3WS3B

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 100
sequence length 100
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3B00
3DMMA 3HB3C 1A6TA 3FQNB 5A40E 5DZOA 5KSAB 1S7UA 4M93B 3U4BH 3Q5OA 2IPTL 1FCGA 4IIQB 3FT4B 4C58B 3AUVA 5TE7L 3IDMB 5DTFB 1XGRA 3OHXA 5I75C 5L7XL 1J05B 5GJSH 1FAIH 4I4WB 1WZMA 3E2HB 2A2QT 2IFFL 2HLFD 4BSVB 1KENL 5FO7A 1BREA 1YEIH 2Z9TA 5I1KH 1N59B 2Y5TA 4G6MH 5SWZB 1JZ8A 1QSFD 2B39A 1NL0H 5C08D 4ZFGL 1N3NA 2VWEC 2OK0L 2AJYL 3SDYL 5CMAB 5E9DD 3VWJC 2C7UA 3GSNB 4H20H 1CT8B 2FD6H 1F02I 1I75A 2D0HA 3EKCA 1LD9A 1CF8L 4Y7MA 3I75A 3O3EB 3OKKA 4G8IB 3MCKB 1TMCB 3MBXL 2NXZD 4BH8B 3MLTA 2O5YH 4I3SH 2JIXD 4FQIL 3TT1L 3P4MB 5GGTL 4LAQH 4LIQL 4ZTPH 5AD0A 1I1AB 4ZD3H 3IVKA 3QDME 5BXFA 3UAJD 4O51B 1U3HB 2Q3AA 1Q9WB 3KPTA 1NCBL 4HUUB 4RGND 4F57L 1NC4D 1M05B 4XP6L 2AEQH 1JPFA 1T21B 2J6EH 4ZFZB 5I8CA 5IOPA 4RAHA 2H3NA 3BPNB 5EFIA 5JQHC 1F42A 2JB6B 4JCLA 3PGFL 3N1MC 3U2SA 1R3LB 3D0LA 3BO8A 5F70A 4KZDL 5I6XC 2VZVA 1HSAB 3C2AH 5F7KC 5IEHB 1NFDF 1M6OA 2XYCA 5D2LB 2BHZA 3FO1B 5AZ2L 2C26A 3OAYK 5D9SB 1S7RA 4G6JL 5GGQH 1CDUA 4H1LG 5K9JL 1J0HA 1U8NA 3UP1A 4HZLB 3UPCA 35C8H 4RBPH 4OZIE 1TQCB 1KFAL 4BA8A 1NGPH 5ISZE 5KZCD 3IGAB 3PE9A 4YK4B 1J1XH 1T3FB 1WLHA 1G6RL 4L3CB 4V1DE 5GGSY 4A6YH 1T5WA 3DUHA 2X41A 3MQIA 5IB1B 2CLRA 3S7GA 1LGVA 5LVEA 4G43A 4PJIE 4K3EH 2BP3A 1AC0A 3TYFA 1L0YA 5KSBB 3VXRB 4PREA 1AJ7H 4JPWH 3UROR 1OCWL 5HHME 4GW5B 2HH0L 1ONQB 4MDJB 4P4KB 3S5LG 2F74B 4X9IA 4YHNB 2OZ4A 4LSRL 4P3CH 1EBAA 4Y4FB 3CU1A 5EBMA 1JZ4A 1GOHA 3W5MA 1IAMA 3B9KD 1I1YA 1YZZA 4EKXA 3MV8E 4HUWA 5CP7B 1FJ1B 4X4YA 1MFCL 4Q0XH 1JN6B 1ETZB 3PV6A 2QBWA 1RZ8A 2FJHB 5I1JH 2V5YA 4EN3B 1MHHB 5TE4H 4BQ8A 3AU1B 4LEXH 3HZKB 2DBJA 3T77B 2Q7YA 4EI6B 5AYQA 4C56B 3OXRA 4WFFD 1BZ7B 4XNMA 3GBML 1A6UH 4JY6B 1EDQA 4P2QB 5KSVA 2VO5A 5DZNA 5ITBL 4FQPA 3QCTH 4QKXB 1IC5H 3K2MC 5DHVB 5T1LA 3LIZH 2I07B 4ETQA 4RGOH 1T0MB 4F7CB 4XVJH 2MKWA 2DLFH 4PBWD 4TUOA 3MV9A 4J23A 3ARSA 3HI5H 3EJZC 1MCFA 3GMNB 4LCWB 3O2WL 1S5IH 2OP4H 3GMQB 4X9BA 1ZA6A 4PRIE 1NCCH 3QXDB 4WTZG 3OBAA 3CPLB 3P30L 3UJIH 1A7QL 2OTUA 2PW1A 4X8XA 1OT2A 5KW9L 1TCMA 2YD2A 4YDLB 2Q1EA 2IAMD 4I13B 1EXUA 3F7VB 3IB4A 3F6IA 3N85H 5GZND 3VXUE 4ZFFB 5B3JF 5BO1L 1UYWH 4NNYB 1BBJA 4ESKA 1ZEAH 4QXTA 5E8DL 5H2BB 3MLXH 1E4XI 1TIUA 3QIBB 2LTQC 3B2UD 2VITB 3SE4C 4LPCA 4APQD 1DUZA 3R8BB 3UTSD 5C0ND 2VH5L 3PHSA 4KVNH 4ZSOE 2O61B 4LOUC 2MQ0A 1T20B 5IESH 4Y2DD 4EEEA 1CICD 1KJ3H 1HINH 3NZ8B 3ULUC 1AD0A 1V5JA 4Y5XC 5GRZA 2R9HD 3PWLA 3S35X 4JQVA 4Q9QL 3WS6A 3ECBA 1J1PL 4YGVA 4N0YL 5FHAL 4Z7WB 3F6LA 4HLJA 4KK6D 1FIGL 2PYEE 1HI6B 4O5LH 3P11H 2EYSA 3GI9L 4EVNA 4OAWA 5JA8B 3QQ3A 5DD3L 4UZGA 2W0FB 4F9LA 3X14A 3EO0B 4NHCH 4AIOA 3TNNB 4FNLL 3KGRA 4NUGH 3L3DA 5C0RH 3WHE0 2XWJA 4FABH 3HG1D 4X99B 1W0VB 3RPIA 1J8KA 1RURH 1S9VA 4NO0B 3ALWA 3VA2C 3OJDA 3MV7B 4WUUE 1BQHA 4U05A 4D0BB 5MENE 1FL6A 4Y4KB 1BVKA 1EAJA 4M6NL 5C07E 2IADA 3H42H 3S34H 5EC1B 2VDPH 3F5WA 4NSKA 3VXNA 5F3HB 3QUXC 2BVOA 5FEBA 2FGWL 4H25A 3D25B 2H26A 4WW1A 2RCSH 1OPGL 5GJTL 4YHOL 4RAVB 4ZAKB 4NQDA 5FCSH 2XTJB 5M95B 1RIUL 2OR8A 3TIDA 1NFKA 4LSQH 5B39G 4IBLT 1JPSL 4FXKA 1HDMB 4KU1A 4NRZB 4WEMB 1IC4L 3HCVB 4R3SA 3STZB 2P5EB 5F9JB 3B83A 3T0XA 1DUYA 5IBLD 4JFED 1U36A 2F54E 4GW4A 4BH7A 4JRYB 3QZWA 2VZUA 1XFPA 2W9EH 3QFJB 4TNVF 2CMRH 1TETL 1A4KB 4I1NB 1P2CB 4TQEL 4L3ED 4L4TD 3WFHB 4HBCH 3WNMA 5C86A 4OV5A 1T5XB 4PJGE 2CJUL 4XCEA 2N7AA 3MLUL 2IQ9L 2AXFA 5FYJH 5MEPA 3CX5J 3G6DL 4LVNB 5C0AD 3LEVL 3VG0H 1WBYA 3IRPX 1TENA 3D0VB 4GRLC 2UUDH 4KJWC 3TCLB 1RK1B 4XVSH 3MO1B 2NY7L 5GIRA 3QCVH 4QCIA 3VH8B 2GK2A 1UJTA 4RA0C 5I73B 1NC2B 1ORQA 5IJKC 2X4RB 1MWAA 1ZTXH 3OV6A 1QFPA 3VE0B 5EUKA 1U8JA 4WWKD 4OCYL 4NOBA 3RIFK 1DQQA 1CFNA 3EDKA 3I84A 1I8IA 1I8LC 2BXYA 3SE8H 1J8HD 4M7JL 5HYEA 4URTB 1IGFH 1T6VN 5IEKB 1I3RB 3QDMA 4F8TA 4GRWF 4KQ3H 2ZCKH 5J11B 2A77H 2P47B 3BGFB 1CWVA 3ARXA 3RHWF 2FJGA 4OLUH 1ACYH 2XTLA 4H0GA 4YGAB 3MMEA 4TNWK 3KYOB 5SWZE 3OF6D 3PABA 3QJHB 4L8DA 4JY5H 2Y07L 3OKYA 1XMWA 1IAOB 4HXAL 1MRDL 3GIVA 4U3XA 3LQZB 4S0TD 4R7NA 1Z9LA 3INUH 3O41B 4A6YB 2MCG1 3H7BB 1MNUH 4NYLB 2VIRA 4LVHC 3WMSA 2RFXB 1X5ZA 4O9HL 3IS1X 1FG2A 5HI3D 5TDPA 1JPTH 2NTFB 1BVLB 4WWID 4NGHL 4OZIA 1B0GA 4HGWB 4Y5YA 5ISZA 1RHHB 3EO9H 5C2BL 1QD0A 2VLKD 5DD0L 4MA1B 2AXJA 2QSCL 4N0CD 5ICZB 1NMAH 3DX8A 2ILLA 4PJIA 2AXGA 3PWNA 2R0ZH 2GK0A 1FSKC 2R2BB 1V05A 2MCPL 4Q9CA 2PNDA 2PR4L 3VFGL 3SE9H 3ZYIA 4B53A 2Q76B 3MX0A 3OAUL 2HFGH 4M9PA 5HGGS 1YY9C 5F8RC 1AFVH 2GCYB 5IMLA 5D2LE 1KN4H 2F8VA 4H1LH 1I9JH 4C59B 4WUKH 2HT3D 3QIWD 4YX2H 2YUWA 3GMOB 1UGNA 4GBXA 2Y23A 1A9EB 4K9EC 4DFHA 2BRRH 4HC1H 1IGJB 3UJJH 1TCRA 2VZ1A 3QG6B 1SJHB 4XMLL 4TVPE 3OB0H 4NKDA 5LGHL 4GJTB 4JCMA 3THMH 3EYOA 2DLTA 3QUKB 5FDWB 5KJRH 2BSSB 3KPLB 4X7CC 4Y4FD 2EIEA 2EZ0D 1ED3B 2AS5M 1FFRA 4KROD 3S35H 1YUHB 1F8TL 3VXRE 1CXEA 1RZKC 1YDPB 5GRXG 4YBHA 1G7JB 1RK0B 1YNLH 3SDCB 4Q7DA 3OKDB 4LBEB 2MJWA 2ZPKH 4MA3A 5HDBF 4IJ3B 1W2KT 2DQGL 4XAKD 1MLCB 2C1PA 5EIVA 2ZCHH 3CNKA 4X98B 1N6QL 2A83B 5LGJB 2VDOL 