1IGMH

Three dimensional structure of an fv from a human igm immunoglobulin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
129
structure length
129
Chain Sequence
EVHLLESGGNLVQPGGSLRLSCAASGFTFNIFVMSWVRQAPGKGLEWVSGVFGSGGNTDYADAVKGRFTITRDNSKNTLYLQMNSLRAEDTAIYYCAKHRVSYVLTGFDSWGQGTLVTVSSGSASAPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGM-KAPPA POT FV (LIGHT CHAIN)
publication title Three-dimensional structure of an Fv from a human IgM immunoglobulin.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1992-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igmH00
5F3BB 3FFCA 4NHUB 3S37H 1NUDA 3VXNA 5HDQH 1JPST 2IPKA 2BY2A 2Y9RT 4NQXB 3P9MA 1S9WB 4JFXA 5FAAA 2W91A 3KR3L 4OGAD 1G7HB 3SCMA 2AAVA 3GHBH 1UG9A 5IHUL 2HJKA 2BNQA 5IHBA 2NW3B 2HH0H 2IH3A 5FV1L 5GGSA 3TBTA 5C8JA 2HJFB 2F5BL 2VLLA 3EW3B 4O9HH 2R2HB 4WUKH 4U4BA 3S3JA 1YY9C 1LEGB 4MZ2A 1CTNA 4LQFL 2YUWA 4JGJA 4TUOA 3BE1H 5DD0H 3RGHA 1XF3B 1YMHB 4LSSH 4TVPL 2CRMA 1NCAH 2YPLB 5GS1B 1NMCC 1BOYA 1FHGA 5D7KE 4LLMB 1HI6B 3U7WL 4M93B 5F1KC 3NBNA 2XWTA 3MPCA 4KGJA 4DVRH 1IKNC 3IFNH 2FO4B 3EFDL 4NBYB 3JUZA 1A7NH 1Z3GH 1MJ8L 2KH2B 1BBDL 4N0UB 3W0WA 1OWWA 4LNVA 2R2EA 5JHLL 1FLRH 5I8CB 3UO1H 1RUQL 4A6YA 1INEL 1IKFH 4BQ6A 1SVZA 4ZXBD 2W0PA 2HRPH 3HNVH 1K4CA 1F6FB 4UDUA 5DJAA 5IK3A 1HEZA 3MCG1 4PJXF 4LVOB 2AJYH 5DQDH 1FAIH 1VACB 4WUUB 2AGJH 4OGYH 1NBYA 1CGSH 3RVTD 4ODSL 1IEAA 3WL9B 1FG2A 3VDBA 4FZ8H 4N8CL 1FLTX 1R5VB 5MEPA 4J3SA 3QDMD 4JHAL 4PJEE 4P5MA 4JY5L 1ZGLP 4JDVB 2JELH 3MRIA 1BD2D 1MJJA 2ITDA 5EZIH 3IETA 3WJJC 4O2CB 5E6ZA 3MR9B 4JKWA 1ZVSA 2B2XL 1DCLA 3KYMA 2NY1B 4NWUL 5L2KE 2XRAL 1PZUB 4JZNA 3N50A 3QDME 1UXWA 2AEQH 5GGRA 1BD2E 3BKML 5E9DE 5GJSH 4HJJH 3R1GH 4PJBF 3DARA 4N0YH 4KROB 2CO7B 2W0FB 1XGYL 3DXAA 5GS0C 3FZUD 2UY6A 1A5FH 4U6XA 4O00A 1M7DB 5D1ZC 4HS8H 3STZB 4R4BA 1J1PL 1J05B 3WIFB 2DQTH 1OPGL 5C0JB 1LD9B 3JWOL 1N4XL 5GRXG 1AHWC 3BW9B 3LHPH 3RVXD 2D7TH 3IJHA 3K4DA 3UBXB 2P5EA 4JQVC 4J3XA 1OAZH 1YEHL 2DQIH 4DN3H 3FONA 3KLHD 5KSVA 1KJ2L 2YR3A 4LLDA 1ZLUK 5AZ2H 1YNTA 4EDXB 3HPJA 5EOTA 4KK9D 4XP4L 3L9RB 4PV9A 2XFXA 2CK0L 1FE8L 4XH2A 1NUFA 5KSBF 2BNRB 1NJ9A 5C0IB 4NN5B 5FEBA 4OZFB 4HIHA 3FFDB 4WWKD 2FX7L 1LEIA 2IBZX 1J1XH 1IM9B 1EO8H 4WI2A 4PJAB 4WCYL 1PSKL 3EDJA 4Z77B 1IM3B 5IB4A 2XN9D 5KW9H 4EI5C 1IC7L 3DMMD 2RR3A 2D7OA 3F58L 1KIPA 1WQVT 5DHVH 5EO0B 5FB8A 1KJ2B 3RUGA 4JFDB 3M17B 3OXRA 1P7KB 2AKRB 4C56A 4JPVH 3KS0H 3HI6L 3OMZA 4R4ND 1VFOA 3U7AA 4Z8FH 1TCMA 2Z4QA 5I76B 4YWGL 1IGJA 5DK2A 3D3VB 3SPVA 5C0EB 4Y5XA 3MLZH 4BSVB 4WFGD 5CLTA 4EQ2A 3C6SA 4FQ1H 5SWZA 2GSGB 3C09B 3D85A 1GRWA 5BJTA 5D1QB 3GBMH 5DUBB 2CDEA 3IXTA 4Y8DC 3FB6B 5DYOB 3UBXI 3IDYC 1RSFA 5D6CA 4PGZA 3HUJA 5I75B 1QBLH 4WTZG 3PE9A 1JK8B 4PRPA 1U8PB 1VKXB 5KVEL 2R0KL 5IVOA 2VSDA 5JIPA 4P9HH 1JYVA 1KENH 2FBJL 5HHPB 4P4KD 3TFKC 2ZG1A 4JO4L 3VJ6B 2B4CH 3O4OB 2H2SD 3BP4A 4JO3H 4K3EH 4HFWB 5CS7A 2LVCA 3C2AH 4RISL 3N9GH 1T7XA 3E2HB 4NKIH 5DF0A 1UA6L 2HTLD 3LV3B 2O93L 2AJUL 1AO7B 3KHQA 2VZSA 1KEGH 5JHDA 3NH7L 2A83A 1MPAL 3U7YL 3IRZA 1WSST 5E5MB 1FORL 3UXFA 1FIGL 3O6KH 2NY2C 3MV7B 1I8LA 4RAUB 4V2CB 1Z6JT 1HHIA 3C8KB 5IJVA 2FRGP 4XHJC 5ALCL 3RPIB 4AMKL 2W9EL 4GKZB 1H0DB 5H94B 5C0FA 1CG9B 1NFKA 3K81A 3AXLB 1UJ3B 5KS9B 4KK6C 3VD7A 5ERWA 4NQSA 4L9LC 3EBAA 1JHLH 4OCSH 3KYNB 4ZYKA 2QADC 3CVHL 3FOMB 5KOMC 2GUOB 3JBG7 3S96B 4MCZA 5C07A 2AV7A 1REIA 5D96B 1JGUH 1RMFH 1LDPL 4Y89A 5FYLL 1TJGH 4N9OB 1SJEA 1FV1A 1PBYA 3DIFA 2VKXA 4ORZC 5AYUL 2HKHH 3R06A 5ACZB 4L3ED 3REVB 5TH2A 3ZKNC 4NDMA 4OFDA 4PJ5B 1BPVA 1JWUA 2D4FA 2EDTA 2L7JA 4HSQA 1ETZB 5D93C 5K9OB 1KBGH 4Q9CA 4R90H 1N8ZB 3W11C 3WN5A 3QDGA 4EQ3A 1CDGA 4Y2DA 5EBLB 1TQBC 4KKBC 3WDIA 4LLAA 4KQ4H 1JPFB 3GIVB 2CDFA 2W92A 4U1LA 5SX4I 4D0BB 3Q6FA 3QPXH 1AE6L 1DP0A 2QSTA 2YPKB 2AJSL 5AUMB 3IVKB 1FFPA 4KK5C 4NM8H 1FSKB 1XF2B 1EEYB 2HFFB 2PW1A 3A6CH 3T0ED 1NLDH 2WUBH 5FCUL 2OXHA 1EJ6A 5I1JL 4R3SB 4L4VD 1I8IB 3FL7A 2YOCA 1YEFL 3QR2A 2BSSA 5ISZE 4PS4H 1G1YA 3MBEA 5DA4A 2XPGB 4HMDA 1YC8A 1AJ7H 2HVJB 4M1GH 4MVBC 4ENED 2G2RA 3KPNA 3TIDA 1SYSA 2C4FT 2ZSWA 3NAAH 4YDJB 4OGXL 1RIVL 2BSTA 4GW1B 3T0EE 2MHAB 4K3JH 4MD5A 3GMPA 4NO0A 3RTQC 2HTKD 2X70A 3UTZB 2X42A 3O81A 4M7KH 4M1DH 3N85L 1OSZA 3HN3A 2GSIB 4HUWB 4BQ8A 4JR9L 2RGSA 4M62L 5BW7C 2O5ZL 1HHHB 3QYCA 2XZQL 3UTTB 2Z31A 3L95A 3PWUB 1DQDH 1RJYB 2ARJQ 4I48A 1TENA 2DKMA 3G9AB 4UILH 4I18B 1MRDL 2DF3A 2OMBA 5T3ZL 5FUOL 4JO1H 3FMGL 5FKAA 3JTSA 4DGVL 2VDQH 5D7IF 4QRUB 2HJLA 3BWAA 3BD3A 3SJVA 4JFED 2IPTH 2VDKL 1FVEA 1VESA 3QJHA 3EGSA 3VXSE 1U8MB 4MHHI 3TJHD 4TOYH 2CD0A 3LKSB 3ARTA 4U1NB 4OZHA 3E8UL 1IGCH 2D7NA 1QFUH 4I13B 5I17B 4JFQA 4KKCC 1VGEH 5D70L 2KZ1B 1HHJA 4NQDE 2EEDA 3OR6A 5I1DA 3K0WA 2A6DB 3MJ8B 4U1IA 1MF2H 3KYOB 5BRZA 2EDBA 3TGXA 4YE4H 5HYQA 4XCCL 3SKMB 1I3RB 2E7MA 3C8DA 4G8GD 5E2WL 4UNVA 3RIFF 5C0BE 4XT1C 4HKZB 5TE4H 1FGNH 4QHUB 5JORA 4YIQB 3RKDD 5J3HC 2F58L 2OBGA 3SKNB 1YPZB 3IT8D 5JPMA 5JLZB 1T0MA 4X4YB 1MNUL 4AEIL 5KSAC 1JHKH 5CJOH 2WINA 2GAZB 4JY6B 1N3NA 3I02B 4I1NB 1NC2D 3TC9A 4UIMB 1LNUA 2P8LB 4HKXB 1FZJA 4JFFB 5JW5B 4U1MB 4OCXH 3SOBH 4P2YA 