3WS3B

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 16
structure length 100
sequence length 100
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3B00
2BNRD 4JB9H 2CIKA 4ZQKA 1X44A 1UACH 1K2DA 3PGCA 3Q1SL 4L4JA 5SV3A 3OKEB 3LRHA 1RUQH 4B0MM 3K2UL 5ETUA 3NIGE 5F9OL 5IFHL 4GG6E 7FABL 5LXGH 1JNNL 4Z0BL 1KXVC 2NYYD 1FFPB 5DJDA 1Q9LB 1IC7L 2FX9L 2EDHA 4NQSA 1OAXH 1OSZA 3T65B 5I16A 5KTEL 4KKAC 4MHHG 1A4JA 1WIUA 4KU1A 1HHGB 4S1QH 1EJOH 2DJ4A 3QJHA 1I7RA 3FFDB 1BVLB 3PV7A 1MJ7L 2VOTA 1ZVHA 3NCYP 1DQDH 1QFWL 3MJ9A 1ZT7A 2ERJB 2P4AB 4X7SL 3V8OA 1B3JA 3BKMH 4X6FA 5CEZL 2X4OA 3WFCH 3QEQD 5CS7A 2WIIB 2BX5A 1U8MB 3HZVB 1KB9J 3D0LB 4DWHA 3CX5K 3VXSB 2OP4H 5TH2B 3IDIB 3OB0K 4LFHD 4TUKL 1TTFA 4M7KL 3ILPB 3RWDA 3O3EB 2XPGA 5FUZL 4H0GA 2IQAB 4Z7WF 1JPSL 1W0VA 3VU2A 3W2DL 2HFFB 5C0BD 2CLVB 4KKAD 4LQFL 4YZFE 4JFEE 1SYSB 2C26A 1J0YA 1A7RL 1R3JB 1SJHA 1WFUA 1IEHA 2BVUA 4P2RA 3QYCA 4K9EL 5I71C 4NHUA 4BZ1L 2A73A 3AROA 4U05A 1PLGL 1F58L 3A6CH 4JM2A 1MJ8H 4UOW1 3ZDYE 5GGTL 4IRSD 5LGJB 1EO8H 1RU9L 1U8PA 4XC3H 4B7LA 5B8CC 3NIGF 3RWCB 3WKMH 2VO5A 1Q72L 5BO1L 1K6QH 1E0OB 2X9WA 5E56A 4FMKA 4Q7DA 1YEJL 3VG0H 2ATPB 4F2MB 1OHQA 4MLSA 4EXKA 2ZG1A 3SJVE 4HIJB 1FZKB 3PHOA 1IM9B 4YH6A 1S3KL 4M1GL 1FYHB 2J4WH 5E2WH 3QEUB 2QBWA 5I66A 2L0DA 1P2CB 2D7OA 4X5XB 3TJEL 2GSGA 5DT1H 5HGGS 3SGJC 5D1QB 4QHLA 1CFVL 1B0GA 4JVPA 5FAAA 1NKOA 2BSED 4Q2ZB 1V7ML 5B8CB 5IMMA 3HI6L 2R69L 1G7HB 4LCWD 4HMEA 3INUL 2ZG2A 3LQAL 5F9JB 3UYPA 3NFNB 4U6VH 1TTUA 4JQIH 4YAQB 3GSRB 3GHBL 5T1KD 3QFDB 5EIIA 3MNVA 3GMMB 3VFMA 2X4QB 3L3JA 3TVMB 3P9LA 5GRJL 1NLBH 4LGSB 1G9NH 3VI4F 3VDAA 3B9KD 3DIFB 3LS4H 4HUNB 1EFXA 4PJAE 5AD0B 4U6XA 5EBWB 1A3QA 3AS3A 4X83A 1T2XA 3G04A 5EBMA 5SWZA 4QRUB 4TTGA 3LSOA 5LCVL 1RZGB 2D7TH 3KHQA 5K9JL 4NOFA 4MHHI 3ZE2E 1N26A 3OF6D 3RNQA 4UUJA 4ZYKA 5CP7A 5B3JF 5IT2L 3EDFA 4HQQH 3W82A 4G8GA 3GJEB 1KN2L 1HDMA 4PTTA 2WZPD 5MERB 3L3JB 2OZ4L 5IFAH 4WY7H 2A6KA 4L5FH 3V0VA 1QLRB 2C7UB 4GAYB 3IFOB 4MNQD 5C0AA 5DQJA 3RVTD 4UILL 1D5IH 3B8SA 3QDMA 1JYVA 4GKNB 4QWWC 5IJVB 5F9OH 1S7UA 1CE6A 5C0AD 5INDA 4OT1H 3QXDB 3KYMB 2ZCLH 1N2RA 4MA1C 4OCRH 2V9TA 1CFSB 5I1HL 4KRLB 1J7VR 1G0DA 3K1KC 4FQJH 2E7LC 1RAMA 2CUIA 5TDPB 1H3TA 2V2XB 4LP5A 2Z8RA 4MD4B 4EVNB 1VEOA 4MQXC 4Z95L 5DVLA 4J3SA 4ERSH 3I6KA 5HDOA 4HF5H 2ITDA 43CAB 1UEMA 2OP4L 5DZLA 3C5ZA 1YMMB 4PP2B 1F4YL 5I71B 4KJPD 5CFHA 5CEZD 3E6FA 5IB3A 4JFDA 1CXFA 1JGDA 5F1KC 5EPMA 5E8EB 1SEBB 5D1ZD 3CDFA 2G60H 3JWDH 5E2TL 4PGBA 4XTRD 1CFTA 5D1ZA 3H42H 3GBML 4QHMB 1ZK9A 3BGMB 2EKJA 4OLYH 1KN4L 5C07A 3OXSA 3TWCH 1XFPA 4X9BA 3M45A 5C6TH 3CFJB 4H5SA 1LVEA 2Q8BH 5FCSH 3ZE1E 4KDTC 1P4BH 4JFFD 3D3VA 2AJXL 2YBRB 3W39A 1A4KA 2YUZA 4R0LC 3C5SB 5D6CB 1GAFL 1FZJA 1K3IA 1XCQB 4H0HB 1OD9A 4NC1E 5IBTH 3T3PE 2J4WL 1PYWB 3HCVB 4HIHA 3SEPA 3U4EA 3DX9A 3GSNB 5CILH 2R1XA 2D2OA 2VLRE 1A1OB 4AEFA 5JUEH 3ZDZE 4FN0A 4HS3A 25C8L 2D0FA 5DVOA 4KZEL 3LKNB 2HH0H 2VLMD 4ZD3L 1UEYA 1S7VB 2EKSA 2Y06L 5GGVH 4CNIA 2DM7A 5EU5B 2Z31A 3QSKB 1CIUA 1G9NC 3D25B 5IVZA 2ITCB 1C5BH 4TVSa 3UBXB 4FXGA 4XCYA 4U1LB 4OTXH 3EBAA 1J1XH 3PUCA 4KMLB 3GSXB 2XACC 1WC7A 4Y89A 3WFEH 5FYKU 3S6CA 2EDDA 5ABDE 5IBUB 1TZHA 5F7DA 1I3GL 1LO3L 4XI5D 1Y6MR 3QCVH 1JZ4A 3VI3E 5B38A 4C4KO 3KJ6L 1DQLH 3GBLA 3I02B 3G6JB 1MHHA 3D39A 4MXWL 1P9MA 4PJ7A 5KJRL 3O6FD 3LN4B 4MXVE 5HDBE 2CLRA 3WBDA 2JB5H 3TPUB 3ZYJA 2EKSB 5GS2H 3H42L 2CIIB 3L3HA 4MCZB 3WSQL 4POZC 2W9DH 1PJ9A 1X5XA 5HDBF 3TFKC 1M7DB 4QXGH 1CFQA 2VDLL 3LRSA 1SY6A 4D9QE 5T5FH 1KCRL 4RGNB 4QOKD 2CH8A 3PXJA 1GGCH 1Q9OB 1TVBB 5CMAB 4AMKH 2X1QA 3TBTB 4POZD 1M6OB 5E9DE 1E4XI 3LPWA 2EIZA 5KAQG 3S96A 3MACH 2Z35A 1A0QL 1YY8A 4M7ZB 2QR0A 3KLHC 2DLFH 2VAAB 3HNTL 4YBLB 3C87A 2ZWLT 2XA8L 3DMMA 5T3XE 1E28A 1B2WH 5J1AB 4KTDL 2GJ6A 3GRWH 3EDDA 1OAXL 4FQJL 4TULH 3F5WB 5KTEH 4Y2DB 1I8LC 1MQKL 4NM4H 3C60D 2WUCL 2NXZD 2R15A 3KLHD 4PS4H 3ZTJH 5JLZB 1BZ7A 3V4VL 4NWUH 5KS9B 1VEPA 4TSAH 4KH2A 1JRHL 1D6EA 3T0WA 1GGBL 5DJ0A 1RZKL 1WWWX 3MRQA 4PJBA 5JW4M 4GBXC 3T2OA 3VXPA 5HHVL 2NPLX 3QUZB 4PRHE 3ARXA 1J87A 2PYEB 1TJIH 4Z7UF 3UTSE 1YA5A 2DQIL 4Z7WB 4XNYH 1L7TL 4NCC2 4CU6A 5FB8A 4U7MA 5JDSA 4C4KT 5LCVH 3MRIB 5GGQL 4PJFB 4U6YA 2PYEE 4JFHD 1GZQB 4LARH 4HKJA 1A1NA 4XCEA 4LPUA 4E41D 3JTTA 3QNYA 4GKSA 1IGYA 1F6FB 3MJGX 3JUYA 5D2NE 4ENEC 1MRCL 1NCWL 3VFTA 4QXGL 1WIOA 3FFCD 1HSBA 1JF1B 4UQ2B 2ZOKA 5DUPL 4AZ8A 4PJGB 4WFFE 2NY0D 3E6HA 2C1PB 4U1SB 1L0XA 2DF3A 4KJWC 4LSRH 4OM1L 3WHE1 1QP1A 1QLEL 3S7GA 4OCXH 3VGBA 2R0ZL 3RHWF 5CD3B 1G7PB 5IQ9A 4XVTL 4JRXB 3TCLB 4J3XA 4YGVA 2HT3D 3OKOA 2RQ8A 2HMID 2JIXB 3NABL 1TQCC 3MNZA 1VDGA 1E27B 3L7EB 3PV6A 3H3PL 3F6LA 4YDLC 5IW1A 3DUSB 1KIPB 1DQMH 4N8VA 2DYPA 3MREA 3RWJA 2R4RL 1LO4L 3DRTB 3K1DA 1CFVH 5DRXA 3IETB 3WJJA 3RWHB 4ZG1A 4G9FB 25C8H 4KZEH 2I07B 3DTXA 1J1OL 3NIDF 3LH2L 5AZEL 3BSZH 3BAEL 1AXSA 1YECH 1P7KB 2BVPB 2I24N 3G08A 4O5LH 5B39G 4D9QD 3MLYL 5L2JA 1JGVL 3BWAB 4QTIH 4CDHA 5HVHB 5JHLH 1OGAE 2EYRB 3N0PB 3ILQD 5I1IL 3MRBB 1WBZB 4CU8A 3M07A 2FIKA 1MHCA 1FQ9C 3BKJL 3D1MC 1ED3B 3TYGL 1L7IL 1UB6A 