4G6KH

Crystal structure of the therapeutic antibody binding fragment of gevokizumab in its unbound state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
QVQLQESGPGLVKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDGDESYNPSLKSRLTISKDTSKNQVSLKITSVTAADTAVYFCARNRYDPPWFVDWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords heavy chain of gevokizumab antibody binding fragment
publication title One target-two different binding modes: Structural insights into gevokizumab and canakinumab interactions to interleukin-1beta
pubmed doi rcsb
source organism Homo sapiens, mus musculus
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g6kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g6kH01
4MZ2A 4HIXH 4RGNE 4X7TA 1XGQA 2GHWB 3IB4A 3D69B 1U6AH 3TBSA 1ACYL 3NMEA 2JK5B 3KLHC 5E2UH 3EO9L 1JTPA 3L7FB 4OTXL 5HI4D 2ATKA 1E0OB 5DJXB 4QGYA 5AWNL 2HT2C 3WJJC 5KVFL 2CGRH 3ZYJA 5KSAB 1MCNA 1M7IA 2FJHB 4K8RL 3D39A 1OGAE 2H8PB 1YA5A 3CVIH 3G5ZB 1U2CA 4PJDA 1L6XA 4WNQA 15C8L 3CFKA 1G9ML 5JOPE 5FYJE 4LMQE 1OAXH 4HIJB 4R2GB 3MLTB 4KTEH 1JWMB 1VACA 3EJYD 3CH8A 2NXZD 3BN3B 1KACB 1MCLA 1B2WH 4DCQA 2A6DB 3G6AA 2X1XR 1C5DA 2YXFA 1JPTL 1TZIB 3MROA 5JIKA 3MRGB 2E7LC 1F3DJ 1MREL 3VXMD 3CNKA 1FNSL 1DQJA 1RSFA 3WIHL 3OKMB 5CJXC 3HZMB 1MY7A 1V3KA 2A74B 1AHWA 3MXWL 4NO0A 4NT6A 3G5XA 2V5YA 3U48A 3UTZB 3S34L 3QP3A 1RUAL 2CUMA 4KKBD 1KV3A 5FXCH 1D6EB 4KUZL 5A16B 5D2NB 3IDGA 3DI3B 5IR1A 4HHAA 1H15A 2WBJC 4YXKH 3U46B 3U7WH 3QRGL 1QSEA 2W38A 3BIBX 2AEQH 5CJQH 1A7NH 4OKVA 4PG9A 2GAZA 1QTYT 3VA2C 3E6HB 1BD2E 2NMSA 3X13B 3I02A 3RZCD 2DD8H 5H35B 3GI9H 4JRXB 5FYKD 1CU4L 3HB3D 4XPTL 4RAVA 1NDGA 1NC2A 4PRHE 5CHNA 1CN4A 5F8QC 1NCUA 5SX4I 5CKAA 5J57B 4LCWA 2OJZH 3MFFB 4IDLA 4PGBA 4WUUE 4XCNA 2FGZA 4L4VB 4Y4KA 3VFRB 4Z7NF 1TPXC 3PHOA 3MCG1 3BQUC 1CFSA 4KRLB 1U93A 1JF5A 4OF5A 4ZTOL 3SCMC 1B88A 2BY1A 3R8BB 4OCWH 3PWPE 4NRYB 3HE7D 4F33A 4OIBA 4ONGL 4X0KA 3MFGB 5IFHH 3WFHB 1E4XI 1NGZB 