1X5AA 4G7YH 1MVUA 4OI9A 4TYUA 4RFEA 4XPGH 3O9WC 2Q86B 2DMKA 5E5MB 3V0WH 1A64A 4Z7QE 1QSZA 3WUZA 2J5LC 2GHWB 2BFVL 3C08L 4KMLB 2UZIL 5E6ID 5D1XC 4Y8DC 3HI6L 1Q38A 3WFCH 2H9GA 5AZEH 3C09C 1FO0H 4PRIA 5HYJB 1DSFH 5IF0A 5J1AB 1KBGH 4C56E 1FLTX 1HNFA 1E6JL 5JXAL 2EEAA 4TPRL 1GAFL 1CK0H 4ZPTA 3TO2B 5HYSB 4IRZL 1DBJH 3O6LH 4XBGA 3U30B 2GTZB 1CXKA 1VFOA 4RQQA 3V5HA 5CZVH 1K6QH 3VXUA 4ZNEE 3IDXL 3U46A 3IRZA 1PVHA 2BY0A 4JG0H 3KPSD 3Q1SL 5D7SH 2QHRL 4B0MM 4DVRH 4HWBA 3FT3B 2FEEI 1W72A 4XC1H 3T1FB 2WMPA 2ZNXA 2CKBA 1KN2L 4FOMA 4OZFG 1G0YR 1LE9B 1GIGH 3CC5B 1YEGH 3IFPB 4OZ4A 5C0IA 3DBXA 4LCWE 1IEHA 1MJJB 4NCDA 2R0LL 3CDFA 3UPAA 4ZSOA 3LD8B 1Z0NA 2BX5A 4J3UA 4YQXL 2VOTA 1JGDB 1MQKH 1WEJL 4WHCA 5DMGC 5L88H 5IW6B 5KS9E 4P46B 2KL6A 3V6OC 3RA7H 1VGKB 1I7ZB 3D85A 3EHBC 3CMOL 2QEJA 1JV5A 1DQJA 4IOFC 4OZHF 4P5MB 4GUPB 1PX3A 4FQXA 5DJ2B 2AV7A 3GI8L 2PYEA 4KJYA 1RZJH 4KJQD 4OLWL 7FABL 3GMMA 2AJXH 5KOMC 1DBMH 5JDJA 4WI4A 1U92B 3DXAB 3TA3A 4PTUA 4FQHA 3HE6B 3BZ4B 2H6PB 4PJ9A 4QHKI 3WE6B 2SEBA 4P49A 4OD3L 2I5YH 3NA9H 3HZMA 4I0PC 4CW1A 3E6HB 2VUYA 5ABDE 1KB5A 2W91A 1LO0H 4WUUA 1KOAA 4S1QH 4YHPA 1CE1L 3MRDB 4DZBA 4J2XA 5C07A 1UZ6E 3PNWA 1E4KA 1AGBB 3MJ8B 1YEIL 1VFAB 4HKJA 1U3YA 4KJPC 1MCIA 1NL0L 4IMLB 1HWHB 1HYRC 1PSKH 1CTOA 4ZTOL 3MRQB 3WUWA 2HJLB 2Z35A 2F5AH 2O5XH 3OKEA 5CZKA 4U2YA 4Z7WE 3V9FA 4H20L 1YC7A 2EH7H 5BS0B 4JDVA 3HMWH 3VW3H 5I8OL 2Y7QA 2FR4B 3W39A 1QRNB 1GJIA 3W0WD 2CRIA 3PQYE 4ODHH 1I8KB 5DI8A 3QUMA 2VLLB 3VFUA 3RDTA 5EU6B 4OFYA 3RZCC 2EDWA 1JTPA 4ZTPL 5B8CA 2P46B 4ZD3L 5EO1A 5HHQA 2XN9D 2XTJD 4GG8A 3MV7E 1E4WH 4P23C 1PQZB 4Z0XB 1KEGL 3BN9D 4PJGA 4WFHE 5DRNB 2XZZA 2AEQL 4JN1H 3OAZH 1E6OL 4WI2A 4PRDB 32C2B 2J6EL 1CS6A 43C9B 5GGVY 5T3ZL 3MRMA 4Y1AE 5DQ9A 2CLZA 4UQ3B 5HVGB 3LQAC 3VG9C 5B38G 3NACH 4TSBH 1ZV5A 3ARDB 5IMOB 2YZ1A 2ZOKB 5C7XH 2P5EE 2P48B 3T4YA 5FF6A 1P69B 3MZTA 4Y5VB 3SKMA 5JORB 4JRYE 4AEIH 3RWGB 5F6IB 3QFJE 1P7KB 3ZE1F 5GSRB 5HPMB 3QI9D 1C5DA 2V7HB 3L6FB 3SKUD 5I2IB 4OIBA 3TVMB 2PYFB 3D2UD 3O8XD 3FQNA 1HKLH 3S98A 2YA1A 5KSAA 3PWPD 3TN0D 3RWCB 1EGJL 4NC1E 1J1XL 2UV3A 4JFHE 2VNCA 4IIQA 2X4SA 1INDH 1FFNB 3FT4A 3IDMA 4A6YL 2C3VA 4LRNH 4QOKB 1J05A 3NAAL 1FYHB 1FFPB 3QHFH 4LDOB 4I4WA 4HIXL 4BSVA 3C6LB 1IKNA 3QXAB 1AJ7L 4JPWL 1FG9C 3JBG7 2N56A 4H0HB 5T3ZD 1N59A 1JFQH 4HWEH 5SWZA 2YUZA 4RX4A 2DJUA 1AKJB 4P3CL 2QQNH 4QWWD 3P4LA 4PJFF 5CMAA 1CT8A 3K0WA 5I1LB 4ZO8A 1HCVA 4FQJL 4X7DC 1A6ZB 3O4LD 2PCPB 1NCWH 3O3EA 1I1CA 3MCKA 1J10A 4L9LC 4BH8A 4X6CE 1GH7A 1A1NB 3P4MA 1Z0MA 5TE4L 3OR7B 1I1AA 4JKKA 4LEXL 4QHNB 2MOVA 3ZHDA 2XQYG 4BKLB 1I7TB 1NCDH 1U3HA 4H1LB 1OTTC 1Q9WA 3CVIH 1A6UL 4HUUA 5I0ZA 1FVCB 4JJHA 3QCTL 4M62H 1MUJB 2D0GA 1M05A 3AS1A 3JV4B 4OQTA 1T21A 3KYKL 4ZFZA 3C60D 3LIZL 2OR7A 1WAAE 4QNPF 3K4DA 3S88L 5E24E 2V2WB 5HVHB 1R3LA 3BKCH 5HI4C 1OP9A 4XVJL 3MRFB 2DLFL 2ZUYA 1HSAA 3TM6A 5B4MD 5JNYB 3RQ3A 3E1F1 4OM1H 5D2LA 3FO1A 2VL5B 3HI5L 2R1WB 5D9SA 5JW4R 5T1MB 4PJCF 1S5IL 3IF1B 2A0LD 2OP4L 3ULUH 3QWQB 5C0CE 4NP4H 1ZHNB 1IEBA 1NCCL 1T80A 1FNSH 2OR9H 3UJIL 4WU5B 3IGAA 1T3FA 1TITA 4MGXA 2VLRD 2I26N 4L3CA 4X6DE 4ZXBB 3G08B 3NPSC 3N85L 5IB1A 1XEDA 1QLEH 1UYWL 1BFSA 1ZEAL 1YQ2A 3MUY1 5I19H 3V6ZB 3VWKB 3VXRA 3AVEA 3MLXL 4MA8H 5C6TH 3DX6B 3ARGB 1FO0B 4WFGE 4GW5A 1ONQA 4MDJA 1R24B 4P4KA 3CLEL 4PIRF 5ITFB 2F74A 4YHNA 4IHOB 4XMKH 5FGSA 3VXPB 5I15H 3F7QA 4GRWB 4KAQH 2APTA 4B7LA 3OB0K 2OXGA 4XCCH 1NAMH 2OX5A 3IDJB 5E08H 8FABB 1QLRB 1TFHA 4KDVA 1P6AB 5CP7A 1FJ1A 4KVNL 5A2KH 1BF8A 1MCWW 1JN6A 4KKAD 5SWQB 2C3XA 3ARWA 4MJ2A 1F97A 4OCMC 4O2FA 1QKZH 2FJHA 5HXMA 4EN3A 1MY7A 4HKBB 3MXWH 3GGWA 1KJ3L 3RIFF 2WIIB 1U2HA 1HINL 3AU1A 3HZKA 1IAII 3T77A 4J1UB 3HE7C 4EI6A 4C56A 4JFYA 4N0UE 1BZ7A 1RUPH 4OCXH 4JY6A 4P2QA 2ERJB 4M6OH 3S3PA 1CFSB 2ESVB 3P11L 4L4VD 2E7MA 4LL9A 4PYHA 5DHVA 4OI8A 1A6PA 4ZNEA 1LK2B 2I07A 4NHCL 4MJ6B 3WJJC 1KEML 2Q87A 3X13B 3H6JA 1T0MA 1QTYT 1RURL 4F7CA 1MCHA 2DWDB 1RJZB 5E2JA 3MJ6A 3MOBL 4G42B 2AQ3A 1P9MC 4DKDC 5KVEL 4P2OB 3H42L 3CVHH 3S37X 1AE6H 2VDPL 5EWIL 3GMNA 3G5YB 1WZ1L 3N1FC 4LCWA 4CMMB 3QDJB 3QO1B 4BJLA 3GMQA 5HYJE 3UDWC 3SO5A 2YA0A 4HK0B 1PGRB 1YMME 3QXDA 4YEFA 3OKNB 4MXVF 3CPLA 5BMFL 4LSQL 2DBLH 2CRYA 4KKNA 4MVBC 3T08A 2OCFD 3LKNA 2G5RA 2X4UB 3ET9F 5GGUB 1KULA 4NNYA 3AMKA 1FP5A 1SJEA 4OTXH 5IHLB 5HYFA 3BHBB 2W9EL 3RVWD 4N5UA 1ZHLB 3QIBA 3MRIB 5JHDE 1I3UA 2VITA 4HBCL 3JVGC 4OZFH 1Z2KA 3ARFD 1MY5A 3RKDC 4LAJH 2VXVL 4TOYH 1UM4H 3GHEL 3O11B 3L3JB 4YHZH 5JW4Q 3GKZA 2O61A 1EZVY 3VG0L 4UB0L 2DIAA 4HG4J 3DMMC 4HKZB 1KJMB 3GM8A 1G9MC 1T20A 1S7TB 1TJGH 4XVSL 4JB9L 5L9DL 4UDUA 3NZ8A 2PTVA 3QCVL 4U49A 4M5YH 3FONB 2AEIT 1XT5A 1MFBH 4U1SB 1ZTXL 3QUYD 3MBEC 4Z7WA 5IBTH 3QIUD 4GQ9H 1HI6A 5ADOL 3FJTA 4P0DA 4KY1H 1S7SB 2DKMA 4PJ8B 3VGGA 4WW2F 1ITCA 3LOWA 3ZDYF 5T3XE 1FNLA 2B2XH 5FYKL 2W0FA 3EO0A 1CDCA 1WFOA 5B39B 4DK6A 3TNNA 3DSNA 3SE8L 1U8PB 4X99A 3ZTNH 5KAQF 3KPOB 4OKVB 1W0VA 1U8LB 4EZMA 3C5ZD 1XH3A 4NO0A 2AEPH 2ZSWA 4N8PA 3SBWA 3MV7A 1QVOB 2P43B 4D0BA 1LP9F 4KQ3L 4X6FB 4Y4KA 1OLZA 1H3VA 1I7UB 3AREB 