3V52H 3QXVA 1UM4L 2CLVB 4YFLI 1JF5A 4NFCA 1K3ZA 1BVKB 3QIUB 3S34L 2NY0B 2VXUH 1LK3H 2BVQB 1J0JA 4NZUH 4NZRH 5EBMA 5IVXB 1C5CH 2ATPA 3DECA 3U82B 1U58B 1ZE3C 4ZUWA 3ROLA 3VFUA 4YHIA 3UYOD 2X2YA 3G6JF 3F5WB 2I9TA 2ZNWA 4AT6B 4P4RB 3TT1L 4X98B 3CPLB 2UWEE 3VWJC 1JWSB 5A3ID 4NOFA 1J9CT 2MCPL 1ED3A 1DQQB 4OB5H 3QNYB 1QA9B 3H9SD 2F54E 5DTFA 1S7XA 3RVWD 4AEEA 3TZVD 3V0VB 3IKCB 1FYTD 5J6GB 1CXKA 4QHNA 5IQ9A 4NBZB 1R5IA 4BFEA 2HG5B 3WD5L 5C9KA 3JVGC 5D9SB 1HZHH 4X9FA 2NY4B 2VQUA 1JGDB 4PLKD 3QO0B 1BJMA 4HXBL 4K94L 5I8OH 1HWGB 3ULSA 3RZCB 3EYOA 1JV5A 5T3XD 3O3DA 2XZAH 5EU4A 4ODWA 4NUJA 3BIAX 1AH1A 5F89A 4KRPD 4NZTL 3LIZL 2OTWA 4N0FB 1TZIA 3V5HA 5I18H 3ZKMC 2OR7A 1J8HD 1GOGA 4QOKB 1FFOB 4ZXBA 1YJDL 1BQUA 1F8TL 4RMWA 5B39G 1ZSDB 4O51B 4G9DB 1MAMH 3BMWA 4PJEA 3VE0B 1ZT4A 5CINL 5DMGC 3WBDA 5DVOA 1A2YB 2OS7A 2BVPB 1LWRA 4K9EH 4XB8A 5IIEB 4PGCB 3MOBL 1ZLWH 2VH5H 4U6VH 3VCLA 1I85C 1MUJB 3QUYD 2YD7A 5DR5H 4DAGL 3JSSA 4DVBB 4B41A 1AKJD 1HQ4A 4ONGH 1N64H 2V7HB 2Z93A 4TQEL 2AV1B 3OKYA 3QDMA 4XAWH 1BD2A 1CFQA 3V5DA 4XX1G 5EU6B 1GGUA 2V5YA 2XZZA 4I3SL 5D7LB 1RZ7L 1UCBL 3WIIL 5KN5A 1PY4A 4JHBA 1ROWA 1UQSA 2FIKB 3O45A 4BZ2L 4IM8A 2O61B 4AIXA 4NJAL 2GW5A 1KJMB 4LLYA 4M6NH 1YEGH 2VB5A 2F8VA 3X3GL 4M48H 5IEHB 1RIUL 3LDBB 3TV3L 3BEWB 1NC4D 1NL0H 3ESVF 1WZ1L 3LPWA 3NIDE 2ZOLA 5E08L 1S7RB 3RFZC 1ZT7A 3EYVA 3MRLA 4PJ8D 1ORQB 5E8DH 4PR5A 1JPSL 3MROA 4TRPH 4S10A 1NAMH 1EZVX 4Q2ZA 4MNHB 4W6WB 1OSPH 3S36X 1XH3B 1RZ8B 1ACZA 4U2YA 1BFVL 5LGJB 3CLFL 4JREC 2CKBH 3MLUL 3IGAB 1EAPB 1TETH 2PYFB 3MLYH 1QQDB 4K2UH 1IGFH 1A9EB 3SO3C 1D5XB 3KJ6L 4HUNB 3QXDB 2IAMA 3PG2A 1UFUA 3QZWA 1CE1H 2IMNA 5GZOC 3VXTA 4MSWA 1OTTC 3UC0L 2EDKA 4P9MH 1HSBA 1BQLH 3HE6B 4ODUA 1OAKL 4F3FB 2FH8A 1D6EB 5EIQA 3UAJD 2VXVH 5B22A 2W9LA 2J5LC 3E6HA 4JEGB 2R9HC 1RHHB 4WWKA 4HGWB 5F71A 4S1RH 2V2TA 1CLCA 2BMKB 3GBLA 2H2PD 3SDAD 4J4PD 3QCTL 1BM3H 1T66C 1A6TA 1F6LL 3QDJB 2F15A 1Z0MA 4NKMB 3DMMA 5HYSG 1FVCB 1EBAA 1LP9B 2OP4L 4AL8H 1N5AB 3SGKC 3T04D 1F5WA 4FMKA 2BVUA 1UYWH 3LKRA 4O2EB 1VA9A 3MLTB 4KVCH 2FYYB 5F9DC 5JXED 5DK0A 5KVFL 1SEBA 2OL3H 3P4OA 2I60H 2A6KA 2R56H 4D8PB 4OBSA 3CFIC 1NAKL 2PW2A 3KGRA 2BXYA 2MNUA 1R3KA 3QUZD 4FOMA 4GQPH 4IOFD 3TBVB 4N0RA 5E8EB 1G6RA 5CP7A 4LCCC 1AGFB 3W9DA 4KMQA 3RA7H 1ORSA 3CFEB 4LNRB 4HG4J 1NCNA 2YUVA 3CK0H 2Y07H 1OM3H 3HC0A 3L7FB 2HP4A 5GS0L 1BX2B 2WWKT 4AQ1B 5DA0B 3LD8C 4Q0XH 4P4KA 2EYSA 4AJ0A 2PUQT 3GMQA 1A3RL 1IILE 1E4KA 4XZUA 3P30H 5IHZB 1B4RA 3OJ2C 2IALB 1BF2A 3GMLA 4ZO7A 1FNGA 1VENA 4Y2OA 3U0WH 1A14L 5I1IH 1CU4L 4M6AA 5FHBH 1K8IB 5HHVL 3FHQA 4AYFA 5TF1L 3T2OA 4EUPA 3QUKA 4ZD3H 1BECA 3Q48A 3LS5H 1UH4A 4HX1A 2EKJA 2GTZA 1DBAH 4H20L 5LVEA 1TZHB 4CRPA 4HC1A 4QF1B 3ULUF 3UYRH 2HVKA 3RUGF 4GW4A 1N6QL 4OIBA 5B38G 1U6AL 5IESL 4ODBD 3GBNH 1QFWL 2MFNA 5D1ZB 1W0VB 1FN4A 1AD9A 1CK0H 2EO1A 2RFXA 3EYQC 2DI7A 5DRXB 3QPQC 1WFUA 5MEQB 4ZUSA 4XMKL 1AHWB 1QSEB 5C6PB 4EVNA 4PRIE 1U8OB 3RJQB 4I0PA 1KCSL 1H3XA 1U92A 4MA7H 5ICXA 43C9B 2NNAA 3GB7A 3MFFB 3TA3C 5DD1H 3CU7A 1P2CA 1E6JL 1XGQB 1T03H 4LK4A 5BQ7A 1Q9KA 2YD3A 1QHPA 2WM0A 3BH9B 3WXWH 1NFDB 4ORGB 1WT5C 4CMMA 4ZFGH 3FRPG 1U91B 3GSUB 3W9EB 5FECA 4Y4HA 3LKPB 5J1AA 5MHSD 1GGBH 2OZ4L 2L0DA 1RJZB 2WBJC 2W9DL 4PBWD 3P11H 4N1EA 3VFTB 4LSTH 2AJVL 1OAYL 1GC1H 3BPOC 2BNUA 3DUSB 3B43A 1IAOB 4OI9A 2G75A 3NA9H 4OCRH 1CBVH 4M8VA 4PP2B 3PWPD 1JZ5A 3T0EA 2DB8A 1X5XA 1YNLL 3L3IB 4EI5B 1OTUD 2WANA 3MJ6A 4FZEL 1S9VA 5E70A 2JJSC 5LGHL 4WEMB 1S9XA 1IMHC 5L2JA 3TNNA 3RL2A 3SGJC 1W2KT 2GJ6E 1JE6A 4NT6A 3OXSB 2FR4A 5D1XD 4K8RL 4CVXA 3KR3H 3QEQE 2XTJB 1QLFB 3MV8B 3P73B 5IHUH 2F74B 4LEXL 3WDHA 3S35X 1H9VA 3MGTB 3LEXB 4G8FA 4JG0L 3DV4B 3CX5J 5DD3L 4G80B 5DXWA 5D5MB 3X13B 1PW3A 4TUKL 4ELMA 2F5BH 1QYGL 1QKZL 1XFPA 4HAGA 3QFJB 5C0ND 1C16A 3HC3L 5IW6B 4IRZL 1GHFL 4NCC2 3JTTA 4LQFH 1MVUB 3AS2A 4NQCE 1MCDA 5CGYC 3VXSA 2QV2A 2LAGB 2J8UA 4Z18A 4TVPH 1KIQB 3BZ4B 4GG6B 4I0CC 4HULB 3U7WH 4NKOA 1RUML 4KMTL 2WZPD 1UJTA 3UDWA 3KNBB 3ARFB 5MI0B 2P48B 3EZJB 4S1DD 4JFEA 3EFDH 4X7CC 5MENB 3G5XA 3QAZC 1MJ8H 1YN7A 1QFWI 5HDBF 4NQEE 1FZMB 5FKPA 1BBDH 2EDNA 3H2WA 1XAUA 2Q3AA 5J9PA 2C1OA 5JHLH 2VLKB 3L5HA 3OWEA 4GKOA 2DIJA 4OD2B 4YPGB 2HFGL 5CD5C 2NY2B 5LGKA 1R3LB 1RUQH 1INEH 2EZ0C 4Y19D 4OM1L 3LKOA 1NKRA 2YXMA 2ADGA 5DJ6B 2FJFB 3TIEA 3O6ML 2AJ3B 3LOWA 1KACB 1M71B 4G8GA 2CR6A 5I66B 4G6AC 1HYRC 4L9LB 1C7SA 3DX7B 1CICC 2QADB 3GUTB 3BYYA 1G7IA 3BGFC 1OHQA 1PX4A 1A1NB 4ODSH 4AEFA 2HMIC 2V7NA 5EUOE 4ZTPL 1L6ZA 3GMOB 3HNTL 2UYLA 1OAUL 4N8CH 5CEZD 1A22B 3RWIB 1UZ8B 4JHAH 4JY5H 2B39A 1NC2A 1CFBA 4G6FD 3REWA 5KOVC 3SDCC 5LAXB 2B2XH 4NN7C 3MRBB 5AEAA 4XAKE 4F9PA 4PJ7A 4NWUH 3MBXL 5HDBE 4HKBA 5CBAB 1PQZB 3C8HA 4KAQL 2X4SB 1TQBB 3QHTC 4HK3J 2UWEA 4K7PL 5HGAA 3BKMH 5JA9A 5EZOL 4HS6A 5DJCA 1XGYH 2VQ1A 2Y6SC 5HI3D 4NPYA 3DX9A 4OZFH 3D39D 4YHNA 2BSRA 5D7JB 3IDNB 4R7DB 1J1PH 4OZHF 4PREB 1NGXB 4UT7L 1OPGH 2QQLH 5ADOL 4IBLT 1N4XH 5EC2B 3C6LA 4GRMB 2UZIL 5IVZB 1YQVL 3TN0A 1YEHH 3NCFB 3TZVA 4N90E 2F53D 1XF5B 1FYTA 3BPNC 5BV7C 1KJ2H 3I9GH 3O2DA 4OI8A 2X4NA 2DL2A 1BVLA 4E41B 1OTSD 2EDQA 2NW2B 4Y5VA 3VH8B 