5C0GA 3Q48A 1I85C 4QYOA 5DJ2A 3PP3K 4QHKJ 2VYRE 4JREC 4LCCA 1N0LA 5K33A 3VXNB 5DUBA 1XGPB 1MCOL 1RIVH 4PJFB 5CD3B 3ZKND 3DO7B 5D7LB 2VDOH 1VKXB 2DQJL 5IVZA 3TFKD 2ARWA 4JRYB 4Y4KC 5J9PA 3T0EA 1KELL 4PGEB 1MAKA 1DBJH 4NUJA 1FYHB 2IQ9H 1IAIH 1PQZA 3T4AB 2R23A 4TN9A 5KJRH 2C26A 1ZLUK 3TLRA 3ARQA 2OLDA 5F9DC 2NY2C 4X4ZA 1I4FB 4W4OC 1JZ8A 2GK2A 1BZ9B 4JDTL 5MI0B 1MI5E 5M7QA 1WFTA 4NQXA 5AYUH 1RMFH 1DQML 5GS2D 4P46B 1QEWB 4F7MB 4POZD 2DJ4A 3CJJA 5I1CH 1I1YA 1RPQA 5GS0C 1KTLB 3JWDH 3EO1B 5CINL 3JV5A 5HGBA 1SEBB 3L3KB 4LDOB 4NNXB 1MAMH 2H1PL 4N9GA 2BXYA 1G7QA 4IOFD 4LPUA 3UYRL 3TBYA 2RFXA 3ELAT 3O0RL 5CJOH 3T0EC 4J4PA 4X8JA 4MWFA 1KIUA 1P7QA 4YC2B 5E6ID 1OT1A 5AZEH 3PIQA 4LEXL 1PSKH 5D7IB 1R3LA 4YPGA 3FB5B 1JNHB 1D5ZA 3TF7C 2DLGA 1A14H 1S7XB 4JR9L 2IAMB 4U6HA 2EH8L 2PKDA 5DZLA 4H26A 1BF2A 1U3HA 1F58H 4PJ7A 3NAAL 1FN4A 2W0FA 1FGNH 1GGUA 4ZPTB 4G6JH 1A6WL 3FN3A 3MACL 3OXSA 4BQ6A 4A2LA 1N64H 3KPNA 5J8OA 3HMWH 4G7VL 2HKFH 4Z18A 5JIHA 2R2HB 4NQDA 1G7HB 4V1DB 1AQDB 3MRMB 2ZG2A 3TBVB 4GG8B 5FDYA 2YA1A 4FZEL 1YN7B 4JFPB 4WO4A 2DQIL 1YEGL 1F4XL 5F6IB 4M02A 3T8XB 3AREA 1T03H 4YNYB 1KIPB 2FD6H 2B2XH 2M1KA 4HPYL 1QFUH 1AKJB 2IWGA 4YK4C 2ESVB 5KZCD 5KVMC 3S3SA 4FZ8H 1BECA 3UTTB 1KNOA 3K8MA 4NZUH 1JHTB 5HGDA 3DUSA 2A0LC 1UH3A 3D9AH 1DVFA 5FFLA 3LKQA 4S1SL 1FVEA 1R5IB 1PG7H 3BH8A 4QOKD 4HCRH 4OCXH 5IQ7H 3ARPA 1A9BB 4Z7WA 1PLGL 3IXTA 1HKFA 2J6EH 3G04B 3EOTL 3AREC 1JWSA 3N1GC 3QDJD 5IHBA 4HBCL 5F3HA 5CBAA 1KSRA 2DLHA 3G5VA 3A67H 1KJ3L 2ATKB 2YOCA 3AY4A 2ICWB 5CGTA 1UM4L 2KBGA 1M7IB 3D39B 1YNLL 1IJ9A 1A7OL 3QJHA 1R5WB 2XXCB 3QFJA 4XRCB 5KVDL 4WNQB 3E2HC 3ZE2E 4MD0A 2YPVL 1MWAA 3CFKB 1DR9A 1YJDL 3AMLA 5DSCA 5JUEH 3ULSA 4BJLA 2NY0C 3GKWL 3KPOA 1VACB 2DQFA 1JZ4A 1YQVH 4X4YB 3QNZB 1J8HE 4Y4HA 1NJ9A 3U4EA 4DCQB 5E0QA 3G6AB 1SYVA 1TJGH 2MHAA 4JN2B 2ARJQ 4KH2A 2EXWD 1KPUB 35C8H 4QHNB 2DQDL 4JPIA 3IF1A 4KZDL 3F7QA 4HQQL 4RAHA 4HS8L 4QRRE 5CZVL 1JHKH 1I8LA 1AHWB 1KIRA 4C58B 1IKNC 