1AGCB 4OLUL 1ACYL 1BFOB 3ELAT 3FFCD 4MA7H 4TULL 5HHVH 3D25A 4RFOH 4ETYA 2WBWB 2FBJL 4RAVA 4YHLH 4ZAKA 4Y8AA 3BD4A 1ADQH 3GSUB 5C09B 1HDMA 4JFZH 4NRZA 3HCVA 3STZA 1A7OH 5I76B 5BS0E 2P5EA 2YD7A 5F9JA 2NY1D 1X5HA 1OTSC 3JWDL 3X3GH 1N5AA 2ICWI 2X1OA 1TPXC 1CDYA 3KLAB 4AIXA 1QRNE 1K4DB 4JRYA 5F7DB 4R4NC 1VESA 3QFJA 3DVNA 1JPTL 5CSGA 5FYKD 3DUSB 5EU6E 3C9NB 4AMKH 4LPXA 1DTUA 1UKTA 4KRNA 2P8PB 1P2CA 4GKOA 3UO1H 3WFHA 5B3JE 1UG9A 4OZHB 1T5XA 5IJVA 5E9DE 1EUTA 3EO9L 1R3IH 4KDWA 5HHNB 4LSVL 4NQUA 4LCYB 2WP3O 2IJ0C 2OBGA 1ZVSB 1NMAL 4K94C 4QRUB 5I1DB 2DL2A 3TCLA 2H2SD 4UTAH 5F7FA 1RK1A 1OAZH 3MO1A 3CCHB 5F7MC 3TVMD 2YKLH 2EYTB 4LQ1A 1AQKH 1NC2A 1KN4L 4NT6A 2X4RA 5IV2A 1I9JL 1IL1B 3OMZA 1IM9D 4WUKL 1P7HL 3VE0A 4PJDF 4KTDL 2LTQB 1X5LA 2F53B 3QRGH 1Q94B 2BRRL 4HC1L 4JAMB 3U4AA 5ADPL 3EYSL 2H32H 4MJIB 4MDIB 4DKFH 2B1HH 5AYUH 4E0RB 1BJMA 3IFNH 4QY8B 1L4IA 5IEKA 1I3RA 4G6AC 1NCUA 1BIHA 1YEKH 4QOKE 3RNQB 3S35L 3W2DH 1KYOK 4LGPB 2DAVA 3G6JF 4KTYA 4WCYH 4ELKB 4CU6A 1YNLL 2GJ6B 2A6DB 5DC9B 4WTXA 5CEZE 4RIRB 4PLKC 3AC0A 3KYOA 2ZPKL 4JZOB 1WAAA 3QJHA 3GSQB 2ZCHL 1IAOA 2EDKA 4KI5C 1JBJA 4GXVL 3V0WL 4YDJB 1BLNB 3O41A 2WLZA 1DCLA 4BFIB 4NYLA 5GS2H 3L3OB 3VI3E 3WNNA 4HX1B 1OP5K 5AZEL 4NC0B 3WFCL 3O3AB 3S37H 2IFGA 2NTFA 1BVLA 1E27B 4JN2B 4M7ZB 2FX8L 4HGWA 1KBGL 5LGKA 5GQBA 1IGMH 4ACPA 1RHHA 2RQ8A 4PJHB 1CK0L 4WJ5A 5EDXA 3LY6A 4ODVH 1LO3H 5HY9B 4U2ZA 4X6DA 5TFSH 3SKOB 2DD8H 5ICZA 1K6QL 4XVUC 2VLMD 2J3SA 1MHEA 1VA9A 4ZO6A 3L95B 4XMPH 2R2BA 1EEYB 2ARJB 4LLWB 2BOBB 5ID1B 2XZCL 4JG0L 2Q76A 2DM3A 2HVJA 3G5ZB 5D7SL 1U9KA 4DVRL 4PY8J 4XC1L 4XHJD 2GCYA 2VDLH 4P5TB 2ZUQB 4HZAA 2HT2C 1GIGL 2GW5A 1I1FA 1YEGL 3GMOA 3WIIL 5D2NB 4YO0B 4MXQD 2VSCA 1A9EA 4OZGB 3BAEH 1GC1C 3U0WL 4EI5D 1IGJA 2AGJH 3VWKD 1MQKL 1SJHA 5L88L 3SDDA 3UTTB 1PZ5B 4X80L 2EDDA 3RWFB 1YC8A 3RA7L 2FX7L 3QUKA 2BSSA 3KPLA 4K3GA 5DS8A 3U83A 1NCAH 4LASH 1ED3A 4HW6A 3MA9H 1YEDB 3VDBA 4N0UA 5D72H 3BJ91 4XX1G 1NMBL 2NYYC 3DGGB 4XI5D 1YDPA 3QUZD 2D7PA 5SWSD 1RK0A 3SDCA 1G7QA 3HB3D 3OKDA 4LBEA 2NY4C 3KJ4B 4HQQL 4JQVC 3GHBH 4GRWE 3WS6C 3N0PB 1MLCA 4X98A 2IPKA 4FMKA 1AO7B 2A83A 5LGJA 2I5YL 2B5IB 2DM7A 4GLRH 5E5MA 3BD3A 1ZXQA 5EUOB 1KJVA 2DQHH 4OLVH 1LO0L 3KYMA 4F9LC 4S1QL 3LQAH 4WY7H 2QQKL 3RWDB 3CUPA 4KHTL 5I16A 2FL5B 1TQBC 3SOBH 4IRJB 5DJXB 1AXTH 5ESAB 5HYJA 1PSKL 5D1QB 4H0IA 5J1AA 3VWJD 2F5AL 2O5XL 4BZYA 1SEBB 1DBBL 5I8EB 3OR6B 3TO2A 4OCRH 3IJSB 4PJCB 2EH7L 2ESVE 4PB9L 3VGAB 2R39A 3HMWL 4M3JA 4YR6B 2GTZA 4BQ6A 5DJZB 3EYUH 2AJ3B 2EEBA 3VXTB 2ADFH 2BOCB 2QSVA 3AB0C 3OX8A 3QDJD 2VDMH 3TNMA 3JXAA 1DANU 3TO4B 1CR9L 5JHDA 3FT3A 1RUKL 5EN2A 4NQVB 3T1FA 5FHBH 1E4WL 4HWZB 4LVHB 5HDOA 5IHUH 2RGSA 1LE9A 3T0AA 5BQ7B 3CC5A 3IFPA 1MJJA 4NQED 5DRWA 5DMIH 4JKLA 4M5ZH 4GMTH 4N5EC 1JGDA 4BSWA 1D6VH 3VFTA 1WTLA 1HH9B 2PXYB 4HMCA 4CN1A 1VGKA 3L1OH 5JDSA 1FFQA 4H5SA 4P5MA 2ITDB 4GUPA 4AEIL 5I1HL 5F9WC 4TN9A 3UTQA 4L1HA 1FIEA 1U92A 3DXAA 3B6SB 3HE6A 4U0RC 5L0QC 5DR5H 1HKLL 4L3AA 2H6PA 5ANME 4UV7H 3WE6A 1WC7B 2DICA 3E6HA 2DYPB 4WO4A 5E00A 3TP4A 3KPQB 4JFEE 5HDBE 4LRNL 4DN4H 4WFED 1S3KH 3MRDA 4D9QE 2HJKB 3QHFL 3D1MC 4NNPL 1B6UA 5INCB 4HS8L 1AGBA 3RJDA 3TC9A 4ZO9A 3MJ8A 1VFAA 4YWGH 4HWEL 3QHZH 4IMLA 3MRQA 3MRLA 2HJLA 5JOPD 5E99L 4ORGB 4U6YB 4QTIL 3U6RB 1C1EH 5BS0A 2YPKB 2PUQT 1ZANL 2BC4B 5B38B 2F19H 1A5FH 2R69H 1AP2A 4J3TA 1QRNA 1NCWL 3T0EC 4OFDA 4Y0GA 1I8KA 3AAZB 3SO3C 1ITBB 2VLLA 3O9WB 4FRWA 5EU6A 1CXHA 1E4XH 3C2SA 1WIOA 1AY1L 4UU9B 6CGTA 5LAXA 3RX5A 1PQZA 1NCDL 4Z0XA 5E9DA 4QRPD 3CVIL 3BGMA 3D9AH 1H3UA 3MUHL 4M62L 1AQDB 2IF7A 4EQ2A 1JE6A 32C2A 5TPWH 43C9A 1OAUL 3SKNB 3KYAA 4UQ3A 1T2JA 1UJ3B 2A9MH 4Y5YC 2H32B 3D39D 3ARDA 3BKCL 5IMOA 2ZOKA 2DQIL 3DROB 1LDSA 2JJTA 2WWKT 4HK3N 5IIEB 4CDHA 4JO4H 4YBQC 3EJZD 4YBLB 5E2TL 3EJYC 4Y5VA 4M7LT 1NC4A 4X6BB 1JF5A 3BUYA 4PLNC 5J1SC 2A6JA 3RWGA 5I1CH 4O00A 1DN0A 1P7KA 5GSRA 5HPMA 3ULUL 2DIBA 1OGTB 2V7HA 1XF3B 3L6FA 4GS7C 4I18C 3VFRB 4OZHE 4J3VA 4U7SA 3UEZA 1BQHG 3FQXB 3NABL 3IKCB 4RMSA 3RI5F 2DQCL 1OAXL 3WFEH 2KUTA 3ORJA 4GBXC 1ZSDA 3V7AE 4QRQB 4QOKA 4WI3A 1D6EB 1B2WH 3PP4H 3K1DA 1FFPA 3F58H 1NKOA 1ZHKA 3MJ9L 5I19L 3C6LA 3QXAA 2BVTA 3DECA 4MA8L 5C6TL 4PJBF 3WIFB 1U8HB 1Q1JH 3FRUB 1LP9B 5FYKU 5I15L 5HTSA 3WO3B 1AKJA 3W81A 4NQCB 1OT1A 5K9OB 1NAML 1H5BA 4RAUB 4CU7A 1MCWM 4NUJB 2X10A 4GAYB 5BV7B 3IU4L 3QZWG 4LOUD 2R15A 3F12B 3SKJH 5TQ2H 1A6ZA 2F53E 1EHAA 2PCPA 2IPUG 4MLSA 1QKZL 1RJYA 4LF3B 1F3DJ 2W38A 2B4CC 3ULUD 5BRZD 3MXWL 1A1NA 3OR7A 4QHNA 1JHLH 4BKLA 1I7TA 3V79C 1RUPL 1AGFA 1IGCH 2GSIB 5A3IC 2P5WB 1ZGLB 2GITA 4R4BB 1FVCA 2DL9A 4XCNB 1BQUA 4AZ8A 3HZYB 4Y4HB 3JV4A 2GJ6E 2O26U 3BZEB 2Q7NA 3CZFA 2JLLA 3O4OB 4JE4B 4X9FA 3WO4B 4AYFA 3BVNB 3CFDB 1Q0XH 1BZQK 3FAWA 1I3VA 3MRFA 5BOPA 1XR8A 4EXPX 5JNYA 4KPHL 1UM5H 4D2NA 2VL5A 4R6UA 1G9MH 3D3VB 3QUXD 5DEFB 2GEEA 3CVHL 5F1SA 3BISA 4AEFA 5T1MA 3CH1B 1CVSC 3IF1A 3MRCB 4XB8A 3DYPA 4EUPG 1MH5B 4J3OC 2OJEA 1Y0LB 2ZUSA 1ZT1B 2F8OA 1J0ZA 4WU5A 3VD5A 2DBLL 5IW1B 4PJDB 2AABL 3OJVC 4XNUH 2MKLC 3WFZA 1RSFA 3ZE1E 