4NWTL 1HHJB 4QXWA 4UDTB 2BSRA 2P5ED 4LCCA 4GG6B 3LAFA 5DQDL 1AI1H 5DTFA 3SDDD 1AC6A 3BDYL 3IJYA 4PRBB 5C0NC 3AU1B 5FA4A 3W9EA 3L3KB 2OS7A 5I16B 4IM8A 3UJJH 2IBZY 4GKZB 4HLZH 5I76A 1EXUB 5EFIB 2ZG3A 3AXLB 3UX9B 5I1LB 1GZPB 1WBXB 3B9AA 4PJBB 2W0FB 3WS3A 2DQCL 2ED8A 1U91A 4WO4B 3BKML 3P0YL 2FATH 5DZNA 3RZCD 2YN3A 4LASH 4RA0C 3G5VA 4YNYB 3QEGL 4PRHD 3TPKA 1CE1L 4XH2A 4U1GC 4DGIH 5I19L 4LVNC 1ZLSL 3FB6A 3MA9H 4PGCB 2FEDC 2C4FU 3RZCA 2A74B 4J6RH 2DQHH 5JW4Q 2CUHA 3TP4A 3FTGB 3BQUD 3MV9D 5I1EH 4RGOH 3C5SA 3DMMD 1BFVL 3BE1H 1CS6A 4FQHB 4KI5E 4QT5A 3ZT7A 3RIFF 1IGFH 4KV5E 4Y5VA 5SX5H 4J3WA 3MNWA 5IGXH 5K59F 3QNYB 5C9KA 3OR7B 4LDOB 4N9GA 2HJFA 1G7MA 3IKKA 2E27H 1L9NA 3RGVA 3HE7A 2KQMA 4FQCL 1DANU 1OAZH 5C09A 1QPXA 4Q0XH 3EJYC 4CDGC 4K94C 3CVHB 5C0FB 4IDJL 3MFGB 2IC2A 4LVHB 4MAYD 2A73B 5GGTH 1I9IL 4OZHB 3DURB 3ROOA 2E9BA 4YHIB 4HSQA 1LDPH 3KPSB 4M3KB 2OYPA 1MCIA 1Q72H 1RJZB 5E94B 4I8DA 2Z92B 4HG4J 1JNNH 4LLWB 1WT5C 4MWFB 4QOKA 4DKFH 4JDTL 1G9EA 3CLFL 3HC4H 4NZRL 5T1MB 2HYMA 4Y16A 1XEDA 4GMSL 1IQDB 3HFMH 4G9DA 2P47B 3VW3H 5CBEB 3FN3A 4LLDA 3MGTA 3GO1L 1T5WB 3P4NA 4RMRA 3ULUL 1X6LA 3EJZC 4K94L 3LV3B 4ODXB 3GIVB 3NFPA 5FA3A 5CZXC 4BFIB 1U3HB 3QG6B 1CFNB 1MQ8A 4KHTH 5EDXA 3QA3A 4LOUD 4YPJA 3O3AA 1RUPL 1U6AH 1LNUB 3UC0H 4EI5D 3M1BB 4WWKB 4XCCH 4PJHF 1QO3A 1UQSB 2HFEB 2VJXA 1QRND 1TZIA 2VXTL 5DK0B 4JQXC 4J3VA 3MRBA 2J8OA 3OKLB 4DKDC 4JQIL 4H25B 4PJ8C 2E6PA 3D2UB 2ICEB 5B3JE 4UT9L 3SDAC 4ZO6A 3VXTB 1PAMA 2ESVD 2Z35B 1JWMB 1MCJA 3QUKB 1J12A 5E4IA 2NY6B 3D18A 4NP4H 4JFDE 3IFOA 2BXYA 5C6PB 2BHUA 2VWEE 2VABA 1MFEL 1D5MA 4J7RA 1P4LB 1S5IL 4JZOB 5JW5A 4NZJA 3STBA 4ODHH 3DETD 4QCIB 3IDIA 4PRPA 4ZXBC 4NO2B 1R5VA 4GXVL 3PHQA 4WWID 3VE0A 5EFIA 4M7ZC 2DI7A 4QRUA 5F1IA 3VI4E 5L0QB 4PJCF 4UV7H 3VCLB 5I6XC 5GGRY 3EIFA 4XX1E 1HWHB 4XRCA 4MNHA 5D7LB 4HWUA 1U8NB 3SY0A 3TVMD 1FC1A 4WTWA 3VXTA 3FOMA 4HLZG 5E8OB 1C12B 2NX5B 5E2UH 5JHLL 5E6IB 5DMYA 1S7SB 4U0QB 3CFCH 4P5KA 4RBPH 2HKFL 3L3OB 2DJSA 4G6JL 1F11A 3FTGA 1AGBA 1UYWL 5HHPB 3C2AL 3UCRA 5DS8A 2Z31C 1A1MA 3GHEL 3Q6GL 3QNXB 5DO2D 3UTTD 5FM5O 5F7FA 2E8YA 2E8ZA 3HLAB 2ED9A 2FGWH 4FQ1H 5JZ7C 4B53A 4QRPB 1I1FA 4NM8L 4O4YL 5D1XA 5M7QA 1OOAA 1N3NA 1A1NB 4XCEB 2AXHA 1LILA 2I5YH 2YMXH 3R1GH 5H94B 2ZUVA 4K7PL 2V9RA 3RWFA 2ATKB 1S5HB 1EX0A 1U8QA 3A67L 3SJVD 2DYPD 1C16B 4FXLA 3GSQA 2A6DA 3H6JA 4PJIA 3FB8A 4NCDA 5CUSH 4C56A 1IJ9A 3GSWB 4GW5B 2F53E 4PRHA 3HG1A 1MFDL 5DXWA 3VMPA 4XC1H 1KIQA 4Z5RA 2CGRL 4L3EA 1MEXL 5CD3A 1I7UA 3Q6FA 1T83A 4UI2A 5IMLA 3BQUA 1DEEA 5HI5C 2P1YA 3QUYD 4D9RE 3L9RA 3ILPA 4P2RE 4OIIH 5F6IC 2GUOA 4Y4HC 4NUJB 1ZLVK 5ID1A 3BESR 1NGWA 3T4AA 3VXRD 1BFOA 5I8CB 3BP4B 3W81A 5F21B 5IM7B 2WBWB 3BZ4A 1J1PL 1OF2B 4PLKC 1L7TH 2J2ZA 4Z7VA 3N85H 1EAJA 4ZUWA 1JNJA 3MCLH 6FABL 5J13C 4G80B 2FECI 5HI4C 5HHQB 3VXMD 2YD2A 5I1IH 1I85C 3K4ZA 5CP7B 3MUGB 3V8CA 2DRUA 4W4NA 1OD7A 3VWJD 3QQNA 4ZO7A 4YWGH 1UG9A 1BVLA 1MNUL 4WW2B 1K8IB 1D5MB 5C0AB 2XFXB 4HAGA 4XMKL 3CK0L 1Q1JL 1RURH 4K9EH 5HYQB 1KPVB 1J18A 1AGFB 3F8UB 2X41A 3DGGB 3UJIL 1UM4H 1H5BB 4FFYH 3SKNA 4XCNA 3CFIC 3QR2A 4J2XA 3X3GH 5HYFA 4ONFH 4LLUB 4P9HC 3HUJB 3D9AL 3MUY1 1KV3A 1FZKA 3ZMRA 5FOBA 4ZFFA 3IDNB 4OUUB 1P7QA 4XNXH 4XVJH 1MHHB 3TIDA 2NY2D 2O5XL 1NLBL 1T5XA 3G6DH 2W9DL 1EEZB 4K23H 4MX7B 3W11C 4KK9C 2O5YH 2R2BA 4CADA 3AREC 4H1LA 1JZ5A 3E2HC 4EQ2A 2FCBA 3QJFA 3G04B 4PRDB 2IADA 1BVKA 3IDXL 1BHGA 5FKAB 4Q9CA 2BVQB 2ARWA 3U0WL 3FQNB 3AAZA 3VXUB 3GGWA 5HHOD 3I6GB 32C2B 1QQDB 4OSUH 4PRNB 3O6FB 4MD5B 4FG6C 3V6ZB 4HUVA 4TVPL 3VMOA 5A43C 3VXPB 4G7VH 1EVUA 2EEAA 3UTPE 2A77H 3S36L 3VFSB 4ZUVB 4CN1A 2IFFH 1ZA3A 3WJJC 1XGQA 2BZDA 4PP1D 1BIIA 5D96C 4Y0GA 2F53D 1KSRA 1YEKL 3ARDB 4QOKB 3WE6A 1XCQA 2EYSB 2ICCA 4KQ3H 3P2TA 4LCIL 1U8JA 5B8CA 4NCC1 1FVCB 2H32H 3MRKA 3A6BL 5JLZA 5J6HB 5IB4B 4UTAH 5GSVA 3IAQA 4JHWH 2B4CC 4XNMA 1P4BL 3BO8A 4HKBB 2XN9A 3B3IB 3CDGA 4L8CB 3O45A 3SJVA 3C6SA 2EDLA 2AV7B 5D1QC 3KYKH 3VFOB 5MEND 3OHXB 3V4UL 5FO9A 2QKIA 1CL7I 3I3EA 1A6AA 1V8HA 3OAUL 1S9WA 3SQOH 4WI7A 3CSYB 1FGVL 3MLZL 4M9OA 5HPMA 4QLRA 2CDEA 1FAIL 1Z2KA 4G6KH 4XBPA 2DQJL 2RR3A 3GSUB 4K2UL 5J11C 1NAMH 4NOBA 1X5HA 3F7RA 4PRIE 4CU7A 5B3NA 5BV7L 3CFDB 3U83A 4KRPB 1OP9A 3P11L 4L9LC 4NZDA 4L8DB 2NR6D 4K3HA 4WVRA 5EIQA 3EOBB 4JKKA 5KN5A 4S10A 4RAHA 1QOKA 4PGEA 1FRGH 3LN4A 1KJ2L 1XR8A 2A9ML 1AY1L 2RHEA 4RMVA 5ADPH 4PJGA 15C8H 4JZOA 5JW5B 4X6EA 3MGAA 4OQ1A 1F4XH 1KJVA 1NCUA 5LKNA 4Y5YA 1H15B 5HY9A 1JFQH 4M1CD 3OKMA 4JKMA 1FHGA 4MXVF 3ZKND 2OR8A 1X5IA 5GXBB 3JXAA 3VW3L 3PQYB 1HWGB 1TVHB 1OAKH 5EN2B 2NX5D 3EJYD 3FFCB 4X8JA 3CX5J 3MO1A 2DDQH 5CINH 4ONGL 4PJ5E 1KELL 4J4PA 4EJ1C 3ARFB 4LPTA 5E5UB 2NNAA 4Y19D 7FABH 4C56D 1HHJA 1KG0A 2QADB 2PCPA 3TN0A 2L7JA 1KJVB 2Y1VA 2OX5A 5F1OB 2YK1H 1IEAB 1OSPL 4IRJA 2VLLA 1CD1B 4JRXD 4LCUA 1WT5A 4LDEB 4LSQL 5DRWA 4QRPA 3QUML 5F72S 2F54D 1DEDA 1T22A 1B9ZA 3VXUE 2JIXD 2WNGA 4JM4H 4JO4L 4NKDB 4I2XE 4IS6B 4G8FB 5FF6B 1CCZA 4LFHG 4GBXA 5BW7C 3BW9A 4OFKA 3VFSA 5IVOA 1C7SA 4R2GB 4M8QB 3RA7L 2ICES 4GAJL 4H5SB 1NUFA 1P7QD 2VR4A 