5BS0A 4PRIB 3TT1L 1GHFH 1CR9H 4PV8A 2I5YL 5BRZD 4IRJA 2IADA 5DQDL 3LEVL 2QQKH 2BFVH 3TIDA 3A6CH 3IDGB 5D5MA 5IR1B 4HHAB 1H15B 3V5HB 4PJ5D 3GB7A 5BO1L 5B4MC 1PY4A 4PTUA 4XMLH 1CXKA 5FYLL 5FYJU 2ZCKH 3LMJL 3EYUH 3IGAA 4P2RD 2AK4E 5A3IC 1EBPA 4PRPE 2DQCL 4R8WH 4YHKH 5TE7L 1EZVY 3I02B 2VDQH 1SY6A 1WZLA 1I8MB 2UWEF 4RAVB 1NDGB 4YAQB 1LEGB 3SE4C 1FNGB 1NC2B 3EOAB 5CHNB 4R4FH 5DF0A 5K59E 5KN5A 4IOIA 1A3QA 4LCWB 1KLGA 4M93C 3X11A 2MKLC 4KPHL 3TC9A 3PHOB 4PY7B 5I18L 1EO8H 1U93B 4YFLI 5I1KH 5FCUL 1NMBH 4ZMAT 5J12C 1UC6A 5D7SH 4KXZI 1MCPH 5C0GB 3S97C 1S7SA 5CJBA 4LPWA 1MJ7H 5GHWL 4NC1E 4QYOB 1JV5B 5EDXA 4U7MA 2VABA 4UQ3A 3O4OB 1J0HA 3F58L 4LCCB 1RK1A 5GSVA 5IV2A 5IROA 1VERA 5GRUL 3MRBB 1FL5A 2Q3ZA 5D1XD 4GLRH 4GRWB 2W1NA 1SVZA 1HIMH 1XIWD 2XKSA 1H8OA 3GMQA 1RIUL 4PJCA 5F7DA 5IVZB 4G7YL 5J9PB 4ZUVB 2OM5A 1S3KL 3DSFL 5IUSA 1NCWL 4N5ED 5T33H 1BAFL 3HC3H 2IFFL 3FO2B 4P9HH 3S36H 3F12A 3FFCE 4P2QB 1CTNA 1TIUA 4GRLC 3WXWH 5FYKH 4QCIA 3RX5A 3DUHA 3Q5OA 4JO1H 4UIMA 3VXSD 1I1YB 1H3WM 1OAYL 1KJMA 3HAEB 3L7EB 5IF0B 1IC5L 1XGYL 4Y16D 1W0WA 3RKDD 5HGBB 5I74B 5HDLA 2MOVA 1KT2A 3LPGA 1MWAL 4JY5L 2BVTA 5DVMA 1LDSA 1NGXA 1X5ZA 1YC7A 5AG8A 3VXRE 2OSLA 4OIAA 1FLTX 2XA8H 3VG0H 3JWOL 2H26A 5H94A 5IHUH 3BD3A 1A7PH 4X8JB 5EZLA 1Q9KA 1TENA 4NQVA 4Z7UE 1CE6B 3PIQB 3LSOA 2EO1A 4UT7L 3BE1L 4LQFH 1R3LB 4YPGB 1GGIH 2FZ3B 4F9LA 4PBXA 1TCMA 5L7XL 1SBBA 4WHDA 3HAEG 1U3HB 4TVPE 4PJ7B 4XNZB 2W0FB 1OM3L 1OF2A 1I1RA 2O5ZH 3OXSB 1T4KB 3PHQA 1NMAH 4X6DF 1HHJB 3KPNB 2FIRT 3BW9A 3IJYA 2YRPA 5ALBL 4HS6B 1ZA6A 3QEQB 3HCVA 1PKQB 1JGEA 4F9PC 5EO0A 4PJIA 2PXYD 2NW3A 1JYNA 1LP9B 2GSIA 4U1LA 4M48L 4WO4B 2H2PC 3QIWC 1E4WH 3MV8E 3QCUL 5GS2H 3OKNA 1HHIB 3X12B 2HKHL 1NBVL 5DC9B 1SY6L 3H9SD 1B6DA 2GY5A 2UVFA 1PW3A 2IC2A 4UV4H 5EOCJ 1ZLSH 5CILL 1KCLA 1ORSA 3V4UL 5KAQF 4R6UA 3DUSB 3FO1B 5EULV 5HGDB 5C0CB 3QIUC 1NFDA 3QJFA 1U8IB 3LKQB 1KXTB 3I84A 2P46B 1ADQH 2YEZA 3QH3B 5HYJB 5JXAL 3O3DA 1Q8MA 1UWEL 2BCKA 1NBQA 4KTDH 