EB 4FQIL 3BPOB 3CSGA 4OZGB 2P5EA 4I0PC 1CK0H 4WUKH 3ES6A 3VGHA 1JHLL 4X7TA 3E6HA 5TDPB 4WW1A 4AG4H 4LCIL 2JCCA 1P6AB 3C2AH 2VLLA 3QCUL 3MRPB 4P9HC 4WWKD 1GAFH 3VFWB 1X5JA 4YWGL 4LRNL 4NO5A 1IL1A 2LU7A 4HJJL 5IFAH 4UT6L 4MYWB 2BDNL 1GZQB 3FFCD 1MRCH 5EN2A 1ND0B 1MFBH 4OAWA 1ADQH 2YBRB 4MJ5A 3WHE1 4WFEE 2PTTA 2ZUXA 4OUUB 1IFHH 1I7ZA 3QDJB 3STBA 3HAEB 1KB9J 3HHRB 4JRXE 3R06A 1CQYA 1FNEA 1PY9A 3CNKA 4HV8A 3WXVL 2G75B 5IR1A 4YE4L 3KPOB 2BVTA 4OLWH 1M6OA 4XNQB 2PYEE 2D4FA 1TZIA 4PRHA 5E94A 2ADJB 3RKDC 4D0CB 1OARL 3EOBB 4J4PC 4NQXA 3SJVE 2HG5A 4RDQF 2IH3B 4PJ8D 5HGBB 5AAMA 1E27B 3W5MA 3D0VB 5GJTH 4M3KB 4DUWA 2C1OB 3FB8A 1R3JB 2NMSA 3RWDA 4Z7VA 3SKJL 2UWEB 3LDBC 5JNYB 2EZ0D 3CMOH 2QSTA 3BEWA 3BQUD 2R4RL 4I0PB 3QUZB 4M8QA 4GQPH 1JTOA 4P5KB 3UYRH 2E3VA 3OAYK 4WI4A 4M1DH 3BH9B 4O00A 1F4YL 3C5JA 3AM8A 1DQMH 2LVCA 3A6CH 3MNVA 2EKSB 4H88H 1NC2A 3OJDB 1QEWB 3VWKA 1TJIH 3ZTJH 1D5BB 1U0QA 2CDEB 1IAIH 1FO0A 3IXAB 4Y5VC 4IRSC 4TUJB 2PXYC 3CFBB 2B1HL 4UTAH 4WHCA 5KS9B 2BRRL 5KVDL 4HCRH 1D5ZB 4M7JL 5E2VL 1FLRH 5DQJA 3MGAA 1CGTA 3RGVC 5IGXL 4P4KD 3V0AC 3W39B 4F9LA 4QOKA 5IR1B 4YGAB 1K5NA 1GSMA 2OTUB 12E8H 3HRZB 1YMME 3VGDA 2OXHA 4ODHH 1EA9C 1H3XA 2GEEA 4MJID 4CRPA 5E8NB 4FFWD 2IG2H 4ONFL 3MZTA 2ICWB 4U1HB 4WO4D 1FZMB 5I18L 1E28A 2OI9C 3MRQA 4HIIA 2BJMH 1OAYL 3CH1A 4TTDD 1JHTA 2BJML 4WUUE 3CVHL 4GMTH 1RMFH 5DFWH 4M6ML 3H3PL 4QNPE 1ETZA 1DL7H 3VI3F 4KY1H 4KUZH 5GSVA 1FVDA 1T2QH 3Q1SL 2UY7A 3W2DL 4BQ9A 2AXHA 3L5XL 3C09C 2EYTA 5I73C 1FFQA 4N5UA 3EZ8A 4WV1B 5DJCA 1YY8A 3A67L 2CDGA 2NXYD 1T2JA 2BNRB 3DI2B 4K9EL 2VDLH 3V6OC 4JO1H 5DJZB 5CILL 3D48R 4L9DA 4Y5VA 4FP8H 3QNXB 5GJSL 5GS0L 4PRNB 3TVMD 1D5ZA 2BNQD 1A3RH 3HAEG 2RBLA 1EXUB 3WE6B 3V6FA 1IM3B 3IAGC 1EHLL 4MJIA 1IMHC 5T5NG 1GGCH 5KSAB 1XZ0A 3DV6B 1QFWM 1GAFL 1SM3L 4AT6B 3BKYH 4YPGA 3ULVF 1FYTB 1WITA 2H32B 2Q86B 5GGUA 2XZCL 1P5VA 2X5PA 2C9AA 4HUWA 3HI6L 1NCUA 2CLVA 4JJHA 4Y1AA 1JN6A 3PV6A 1MRCL 2ICWA 3Q6GH 3WLBA 4JFPB 5D2LF 2XG4A 3PJSB 4UOW0 4APQC 4MVBD 1AY1L 1ZANH 2AEQL 1UJ3A 4DGVH 5HHXL 5BZWB 5FYJH 1KIRA 2HJKA 1B90A 1CR9L 2Z31D 3VFSA 1QVOA 3GJEA 5HVHB 3GSNB 2X41A 2BZDA 2CUHA 1A64A 2IADA 4RRPG 3OKKA 3L5IA 5LGJB 1WAAF 1F8TH 4QYOB 2VR5A 4LHQB 3WFHA 4PLKD 2IQ9L 3EO0B 3VG0H 2V6HA 3KJ6H 4KXZH 4CU7A 4HS3A 2UV3A 3QULA 4MQ7A 4QRRB 4YDIL 4N8VB 1XF4B 2X4RB 4XCNB 4KZEL 3DOSA 4APQD 4JM4H 3MQIA 4JPKL 3ETBF 5CZKA 3G6AB 3MTRA 4HGKC 3MOQA 3ARGA 2KZ1B 1LD9B 2PTVA 5IHBA 4GAYA 3MNWA 1CLZH 2Q7YA 4Q9BA 5L8JB 2PNDA 4P5TD 5T5FH 3RKDD 1J0JA 5EPMA 3EYOA 4YHMH 3ES6B 4U3CA 4OLYL 2EO9A 5EU7C 4M1DL 1KIQB 4PJ5E 5IB3B 5HYEA 1ZTXH 4BFBD 1EGJL 3QHZH 3O2WH 4RFEA 1E4WL 2F19H 5J4MA 4E41D 1JPTL 4Z7UB 1W72H 4XVJL 1LDPH 1CU4L 4LOUD 3MLZH 4G9FE 2R29H 5FHBL 4OB5H 5FCSH 4HQQH 5E2VH 4WI8A 2V2TB 2IBBA 4XMKL 4KK5C 1DTUA 2QSCL 3WEXB 5C0EA 1LEGB 2DLFL 5I19L 4NT6B 3WFEH 4QGYA 3OAUH 4OCMC 3HE7D 1IQWH 4X6DA 3S88H 4DN3H 1JPST 1AI1H 4U6YB 1M7IB 3PWVB 2IH1A 2OL3H 1G9MH 4HKJA 3BIKB 5T1LD 3WS3A 5EUOA 3LEYH 4C55A 4S1DD 1FVCA 3K2UL 8CGTA 2J4WH 3MRDB 4MCYA 3MJ7A 5FM5O 4PLNC 6FABH 3MXVL 4HAFA 4FZ8H 1E27A 1Z5LB 3QH3B 5FYLL 2PYEB 4WO4C 5IWLC 3MXVH 4HC1H 1OAQL 1KELL 4J7RA 3K8KA 1S8DB 3UTTB 4CVWA 3D18B 4GKZB 4U6VL 2X4QA 2IPTL 1IJ9A 3EYVB 3FO9A 2HT2D 4JRXD 1LE5A 4IBLT 2WLYA 5SWSE 2LAAA 4EI6B 1HYSD 4MAYA 3TWCH 1AXIB 1BAFH 2AEIT 4KDWA 4NQSA 1JPGB 3DO3A 3EOTL 2E8YA 3ZHLA 2X1XR 1EFXA 4DK6A 2ORBH 5ELIA 5GXBB 4RQQB 2VDLL 1EO5A 4PGCA 5DJ2A 2I07B 3MYZA 3PP4H 3Q48A 3H9HA 3FFCE 4U7MA 3QQ4A 4DKAA 3U46B 1Z3GH 2RR3A 3ULUC 1UCBH 2VAJA 2DL2A 1T0MA 3DO7A 4JDZA 4U0RC 1UM6H 3TO2A 1NMCC 4JANB 1KENL 4UNTA 2LFGA 4LRIA 5JXED 1I4FA 5CFHA 3BKYL 3QUYC 4LSUL 2H32H 1QHPA 1TETH 3D87B 3EHBC 4LPVA 4XPFL 4JR9H 1DVFB 3DVNA 5TDNA 3Q5TA 5CJQL 1IAKB 4EZMA 2WK2A 2DMBA 2QLVB 2VZOA 2PYEA 4LSVH 3VA2C 1DQML 3O6MH 3TH3T 3VE0B 4DZ8B 1R24B 1QFOA 2ZUWA 8FABA 3GSWA 4J23A 2OCFD 3VMNA 2NY0C 1VFAB 3B2UC 4M62H 5TF1L 4P57B 2PXYB 1W2KT 1CTOA 1WZ1L 3SGDI 3MV01 3ZE0F 1SVCP 4LKXA 4NQDB 4P2RA 5DUML 5ANMB 2D0HA 5C0AA 1F3RB 1G7PA 3BSZL 1D6VL 1PKQA 1ZVHA 1KF9B 2Q8AH 1RJYA 3WL9B 2VAAA 3G5XA 2J1KA 4N1CA 5L2JB 1KG0B 2X89D 3U6RB 3RPIA 5DJCB 5T3XE 3VWJB 3D39A 3LHPL 2P5WA 1TVBA 1LP9F 1Q9LB 1FFNA 3IKKA 2EIDA 4ZTPL 1E6JH 4I2XE 3DGCR 4KXZI 5I17A 2FIKB 2GHWB 2K7PA 1RK1A 2CUMA 1MLBB 3MLVL 1T5WB 2AJZB 3WUZA 5KSVA 4JFHD 3QNYB 4GG8A 4H8WL 5KSAD 3I6GA 4M1GL 3T0EA 3S4SB 3T0ED 3CLFH 3DV4B 2IANE 5EU4B 5BJTA 4U6XB 4LCCC 1S7QA 4NQED 5DO2C 2AV1B 1DBJL 4RMSA 3EYQD 2BNQB 5FYKL 1FG9C 2H32A 1CDCA 2CDFB 1D9KC 3KLAA 3UJIL 4QTHB 4BSVB 1KPRA 1G9NL 3HMWL 2EDOA 1YPZE 4JO4H 2VLME 3RUGE 3MA9L 1CLYL 1N7ML 3TNNB 4KUCD 3FCTA 4YX2L 3U7YL 2EIZA 1Q9WA 4IOFC 1RPQA 3LCYA 3UTSB 5I2IB 5E9DD 1M1SA 1N0LA 2JK5B 5IMOA 3GGWA 5JPNA 3MRFB 5EC2B 2Y6SC 1KGCD 1EHXA 