2VTFA 5EU5A 5F7UA 5BS0E 1OAQH 1T80A 1D9KC 1FVDA 3F65A 1RZJL 3PL6D 5EZJB 4ZSOE 4HBQA 4PJGF 5DDHA 3TF7C 4M4RA 1IAII 1CGUA 1DUZA 3VFUB 3MLZH 3CNKA 5T1LB 4D8PB 4BQ6A 5EULV 2FD6H 4OD3L 4WENB 4ZUTA 3FT3A 4OQTL 4JAMA 3KPRE 3GMPB 1JF1A 3L7FB 3QFJE 1I9RL 2AGJH 4G6FD 1IC5L 3GSNH 3LN5A 2C1PA 1IC7H 2X09A 4U1SA 3V79C 3KYOA 1NJ9B 3P4OB 2B1AL 1KJ3L 2R2EA 5J12C 3Q3GB 3AY4A 3VXMB 4FFWD 5JOFA 4JKWA 1OAYH 3CFBB 1BJ1J 4PJDF 5D7JC 3QUMA 4NO0B 1BJ1H 4OM0H 1RFDL 5J06A 4NM4L 2KL6A 4L1DA 3MRJB 2PXYA 3ARSA 3RKDC 2O61B 1JRHH 3F7VB 2N1KA 3MGOA 4R96A 4JZJA 2UUDH 3BJ91 3IAPA 5E8DL 2G5RA 1J05A 5DD3H 5FYKD 3TO2A 3MV9B 1TJGH 1NJ9A 2VIRB 2M26A 4WFED 2ADFH 4G6MH 5TGBA 4LVOB 2NY1B 3OJ2C 4GRWB 2CDFA 2A1WL 4PG2A 4YX2H 1GGIH 4KGLA 4JRYB 1H3VA 4ZUSB 3DVNB 4GRLB 1WICA 3TEUA 3U7YH 2EH8H 2HJKA 2OLDA 3IFLL 5HHNA 3TBWA 4Z8FH 1JF6A 3IXAA 5IF0B 4BQ8A 1CGSL 2YSSB 1BZ7B 1IT9H 1KJ2H 4QY8A 2BHZA 4LHUD 4YBLC 5FYJL 4MXQD 1TITA 1JPGB 2VERN 1J8HD 2D03H 3TZVA 3W2DH 4DEPB 2GK0B 3FQWB 4J4PC 3LZFH 1FN4A 4JQXA 4TVPH 1RVFL 4Q74A 3MOQA 2YC1A 4WI6A 3LMJH 3LIZL 3QXAA 3UYRL 4L8BA 2J8UB 3DGCR 1J0JA 4M9PA 3QEGH 2R9HC 4GKNA 4OFVA 1U8HB 1EXUA 3S37H 4XAKE 3MOAH 1I1AD 1M7IB 1AQKH 5J0BA 3FB7B 3O2VH 4PGZA 4JFXB 1AO7A 2HT4D 4P46A 1U92A 2D7MA 4JG0H 1WV7T 2Q86B 4KPHH 3VGHA 3TZVB 3KPOB 4ALAL 3HG1E 5JW3H 3B9DA 1A6TA 4HH9B 1MVFA 2VC2L 3LKQB 1MY7A 1MCWW 5ICXA 2BMKB 3QPQD 3CZJA 4NHCL 3PNWB 5IW1B 1BJ8A 1DBMH 3CVHL 5KSAB 4ONFL 5F3HB 1ZLUK 1BOGB 1BAFL 3DXAE 4JN1L 3L3DB 2NY2C 2BCKB 2XTJB 1JRHI 5L0QC 4NNXA 1F3JB 1OTSD 4DZ8B 2DM3A 4TNWK 1ZVSA 2VDPH 3BHBB 2IQAA 1ZAGA 1BD2D 2YKLL 5HGAB 3S35H 4BUGA 2OTPA 4URTB 5TE6L 4OZIB 2FIKB 1T66D 4ZFGH 4F37F 5JOPE 4UIMA 1NLDL 5C0CD 4N0YL 3SO3B 4GG6A 5DK2B 1UH2A 4PLJC 4WEBL 3V9FA 1TETH 4N0CC 5HI3C 3FKUS 1U3HD 1S7QA 1WEJL 4ZFOL 1KCLA 4GKZA 4B50A 4S1SL 3D6GA 1U3HA 3C6LC 4HIEA 2W60A 3MOAL 4F7PB 2A6DB 4KUZL 4GKOA 4BFBD 4N0FA 1EMTH 5IV2A 2NY3C 5DTFB 5GGTA 4TUJB 4WFEE 2D0HA 4BQ9A 3RDTA 2F58L 4O02L 4QRRD 2YD9A 2BVOA 1UVQA 5IHLB 3HPLA 1ND0B 3OKLA 2HFFA 4G7YL 2A0LC 4N90D 5GGVL 3RDTD 2AEPH 5C09E 4POYA 4UNVA 2VZTA 1JBJA 1NEZA 3C2AH 1SJVA 1F4HA 4P2RB 3MBEC 5F7EH 3IDYC 2NXZB 2AK1H 1UB6B 1LO0L 2ESVE 2J8UE 3BT2H 3O3DB 1RZKC 1TVDA 1ZANL 4XPFL 5E6ZA 3HFML 1T03L 4PRPB 1GXEA 3SDYH 2YMXL 2IAMD 3FO0L 5D7LD 1IGCL 4OTXL 3ES6B 4GQPH 4QF1A 5DHYA 3QEQA 2DTMH 1S7TB 1A7OH 2LU4A 5IVNA 5DGRA 4BFEA 4BSJA 3UYOD 4JN1H 3TESA 3ZKMC 4ETQA 3KDMB 3SDCC 3K8KA 5CKGA 3OQ3B 5F6IB 2EIZB 3MR9A 5ALCH 5FDWB 1WAAE 3JWDC 3MFFA 1T5XB 4UT9H 3TBSA 1B0GB 2X4QA 2EEBA 5F6HJ 3WNLA 1PZ5A 1MOEA 3LDBC 4EDXB 5HVWA 3U1SL 3IRZA 4O2EB 1LK2A 2WLZA 2A2QT 3VXOB 3WXWH 4JFQA 2CMRH 3LQAC 3MV7E 5DRNB 5EBMB 5CBEA 2YD1A 3MRHA 4FQXC 4ERSL 4DQOL 4R4BA 4PJ7F 5H8DA 3HZMB 3P9LB 3T0EB 5TE7H 3V6ZA 4CVZB 1MPAL 3LN5B 3VWJC 1OB1B 3EDKA 3PE9A 5JPNB 5D7IE 3RWGB 3QG6A 2X70A 3KPSD 1R0AL 1C5CH 5CGMA 3FT4B 2VQ1B 3HS0A 3G5XA 1CL7H 4FZ8H 4YHZL 4KDTA 5IBUG 4HDIB 1RZFH 2ZJSH 1GJIA 1TZIB 1TJIL 4ZFZA 1YEFL 2VE6B 1ERNA 4KMTL 2DAVA 4HCRL 4UBDD 3MRIA 1QSEE 1OARH 2DICA 1Q1JH 1BVKB 3HMWH 4IOIB 1T0PB 1KNOB 3T0EA 1HZHL 1S9YB 4NIKB 3O11B 5EU7C 1QLFB 2E5EA 1CFNA 5DEGB 5D2LB 3VFRA 4HEME 3MQIA 2D9CA 2YD6A 2GYSA 4DCQB 3U79A 1M4KA 2ITDB 1BBJB 4GSDL 2I27N 5C8JA 3HZKB 3NCJH 3NCCB 4BH7A 2F5BH 5F9WC 2YBRA 1PLGH 3ZKXC 4OKDA 4BELD 5CILL 4XPTH 5L6YH 1A6ZA 1X5KA 2R0ZH 4W70A 5AAWA 4F7MA 1DBKH 1RU9H 4GRLC 4HKXA 4P4RA 5FECB 3O11A 1I7ZA 1KENH 2YEZB 4X7TB 2R8SH 3NZHL 2R0KL 2KDGA 1AGBB 1INDL 4G7YH 1J8KA 3JV6B 2EC8A 1S9XB 1RUKH 2JB6B 2JJUA 2FNBA 2QKIB 3SKJL 2OMNA 4OM0L 4BQCA 5DA0B 1JPFA 1OPGL 4HIIB 1KPUB 1IARB 1KIQB 1MAJA 2AJ3A 4YDIH 5C9JB 4KY1L 3KXFA 1RD6A 5HGHA 4LKXB 1R6VA 1VPOH 1QNZL 2X4UB 4WNQB 1BD2A 3RIFK 3NGBC 5DQ9B 1U8QB 1ZEAL 4YBQD 2PW1B 4Y8AA 5DC0A 4W68A 4WI4A 5C07B 2JB5L 1L9MA 1LO5A 1SHMA 3GMOA 2Q8AH 5HHPA 4GW4A 4FFWC 1AHWC 4YDKL 1YUHB 3M8OL 2FX8H 4KK5D 4RIRA 3QUXA 3UTTB 8FABB 2CRYA 2FX7H 2NZIA 3C5JA 3D3VB 5E2WL 5C0IB 3DMMC 3HE6C 3GI8L 5C08A 4L3EB 3B5HA 3ARZA 2COQA 4UT7H 3QUXD 1NKRA 2ZNXA 1ITCA 4YHLL 2F5AH 3HR5A 4FQLH 1A5FH 2ITCA 1J88A 4Z7UA 1HINL 4R97C 4U1LA 1KXQE 1KTDA 5JPNA 3FO1B 4WWKC 1KELH 4ODUB 3F58L 3O4LD 1D9KB 4LSDA 4XPAL 3LKNA 1CDBA 5EIVA 2EO1A 3BQUC 5CBAA 3V95A 4ZAKA 4JRYE 4N5EC 4WW2A 1VCAA 3QH3A 4HUXA 4RAUB 1I8MB 4ZAKD 3T0BA 4F80A 5DK2A 3KJ4B 1IEAA 2B5IC 4ZOBA 2NW3B 4JFYA 1ZLSH 1QR1B 1FVEA 3HI1B 3RJDA 2XY1A 3RL1A 4DZBA 1H5BA 3JWOL 4OM1H 5AYUH 1TZHB 4MAYC 5F7DB 3IKCB 4I77L 3BD5A 3NCYS 3CXDL 1DJSA 3B5TA 3DIFA 4G9FE 1D5XA 3ZE0E 1QZ1A 2G60L 2IANB 2F58H 3MRDA 1QPPA 4Q97A 1L6ZA 3P3YA 4BK5A 2FB4H 1KENL 2FYYA 1J10A 3WJLA 5IIEB 1JUFA 4RGOL 1LP9E 1JMXA 5DYOA 3V6BR 5DLML 5DFVC 5IW3A 4DVBA 1D5ZA 4HF5L 3LRSB 1A6ZB 1MIEH 1XR9B 5GQBA 1ZLWK 1YEGH 3EYVB 3TYGH 4X7EC 4HUWA 3ARGB 4PGEB 5C0JA 3ARBA 3GNML 4WCYL 1WQVT 3RKPA 5DQDH 3KPRB 3N1PC 1HK6A 1SBSH 4RAVA 3MGTB 3ETBF 2V6HA 3C08L 2Q7YB 4L8SC 4LHUG 1KCUH 4CJ1A 2IAMB 2F8OA 3Q5YA 4MD5A 2LU7A 5IBLD 3WN5C 3PWUB 2F5BL 4PTUA 3UJTL 1UYWH 2P8PA 3UDWC 1KPUA 4X6BB 1G6RB 3DVNA 3NA9L 1MJUL 5JNYB 2CDGA 2R2HA 