4NQEE 5B3JE 5F9WB 3T09A 1EA9C 1NLBH 4LHUB 1MQ8A 3V4PH 4LSRL 3EKCA 1KCRL 1K2DB 1A6ZA 4P9ML 3K2UL 3B9KB 4PV9A 5TDNA 5BZDB 1BREA 2XPGA 4CN6A 1Q1JL 5C8JA 3O11A 4ZOCA 2FIKA 4QRPD 4FXKA 1MF2L 5F21B 4MZ3A 1FQ9C 5DQJA 3QJHB 3FOMA 3EJZC 5FGBA 5C3LD 6FABL 1PZUB 4H88L 2AJYH 3KDMA 1LD9A 1E6JL 3EYOA 1KFAH 3ULSB 4WEUD 1MPAL 1MUJB 5I15H 3KPOB 2JJTC 2DQFB 4YHZL 4LHUG 1XR9A 2E9IA 2IPKB 1HQ4A 1KC5H 1NJ9B 3U4EB 2Q6WA 1NDMA 3SKJL 1IAMA 4MB3A 3U2SA 1SYVB 3UJTH 5ID0A 1FJ1A 5DS8B 3BRDA 3WFBL 4PJBF 4I18C 3IF1B 5E94A 2W0PA 1IE5A 1DL7H 1QFOA 3QDMA 3LY6A 5KBNC 3SJVD 4IHOA 2MWCA 1CL7H 2CLVB 5GGQL 4YDIL 3MRFA 5EFIA 4I0PA 4GRLD 4DOHB 2JCCF 3BJ91 3BEVA 5I75B 3UTPE 4JLRA 5IB4B 2F15A 4LLDA 2IADB 3W11C 1YEEL 1OSPL 1AC0A 3CLFH 4Y4FB 5IP4A 1S7UB 5MERA 5T1KA 3RVXC 3GJFB 5C09A 4BSVA 5GPRA 3GB7B 4Y2DD 4NKQB 1J10A 4HH8A 4X6EA 4KDVA 1P7HL 1DEEA 2DTSA 4G6AC 5I1LB 4NUGH 3HE6D 4X7DC 4X6FA 2LQRA 3IXAA 5L2KE 4U0RB 1MFCH 2AXGA 3RDTD 1ZMYA 1TQBB 1NGYB 1WGOA 3DROA 1AGBB 2PW1B 4AL8L 3RY6C 5KN5B 5EORH 4Q97A 4PLJD 1KLGB 4M1DH 5AEAA 2OR9H 5CLTA 3SKOA 3C08L 4I0PC 4LRNL 1FVCA 3MLWL 3QO0A 4HIXL 1OTSD 5FO7A 4MQTB 1U6AL 3QQ9C 3BP4B 5E2UL 3RKPA 3H7BB 4X9FA 4DVBA 1GC1H 1M6OB 2BVQA 5L0QC 3O6ML 4BYHA 2ADFH 1T0MB 3UBXA 2LAGB 2CGRL 4RFEA 2CRMA 2Y06L 3MBEA 3OGCA 4X9HA 4DUXA 3CVIL 5F3BA 2VABB 4UQ3B 3F7RA 4MA1B 4NZTH 5SWSB 4U6VL 4IRSA 1RK1B 4HMDA 3PP4H 3QIWD 3BUTA 1OAXL 1FL5B 2P44B 3MLVH 5D9SB 2ITDB 5MENA 2VZOA 3H0TA 2WIMA 3BSZH 5HPOA 4PJCB 4DQOH 5D7LE 3BX7C 3WNOA 1UWXK 4R0LA 1FV1B 4BFGA 4ZXBA 2HRPH 1N3NA 1Z9MA 3IT8D 2HT4D 3F12B 4DJMA 2I26N 1WZMA 3CFEA 2WANA 3LKNA 1C5BH 3QIUD 4K3DH 5IVXE 1A47A 3KXFB 4L8BB 4XBEH 5TF1L 4QCIB 2VISB 5AZ2L 3DGCR 3L3OA 4EN3B 3BRFA 3DGGA 3TWCH 5J7CC 1II4E 2P8PB 1OT2A 1C5CL 5J11B 4QRTA 4ZO8A 3VU2A 4L8SC 2ZUXA 2H26B 3GSRA 2IEPA 3CH1A 4O51A 4M7JH 1FO0L 2OQJA 5EZLB 1Q9KB 4NQVB 4DKFH 5CJQL 3LSOB 3GEWB 4LKCA 4U6XA 3PWJB 2DD8L 4PJ8D 5ERWB 3H3BC 2NY4B 2K9UA 4G3YL 2HYMA 3Q5TA 5ANME 4BUGA 1CFNA 