4QRQA 1CFQB 3LPWA 4OD1H 3U1SL 4HS3B 3GMRB 1IGTB 4QWWD 4MJ4A 2XKSA 4E0RB 3GKWL 4DQOL 2CJUH 5K33A 4K71C 5AG9A 1JPSH 3E8UL 3G6DH 3BPOC 3UEZA 5J1SC 3B83A 5GSRA 1A6AB 5F7KC 4YHNA 1LDSA 1LP9A 1CXKA 2O5ZL 3TPUA 4KZDL 4HC1A 1JHTB 4LAQH 4QHMA 3SDDB 3O4OC 4JZJB 1GGIL 4M7ZC 1INEH 4M5YH 1DVFD 5ISZD 5DC0A 1Z6JT 2HAZA 3BP4A 1BAFL 2EH8L 3DSFL 2FO4B 1WWBX 4I0KA 3CVIL 2OM5A 2UYLB 2HKFH 2OL3A 2YA0A 4PBVC 4YE4H 2IAMC 3BE1L 4OV6F 5FYLE 1F8TL 4G9DB 1KV3A 4JHAH 4PJGA 3SE3A 3VXPA 3STZA 1WBXB 2R2BB 3EFDH 1RJCA 3HAEH 5FUOH 4GW4A 3TLRA 1JFQL 4HJGA 4PGDB 5BMFL 4TSBL 5I73B 4PTTA 4XZUB 4L4VE 4Z7OF 4L9LC 3ARYA 3RBSA 1RUQH 1HHJB 4GSDH 1UWXH 5JDSA 2NXZC 4RFOH 3NACH 3V5HA 1KTLA 3FQWA 4GOSA 4WHYG 5EA0H 1BIIB 1Z9OA 3WEXA 1S9KC 5F9WB 5IESL 2EXYC 4POUB 4WJ5A 5JORB 3KPRE 3UJTL 3QJHA 1W72A 2J6EL 3NABH 1ZEAL 2ICEA 1YQVL 1QBLH 4KKAD 3D3VD 3FRUA 4PP2B 5I0ZA 1DP0A 4Z0BH 4MLSA 2ITDB 2XTJC 3C9NB 2QQKL 3MR9B 4YHOL 4Z18A 1JYXA 3UTTD 2DIJA 3SE9L 1CFNA 3HPJB 3BPNC 1ONQB 4YBLB 4LQFH 4WIQA 5I1HH 4YHNB 2F8OA 2H3NB 4TRPL 1O5DT 4OJFL 3F7VB 2VUYA 2DKSA 1QRND 3H7BB 2YD1A 3FL7A 4KVNH 4PP1C 1QSEB 4G3YL 3DUSA 3KGRA 5FKAB 2DI8A 4P3CL 2G60H 3VXRE 4G3YH 2WM0A 2FZ3B 1DN2A 5L6YH 2Y06H 3WIFA 4DN4H 2QEJA 2YUVA 4JDVA 3SQBA 2P5EB 6FABL 2YEZB 3ULUF 3WFDH 3MRMA 1J5OH 1I1CA 3KPSE 3RWGA 4KKLD 5IB4B 4PJDE 3ARDC 1I9JH 3GBMH 1MJ8H 3SKNA 2JLLA 2BNUB 3TBWB 2X4SB 4PYHA 4WFGD 1MI5D 5CP3A 3BUYB 5L7XL 2V5YA 4ZUWB 4K3GA 4UBDD 4BJLA 2VSDA 2DQHL 4PY7A 3IDJA 5IFHH 1AP2B 3SKOB 2WNGA 2OR8A 5HHOA 2PYFB 4YHIA 4NQVB 2MPAL 5CGYC 1A0QH 1K8IA 5K9OB 5IKCA 4PGEB 1H3WM 1ZHLA 5EORL 2W1NA 1DANT 1LEIB 1RIUL 2MJWA 1DQJA 2V7NB 3GMQB 4NRXB 5C0EB 3HC3L 5JW4Q 1PBYA 1SM3H 3T2NH 1X9QA 3UBXA 3F7PC 4Z0XB 5B4MD 3S3PA 3VFTB 4FNLL 3L3DB 4RBPK 1Q0XL 1BFOB 3W9EB 1FGNH 4KI5C 4Y4KD 3QWRA 1MH5B 2NYYD 4XVSL 1S78C 4UV7L 5DRXA 4XP4L 2P47B 3A6CL 2H41A 3QEQE 4YDLB 5DD0L 3I02B 2YXFA 4OLUL 1FFNB 2G75A 1R3LB 5FO9B 1C7SA 5IQ7L 4U49A 5BQ7A 1FNSL 2R2HB 3PXHA 1E4JA 3RIAK 4QHNB 3DYMA 4D0BA 5LGHH 3VFGL 1CXHA 5TH2A 5JQHC 2ZUUA 3PQYB 5CLTA 3WFBH 1C12A 2R1XA 1PYWB 3QUYD 3VWJC 4POYA 5CZXC 3CCHB 2ICCA 3IXAA 5GGTA 1JNJA 4R4FL 3D25A 3VGAB 3EO1B 2J12B 3K7UA 4DEPC 5T1MB 3QFDA 5KN5A 4PY8J 1TQBC 3QWOA 5CEYA 2O61B 3TN0D 2P8PB 4L4VB 2MCG1 1RIVH 2OJZH 1XF2A 1VACB 5FO8A 4L8BB 1RZ7L 4KROD 4QOKB 2VB5A 2VL5A 4HCRA 2VOTA 3ARBC 4LCWA 4S2SB 4XXDB 5EULV 4FRWA 4XP6L 1U3ZA 2X7LB 4JFEB 1UCTA 2FECI 5IWLA 1XF4A 3F5WB 1RZGA 1P7QA 2HLAB 3QDMB 5C6PB 2GQHA 3UBXI 4YXLL 4U6TA 3U0PB 5CD3B 2F19L 2IAMB 4QGTA 1J1OL 2AABH 1JPTH 3RU8H 1WAAA 4PG9B 3KLHD 3T0VA 2B20A 3RX7A 3TN0B 3RUGF 1CD0A 5MENE 1D6EA 3U36B 2H9GA 1X5IA 3HMXA 3CIQA 2Y5TB 5TGBB 2OK0L 1MJ7L 3DIFA 5L0QB 5ACMA 3O6FD 2FX7H 5DYOB 1I3RA 4PJIE 1ED3A 3GO1H 1OGAB 2MQCA 3CH1B 1HI6B 2GJZA 3HLAA 4KC3B 2A6JB 5EUOE 4LBEA 3NTCL 3KYNB 3WS6A 2PO6C 1CGUA 2XYCA 2X4PA 1OAUL 1I1FA 4CNIB 2YD2A 4KHXH 4OCNC 4N1HB 3K2UH 4Q6YA 5ISZB 3U9PH 4NT6A 4OSUH 1SEBA 4JVPA 5GGVH 4KDTC 3MC0A 3SDDD 4NN7B 2AERT 5J7CC 2YPKA 1MIEH 2VE6B 4AT6A 3WV0A 4FN0A 4U6VH 4H5SB 1ZANL 3M17B 1ACYH 4OZFB 3EOBA 2BNRA 1WWWX 1CDYA 4ZOAA 32C2B 2D7MA 3ULVD 1ZWIB 3L3HB 1PDKA 2Z8VC 1FZKB 3L3KA 4AH2B 4YHPA 1I1AD 3LQAC 4U6XA 4WHTB 3GMLA 3BE1H 2APFA 4MJ2A 4OLVH 1MIML 4MQXC 3CFEB 5T33H 3VFPB 4CJ1A 1HH6A 3ZE1E 3O3EA 1E4XI 1OARH 5DHXB 3SKUD 3MROB 5D71L 1UM6L 1FYTA 1GC1H 4LHJB 1EBAA 1CGSL 1HEZB 1WTLA 4LF3A 2I60L 5SWSB 5F9AC 4F9PA 4Q97A 1OVZA 5ID1B 2GUOA 3MV7D 5FYKU 5ETUB 1WZKA 2B2XH 1UM4H 1CICB 4NQDE 5ANME 1IC4H 3FMGH 4I3SL 4RNRB 1F4WH 2C1OA 1AO7E 3ARBD 5F1NA 3QDJD 1ZA3A 3KR3L 2A74A 1QBMH 1E4WH 2EYRB 4ZXBD 3OG4B 3QQ9D 4ODTH 5IF0B 3V0VB 3NH7H 5D7JA 1Y0LA 5AZ2L 1XGQB 1HHGA 2VR4A 1VFMA 3ARXA 1A7BA 4GUPB 5F3HB 5IQ9A 5TE6L 15C8H 4N9OB 5MI0C 3AM8C 3DMMB 3G5ZB 4MD4A 1IAIL 1IRAY 2W38A 3C5ZA 3LKQB 4M5ZH 4R26L 4LSDA 3T4YA 4XPAL 1S7TB 1DANU 4MSWA 4NGHL 4V1DD 5DS8B 2B1AH 1QSED 4XPAH 3QDAA 4IRJD 1GOHA 4WWKB 5IJVB 4JFQA 4TRPH 1A7OL 3FQXA 3WHXB 3BGFC 4WTZG 4DEPB 1Q72H 3RVTC 3GSWB 1A7OH 4ODHL 3RJQB 3C2SA 1ZS8A 4B53A 5CUSH 1TZHB 3HE7A 5HVGB 5LBSH 2H8PA 3KWWB 4NP4H 3WDJA 3VXTB 1I8LA 1D3CA 4N9GB 4HWBL 4AEFA 5T3ZD 3N0PB 3TJEH 4TVPL 3BP7B 3S35L 3M1BA 4FQHA 4PRBB 3QIBB 3RPKA 5F7UA 4NKQB 3BAEL 5CBEB 2NZIA 1OD9A 4NM4L 5DLMH 5C09B 1A6TB 3SDAA 1KB5B 2A6DA 5F7DA 3ZDZF 3PP3H 4X98B 1KJ2H 4TULL 1MAMH 2EDXA 2XY1A 4XBGA 4CVZA 1YUHB 4ODUA 3ARFB 3T1FB 4K7PY 3QA3A 1J0ZA 2Y4SA 3LVEA 3A67H 2F54B 1PFCA 2QHLA 4LPYA 3DV4A 5EU4A 5DFVC 1G0XA 4RFNC 2VXSH 3TH4T 4KMTH 1G9EA 4YHKH 3B2UD 2LABA 3WS6C 4OCSL 1J1PH 3MJ7B 1KXVC 4CKVX 5F1IA 1ZA6B 4PJDA 1C12B 1RFDL 1AGCA 1JYWA 1XFPA 4YXKH 1GGCL 4LCIH 1HDMB 3BP5B 1FRGL 4U1GB 1S8DA 5DA0B 4OM0H 1CZ8H 3BQUA 3ZKMC 4F7TB 2V9TA 4R90H 3HI6H 5E8DL 5AYUL 3AC0A 1MCBA 4U2YA 5D4QA 5D7IA 1JGEA 3ZZ1A 4A6YH 