4ZXBA 1LEKB 1R3KB 2V17H 3RBGA 4XC3H 4ZG1A 5H94A 3ZKQD 4PJ7B 2LAAA 3B8YA 4OTXL 2EO9A 3VI4F 1ZOXA 3V6ZA 3KPRE 1XIWB 4NZTH 1K9TA 5EA0H 2NY6C 3DX6A 3ARGA 1FO0A 4H88L 4NJ9H 5DHXB 1R24A 4CN4A 4IHOA 1D5ZB 3VXPA 2D31B 3T2QA 1F6AA 1OD9A 4FQXC 3IDJA 3MSPA 4TOYL 8FABA 4POUB 1QLRA 2XICA 4YHZL 5D2NE 3QDGB 2APVA 1A7RH 1BD2D 4GRLD 2R2HB 1U41A 4AEHH 1BP3B 4KJWD 1VKXB 5SWQA 5HHXH 2AJVH 4AQ1B 4PJ9C 3K80A 1MSPA 3UTTE 3STBA 4WIQA 3ROOA 2VXTL 2WIIA 2BCKB 5EZOH 2WQRA 1G7PB 5EORH 4J1UA 5D7JB 1MFBL 4ZYKB 5IBTL 5EZIL 4GQ9L 1CFTB 1CGWA 3K81A 1JL8A 1G0DA 1E4KC 2ESVA 4OD1H 1CYGA 4LMQE 4UAOC 2QADC 4D9RD 3P0YH 3AY4A 5CBAB 1V7MH 4HULB 4MJ6A 3X13A 15C8H 2VQTA 2FJFB 3ZDXF 2HVKB 4Z7NF 5FK9B 2AEPL 1RJZA 4KRPB 4QNPE 4K94H 5D7IF 4RGMB 4P2OA 1PX4A 4S2SB 2D7MA 3G5VB 2BRQA 3G5YA 3EYVB 5ACLA 3BIBX 3RDTC 2G2RB 3QO1A 1KTRL 4MA7L 4RFOL 5B8CC 4HK0A 1Q8MA 5E03A 3U1SH 4Z77B 3UMTA 3OKNA 4YHLL 1QFUL 4HIEB 4DUWA 1ADQL 1Y6MR 4NO3B 4PJCE 2OM5A 4PRAB 5MP6L 2X4TA 4K9EL 3X3GL 1UH3A 2X4UA 3EOTL 2AKRB 2XRAL 5GGUA 3TPUA 1TNMA 5LWYH 4XB7A 2VJXA 3HN3A 4PB0H 3BHBA 2P7TB 3TH2T 3VXSB 2XFXB 3RY4A 1CGSL 3MRIA 3E0GA 3PHQB 2G5BB 2NXYC 5FUCE 3MRHB 1R3IL 1RZKL 2FX9H 1TVHB 3TBYB 3L3JA 3QB7C 1T6WA 4HPOH 3T09A 3I6GA 3RUGF 3VRJA 4HKZA 2QSTA 1KJMA 1JRHH 1PW3A 1W8NA 5KSAC 2CXGA 4M93C 1S7TA 3QPQC 1OP3K 2YUVA 3K2UH 3OWEA 3QCUL 4GH7B 4FG6C 3IFOB 3WKNA 1YY9D 3NTCH 2C9AA 1TJHH 4IIQC 3NPSB 4LQFH 5KVGL 3FONA 5DMYA 4U1SA 1BX2B 1AQKL 3CFIC 4XBEL 5L6YH 1RUQH 3E2HC 3FO0L 5AG8A 1IKNC 1S7SA 4PJ8A 5EO0A 3MRJB 3O3BB 2FIKB 3BD5A 5GISH 3QRGL 1P5UA 1WT5A 4LLQB 4RWHA 2E7HA 5B39A 2IAND 2UWEB 1RUAL 1VCAA 1U8PA 1BQLH 2DI9A 1R5WB 4NNXB 5EOCH 1LILA 4OKVA 1U8LA 1JNJA 1IRAY 2ENSA 1QSEB 5FDYA 4P2RB 2BNRD 3WL9B 2WBJB 3W2DL 1I7UA 1UWEL 5AUMB 3ME0A 3AREA 4IDLA 3GB7B 4WCYL 1AGCA 3ZKNC 1BFOA 2H2PC 5IR1B 4HUXB 3VFPA 1I1AC 1NAKH 5DLMH 4PRHD 2CO7B 2IALB 2D7TL 1G1CA 3O9WD 1U3HC 5E5UB 1JF1B 3IDGB 3TYGL 1Q9KB 3DRQB 3EIFA 3GSUA 2XQBH 4OKDA 1R5IA 5I76A 3QEUB 4F8QA 5D1XD 3KLAA 3BPNC 1B0RB 1JIBA 1K4DA 4MXVE 3T2NH 1B9ZA 5F7DA 3S37L 3DUSA 3C9NA 4PD4J 2P8PA 3CDCA 2G9HB 4OZHA 4JREB 4HAGA 3I50L 1WFUA 1F11B 2MFNA 4I0CC 1FDLH 4ODVL 1LO3L 4G9FD 5HHNA 3VRIA 1VFBB 4LCYA 4IEFB 3BQUB 3M8OL 1M7XA 5TFSL 3H0TB 2DD8L 1ZVSA 4QRUA 4ZPVB 1ND0B 1TQCC 5I1DA 2LU3A 4U31A 3O3UN 4XMPL 1LK3H 1VPOL 4U6HB 3WUWG 2YEZA 3CCHA 5BJTB 3JTTB 3U4EB 3HNVH 3PIQA 5DUML 4G6FB 4U6VH 4O4YL 4ELMB 4HH9B 3T0BA 4QF1B 2NY2B 3VGEA 3C6SB 2HRLA 2VDLL 3HKFA 1NGQL 3WSQH 1IL1A 1QPPA 2CXKA 5D6CA 5CBEB 2BVQB 4YZFF 4UNTA 2FHFA 4M7KL 1OM3H 5GS2D 1P6FA 4KZEH 2F53A 4P4KC 4OCLC 5DMGD 2HWZH 3BAEL 1F4AA 4JAMA 3TF7C 5DYOB 5J56B 4JQIH 3MRGB 3QWRD 4AENB 4MJIA 4J6RH 3EHBD 1FZOB 4MDIA 2FDBP 3ZDYE 5JZ7C 4IOFD 1V7NL 2V9QA 2R0KL 1P84J 1NCAL 4NQCD 3RNQA 1EPFA 3MA9L 4FS0A 5D72L 4ELKA 4EN3C 2GJ6A 3CX5K 1CIUA 2AK4D 5JW4N 4RIRA 4YC2B 2J7LA 4HFUH 4JZOA 4ZUVA 1CDBA 1LP9E 3GHBL 3WD5L 4I0PD 5HGDB 1FQ9C 4CMHB 1D9KB 3WBDA 5F6HJ 2M1KA 2Q8AH 4YDJA 1BLNA 3NCEB 4OLVL 1QFOA 1FYTD 1SMOA 3GSWA 4BFIA 3VD9A 2CH8A 1V8HA 3AS0A 3LQAL 1TXKA 4WY7L 5FM8A 1OF2B 3L3OA 4AY0A 1LO5B 4J12A 5LCVH 4HX1A 1YYML 4KJPD 2A6KB 4ODWB 2X1QA 2CIKB 1DR9A 1E27A 4JN2A 3I02A 4UIMB 2WUCH 4NBXB 3LCYA 4D3CH 2DTMH 5FV1L 4DGIH 3I75B 3BP4B 1QLFB 3ES6B 4OCRL 2E8YA 5HY9A 1WIUA 4P3DB 5K93A 3SKOA 3NN8A 3EYUL 3UTPD 3WYRA 5ACMA 4OLXL 2VLJE 3L95A 1JYWA 2YRZA 1MWAH 2ADFL 1IEAB 3C8HA 5C0JB 3RZCD 3FQRB 4LLWA 1WIPA 2VDML 3KPRA 2X09A 4FXGB 5JLZB 4DW2L 5ID1A 5L2KB 4YDLC 4P23D 5I8CB 5IOPB 1BWMA 5FHBL 2X89A 2H3NB 3RKPA 4P5TA 2VR9A 3SJVD 5J12B 1UQSB 3NIFF 4EUPH 3TZVB 5D2NA 4YO0A 1N64H 3QIBC 2MHAB 3RAJL 3HFML 5E8EA 1OLLA 1D6VL 4QRRB 3V4UH 2ADIA 3UTTA 4CRPA 4NCC2 4PJDE 1PZ5A 5TF0A 3DVFA 3RWFA 4NN5C 3IKKA 2LU4A 4MB4A 1YEDA 1U93B 1NUDA 5JR1L 4JZJB 3D69B 3DGGA 3AM8C 1XZ0A 5CD5C 3R0NA 1EFXD 1BHGA 1U6AH 5CKAA 5JUEL 2DJ4A 4BQCA 5TDNA 2BK8A 4MYWB 4PLJC 5DR5L 5IFHL 4UV7L 4LK4A 1AO7A 1H9VA 3TYFB 3G6JE 4PREB 3O6FB 2KZWA 1FL3B 5GGSA 1DQLH 5DURD 1U3JA 3QDGE 1I1RA 4CKVX 4MMXC 5F9DC 1X4ZA 4DN4L 1F13A 4FQLH 3P0GB 3DIFA 3RWDA 3BWUC 3KXFD 3K3QA 2FL5A 3E8UH 2XKNA 1JPST 1JGEB 1CD9B 4IRJA 5DJXA 1UZ8B 5TE6H 1CE6B 3CIQA 3QHZL 4HUWB 3L5IA 4PR5B 5ESAA 2VRAA 5D1QA 4BQBA 2DM2A 5GS3A 3SBWC 4Z76B 4ZS6C 1BGXL 4RISH 2JB5H 4OB5L 4Y4KC 4Q9RH 1RZ8B 3LN5B 2B7DT 1B90A 1SEBA 4ORZC 3OR6A 3H9ZA 5I8EA 3IJSA 3MACH 4PJCA 4HF5H 4X7EC 3EYQC 2DDQL 4YR6A 4YH6A 5EZLB 3O0RH 4NKIH 5DJZA 4S1SL 3VXTA 4ZAKC 4LHQB 1OTUC 2BOCA 5AWNH 1ZT7B 5T1KB 5DVLA 3TO4A 3TFKC 1F90H 1OTTD 4NQVA 3W82A 2FYYB 4HWZA 4JRWA 5T5NF 5D7LD 3EDFA 3NCFB 2QKIB 2YZ8A 3VXOB 3D9AL 5BQ7A 1I9IH 4I3RL 1CXLA 5TQ0H 1KC5L 5TPWL 2IH1B 4JHBA 3EAKA 4PV8B 4TUOB 4LPVA 3TWCL 2A9ML 3D18B 5HI4D 4KK9C 4XPFL 4NC1C 1HH9A 2PXYA 3ZE2F 5T33H 5CHNB 1NGXB 4J8RB 2ZNWA 4JO4L 4LPWA 3LB6C 4AH2B 5DT1H 2ITDA 3LPWA 2VAJA 4EDXB 2B4CH 2Y5EA 3QEQD 4TRPL 5I1CL 3VXSE 3TBWA 3DUUB 4JRXD 2OJZL 5I74B 5C0GB 5I73C 5IFJB 1VFUA 4Q2ZB 4OLYH 1WC7A 4QXTB 1MCCA 5J6GB 3H3KA 4FQ1H 2DYPA 4O2CA 4UTBL 3KPQA 1QG3A 1FHGA 4M3KB 5LXGL 4JFFD 4DUXA 1B2WL 3PP4L 1OY3B 