4XP4H 4U3HA 3WJLA 1YZZA 2NR6D 3B9EA 3ZDZF 2NPLX 2J2ZA 2CK0H 1FE8H 5LWYL 4P49A 5LQBL 1F3RB 1T7WA 4AIZB 4KI5F 1XR8B 2XXMB 4R0LA 2FX7H 2PO6D 3NIGF 2OQJB 3QSKB 2DJ4A 2Y23A 4WCYH 1PSKH 3T65A 2VUYA 3TPUA 4LBEA 4IOSD 3ET9F 1JNNL 1FL3B 4OAWA 1T5WA 1IC7H 1UXSB 3WNNA 4LKXB 3F58H 3CIQA 5J6HA 4B7IA 2HKFL 3B9KB 5FV2A 1G7JA 4PBVC 5TDNA 3U0TB 3N1MC 3FO1A 4HJ0C 1D5BA 5HY9A 4LSUL 4GAYA 1CE6A 3LZFL 5SX4H 3HI6H 3BZEB 5BMFL 3QUYA 4WTXA 1C08B 4YWGH 4ODVH 1UH2A 1AKJA 3LB6C 4QTHA 2D2OA 2D0HA 3NPSB 5L2KB 4HT1L 4M61B 1QSVA 1MVFA 1QRND 1RULL 1JYXA 4QXTA 2IJ0C 5E9DB 3QXUA 3RVUD 1ZHKB 4TUJB 4X4ZA 5IQ7L 2EE9A 4OZGF 4APQD 5KVEH 2R0KH 4ZUTA 1JGVL 1QSFD 5DS8B 3IFLL 4QRPE 1NC4A 2FBJH 4PJXB 1ADQA 2A0LD 3FQNB 4W4NA 2CMRL 5B21A 3MRQA 3RU8L 3PHOB 4RISH 3UTSD 3QHZL 4D9QE 2BRRL 4PJ8A 1UA6H 4L8SC 4J23A 2AJUH 3KPLA 4OCYL 2P1YA 1QSFE 1P9MA 3CFJB 3NH7H 3WO3B 3U7YH 5FDWB 5JOEA 4JCLA 1BFTA 1MI5B 2XWJA 3EHBD 1FORH 1FIGH 4N8VA 5TE6L 2DAVA 2VDOH 4ODXA 4PG9A 2W60A 5ALCH 4AMKH 1MCRA 2W9EH 3CXDL 5I71C 4JPWL 4UAOB 3U48A 1IVLA 4UINL 4H0IA 1EHAA 1Y18B 3ARGB 5GS2H 1RZJC 3CVHH 5I16B 1OQOA 4HLZH 4GAJL 3ULUC 1UB5A 3VWJB 1LDPH 4QTIL 4N5UA 4WIQA 5FYLH 4OZGE 4GBXC 5CIPH 4TSBL 1DLHB 1BFSA 1U3YA 3ECBA 5AYUH 3DYPA 2Y5TB 3ARXA 3EJYD 3SDAA 4J4PA 4MZ3A 3WXVL 1KXTB 1S8DA 1SEQL 4Y5XC 4QNPE 3OKEA 3C60D 1AGEA 1VEOA 1MFDL 1AFVL 4Y1AD 3LEYL 4Y8AA 2YA0A 4FXGA 3E1F1 4G8IA 2VWEE 2MJWA 2EKSB 5E6IA 2DTML 5HYJE 5HBBA 4IIQA 1QHOA 5JXEA 4LLWA 3FT3B 1AE6H 4MAYD 1T83A 3HE7B 2VSCA 4UTBL 4Y1AE 3VXRB 5KSBB 1SQ2N 5T1LD 3IDJB 3QUZA 3BUYA 5FCUH 4ETQB 5I1JH 5ITFA 1CD1A 1YEFH 1UWXH 4MD4A 4LDLB 2FEDD 5ADPL 2OMNA 4W68A 1BFOA 5L8JB 4YBQD 2DDQL 2ZUTA 3ZE1F 4Y5YB 4NNPL 3FOLA 5FUCE 5HHOE 3D0VB 5DLML 1KLGB 4OGXH 4RMSA 1GGCL 1RIVH 2W1NA 32C2A 4U2ZA 3CZFB 4X6DE 3MNWA 4H8WL 1X4XA 2C3GA 2Q76A 1DFBL 1FO0A 1UWXK 4XGZB 3IS1X 4RGNE 3N85H 1KELL 4LHJB 1T20B 4JR9H 5AZEL 2NY6D 1T4KB 4M62H 2YA2A 4TTDD 3T3PE 4DKAA 4HWBA 5SWSB 3S37X 4PRAB 5J57B 3DVNB 2AK4B 2XZQH 1KC5L 1MCOL 1KTDB 1WTGT 3QFDA 3QQ3A 3M1BA 4HJGB 1GZPA 3L3HA 2AEWA 3FRUA 4J7RA 1M7XA 1MRDH 4HWZB 3EIFA 4L3CB 5T3ZH 3V6OA 5FUOH 1T1XB 4OV6F 1ND0B 3FMGH 4JB9L 2XIDA 2YWZA 2DLTA 3B3IA 1I8MA 2GTWB 4DGVH 3EJJX 4WJ5B 2BOBB 3TO4D 2QQNL 1ZOXA 1T7VA 3FQTB 1FCGA 2VDKH 3P4NA 4NM4L 2ESVE 3GSQB 4L8CB 3WN5C 5IMMA 2X1OA 3E8UH 4PJFA 1V7ML 1G7MA 3TH4T 5KTEL 1KB5L 2BY3A 3U4AA 4JY4B 4WV1A 5ESAB 5D70H 1YEEL 5EPMB 4WDIB 2DICA 3LSOA 1C1EL 3DTXB 3IDUA 4XCYA 2V2WB 3MUGA 5IBUG 2PYEB 3SO3B 5K59E 2DQGL 3BUTA 4XCCH 3P0GB 4OZFG 3F62A 1LILA 5TGBA 5TF0A 5E2WH 3MRCA 4S2SA 3WUZA 2F58H 4R26H 1S9YB 1QEWA 3IFPA 2A73B 4PUBL 1MNUH 2HN7B 4AEIH 4XX1E 5ENWB 5T5FL 5CZVL 3PDGA 2X1QA 5GZNC 4QHKI 4PLJC 5ISZB 4FFZL 4BJLA 2VDNL 2AK1L 3IDIB 4JRXB 3PWPA 4XNQA 3H7BB 1CLZL 1UM4H 3GMRA 5T1KD 3L3KB 1WC7A 4KY1L 4X5LA 3OKNA 3OF6D 3S34H 5T33L 2V5MA 3ULVH 2Z31C 2YKLL 1H5BC 1LE9B 2VE6B 1WBXA 3WFEL 3PDOA 3GMNB 4NQCA 4LVNB 3U4EA 2B8OT 3WIHA 2X9XA 3KDMB 3OB0H 4WI3A 3TT1H 1M1SA 2AERT 3ARUA 3ALPA 4QT5B 5FGBA 1ES0A 2MCPH 3GRWL 3X12A 2FEEI 2D31B 2YD8A 3BYTA 3FQXB 3TCLA 4YDKH 1MAKA 3PV6A 1A1MB 3LH2L 2UUDK 4X8JB 1ZHNA 3WD5H 5EFIA 1MWAA 3HAEB 3B2VL 1NCCL 4BQ9A 3GSNL 3HI1A 4HXBH 4K94H 4F8TA 4NQDB 5EH1A 4MJ5B 5CKGA 3ZYIA 2KPNA 4NZTH 3LIZH 4KTDL 4LIQE 5E8PB 4Z7NF 2G9HA 1MY7A 4YHLL 2VQTA 3RWHA 4QRQA 3QIWA 2FATL 4Z7OF 4KI5C 1JGEA 4HBQA 2XA8L 4Y19A 1YJDH 4YGAB 2NY5C 1F8TH 4JE4B 4C83A 4LSDA 1FC2D 3PF2A 1T1YA 2N56A 2C3VA 1A02N 1L6XA 4UDTB 5CINH 5FM4A 2V9TA 3O41B 5INDA 4OZ4B 1R3HB 3MOBH 4ZO9A 2OLDA 2NZIA 4DAGH 3T1FB 5D7IB 1DEEA 1K8DB 4TQEH 2AJZA 4PJGE 4HIJA 2WWKO 5JIKA 4H1LB 4M3JA 1FFNA 4OGAC 3N1GC 3V7AG 3OKMB 4ESKA 1S5HA 4I3SH 4TPRL 3WV0A 1RZ7H 1UCBH 3WIIH 3TA3B 1FVDB 4MHHG 4JFHD 3MRJB 4L4TD 2EE3A 2H32B 4BZ2H 4HLZG 1KG0B 4JZJA 5TDPA 4NJAH 1WFOA 4FTVB 4LKCA 1HYSD 1PX3A 3H3PL 4PRNA 4X6EB 4XC1L 2E7LA 3X3GH 2VZTA 1RIUH 3TV3H 1KYOJ 4O5LL 4RNRA 5IB5B 3ZT5A 2PNDA 1OARL 4ZTOL 3TBSA 1WZ1H 4J2XA 4MAUL 2X4TB 5E08H 1HCFX 3PABB 3UPCA 1MFNA 3JZ7A 3L3GB 4GRWF 2IWGA 3N1FC 5GGQL 2F54B 3NFSH 3BPOB 2APWA 3D2UA 5ICZA 1JPSH 2P5WE 1WBZB 2A6JB 3ARDB 3MRKB 3HB3D 4CW1A 5EUKB 4OKDA 1S7UA 1BFVH 3OKLB 4MNQD 3CLFH 4OFYD 3MLUH 4X6FB 3LCYA 3MV9D 4W70A 4QRRB 1V3JA 2H6PB 3QULB 1CXIA 1FJ1A 1U42A 2F53A 4ZPVA 3WUWB 1A9BA 1AP2A 3KJ6H 4M1CD 5I74C 1U36A 5DJDB 4B53A 4S1SL 4IOIA 4NFBA 5C0AD 4D9RD 1HH6B 3KWWA 5F7LB 3QNZA 2H3NB 4CADB 3MNZB 4ZXBC 1XGTA 5EA0L 1CVRA 3RRQA 3UC0H 2YEZB 2YS4A 3MV9E 4Q6IC 1HCVA 1OAKH 3RDTD 3FO0L 4RGMB 4E5XB 1HXMA 4EI6A 5TPWL 2EH8L 3G6JB 3K1KC 4HIXL 2PO6A 3RVTC 4E0RB 4Z7UA 2JIXB 2RB8A 3NZHL 4XMPL 2AS5M 1XR9A 3H9ZA 3QCTH 1NGYA 2NX5E 5CJXA 3BP7A 3O4LE 1QD0A 3L3JB 4PJ7F 5FHAL 3MTRA 1UH3A 5F7NC 5JZ7D 3MRHA 1I1YB 4PJIA 4QHMB 2OP4H 3R0MA 3OG6B 5DRWB 1VDGA 3QAZB 2I9LA 5C1MB 1R3JA 4D0CA 2R2BA 1KPUB 5KVFH 1L4IA 2EDYA 3BESR 1SJHA 2UV3A 4F7EB 3A67L 3RBSA 1NAKH 1EPFA 1MHHB 4EXKA 1WBYA 4L29B 3BH8A 4ZAKD 1KF9B 2HLAB 4QRPA 2FGZA 3MZTA 4NCC1 1SJVA 4HPOL 1DUZA 3O2WL 3BHBB 5E5RB 4B50A 2A6IB 4WU7A 5I1AB 3P0YL 3S3PA 2XY1A 3VMPA 3LPGA 4Y4FD 1CICB 1NGZA 2APXA 5E5UB 5I1HL 4APQA 4NC1C 1QSFA 4LHUD 5GS0H 