2Z8RA 1OQXA 1PY4A 2BNQE 4JPIA 4UUJA 3V95A 2AJSL 4G9FB 5GS0D 2WBJB 3I75B 3ARVA 3PGFL 1B4JL 4MD5B 5IVXB 3GSUA 5FGSA 1ACYL 2VZ3A 3VFGH 1AY1H 3P4MB 5HHVH 1T7WA 1BVLA 4HUXA 4WNQB 3SCMD 1BOGA 3DRQB 2DJUA 2HKHL 3IFOA 2V7HB 5E9DB 1PAMA 5C0NC 3LRSA 4J4PA 3OJDA 2L4OA 1ES0B 3Q6FB 1FO0B 5DQDH 1T0MB 5INDA 3DO7B 1J86A 1KNOB 3ZDZE 1HXMA 3QB7C 5E08H 4K94H 4MD0A 5LXGH 1A2YA 3Q0HA 4XNXH 1I4FB 3D0LB 5SX5K 1UGNA 3MX0A 5C0AE 2BY2A 2IALA 1ACZA 1U8IA 1DVFA 1N6QL 5I1JH 1TJHL 1GL4B 3KYMA 4ZXBB 1AGFA 4M02A 3RIFK 3BI9X 5EA0L 3OR7B 1H3PL 2Q6WB 3ARBB 1DQJB 1AR1C 1DBBL 1A1NB 4HV8B 3G5YA 1WT5C 2DM2A 1DSFH 1CICD 1XGYH 1X7QA 4HFWB 1BQLL 3AU1B 3WNLA 2PXYA 4V2CB 2AABL 3EYFB 3RWIA 5AZ2H 4NNPH 1V8HA 1SY6A 5FYKD 4DFIA 4X4XB 4YR6A 4M5ZL 5DMYA 4YXHL 3PWPE 1G6RH 4FQQA 4GRMA 4I5BB 4HZLA 4ZYKB 2ERJB 2OMNA 2GTZB 1CLYH 4H25A 5DJXA 3VXOB 4LEOB 1YMMA 1QFUL 4OT1L 4IOIB 3UZQA 1IGIH 3QEHA 3GNMH 3G08B 1YMHB 2GSIB 2P45B 4ETQA 2YD3A 3UTTA 4ZFOL 1QFWI 4OQTL 2FWOA 2X4TA 4HJ0C 1OP3H 5F72S 5DWUL 5E5MA 4DOHB 5GIRA 3IJYB 1JZ7A 1LP9E 4HGWB 1U3JA 4OM1L 1AXTL 4PLJC 2UWEE 3HCVB 3CFKB 1R3HA 1JPSL 4GG6E 3U82B 2CGRL 2OYPA 3B5GA 2Q7NA 3BZEB 3VCLB 2ILLA 4R2GB 3QT2A 4KY1L 3QPXL 3EOAA 3SN6N 1OWRM 3FRPG 1NGQL 4M8VA 4O2FA 1T2QL 3LEXB 1QKZH 3Q1SH 5D7IE 2VISA 2AXFA 4P5KA 4JFYB 5JW4M 1H9VA 1JUFB 1WUNT 3QJFB 1LGVA 4OQTA 4NWTH 5C7XL 1KYOJ 2LTQC 1JGUL 5C0BD 3O2VL 5J9PA 5L2KE 5CBAB 1D5MA 3O2VH 4BZ1L 1PKOA 4XXCA 3CDGA 2C3XA 5JPMB 1BZQK 5EORH 4YR6B 1P2CA 2BVPA 2H6PB 3GDBA 4YUEL 4YNYB 5B21A 1L7IL 2ATPB 3QFJB 4BK4A 2I60H 2BSED 2C26A 3VRIA 3FKUS 1YEFH 2YRLA 5TF0A 4GSDL 3TN0C 5D71H 5F93C 3D85A 1ZT4A 1JGDA 2QV2A 1BF8A 4JAMB 2YUXA 4FNLH 4NQVA 3I84A 4QY8B 4OZGF 4PJCA 2CKNA 3QXUA 4HBCL 1N0XL 4MJ6A 3NABL 1U36A 1ZLSH 3IXTA 2W59A 3L3OA 5C8JB 5JW5A 4XX1E 1I9IH 1OB1A 2ZJSL 4QF1A 1INQA 1HH9A 5DJ8A 4WFHE 4HDIB 2XT1B 5EOCH 4PRID 4WVRA 3K8LA 3MRCB 1GZPA 2NY6C 3FOMB 2W9EH 4G6JL 5T3ZL 2BOBB 4C56D 5BV7L 1ZHNA 1VHPA 4LQFL 4RDQG 4BKLB 4C56A 3LB6D 4PG2C 3NIGF 3VWJA 1XIWB 2QKIA 4MJIB 1VFUA 2IJ0C 5ITBL 4LK4A 1QTYT 3ME0A 2L7UA 1X4YA 2YK1L 3GUTB 4N90D 3D2UD 1OHQA 3RWFB 4UTBH 3L3JB 2AJUL 1KTLB 2VLKB 5D2NB 3DPBA 3QR2A 4JFZH 1OTTD 4S0SD 4XNXL 1KFAH 4NO3A 5GGRY 4KTDL 1SMAA 3TCLB 3E1F1 2FO1A 1NLDH 2Y25A 3GB7B 2Z93B 4P2OC 4NQCA 4XRCB 3M07A 4X6EA 2Z0BA 4YC2C 3QFJE 2ED9A 1RZ7H 4OAWB 1NFDF 4HKZB 3WIHL 1JYVA 1HCFX 3MLYL 3EDEA 1ZT4B 5I76B 4JKLA 1LEKA 5EUOB 2MKWA 3WFZA 3V6FB 1Q94B 2DIBA 1NCNA 3G9AB 3BH8A 1MHHA 2KH2B 3JUYA 4CN6A 2BERA 3R8BB 2UUDH 3ECBB 3RL2B 2ZSWB 3QUMH 5BRZE 1AO7A 5JZ7D 1ODAA 4J6RH 3MRKA 2HP4A 4OD2A 4X6DF 3BRGC 2QR0B 5IEHB 1HHKB 4JY5H 4UT9H 1OF2B 4JY4B 3ULUH 5IMMA 4MQTB 4X8XA 1A6WH 4Z7UF 5F6HI 1AIFA 3RWDB 1CFQA 3PL6B 5DHVB 1I85A 3DNKA 5BW7C 4IRSD 4UOJA 3PIQA 3T04D 4EBQL 3ABZA 4LOUC 3QZWA 3SDCA 3O41B 1RIUH 5J11B 2D31A 1C5BH 1EFXB 4NQTA 1RJLB 4YFLI 4LVOC 1BX2A 3KPRD 4QRPA 4AG4L 3X3GL 3KHQA 3UPAA 4PJ7E 1ZGLB 4JZNB 4RZCB 1IC1A 4ZO6A 2WBKA 4V1DA 2AI0H 4IDLA 3NMEA 3TNMA 2A6IA 1EIBA 1U8HB 1XCQB 4ZUWA 4Q2ZA 4KRPC 4N5ED 4UIKL 2VABB 3NZ8B 4L1HA 4ZAKC 3P0VH 3DX8B 3H7LA 1FYTD 2AJSH 4PJGB 1NPUA 5FYLD 1I8IA 4BUHA 5JTWA 4OZGA 1BQUA 2BOCA 4XH2A 1F58H 4TSAH 4KMLB 1P9MC 3C87A 3RDTB 3FQWB 1RZJC 1RIHL 2EXYD 2D7TH 4PLKC 2RFXB 3V8OA 3VXQA 4OLVL 3MRBB 3ZHKA 4KAQL 3RWIB 5D2LB 1JFQH 4YDIH 1UWEH 4JM2D 3I6LE 4LPXA 1CVSC 1UH3A 4L5FH 2FD6L 2GFBB 2XWTA 5MI0B 2D7QA 1WICA 4Y5VB 3JWOL 1FDLH 4B5EA 3Q5OA 5C0CB 3SDXF 4PJEB 5DTFA 1JF1A 4OZHE 3QEHB 4S1SL 2YOCA 5F7WC 3OR6A 4HUVB 1TJGL 4AEIH 4GW5B 4I9WD 4N0FA 1NDMB 1TETL 3H3BC 3T2OA 1YEIH 5FDWB 4Z78B 4RZCA 1MCKA 5BXFB 1RURL 5CP7A 5E5MB 4Z0BL 1MCFA 3N1PC 3FONB 2FBJH 3HNSH 4KKBD 35C8L 1JTPA 2YD9A 1JNNL 4DTGL 4YXHH 1UFUA 3PWLA 4RSVA 2WINB 4MA3A 3WLBB 5CJOH 5IVXE 3T0WA 5BOPA 2VDML 4ZFFA 5LKNA 3WLWD 3ZT6A 4OT1H 2B1AL 1MJ7H 2BC4A 2J5LB 4JDVB 2NXYC 1XGUA 3MLUH 3HTLX 4OB5L 1KBGL 1CD8A 4KVNL 4PJ9C 2PF6A 4Y16D 1EVTC 2YD6A 5CUSL 4D9RE 1XEDA 1HQRB 2DBLL 1J05A 2X7LA 4N0CD 3LQAL 2Y5TA 1QSFD 1FORH 3DVFA 5JMRA 1G9ML 4N0CC 4Z7QE 5CEXA 4WEUD 1LO3H 2I07A 4G6KL 4M4RA 3HB3C 4OF8A 4UDUB 3QEQB 2F54E 3ZE2F 4NQXB 1OAQH 1AHWA 4HJJH 1JF5A 2CIKB 5AUMA 1U8KA 2C4XA 5DRZB 2CO6B 3QYCA 5ALCL 5D7JC 1TXKA 3WDIA 1J87A 1W0YT 4I0PD 2HN7A 4MCZA 5EU6D 2NW2A 3U2SA 4GS7B 4LEXL 3KDMB 2FH6A 3N1MC 4P59H 5E00B 3JXAA 5DFTA 3ARGD 2R69L 4G8GE 4RFEB 5I0DA 3CXDL 4X4YB 2G9HA 3C5JB 4JLRB 3RI5K 1BFVH 1U8QB 4NZRL 5GJSH 5GS0H 4D9LL 5DURB 3IT8D 5I1GL 4YQXL 4FQXC 4R9HA 3E2HC 3MJ6A 4GKNA 3O0RL 4K07A 3W9EA 1R5WA 5FGCE 4BSJA 4AEEA 4X0KA 5D5MA 3UYPA 1LEGA 4P2RB 4WFFE 3QDME 4L8DA 1U8MA 1WV7T 2KPNA 4PPTA 4EDWH 4D0BB 5D1XB 5E2UH 5C0DA 3ZYOA 4XVSH 1ZLSL 2V5RA 1S5HA 4MAYC 3OJVC 2R1XB 2YC1A 5DUBA 1JIBA 3MBXL 5MEQA 1X44A 3THML 3JSSA 3RRQA 3L1OL 5JIPA 1PW3A 3C8HA 3JV4A 5IUSA 3H0TB 