3BYTA 3F58L 3GSXB 1QRKA 5INCA 4NWUH 5DFVC 3U7WH 1JGLL 4UNUA 1RIHL 1FORH 4R4FH 1OQOA 4Y19B 1RMFH 1MJ7L 2EDTA 1Q1JL 1D5IH 3TN0A 5FYLL 3BDYH 3RGVA 2CIIB 5J11C 4ORGA 4JFDD 5IM7B 3BGFC 3A6BH 3TV3H 3U6RA 5C0BD 5IB4A 1QSED 1AD0B 1GYAA 1GPOH 2BC4A 3SKJL 5B38A 5TQ2L 3UYRH 4GG6F 5EZJB 1OQXA 4YGVB 3MOAH 2BNQB 1HSBB 2CKBH 3GK8L 4DJMA 5GS1A 3AAZA 3A67L 2FCBA 4N90D 3HE7D 3KAAA 4OAWB 1KSRA 3QQ3B 5EPMA 4AT6A 4UU9A 4F9PA 5IVXF 3UZVB 4DN3H 4P2RE 1OGAB 3MGOB 3T65B 1MCBA 1MPAL 1TQBB 1V3KA 5F88A 3HNSH 5DFTA 1AQDA 3RPIB 1W8OA 5MHSE 3H9SD 4WEBH 3OJDB 4K3DL 3SKNA 2J4WH 1UJ3A 4R26L 2IADB 3B5GA 1Q0XL 2H32A 3O6ML 5IUSA 4PRPD 1J11A 1EMTH 3JV0A 5MI0B 1DBKH 4JM4H 3HZVB 1NLBH 3DROA 3V52H 1MCOL 4MA1C 1BFVH 2YA2A 5FYLD 4WW1B 4IOSD 3RIAF 3RUGB 1F3JB 2WSKA 4PY7B 2Z31B 3MLYL 1G9ML 4X6BA 2AJSL 3RFZC 4L9DA 4M00A 4FXKB 3FQWA 4XWOC 3QJFA 4JHAH 1OGTA 2X44D 1XF3A 2F5BH 3VFRA 4S1DC 4GW4B 4CVXB 5IWLA 4MVBD 3FQXA 3PDGA 3O2DH 4XZUB 4WW2A 4XP4H 3P0VL 1KIUA 4NM4H 4DQOH 4QRQA 2V17L 4QGYA 1KJ2H 1NMCB 3ULVF 1D6EA 5CILH 5EA0L 3SCMB 3RGHA 1ACZA 1RV6X 4NJ9L 3WIFA 1U8HA 1AHWA 5MEPB 3FRUA 4LCUB 3HC3H 3RKDD 1LP9A 1WBYB 4LLDB 5K9OA 1L9NA 4H26B 4NUJA 3OJ2C 3QUMH 4GAYA 2EKSB 1UB6B 3SDCC 1RZGB 3DMMD 1A7RL 2VLME 2ED8A 3F12A 4OCWH 1UCBH 5I1EH 5L0QB 4P9HC 4PGEB 4AEHL 2NZIA 5BVJB 3KLHC 4IJ3C 5F7EH 4FFZH 4LF3A 4OCSH 1DL7H 3ZL4H 1LO2H 2VR4A 5CZXC 3FB6A 1U8JB 1IMHC 2ZUXA 3QULA 1EJOL 3MBED 3ARBB 4XXCA 4KXZH 3MRPB 1CGXA 2GSIA 1ZGLA 1EFQA 2JKXA 1F5WA 4R4BA 2LV4A 4XCNA 3QT2A 2V5TA 4EUPB 1IGIH 1F6LL 3HZYA 4OD1L 4Y4HA 1FNFA 3DV4B 3NA4A 5J3HC 1LO4L 3BZEA 2CRZA 3EFFB 4D0CB 2VLJA 4KKLC 5FA4B 3BVNA 2EDQA 2OSLB 3CFDA 4NQTA 3SEPA 15C8L 3NCMA 4B41A 4TUKH 3V6FB 4UT7H 1T03H 3S36X 4K94L 2C3WA 3LPFA 3VGFA 1NUGA 5DEFA 3D3VA 3FO2B 2CK0H 2H1PL 3CH1A 5A43C 3MRCA 5KVDH 5HDQH 1T83A 1MH5A 4NZUH 2EXYC 1X7QA 3U1SL 5EIIB 1N4XH 1DQDH 2VIRB 1ZT1A 2Z92A 5MERB 4XP1L 5I66B 1BQSA 1DFBH 4U33A 4PJDA 1OTSD 5IW1A 5I18H 5BZDA 1S9YB 4JG1H 3NMEA 1LEKA 1R3KA 4UINH 3LD8C 2OZ4L 4XWGL 4K7PX 4R4ND 5LWYL 4Q6IB 4Y5YB 5FUOL 2PETA 5FO9A 1U8IB 1YJDH 1XIWA 4UOW0 3VXMB 4YAQB 4P46C 5I17B 2X9WA 4G9DB 4V1DB 2CKNA 5L2KE 3BZDA 2D31A 5ECJE 4XX1E 4LHUG 5JMOC 1QNZH 4UT9L 5KBNC 1U8QA 1X5GA 3G6JA 4I2XB 4P57B 5HHMB 2ICEA 3QDGA 3HUJF 2VN4A 2R2HA 1VKXA 3HE6C 4HEME 4G8GE 1JMXA 5E2UL 1JRHL 5IMLB 4F7TB 3HS0A 4LSUH 2CR3A 5IFAL 3QSKB 4QRRE 4N1HB 4U1KB 1Z5LA 2XI9A 4CBPA 2BCKA 4OQTH 1HHKB 1TJHL 3MV8B 4WO4C 4LQFL 1VACB 1G7PA 1WZLA 5DVKA 5D7JA 5DD1H 4WU7B 3BPLB 5L6YL 3F8UB 1TCRB 1JP5A 1ZS8A 4ZYKA 1RUQL 4K3HA 1CFTA 4NFCA 3NFSH 2VKXA 4I5BB 4A2LA 4WDIB 2I60H 4QYOB 5GISL 3EOBB 5GRYA 5CBAA 1CDGA 5I1AB 4X5XB 2CUIA 5D5MF 4G6AD 3MV01 1RULL 1RVFH 4QHLB 2FJFA 2HVKA 5FK9A 2C1PB 2AV1B 4TVPH 2IMNA 3G5VA 5ALBH 3EYVA 1MVUB 4PLKD 5E2WH 2UZXB 2G2RA 5CGYC 4XNQB 1AXIB 2J8HA 3SGEI 2ZUWA 5DLML 4KI5D 4Z77A 5D7KD 2X42A 4U1IB 1JJUA 4PGJA 2Z8WC 2YD1A 4NO3A 3PP3K 4G7VH 2XQBL 4PRAA 5T1LD 5CLWA 3RWHB 5EBGA 4WFEE 5F96L 1GC1L 2AKRA 4OBRA 2D03H 3P9LB 4K23H 4HIJB 3ARZA 4DWHA 1A14H 2P1YA 3ARUA 4XPBH 3ZKMC 4GO6B 4W4OA 5TGBB 3VXSA 2XFXA 1DLFH 2Y25A 1FC2D 3ARDC 4NKOB 3MV9D 1A3LL 2XNAB 1UVQB 2JJTC 2FWOA 1CIDA 2G5BA 1YNTA 2Y1VA 4Y5VC 3VI4E 4JPVL 3T0WA 3WFDL 3MRHA 5L8KB 2I27N 1FDLL 2BSTB 1TVHA 4LNRB 3TBYA 4XVUD 5F6IC 1OARH 2DN7A 3OPZH 4LPTA 3U9PL 2ORBH 3MRNB 4I9WD 3SHSA 2C4XA 3IFOA 5C0IB 1L6ZA 3HNVL 4XVTL 3REWA 1H3PL 5DHVH 4NKMA 4U6VL 25C8H 2XZQH 4EDWH 2HT2D 3R1GL 3CFCH 3RY5A 3QG7H 4PV9B 3WSQL 1BOYA 4MXWH 4X9GA 3C6LC 3V4VL 1VEPA 5IROA 3MRJA 3O3BA 2FIKA 4KZEL 2FIRT 5DK2B 2HWZL 3ZTJG 4LLQA 1JV5B 4FFVC 5EH1A 1RZIB 5DSCB 5CJ5A 4JQIL 2NY0B 3MLRL 4FQXB 4E42B 1T04B 1H5BC 1R5WA 1XR9B 4NNXA 1X6NA 3DNKA 3GMMB 5GHWH 3TA3B 4PS4L 3KHQA 2GTWA 4FQHB 3I9GH 4P2RA 1ODAA 3U0TB 2NYYD 5D1ZB 2WBJA 4PJ9B 1A47A 1TTUA 2VQ1B 1S7WB 5AUMA 4BFGA 3GB7A 2NY4D 1FNHA 3P77B 1L0QA 4D9LH 4Z7NE 4KKCC 4Y19E 4HUXA 5IR1A 4HFUL 4HG4K 1CDHA 4PJXF 1HOCA 2JF1A 2IALA 2YWYA 3BEWB 5MENB 2GQHA 5C07B 4D94A 3IDGA 4POZC 1Q9KA 3DRQA 4OD2B 1JNNH 2ICES 3M17B 3U7YH 1DANT 1D5MB 4HEPG 1J5OH 5DRXA 1KJ2B 3Q48A 5F71A 4KWUA 1HH6A 1B0RA 2BNQE 1CQKA 1EHXA 3S36H 3OKEB 2VDQH 5LCVL 3KG5A 2WWKO 4PJAF 1IGYB 5HVHC 5ACZB 3W11C 4JDVB 2WUCL 2X5PA 1GGCH 4D3CL 1N0XH 5HSFA 4DGIL 2F54B 2W0LA 1OGAE 4XP5H 4Z18A 3QQ4B 2EXWC 3BKJL 3BIKB 1J1OH 2VDRH 5KTEH 1GGTA 1VFBA 2IG2L 1LQSR 4ZNCD 4WHTA 4U6TA 4NQDD 3PWVB 2ICWB 1IKFH 4ZPVA 1ND0A 2R1YB 4PJGB 1MWAL 5F89A 1N5YH 4MQ7B 1QA9B 5FKPA 1XAUA 2ZSVB 1N8ZA 4K7PH 3VU2A 5BJTA 3JTTA 4KUCD 1GZPB 1UACL 2YK1H 4F37K 3L3GB 3U4EA 3S9DB 4ZXBC 3Q0HA 4ZUUB 3RUGE 4ELMA 4HH9A 4QF1A 3C6SA 5DGQA 2HKFH 4Z95L 1F4WH 5CBEA 2BVQA 3D48R 4Y16A 4JHWH 4GW1B 3ARGC 1N64L 1FGNL 2APBA 1K4CA 2IH3B 4N5ED 4WGWB 4LSTH 3NCJH 2VAAB 1O7SA 2NXYB 5DYOA 2VXUH 1B6DA 3MRGA 3AS3A 5IW3A 4AENA 3H3PH 1Q9LA 2E9JA 5JHLH 3T4AB 5A2IH 1AD9A 2EICA 4KI5F 4GSDH 3I2CH 1UH2A 4OLEA 4PP2A 5GS0C 5DUPL 2NX5B 4UT6L 5SV3A 4J3WA 4OF7A 2X4SB 4OSUH 5IVXB 2C3VB 1UWGH 4O02H 1MRFL 4JLRB 4FQCL 5HGDA 1KGCD 1CBVH 1D9KA 1XCQB 3BMWA 2VDKH 2ERJC 4DKEH 5I1GL 1MQ8A 