5ITBL 5HPMB 3WNOA 3RVXC 2A74A 3VXNB 2B1AL 1V8HA 5F72S 1A3RH 3KLHC 4DZBB 3HLAB 3I75A 3ZHDA 1DBBL 4XBEL 3UTSA 2NTFB 5E7FA 3CC5A 2SEBB 1EHXA 5DJXA 4YXKH 4XXDA 3SDCB 3WHE1 1A14H 4KK9C 1CU4H 3NCEB 4NZJA 4UUJA 4LLQB 3E3QC 2EECA 3PJSA 4PY7A 3BFOA 4XPBL 5HHVH 3OAZH 4Q97A 4K8RD 5BV7L 4WO4C 5CGTA 1DBJL 5TF1H 3VRLE 2X09A 5CSZA 4Z0XA 2EE2A 4X7TA 1ZT1A 2BVOA 5LKNA 4WWKC 1CFSB 1PEZA 3CDCA 4YNYA 4A6YL 2BCKA 1RK1B 1U8JA 4H20H 4LCWB 5I1LA 2NXYD 5C71A 4TUOB 3HG1E 1N6QH 1A6VL 4PJDE 3I6KA 1U6AH 2ZJSL 5IESH 4I4WB 5KG9A 2C3WA 2VRAA 2CKNA 1QFWH 4G7VL 4GSDH 1EVTC 3B8YA 5F9WC 2DM2A 2FWOA 2W65A 3T8XA 3IDGB 1KPVA 3UPRA 3P77B 4LVEA 2F8XC 4XMKH 4R4NC 1PZ5A 1A1OB 3QXAB 1I1FA 4YHOL 1P84J 1CR9L 3P4MB 1KCSH 1I1AD 4RZCA 2R2EB 3BPNB 4P5TD 1OVZA 1E0OB 5IWLA 3C60A 1A3LL 4A6YB 2E6JA 5LCVL 4HWNA 4Y1AA 1CGTA 1F4HA 1K4CB 3BMVA 4UDUB 5DJAB 5IK3B 4BH7B 4FABL 4PGEA 4JHWL 3CFBB 2OZ4H 1XGPA 1OGAD 2W9DH 4N9GA 4PTUB 3PNWA 5F1IA 2EDHA 2AJVH 2ZCKL 1OAYH 2EYTA 4JGUA 4MAYA 1Q9WA 4JFPA 4AM0A 3F6IA 2VLJB 2R2CA 4LMQI 4JDZB 4OFIA 1ONQB 2JF1A 1L0YA 1E4KC 1YNLH 4KHXL 5MEPB 4X6DA 4BSJA 4FZEH 1ACYL 3AAZB 4P5MB 1O5DT 1OGAE 3MRIB 4UQ3A 2ICWJ 5LGHH 1MJJB 4Q6YA 2HTLC 4G9FB 2VN4A 1I3VA 3KYMB 5IB1A 2E9WA 3FCTA 4MNGA 1MLBA 4OLXL 2JJTC 4ZFOB 2RBLA 2Q6WA 4R2GC 1EUUA 2AXJA 4TVSa 4YO0B 3TBYA 4LEXH 5C0CD 2JK5B 4JG0H 1MREL 2VL4A 3QUMB 5DD3H 2VZOA 4V2BA 2WLYA 1ZV5A 4TUKH 3P3YA 1U9KA 3CH1A 1QYGH 1QKZH 3QJFA 3HC3H 4U6XB 4M6MH 4IRZH 1GHFH 3CSYA 5DC4B 4R4BB 4X5WA 4OZIA 4P3CL 1U95B 5DZOA 1N0LA 3PXHA 5JOFA 4GKSA 4X4XA 4KV5F 2QSCL 1F6AB 3QI9A 4I2XB 4LOUD 5C0GB 3I3EA 5D4QA 5DC0A 3O11B 2NMSA 1T2XA 1RZJL 3WFCL 5LG1A 4P2RE 1RUMH 3DI2B 4KMTH 3RIAK 5CEYB 3ARED 3C9NB 3VXUD 4X9BA 3RP1A 2ZUVA 4Z7VA 4L8SB 3MUZ1 2Q7YA 4PRIB 1GVIA 4DKFL 3HPJB 3WE6A 1IT9L 2AXFA 4PTTB 1QR1A 1C12A 2HFGH 2NY3D 1DSFL 1TMCB 4MCYA 5IP4A 1T21A 3GDBA 1NJ9B 2AXHA 1WCQA 3D69A 1KCRL 1QO3B 2V5TA 5E8OB 3S6CA 5DJ0A 2R1XB 4C54A 4OM1H 2ICWB 3WS3B 3F7VB 5I71B 5DJZB 1TLKA 1MHCB 3LQAC 3O6MH 4F2MA 4OCNC 3CX5K 2G5BB 2OI9C 3PIQB 1R6VA 4GMTL 5EU5A 4Z76A 2KBGA 2NTSP 1QFPA 3KPSE 1MLCA 3EDFA 4UU9B 1GAFL 4HIEB 2YD4A 4JPIA 4ZTPH 4JCMA 3RUGB 4YHYB 3HNTH 1A4KA 1JF1B 1OAUH 1P69B 1YEKL 5H8DA 4GBXB 4ENEC 2DLIA 3MGOA 1ZGLA 4F7CB 2C1PB 2Z4QB 2Y72A 4P23D 3DETD 4PGDA 5DK2B 3UZQA 1W8OA 3MJ7B 2GJ6B 2CIIA 3FAXA 3C6SB 1T6VN 3D85B 5T1KA 4KAQH 1QLEL 4K7PH 3IXTB 3OF6A 5FA4B 3GJFB 1DL7L 1M6OA 4AY0A 4WFHE 5D6CB 4P3DB 3LQZB 1G0DA 5EZOH 3VGHA 4YDVB 2XWBA 4ZSOB 3G5VB 3OR7A 3MSPA 4NRZA 2QKIB 4HUKB 1Q9OA 1IC5L 3QG6A 4PJFF 3WNLA 3ILPA 4UT7H 5ADOH 2OSLA 4XPGH 2P24A 5EU7C 2R29L 1NBQA 5IB2B 2MOVA 4JKPL 3TJHC 2UZIH 1VPOL 1YQVH 1NCDL 3E6FA 3TYGH 4KKAD 5JHDB 2ICWI 1E28A 5GRWA 3T0BA 4EJ1C 4MQTB 4P5KB 1KNOB 1OY3B 5IJVB 4Z5RB 3VFNA 2YPLE 3FB8B 4FQ2L 4HK0B 3NFNB 4EN3D 5LWYH 3VI3E 5ERWB 5LQBH 4NQSB 1J0KA 5LBSL 3STLB 3LKNA 4ZYKB 3SDYL 5B8CB 4PFEA 3CX2A 4QYOB 5C07B 2AV7B 4LLVA 4PRDA 1JNNH 1S7TA 5J11C 4HUUA 1S3KL 1FV1B 3MFGB 2HKFH 4KKLD 3KYAA 4IRJD 4ZS6D 4PJGA 1NGWB 1AGDA 1JNHA 2Z91B 4LSUH 1JWUB 4F9PC 1P7QB 3LZFH 4K9EC 4DFIA 1UWEL 1VCAA 4M5ZL 4TVPE 2X5PA 2PXYD 4WHTA 1BLNA 5BMFH 3MRRB 2FSEA 5KVGL 4WUUE 3WN5B 1SBSL 4GRLB 5IKCB 1HHGA 1I9IL 2CRIA 2NY1D 3HKFA 4DK6A 2X1XR 3VW3L 4HT1H 4NFDA 5FF6A 1BQHA 1RZKC 3HS0B 3T09A 3N1QC 1RULH 1QLRA 5ESQA 2ITCA 4KJQD 2BDNL 3GJEB 5EC1A 1JYWA 5E8NA 1PY9A 3G04A 1U3HD 4UZGA 5DMJB 2APTA 5A3IC 5IQ7H 2P5WA 4F9LA 1JGVH 1SY6A 3NCJL 4J3TA 3L5XL 3AS0A 3IFLH 5SV4A 3RVWC 3TZVC 4JVUA 2CMRH 4FN0A 2DMCA 4WY7L 4YUEL 4ELKB 1ZAGA 3QHZH 3EYSL 2BRRH 4MX7A 1PGRB 4MD5B 4NO0B 4OCYH 3VG9C 5AD0B 2X70B 4QXWA 4KDWA 5KANI 2L7UA 4JANA 4R6UA 3WJLC 4PLKC 1IAIM 4P57B 5FO9A 5IROA 1U93B 3BSZL 5TE6H 1MSPA 4MNQA 3UROR 2YHGA 1DE4A 2X9YA 3MV9A 1CVSC 1LHZA 1XCTA 1OWRM 1YDPA 4R0LC 1F3DJ 1UM5L 4KRPC 1RV6X 3CXDH 3MYZA 1F3JB 3CLEL 4JPWH 1JYNA 1B3JA 1T0NB 5CZKA 1H5BB 4UINH 1YMMD 5C0AA 2P42B 4G5ZL 1F4WL 3S7GA 2DYPD 2WIMA 3UTQB 1JTTA 5FKAB 4GAJH 1RK0A 4YQXL 1TZGH 3O4LA 3RDTA 3B8SA 1DN0B 5EORL 4QTIH 2HJLB 4HFUL 2BNRE 1NCWL 2B1HL 4TSBH 3EGSB 5JUEL 3T0WA 5F6IB 5IMOB 3QUYC 1NDGB 5ETUA 2NY5L 4JFDD 3WXVH 3TYFA 1SEQH 4PJAE 1BOGB 3MRFB 2GFBB 3RVVD 4H0GA 3OR6B 5I1DB 1YYLL 3K2MC 2Y4SA 1MFDH 3TNMA 4U1IB 1AFVH 4M7ZC 5L7XL 5CWSA 5DURD 1CTOA 5EBWA 5DJ2A 3D87B 3LEYH 4RFEB 2DTMH 5DD5L 2YUZA 1I7RB 4ALAL 2ZSVB 3SE9L 1Y6NR 4JFOA 4P46B 3R8QA 5D1QD 3GSWA 3QUXB 1NH6A 3ALWA 5DJYB 4V1DB 1TTUA 2NY7L 3BDXA 4UTBH 4OTXL 3D3VE 3MODL 3GK8L 5KSUA 1VEMA 3VGAC 4F7TA 2X44D 3PQYD 4OBRA 1N3NB 4LDOB 4PJ8C 1IJ9A 3HR6A 5ADPH 1FZJB 1I7ZB 3CU1A 2DDQH 3LS4L 5CKAA 2V6HA 1S7QB 4NUGH 4KFZC 4PBXA 4JGMA 4NNPH 4Y4FA 4Z6AT 5DLMH 3T2NL 4XNXL 1GGCH 4LHUA 2PTTA 5IW1A 2IC2A 2XNAB 1AO7D 4H8WH 5EO1B 3OX8A 2MSPA 3IFOA 4OLUL 5EU3A 1DFBH 1QP1A 4MMXC 2DIBA 3GI9L 5CSBA 5A1AA 1BZ7A 1KELH 2GIYA 3FQUB 5JDSA 2OJEB 5I1KL 5AZEH 3P0VL 3VFUB 4U7MA 1GPOL 2BY1A 4BYHA 3MLXL 4U1JA 3U4BL 2IPUK 2VDRL 4Z7UF 1KC5H 1MCOH 4PJDA 4ZUUA 3UAJC 3U9UA 1ED3B 3VFGL 3MV7E 1KCUL 3MZGB 4TNWK 4JB9H 3VFSA 3PGDA 3SDAC 4J4PC 4F80A 5B3NA 2R23B 4FFVD 3BP6A 4OZGB 4CVZB 4YJZL 2QQNH 5IQ9B 5KS9E 2DQFB 4NM4H 2RCSL 4QLRA 