4U4BA 4LLMB 4ZAKD 3P30H 1RZ8A 4HCRL 4N5EC 5KVEL 4M7ZB 1EXUA 3O4LD 1BIHA 4PS4H 3WJJC 3RGVD 2CIIA 3RGVA 3VXSB 4XAKE 2MCPL 4H1LB 2MTPA 3Q3GB 1X5AA 1F45A 3NBNA 1CDUA 1UZ6F 2PXYD 4BH8B 4XHJC 4L8SA 4Y5YC 2VLRE 3H42H 3C6SA 2HLAA 2DQUL 1P84J 2VITA 1OF2A 1TZGH 1FNGB 1K8DB 3R0MA 1H0DA 2EYRA 2NXZB 1EBPA 1JPFB 3BAEH 2R0LL 5D5MB 2R0KH 5IVOA 4X8JB 4ZFZB 1U58B 3BYYA 5E2TL 4OV5A 4PR5B 2MQ0A 2P8PA 2XA8H 1TFHA 3EKCA 5GRUL 4PD4J 1VFBA 1T3FB 3F58L 3OF6D 1RZIB 1DBJH 1RUPH 5TJWK 4O58H 2KL6A 4NNPL 3FHAA 3O6KL 4XCEA 2NX5A 4KDVA 4K7PX 1RVFL 3BKML 1MCIA 3NZ8A 3TPKA 1VESA 5CSZB 4K3JL 2HT4D 3GK8H 1QUNA 4NPYB 4GRLC 1FYHB 4JHBA 5I1CL 4Z95L 5F9JA 5FA3A 1A6WL 3B9KB 4ELMF 4XMLL 3NA9L 3CJJA 4FFZH 4AK1A 3LKPA 4FQIH 4OZFH 5LQBH 1M05B 1R0AL 2D4DA 1JZ6A 1MQKH 3UBXG 1VADB 4XVUD 5J6HA 1VGEH 1PKQB 5JHDD 3QI9A 4ONHA 1YN6B 3LOWA 4L29A 1IM9D 1X5FA 1GJIA 2X4UA 1WT5A 4NO0B 1SYVB 3MJ9L 1N5AB 1FNGA 3GMQA 3OV6A 4NRXA 5KG9B 1MHEA 3MA7A 1WK0A 4N8VA 3DMMD 3AVEA 2BFVH 4WHTA 4OF5A 3JV6A 2EDFA 3GKWH 4WI7A 4R0LC 5JO5A 1AGDA 4YDJB 2E9IA 2ARJQ 4D8PB 3HC0B 5EIVA 2OTPA 5DQJB 4MA8H 3QUXD 1FSKB 4Y5XB 4Y4HD 1SVZA 2HKHH 4MA7H 3EYOB 3ZKSD 2AS5M 4X6DB 1HEZA 1MFCL 2NZ9C 3JWDH 3QDGB 4XX1G 1G7JA 2FEDC 3I3BA 4I48A 4JHAL 4MNHA 3EDFA 1IQDB 2AXGB 4XWOC 2ATKB 3DSNA 4KQ4L 5DK3A 2J8UA 4R8WH 2V2WB 2V5TA 5H2BA 2V7HA 3RI5F 5C0FA 3SKMA 5M7QA 2BVQA 4O02L 1Q0YH 3RNKA 3RTQA 1GHFL 4CMHC 4NQEA 1A14H 3TBSA 4TQEH 3HNVL 3PL6D 4D9QE 3JUZA 1K6QH 2BNUA 3RA7L 1ORSA 3D18A 2HFEB 1JE6A 5M95B 4ENED 3LRHA 4P9ML 3RA7H 1RY7B 5FUCE 3UTQB 1BEYH 1OAXH 2IF7A 2DQEL 1OCWL 5EU6B 1PQZA 5EU5A 1YYLL 1VADA 5F1OB 3SEPA 1H3UA 1EJ6A 1XF2B 2JELL 5KS9A 2BVOB 4LLWA 1WTGT 4RX4D 1IC4L 2EC9T 1Y18B 2QQKH 4WGWB 3VU2A 4DZBB 2FBJL 4YDLC 2IGFL 3Q6FA 4OGXH 4MB4A 1AE6H 1CD1B 1JI1A 1U8PA 1E6OH 2ZNXA 5LGHL 1HXMB 3GJFB 1ZS8B 3P73A 4UZGA 1LMKA 3VXMB 1UH2A 5CMAA 5DC9B 1A1OA 2R9HD 1A8JH 1OTUD 3HR5B 3KYOB 2BRRH 4GKZA 1BVKB 4OF6A 1BD2E 3WHE0 4Y5XA 2R4SH 2P8LA 1GXEA 3CC5B 5K9KB 4ERSL 2NW2B 4G8GB 1SMOA 5K93A 4I77L 5E8EB 3MLUL 4G6FB 3TN0A 3LHPH 1QSEE 3CMGA 4LKCA 3TGXA 3BKJL 1GOFA 2XNAA 1KFAL 2EO1A 3V6OE 2EDTA 4H20L 4P2QB 1QBBA 4JPWH 4GBXC 5IB3A 5D70H 3K74B 1JWUA 1XR8A 4F7CB 4K8RD 3FT3B 4KGJA 1ZAGA 1S7RA 1MEXH 4M1GH 1LP9B 1ORSB 4G6KH 2GKIA 1OPGL 1NL0L 3MRGA 3OB0K 5DK2B 5C0JB 4G7YH 5GRYA 5IIEB 1DL7L 4JREC 5HY9A 4PV9B 1ZT1B 3CGTA 2FL5A 4ODXA 4HXBL 3ARQA 5IT2H 4XP9L 2FGWH 5ALCH 1W72B 2Z92B 1OT1A 3IJHA 1RK0B 3VXPB 2VXUL 5J12C 1J0IA 4L4VA 1II4E 4J1UA 3LZFL 3AMKA 4XXCC 5C07B 4FQ2H 1AGBB 1BZ9B 5E7BA 1QLRA 1JVKA 3BH8B 1G9NH 3HMWH 1ZVSB 2VL5B 5I30L 43CAA 2QSVA 1GGYA 1NEZG 4YHPB 5C07D 1YPZF 2JJUA 3FN0H 5C9JB 1ROWA 5K9KA 1KN4L 5IFJB 1LO0H 3U83A 4HUKB 3GI9H 4KK6D 1RHFA 1FNFA 1UA6L 1FGNL 3QUYA 4L1DA 4QRTB 5FM4A 5HJ3A 1A6UH 4HF5H 3BPNB 4NSKA 5BO1L 4JR9L 4XNMB 3P0VL 4OCXL 1AKJA 1DUZA 4U6HA 3T0DA 4FXLA 4F7CA 4QCIB 5FEBA 4GAGL 3V6ZB 1TQBB 5DMIL 4K23L 2LU4A 4NRYB 4KJYB 2P42B 5JZ7C 3VFOA 3D1MC 5ADOH 3LAFA 3SGJA 2OTWB 5HHVL 4XHJD 2AVGA 3P9MB 1JHKH 1YJDL 4G8GD 1HKLL 4L4TB 4K94L 1U8JA 2ZUSA 3HUJE 3L5JA 5DMGD 1X5GA 5ILTL 4DWHA 3ZO0A 2K1MA 3X11A 2BNQA 3E2HB 4P46D 4PJCB 4Z7VF 4MCYB 1IAII 2AQ1A 4HIXH 2Q87A 1FNAA 4RA0C 1N2RA 1VERA 5E56A 1X6LA 3VRJA 4I18C 4JJ5B 1RUQL 4GKNB 5IBTH 1M71B 5CHNA 2BSTB 1FFOB 2VTFA 2BMKB 3F7QA 1UM4L 3EW3B 5DJ6B 4Z7OE 3LRGA 3BDYL 1A4JA 3QCTL 2ZCLH 3IGAB 3DURB 5LVEA 4U1MB 2DB8A 4AENB 3HZYB 1RZKH 5JIHA 1UWGL 4LCCA 3KYNA 1LO2L 2OSLA 1HXYA 1LDPL 1YN6A 3MRNB 3MUGB 4KK8D 2YUZA 1JF1B 1OGTA 2ADGB 4K8RH 5DDHA 4ZSOE 3RVVD 1GPOH 4NO0A 1T0NB 2VLJA 2B1HH 1OAZH 4L8CB 4LCWD 4KJYA 1WBYA 5HYJE 2VDOH 4Y4FC 1P4LA 2QQLL 3P4LA 3M17A 4XNYH 4GRWB 3I3EA 1CL7H 4PRPA 4GMSH 4XNYL 4WWKC 5GS2H 1NJ9B 4HULB 3GNML 1XIWD 1EUTA 3CX5J 5D7KE 4OZ4A 2VR9A 3A0OA 3IF1B 2DL9A 1QRNB 4X7FC 2VZUA 1PX3A 3S88L 1I1RA 1J5OL 5F9OH 1I7RB 5JOEA 3UP1A 3U9PL 1MFEH 3J8F7 25C8L 4Y88A 5BQ7B 2QTEA 5LAXA 3SCMB 4M4PA 2FATH 5C9KA 3TO4C 4HWEL 1QP1A 4WUUB 4U33A 5DLML 5GZOC 1IGYB 4K2UH 4LCWB 4S2SA 5DMKB 4BSWA 2ADFH 3CZFA 2XZQH 1WEJH 4WTXA 4E41A 1A4JB 1NGQH 1DUYB 3L95B 4QT5A 1U93B 3E6FA 3HG1B 2NLJA 3MCLL 2W9DH 1ADQL 1MHCB 4TULH 2FB4H 2Y07H 5EU7E 1NCCH 1GIGL 2ARWA 2K3TA 3MCLH 4WDIA 1FJ1A 3GIZL 3O3AB 3LV3A 2VLKE 3QJHB 3DUSB 2QQNL 4JQXC 3KXFA 3B8YA 3CVHB 5FHAL 1TLKA 5FM5M 5CEZE 4YQXH 2F5BL 2GI7A 1KN2H 3IS1X 4OKVA 4FQHB 3BO8B 4QRQB 2H2PC 1J9CT 1V3MA 3G5ZA 4KH2A 2VYRE 3LQZB 3NCEB 1YDPA 5T1KA 3T2NL 2DQIL 5CJBA 3T4AB 2V2XA 1NDGB 1S7VB 2FX9H 3O45A 1BP3B 3IDYC 4FXKB 3SO3C 5A2JH 1MREL 1FL6B 3P4OB 4TVPD 3QEGH 4HBCH 5JHDE 4U1GC 4TNVF 5GSRB 3TEUA 4MA1B 2JB6B 3QIUC 4JM2F 4HHAB 1UJ3B 3ARFD 2UZYB 5MHSD 2CRZA 3GSNA 1MCQA 3W0WD 3L5WA 4KJQC 1WFTA 4YHLH 5TE6H 5IQ7H 4F15B 4W6YB 3FO2A 5KG9A 5FYJL 4GRLB 1JZ3A 4ZO9A 4GRWE 2X4OA 3WO4C 1ZV5A 