3V4UH 3A6BH 1A9EB 2FLRT 1PG7L 4N1CA 1GPOL 4AJ0A 1GHFH 3B2VL 3CVIH 2XOTA 2WLYA 4LRIC 3RTQA 1JYWA 3VJ6A 3S8WA 4UILH 1A02N 4QRTB 4AL8H 1YNKH 2DQEH 4U33A 4XVTH 1QSFB 2WP3T 2YC1B 4M02A 4NKOB 4HS6B 3P73A 3UPCA 4R26L 3UROR 3B2UC 4P46C 5LGHL 1GVIA 1WK0A 1Z9LA 3SKOB 5BVPH 2W65A 1AY1H 2AXJA 2ZUSA 1FNAA 1OAZL 4F7TA 4G8EA 2MPAL 4KMTH 5DRNA 1AIFB 1JHTA 2F54E 2MCPL 5F70A 4C55A 1LE5A 3C60A 3CFEA 4JO2H 5FGCB 1ES0A 1YZZA 4PPTA 3DARA 4NN7C 3MUHL 5L8LB 3QEHB 2EECA 5F7WC 3RWGA 2FD6L 1QFWM 2BNUA 1IGIH 4RQQA 1QNZH 3UYRH 5CGYC 3QJHB 4JRYD 1BGXL 3HAEA 1DVFB 1BQLL 5FFLA 1XZ0B 2VR9A 5EC1B 2VDRL 3PV6B 5GZOD 4JGMA 3B9VA 1KCVL 4EUPH 3EYOA 2EICA 2H8PA 1AIFA 3T3ME 4OGAD 2BY0A 1UJ3C 2R1XB 3SCMD 1XF3B 2B2XH 5KVDH 5IB5B 4JDZA 5I1KH 5L7XH 2ESVB 3GEWB 4F7EA 3QEHA 2HT2C 1NCCH 4RWYH 1L4IA 2FJGA 1AXTH 4M43L 2G9HB 1JHKH 2ORBH 3FO9B 1TZGL 2EDKA 3LHPH 1E4WL 3LVEA 4NBXB 4BSVB 4G6JH 4U2ZA 3QCVL 1I8IA 3OKYA 3ROLB 3L3IB 3RWJB 4CVWA 1IQWH 3E1F1 5D7IA 5C0GA 5I1AA 5TJWK 3RWIA 1Y0LA 2R1YB 1A4JB 3R06B 1I1CA 4BZYA 4HUWB 3KXFD 3EYOB 3Q6FB 3BZDA 4RZCB 1CQYA 2EC9T 3MYJA 3IDMA 4YDVB 1N5YL 1MVUB 4IJ3C 1RUMH 3WDHA 3SGEI 4C83B 2ICWJ 2OSLB 3L6FB 5FO8B 4U6TA 1DE4B 1YPZB 1EUTA 4PBWD 2DBLL 2H6PB 4LMQI 4OJFL 4DUXA 2IPUK 5EOTA 1MAML 1Q9WB 3I50H 1CL7L 1NDMB 3MV8A 3PJSA 4OZFH 4M8QA 4PB0H 4R3SB 5GRVL 4KXZI 2FX8L 2VNCA 4U1IB 1CD1A 4LCUB 3DWTA 2AGJL 1MEXH 2ARJA 3DSFH 5JMOC 2XY2A 2ZSWA 3O3EA 1MFBH 4LLMA 3QPQC 1WWAX 2XXMB 2BC4B 2NY7H 5I1DA 3G5YA 5D70L 3WD5L 5D8JL 1L6XA 1N8ZB 4S2SB 1GC1L 3NTCL 3IT8D 1YY8B 1C08B 4J3OC 4N0UA 4QKXB 5HHMD 1QLEH 3ZYIA 4JGUA 4M6AA 4ZFOA 1NAKL 2WBJB 4ZODA 4UINH 3ULVD 3FT3B 2JF1A 3VGAB 3U36A 1CD0A 1EBAA 5EORL 3GUTB 1NFDA 4KKLD 4DGYL 4AG4H 1HXMA 5EIIB 1G9MH 3UTQA 5BV7B 2Q3AA 1IGIL 2BFVH 5C0FA 3L5JA 4RRPG 5J6GB 2P5EA 4Y5VB 2B4CH 3ROOB 4E42B 5GRUH 1K4DB 5JXEA 4QT5B 3LQMA 3EJJX 2V2TB 3K2UH 2C3WA 5D4QA 1R3LB 2RB8A 4NKDA 3JWOH 4YC2C 4S0TD 5C09B 2APTA 3QUMB 4FQ2H 2EDWA 2EH7L 1ZT4A 4R9HA 4NRZB 4P2QA 4PB9L 1WLHA 3L5WA 4WI3A 3VI3F 4PJXA 3BMWA 2YD8A 2EIDA 3H9SB 1P7QB 1ONQB 3WLBB 3C8HA 3DO3A 2G75B 1JZ3A 5EO1B 4M03A 4E5XA 3L3DA 3QDHA 2IPTH 4Z76A 3MUJA 1RZKH 4GRMB 3VWJB 4ZUUA 3BKYH 3DUHA 4LPWA 1NC2B 5T1LA 3SQBA 2AXGA 3MSPA 5DURD 5JW3L 5INDB 5FM4A 5DJ8A 2FO4A 3RUGA 3V5HB 3CSPA 3HRZA 2YXMA 1DBAH 3O6FA 1YDPA 4WWKA 1Y0LB 4L3CA 5BZDA 15C8L 1Q8MA 4I3SL 3SE9L 4M4PA 2ZOLA 2DD8L 1I3UA 1JF5A 1QR4A 1FH5L 5E2TH 3VWJA 2GFBB 4CRPA 3FOLB 2WUBL 4B41A 1AQKL 1JVKA 4JJHA 4HX1A 2C3GA 2BSSB 2D31B 5IMKA 4OLYL 3TNMB 2H3NA 3EGSA 4PLJD 5EOTB 3NZ8A 2IQ9H 3OSKA 5DD1L 1RPQA 2YPVH 4NQEE 2ZZUT 3IETA 1CR9H 3QWOA 4U1KB 5DD5H 3SDCA 5F1SA 4IRSB 4EOWL 3X3GL 3RDTB 3QXVA 1J5OL 5IB1B 2DMBA 2HVKB 3DXAA 1CD9B 3OPZL 3OXSB 1Y6NR 4S1DD 1HYSC 3S4SB 2X4RB 3CH1A 5DUBB 3OWEA 3H9ZA 5EUOE 5HHMB 4QNPF 3QO1B 3OMZA 2AV1A 5I18H 4GAFB 2VDKL 5BZWB 4HJGB 3MROB 4JO4H 5GSRB 2E7MA 4J1UB 2ICWI 2K9UA 1BREA 3I6KB 4LGPB 4P4RB 5FECA 1EO5A 5HHME 3BMVA 2GK0A 1YN7A 2YWZA 3E3QE 3FQWA 1S7RA 4PB9H 4D0CA 4PP2A 2Y06H 1NGWB 3T4AB 1ZHKA 3P73B 5FYKL 5JZ7D 4V1DA 3NCBB 3OAZH 2VL5B 5CHNB 4GMTH 2E7LA 3H3KA 3RZCC 2V2TA 5TE4L 5AEAA 1R5IB 3HLAA 5K9QI 1BBJA 1ACZA 1MCCA 2APFA 3ZKMD 3JVGC 4JGJA 3WNOA 3QO1A 4JN2A 4Y16D 1G9NL 3EJZD 2V17H 2VB5A 4Z5RB 3X12A 1WUNT 2IANE 5EORH 4QXUH 5K93A 4IHOA 4HKXB 4YHZH 1I1YA 1G7LB 1KCUL 4Q6IA 2NYYC 4OZIA 3MFFB 4E41A 2R69H 1IC5H 4YHPB 4NT6B 4ZSOA 4DKEL 1KTRL 1N59A 3VD5A 3LEYH 3MRRB 1HOCA 3RWEA 5C0RL 4OLUH 5IMLB 5ITFB 2HLAB 4LBEB 2Z8VC 3VXOA 1N6UA 1PDKA 2AEQL 2XTJC 3IJSA 1CDYA 3IDJB 1MRCH 5JIHA 2ZSVA 3HC3L 3X3FL 2VDML 4LCYB 5D8JH 2X4PA 1XT5A 3ARBC 1BFOB 5I8CA 1KB5A 4HKZB 3V7AG 1NEZB 1DUYB 3LQAH 3HE6D 1K85A 4LPXA 3MV8D 3FO2B 2Y72A 2CO7B 4L4VE 3RNKB 2X1PA 2DQTL 5C0CB 1V3KA 2C7UA 3PDDA 2IG2L 2W38A 1MFCH 2HA1A 1HNFA 5E2JA 1OP5H 4OD1L 3C6LD 4F33B 5ACMA 4JFYB 1RJLB 1AH1A 1KLFA 2HKFH 4MX7A 3WUWA 1Z5LB 4C57C 4KJQD 4JDVA 1S7TA 4TNVF 1C1EH 4NC2B 4HC1A 1DQML 1ZWIA 1AGCB 1KN2H 5JHDE 3QUYA 1ZHBA 5D5MF 1NEUA 2VZUA 5FYJD 3ZL4L 3TPUA 5MEPB 3KJ4C 4G42A 4KJYB 5KSBF 2K1MA 4J6RL 3UO1L 5HVGB 1KCVH 4Y4HB 4OFYA 3VGAC 4KI5F 1S5IH 5KZCB 4FQXD 2AXFB 4FXKA 3TWCL 3D2UA 4S1RL 1I7TA 3FONA 3HI5H 1T04B 3BPCA 1UZ8A 3KPLA 3X13A 5EU3A 3QQ4B 3HTLX 3J7HA 4ACPA 4Q9QL 2PXYB 3UPRA 1NBYB 3KDMA 3D85D 4HXAL 3CFKA 4NO5B 1FYTB 1KEGH 3B8YA 5A16A 3BPOB 1MPAH 3A6OA 3INUH 3PGDA 3EO1A 4FQQB 1H0DA 1GH7A 4Z7WE 5E8NB 1IM9A 1R0AH 4I18B 2VDMH 3ARVA 3SDXA 4F3FA 5DD1H 3CDGB 1RMFL 1LP9B 1CLZH 4MJ6B 4Y4FA 4CVUA 1JV5B 3MLXL 3A67H 3QDGA 3K4DA 1V05A 4QHLB 1X9QA 4EI6B 4IRJD 2EDBA 3BKYL 4EN3D 3RUGF 2IAND 5GGSY 5A1AA 3MRNB 3V0WL 3RQ3A 4QRTA 3LEVH 3SE4A 3WIFB 5IUSA 1XGQB 2LVCA 5IK3B 4XXDA 3MRRA 3EOBA 1N5AA 1FLTX 2MCG1 6CGTA 1NEZG 3SDXB 2A1WH 2DMCA 5KVFL 5LGKA 4DVRH 4PJBF 4JO3H 1QYGL 4PJ8A 2J8UA 1I1FB 2YUXA 1BEYL 3DI2B 3MRKB 5E99H 4ODSH 1N0LA 1JPST 1E4KC 1S7XA 3QQ3A 5DURB 3T77B 3B9KC 3IFPA 1HE7A 2XPGB 1S9WB 1MUJA 4NRXB 2X7LB 1EHAA 4ISVB 5D2NC 4H8WH 1XF2A 4L8CA 1AGDB 4ZAKB 3CLEH 1RZIB 4GLRI 4TSCH 4XVSH 4AG4L 3I3BA 2EYRA 1I8MA 5J4MA 4ZNEE 4YHMH 1YEGL 4EBQH 