4CU6A 1K85A 2H9GB 3K46A 3P9LB 3Q6GL 4G8EA 4IDJH 1H3WM 4NKQB 1V7MH 4U0QB 3OJDA 1JN6A 5KTEH 4Z7QE 1KB5H 2WWMD 4BELD 1NEZG 1YEEH 5DSCA 1JV5B 1IEHA 3O3DB 4IIQC 2IFFL 4ODWB 1C1EH 1FP5A 3X14B 4HHAA 3L3DA 1T83C 3F8UB 2OTWB 4XP1L 2DQGH 4XTRC 2IEPA 1JF6A 5I74B 1N6VA 4PJ5E 2I27N 4YR6A 2CQVA 3QUZC 2L4OA 3E0GA 4IOFC 4H5SA 2C4XA 1FZOA 3WFBL 4FMFA 4LU5L 4GS7C 4Q6IB 5JMOC 3MRMA 2VR4A 4PUBH 3AROA 1OGAA 5T5FH 5CZVH 3UP1A 1Q94A 2FL5A 3KPQB 1QTYT 4RMTA 3VWKD 3ZDYF 4FFZH 3V5KA 5J13B 1NBZA 1HQ4B 4KQ3L 2VDNH 2AK1H 3G5ZA 4NWTL 5K93A 1X5AA 4X9HA 1CLZH 2C3HA 3ZMRA 1CFQB 3CFKB 1KPRA 5DHVB 1DLFL 5GSRB 3VFMA 1ZKAA 1RUPL 4KY1H 4Z78B 3HAEH 1D5MA 5T33H 5IBLD 1IAKA 2YKLH 3DUUA 3IDMB 1Q9LA 1CGYA 5GHWL 3V6ZB 1IE5A 4W4OA 1KJ3L 4QCIA 3WFEH 5DEGB 3V6OC 4OKVB 3DO7B 3DRTA 5C0CA 4RX4D 1SBBA 3H9YA 4NNYA 5F96L 1T04B 1XGRA 3VRJB 4XCFL 1NDMB 3VFRA 1ZT7B 3GRWH 3MRDB 1EO5A 3BXNB 1HXYA 1TVBA 3MRLB 1KULA 3FO2B 4Q2ZB 3PV7A 3GSRA 4F7PB 2OX5A 4FQJL 3UTTE 3LH2H 5DEFB 3BEVB 1EEZB 5I8EA 1EX0A 1JZ2A 2ESVB 4F33A 35C8L 2R8SL 5EZLA 3B2VH 1P6FA 2HT3D 1T22B 3AREA 1NCCH 4JRYB 3GSNH 5IUSA 1N26A 1QPXA 1PJ9A 1Z5LB 5BZDA 3V9FA 2BRQA 5B39B 1MH5A 4LPCA 1MCNA 3MRNA 4H1LH 3VXTB 5ID1A 3GIZL 1QOKA 2Z35A 3PGCA 4KTDH 4U6HA 1HSBB 4ODUB 4YHLH 1NQBA 2XYCA 4WO4B 5HYIA 1F4XL 2FATH 3TF7C 4LCUB 3QB7C 4WI4A 2H32H 3L6FA 2XA8H 3IJSA 4XNYL 1M05B 5K9KA 4AZ8A 5FYKD 4HGMA 3V4VL 4FNLL 1WLHA 1G6RL 1A6TB 5GIRB 3EO0A 2XN9B 4KHTL 1T1WA 1T5XA 1OTUC 5T3ZE 5IF0B 5F9WB 4YXHL 2C9AA 1YPZE 3U2SA 4ZDHA 1VFAA 3CAFA 5D1XC 5F3BA 2P8MB 2Z92A 1AR1D 3TBWB 3S88L 5EZJB 3P4OB 3FFCD 5MP6L 3QIUD 3K2UL 4TPRH 2GJZB 5DQ9B 5DK3A 1QVOB 4NQXA 3MREA 4QXGL 1PKQB 1S9WA 1X7QB 1G7HA 4JFFE 3DLQR 3NABL 3MXVL 5FGBC 2PF6A 3H3PH 4XC1H 1DVFC 3NVQA 3SCMD 1JWMB 5C0NC 4O5LH 4FFWD 2NW3A 1OARH 2YA1A 4ZTOH 4HC1L 4MAUH 5IVXE 4UOJA 1E27B 5DFWH 2HWZL 5GGQH 2R2HA 1AD0A 1LEGA 2P45B 4JPKH 4RWHA 5E6YA 4LPXA 2X89A 2EYSB 4K55A 1XF3A 1YMHA 4S1DC 3JWOC 2DKSA 3GMLB 2YPLA 5GS1A 4LLMA 1AQKL 1HI6A 2P8PA 3KPRB 2X4QB 1EA9C 3JV4B 4UI2A 2Z0BA 4FQLL 5KJRL 4W81A 2FO4A 3RZCD 4I5BB 4PRHD 5HHXL 2ARJB 1JMXA 1T2QL 4R2GB 5DHYB 1JHTB 4N0UA 3KPMB 4HX1B 5EA0H 2GTZB 1A21A 5I8CA 3JXAA 3ULVE 1HQRB 1RI8A 2HVKB 3FO0H 5HYSB 5BS0E 4QOKD 5TPWH 2EH8H 4LAJH 4HIXH 4BZYA 2IANB 3OKKA 3BDYL 1KYOK 4DCQB 3O6LL 3NZHH 4XMPH 2IPUG 2ZUXA 3CXHJ 2XXCB 3HPLB 4CNIA 3LQAL 4GQ9L 1UC6A 1VACA 3TM6A 3BGAA 5FHAH 4O02L 2ZPKL 4NC0B 2VL5A 4EVNB 1EFXD 4BFIB 4GAGL 5DUPL 4L3EB 4XVUD 4G3YL 2C5DC 3QIBD 3WL9A 3VD4A 3A6OA 3ZL4L 2NNAB 1T6WA 4XRCB 1XF4B 1G7PB 3DX6B 2PXYA 4JZJC 4O2CA 3MR9A 4O58L 2OTUA 2EC8A 2E7LC 2GK2A 1X5HA 5C0DB 3A67H 4CJ0A 4OJFL 5L6YL 3SKOB 3H9HB 4JM4L 4HPOH 5EU6E 2N7BA 3O2WH 1WWCA 3S36L 1F4YL 4UT6L 5D7LE 3P0YH 2OI9B 4LVHC 4FRWA 4ZPTB 5L0QB 5I1HH 3BO8B 4KXZI 1S9VB 4L4VB 5ITBH 1JNJA 1M7DA 2B1AH 3VGFA 2ZKHL 2MKWA 1J05A 4CMHB 3KLSA 5FGSA 3WIFA 3G6AA 5C0JA 1LD9A 2GCYB 1DBBH 2HRLA 3QP3A 4PJ9C 4KH2A 4XBEH 4CVXB 3BW9A 5C09D 1OTSC 1E4XL 4NQVA 3VMNA 3BP5A 3UBXA 3BT2L 1MFBL 1WICA 1FL5B 2NR6C 3Q2CA 4XPBH 1CCZA 3GHEL 4KUZL 5BV7H 5IFJB 1DBJH 3ZDXE 3UPAA 4EDXA 3CSBA 4MLIA 3HMXA 3EZ8A 1T80A 3L9RA 3U30C 4C59B 1C16B 4A6YH 3HE6D 4XNMB 1TCRB 2V5RA 3AM8C 5C0IA 4FQXD 1A6VH 4OCLC 5ID0A 2DYPA 2ZJSH 5D2NC 5F7KC 3BJ91 4G7VH 1IM9A 4NKOB 1NUGA 5A2KH 1AXSA 2NX5B 3BOVA 2W0LA 5DWUL 3D48R 4GRWB 4I0KA 3G5XB 5I15L 1YN7B 1I7TB 3FB7B 5EO0A 3CDGB 4YHOH 4AH2A 1CR9H 4JFDA 3M17A 3O3AB 1P7KA 2AKRA 3GKZA 2C1OB 5ANMA 1XGUB 2W38A 5EN2B 3DX8B 5DFTA 3QDJE 3NACL 1OP5K 3VA6A 1A3LH 3IF1B 3QNXB 4UNTA 4H26B 2A2QT 3BKCH 5LCVH 3QT2A 4H25B 2ADGB 5F88A 5C0EA 5GGSY 1TDQA 1Q1JL 4FABH 4P2OB 1DR9A 4JHWH 2JJWA 1LP9E 1JZ8A 4XWGL 3RVUC 4G8GB 2DOCA 5A2JH 3TH3T 5F7YC 2ZCKH 5D1QA 5DVNA 1J11A 5DUBA 5SWZD 3V6FB 1G7IB 4PIRF 3FB6A 1RZKL 2V17H 5DYOA 1BZ9A 2FD6H 3I50L 2FX8L 4ZOCA 2A0LC 1JK8A 1U8PA 4EEEA 4KHXH 3ARVA 5J11B 4OF3A 3PQYA 1ACYH 4PRPD 5CLWA 4OSUL 4S0SD 1EH9A 1NC2B 4U31A 3BD4A 5HHPA 3REWB 1EMTL 1IGYB 4KC3B 3VJ6A 1H8SA 4BZ1H 4MXWL 1ZTXL 4H1LG 3H6JA 4HFWA 4PJ7B 3EHBC 4OLXH 3ZE0F 4B7LA 3O2DL 3LV3A 2NLJB 2VJXA 4YXLL 1AO7A 5F6HJ 2EEAA 5C70A 2I25N 4LEOB 5E5MA 1X4ZA 3MV7A 5DJCB 2BHUA 3C5ZD 1E4XI 2VISB 3C8KA 4LPUA 4NPYB 1U8LB 5T3XL 2EDEA 3KJ4B 3RPIA 4RBPH 1BIHA 4GKZA 1H0DA 5H94A 4H88L 1CG9A 4JLRB 3AXLA 1UJ3A 4P3CH 1M7IB 3T2QA 3NOIA 4PJCF 4FS0A 3BDBA 1EEUA 1II4E 3KXFD 2QSCH 4FG6D 4CN1A 3FOMA 1JVKA 3H9SB 5D1ZD 4X80L 1OCWL 5ACMA 4X0KA 1RZJH 3WFCH 3EJYC 1G7QB 4RBPK 1HKFA 1FYTB 1B0GB 5E00B 3O8XB 2AQ3A 5IWLC 5ACZA 3REVA 4DKFH 3P40A 1NAMB 3VG9B 1IT9H 5GRVL 4R8WH 5HVHC 1PYWB 1ZA3B 1HOCA 1ETZA 3ZE0E 5K9OA 1DSFH 5FCSH 1ZHLB 1MQKL 5GGRY 1N8ZA 2CKBB 1DQML 4GXVL 1KCRH 1QSEE 5EBLA 1QBBA 4MAYC 5M7QA 1CGXA 1JPFA 3GIVA 1TVHB 3GJFH 4D0BA 4PG2C 3ARRA 1J8HB 4LBEB 4F57L 4GMTH 1CF8L 5FYJD 2YPKA 3UJTL 5FXCH 1GAFH 5TDNB 2FEDC 3O9WD 4YBQC 1XF2A 4PJCE 5E1AB 3NGBB 4D94A 1EEYA 2HFFA 2FZ3B 1YEKH 4GAYB 1ADQL 4DKEL 1CE6B 4R3SA 1I8IA 1RU9L 1XF1A 1I3UA 4RFOL 3QUYB 3RWDA 5DD6B 2DI8A 1RUAL 3B6SB 3FN3A 3S35L 1XEDA 2HVJA 1CIUA 2XTJD 3MV8D 4GW1A 2NY6C 3ROOB 2MHAA 2DWDB 4M7ZB 3ZE2F 4NO3A 5CMAA 5FUZL 4TTDC 4QXTB 1QLEH 3UTZA 