4AIOA 3BJLA 4ZNCD 4MWFA 5DHYB 1FAIL 3EO9H 3ARZA 5HDBE 3BVNA 5GS3A 3HC0A 2BY1A 2X4RA 4XCNA 3ZLQC 4KTYA 1T21A 3OWEA 1XF3B 1MLBA 1FZMA 3MRCA 4LVHC 1N26A 3MOBL 3OAZH 2GK0B 4IS6B 3H8NA 5INCB 3CPLA 1MRDL 2BVEA 5FCUH 1AGBA 1TNMA 4LP5A 4YIQB 4P23C 1LILA 1OQOA 5LBSL 4Y4HA 3TA3D 4L3EA 4MQXD 3MLWL 1AXSA 3SE8L 3EDKA 1B3JA 3P0GB 1OOAA 2WUCL 2XA8L 2V2XB 3W5NA 2DN7A 1U3YA 2HVJB 2EDHA 4IRJA 2R0LH 4MMXC 4WV1A 1J1XL 5C0ND 3X12A 4X9FA 4HK0B 5I1IH 2JF1A 4Y5YB 1ULVA 4JG0L 1OGAE 2VDNH 1QFWL 2FO4A 2GJ6D 2CIKA 3BXNB 2GJ6A 4O58L 4OTXL 3L3DA 3OB0H 3PUCA 5CJ8A 4K3JH 1CG9B 1AKJB 1DUZB 4U6HB 3MV9B 1IE5A 4MCZB 3CX2A 4GW4B 5JLZB 3SO5A 5F70A 4GG6F 2B4CH 4RAHA 2A73A 4LGSB 4FFZL 5ICYB 2OK0H 3OKNA 2VXSL 2D9CA 1TDQA 4X7SL 1PSKL 1JP5A 3HR5A 3KYOA 4FTVE 5LQBL 2L7JA 4AM0A 4HBQA 2IPUG 1UQSA 3SDAC 3UC0H 1PJ9A 4RNRA 1KUMA 2VLJD 5HD8D 1HIMH 4OQTH 1EJOH 3TPUB 1MAKA 4LU5L 3S5LG 4HT1L 4LIQH 4B0MM 4PG9A 3VFMB 1MFBL 3VXTA 3U1SH 5D1QD 4Q9RL 1G7QB 1MSPA 4P4KA 2OQJB 1BM3L 3VD4A 2ZCHL 3RZCA 3RGHA 3QEQD 1OW0A 4OD3L 3BP6A 4L8BA 3R1GH 2YXMA 4LLQB 1S7TA 4OGYH 1A9EA 4PJGE 4ZTOH 3T77A 2FB4L 2X4UB 2Y07L 2FJFB 3MLTA 4MA8L 5T1LA 4TSAL 3BESR 5HY9B 1GGIH 2MQ3A 5C2UB 1OTTC 4XB7A 5DJ8B 3V4UH 4W6WB 3MRNA 4X0KB 3KJ6L 2J8UE 1TCRB 2HKFL 3EYFA 1B2WH 1DN0B 1HHHB 4TOYL 4Z7WA 2IQ9H 5EIIB 1B2WL 4GW5A 3MGOB 4NC1E 5C0DB 1A7QL 2XIDA 5HVWA 1GHFH 2F54D 3JWOH 5DSCA 2YD5A 3BDXA 1D6EB 2YC1B 3D39E 4Q9QH 2B0SH 3LS5H 3DXAD 3HE6C 4RMUA 1NCAH 1SY6H 3LKSA 1XH3B 2FHBA 5CP3H 1MVUB 1QLEH 4P2YA 4DVBA 1T4KB 5CZXD 5I71C 3HZVA 1J18A 4ONGH 3PDDA 5KSUB 4OZ4B 3O2WL 3OKYA 4HD9A 5SWQA 3SQOL 5TE7L 3GMLB 4JRXB 2P8MA 3UZEA 2YS4A 2ZOLA 2CIIB 3L3GB 3QO1B 1EAPB 3NH7L 2A38A 3QUZA 3GIVB 1GRWA 4NM8H 2F53E 4KJPC 1YEKH 1I3UA 4UUJB 3D25B 3O6LL 4UV4L 1G7MA 5IHZB 3AY4A 5MEPA 4LF3B 5J6GA 5E1HB 2XQYK 3VXRA 1KBGH 1QSFE 5E99L 3P4MA 2ZWLT 1RU9H 1BQHA 2GJ6E 1VKXA 1IGIL 2CDEA 4PJ7F 4JREB 4Y19E 1FFRA 3WUWG 3WFCH 4Z0XA 4XBEH 4LARL 3FN9A 5H8DA 3P3YA 3NZHH 3ZKXB 3X3FH 5JOPD 4X5WA 1U2CA 1NAMB 4XMPH 5BOZG 3WN5A 5L8LB 5EC1B 3DBXB 3DRTA 1Y0LB 1F2QA 1F6FB 2CO7B 4MAUL 5D7LB 5FV1L 1DDHB 1GOGA 2IG2L 4ONFH 5HYSA 1KIPA 1AXTH 2BSSB 4XB8A 4CMMA 3QIWB 1RMFL 1CCZA 1N2RB 3QXTA 4FABL 2XNAB 5I15L 1OSZB 2ESVA 2VXQH 4HK3N 4W68A 4XPBL 5D7SL 4JQIH 1U8QA 3SJVD 3GUTA 2W9DL 5L7XH 3P4OA 2A0LC 2J7LA 3ULVC 4KQ3L 3FQXB 3WHXA 5J57B 1RUAH 4KKNA 5DVKA 3MACH 1T66C 1MNUL 3DJ9A 5A2KH 4EIGB 5IIEA 2VDPL 3V4VH 1I3RB 2C7UA 5DDHB 2E6PA 1HH9B 1JNHB 2JK5A 3EOTH 4PJXF 2COQA 5CSGA 3MRFA 5EC2A 1HHGB 5F3HA 1A7PH 4PRPE 5CIPA 4P5MB 2NY3C 4D3CH 1CFVL 2IPUK 1MVFA 1JV5B 4QRSB 4CDGC 4F9PC 3UPRA 5E94B 5JMOC 5HDQH 4MSWB 5F97E 2RFXA 1TPXC 5DEZA 2R0WH 3IDIA 2Q76A 2VLJE 3S35X 2XQYG 4HWZA 4KJQD 3QI9D 5F9WC 4HFWA 3JV4B 2OP4H 4OCXH 3C6LC 5GPRA 5J0BA 4D8PA 3MUHL 4U7KA 4ZUSA 2PTUA 4JHZA 1PKQE 5INCA 3RWCB 1CFTA 1TZHA 3DBXA 3DRTB 2Z31B 1MI5B 4A6YL 3KYAA 3MMEA 4JN2B 5D6DC 1YYMH 1J8HE 3TA3C 3ARSA 3LKRB 1QPXA 1R6VA 2XTJD 1QNZL 3VXOA 4UIMB 1Z9MA 1H8SA 3O41A 2GW5A 4HUWB 43C9A 3OKLB 5I75B 1OGAD 4XWGH 1JTTA 3FB6A 3CUPA 3B3IB 2VLKD 5MEQB 4P23B 3HG1A 1V05A 4MX7B 5BRZD 1MHHB 1AD9A 1YJDH 2R23A 4HSQA 2C3HA 5I1EL 5LXGL 2GUOB 4JO3H 3M8OL 3QIBC 1AD0A 3BZFA 3IVKB 2YD4A 2IADB 5D6CB 4JN1H 1A3QA 4Z6AT 4JQVA 5B22A 2VLMD 5ALBL 3VFUA 3Q2CA 5HDOA 2HTKC 3OZ9H 4JPKH 4HFUL 4EIZC 1T0PB 3HFMH 4IOFD 3TJEL 3BZEA 5HSFA 4OLYH 1UB6A 3QUMA 2O5XL 1BBJB 3ARFC 4U1JB 4JO2H 2VIRA 2NPLX 1ZKAA 4U1SB 5HHQB 1CIDA 1CDIA 1LO2H 1NFIA 1ZA6A 3LEVL 4PJDB 3U0WL 2YPVH 1ZWIA 1SBBA 2ZG2A 5JIIA 3IETA 3RDTA 4JFED 5CCKH 3KPSA 1DBKH 3BD5A 1LD9A 3RU8L 1WC7B 4NWUH 1B0GB 4KJWD 7FABL 2J6EA 4PRHB 5DK2A 4MHHG 5E4EC 5C0JA 1OLLA 1J7VR 3QFJD 5ICZA 3VXUA 1CDJA 3LKRA 5L88H 5CJOL 1D9KB 4L4VD 4R6UA 1NLBL 3FN3A 3OL2A 1VFBB 5GGRA 5A3ID 3GRWH 4YGVA 3VJ6A 4GW1A 3DYOA 3WNOA 2N7AA 2JJTA 5ENWA 2UWEA 1VPOH 4OBSA 4BKLA 2GTWB 4YDVA 1AI1L 1YY8B 3OX8B 1BVLB 1A1NA 3TIEB 4MZ2A 4IDJH 4F2MB 3LQAH 4M9OA 4UILH 5IB4A 2VL4A 5GGSA 1HIML 3ARUA 4HPYH 4NKDB 5FYLH 4Y16B 2C4FT 1JGLH 2DYPB 4IS6A 3U0TA 1NJ9A 4GRLD 3TO4D 4OKDA 4Q9RH 4NC1C 3TO4A 4WRLA 4YWGH 1A2YB 3RX5A 4EVNA 5JW3H 4GBXD 3IJHB 2RGSA 1T6WA 2AJVL 4FFWC 1TENA 1EHNA 2AJYL 4NCDA 4ZOEA 2EDYA 4NUGL 4HEME 5EO9B 1KCLA 4L29B 3WD5H 4N1EA 4PB0L 3STZB 3V5KA 5B3JF 3QH3A 3WXVH 5EBGA 3RWFA 3IETB 1F58L 1T20A 4JFXA 4P4RA 1YEEL 5IW6A 1OTUC 2CLRA 4WHYH 5FHAH 5K59E 2P8MB 1UXWB 1NANH 2P4AB 3UTQA 3IDUA 4UDUA 5AEAA 1Z3GL 3GIVA 1A0QL 4ORGB 3JTTA 1CLOH 3LIZH 1A14L 3IRPX 4PJAB 4ODVL 2NTSP 3MRQB 3FB5B 3IFLL 4QHKI 2BSRB 4ODVH 1NH6A 3HA0A 2FX8L 1RUKH 3U4EA 3FQTB 3V52H 3ILPB 2D2OA 1A7QH 5IF0A 5I1DB 3GSQB 4JM2B 1IQDA 1N0XH 2BY3A 2FD6H 3OGCB 3T0BA 5C3LD 4GKOA 3EJZC 1BLNA 1ETZB 1MCOH 4JFOA 4JFFA 5DA4A 3LQZA 3G08A 2R2HA 4N0UE 5CJQH 3JVGC 1A1MA 1BWMA 4NQEB 3TBSB 3W81A 1MJJA 