5C2UB 2XTJC 2RCSH 4CBPA 2VXTH 4HWZA 4P5KA 1MLBB 2OJZL 1Q38A 2HT3C 4TSCL 3BW9B 4EQ3A 2WWKT 3IJYB 5EN2A 1LE5A 1KCVH 3QIBC 4HCRA 4FTVA 4NQCA 5JXED 5EZOH 3HCVB 1JGEB 4OCWL 5BW7C 5EO0B 4GAJL 4PJIB 4YXHH 2J6EA 2DAVA 2GSIB 5ACLA 2I07A 5C0IB 4UV7L 4QXTA 4K7FA 3RTQB 3BZEA 3VWKD 1GGCH 3MLYH 1G7JA 3HUJA 2ED8A 2D3VA 2AQ1A 5KVGH 1ZSDA 1WISA 3EYQD 5E1AA 3HR6A 4MDIB 1TCRA 5C0BB 2VDOL 4JO4H 2R1YA 1RZFL 1DBJL 2VO5A 4O9HH 2IQ9L 1IAIL 3QEUA 3H6JA 3QJFB 3KJ4B 4F37F 4P3CH 2D0HA 4G8GB 5JR1H 4JFED 4LCIH 2G5RA 3ZT7A 5E9DD 2C3VB 3O3DB 4N0RA 3TBWB 2BCKB 1FSKB 3PP3H 2IMNA 2X42A 4MNQE 5AYUL 1RMFL 2O5XH 1TMCB 5I1CL 3PDGA 3H3PH 2L4OA 1WZ1H 3A6OA 3MRCA 5GGVY 3JWDL 2IQAA 3N1MC 4N1HB 4PV9B 1DQQB 1I9IH 5GJSH 2OZ4L 5HYEA 1QR1B 3LH2H 2D7PA 2FIKB 3QQ9D 1L4IA 4OF6A 1IGJA 1OW0A 5C86A 4D9QD 3ARFD 1ZGLA 4UOJA 1NANH 4UI2A 4Z76A 2W91A 4HUNB 1KTDB 4PBWD 5KANI 1UJ3C 2ICWI 2YK1H 4PJDE 3FZUC 3EYOB 3IYLW 4WTWA 2J2ZA 2FEDC 1NPUA 4WWKC 5LBSH 2EDLA 1A14L 3H9HA 4JY6B 2C7UB 1FO0B 2B7DT 4L1HA 2GJJA 2Q6WB 1JZ6A 1NDMB 1X9QA 1FGNL 1OP9A 5ID0B 4G6JL 5HHME 3TYFA 5EO9B 3MV9E 3OKOA 2OMBA 3GK8H 4WU7A 1N64L 3C09B 1N5YH 5E94B 1HH6A 3HMWL 2HKFL 5I1JH 2OK0H 4OZIF 3H42H 5L88H 3QI9B 2A2QT 3TNMB 3QDMB 4XBPA 1OAQL 5JO5B 1MCWM 5BV7L 1NAML 3MRFB 5C2BL 4LSUL 1KN4H 2ERJC 1F4WL 4JLRB 2EC9U 2AJ3B 1IKFH 1T03L 3BN9C 2WSKA 3GBML 1FE8H 1IAOA 2YD6A 4UOW0 4OSUL 1QFUL 1PKOA 4RA3A 1DDHA 2NY1B 4F7CB 4X6EB 4NPYB 4AG4H 1DEEB 4NZRH 5DD1L 1QSEE 5DR5H 3I3DA 4FZ8L 5ELIA 4NZUL 5C07B 2CQVA 4OIIH 1CLZH 2NXYD 3D9AL 4LNRA 4PB0L 5EC2B 4PGDB 4G9FD 4Y1AD 3SE3A 1ZT1A 5DD5H 5T1MA 3HC4L 2DQHH 1IQWL 2R0KH 2PNDA 4B5EA 4HCRL 4YBQD 4BZ1H 5IQ7L 1N5AA 3VI3E 3L3IA 2MQ3A 2GFBA 3G6DH 4DWHA 1FVCB 1M71A 1XH3B 3QB7C 2J6EL 5HDBE 5TE4L 2IG2H 4IRZH 4PJGB 2KPNA 3RWGA 3N0PB 5HHXL 1W2KT 2YPLD 5I8KH 3RZCA 1GIGH 1AC6A 5IQ9B 5LGKA 12E8H 1KIQB 2DBLH 4PIRF 4MB5A 3A67L 4DVBB 3D85A 3R4DA 1W0VA 4FHBD 1WSST 4RZCA 1NLDL 4JM2A 4ZS6C 4RFEB 3MBEB 1AGCA 2XWTA 3OGCB 4YXLH 1H8SA 3ZKXB 