1NCUA 1DL7H 3ARQA 1A0QL 2HFTA 2GSIA 3K3QA 4HUWA 2AXGA 3QQ9D 1ZXQA 2OL3B 2E8ZA 5E2UL 1HHHA 3BVNA 3RIAF 4RX4A 5EO9B 1RJYA 3TO4C 4I18A 2R29H 3ZKXB 4JKPH 3IXAB 2R1WB 5C6WH 3KLAA 1VPOH 3TFKD 2DIAA 3PWNB 1NCDH 3HTLX 3QFJE 3ZT7A 3ZHKA 4QRUA 3ARFD 4K07A 3DROA 2X7LA 1EXUB 1U8MA 1BIIB 3LKSA 5T1DL 2W60B 1CL7L 3SDXF 5JDJA 4GG6E 4FQ2H 3ZKQD 5I17A 2VLKD 4K94C 5F6HI 4POZD 2LU4A 4LQ1A 2A6DA 5LBSH 3CUPB 5I1EL 4XHJD 3KYOA 5MENE 3MUY1 3SDYH 2EYRA 4OM0L 4ZOBA 4JFZL 3SKMA 1UB5B 1B9ZA 3S98A 3G08B 1MJUL 1RAMA 4HKZA 4FQIL 4QHUA 4X7EC 1S3KH 4XPTH 3NPZB 3ECBB 3V4UL 3L3OB 3SKNA 4HS3B 1UADC 3SDAB 5JLZA 4X4YA 2DI9A 3NIFF 3HZKA 5E4EC 4AQOA 3QRFM 4JY6A 1UWEH 1FRGL 3OKEB 4M5ZH 3I02A 5KVGH 2P8LA 4HKXA 1JZ6A 4MJ4A 1SBSH 1A6ZB 2DWEB 2EDDA 1I9IH 4U1MA 5JW5A 5ESVB 1NGQL 3VW3H 4IIQB 3KHOA 3SBWA 3QRGL 3U6RB 2CSPA 1BVKA 3QIUA 2VXTL 5GSVB 1JPTL 1RUKL 2DMKA 2BVQA 2BDNH 2IQAB 4HWBL 4WFFE 5IVXA 3V7MA 1J8KA 5KZCD 3QUZB 3LRSA 1U58A 3BKJL 3NCJH 3L5XH 5HD8D 2JCCF 1JUFB 4AT6A 4P4RA 5D7JD 4X98A 1BFOB 3CPLA 1JWSA 3T4AB 2CLRB 4WY7H 3FOLB 5IOPB 2BC4B 3QNYA 3EYSH 1HIML 5D7KD 5CJ8A 2J8OA 4PGBB 3MNWB 2WW8A 3AMLA 1BHGA 1S7VA 5J6GA 4Z7WF 4JQXA 1AXTL 4U6YB 2HG5A 3BSZH 2YD6A 1OW0A 1HDMB 5D9SA 5H35B 5IFHL 1G7LB 1JGDA 2IADB 1UM5H 4R9HA 3CLEH 3RZCA 1WWAX 4PRHA 3QFDB 43CAB 2WBWB 1JGLL 3EOBA 3W39B 3L3HB 4G5ZH 4KJPD 1F4WH 3BKYL 4E41E 1CL7I 4PJHA 2E3VA 3B83A 2FGWL 2AABL 1CDHA 4X7DC 5HI4D 4N0FA 2APFA 4YQXH 1S7SB 3UTPE 5K9JL 5EORH 4QOKA 1FFOA 4HFUH 3T4YA 1NCWH 2B1HH 3B9KD 1DQJA 5JUEH 1WAAA 2JCCE 4MQ7B 3RX5A 1ZSDA 4O51A 4LGPB 4G9DA 2NY5H 3VE0A 4PJFB 4WENB 1A2YA 2BVPA 2IFGA 4PGCA 2PTUA 3S5LA 3PUCA 4NHCL 1F3DH 1HWHB 1MUJA 1YYLH 1EFXA 1NANI 3D9AL 4WWID 4DVBA 5L7XH 3O3EA 3H0TB 4MB4A 3QIBA 4P2QB 2VLME 2V7HA 2AV1A 2FHCA 1ZK9A 4KRLB 5DD5H 5L2KD 4ALAH 4NSKB 5BZWB 3SE9H 1FNAA 4M03A 5EU6A 4F9LC 4J3VA 1HYSC 3BAEL 5E9DD 1WCBB 2FIKA 2NY7H 3IFPB 4OTXH 3WIHL 3MODH 3GK8H 1C5BH 3QEUA 3Q1SL 1KJMA 1RJCA 4CL7A 8FABA 2VO5A 5IEHA 1X5GA 3G5YA 3BEWA 1RPQA 4LSQL 2A9ML 3LS4H 3V8OA 3PWPB 4XNQB 1K6QL 5DVLA 1J88A 3T2NH 4BK5A 4WFED 4XNXH 1ORQA 4KTEL 1JZ7A 1WC7B 4MNHA 4OLUH 5F1OB 1MWAL 2CIKB 1RZ8A 2IBZY 4N1CA 3GI9H 4PJXE 1ZLUH 5C6TL 5D1XB 4M1CC 2DQHL 5F9AC 5LGJA 5I1KH 5C7XL 1LO0L 5C09A 3P0VH 3OL2A 1EAPA 1AIFA 3GSOB 1N2RB 1GPOH 2PYFA 2R39A 4WFEE 3U4EB 1KLUB 3U4BH 2VDRH 1A9EA 1D5XA 2VLRE 1OAXL 1BVZA 3QXDA 1MI5E 1AY1L 2IAMD 3ARGD 3VFGH 1DVFB 1KCUH 5D71L 1YYML 3T1WA 4I9WE 3HE6A 2X41A 4YDLC 4F3FA 1D6EA 4HZLB 1J18A 4ISVB 4IRSD 4FQXA 3UYPA 4UMGA 1RHHA 4LFHD 3RWFB 3IYLW 4P59L 5IBUB 3OAYK 3SDDD 2RCSH 1JI2A 1MCEA 2YD5A 5JZ7C 3Q6GH 5FO7B 3NCCB 3TLRA 4RA3A 1R5WB 4PJBE 5JNYB 2H26B 2EICA 4R96B 1G9MC 2EIZA 5CUSL 2IFFH 5CEZL 1FVCA 5HHNA 5BCAA 4PRBB 2ENYA 4OLEA 1LP9A 3BWUC 5CGMA 4XP1H 1N5AA 5IEKB 5IR1B 3WLWD 5DGQA 1A7QH 5F9JB 4O2EA 5GGTA 3MLTA 1XZ0B 4Y0GA 5J06A 5KANG 3ZLQC 3PL6D 4RGOL 4ZAKC 4Y19B 5D2LF 5GGUB 3WFBH 1G1CA 3HE7D 3QA3B 1ZGLM 4U0RC 2C3VB 4YGVA 5DFVD 3RL1B 5CP3A 1J0IA 3LVEA 2DLGA 1EO7A 5FOBB 5INDB 3MOQA 5E8EA 2PKDA 1IQWL 1CQYA 3I3BA 2NCMA 4OI7A 3MYJB 4LNRA 3CFEA 5D6DA 4KQ3H 1S9KC 5FO8B 1DEEB 2AJZB 4NWTH 1ZLVK 3VXRE 5KSBE 1BX2A 5CEXB 4ZQKA 1KLFA 2GEEA 4G6FB 1DLFH 3S37L 4TSCL 3MRGB 4GG8B 1KN2L 4WW1B 1S5HB 2W59A 3VXQB 2YPVL 2IALA 5A40E 5C08E 4OLZL 4IMLB 4K8RC 4JZJB 1UWGL 4TNWF 1KJ3H 4ONFL 1OP9A 4Q9BA 3D18B 1K8IA 2QQQA 4DWHA 5F96H 1GCFA 5HPOA 4TN9A 5JQHC 4JFYB 4XCFH 5BOZG 1NEUA 3C5ZA 5D2LE 1LE5B 4KUCD 3D39B 1TZHA 3WHE0 4K7PX 4QF1A 5SWSE 4LL9A 3U46B 2FLRT 4FQJH 2AK4E 5GQBA 4KWUA 4PPTA 4DW2L 4CW1B 3KXFA 1TJHL 3WO4C 5I1GH 1UZ6F 3BIKA 3L7EB 5D1ZA 4HV8B 1W0VA 2HFEA 2J6EL 35C8H 1A6WL 2R8SH 4CUCA 3QEGL 4XNUL 3CDYA 1D9KB 5DRXA 1X5ZA 3T08A 4DVRL 1I1AC 5I9QB 4W6YB 1FJ1B 2F53B 4P5TC 3MNVA 3SEPA 1AP2B 3C5JB 2EDJA 5MEQA 3AUVA 1CXFA 4PJ9B 5JW3L 1LVEA 1IGTB 1T3FB 2IGFL 1U8OA 2QSVA 1QG3A 3GIZH 43C9A 1BGXL 5AYQA 3MFFA 4I0PD 2OJZL 1AGBA 1F4XH 5M95B 1XGQA 2VC2L 4UTAL 1IKFL 1VSCA 4XNYH 3BH9A 4Z7UB 1NFDA 4ORGA 5DJ8B 3W9EA 1TIUA 3V4VH 4FNLH 1CYGA 2K7PA 1NGYB 2PYEE 3VFTA 4KHTH 4Y4HD 3W5MA 1FAIL 3BP7B 3WKNA 5D2NB 3CVHB 5KVDL 5ISZD 3DUSA 4F7MB 3O9WA 1MCPL 4NKDB 4PP2A 5CIPB 1KIUA 5GJTL 2R2BB 2X10A 4N1HB 4OIAA 4BA8A 3S88H 2ICCA 3FHAA 5E0QA 5MP6H 5I2IB 3K2UH 3WS6A 4X7FC 3OXSA 1KCVL 2FJHA 1QRNB 4JRXE 3NABH 3MV8A 3MXVH 1QLFA 1WBYB 3P73A 2VXQL 4YK4C 3BH8B 2FH6A 3ZTJG 4KXZH 3WHXB 4LARL 2M2DA 1Z9OA 1MCWW 1U8NB 2F74A 4EUPH 4PV8B 4ZODA 3MGTA 3C2SA 4HEPG 4YFEA 3LEXA 5I0ZA 4G80A 5D5MA 3X13A 4HC1H 2D7QA 1A7OL 4LOUC 4LASL 2HWZH 3MC0A 1MVUA 3FQWB 3EYFB 4QEGA 2RIKA 3I75B 4DOHE 1KIQA 3BZ4A 3UTSB 3VXSD 4GG6A 1RZGB 3VXME 1AQKH 3LMJL 4FQLH 5H2BB 5KJRH 3ARFA 4LSPL 5E2VL 4NQDD 2NY3C 3M45A 5HHXH 4YZFF 4RIRA 1T2QH 1FZMA 4RAHA 5HGHB 4EDWL 4YNYB 2VLKA 2KDGA 1U8JB 3EO1B 2VAAB 5C0BD 2Q86B 1R3LA 4HMCA 4OV5A 1OL0A 4ZO6A 3BDYH 1SYVB 4X6CF 3O6LH 3B9AA 2FJFA 5DJ6A 1M71A 5I66A 3T8XB 3LQAH 4L9LA 1KPVB 4GQ9H 3DX7A 3GUTA 1LQSR 2D9QB 4O02H 2ZPKH 4AENB 1A1NA 3B9VA 3IRPX 4GAGH 5DUPH 1V3MA 4P23C 4G3YH 3QPQD 3DETC 3ZL4H 1W0YT 1JZ3A 1UZ8A 5IMKB 1L7IL 3LN5A 2BHZA 4ONHB 1Y0LB 1EEQA 4O58H 5ABDE 5LAXA 5INCB 3VXOB 