4XPFH 4Y16A 4HIJB 2W60A 2XWJB 2DQGH 1S7UA 2WWKT 5J3HD 3A6BL 3EYSH 4WUUD 4FMFA 4S11A 5HGAA 4KK9C 5EN2B 3C5ZD 4LPTA 2DD8H 3FFCB 1PGRB 3PWPD 4TSCL 4XWOD 4XAWL 5FIEA 4RMVA 5I75C 1I3VA 3DX8A 1N8ZA 1NGWA 1XT5A 4PJFB 4NCC1 2D31B 2CUIA 5CEYB 1MCJA 2YPLE 2VLRA 4JZOA 1FLRL 1EZVX 4EXKA 5JR1H 4NYLB 1I8LC 3GHBL 4FQ1L 5DRNA 5IBUG 2X4OB 4O2FB 2I9TA 2Y7QA 4MJ6B 4JFZL 3CAFA 5BRZB 2R8SL 5GRZA 2HT3C 3L3OB 5D70L 1MRDH 4X5LA 4P3CH 4Q2ZB 3S35H 2VJXA 2HTLD 4EI5C 3FZUD 2C4FU 4XCFL 2XTJB 3KS0J 4EQ2A 2IANA 3QA3B 2H1PH 5HYQA 4LIQE 3CFDB 4NZJA 2ADGA 5IP4A 1BJ1J 3LKOB 4XPBH 1PZ5A 1FVCB 3D39B 1FE8H 3B6SA 3OJ2C 1EDQA 2H26B 1VGKA 4KUZL 3CLFL 1O0VA 4M8QB 4KV5F 4D0DB 1MVUA 2WQ8A 4H25B 5DJXB 2VQ1A 5F6IB 5IKCB 4YFLF 3VXQB 2R69H 3LS4L 3JVGA 1PG7X 5E24E 2JCCF 3NN8B 2B4CL 3L95A 1PG7L 5MERA 1KJMB 1U95A 1WZLA 2CLZB 4Z9KB 3V6OA 2CPCA 4P5TC 1EH9A 3RFZC 3O0RH 4MAYB 4G8IA 5JXAH 4LSSL 4YX2H 4X7SH 1S7XA 4LHUB 3HB3D 1YNTB 4AZ8A 5FFLA 4DCQA 1G7JB 1RK0A 4PJEA 5DTFB 2Z4QA 2PCPB 1QA9B 3TT3H 4LLUB 2FIRT 2J88L 4P99A 2EC8A 1CZ8L 1KPUB 1R3HB 4LU5H 3QEUA 5H2BB 4QRUA 4PJ5B 1I3GL 2HFGH 4Y16C 4EI5D 2O93L 3MRKB 4WFED 1VENA 1G84A 3EOAB 5J11C 3PHOA 3ZYJA 1ZLUH 5D6CA 1MCWM 4JANA 5E8DH 4BUGA 4GLRI 2D7NA 2IPKB 3X14A 4A6YA 4LLYA 3U79A 1VB9A 1YC7A 4PREB 1FC1A 3DTXB 4ZFOB 1INEL 3EZJB 1YC8A 3MCG1 4MXVF 1DLFL 3V7MA 4OCYH 4OI7A 3RNQB 4BQ8A 5DRZA 4ZFZA 4R7DB 1REIA 2R1YA 2OQJA 3LN5A 3GSRB 4G8EA 4LNRA 3OAZK 4M00A 4WW1B 1OD7A 3CU1A 1LEKB 3OB8A 4I2XA 3UTSD 4F8QA 1Q9OA 4NQEE 3ZKXC 3D5OF 3SDDA 2NNAB 3WUWA 3IJSB 1HNFA 4PJBB 2FJFA 3P73B 4V1DB 3PWJA 3BD4A 1N5AA 3T0EE 1M7XA 3REVB 1CD9B 4LSTL 1RZGB 1XCTB 4OLZH 5A43C 1FLTX 3VXNB 4CW1B 2J8OA 1IARB 1E6JL 3MBEA 4JFDA 1P69B 4J3VA 5FA4B 4K94C 4JKWA 3VXSE 2PCPA 1UM5L 2E7BA 3IDNA 4W4NA 5IESH 2E7LA 5IBUB 4F2MA 5KSBF 3SPVB 3FT2B 5C0BB 3FFDB 1QSVA 3ZYIA 3F58H 2GTZA 3WJJA 3VRJB 1DBKL 4UDTA 3MRPA 3QJFA 4JCMA 2ATKA 2C1PB 3V0WH 1TIUA 3MRGB 2YZ8A 4P2OB 1VFOA 3BT2H 3FQNB 3X12B 4FFVC 3C8KB 2XN9D 4Y5YA 2Y5EA 2Z91A 2FL5B 4N8VG 5EBLB 4JO4L 4F7EA 1R5IA 4WW2F 1IM9A 2GK0A 1UYWH 3RUGB 2MMXA 4LBEB 2FR4A 5EWIH 1YMMD 3VRIB 2X2YA 5C0CA 5C0CE 4Y2DA 3VRLE 3D3VA 1YY9D 1AQDB 4HIHA 1FC2D 3O81A 3B8SA 3HAEA 1FORL 4NQDD 5HTSA 3SE4A 3AS3A 1T20B 1L9MA 4OCWL 3QIBA 4C56E 5DJDA 3OXSB 5I76A 1DLHB 4GJTB 4R0LA 4WY7L 4WO4A 5EU3B 2Z8SA 1HCVA 3C6SB 1KLUA 2AXFB 4D9QD 1FZOB 1QSEA 5J8OA 1YA5A 4O51B 5D7SH 2ESVE 4LMQI 4LLMA 3PQYE 3W0WE 2VXQL 2BDNH 2EDBA 3QUZC 4LEXH 4K2UL 2CD0A 4XVUC 4WU5A 2GT9B 5ESQB 4XNMA 1T7ZA 2OTUA 4M43L 3QPXH 1DZBA 3O3EB 4LASH 4Y89A 4N0FB 4BELD 4PD4K 3T4AA 3O6FB 4QRRE 1OM3L 4P3WA 1F97A 4R96A 4FQJH 1Q38A 3PHQB 1MFCH 3JWDL 3BPCA 4KFZC 4QHMB 3OBAA 1ZGLM 4NFCA 1NUNB 4KRPB 4C58B 1YECL 2XN9B 4S1QH 3QXVA 3SJVA 5HHPA 2D0FA 3BW9A 3GJFA 3S34H 3HNTL 4YUEH 4DW2H 3TYGL 2ZZUT 4LPWA 1A1OB 4HMDA 5KSVB 2NY2B 4ODXB 5TFSL 4Y7MA 5CEZD 4GAFB 4WW2A 4JPIB 1NSNH 3CSYA 4OM0L 1JBJA 3RWHB 1SJVA 4U0QB 3QDMD 4NKMB 4X80L 2N4IA 1H8OA 4KK5D 2ZG1A 3LPFA 2AP2A 3S5LA 1AHWC 3D9AH 4LSUH 2ZUQB 2CQVA 1C16A 3O6ML 5MEND 1F4WL 1QNZH 3HR6A 3SGJC 4OZIA 3MXWH 2NY3D 2VQTA 4NO0D 5KVEH 1WWCA 3TZVA 5C0RL 1BFOA 3EYSL 1EVUA 5HYSG 4HWBA 1OP5K 3UTTE 4EQ3A 2KQNA 2W9EL 1AE6L 4TUKH 3N85H 3WO3B 2DWEA 2A6KA 5D5ME 3CFCH 4DUXA 3ZDXF 2I25N 4JPVL 1JWMA 3PGCA 2CH8A 2VDKL 5EBWA 1IC5L 1G7HA 3K0WA 2GFBA 2XWTB 2EKJA 5JW4N 4XGZA 2P5EE 1FIEA 3AS2A 4C59B 3PNWB 4R4FH 3MFFA 3M1BB 3HI1A 4J2XA 3M45A 1KPVB 1KJ3L 4OZHA 3SY0A 2CLVB 4UNVA 4QEGA 2YMXL 1MFAH 2A6IB 4LCYB 4KTDH 3QBTB 2EDLA 4OQ1A 1IEHA 3OHXA 2C3WA 1LNUB 4ZTPH 4HWBH 2H1PL 5E70A 5F96L 2WIMA 2X42A 3HI5L 4R4BA 4XCFH 4FABH 4PJ5D 3VFNA 4IIQC 5CCKL 2XPGB 2E6QA 1UACH 1V7MH 3PWLB 1CGVA 4LLVA 1IGJB 5FUCC 1KPUA 1BJ8A 1DQLL 1CI5A 1BD2D 4PRAA 5IM7B 4I3GA 1QPPA 5FK9A 1HK6A 2YPLA 2W07A 3PL6A 3SBWA 1UEYA 1C8PA 4DJMA 1AO7D 1W72L 5F6HJ 3PXJA 5L88L 1KOAA 1ZE3C 2R39A 5JUEL 4WI9A 5FYKH 1R3KA 2APXA 4HPOH 1S7UB 2ZNWA 4FQCH 2M1KA 3P4NB 3LS4H 4QCIA 1U3HD 3QAZC 1KEML 2V17L 4PIRF 3WXWL 1ZSDB 2BSTA 3GRWL 4HH9A 3GSXB 3RNQA 1L0QA 2DWEB 4J8RA 2MHAB 3K1DA 4I13B 2P8LB 1XGPA 4C4KO 4HGWA 1JZ5A 2WUBH 4N0YH 5E95B 5F8QC 1IZJA 4CADB 2WP3T 3RGVB 3O2DA 3BWAA 3BISA 1K4CB 5E6IA 1Q1JH 4DQOH 3LN4B 4FZ8L 5CGTA 4BH8A 1TVBB 2P5WE 2FATL 4O5LL 4HT1H 3Q6GL 2EH7L 3ALWA 1NAMH 4UIKH 1WEJL 1TCRA 4ZQKB 2BXZA 3QQ9C 1CR9H 4OF3A 2MOVA 5DK0B 1C5DB 4ZS7H 2AEQH 5DR5L 4W6XB 1DQQA 2EH8H 3DSFH 4HXAL 2VC2L 4YDKL 4PJ9D 1KXQE 3ET9F 4HMCA 4PJ9A 1RIHH 2VE6A 1Y6KR 2MCPH 5IHUH 1GC1C 3TVMB 2F74B 1BWWA 4TPRL 5EBMB 4NDMB 1JGDB 3O9WB 5HYJB 3JZ7A 4F80A 4AJ0A 1T5XB 3G5YB 5GJTL 2DI7A 4P9MH 4WENB 1IEBB 1T22A 4AEHL 5ITFA 2RQ8A 4ZS6D 4I3RL 4FXGB 1I1YA 2PETA 3V52L 3BIAX 4X7DC 5DGRA 3QCVH 3L7EA 3D3VB 4GXUM 4J3OC 3PWUB 3HE6D 2IH3A 4YHML 1YEIL 2EYSA 2G2RB 4Q9CA 5E2TH 5HD8C 5FYJD 