1BF2A 5DJDB 3EDEA 3AY4C 3PWJB 3L7FB 4JPKH 1MCRA 2GT9B 1OF2A 1G9EA 2A6IB 2Y4SA 1LO5A 4U1HA 2VR5A 3WHXB 2A6KA 4ODWA 5F97E 2CIKA 3RNKB 5TE6L 2F8XC 3QDMD 3BPOB 4UIMA 1T0NB 3TT3H 3QAZB 4FTVB 4OT1H 2MNUA 4LKCB 1HCFX 1G9NH 1I9EA 3BH8B 5FGCE 1P7QB 1U2CA 3BP4A 4P2OC 1QLFA 3ES6A 2WK2A 3MACL 1RZJC 4C4KT 4P3DA 1AR1C 3GJEA 1JCKA 4TSCL 3T0ED 1ZK9A 1WICA 1F3DH 1IEAA 5C0JA 3GRWA 3NCCB 1WCQA 3FQRA 1A6VH 5AWNL 2A9NH 1FRGH 4FXGA 3R8QA 5JLZA 1NBYB 3FT2B 4I77L 2WV3A 4HWNA 5L2KA 1PKOA 1YPZB 2V9TA 2A1WL 1OHQA 2VE6A 3BP6B 2YHGA 4D0DB 1R0AL 3QP3A 4PJEF 5HVFB 4XT1C 1UQSA 4FZ8H 5FUZH 4LVEA 3TZVA 3P9MB 5D70H 3AFLA 5DF0A 1E28B 2MHAA 2W0PA 3DLQR 4G8GA 5ISZD 2V2TB 5C8JB 4HMEA 4DGVH 4QRRA 4YZFE 4YBQD 3DYMA 1UA6L 1DLHA 2Z91A 3EJYD 3GIZH 1X5FA 1WITA 1IEBB 1I9RH 2APFA 4PP1C 1U93A 2D3VA 4Z8FH 2R4SL 4LLUB 2B4CL 4Z7VB 4JZJA 3D69A 4GKNB 1G7IA 3VXME 1F2QA 3IAPA 2NY3C 4M1GH 3UBXI 5J13C 1TZGH 1AR2A 1A7NL 2D7QA 1IBGL 4I2XE 4GBXD 3O6FA 1FH5H 4RFNB 4FQ1L 1FL3A 4PJ8C 1MIML 1U3ZA 2G60L 4J7RA 1TZHB 3HHRB 2B0SH 4YIQB 2X4NB 1WT5C 4E5XA 5KN5B 1WWAX 4O58H 5DWUH 3MODH 2W60B 1FORL 5LJYH 1JGEA 2O5ZH 4R4FL 1UZ8A 2DQEL 1O7VA 1CE6A 3V5DB 4PR5A 1D5IL 3DV6B 4Z76A 1OOAA 3BDYL 4N0RA 4UILH 2CR6A 5E2VH 4O2FB 3LN5A 2ZKHH 3TV3L 4MAYB 1P4IH 4KUCF 1HHIB 3AREC 3GGWB 5CJOH 4R2GB 5JW3H 5EZLA 4HWBL 3UYRL 2A38A 1U58B 1W72L 3ETBF 4JFYB 5EOTA 3MOAL 2IBGA 2CKBL 2E27H 1FL5B 1ZT7A 5FFLA 5T1KA 3AS2A 5IP4A 3ZZ1A 4GMSH 1QBAA 3NBNA 5A3ID 4DUVA 2FYYA 4DN3L 5DJ8B 2QKIA 5DVNA 1N2RB 3VXOA 2X4OA 3FQUB 2MQCA 3HAEG 4YE4H 3HNSL 5DRZB 4PRID 1INQB 1MIEH 3F62A 5HPOA 2XWTB 4WEBL 1AIFB 2IH1A 4MNGB 4PV8A 2R1XB 4HWUA 2J4WL 3VFWB 1S8DB 2OYPA 3D18A 1LWRA 3NIFE 3MC0A 2ZCLH 2DF3A 3HRZB 5CHNA 4JM4L 1NGXA 4J8RA 1FV1B 3HUJB 4WI7A 3T3MF 3VXUD 1BFVL 2CRMA 1MI5B 1NKRA 1RY7B 3TGXA 4P9HH 4R90H 3EYFB 4AH2A 3UJTH 4EDXA 2IMMA 5A1AA 5KS9B 1AGDA 1F3RB 1RFDH 3HNTH 3ARTA 4I48B 3LKNB 4M03A 3DUUA 4HCRH 2NY5C 4DTGH 1KB5L 3RVVC 3WXVH 2F5BL 1HIML 4XPAL 5C0GA 5IFJA 4Q2ZA 1CD0A 3IAGC 1SJEB 3BKML 5J6GA 3ESVF 3X11A 4M8VA 2D9QB 4XP4L 3P3YA 4NM4L 3ILQC 1EHLL 4PJ5B 4DQOL 4K2UH 1FGVH 5ESVB 4JM2B 3GSXA 5D5MB 2NY6D 3D85D 5HVWA 3ARYA 3LEYH 4NN5B 4Y19A 5DC4B 4FQXD 2E9IA 1D5BA 2CIIA 2PYED 5J06A 5CINH 3T2PA 5IM7A 5CSZB 2X40A 1X44A 1TNNA 3QUML 4FP8H 4EOWH 5EU5B 5JTWA 2IC2A 4UDUB 2FLBT 5DD5L 3HMXA 4OCWL 4LSPH 5I1EL 2DMCA 4PJ9D 4IDJL 4YNYB 5EZJA 5F7EL 3S96B 2YD5A 2BNQA 4Q97A 1HSBA 2YBRA 1N6VA 1IGTA 3BW9B 1LO2L 4WUUD 1ROWA 2EIDA 1OGAA 3MGOA 3T65A 3PQYB 2NCMA 3WNKA 2P24A 3N1GC 2QADD 1GGIH 3BXNB 5CUSL 12E8L 4HDIB 1XH3B 2ZSWB 4U1GB 4X9HA 1OAYH 1OSZB 1S9WB 1PJ9A 4M7ZC 5EOQH 1RQ5A 4GKSB 5E8NB 3KPPB 1UT9A 3FN3A 3PUCA 2D9CA 4MNQB 3VD4A 3GJFB 1JMZA 1YEFH 5J0BA 2YSSB 3Q5YA 4TUKL 3HZVA 3GNMH 2IQAB 5T3XH 3BJLA 4JDTL 4CAGA 4UT7L 4ZOEA 3RVTC 1KTDB 3RUGA 4YXHH 1F3JA 4U1MB 4Y1AB 3OKLB 4PY7A 2Z31A 3DYOA 3OGOE 2CK0L 3MLPA 3RDTD 4L8SA 1BM3H 4OFYD 3SQBA 3ZE2E 2YPLB 3ZO0A 1Y18B 2PO6B 3L9RB 5L8JB 4KHXH 1N5AB 3LKPB 2DQJH 1N4XL 1DQDL 1P4LB 4CVXA 4UV4H 4P5TC 3KWWB 2ZUQC 3ROLB 1DFBL 4LEOB 3WEXB 4XZUA 2I25N 3DVNB 4XP9H 1FYTE 4M61B 4F80A 3WS3B 5D2NC 2YRLA 4YHKH 4UINL 1QP1A 1DVFB 5IJVB 1KXQE 3SCMA 3GSNL 3PF2A 1FLRH 1RUML 4LCUA 4MS8C 2NXYD 2VTFA 3U48A 2ADJB 2R0WH 1QNZL 2X4QA 4KTEH 4LLDA 1S9XB 4H26A 1JYNA 2XY2A 1X5YA 4OM0L 4XPHL 2E7LA 2EKSA 1SJXA 2XV6B 1UB6A 4KUZL 5T5FL 1RZGA 4XPTL 4Z0BH 5KSAD 4PGEA 5BVJA 5KVFL 4I3GA 2C3HA 3KJ4C 3QPQD 4OGXL 2JJVA 3RTQB 5I30H 2IGFH 5K9QI 1HXYB 4FG6D 4NT6B 1KCUH 1ZE3C 5IV2B 5CJXA 4XCFH 2B5IC 4U3CA 1T7XA 3TJEH 5HHOE 4OQTL 1URLA 1EA9C 2JTDA 1CLZL 4GG6E 3ARBA 1RD6A 3BT2H 3CU7A 2N1KA 3V7AG 3MRPA 3G04B 2NX5E 3VRLE 4F58H 4X6CB 3J7HA 1T1XB 4QT5B 4EUPA 2W92A 3NFSL 5SWZD 1U8KB 4RX4D 1EERB 4IRJC 1U8MB 3DV4A 5IQ7L 2I60L 3ZYOA 5IVXE 3EFFA 4D0CA 5D1QC 5F72S 5FA4A 4G8FA 1OSPH 1BIIB 2OSLA 2OL3B 4X4XA 1RVFL 4BZ2H 1F4YH 5IVZB 3V6FA 3D6GA 3QNYB 3VGAC 4HUVB 1NGYB 1KENH 1T1WB 4IRSB 1KCRL 1FBIL 4MAUH 3FO2A 1ZWIB 3ZKND 1K3ZA 2H2PD 4UOJA 3IU3B 3F7YB 1I1AD 5E2WL 4ZFGH 1VEMA 4ERSL 1I8LA 1M7IB 3TO4C 4LHUB 3EGSB 4YDIL 1U3HD 5EIIA 4ALAL 4FTVE 4OF8A 2EDYA 4LGRB 1PY9A 5MERA 1VENA 3SDXF 3NIDF 5FUCC 5I66A 2X1XR 4MSWB 3AXLB 4G7VL 5CEZH 5C0CB 1S9YA 5IB3A 3MBXH 5F9AC 4NN7B 3TT1H 4CVZB 2D03L 4K23L 3RL1B 4LIQH 4Q6IA 2DOCA 1U8IA 3BGAA 4QRTB 3VCLB 4WJ5B 4XPBL 3VXMA 4X83A 2KKQA 4YAQA 1F6FB 3B3IB 2PXYC 5I17A 1NFIB 4G9DA 1YPZE 4V1DA 4X6DB 1NCBH 1RJCA 4F57H 3ULVE 4NHUB 1MHEB 4XP6H 2JK5B 4F37F 1R5VB 3R4DA 4I2XA 2FO4B 1A4JB 3VJ6B 4ODTH 4P57A 4CNIB 2HVJB 1IVLA 1A1MB 1OAKH 3V95A 1T66C 3OPZL 2R29L 4RBPK 3PGFH 4RDQF 4G6KH 1GSMA 4IOIB 3ZHKA 4F7TA 4U1KA 1I1FB 1TVBB 3WDHA 2BNUB 1HHKA 3MV8A 4EBQL 5E0QA 4PBVC 1VACA 5ELIA 3EZ8A 1HXMB 4WU7A 25C8L 4M1CC 5DC0A 3VXRD 3QG7L 3SDDB 3SDAB 4Z7VE 4MXWL 4JVUA 4P4KD 4P4RB 4I5BA 5ICYB 4WDIA 4CJ1A 4QYOA 4B5EA 3BKYL 4E41B 3EOBA 5DS8B 2GUOB 4GAJL 2FECL 5I1AA 4N0UB 4X5XA 3RGVC 4NO2A 1LHZA 4M4PA 1G6RH 5JZ7D 1T2QL 1KB9J 4QHLA 4ODSH 3KPNA 3U79A 1G7QB 4WV1B 2RB8A 1CU4H 1OCWH 2FGZA 4EN3D 2J8OA 2IPKB 1F4XL 4GXUN 2AV1A 2HH0H 3U36B 