4O2FB 5HVHB 3VI4F 3VFOB 2DBJA 2CLZA 5D7IE 1EHLL 4OJFH 1XGPB 2UZXB 4OIIL 1D5ZB 5CBAA 1UKTA 4FTVD 4C58B 1PQZA 5F3HB 2I26N 5HGDB 4MAYB 1V5JA 4JM4H 5IT2L 4BKLB 4AM0B 1F4YH 4UT6H 1EGJA 2P46B 4X83A 1H8NA 3QQNA 4FQCL 5T1LB 5DQJB 3NCYS 4UQ3B 2F54D 5ICYB 4X6CE 2QLVB 4FTVE 4P9HL 2FECL 4XBGB 5D7JA 2R69L 3IDNA 4R7DA 1DUYA 2ZKHH 3ARDD 3CXHK 1FNEB 1NGXA 4MNGB 4QXUL 1MLBB 5EC2A 3DBXB 2BSED 1P53A 4HUXB 1E4XH 4GRMA 4GRWH 5IVZA 4QRRD 3C6LD 3AB0C 3BT2H 1TFHA 1MIMH 1MFBH 5DI8B 3TN0D 5ELIA 4EN3C 3GHEH 4QRTB 4KUZH 1CFVL 1CQKA 3SE3A 3OSKA 3VH8A 3OPZL 2ORBL 3VI4E 5CHNB 1F2XK 4EBQL 4QRRE 5JOFB 5BS0B 4GKSB 2X40A 4AIZA 3W5NA 5BW7A 1XR8A 4MA1B 4POYA 3DV6B 2JIXD 4KKLC 3I2CL 3BRGC 4IRJC 5E99L 4ZS6C 1TNMA 3EDEA 4MD0B 1FL3A 3TO4B 4WW2A 5DWUH 5BVJA 1UXSA 4MWFB 3OKOB 4LKXA 2FB4L 4Z0BL 3B9KA 5C86A 2PXYC 5I15H 5M94B 1HNGA 3G6JE 3WE6B 1U8IB 3FJTA 3PWJB 3TWCL 2NY1C 4BSWA 3QZWG 4GUPB 3SE8L 4LF3A 4OUOA 3NACH 3BZEA 1ZHBB 3OGOE 3L5WA 5DJ0B 1NGPL 3CFCL 4IMKC 1KOAA 4KJQC 1Q1JH 1Q72L 4IHOB 5L2KA 1EZVY 4M61A 4XWGH 1U3HC 1X5IA 5TQ0L 3DI3B 4QHLB 5EIVA 1Y6MR 4DUWA 1RZKH 4KJYB 5E9DA 1MFCL 4JPIB 3I50H 3KG5A 1ZANL 2FX8H 1ZHKA 2C4FU 4G6AD 1BBJA 3PHQA 2AJXL 2CXKA 1EHNA 4J1UB 4D9LL 4OSUH 5DS8A 2ZUUA 3MJ9A 3NZ8B 1EMTH 4PJXA 4BK4A 4PGDB 4Y4KB 4R7NB 1FBIL 4M1GL 5E4EB 4MXWH 1ZTXH 4MJIE 3PHOA 4ZFZB 5K9QG 4M9OA 2APBA 2QHRL 1MHEB 3SN6N 4YXLH 2XACC 4H8WC 3S97C 2FECI 3HZYB 3CFJA 1YEDB 4LIQL 1M6OB 2Q7NA 4PJHF 5FDWA 1GYAA 1MI5A 1J0YA 3RAJL 4EIZC 2BVTA 2VTFA 2XWBB 3BGMB 1KT2B 5T3XH 1KIRB 2V2XB 4MQXD 4H88H 1JTPA 2DQUL 1KGCE 4LCWD 1Q9OB 4OF8A 2BNQE 4LMQE 1Y18A 2Y6SD 3RWEA 3ARGA 3SGEI 5I16A 3WFHB 2ZCHL 3P4LA 1OCWH 4WGWB 4X80H 4MQSB 5T5NG 2QR0B 3MCLL 4DZ8B 4IRSA 1R0AL 4LCWE 2ERJC 3RVVC 1DLHA 1UM6L 3FB5B 3SDDA 2YMXL 2CJUL 2ZG3A 4LPTA 2Y5TA 4RRPA 3JUYA 3LEVL 4X4ME 4BUGA 4EUPG 3BPLC 1A6UL 2FIRT 4NQUA 1MQKH 2KL6A 1DQMH 3C09C 4GXVH 1NMCB 1JIBA 1GSMA 1F90L 2EKSA 1ITCA 4HH9A 3W0WE 3VU2A 4Q58C 4LLVB 4PRDB 5GRVK 1F02I 5E6ID 4F57H 1CF8H 3FT3A 1YY8B 3PL6A 4K3DL 5FDYA 5TE4L 4HUUB 2YBRB 3PWVA 3UJTH 3OAUL 4U1SB 1OLZA 3HE7A 1YN6A 5IVNA 1GGIL 5EG6C 1SY6L 3VXRA 2GY7B 4U1HA 1JNHB 1GGYA 3IDJA 4DKEH 1ADQH 3PGFL 4ETQA 1RU9H 1CZ8L 4WHTB 5DRZB 1BLNB 2FSEB 1TQCC 5F9OL 1F45A 3SQOL 1RUAH 3S35H 4HJ0D 1ZVHA 4Y5YA 2JE8A 4OFKA 2XZCL 4OCXL 2VLJE 4WU5A 3D0VA 1JPGA 2J88L 1KLGA 4KU1A 3T0AA 3FO9B 1X5KA 3CZFA 4UV4L 5CJ5A 5FUZH 5HDLA 5ESQB 2ITCB 1F42A 3BI9X 4XGZA 5HHMB 4G9FE 5EC1B 4QY8B 4L4TB 3QQ4B 1A0QH 1T20A 2E9JA 3MACL 2ENSA 2CK2A 4XWOD 3RY6C 4GXUM 5E2UH 1VEPA 3MLVL 2IF7A 2AK4A 4F15C 1ZLSL 4KTYA 2ICES 1KTDA 3LN9A 3Q3GA 3FN9A 4NRYB 5BXFB 4HJGA 3GMMA 4FFVC 1T1XA 1ND0A 3BPCA 2YC1A 2B20A 1B0WA 1DZBA 2OXGA 3CCHA 4WJ5A 2BOBA 3S9DB 5BO1L 3FQTA 1XT5A 2WWMC 2E6PA 1A6AA 1N59B 4PRID 3GSQA 4L8CA 5EOCJ 4I2XE 5T1DH 1XCTB 1I3GL 1CL7H 1NSNL 2VAJA 4NO2B 3QH3B 2P5EE 5I8OL 1JBJA 3ZYJA 1PG7W 4JY4A 1Q38A 4IEFB 4NNXA 5ESAA 3EFFB 4WDIA 5C0AB 1WZKA 1G9ML 5I1EH 3FT4A 3VFPB 1LO4L 4OM0H 2V2WA 4JFZH 1RK0B 2FX9L 3O6FD 3BJLA 1MJUH 1KJVA 4XB7A 4FQIH 3HUJF 3MMEA 1WISA 4J3WA 3V4UH 1NANH 1I7UB 3ULUD 2MQ3A 3MRPB 5ETUB 3VWKC 4YDLB 2A73A 1WV7T 5IMLB 4PJCB 2HN7A 4S0TD 4LSVL 2Y06L 4P3WA 1QBAA 5ENWA 5EOCL 5DMKA 1FRGH 1KN4L 3HFML 1IAMA 1AQDB 1ZEAL 5ISZA 4YBLC 2QHLA 4N5ED 4K71C 4XPFL 2GJ6D 4EXPX 3IDIA 4JRXA 3ULUE 3RUGE 1NGQH 5IBLC 3H7BA 2XY2A 4MB5A 3QEQD 4C56E 2A9NL 4MXQD 2DS4A 3QRGH 3WCYA 3W82A 2VXTH 1JPTH 1RUKH 3GSXB 3SGKA 2OK0L 1F13A 3CVIL 5D7SL 3RNKB 5JW4Q 4HWBH 1LE9A 3UJIL 5KSUB 2VE6A 2C7UB 2AVGA 1CDIA 1P4IL 5AWNL 4F7TB 2XICA 4ZAKB 3BKJH 3GMNA 3NCBB 3KDMA 1QPPA 1V3LA 1ZS8A 4U0RB 4NQCD 2BERA 1Z9LA 4MS8D 4XI5D 3QG7L 3FTGA 4QT5A 3U36B 1AGCA 4DJMA 4OF5A 3JWDC 1HIMH 2D31A 3FQXA 4ZSOE 3RY5A 4ZS7L 2EXYD 3SO5A 3OZ9L 2DD8L 3IDYB 1PDKA 4IJ3C 4X8JA 1AXTH 1CT8B 1LO5B 4YFDB 1T1ZB 3DYOA 3HAEA 4NQED 5IFHH 1W72L 3BRFA 2GHWB 2EH7L 2VN7A 4U1JB 4PYGA 3FKUS 4K2UL 1EVUA 1WEJL 5JHDE 4NQDA 4Y16D 1T7YA 4ZUUB 4C57C 1JGLH 4MJ5A 4XXCC 2DN7A 1PG7X 3BKYH 2DJSA 2FGWH 2AABH 3PP3K 5E8PA 2NQCA 2F9BT 5K9JH 5GPRA 4MXVF 5GRYA 5JW4N 3F12B 5C0BA 3MA9L 3VFVB 4KDTA 2X4RB 4GW5B 3QIWD 1MRFL 1MCQA 2VZ1A 2AQ1A 1K4DB 3H3BC 1MFAL 1MCBA 5C07E 3O41A 4OZ4A 1R3HA 3WO4B 1W72B 4NHCH 2BK8A 1HINL 1AR1C 1RD6A 3D9AH 5FFLA 3L5IA 1UKQA 3SBWC 3CD4A 3T1FA 1I1AB 4RMQA 3L3DB 2GKIA 4GRLD 3QIUC 2VR9A 4M7LT 4P5TB 1K8DA 4XAKD 4JM2D 2NXZD 2CGRL 2VDLL 3SY0B 4KK8D 4H1LA 2MCG1 4YR6B 1Z2KA 2WLZA 5SX5H 4OLWL 2E7HA 1NMAL 1TTGA 3AU1A 3SDXB 5IV2B 3BAEH 4H5SB 3SCMC 3AVEA 3TA3A 3U79A 3MRJA 4FFWC 4XCEB 3WIHH 4ODHL 4PB0L 4RQQA 1KG0A 5GXBB 4L4JA 3Q1SH 4FTVA 5D93B 3RX7A 4DTGL 1Q94B 2XRAH 4X6EA 4UB0L 2IG2L 1WT5A 4LSQH 5SX5K 3S3SA 2A9MH 4JDTL 9CGTA 4HUVB 4X6BB 1YUHA 4POUB 2X4TA 1K6QH 5IBTL 4HW6A 4JQXC 3L3GA 4QRSB 2F54A 4OF0A 1OW0C 2VITB 2ZOKB 1KPRB 4KTEH 3U0PA 3CSGA 1WBZA 4FXKB 4N90D 2A6JA 1MWAH 3ARDA 3MRKA 3D2UD 1D5MB 2B7DT 3P30L 2YD2A 3BX7C 5C6TH 5EUKA 3RZCC 2DQHH 5C7XH 1LO0H 2ADIA 3JWOH 5KBNC 3O3BA 4X6FA 3MLRL 4QRRA 1U41A 1J1OL 2H6PA 4JZOB 3WUWA 1LEKA 1G9NC 1OAXH 5DJDA 4BFGA 3H8NA 1XGRB 1FC1A 2F19L 4YK4B 3VFWA 1HH6A 1AY1H 2H3NA 4CADA 1TVBB 3MNZA 2QL1A 