4AYFA 5D9SA 3K4ZA 1L7TH 3BUYA 4LQ1A 1DSFL 1NCWH 1XGYL 3OAYH 2GAZA 3CSBA 1K4CA 5E6YA 3U7WL 3FQTA 4YXLH 4J1UB 4LVNB 1AC0A 2BC4B 5E8OA 3T65B 4WO4B 3GI8H 4M3JA 1BLNB 2V2WA 5C0FB 3SGEI 5F7YC 5KVDH 4OCRH 4JHWH 5HI5D 4G5ZL 5DHVH 3QXDB 2YA2A 4M03A 4OBRA 4PJIA 1MOEA 4FOMA 4NKOA 3TESA 2UVEA 2QHRH 1KIRB 3BXNA 4OJFH 5HGAB 4NJAH 4PB9L 1U42A 3E3QE 5A2IH 4X6EB 3QG6A 4LARH 3UTZA 1ZMYA 3F12B 5CZVL 4O4YH 2WSKA 1DQTA 3VFTA 3GO1L 1KJ3H 4HKZA 4GW1B 3P9LA 3VDAA 4KK6C 2A0LD 1VGEL 2HFTA 2X05A 4NDMA 3PDGA 1V5JA 3IJSA 5DMJB 4JPWL 5EFIB 3P0YH 1OAYH 4HJGB 4OGZA 3MLVH 4OM1H 2XWBB 1K9TA 1WIPA 4YBQD 5CKGA 3TBVB 2IFFL 2UWEF 3I2CH 5FOBA 1R5VA 4CMHB 3BW9B 1JUFA 4B50A 3KPMB 2H8PB 5KS9E 1MIEL 1BIIA 1UACL 5KTEH 1XF5A 2AV7B 3MSPA 3G6JA 2ED7A 1KELH 2YWZA 3H9SE 5DJ6A 2VN7A 3MACL 3HG1E 4FFVD 2DQDL 5IW1B 3REWB 3BZ4A 5ENWB 4NQCD 3QFJA 4HX1A 1FYTE 1NGPH 1KB5A 1Q9KA 2QADB 4LLWB 2AQ2A 5L8KB 1Q9LA 3FOLB 5C86A 4WCYL 4NRZB 4L3EB 5IVXF 4ZFGL 5ICXB 3FAWA 1A6ZB 2VUOA 4OFIA 2AK4B 3I6KA 4C83B 2XACC 4LFHG 2BXYA 3W11C 5DVMA 2HRPH 3NIDE 5TDOB 3TYGH 4EUPB 1FRGH 5IEKA 5GRJH 1MF2H 2ZG3A 2Z9TA 5DXWA 1DN0A 4RWYH 5DZOA 4KGLA 4EN3D 1YEFL 3FB7A 5I8CA 5J1AB 4ZSOA 1S7XB 4YDJA 1QLFB 4EOWL 2R56H 3KPNA 2DQJL 4P5MA 4N0UB 1M7IA 2OP4L 5AYUH 3F6IA 4LVEA 3ZYZA 1F2XK 3MLSL 1ZT7B 4X5XA 2A77H 4Z7WE 1E4KA 2ZUTA 5CINL 2NY1D 3PQYD 4XH2B 3DYPA 1KLUB 4ZOCA 4HMEA 2Q1EA 4GAJL 3VI4E 3KPMA 2FSEB 4MS8D 5KAQG 2ADJA 4GAJH 2EIEA 2HVJA 3UAJC 4DKDC 4ZXBC 2OS7A 4OI8A 3P11H 2FJHB 3LMJL 3DX7A 1XGRB 3LMJH 3GM0A 3LKPB 4K7FA 3G6JE 5JNYA 1UKTA 3INUL 4V2BA 4N8CH 5FUZL 12E8L 3SGKC 5DS8A 1NEUA 4LNRB 1JRHI 3BN9D 4HKXA 4JFHE 1N59B 4NQUA 4ZO7A 1D5XA 3QQ3B 4TSBH 4R7NA 3VXMD 2HH0H 4RQQA 3CUPB 1CBVL 5IOPB 1MHEB 3MA7B 5JOFA 1FBIH 2A73B 4Z78A 5FDWA 3MJ8B 5C92A 1U2HA 4K3EL 4YJZL 3CH8A 4MJIE 1OAKH 1TITA 2AGJH 3BDYH 4NFDA 1H15B 4Y2DD 5D7KD 3UBXB 3P9MA 1FNLA 3OXRB 4Y19A 4UBDC 2NY5H 3VFUB 4JE4B 4HJ0D 1T1WA 1J8HA 3KYMB 3FRPA 4ZXBA 2BHYA 4KI5E 3RBGA 3B9KA 2DTMH 2LE9A 5GHWL 4UU9B 3SDAB 4JHWL 4OIIH 3SDCB 1UXSB 2BVUA 1MJUH 3CD4A 4P49A 3MODL 4HLZG 4M6NH 4NUJB 4M9PA 4Y4FD 4KKLC 5FHBH 1SBSH 1WJ3A 3SDDC 3NVQA 4GMSL 3RTQB 1OWWA 4FQXB 3SDYL 4KHTL 1R3IL 1NDGA 1S7VA 2WANA 3STLB 1F90H 5D7LD 4JB9H 2OLDA 4MWFB 2P5ED 1QVOB 2CXKA 3UTOA 3FZUC 3D2UB 4HIEA 4ZUVA 1JWMB 1G7PB 3KHOA 1MQKL 3QQNA 5AUMB 5C0IA 4YEFA 1J0KA 2NY4B 3QWOB 4JRWA 3QCUH 1KC5L 1QA9A 2LV4A 4PLJD 1INDH 1A02N 1NMAL 1VACA 5FO8B 3I2CL 2VSCA 4JFXB 4U0RB 5E1AA 3IDIB 4OGAC 2HT4C 2DQCH 1T22B 4FQLH 3DMMA 4MD4B 2JCCB 1DLHA 4HW6A 4PLOB 4G6AD 1P6FA 5DMIH 1IFHL 3E8UH 3G6DL 3MUY1 1YEJL 1HSBB 4GFTB 4ZUSB 1XH3A 1KCRL 4BQCA 2DQDH 2ZP0T 2NY2C 1MUJA 4P0DA 4XTRC 1BGXH 3VH8G 4EVNB 4FTVD 2CR6A 4RAUB 2Z4QB 5SV4A 2E6JA 4NWTL 3MRRB 3MRHB 5I1DA 1S9VA 5C0GB 2X1PA 3ORJA 3FJTA 3OPZL 5EU5B 3VFVB 1X6NA 2QL1A 3WN5C 3RTQD 3QO0B 5JLZA 4F37K 2FX8H 2Q86A 4P4RB 3IU4H 4Y4FB 1V3JA 3GRWA 2EEBA 4BSWB 4UQ2B 1TTUA 5I1JL 4E41B 2FX9L 4A6YB 4KU1A 1UENA 5D8JL 1KACB 2VNCA 4ONOA 2JJWA 2H6PA 4UQ3B 1RHHB 2FHCA 4FG6D 5TQ0H 1BREA 5E6IC 3CLEH 1V7NL 2F53A 1MCOL 4QNPF 3HUJB 4R2GD 1CE6A 1S9WB 1ZTXL 1CGWA 5IROC 1RURH 3TO2B 3ZKMD 1RZ8B 1QRNA 1CG9A 1JMZA 3HRPA 2VLRB 1J0HA 3BIKA 4DGIH 5GS2D 4QYOA 2OZ4L 1YPZA 3SE9H 3C5ZC 4LSVL 4MNGA 3FT4A 3PV7A 5B39A 1HINH 1CU4H 2F8VA 2NNAA 1FNHA 3WUWB 5I1AA 5CEZL 3QDHA 1FV1A 4FTVA 5FYKE 1QSZA 4PJ8C 4WI6A 1JNNH 2YSSB 5HHNA 4WEMB 4U3XA 3J7HA 1N64H 4U1IB 3QG7H 1C5DA 1TPXB 1YEDB 5TPWL 5I6XC 5IFJA 2RB8A 3TZVB 4JO3L 1UJTA 1WZMA 2KZWA 4RGOH 2Q7YB 1KJ2B 3RTQC 1MI5A 1YMMB 3GHEH 1F11A 3QP3A 5D96C 3BPLC 1A7NH 4K3DL 5CJXA 5F9OL 3C09B 2PN5A 3RZCB 2EEAA 3SDCC 5GZOD 2HN7B 5AG8A 1QBAA 4Y0GA 2IBGA 4X7TB 1RZIA 4K8RC 3EGSB 2EECA 2W9LA 4MAUH 3VGAC 2VXVL 1FO0L 1BHGA 2VLJB 4YFEA 3CXHJ 5DGQA 1AKJD 5SX4H 4WFHD 1TQCB 1FE8L 5E8PA 2I27N 1WBYB 5E8NA 4F7PA 1RUPL 3EO1A 4C54A 2DM4A 1P7KB 2R15A 3HZKA 5D2LE 1YEHL 3RWCA 4RGNB 1MH5A 3X11B 5KOVC 3RVTD 3QPQD 2VXUH 1MNUH 1IGJA 1CF8H 4UT9L 2DS4A 4FQ2L 4BZ1H 1FSKC 4Y5XC 3QWRD 1CFSA 5GISH 1AXSB 3ARED 1T1XA 3BHBA 5LWYH 1FNEB 4PJHA 5GGUB 4XMLH 5EU3A 5HHMD 2AEPL 1RZJH 1CS6A 1IKFL 1NUFA 3BN9C 1YEDA 4Z76A 4L8SC 3CDGB 5JPMA 4HK0A 1LVEA 1U95B 3O4OB 3MV7A 4M7LL 1MHPH 2HA1A 1A22B 2R2CA 5K59F 3AROA 2VDQL 1RJYB 4QRPE 4E5XB 3E6FB 1ORQA 4JRYB 2PW1B 4XPHH 4B7LA 5J13C 4LL9A 5JW3L 4K71B 3QDJA 1TMCB 4R7NB 1M7DB 1I8KA 3GSQA 4JM2A 2O5ZH 4KZDH 1U8NA 2UVFA 1FNSH 2UZXB 3MRMB 4GRMB 1RQ5A 5E6IB 5DD0H 3FAXA 4XNQA 1QSFA 1B0WA 1SJEB 4QRPD 1X5HA 1BQHB 1B88A 3TIEA 3PABA 1ED3B 3W0WB 1N4XL 1W8OA 5ESAA 5C08E 3I6GB 5DQDL 5I66A 4XBGB 4ZO8A 4R4NC 5I16B 1T83A 3FB8B 1UWEL 2XKUA 5FUZH 2AV1A 1I1AC 1FL6A 3S36L 3MOAL 5EZOH 4XNZC 3S36H 4I0PA 1U8OB 2WMPA 2QADC 5FKPB 3BGMA 2NY6B 3L7FA 4NYLA 5K9OA 4MDJB 4FQXA 2VAAB 3B9DA 3CK0H 5EBMA 1QD0A 3MNVB 