1N0XL 2CD0A 3MRMA 2HG5A 1UT9A 4EDWL 1NFIB 2HRPH 2HVJB 3TYFA 3WN5A 4HXBH 1FZJB 5E1HB 4ZFZB 3MOBL 1OPGH 2Y07L 4QTHA 4PRBA 1GCFA 5DD5L 1A3RL 3TBTA 2XKNA 5EBGA 1AE6L 3DLQR 1MCEA 1MI5D 5BMFL 4Q9QH 2BHYA 1WITA 5EBLB 3AXLA 2OQJA 1NGPL 3EO9H 1AKJA 1FLRH 4NPYB 4TOYH 2E7HA 4L4TE 5DHVH 2ZNWA 5CEZH 3WHXA 5T33L 1BZQK 1I7TB 3FONB 5MEQA 2HT2D 1JPFB 2VLRD 4P9MH 3IB4A 4FQIH 1WGOA 1FBIL 2LVEA 3RY6A 1FFNB 3NIFE 2GITA 4JCMA 4X8XA 5E2VL 1FNHA 5DRWB 4FFZL 5B38B 2EH8L 2AK4D 4NQUA 2IPKB 2YUVA 5A2LH 2ED7A 3CPLB 4HK0B 1F3DJ 3F58H 3S35L 1KG0B 4JB9L 4YGAB 4MQTB 3TGXA 1LEKB 2XRAH 2NNAB 3CIQA 4WW1B 4F3FB 1WBYB 4XMPL 1XH3A 1T83C 5GRVK 1PY9A 2IBBA 1MJ8L 4U6HA 2DWDB 1HEZA 4OZGF 2BY3A 5E6IC 1CGYA 5I1LA 5BXFB 3ZTJG 5CJXA 3WYRA 1EEYA 1ZOXA 5I74C 3S5LG 3HE6A 3S37L 2JK5A 2YZ8A 1ZGLP 4P9HL 1MIEL 5DRZA 4MZ2A 1W72L 1IQDA 3ULVF 3FB6B 1A47A 2MTPA 5CIPB 1IVLA 1NGXB 1BF2A 2JJTC 3GMPA 4GJTB 5HYJB 4L3ED 4GAGL 3QHTC 1JCKA 2IBGA 2HRLA 3CX2A 3PWPA 4FZ8L 4WIQA 3LCYA 4XNZB 2QHRL 5DD6A 3P4OA 3RL1B 4DZBB 3KYMA 3REVB 1ZSDA 1L0QA 1QQDA 4PRNA 4HCRA 3FRPG 3CAFA 3MBEB 2BNRB 1D5BB 4HKZA 4XPHH 3SOBH 3O4LB 5T3XD 3HE6B 4APQD 4LKCA 1INQA 2MQ3A 1C08A 2C3HA 5CUSL 2FJHB 4FTVA 2IANA 5SWSD 2WK2A 1UXSA 1FNSL 2R0WL 2B5IB 4HT1L 4QNPE 3QI9B 4PYGA 3BPLB 3VH8B 1YMME 1N5YH 3CFBA 2EE9A 2VQTA 4W6XB 2OR9L 3BP7B 2J5LC 3E6FB 4PGDA 3PWNB 4I48B 3BKJH 4X9IA 5IB4A 5KS9E 3L5HA 3L3HB 2ERJC 4O2EA 3O6FC 1SEBA 1X5FA 1XF1A 5HDLA 1A7BA 1QKZH 1KEML 1AXSB 3BPLC 1HCVA 5FKPB 2LTQB 4OZGE 5ADOH 3BX7C 2XN9B 3B3IA 5ESQB 4WW2F 3VFTB 4P2OA 5BVPL 4CUCA 4LSQH 3ZYZA 1OTUD 1FO0A 3VA2C 5GJSH 3ROLA 5B4MD 2AAVA 3WV0A 1PX3A 1IM9D 2Q86A 5FYLL 4JFFB 2VLKD 4PJCB 5LAXB 1FNGB 5TQ0L 3SO3C 3WS6A 5DFWH 2XNAA 3GK8L 5MEQB 3BPNC 4DVRL 4PV9A 4HZLB 4LQ1A 4TSBL 2N7BA 1OAUL 2ADGB 4ESKA 1UXWA 3MJ8B 2Y4SA 2F54A 2A77L 4E5XB 2X89D 3IJYB 3TCLA 3NPSB 2VE6A 1OP3H 4HAFA 1YNLH 3IF1A 3TT3H 4MQXD 1R3HA 1XGTB 4ZNCD 4HK0A 1VSCA 4NDMB 4GBXD 1CICC 1G9ML 3L7EA 2DIBA 2HP4A 3TV3L 4WRLA 5FXCH 3T0VA 3L95B 4KJPC 4X0KB 4BH8B 1F4WH 3MODH 4G6AD 1WZMA 1Q94B 4CVXB 2UY7A 1MFAL 1F4YH 1M7IA 5E7FA 4XP6L 2MHAB 1A7NH 3FN0H 3LKQA 2PYFA 3VCLA 1U0QA 4LSTL 3DHMA 3ARFD 2RBLA 2CDGB 5DVNA 1WC7B 5HHOA 2DIAA 3H7BA 2EXWC 5TDOA 3G5ZA 3S36X 2GHWB 4XPTL 1DEEB 4X6CB 1H8OA 1W0WB 4Z0BH 3JTTB 5GISH 4TQEL 1OWWA 3DO7A 3MRPB 4OF8A 1U8IA 1JPTH 3ULVE 3RHWK 4H1LG 3WDJA 4OZHA 5DFTA 2DQFB 4ONHB 4X4YB 1D9KD 3ZO0A 1J86A 4MB5A 2GJZA 4X80H 2FH6A 5JO5A 1IRAY 3BVNA 3LKRA 4PJEE 3P0VL 3ARRA 5I1AB 5CGTA 1A7PL 3RGHA 4HMCA 4I0PB 3KS0J 1UZ6F 5H94A 1MNUH 3MLTA 4OKVB 5JA8B 1XF2B 1GGUA 3CZFA 4PYHA 5J8OA 2WWKO 2P8LA 4KDWA 3U2SA 3NPZB 1W0WA 3GM8A 2FRGP 3ZDZF 4X4XA 4O2CA 4NNPL 3FB8B 3R4DA 3H3PH 2OSLA 2QQQA 1K2DB 4ZOEA 2D7NA 4K7FB 1TIUA 1OQXA 4ELMB 2R4RH 1OM3H 4M6ML 1QVOB 4X6FB 5GJTH 1DLHB 2R0LL 1LO0H 4G6FB 5HYQA 4LIQE 3BD4A 4U1IA 5DK0A 2BVOB 5T3ZH 2AK4A 4HGWA 5DR5L 2A6JA 3W9DB 4OKVA 1KTLA 3KNBB 3DROB 4YXKH 1A7NL 1NFDE 2WP3O 4NO0D 4G8GB 1N8ZA 4S2SA 2VXTH 4HIEB 1CDIA 4OLWL 1WF5A 3N1QC 3O2VL 3F7YA 3QUZA 1ETZB 2VLKE 2P5EE 5C0RH 3RRQA 5FOBB 5C0GB 3MODL 3HB3C 3KPRD 4GAGH 1HH9A 3FOLA 3OJDA 1YMHB 1NFDB 4QCIA 1UH4A 3O8XB 4RDQF 2N56A 4F7CA 4MS8D 2NW3A 2WIIA 2NY5H 4M7JH 1FG2A 2BRQA 2H9GA 4JFEA 5HHXL 4Z8FL 2HJLA 1LP9F 3NZ8B 3WDIA 1ZWIB 4P57B 1DQJA 4F8QA 3KS0H 3PF2A 4JM2C 5CLWA 3SKJH 3FQUA 1F02I 4WHTB 4XT1C 5F8RC 3K80A 1C12A 2NX5A 4DUWA 1K8DA 1U91B 3W11D 2H2SC 1HXMB 1FIEA 4TTDC 2EDNA 1DSFL 3MLSH 3LKSB 5DD0L 5E7BA 4R3SA 4CJ0A 5D1ZC 3N1FC 1D6VH 4MA1B 3QDJB 2R8SL 1QA9A 1KBGL 2Z93B 1XF5A 3G6JE 1J8HB 4F7CB 3TBSB 1DN2A 4HWEL 3OZ9L 3CU1A 3X13B 1CK0L 4JRXA 1HXYA 3VG9B 1MHPH 4ZFFB 1IFHH 1AGCA 2WBJD 2VZ3A 4Q0XL 4RGNE 4KPHL 1M1SA 2XIDA 2IMMA 5CIPA 2R23B 4MVBC 1O5DT 1N6VA 3GSQB 3GMMA 4IMLA 3PHOB 1MAKA 4CW1A 2QL1A 1F4WL 1V5JA 5D7JB 1T7YA 2OR9H 3QAZB 4UOJA 5DD6B 4E42A 5C3LD 1NAML 2BERA 4JFOA 2V5MA 5F93C 4X6BA 1EFXB 2IWGA 4F2MA 5CSGA 3BD3A 5FO9B 4WDIB 3BXNA 4NKQB 4JFDD 4LSPH 2R2HB 4LSSH 3QI9C 3TNNA 3RU8H 4YJZL 1INQB 3B6SA 4YEEA 4JZNB 3L5WB 1HQRB 5GPRA 3GJFH 5ACZB 3QCUH 3MRNA 5KSAD 5CJXC 3QEUA 3VJ6B 3G9VA 4MXWH 4JHAH 5CCKH 3L3GA 2NY5C 4GUPA 5IOPA 3BYYA 1E4XL 2XTJD 4F15C 5GS3A 2CUMA 3K81A 2UWEF 5J7CC 4U1MA 1T1YB 1FCCA 5IQ7L 5HYIA 4Q2ZA 2DKMA 1JWUA 4OCYL 4FG6D 4LCCC 5FGBC 3SDAD 4RNRB 3RWDB 3DROA 4ORGB 1RUKL 3QXDA 3MCG1 5KSVA 5CD5D 3VFMB 1RZGA 2FWOB 4R2GC 4MA3B 3E8UH 2AV1B 2ZP0T 2JTDA 4JVWA 2NLJB 5I1GL 4U1GB 1A6VH 4WJ5A 2NY3D 4X8JB 4MNQE 1JWMA 4QEGA 1BEYH 2PYED 3OKDA 1RFDH 1NL0L 3HZKA 5E2UL 1BZ9B 3VFVB 4AMKL 1FGNH 5DUBA 3LS5H 4DK3A 2H9GB 4JFEB 3TA3B 4PY8I 4FQHA 1F58H 3A6CL 3C5JB 1L0YA 4YUEH 5JOPD 3QDMB 3FFCE 4W4OA 1YY9D 4JCLA 5E8PA 1U8LB 5IWLA 5HXMA 2FX7L 1VKXB 5BJTB 4K23L 3FQUB 1ACYH 4WHTA 1FP5A 1Q0XL 1G7IB 2FR4B 1XR8B 2P5WA 3U7WH 4UIKL 3X11A 4PJDA 4G42B 5JHDD 1MFDH 5F88B 4K8RD 2J88H 4OGZA 1PQZA 7CGTA 1I1YB 5T5FL 2R4SL 4MDIB 2X05A 1J8HA 5JIKA 4Z77A 4M6OL 4ZPTB 1EHLL 3WS6C 1FNEA 2BNRE 1X5LA 4XVUC 2VXUL 1JHLL 2DOCA 4LSRL 4AIZA 5M95B 1URLA 3O41A 3QULA 3H2WA 1FPTL 5IMMB 1B6DA 3LDBB 4HPYL 1AE6H 4L8SB 3EHBC 