2A6KB 5F3BB 5F1IA 5FM4A 5HYIA 4IRSB 4Z7OE 3NBNA 1ZA3A 5I9QC 3KG5A 4UNTA 3ILPB 4NCC1 4FXGA 3FQTA 3BRGC 1BPVA 3HE7A 2HFFA 1CYGA 1EEYA 3T0EE 1EO7A 1JUFA 3TO4C 4ZXBB 3MRNA 3QNXB 1GGBH 5GRVL 4DZBB 4U1JA 1QSVA 1TJGL 3DX8A 2C3HA 1SEQL 3CSGA 4GW1B 4YEFA 35C8L 4ISVA 1F2QA 1B90A 2C3XA 3UPRA 5KSUA 3V8CA 4HF5H 3MO1B 4JM2C 2YD3A 4OZHB 1JHKL 3W5NA 1IBGH 4GG6A 1IC1A 3L3OB 3BPOB 4NQSA 3KJ6H 2VDLH 5GS3A 1GHFL 1KCSH 1CR9L 3TM6A 3EYFB 2IGFH 1QLRA 3NPSB 1PBYA 1CGSH 2BFVL 4Z7QF 5BV7B 1NAMB 1CDYA 4L3EB 5BJTA 5D1QD 3D25A 3TBTB 3CH1B 2VLRD 4XMLL 2OQJB 4G8IB 4PJEF 4WW2F 1T21B 3EYUL 3L1OH 2DKMA 4U6XB 3UDWC 4S1QH 2X4SA 5EZIL 2MPAH 1A8JH 5E2JA 3R0MA 1EVTC 1G7PA 5FYLE 1CFNB 3SGJA 3RPIA 4R4FL 1EJ6A 5CCKH 5BOPA 1OP5K 4HIIB 1QA9A 1ADQA 3SGKC 5EN2B 2Q8AL 4X98B 5JNYB 4AK1A 4FTVB 4NQCB 5I1KL 4MVBD 4NQDE 1MCBA 1NMBL 2V17H 4X5XA 1NBZA 4KRPC 4QXTB 1MCPL 3CFDB 4U1MB 2VLKB 4KZEH 1QRKA 3NH7H 1CXLA 3L5HA 4F8TA 4LRIA 1G7JB 1VGKA 4WFGD 4Q6YA 5D2LA 1KTRL 1DBMH 2YA2A 5JZ7D 1ZSDB 3HPLB 3NIDE 3DYMA 5EU6B 4P2OD 4LFHD 2EIZA 3CMOH 4OCLC 3WYRA 2R1YB 1AO7D 1AR1D 3MLZL 3QEUB 2CPCA 4LSSH 5T33L 3TZVA 3HC3L 1RZGB 2J8UA 5HI3C 1U0QA 4HZAA 4OJFH 1FFNA 2N4IA 4U49A 3T65A 2CIIA 5FYKL 4Z7WE 3S5LA 3FB8A 4ZPVA 4JKMA 1RJZB 2ZUWA 3EGSB 3MRCB 4LMQI 5E1HB 2IQAB 4TUJA 1FZJB 4O2FA 3VFSA 3ZZ1A 2LAAA 2APTA 2ADJA 2J5LC 4ZUTB 4BQCA 3SOBL 3HZVB 1IGJB 3VG0L 3TPKA 1LK3H 1ZGLB 3FQWB 4Z76B 4LLWA 4R97C 4LCYA 3AGVA 4JZJA 3MOBH 4ZNEA 1LEKA 3QFJE 4RGOH 5C0AD 1YMMD 3WIFB 1ZT4B 3SGEI 2A6IA 1GGIL 2HMIC 3J7HA 3QDJA 3B6SB 3BHBA 4UT9H 2UV3A 3CDCA 1TZGH 4RFNC 3WSQH 4HGWA 1LO4H 3O8XB 3O9WB 3ARVA 1IM9B 4R7NA 1DE4B 3TYFB 3OKOB 3E8UH 2O5ZL 1M1SA 4WU7B 1DFBL 4LU5H 4M6ML 3G5YA 1HH6B 2ADGA 3MZTA 2Y36H 1KXQE 2ZSWB 2VDRL 1X5KA 2VWEE 1I7UA 3ULVF 4NJ9H 4OZFG 3QWOA 3KAAA 2F8XC 5B8CC 1CVRA 2QKIA 2NXZB 4MMZC 3DI2B 5BS0E 2XG4A 5DC4B 1E4WL 3HI5H 3LQAH 3GMOB 4HWNA 2HVJA 1RZJH 3LD8B 3Q6GH 3TGXA 2LFGA 4YFLF 4H0IA 5D5ME 2H41A 4HH9A 1JP5A 3VXMB 3RNKA 3CLEH 