5D71H 1YYMH 2X4UB 2YEZA 1NEZB 3RTQB 1SVCP 1DBKL 1WFTA 4E5XA 2CDGA 4P59H 4L8DA 2JCCB 3RHWK 2JIXA 4F33B 1CK0L 5EZLB 4XVUC 3QIBC 3ZT6A 4HLJA 4N8VG 3VXUB 3L3JA 1R24B 1FZKB 1DANT 1BQSA 4O4YL 5CUSH 5CEZH 2DQDL 4D0DA 2Z35B 3KPTA 4Z7WB 4U6HB 4OZHE 2NY3B 2DQJL 1FH5L 2DMBA 4ETYA 2YRPA 4P46D 3L6FB 4RGOH 4OF7A 3WLBB 1OD7A 3ARSA 3QUXD 3L1OL 3IU3A 4V1DD 5GISL 4F7EA 5BRZE 5DUML 4U3XA 3ARBD 4KI5D 4L29A 4HQQL 1T1WB 1WF5A 2HLAA 4OQTA 3X11A 4HCRL 1IQWH 5HDOA 4QRPD 3O0RL 5I1AA 4UNUA 3ZDZE 4V1DE 3U2SB 2PR4L 1CICA 3FT2A 1K2DB 1TITA 3KPPB 5EDXA 4D9QD 4KI5E 2Z92B 5HPMA 3NIGE 4TSCH 4P23B 2BVEA 1KN2H 3HA0A 5E94B 1P4LB 4DZBA 2YPVH 3FN0L 3HLAA 3MREB 1PFCA 4JO4H 5KSAB 4OLZH 2NTFA 1RY7B 1UWGH 1T7ZA 2D03L 2SEBA 3SDCA 3VDCA 3D25B 4ONFH 5FYKU 4LLQA 2VERN 2VLRB 3HE6C 5GGVL 1B90A 1XIWD 1I4FB 3NMEA 1MPAH 4FQXC 4JJHA 4AIOA 4WW2F 1CFSA 3MO1B 1AD0B 2V9RA 1RK1A 4LCWA 4RFNC 4YH6A 1C5DA 1JNLL 2I07B 4IDLA 1I75A 1OF2B 4GT7A 4DW2H 1L0QA 1TJHH 4I4WA 4PJEF 3EOYG 4LLUB 5F7WC 3D0LA 5FM5M 2J6EH 4FQHB 4X4MA 2P8PB 3QEHB 1A6WH 1QUNA 3QEGH 3PWLB 4XNUH 2B0SL 3THML 4MDJB 1DTUA 3IDGA 4PJBB 5JXAL 3P77A 4EOWL 1A1OA 4X8XA 5JW3H 3S4SB 3QXAA 4UT9L 2IGFH 3DURB 4LRNL 3P4MA 3AB0B 5E03A 1BGXH 4EN3B 5HYJD 2XQYK 2OJZH 4J8RB 5DRNB 2VMFA 2Y7QA 4KZEL 2VC2H 3HR5B 1TPXC 4UTAH 3OKKB 5F21B 1RJLA 4BH7A 1CFTB 3CFBA 5D6DC 1KTLA 4CBPA 4K23L 4CNIB 4PTUA 5HGBB 2DL9A 2VXSL 2VL5B 2ZCLL 1PLGL 4IRJB 4GKNB 4MDIB 5KVDH 1W0WB 2VLJA 2AJSH 3EJZD 3I85A 4JO2L 1MCPH 1NBVL 4JDZA 1ONQA 2FJGB 5HHOD 2E7CA 3AAZA 4RAVB 5GJTH 2PXYB 3IKKA 2J8HA 4G9FA 4WI6A 2OTUB 5DMIL 4ODTL 2JJUA 3NTCL 4RGND 1E6OL 1KCVH 5C08B 2WSKA 4ZFOA 5CBEB 2VXQH 3C5ZC 3DO3A 4YO0A 1D7FA 4YDIL 4QWWD 4LARH 3VDAA 1I8LC 3ES6B 2YN5A 3CFDB 3HMXL 1FL6B 2JK5A 4H0HB 3QUMA 1U3HB 3HNSL 3OGCB 3HZVB 4FG6C 3RWJB 1A7OH 5D2LB 4LASH 2J4WL 2LFGA 25C8L 4X7SL 2O5ZH 4ZFFA 1U95A 5L8LB 2Z8RA 3G6AB 2QQLL 1NCBL 1F6AA 4I2XA 1B0RA 5C0GA 4LGRB 2ESVD 3O11A 3V95A 3T0VA 3LMJH 4NQVB 3QI9D 3BP5B 1MHPL 3H7LA 5CEYA 3C9NA 4JKKA 2LU3A 4JRYD 5J1SC 4LSPH 5E2VH 3I9GL 4KVNL 3OHXA 4G7YL 4HBCL 2ZP0T 4UQ2B 5SV3A 4JRWA 4L1HA 4L8SA 2EEBA 1PEWA 4IS6B 4PRIA 1P1ZB 4NC1E 3F7QA 1HH9B 4B0MM 4EDWH 1WGOA 3GM8A 4PTTA 1DANU 3ZE1E 4WO4D 4Y2DC 2AP2A 4GFTB 4JRYE 1YMMB 3NFPB 5ID0B 1QO3A 4NRXA 2DYPB 1DBML 2R1XA 5E8OA 4JREB 1R3IL 2ICWA 3WS3A 3F7VA 5DJZA 4FQPA 5DZNA 1MHCA 1AXSB 5JIHA 3H42L 2EXWD 2ZUYA 2P7TA 3O9WC 3O6FA 5FA3B 2G5BA 3E3QE 3PIQA 1U0QA 5JMRA 4YHPB 1L0XA 4NJ9L 1IZKA 4UU9A 3IAPA 4HIEA 1HILB 1WUNT 5F1NB 4AH2B 5ANMB 3MXWL 1JF1A 3V0WL 2XI9A 4GBXA 2ERJB 3WS6C 1P7HL 4G42A 3MBEC 4F7CA 2J5LB 3V4PL 1L7IH 1P5UA 2C1PA 2XTJC 1OB1B 2XN9E 5T5NF 1G0YR 4ODVL 3ISWA 5DURB 1HN1A 3TO2A 5F88B 3MJ7A 4HXAL 2GJ6A 3RNQA 3BPLB 4PGJA 4L8BB 1KB5B 1EHLH 3QEQA 3BQUD 4OIIH 5ACLA 2DM3A 1A4JB 2LE9A 5FIEA 3QQ9C 3RWCA 2EIDA 2EDXA 5FA4A 3GJFA 5IT2H 1BZ9B 4XP5L 2BP3A 4KUCF 5C9JB 1F2QA 7FABL 4P3DA 3LQZA 4S1QL 1H3TA 1S7WB 1EAJA 2YSSA 4YDVA 4FQCH 1PKQE 4ZSOA 15C8L 3G5VA 4WFGE 3PQYB 1CFNA 3OKDB 2QKIA 4YC2C 1IZJA 2R69H 5EIIB 2UUDH 4U49A 5MI0C 3ARFC 2VYRE 4DOHB 1MRCL 4QXUH 5IB2A 1INQB 3VXMB 1EJOL 5F7DB 1TQCB 1IEBB 3KPRD 5IM7B 1IQDA 3BZFB 5A16B 5IHLB 3DNKA 4LCCB 3DVGA 3WSQL 5EBGA 1H15B 5A2IH 4P5KA 1KNOA 4POZC 5I19L 1CFVH 4R2GD 2VDOL 4NQEA 3SGEH 4Z5RA 3QO1B 2WIIA 3OPZH 2ORBH 3FB8A 5HHQB 4HK0A 3NFNA 2VIRB 3LD8B 3KPRE 4XCNB 4EBQH 5DHXB 4Y16A 3WEXB 1E4WL 2JB5L 3STLA 1K5NB 1JTOA 2CXGA 4JN2B 3N1PC 2D4DA 5B8CA 2IAND 1J5OL 4U1GC 1MOEA 3I2CH 4X0KB 4F15B 4QYOA 5E99H 4XHQA 3EDDA 5KAQF 5F44A 2JLLA 1OGTB 4J3OC 3EOAB 2DM7A 8CGTA 2FB4H 4Z0BH 5EULV 5EUOA 4G6ML 4PYHA 1NGWA 5SWQB 3IJYB 2IANE 4DK3A 3TWCH 4HIIA 5MERA 3V2AR 2Z91A 1HOCB 1VGKB 2OCFD 3MCKB 1P7QA 3SE8H 1MCIA 3MRRA 3AS1A 3MA7B 4JJ5A 4WTZA 1PD6A 3F7YB 1NGPH 3CFCH 4GRLA 5IKCA 2UVFA 4BFBD 4L5FL 4LGSB 3GSNB 4M8QB 4JM2A 4L3EE 1Q72H 3TVMD 2XKNB 2X4PB 1HSAB 4G6JL 4UOW1 4JG1L 5TQ0H 3HS0A 3A6BL 3ABZA 5IB3B 1GZQB 1CI5A 1IGML 3HRPA 5CD3B 5HD8C 2X4OA 3GJEA 1MFCH 4ELMF 4YHML 2PCPB 3KPOB 5D7JC 1ZANH 4OGZA 1YEJL 2NZ9D 5MEOA 2XQYG 1HE7A 2AJXH 4D9LH 4X6CB 2P5WD 5F7UA 3RWDB 2J8UF 3RBGA 3VWKB 4U7KA 4Z7NE 1FBIH 1DDHB 4ELKA 2WBJB 4Z7OE 2QHRH 1VB9A 3U1SL 3JWDL 1FAKT 4NO3B 4HEME 4L4VE 3SE3C 4YBLB 5CMAB 5AD0A 4NYLA 4K71B 4B5EA 4XC3L 5D8JL 4LIQH 4OUUB 4P57A 1U93A 3RAJH 2AXGB 5FYJU 2Z8VC 2R1YB 4KJPC 2UZYB 3BVNB 2GK0B 5C92A 1F3JA 5C3LD 5HI4C 2DQUH 1T0NA 1H5BA 3KAAA 1LK2B 4I8DA 3B4NA 1BJ1J 3V8CA 4WW2C 3HCVB 3UTQA 1U8QA 3O2VL 3B9KC 4M6OL 2ZCHH 4ELME 3KLAB 4PD4K 4FQQB 1DN0A 2NX5D 3MCLH 5FYKL 4M9PA 1R0AH 2ADFL 3O4LD 3DRQA 3DROB 2X7LB 1UM6H 2P47B 2GITB 2YMXH 2CJUH 2J8UE 2XQBL 5IMOA 3HZMB 1NDGA 5L8KB 3LN4B 1UVQB 4LRIA 2J7LA 3LEVH 3RWGB 4S11A 4YAQB 3IAGC 1BOGA 3EO9L 3MRFA 4IJ3B 3NPSC 1A6UH 2GFBA 2WBKA 1FFQA 1MCFA 2ADJA 4JFEE 5DDHB 4GRWE 5EU7E 3MV11 2E5EA 2EYRB 1QFWM 1HNFA 4MGXA 4RFEA 3B5HA 3BZDA 1F90H 3ZZ1A 5KVMC 4P2OD 2C3XA 1I7RA 2GT9B 5CJBA 1KV3A 2UWEF 2ZSVA 1UKSA 4P46A 4K3DH 3SE4A 3GSVB 4KRMB 3QUXA 4R26L 3OAUH 4WHDA 2E27L 5DJYA 1GGIH 4V1DA 3GGWB 1SY6H 1IBGL 4DUXA 3ARBA 3HZKB 4RCAA 5HGGS 3T77B 3PGFH 5FM5O 3OV6A 4G8GE 3MUJA 1CZ8H 4X5XA 3FZUC 5K33A