4HC1H 1FSKC 1JK8A 4LSPL 2Y5TB 4LPVA 4POUB 5D7JD 2MSPA 4OFIA 1HN1A 3LOWA 3HAEH 1OGAB 3QIBD 3MRQB 2VKXA 2P43B 3GMOB 4BFIA 1N7ML 4NQCA 4AENB 4R0LA 1AP2A 2MPAH 4JFOB 1QRNB 3ARDD 2VSCA 5EA0L 3W0WD 1FNEB 3WFBL 2E7BA 3TT3L 3ARDA 3WE6B 5LQBH 3RVVC 4X5LA 1D6VL 4MAUH 4LCYA 4C54A 2ZCHH 5JOFB 3QXWA 1YEJH 3VG0L 5D7LE 2YD5A 4OLZH 5ISZB 4K7PX 1FFOA 3VXRE 3UZQA 1SEQL 4QHNB 2OL3L 1UADC 2WBJA 1ZT1A 3U0TB 3SDAB 3DX9B 5IR1A 2WWMD 2AEWA 3F12A 4PJ8B 2XTJE 2UWEE 1DLHA 4IIQB 3B5GA 1N6QL 3VD7A 5IFAL 1RV6X 3FHQA 5E4EC 2BFVL 3T4YB 5HPMB 4RMQA 3IVKA 4DOHB 3SKMA 3V5DA 2AK4B 3W9DA 5K9OA 2FWOA 5IVZB 5DYOB 5BS0A 2NY3B 5SWQA 4D0BA 3IDUA 4GG8B 1MRFL 3T2QA 4MD0A 4KVCH 5JQ6H 4P23C 4MS8C 1HKFA 4M6OH 1EHLH 1IAKB 3EYUL 4YIQA 1AFVL 3KYOB 2FJFB 1FL5A 3T0DA 3FQXB 4DGYH 4KY1H 2JJVA 1A3RH 2YPLA 3MV7D 3QDMD 2HWZH 4KHTL 5GS2D 2VXVL 3KHOA 3TC9A 5HYJA 1G0YR 2VAAA 3MJ9H 2MCPH 2P46B 3DMMB 1MJ7H 5AG9A 3UTZB 2VDOH 3KPSE 1B0RB 1Z5LA 1D3CA 5D2LF 4OAWB 4PJHE 1IL1B 3PQYA 3VRLF 3BIBX 3T2PA 5IFJA 2GJJA 3MXWH 4EDWH 5L2KD 1KT2B 2D0GA 3SPVA 2OZ4H 4AIXA 4F9LC 2W91A 2DBLH 4R7NB 4PJ7E 4AIZB 1UXWB 3MJ8A 3TT1L 4PFEA 3L1OL 1DP0A 1WWCA 1XIWB 4CADB 5F7MC 3PNWA 1H8SA 2QQLL 3S3JA 3J8F7 4LVNB 3HZYA 3V6OC 5FUCC 3CPLA 4OZGB 1FL3A 4KQ4L 4RMWA 4RMTA 1T03H 2AP2A 2QR0B 1KFAH 2W0FA 1XF3A 2OBGA 4Q58C 2QSQA 5I1EL 2B1AH 5C0ND 3I6GA 1F3JA 1CBVH 2P5WD 4B7IA 4NJ9H 1A5FL 2EDEA 2VR5A 5JHDA 4M6NL 1HEZB 2ZUYA 2ADJA 5DA4A 5GGSB 5F9WB 2KZ1B 1AHWA 1AXTL 4M43H 4DKAA 2ZJSL 2AJ3B 5IT2H 1TXKA 1ZA3B 3VD3A 1ZXQA 4X9HA 1QTYT 4NBZB 1XZ0A 2AVGA 2VISB 3VH8G 4FMFA 4ELMF 9CGTA 1LD9B 5GZND 4YHKL 2QHRH 3NH7H 3CCHA 5J3HC 5JDJA 4TN9A 1ZLUH 3KPOA 3BJLA 1CLCA 3P0GB 3BZEA 3T09A 1A22B 3PGCB 3P0YH 2V5YA 3MLWL 5C0AE 2LV4A 5ILTL 1T2QH 2JELH 2Z31D 5ETUB 1MCKA 5L9DL 2VLLB 5HVHC 3QZWB 4EXPX 1Q9KA 3FO9A 5JW4R 4I77H 3IVKB 4XGZB 1CGSH 1V3MA 4EZMA 1KULA 5DWUH 4AH2B 4XCNB 3U30C 3DRTA 5DRXB 4DJMA 4HBCH 1HHHA 1F2XK 1IC4H 3VD9A 4JDZB 5JXEC 4Y19E 3CSYA 1CD8A 4S1DC 4MD0B 2ZCKL 4AEIH 1HIML 3ARBD 3UDWA 2VH5H 4YPGB 1T2JA 4CN6A 1ND0A 4HJ0C 3UC0L 4U2YA 4CMHC 1JI2A 3HUJA 5HGAA 4LVOC 1J1OH 5AZEH 4HEPG 2GT9B 2O61A 2NLJA 3QI9A 2FGZA 3MGOB 1MHEA 4UIKH 4JM2D 3LB6D 4Y8DC 3GSOB 4JY6A 3MNZB 2FZ3A 4FABH 2R1WA 3I84A 4NQDE 3PWNA 2IF7A 3MRMB 3R06A 4I48A 3WKNA 4TPRH 3U36B 3EKCA 3D39D 2GJZB 3KLSA 5EWIH 5K9QG 2MFNA 4BA8A 3PWLA 4D8PA 4WUKH 2DLFL 5BVJA 3BRGC 2ZUUA 1AO7D 4GS7B 1A6PA 3T0AA 2GTWA 4G3YL 2H6PA 2WBKA 3QUMH 2FSEA 4Y16C 4OGYH 4YHLH 5EZOH 4NSKA 2VC2H 3U2SB 4N1HB 5GS0H 5EBLA 4LSUL 2DTSA 3FN9A 5F96L 1T6WA 3PJSB 2P24B 2JJWA 2GTZB 3LB6C 5LGJA 3OGCA 2H1PL 1AJ7L 5IVXE 2BSTB 1RJLA 3VE0B 4D2NA 2VZSA 4JFPA 3P77A 4LU5L 1IGJA 4WV1C 4HUKB 4QYOB 3SBWC 2NY6C 4XPHL 5E1AA 2WANA 3L95A 5IHBA 1WFOA 4W4OC 5DMIL 5DJAA 4J12A 2PO6D 4MCYB 1X7QA 5TE4H 5HSFA 2PR4H 3WS3B 1XH3B 2KZWA 3BW9B 4OQTH 4N0UE 3RIAF 2CK0H 3STZB 5TQ2L 3SDDB 4DN3H 3AGVA 2O93L 1EPFA 4I13B 3TBWB 2Q6WB 4FZEH 2Z93A 5FM5M 5F3BA 2FIRT 3O8XA 3IU4H 1SVCP 4OCSL 5DJZB 4CN4A 2G75A 3BH9B 3EYFA 3GMQA 4RX4A 4QYOA 1P4IH 3T04D 1F97A 1VB9A 3EFFB 4HFUL 5JMRA 3P0VH 5DC4B 5MEOA 3TN0C 4KK8C 3MLVL 2JK5B 1FN4B 1CLOL 3ARFC 1G7HA 1MCBA 1DQJB 3BHBA 4NNYA 1Y18A 4GQ9H 1U3ZA 3OPZH 3AS0A 4ZD3H 5J89A 3TO4C 3QNZA 3QDAA 4G7VL 4X98A 4BQBA 4EQ3A 1NDGB 3MNVB 1EEUA 2Y36L 3X17A 2XQBH 4O2FA 2V5SA 3IYLW 4PJCA 2HFGL 2JCCE 4ZUUB 5HY9B 1ZS8A 3CDYA 1YNTA 3QA3B 4HWEH 2XWJA 1XCTB 4HZLA 3Q3GA 2I60L 5EC2B 5SWZB 3REVA 3GMNA 1YYML 5L8KB 1I9JH 1DQTA 3OB0H 4A2MA 1PKQE 4PV8B 2BNUB 4LSTH 4XMLL 4DW2H 5KVDL 1M7XA 4MNGE 4ZNEA 4P2QD 2QADD 3OKEA 3KVQA 4UUJB 3T2NL 2CGRH 5E94A 5CZVH 1NCWH 3WIIL 3P4LA 4X9FA 4LLDB 5I75C 5EOQH 2Z92A 4RFEB 4UOW0 3PDOA 1T1YA 5IP4A 2J7LA 3S5LA 1MI5B 4NGHL 3D39E 2XWJB 1T2QL 1KACB 3FCTA 3I75A 3HG1D 3SKUD 1S9XA 4NQSB 4JLRA 1N2RB 5I75B 3WFCL 4EUPB 3GIVA 2QQNL 3NFPB 5E70A 1IKFL 1FAKT 5HHOB 1GL4B 2CXGA 1QSEA 5TFSL 1HKLH 3KXFB 4U7KA 1NGYA 1NANI 3GIZH 12E8H 4U1JB 5KG9B 3QRFM 4V1DE 1SMAA 2X1XR 1PEZA 3RVWC 5LGHH 3QIUD 3NBNA 1IC1A 4WWKD 1U8OA 4LARL 5C8JB 4PGCA 2P49B 1T1ZB 1SYVA 3A0OA 5EZJA 3PP4H 4XHJD 5KSBA 3TH4T 4X4MA 4J1UA 5D71L 2BRRH 5C08B 4HJGA 1BM3L 1FORL 2AABL 1KIRA 3V0VB 2UWEB 2DQTH 4KV5F 2PTTA 4NNPH 4PJAB 4OIBA 1EK3A 2OQJB 4NHUB 1RURL 2G2RA 4OLVL 4OUUA 2VAJA 5EO0A 2EH7H 1XF5B 4X4YA 5GGRA 3ULVC 4DOHE 1UJ3A 5DMKB 5DJZA 4GRWE 2PYFB 4JKLA 4TOYL 1PY4A 2BVEA 2MOVA 4LK4A 5CJQH 3DXAD 5C9JA 1IQWL 2AJUL 2B4CL 4R6UA 1CG9A 5ITFA 5IEHB 3H7LA 3K46A 1A7RH 2IFFL 1LEIA 5FM8A 3MRHB 4PJGE 4ZS7L 2O5YL 1YN6A 2DI8A 4PJDB 4IRSC 1EFXD 4WV1B 1XGUB 1Q9KB 2PO6A 3BIKB 4YHOL 5D2NA 1XCTA 3QO0A 1ETZA 2CKBH 1PSKL 1MCOL 3O2DL 3U46B 4KAQH 2J8HA 3SCMA 3TJHD 4P2CG 2IGFL 4ODTH 1DQDL 4TSCL 4XVSL 4EIGB 4HC1L 4QGTA 2DQGL 5DEZA 4D9RD 4AT6A 1WEJH 4I3RH 3GBNH 3CK0H 3FAWA 2R0KH 3GSRA 1GGTA 4M5ZH 4X4XB 5KJRH 1NPUA 4MSWB 4S1RH 1ADQL 2V7NA 4I2XB 3OG4B 1DBAL 5D7SL 1NGZB 5MENB 2V5TA 3TZVC 1ZHLB 1BP3B 3NCEB 5J3HD 3I6LD 2M1KA 2Z9TA 1T0MA 2XZAH 4P23D 2DQIH 2CSPA 4LCIH 1LHZA 4LHQB 5DFVD 1E4KA 5HD8D 3MLRL 4XTRC 1G9MC 1KCKA 1ZHBB 2OTWA 3STLB 1F13A 4LLUA 2FHBA 4U1JA 