2N7BA 1VA9A 3RRQA 2WBKA 4J3VA 1ZLSL 2Q7YA 3NCYP 1S8DB 2V7HB 5EUOE 2F74A 5F1KC 2IPUG 1HXMB 1GZQB 2BP3A 4LNRB 1FAIH 5BRZA 5DVNA 1ADQL 3CSPA 2A6JA 4XP1H 5E8EB 2FHFA 8CGTA 4KTDL 3NFSL 2XNAB 1XCTA 3RGVD 1TJHH 4LAJH 1CICB 1QO3B 1LMKA 3QXAA 3RWGB 4AH2A 5A2FA 4GQ9H 1JGDB 3RZCB 1FG9C 2EDBA 3V7AG 4OF3A 4J3XA 3MGTA 2VZSA 1MIEH 5GGRY 5C9JA 1DBAH 3MCLH 2JIXD 3IKCA 4HBQA 1AGCB 2XWTB 4ELME 1B0GB 2VXSH 5ESQB 3ZDYF 1UQSA 4QHUB 5F1IB 3O81A 2XYCA 4MS8D 3NIFE 4JFFE 2ICCA 1JN6A 1P53A 2AJYL 4J3OC 1KFAL 1ZA3B 1T80A 3NCMA 4PP2A 2JB5H 4N90E 1XCQA 5I15L 1UXSA 3FQTB 2AV7B 3HE7B 5DLMH 2HFFB 1U8KB 4PJ9D 1KC5L 3QQ4B 1EEYB 1XR8A 3JV4B 1JUFB 1MSPA 1F5WA 1FORH 5ACMA 4WJ5A 4U1JB 3DX8B 3UJTL 2MMXA 1H8NA 3FOLA 4P4KC 4ESKA 4LLUA 1BFOA 4NN7C 4YBHA 3UPRB 1TVBA 4M4RA 2NY3C 3Q5YA 5KSUB 3EAKA 4N0UA 5D1XA 3CZFA 2DWEA 4GG6B 1XIWA 2EYRB 1K8DB 4JFOB 1RZKC 5ACZA 3JWNC 5DMYA 5D70H 1KPRB 4N0FA 1MVUA 5KOMC 3W39A 3CLFL 5KW9H 2I60L 2QHRH 3P77A 5TH2A 3MZGB 3PQYE 5MP6H 3BKCH 5BJTB 3D25B 1ES0B 4APQD 5LG1A 1KCKA 3VH8A 5FK9A 4OZGA 3S37H 3VXSA 1QFWI 4EDXA 4M3KB 1UWGH 3LV3A 3V79C 4Y16A 1MFCL 4GS7C 1T7WA 3DPBA 4NRXA 2D4FA 5LWYL 3ECBA 1U8NB 3QUMB 4Q6IC 2I9TA 4M1DL 3MA9H 4WTZA 2OR9L 4K94C 4BELD 2SEBA 3WNPA 3DX7A 1QA9B 5E6IB 4HGMA 4M62H 3MJ7A 2EDEA 2BOCB 5E08H 4MA3B 1HHKA 4JANA 1T0NA 2QQQA 1GC1L 4LDEB 3OR6A 5AAWA 4PJIE 2ADFL 4KHTL 3EDEA 1SVCP 1A6AB 3V6FB 3VRJA 1VGKB 4LASH 4NZTL 1CGWA 1RZIB 2VE6A 4PLOB 2Y5EA 3PP4L 2EKSB 1A6TB 1AD9A 2DL9A 4MJ6B 1V8HA 2EIZB 1QD0A 2BNRA 5EIIB 3W2DH 3BSZL 3KLAA 1MHEA 4DQOL 4HS3A 1SM3L 2PXYA 3RUGE 4TNWK 2QSCH 4UINH 2HRPL 3DURA 1NFDE 1S7VA 2C4FU 2J8UB 4R90H 2OMNA 1FNLA 1IGTA 1TJIH 4EIGB 4CU6A 1IC4H 1FFNB 4M00A 2KH2B 3CFBA 4QO1A 4K3DL 3T65B 2W9LA 2OR8A 4XBEL 3IKKA 3S5LB 3H9SA 3BYYA 1FIGH 3ARYA 3LDBB 4U6TA 2E3VA 3DVIA 3TWCL 1QG3A 1FGVL 1K85A 4O2FB 4Z0XA 1UWXH 2ADJB 3SKNA 1PYWA 3CD4A 3SHSA 4QOKB 4HK0A 4M8QA 1BLNB 2BY3A 1LK2A 4TSBL 4M7JL 3BISA 3QPQD 3U6RB 4JZJB 3ULVD 1LEKB 3O6LH 1F13A 4QKXB 