3KJ4C 4O2CA 1HHIB 3K3QA 1Y18A 4KI1A 3HI5H 5EZIH 1FBIL 3X13A 2OJEA 1LK2B 2V7NA 1CLZL 3KPQB 3L3KB 4ENEC 1TJGH 5I2IA 4RRPA 4NN6C 1TZIB 3V4PH 3WIHA 2HT2C 3UXFA 1T7VA 3ZDYE 3L7EB 1AQDA 4ODWB 3V5DB 4YHOH 4OIIL 5D96B 5GRVK 3D6GA 2UZIH 1FCCA 5T3XD 4OKVB 3BT2L 1SYSA 4PJ8B 4OF7A 4NGHH 4L9LB 1G6RL 5GGQH 1U3HA 3OKEB 3QPQC 3U7YH 1A6AA 2RCSL 1VPOL 4F33B 3IFOB 4P2QA 4XMKH 4P2RE 1HWHB 4H0HB 1PYWA 3L3HA 3LN9A 1U8LA 5T1LB 1S9YB 5D93B 3HE7C 3SGKA 4YO0B 4U1LB 3GEWB 4HHAA 3CZFB 5HYFA 3G04B 1MFEL 3PIQB 3L3GA 4H1LG 4G9DA 3DX6B 3C5ZB 3QQ3A 3GGWB 1PZUB 1OPGH 4OSUL 1JPGA 1INDL 1GGBH 3H9YA 4WWID 5ESVA 5F89A 1M6OB 5IFAL 3IDGA 3D69A 3P77A 4WTZA 1WFNA 5CKAA 1RUMH 1ZSDA 1K5NB 1IT9L 3MRLA 2Y7QB 1IVLA 4WFFD 5L9DL 5C7XH 2DKMA 3DROA 3DXAA 3HZVB 2HJFB 3PJSA 3NGBC 4R97B 2IWGA 3UTPD 4PJXA 1OT2A 5C9JA 3KLSA 5ISZE 3JTSB 5HBBA 4QHLB 4RA3A 1CLCA 3RWHA 5ICZB 4QTIH 5DRWB 1LE5B 5B39B 1YZZA 4XNUL 1IAIM 1UCBL 1G0YR 2F58L 5IB5A 4PBWD 3DV6A 3QNZB 3IDJB 3GBNL 2WBWB 2QJDA 2PW2A 1MFDL 2P5WD 4YC2B 4P46B 1KULA 1KB5L 2P7TA 1G7IA 5DRNB 3MLSH 2HMID 3CMOL 3MBXH 4PY8I 5TDOA 4CW1A 3CFIC 1KLGA 4OLUH 5B8CB 1F11B 1DQQB 2DQGL 2Z31C 5GRXG 4WU7B 2NY0D 3GSVB 4WJ5B 4HEPG 4OI9A 4Z7NF 2AW2A 4A2MA 2IMNA 2DQFB 2MFNA 1XF3A 4LHUA 4S1RH 1EX0A 3OKDA 4R26H 2XRAL 4EN3A 2DYPD 2Q3AA 5I8KH 5KJRH 3VW3H 3RY6C 1A6PA 3D69B 5H37H 1HWGB 1OTSD 1RD6A 1NGZA 3MGOA 5BVJA 3KYKH 2JB5H 1NMBH 4H1LH 3VD5A 4PS4L 4OFYD 1BJ1H 5ITBH 1DVFC 5I17B 5JDSB 5D1QC 1UQSB 4DVRL 1IGCL 1YQ2A 4JG1L 2H3NA 1BJMA 5TH2B 2HH0L 5J9PB 2DBLH 3ISWA 1MPAH 3K4DA 3VFNB 2X9WA 5CAYB 4G9FA 1XGUB 4JM4L 5EOTA 1F3JB 2H2PD 1IKNA 1T03L 5A16B 3H7BA 2FJGB 4U1MA 4M6OL 1MRFL 3TIDB 4QWWC 1HSAB 2NY3B 2ZOLB 5KVFH 3U0WH 4YZFF 4PBXA 3PWVA 1JV5A 1KPVA 3V5KB 4LDEB 1RV6X 1T7YA 2GYSA 1ES0A 5F7HA 3GSNH 5FXCH 3T8XA 1FZOA 3GSXA 1JGVL 5GQBA 4H0IA 3NFPB 5EUKB 4H0GA 2V2TA 3NCCB 4F9LC 2KQMA 2DQHH 3O6KH 4OTXH 4ORGA 2Q8BH 3MV8B 1NLBH 3AXLB 5GGQL 3LDBB 1QFHA 1CTNA 1TCMA 3FFCA 3LPGA 1S7QB 4JDTL 3FO1B 1CDBA 3I6LD 2G9HB 4TVSa 1EZVY 3RVXC 3VFMA 1F6AA 1MCLA 5D7JD 5HHNB 1WGOA 2XWBA 1KN4H 4CMMB 5GGTL 5E9DA 1JHLH 1Z5LA 4Y1AB 3U36A 1OAUH 4P23A 3NCBB 3CCHA 4JEGB 4P23D 5KSAC 2P49B 4NKIL 1A9EB 4G6FD 3SKNB 1KNOA 2W0LA 2PO6B 5SWQB 5BZWA 4EOWH 2Y23A 3KVQA 1AJ7L 1QHOA 3TBTA 2AI0L 2R2EA 3ROLB 2MHAA 3RZCD 1N5YH 4LSRH 9CGTA 1XCTA 2EE3A 3N1FC 2X1QA 4UI2A 3ZE2E 4EI6A 1AR2A 3MBEC 5IMLB 1P4IL 1T1YA 4KMQA 4EDXA 1NGWB 1Q9KB 3LKNB 2A9NH 4X5XB 4JZOB 5DUBB 3BDBA 1HN1A 3ILQC 5D2NE 1R3LA 5FO9A 3MRIA 1G9MC 4X98A 4UMGA 4EJ1C 2ARJB 1U41A 3NFPA 4M7KH 1FN4B 1AFVL 1T2XA 2DLGA 2VZ1A 1L0YA 2EZ0C 3EUUA 3EFDL 2JIXA 3MOAH 4P2OA 4GQ9H 2K9UA 5JORA 3MV8A 2M2DA 1JZ2A 1RUKL 3U30C 1BPVA 3L5HA 3RJDA 2FCBA 4HZLB 1YNLL 4I48B 4JRXA 3BRDA 3AAZA 4LSTH 4DGYH 2H9GB 5E8OB 4S1SH 1QR4A 3MMEB 4JN2A 3BMWA 2DM7A 4F33A 3LY6A 5T3XH 2H45A 4AIZB 3IFPA 5JXEC 5TQ0L 2ICES 2CXGA 5IHZA 2YKLL 4UIMA 1TNNA 4EN3C 3VE0A 4DZ8A 4DKFH 4I4WB 2XZAL 5DD5L 4I18A 4NKOB 3RKPA 1ZXQA 1EFQA 3MJ9A 5DD5H 1JK8B 4XAWH 4DUVA 3MXWL 3QIWD 1P7QB 3SCMC 2IGFH 2XPGA 5ISZA 1DFBL 3F12A 3S4SA 1HINL 1U8NB 3I50H 5CJ5A 3TV3L 1CE6B 1S9WA 3U9UB 1J12A 1O7VA 2ZKHL 3R0NA 5D1ZC 1EMTL 2R0ZL 2XQBL 1T66D 4GBXA 2DDQH 4QY8A 4HQQL 1CQKA 4WU5B 5E99H 5EO9A 5CZVH 3MRIB 5C2BL 5JQ6L 4X4ME 1G1CA 1XZ0B 4E41E 5C6TL 5I66B 4XAKD 4IRZH 3AS1A 1BECA 1MPAL 1LO4H 1T5WA 3RVXD 1PX4A 4XBEL 1FVEB 1VA9A 3MRBA 4XPTL 4MB5A 3G6JB 1XR9B 2G60L 4LFHD 4NHUB 5DD3H 4G6AC 1DUYA 4QT5B 4QXWA 3FO9B 4D0CA 3T0EC 3UTSA 2J8UF 4PREA 2AXJA 1NMAH 3IKCA 1H3VA 3OKOA 5H94A 4HH8A 4HWEH 5IMOB 2YRZA 4PJCF 3WFDL 5JPNB 5FKPA 2CGRH 5I1LA 5MP6L 4ONHB 5HDLA 3TZVC 1F00I 2GJJA 3GJEB 2DKUA 5BV7C 4LKXB 4NQDA 5ANMA 5EBWB 4DKEH 2Q6WA 1S3KH 3IAQA 4Y2OA 1WIUA 2A9ML 1C08B 2ADFL 4N90E 3RQ3A 4XC1H 3TNNA 3BEWB 4JKMA 1MAML 3NIFE 4OUOA 1WISA 3FTGB 3UJIH 1EEUA 1B9ZA 1OM3H 2VWEE 4H5SA 4X7EC 3T09A 5CP7B 2HWZL 2OR9L 5E0QA 4LASL 3QHFL 3TBWA 4ELME 1ERNA 2HWZH 4WU7A 4PFEA 1NBZB 1H5BA 6CGTA 5DT1H 2NY6D 1QLFA 2BVYA 2ZSVA 4L9LA 2DQIH 3UO1H 1A7PL 1J1PL 4O9HH 5DI8B 2AEPH 4KKBC 1G9NC 4LNVA 3GMRA 4MNHB 5HGGS 4PRIA 1KENH 5BJTB 3VFPA 3ZDXE 5FK9B 3HUJF 3FQUA 3ECBA 3RL2A 3IU3B 3UDWC 1CFSB 5IHLB 2AK4A 4C83A 3CLEL 4LGPB 3OXSA 1AJ7H 2XZCH 3BYTA 1C5CH 2H2SD 1RULL 4Z76B 5KVGH 4F3FA 4MX7A 4AH2A 4OCYL 5A16A 3BP4B 1UC6A 5C0AB 4F7TA 4QXGH 3HC4H 5C0GA 4GRWF 2XN9E 3QXWA 1ZGLP 4IMLA 4LCUA 3T0XA 4IEFB 2A74B 1K2DA 3LD8B 5LJYH 5C6WH 4HIHB 1G7LB 4PUBH 1WBXA 5C08A 3V7AE 3P30L 5T3ZH 3T65A 3OX8A 4MNGB 3BSZH 4XZUA 4JZNA 2XG5A 1U8PB 2V5MA 5IB1A 4PJ5A 3B5HA 4ZAKB 2ID5A 1DJSA 4MNQE 3TNMB 4E0RA 3O6FA 2EE9A 4Q6IB 2QR0A 2Z35A 5DJAA 5DC4B 4JFFE 1MLCB 4C4KT 3AXLA 4JQVC 1JNLL 5IVZB 1AIFB 4LCWE 5AZEH 3SE3C 1D5IL 5D72H 5DI8A 3QNZA 3S37H 4JFEE 1DBAL 4LSPL 5EOQH 1DQDL 4LVOB 1KCVL 3K2MC 2FYYB 1RZKL 1P7QD