3QIBB 1FE8H 1QFUH 4NC0B 4OT1L 2YA0A 3BZ4B 1RIUH 2FJHA 4R4ND 3QZWG 1U3JA 4GQ9L 4RMSA 4PGJA 3ZLQC 1TFHA 3BT2L 4LOUC 2X40A 2GTZA 1TTGA 1BWWA 3F12B 4IBLT 2UZIH 5GRJH 4WTXA 1FSKB 5HHQA 3BGAA 2XFXA 1D5ZB 2NTFA 5D1QA 1JGLL 3QQ4A 4OZHF 3H9HB 3BYTA 4WTZA 4CKVX 2GJ6B 3SOBL 1XGRB 2A9MH 2UYLB 12E8L 1F6LL 3GIZL 3MRGA 2J6EH 2LU3A 1NMAL 1XGYL 5K9JH 1S9YA 4FQIL 3HPJB 1EV2E 4XMLH 3CFKB 4NO5A 1T7WA 1O7VA 4HT1H 2AEQH 3ZT5A 3D0VA 3P11H 4BYHA 2HWZL 2XZQH 4XHQA 1DN0A 1EAPB 3EYQC 3LZFL 2VDRH 3D3VD 2MQCA 1H3XA 4R90H 4LF3A 1CDUA 3TO4B 1NC4A 4MLIA 3RPIA 1S3KH 4M1GH 5D72L 2VKWA 2HFGH 1HH6B 2F54B 4YBHA 2K7PA 5BZWA 4CL7A 5JA9A 1PZ5B 2P8MA 4FNLL 2C1OB 4L8SA 3HC0A 2UYLA 4XP4L 3CH8A 4PJHB 3RU8L 5ACZA 2FBOJ 4X7TA 4XVUD 4UZGA 3FQTA 1U42A 3ZKNC 4QTHB 4XP1H 4QHUA 4WV1A 4A6YA 4OZHE 3P4MA 2XICA 5FYLH 5GRYA 1MRDL 2A6KB 2FECL 2R2BB 3I9GL 1OB1A 3C6LA 2F74A 3LEXA 4K94H 3QG7H 1J1XL 3E6HB 2X70B 4HUXB 4RAUA 4UNTA 3MLPA 3S37X 1S78D 4K3DL 1Q0YH 2X4TB 4FQ2L 2GIYA 2OL3B 4G8EB 1CE6B 5IHZA 3RY5A 3WHXB 1KB5H 4LKXA 2ZUWA 4U3XA 1AR2A 2OCFD 5DUMH 5CJOL 2AW2A 4AM0A 1QFPA 3X3FH 1U3YA 4Y5XA 3RVXD 4NT6A 1RZIA 5GIRB 2APVA 2DN7A 4MJ5A 1HKLL 3HE7D 4QRSA 1A2YB 3UJTH 4UV4H 1F42A 2A6IB 1KPVA 2VDLH 3V6FA 4FQXA 1JTOA 1EVTC 2P7TA 1DFBH 1OL0A 3R0MA 2D4DA 4TYUA 5D70H 4Y5YB 4WFGD 1Q38A 2DBJA 3FO1A 1RZJH 1MCOH 5C71A 1X6NA 4Z7NE 2D03L 4OF5A 3MLXH 4LGRB 4YFDB 2ZOKB 1BF8A 1TVHA 2V17L 3CDCA 5ILTH 4JG1L 3L3IA 3LIZH 4R96B 1MWAB 4LPYA 5IVXA 1G84A 3RX8A 1CICA 4I4WB 4GMTL 3MZGB 3EFDL 1SYVB 4HWBH 4L9DA 3ZKSD 3GSVB 3TA3A 4EDXA 1YYMH 5D5MB 1CICD 2CDFB 2CKNA 4UAOB 2CRIA 4OI9A 1E6OH 3WUZA 4X6DB 1A6UL 4CMHB 3SGJA 5E8PB 1GGBH 5J6GA 1JZ2A 1X5ZA 2OK0L 2NX5E 4YPGA 4PJ5A 1IAOA 1KTLB 3KNBA 4XNUH 3U30B 5KW9L 3HB3D 5TPWL 4AEEA 3SE8L 3Q48A 2WUCH 3ULUH 1R3JA 1SJHB 4P3CH 5GHWL 1KGCD 5KOMC 3TO4A 3JUZA 5H35B 4C56E 5EO0B 8CGTA 1KFAL 2DWDA 4KJQC 3QHZL 4M6MH 4FTVB 1P2CA 2HAZA 4K07A 4XZUB 1OCWL 1IGFL 3C8KA 4JRXE 4G9FD 4LLQB 1AD9B 1R24A 4TUKH 4MJID 2A74A 1A64A 5I0ZA 4F7TB 2QSCL 2IGFH 2XWTB 4MNGB 1CWVA 3MLWH 2Q20A 1MY5A 1SJEA 2VZ1A 4RAVB 3GSNL 5I2IB 4G5ZL 2ATPA 3F7PC 3EO1B 4FQQA 5DJCB 2Y7QA 1GAFH 1MCFA 4HQQL 5D1XC 1NGXA 4PREB 4ZUTB 2VLJE 5E5RB 1D9KA 4K3JL 5D2LE 3Q5OA 4MJ6A 2FDBP 2P5WE 5FHBH 3RUGB 4L29B 3V5HA 2QEJA 2QSVA 2Z8WC 4A6YH 5C1MB 3W9EB 4XNQA 5E95B 3U46A 1IBGL 2IH1A 3QCTL 2QLVB 4LU5H 3L5XL 1A9EA 3FQRA 1BIHA 4JO1H 4NZTH 5C92A 4I9WE 3TV3H 1BOGA 4MJ4A 4Z7OF 5DK3A 2R2CA 4HW6A 3SDXF 2IEPA 3PP3H 5I2IA 3SQOL 1NMAH 1XGYH 4ZS6D 3GMLA 2KUTA 4Z7NF 1P5UA 4HD9A 2GCYB 2O5ZH 4MCYA 3HRPA 2H2PD 4G9DB 1WISA 1UKSA 2YN5A 3RZCB 3KPMB 2IPUG 1AR1C 2EIBA 1QHOA 5EUKB 1LQSR 4IMLB 4PRPD 4XNQB 4O2FB 5TF0A 1X3DA 2VLRA 4XMKH 1YECL 1RK0A 4JY4B 4K9EC 4R4NC 5FHAL 1GHFL 3B2VH 3C5ZC 2RAMA 3I9GH 3ARYA 4LLVB 4Z7VE 5C2BL 3DUUB 5DJ8B 3GM0A 4DVBB 1LO4H 4L4VB 5CWSA 1YC8A 2AJZB 1OARL 2DQEL 3OXRA 4BUHA 3EUUA 1UZ6E 3QQ9C 4N8VG 3CC5A 4UTAL 4M7LH 4NWTH 1NCAL 2NZ9D 1NSNL 3MO1B 2OK0H 1R3HB 1XGTA 3GJEA 1VGEH 6FABH 3MRFB 5FYKH 2ICEA 1HDMB 4PTTB 1OAKL 3TYFB 2WBJC 3GSVA 3QFJA 4X98B 3V0WH 2W60B 4ZXBB 1YUHA 4QRRB 4WU5B 3UTOA 5HI3D 4PJ9D 5D93B 5KSBE 4YLQT 3U0WH 5JHDB 5DQJB 3PWUA 1JWUB 4WI5A 2NXYC 1EO8L 3HNTH 3EYSH 4ZO8A 2X9YA 1ODAA 1A9BB 3BP6A 3VXNB 4GRLA 3ELAT 2XT1B 4PJDE 2DM4A 3EOAB 5BRZD 4ODXA 4DN3L 5H35A 2PTVA 2EC9U 4GKSB 4JPVL 4ONOA 5CCKL 1QRKA 4UQ3B 4O02H 3ULVH 4YFEA 4QWWD 3ZSSA 1MFBL 3NABH 3OKNA 1KT2A 2NZ9C 5J1TC 5LWYH 3BZFB 1IGML 3L3OA 5ICZA 1NMBL 2GI7A 5EZIL 4ZTOL 3NGBB 4PD4J 2HTLD 1MI5E 2XA3A 1MCPL 4D0DA 4ELMA 1EUUA 1QR1A 4EBQL 4YK4B 4ONHA 5MP6H 1IBGH 4MJIE 1JGDB 5JOEA 4IOFC 1Z0NA 1EERB 3MOBH 5T3XH 1GC1H 4F57L 2K7QA 4HIHB 1I1AC 5I30H 5MENE 1ES0B 1LO2L 2J3SA 3RWFB 4YE4L 3E2HB 1NLDH 1P4LA 2PTUA 3KWWB 2NY6D 4V1DB 3BZFA 3RGVC 1TQBB 1FZOB 1UB5B 4XHJC 5JO5B 3MC0A 4PRID 5F7YC 4TRPH 4M62L 1FFQA 4J3TA 2QHLA 4XI5C 3VXMA 2I07A 2YR3A 4L9LA 1A7OL 4PRIA 2VISA 1OSPH 4LEOB 1CQKA 1QFOA 2UVEA 4PJ8D 3CZFB 1I3RA 1IGCH 3EDEA 4I0PA 2EE2A 1OP5K 4H26B 3TIEB 1BVZA 5FCUL 1U36A 1J1PH 2VLKA 5EZLB 5DF0A 4DZ8A 4P3CL 1Z6JT 3OAZK 1ZTXH 3NMEA 2WWMC 1N64H 4M5YL 5FEBA 1RZ7H 1HQ4A 3TLRA 3P30L 4XAWH 3V6FB 3TA3D 1QHPA 5ANMA 3C60C 1QRNA 3NFSL 5I0DA 3QT2A 3AU1A 2LE9A 1P6FA 2F8XC 5ACLA 4JEGB 1WTLA 4Q6IC 1HH9B 2R56H 2NY4D 2ZPKH 5LWYL 4UINL 4OCYH 1KCSL 5T1MA 5KVGL 2BVYA 4TNVK 1FG2B 5B21A 4NSKB 3ZKXB 1M6OA 1QSFD 1FRGL 2WV3A 3MYZA 1IAIH 1YJDC 3H0TA 2CR3A 5A3IC 5BQ7A 3SGDI 3S97C 3I50L 3OJDB 3JWNC 3UBXI 2HTKD 1I8KB 5I9QB 2CKBL 5DT1L 1X7QB 3WFZA 3QRGH 4CGTA 4QRPE 1JE6A 4X5WB 1BJMA 1CTOA 3O6KH 1AKJD 5ENWA 4AQOA 2WUBH 2CKBB 2Y6SC 5EZIH 4ZTOH 2GSIA 4FS0A 5H37H 2NY7L 1KJ2A 2FO4B 3JVGA 2BVTA 1GOHA 3IS1X 4NJAL 4JFXA 1EH9A 2A0LD 4NZRH 3TZVD 3G5YB 3PL6C 2YUWA 4NQXA 1BX2A 5D71H 2VDQH 4PV9B 2JCCA 3STZA 1QYGH 5HGDB 5DD3L 5HD8C 1X5AA 4MA7L 1YJDH 3OB8A 2V2WA 2VL5A 5CJ8A 5IOPB 3ZE2F 2NY1C 4QO1A 4AK1A 4U6YB 1KXTB 3IRPX 1OT1A 5F89B 4NC1C 1CN4A 2Q8AL 4HKJB 1TJHL 3MXVL 1FYTA 3H3BC 4OCWH 5DO2C 1NSNH 3GGWB 3PGDB 2XKSA 1QBLH 4NQCD 5DEFB 1D6EB 4P46D 1PW3A 5KBNC 2E27L 3C2SA 3FQNA 1HQRA 