3IDIB 4D9LL 4XNQA 1KJVB 4OUOA 4C56D 1QZ1A 1L9MA 3KYMB 4F9PC 4ZUSA 4P2QD 3IDUA 1FZKB 4U1IA 4PJEB 4MJ4A 3CUPB 1OW0A 1XF2A 5I16B 3WDJA 4U7KA 1MFCH 1P5VA 1IQWH 3U7YL 3RWHA 2NW2B 1J5OL 3SN6N 1G7HB 1NFDB 1S78C 4PLOB 1YMMB 4GRWH 3P9LA 3HRPA 3KS0J 4HIJA 3S36L 1UJ3C 4LVOB 2VDQL 3KR3H 5TGBA 4JO1L 1FCCA 4NKOA 5KANG 2DQTH 2XNAA 3QEGL 4P59H 3GBMH 5E70A 1UVQA 1LDPL 5GS0H 5CD3B 1I8MB 4HT1H 4JFDE 4YBLC 4BUHA 2D7OA 3HAEH 2DQUH 4QTHA 3S3JA 3I6LE 4LCWD 1J1OL 2VDRL 3OX8B 2NZ9C 3TNMB 3V5KB 2BSTA 5KTEL 3ZLQC 4LNRA 1LE5B 4NZRH 3KNBA 3WN5B 5JHDB 4MNGE 3OKOB 2V2XB 3DO7B 1SM3L 5EN2B 2J8UF 1IKFL 3MRNA 2MTPA 2PKDA 5FM5O 5DGRA 1JGVH 3LV3B 1QEWB 4K7PL 2X70B 2YK1L 4Q74A 5B3NA 4WW2C 3HUJE 1MI5E 2HTLC 5DRWB 2EDLA 2LU7A 4UIKH 2HKFL 4PV9A 4BSWB 1LNUB 1MJUH 3VFTB 4XNYH 3QIBD 1QFWH 1M71B 3BWAA 5EOCJ 2QL1A 5JDSB 1QQDB 2VUOA 3P30H 5DK2A 4H5SB 1A7QH 1AHWC 3NCJL 5KW9H 1DEEA 1RZIA 5JQ6H 5DSCA 2VXUL 4ONGL 4PRPE 43CAB 4E42A 1T04A 1MRCL 3H3PL 1XR9A 5CKGA 4HV8B 5JHLL 4MMZC 5BV7C 2ED7A 5BO1H 3UTQB 5C9KA 4GSDL 4PJ5E 1EEZB 5I1IL 3U0TA 1MJ8H 1QBMH 5D1ZA 3RWEB 4YJZL 3ZKXB 5D5ME 3U4BL 5CD5D 3WJLA 2VQ1A 1S7WA 4ENEC 1JHTB 3P77A 4HJ0C 5TH2B 2XACC 4WO4B 4PLJD 5E00B 5GGRY 4WRLA 1UWGL 4O02L 3KYNB 5HGBB 3BEWA 1PD6A 5MENA 2EC9U 4HD9A 4XXCC 5GJSL 1FAIL 1CBVL 4OD2A 2VDKL 3O2DA 3M17A 5F7HA 2HJFA 1D5MA 4QEGA 4Y4HC 5D2LF 1MCQA 3BIAX 4G6ML 5I1KL 1KIRB 2R2EA 1KJ2A 2AJZA 2AEWA 1BBDH 3O4OC 3MRLB 1NGZB 3WO4C 5GRVK 2VISB 3O2VH 5C70A 4NO0D 4QHKJ 1IGYA 5ACZA 1J1PH 3MV7D 4ZS6D 2FD6L 3ZE0F 4N0YH 4PRNB 4ZFOB 4Y4KD 1KLGB 1UENA 5C3LD 2WUBH 4OT1L 2F54A 1AP2B 3LKSA 1NEZA 5INDB 4WFHD 5HBBA 1J0KA 3GI9H 3QQ4A 3EYQD 3PGCB 5DD3H 2DI7A 3BIKA 2O5YL 4I3SL 2EDEA 2NNAB 4LAQL 1FYTA 4G8EB 2WINB 5C08B 1C8PA 2V5RA 4LCCA 1T83C 4ZAKD 2FNBA 3PWVA 4AL8H 1OTUD 2ICWA 3VDAA 5KSBF 5LAXB 1EVTC 5KVMC 2R1YA 5E9DB 4MNQE 3BOVA 3OTTA 2ICCA 4MQ7A 1QA9A 3BGMB 2P5ED 2ZSVA 1FRGL 3FHQA 1AC6A 1GZPA 1XGTB 4FZEH 5DFWH 5TDOA 3L3GA 4CADA 3TFKD 3V0AC 1P53A 4PBXA 4M6NH 5E7BA 4ZUUA 4JRYD 2NXZB 1ZLSH 1KCKA 2FGWH 3LPGA 3QFJD 5MEQB 1KG0B 1NQBA 4FZ8L 5FUZL 3DPBA 5SV4A 2YPLE 1XIWC 1OPGH 4YHOH 5D70L 5LQBH 2MWCA 4GW1A 5GXBB 4NKQB 2GYSA 2IH3A 1EX0A 3C2AL 5JPMB 1JPSH 2VAAA 4KK9D 2DQFB 1EV2E 2FSEB 4JFHD 1NC4B 5J57B 3BUYB 5GGQL 2A6JB 4PD4K 3MCLH 4P23A 4XXDB 1DN0B 5HHOA 3T4AA 4P9MH 3OKMA 3LB6D 2VABB 1J12A 3GSVB 4GG6A 1VB9A 35C8L 4UBDC 2ZG3A 2NX5A 1NGPL 4Z8FL 2UUDK 2Y36H 3RVXC 4ONOA 1JHKH 5FGRA 1H3GA 1ZSDB 5IVXA 1TZGL 3E6FB 3H9HB 1NC2D 4JLRA 1CD1B 5D7JC 2IQ9H 1ORSA 2UZYB 4K3EL 4U6XA 1ZHKB 1XCQA 1FH5L 1Y6KR 1IT9H 5DJDA 2VN7A 2HFFB 4PJXE 4AK1A 5DFVD 3PWJA 5KZCB 3L7FA 3VGDA 2GT9A 4RZCA 3RU8H 4P99A 4O58L 2A6IA 5DWUL 3MV11 1H5BB 3WHXA 9CGTA 2O5ZL 3RNKA 3DO3A 4ZUWB 3WNLA 3QO0B 1T0NA 1EO5A 4Q0XL 4KRPC 4NM8H 1TZIB 4FTVA 4LKCA 3BMVA 1FPTH 3BH8A 4W6WB 1P7QA 2H45A 3VFOB 1RJYB 4RGMC 5I1JL 5IK3A 1P4IL 1WJ3A 3Q6GH 4PJAE 2OMBA 3ARRA 4KK8C 1P84K 5KAQG 2NY5H 1EO7A 1GCFA 5EU3B 5JW3L 4GKZB 2LE9A 3GMRB 4W68A 3FB5B 4M7JH 1I3GH 5H37G 3NOIA 2A74B 3B9KB 1AGFB 1KUMA 5C3TA 3FO9A 2GITB 2WZPD 1PEWA 1NBYA 3FT2A 3TBSB 1QACA 2ATKB 5JO5A 1YPZA 1IC5L 1FE8H 3BP6A 2E8ZA 3CZFB 4D0DA 4LKXB 4KDTA 3L3IB 1X5KA 4HUKB 4RGOL 4YE4L 4W4OC 2Y07H 1SYVB 3A6CH 3P9MA 1XR8B 1E28A 3BEVB 3HI1B 4HXAH 1PY4A 4M43H 3KJ6H 2V2TA 5C8JA 4M9OA 1ES0B 3P4OA 3UZQA 1G6RB 4J4PA 2ZCLL 2X4PB 3GKWH 5BCAA 5DD6B 5ENWB 4B7IA 4P9HL 4R90L 4RNRB 4HIIB 5F7LB 2VZOA 2OJEB 3UJTL 4LLUA 2VERN 4QXUH 4XWOD 4Z7VA 4GKNA 4WFGD 3HNTL 4S1DD 4DTGL 5D6DA 3WXVL 4EIGB 1JI2A 5H94B 1J18A 4C83B 1EIBA 2QSCH 3BP5B 1UCTA 2APWA 3LKQB 5IROC 4K2UL 3UZEA 2PTUA 2MCPH 1FZJB 1TZHA 4YIQA 4PGCB 2X4NA 1PZUB 3VFGH 5EULV 1RI8A 5KN5A 1F6AB 1GOGA 1CVRA 5A16A 3OAUH 3VDCA 3MYZA 5F1NB 2W60A 2IAMB 3QISA 1T1YB 3V5DA 1CFVH 3DV6A 3DX9B 3QFDA 3HAEB 3ULSB 4WHDA 5CINL 2WBJC 4MAYA 5IESL 1HHIA 3SDCD 1VEOA 3BDBA 4EOWL 1INEH 3ROOB 1MELA 5TF1H 3CFKA 3KLHD 4XMLH 4LSPL 4E41E 4APQB 1U58A 1JZ6A 2BDNH 2Q20A 3B4NA 3UTSB 5CCKH 1MHPH 1H8OA 3SDXB 5CZXD 4KGLA 5F3BB 1FL5A 5ESQB 3MFGB 1HWGB 4P48A 4JO2H 4O5LL 2CDFB 2NR6C 1A8JH 4UUJB 1RIVH 4PGBB 3MLWH 3GM0A 5DJ8A 3UBXG 3O45B 3W5NA 3N50A 5GRVL 2KBGA 1N2RA 4NUGL 2DB8A 3MYJB 5C0RL 1HYSC 3FQUA 4MWFB 4FABL 5J3HD 1GGIL 4TNWF 5DRZA 5J9PA 1INQA 1XF5B 2HLAB 5HYJD 2XWTA 2C5DC 4KKLD 1OAYL 1AIFA 4MNGA 2XA8H 2R1XA 2NLJA 1EVUA 3X3FH 3CFJB 3CXDH 2N4IA 3SGDH 1S8DA 2EH8H 4JREC 3VFWA 1B88A 4PJEE 1NH6A 3S34L 5E1AB 3GBNH 3DETC 4M1DH 3HRZA 2X1PA 1GRWA 1FV1A 3HUJA 3BQUC 4PGDB 5T3XL 1MI5A 5BVPH 4DVBB 1NFDE 1RZ7H 2RCSL 3EYFA 2HA1A 1E4JA 5KS9A 1BM3L 3WCYA 4QO1A 5JHDD 2EXYD 4I48A 5H8DA 2DLGA 1I85A 1W0YT 3IXTA 3T0DA 3WJJA 5JXAH 2X4TB 1S7XB 1IM3A 4KHXL 4MX7B 2MQ3A 1PBYA 4IMKA 2DQJL 4XRCB 2GJZB 2V9RA 1U8OB 3TPUB 3IAQA 2NY2C 4UV4L 5JIKA 3MFFB 1FZMB 2CMRL 4XP9L 4Y16C 1YNKH 4PJ5A 4YHKL 4QLRA 5JPNB 1PLGH 5ANMB 4JM2A 5ESVA 5FGBA 5D5MA 3IJYB 4P46D 2RR3A 3Q1SH 4S10A 2QHRH 1HZHH 3U0PB 4KKBC 1KN2H 5FYJL 3RVUC 4JFEB 2ATPA 5DUBB 3L5JA 3I6GB 4ZS7H 3VRJB 3SQOH 2Z4QB 3EDJA 3FL7A 4R9HA 2R0LH 5DJ6B 5CSZA 5EU5A 5T3XD 2NY3B 3DXAD 2HKHH 5DK0B 