3HZMA 3RI5F 4P23B 4QF1B 5DHYB 5D7JA 5J9PA 3SPVB 4DGIL 4ODHL 4Z9KB 4LF3B 5I19H 3CH1B 2D7PA 1NC4B 5AG8A 3H9SA 1BWMA 1RSFA 3QUXB 8FABA 1T3FA 3NCFB 1FJ1A 1KJ3H 4ODWA 3FT4A 4YHOH 5IB3B 4Z7WA 1UCTA 3VXSD 1FL6A 3VRIB 3TBYB 5TDOB 5A2IH 4FP8H 1U8JB 3BH8B 4PV8A 3NOIA 1PX4A 5F97E 2EZ0C 3AMLA 3MRGB 1VPOL 3IDNA 5M94B 4IRZL 4DUVA 2LQRA 2AEIT 3BEWA 4D0CB 1RUPH 1U6AL 3SBWA 3DX8B 1KCSH 5FDWA 5I8KH 5KVGH 5MP6L 3DI3B 3BGMA 3KYNB 4X99A 4XNZC 2AQ3A 3DV4B 1T89C 4GUPB 3MREB 1FNFA 1QLFA 4TUOA 3BEVA 4L1HA 2NW2A 1INEH 4LSVH 4Q9RH 1VEMA 1W72B 5B39A 3BDYH 4JM2B 4PRDA 3L5IA 5SX4I 3TBYA 3OHXA 4GRLD 2PUQT 5CWSB 4KK5C 1ORSB 1J0HA 4CVZA 3RVWD 1G7PA 3PABA 4GMSH 1VFMA 4AM0B 4HG4K 3SY0B 1BM3H 2YPLD 1GPOH 3KYNA 4X99B 2OM5A 1ED3A 5INCA 2RIKA 3VWKB 3EGSB 5FGCE 4MQ7A 4WFHD 1FE8L 3O81A 5MEPA 4ZDHA 1UKTA 3FRPA 3C5ZB 1ZA6B 3P40A 2EYSA 1KEMH 5HDQH 1WZKA 5LVEA 1UWEL 2DQUH 2VITA 2CJUL 4OD1H 1VKXA 1VADA 1PG7H 3DTXB 4PJCE 1CU4H 4X80L 3ARGD 3IGAB 4NRYB 4D3CL 4RDQG 1PG7X 2YZ1A 3V4PH 4F57H 3O2WH 3B2UD 5IEHA 1DL7L 4HJJH 3K4AA 4E0RA 3MMEB 2G2RB 3P9WB 2H2SD 1A2YA 1VA9A 4HULB 4H1LH 5I8EB 4ZPTA 3UAJD 4QHNA 3PGFL 4Z77B 3KGRA 2PO6B 3BOVA 1IC4L 3BIKA 4JHAL 1ZVYA 4WCYH 4EN3B 4XNXL 4O51A 3ULSA 4LL9A 1NCDH 1VACA 2ZPKL 2KKQA 2VXSL 3ARTA 3O6LH 1NH6A 1V7NL 4NFDA 2N4IA 2YEZA 3QDJD 3SCMB 1LEIB 4HIIA 3ARED 3V5KA 4NUJA 3X12B 4BJLA 3CMOL 3DNKA 4K3EL 1RULL 2APXA 4HZAA 5IG7A 3WCYA 2X4SA 1MFNA 3KAAA 1H15A 4X7SH 2YKLH 3SN6N 3UJIH 2P24A 2FJFA 1P6AB 4JO2L 4PD4K 1MCWM 1ZHLA 1MLBB 2C3XA 2X44D 4FA8A 4UDUA 5FGRA 5D5ME 2EDTA 3U4BH 4Q9BA 3ZTNH 5K33A 3UPRB 2ZKHH 1LMKA 2V5RA 3IFPB 4H26A 5JUEL 2VXQH 1MUJB 5GGUB 3GKWH 1FGNL 1IAOB 3SKMB 3V5DB 5GHWH 1YEKH 1U9KA 5BCAA 3RGVB 4HCRH 4PREA 2VDQL 1BLNB 4NO3A 1J0KA 5C0DB 3RTQD 5F1NB 4W6YB 1SMOA 1PGRB 4LQFH 1CZ8H 4G8IA 1D7FA 1FL5B 1BQSA 35C8H 1T0MB 2H26A 2DJUA 4Y1AE 1FBIH 3E0GA 43CAA 3KPSA 1F8TL 1GOGA 4M7JL 3WKML 5T3XL 1EBPA 4ODUA 4I1NB 2XYCA 4YIQB 3HA0A 4Y5XB 5GSVB 2I9LB 1XR9A 4PJIF 4U4BA 4OBRA 5E4EB 2ZCKH 4GT7A 4AEIL 1Y18B 2XKNB 4OCXL 4R2GD 1TPXC 5TQ2H 1NCDL 3HKFA 2MKLC 2WINA 4IIQC 3BKCL 4J23A 4TVPE 5EUKA 4KRNA 1AKJB 1TETL 4NPYA 4X5WA 5KSUA 2P7TB 1FVEB 3HI1A 2E7CA 5JORB 3QQ3B 2XI9A 1S7UB 2YHGA 3ZHLA 5KSVB 4YHYC 3S34H 2HFTA 1TQCB 3CJJA 1IM3A 4PJFE 3RDTC 4MNHB 4K8RL 2AJZA 1MJJA 5FKAA 3CUPB 3BP5A 4EVNA 4KTYA 4YHNB 4HWZA 3O6MH 3GMLB 3KLAA 1WAAA 4XP9H 3SDXE 2DLTA 3BUYA 3DOSA 4DN4H 4MA8H 4R7NA 2WINB 1JGVH 3H9SD 4ZSOB 2ADGA 5E00A 3WXVL 1UM4L 4K3GA 4L8BB 1OTTC 4NN7B 2HLAA 4LBEA 3QHZH 5C0IA 3RWHA 2F74B 3LEXB 3QXAB 4K3DH 5BJTA 1GIGL 1U8HA 2P8PB 1CFTB 5SX5K 4JO3L 3D25A 3QEQE 5CJOH 4GS7C 5ITBH 2VDKH 2ZKHL 4FTVD 5SWSA 1DSFH 3MLSL 3ULUE 2W1NA 2XRAL 5DMGC 5GRUL 3VFWB 3HR6A 4TPRL 3GJFK 2IBZX 3RL2A 4XBGB 3C6LB 3FO2A 4ZTPH 4K55A 5C0CA 2MHAA 1W8NA 1P4IL 1AD9A 4ZO9A 5SWZD 1U8OB 4OZFG 2B2XL 4XB7A 3TVMC 2VMFA 1OTTD 5GGUA 1FV1A 5I74B 3RZWA 5CP3A 4OV5B 3RTQB 4JDVB 3PWLB 3T0EE 1QUNA 3GSNA 4J3UA 4YDIL 1GRWA 3W0WB 4FHBD 2X9XA 5EUOB 2KQNA 3O2DA 4P4KB 2DKSA 1ZT4B 1U8IB 2YXFA 1FYTE 4WI8A 2A6JB 1QFWH 3PWVB 3AREA 4KKBC 3QQ9D 3KWWA 1NMBH 4YC2B 3ARWA 3NAAH 2A6IA 4RISL 5DHVA 3THMH 3R0NA 1J9CT 3RBGA 3VWKC 2DQDH 3EHBD 1OVZA 4Z95H 5T5NG 2KPNA 3U0PB 1NC2D 3FL7A 4NYLB 2BDNH 3QIUC 1C5BL 1ACYL 5AAMA 1RK1B 1VFUA 5H2BB 5T1KB 4OZFA 3HE7B 3KG5A 1EGJA 1S7QB 2QQLH 2IPTL 2BOBA 2GKIA 1NCAH 4OCMC 3AMKA 5I1HH 5IJKC 3ALPA 4L5FL 5CJQL 4V2CB 5BS0B 2E9IA 5E8DH 4JY5L 2PYEA 5GJSL 5DJ2A 1CFQB 3WXVH 5ESVB 5C0BA 3ZTNL 1KPRB 4YHNA 4Z7QF 1ZVSB 4YO0B 4YZFF 4UAOC 3O0RH 5ICYA 3GMRB 1GIGH 5FB8B 1IMHC 5KAQF 5FF6A 5DGQA 3AB0C 2GQHA 2BK8A 5CEYB 1MVUA 3EFFA 4P3DA 3QFJB 3SDYL 1LEGB 4K71C 4OF6A 2XV6B 1GGCL 2VWEC 5CKAA 2F19H 1RQ5A 4EKXA 3OGCB 5ANMB 3QXUA 1XAUA 3IFNL 5BRZB 1G7JB 3QEQB 1RVFH 3QIWD 5KVEH 2HJLB 2AKRB 3OKKB 3RVUC 4F15B 4P5TB 5IF0A 4PJ9C 4M3JA 1CVSC 3GRWA 3THML 3JZ7A 4O4YH 2PKDA 5AUMA 3IDYB 5C07E 1F5WA 3TJHC 1FO0L 3O9WC 4NQXB 5BRZE 1HYSD 5DJYB 1LEGA 1JYXA 5BQ7B 3OR6A 3MRPA 5C6WH 1CIDA 5KVMC 4L3EE 4YX2L 3ZKQD 4NJ9L 2VABB 1MLBA 4P5MA 3BRDA 4KMQA 4J8RB 1A7QL 3QB7C 4XWOD 2AKRA 3OKKA 3BH9A 3EYFB 5TDNB 1U3HC 1G0XA 1KYOJ 5FYJE 1OP3K 3HMXH 3E8UL 5GS1C 3MLUL 4PJXE 4OF7A 1KB9K 3WIHH 1DBML 3WJLC 2I9TA 2P8LB 3EOTH 2FGWL 5H37G 4O9HH 5GGSA 1MCRA 5KSAC 2WQ8A 4NRZA 3V2AR 1VGEL 1HSBB 1YJDL 1MFEH 5J9PB 5DI8A 5DHXB 5IB2B 3WLWD 5CZKA 3FMGH 4K7FA 1T1XA 1CGVA 5I1CH 2GSGB 2HKHL 3NACH 3VXQA 1F90L 4JRYA 1FJ1B 4ODWB 1JFQL 3ZHKA 2OXHA 2EXYD 5IBTL 3DSNA 4JPKL 3G5XB 1CYGA 1PKOA 1O7SA 4GXVH 3AS1A 5ELIA 2CIKB 4KUCD 3IDMB 1MFCL 4PJXF 3D85B 3M8OH 3MR9B 3PP4L 1ZGLM 2ATKA 4U7SA 3NA9H 5HYEA 2DQFA 4Y5VC 1FG9C 2VUOA 4M00A 3OJVC 4P23A 1SYSA 2Q1EA 5DR5H 1IEBB 1VERA 2NY4B 4JHZA 5IJKA 3QWOB 4GW5A 3C09C 5D2LA 1DQQB 4DEPC 2X4TA 4AEHH 4RISH 4KVCL 3BP6B 5GJTL 3TM6A 3SCMC 2CPCA 1P84J 1P7KA 3G08B 2DKUA 4HIXL 4X6CE 4XCCL 3D87B 4H20H 4P46B 2NMSA 4QHKJ 1QACA 1DQLL 3MNWB 4L8DA 5MHSE 4GLRH 2FZ3B 3D9AH 4X7DC 4HHAA 3DETC 3MROA 4FOMA 4QTIL 5FIEA 5GSRA 1CBVL 3DECA 5E6YA 4P59H 1XGPA 4ZXBA 3U6RA 4ZDHB 4RSVA 3WFEL 4XB8A 1O0VA 3KYKL 4NQEB