4MXQC 3HE6D 3VA6A 2IBBA 4DZ8A 4L3EB 4L4TB 4NQDE 5J13B 1XCTB 4YC2C 2UYLB 5DO2C 5I30L 4YNYA 3S96A 4XTRC 4Y89A 1KCUL 3BW9A 3N9GH 4WO4D 4TTGA 4CMHC 1D9KC 5K33A 5C0AB 3ZYZA 5EO0B 5CSBA 2ZUTA 4X8JB 3GI8H 4L8BB 1D3CA 1ZLVH 3BT2L 1RPQA 7FABH 1HILB 3PQYA 4F58L 4POYA 3U9UB 3RL2B 3BRGC 2K9UA 1JNHB 3BXNA 1JK8B 4HDIA 2WP3T 1S7QB 1IGFL 1OSZA 1S9WA 1K2DB 4JFOA 4GKSA 4OD3H 3KPPA 5E8NA 5ID0B 2ZCKL 2VXSH 2A77L 4MNQA 1OSPL 3GJFA 2CO6B 5BS0D 1KCSH 3MRRA 2YSSA 5FYJD 4BZ2L 3DWTA 1F4YL 3QXUA 3HPLB 4WWKB 1CE1H 1SBSH 2IQAA 3MBEA 1QRND 1MCKA 3VFPB 1CL7H 2J8UB 1KTDA 2B20A 4U1MA 4JY5L 4Y1AA 5I71B 2C3GA 3OKLA 4MAUL 4RMVA 1J8HB 1T7VA 5CGYD 5EU6D 2P8LB 3VFMA 2YPLA 4ZTOH 1R5IB 1Y18A 3T3ME 3EW3B 2PO6A 3INUL 4DKAA 3L9RA 3LKPA 1MNUL 2APXA 3C5SA 2FH6A 4G80A 2VQUA 1KGCE 3ZYJA 1P4LA 4KMQA 5FA3B 4Q9BA 3TBVB 4OGAC 2KZ1B 3KWWA 3ROLA 5J12C 5I8OH 4LEOA 3WEXA 5C92A 3OAZK 4M61A 3TZVC 1QSFE 5CEZL 5C08E 4K71C 3WS3A 2L0DA 1DVFA 2X2YA 3ZKMD 3ARDD 1MOEA 3MRBB 2GKIA 3MGTA 4WI5A 1JTTA 1J0JA 3VRIB 4OFIA 1KEGH 1MFDH 3MNZB 4GQPH 1UB5B 1CI5A 3CX2A 2ADJA 2ICWJ 1E6OH 2R0ZL 2ARWA 3BSZH 1S9XA 4NN6B 2YEZB 4JZJC 5T3ZH 3SE9L 4ODTL 3X12B 5C0DB 3T0EE 3PIQB 2HFGL 1OAKL 5D93C 4PJXA 4GLRI 3NFPA 4X7FC 4G6KL 1AFVL 3RTQA 4JANB 1C08B 4RGNE 1HXYA 2VLKB 5D6CB 5LBSH 3EO1A 4Q58C 2BJMH 2JJUA 3RPKA 4YX2L 2FH8A 5ERWB 3O6FC 4QOKD 3HR6A 1K8DB 4CGTA 3JWNC 3GBLA 3UJJL 3G04A 3C6LD 2EIBA 5D96B 3OXSB 4X6CA 3MROA 4DEPB 3NGBB 4PJAA 5CEZD 2XPGB 1T1XA 4QT5A 3THML 1YMHB 1U8KA 1U8MA 4FFVD 5KJRL 1AKJD 4CU8A 4OUUB 2LVEA 1EGJH 1JTOA 3MLZH 5F7UA 1K8IB 4C4KO 1BIIA 5IB5B 3QIWB 2OL3A 3FMGH 3NAAH 4ODSL 5IVZA 3UYPA 4TTDC 2XXMB 4HUVA 3QNYA 4HIXH 1NGYA 4ZUVB 1T1WA 4IRSA 1CU4L 3FOLB 4LIQE 3V8CA 1ZWIA 4KKCD 4N9OB 3IU3A 4G7YL 3F7YA 4XPGL 3Q6FB 5M7QA 4I0KA 3WIHA 3N06B 1M7IA 4LHUA 2YWZA 1IAKA 3PL6A 2J12B 3EGSA 3GSWB 3LVEA 4KROB 5E4IA 4POZD 4DOHB 4FQJH 3IFLH 1J88A 3SE3A 5SX4H 5K9QG 3B9EA 1YA5A 3AXLA 4MSWA 1IQWL 4GAGH 5DJYB 3WDIA 1FO0L 5C0CA 4D8PB 3I02B 5H37H 1DSFL 5JOFB 4CVZA 1G7LB 1NDGB 3RL1A 2HG5B 3DGCR 2NMSA 1A0QH 3MREB 3W11D 4QRTA 5JXEA 3VCLA 3KR3L 2H41A 2FLRT 3B3IA 5BV7H 2YD8A 1DBJL 1NFIA 1JPGA 3EDDA 3O6LL 2DQTL 1IFHH 1NUNB 2QSQA 4P59L 5HYIA 3MJGX 5CZVL 2EXWD 3NN8B 4LLVB 5E6IB 5GS0L 1ZT4B 4HT1L 4NHUA 1VFMA 2DQUL 2JK5A 1FVEA 1R5VA 5E95B 2XWBB 3KYKH 2EDRA 2FO4A 3KPRB 3TEUA 1A4JA 3VJ6A 3MA7B 1NJ9B 4NZRL 2RHEA 4JY4B 1SVZA 4CNIA 4JFXB 1A1MA 3S88H 4FQQA 4FMFA 3MLSH 4WI9A 1ZVYA 4WFFE 5I74C 4IOIA 2FZ3B 1JGVL 4LFHG 3P2TA 4IS6B 1TVBA 4ZXBD 2BNUA 4NZJA 3NVQA 2EIZB 1HXMA 2DQDH 4UIKL 4Z9KB 5E8EB 2ZUVA 1BJ1J 5DMKB 4PJFB 1SY6A 3SDAA 1MJUL 2ADIB 3ARGD 4XNYL 3KPSB 1QFWL 4P4RA 4YHYB 1CFQB 5ICYA 1HHGB 2XKSA 4E41A 4KQ4H 2GUOA 1A7PH 5JQ6L 4PPTA 4YLQT 2X9YA 4MNHB 1H0DA 4WGVB 4W70A 5H35B 4N68A 1NEUA 1RZJL 1XZ0B 1MVFA 2AJXL 2AK1H 3EOYG 1DBML 5DEZA 4LCIH 5GS0D 4WV1A 4XAWH 5TDNB 1MJ8L 1QBML 4NQSB 4F3FB 3CLEH 3U36A 3IDIA 3NA9L 4HXBH 4JZNB 4HCRA 5GGSB 5JOEA 1KPVB 3H8NA 4TUJB 4OIAA 1FZKA 4JDZB 4Z78B 3DIFB 4PJEA 1B4JH 2ESVD 4MLIA 3MUGB 2XKNB 5CGTA 4FHBD 2D0FA 2OQJB 2NW2A 1G7HA 1NFDA 1YMMA 1BBDL 1QHOA 5JIIA 4LSSH 3UTSE 4UQ2A 3SDXE 3NIDE 3O2VL 4LDLB 4PFEA 2QLVB 1CXIA 5MI0C 2COQA 3VW3L 4P2OD 2WUBL 5CD3A 1I8MA 2Z31C 4ODHL 1EK3A 4Q6YA 4L8SC 1AR1D 2CGRH 3V5KA 1QBLH 2OI9B 2W65B 1LE5A 3WHE1 2P45B 4M6AA 2VMFA 3WN5A 3OKOA 2V2XA 1WWWX 3DO7A 1KEMH 4AL8L 1WUNT 3ZSTA 3LV3A 1QEWA 5E5RB 3MOBH 2X70A 3CXHJ 4FZEL 1DDHB 3TBTB 4JN1L 5C0EB 5KVEH 4OI7A 3DOSA 3C8KB 5EWIH 3W0WB 1NMCC 5EG6C 1WZ1H 3NACL 1MHCA 3HG1E 4TSBL 1ZLSL 1LNUA 4RRPG 3HLAB 5E6YA 3ZSSA 5F7WC 3SCMC 1M71A 1CFBA 3P9WB 3RJQB 5C7XL 2XN9B 5LQBL 5BMFH 1QQDA 1LMKA 3VI3F 3QQ9C 2E9WA 3HC0A 4V2CB 4RMQA 43CAA 1KACB 1QOKA 3WXWH 4HV8A 3MCLL 1NBQA 3VXQB 3T2OA 4QGTA 3TBWB 4P9ML 2E7LC 1PG7X 4ZOBA 4PP1D 4D9QD 1EEZA 3T0VA 3DSFH 1YYLH 3RWEA 2NY3D 3MNVB 2EDBA 4YDVB 3ZDZF 3CGTA 5CJXC 2W9DH 1JHTA 2Y36L 2DI8A 4Y2OA 4X7SH 2HAZA 5TH2A 1JHKL 4O2CB 5GRWA 2J1KA 1INDL 1T4KB 2VXVH 3KYNA 5HGBA 5CP3A 2CDGA 2R56H 3GHEH 3ARBC 5E4EB 4AIZB 5JIPA 3EBAA 2UVFA 4PJ8D 3QI9B 4UB0H 5HDLA 1IT9L 5F1IB 4L3EE 1JFQL 4L4TE 3D2UB 1KIRA 3O8XB 3PWPB 4XGZA 1Z9OA 1ZLVK 3TN0B 4JB9H 2QQNL 1NGZA 3RGVB 5L9DH 1HNGA 4N8VA 3RZWA 3RU8L 2VISA 5HGHA 5FB8A 3DURA 3FB7B 5C0AE 3M07A 5IB4B 4L8CA 1BPVA 5I9QB 4PRNA 4ZFOA 1KLGA 4NM8L 3Q3GB 2BSED 5ADOH 5F93C 5INDA 1FPTL 3ARED 3PGCA 1J0YA 1CCZA 5FYKH 2BVUA 5GS1B 2Y6SC 3Q6GL 2NNAA 4G8EA 1QSFA 2NY5L 2WINA 3R0MA 5C08A 5CEYA 4X5LA 5EPMB 4AT6B 3FHAA 3ZHLA 2X05A 1I3GL 3HTLX 5KG9B 5C09D 4P5KB 3EZJB 4E9LA 2P42B 5F9OH 3UTOA 4U1NB 4BZ1H 2XG5A 5F88B 1XGTA 1MLBB 5MEOB 1Q72H 1T89A 3O4LB 3S6CA 1FE8L 3S4SG 4MCYB 2J8UE 1J8HE 2JIXA 4Q6IC 4TULH 5EB9A 5MEQA 1KG0A 4EQ3A 3I3BA 3LN9A 2FBJH 4P2YA 3CFEB 3A6CL 3T0EA 4IM8A 2ZOLB 2ZG2A 3LRGA 5JPMA 4MCZB 2E7CA 4M43L 3KJ6L 2DQFA 4OM1L 2FSEA 3VMPA 3JWDH 4NWTH 4XXDA 3GKWL 3LMJH 3C60B 3FQWB 3QJFB 2VABA 3R06B 3FFDB 3GSVA 5FYJU 4NP4L 6FABH 2KQMA 4FFWC 1Q9OB 1FNSL 2OR9L 4QXUL 3RVVD 3KLDA 4FQ2H 4WW2B 3TCXA 4EIZC 4G5ZH 1CQYA 3E6FA 3H9HA 1CGVA 1KELH 1CD1A 4LSVH 3LDBB 3BPLC