3QA3A 3QDJB 3S5LG 3PWVA 3BHBB 3KYNB 3O3UN 3MMEA 1SMAA 2Z31C 3BQUB 3UAJC 2VKWA 1EXUA 2VXTL 5C0DA 4YHYB 3SCMB 4QRPA 2E27L 4DKAA 3PL6D 4R7NB 4KK5D 5DEGB 3P0YH 2UZXB 5B22A 5L9DL 2GCYA 5IBTH 3BKMH 1OGTB 3BVNA 2ADGB 5D7JC 4KRMB 5EZOL 1I7UB 4RMTA 5HVFB 1WIOA 4JREB 3QWOB 2QKIB 3U7YL 4O00A 4ODWB 1GGCL 3MLYL 4HW6A 4Y5YA 5FHAH 1E27A 1KGCE 2ZOKA 5KVGL 3STZA 4XWOD 5GIRB 2MFNA 5BQ7A 3M07A 5C09E 3RNKB 5FIEA 1FP5A 2Q8BH 2ENSA 2UWEA 4TSAL 1F3JA 5HGAA 3T04D 3SJVA 2F74B 4H8WC 4O9HL 2X4RA 4ERSH 3JV6B 4ODXB 4B7IA 1N26A 4XX1G 4OFYD 4ZTPH 4P3CL 4NKOA 5JR1L 3QYCA 5CS7A 3DMMD 4L29A 5EBMA 2A6JB 1P9MA 4LCIL 3C8HA 3MRPA 1GPOH 2HLFD 2BZDA 2XZQL 1ZXQA 1XGUA 2IAND 5SX4H 4EVNA 3KPSB 4PG2C 4PJ5B 4Y2DA 3QT2A 1DTUA 2O5XL 5CIPH 3UX9B 2WBWB 4P2RB 3QXAB 2HTKD 3H3PL 1OTTD 1WZ1L 3HE6A 2DTMH 1VEPA 4I3SH 2OCFD 5I6XC 3RDTA 3IU4L 5GJSL 2HLAB 3T2PA 2YC1A 3EZ8A 2B5IC 2VMFA 1BVLA 2HA1A 1ZHLB 4BKLB 1UQSB 3GSOB 2H32H 4IBLT 3MODH 4JG1L 2YK1L 1JN6B 4PJHE 3ZKQD 4U4BA 4YHOH 4PP2B 1HHGA 2EDOA 1XCQB 5LBSL 4ORGA 3MUZ1 2BSED 2LTQC 5MENE 2CDFA 4JG0H 1XR8B 5EH1A 3HRZB 4WJ5B 2XY2A 1IL1A 3QHFL 2V2WA 3GK8L 4XNXL 4OZ4A 5DJYA 3ROLB 3W0WD 2HJKB 5I1JL 2OK0L 1Z6JT 3H42L 3H9ZA 5DK0B 2OTWA 5D1XB 2XTJE 4KJWC 3CZFB 2DWEB 3V52H 4IS6B 1XIWB 3KYKH 3BDYH 4NO2A 4IJ3B 1BZQK 3WFEH 1KN4L 5DD0H 1QKZH 1JI2A 1Q0XL 5EU3A 4BZYA 1IKFL 2PYED 5IHLB 3QUKA 4NSKA 1BEYH 3REVB 3P77B 5TH2B 5GJTH 4OQTL 2Z92A 1I1FA 1U36A 1EIBA 1W0YT 5TDPB 3V0WH 4CN4A 4AG4L 4NZRL 3NGBB 5DR5L 1ZANH 3GSNB 4ZAKD 3VXSB 3LV3B 1UZ6E 4P23D 3ZHKA 3MRDB 1CLZL 4XPGH 1I9JH 5FUCE 2AABH 4NRXB 5DD5L 4LGSB 3MRJA 4X6DA 2R0KL 4LVOC 1Q9LB 1S5HA 5J1TC 2I9TB 3NVQA 1K5NA 4Y0GA 2PO6A 2CRIA 2VLME 3PDDA 4KK6D 3G6DL 4HFUL 3QUXD 2SEBB 4OB5H 4ZS7H 2WM0A 4MA8L 1BOGB 4IRZL 3O2VH 4Y7MA 5TE6H 5D93C 4YO0B 3V0VB 4U7KA 4U0QB 3HMXL 3S3JA 1GIGL 4PJ8A 2EEDA 12E8L 4ZDHB 3D3VE 4O2EA 4C54A 4L5FL 5HSFA 3T77B 1NCAL 3QDGD 4W6WB 4BH7A 2ID5A 3U1SL 3ZKSD 1AGDB 1S7TB 4YXLL 4JFXA 3LHPH 5DURD 4ONHA 1HI6A 1FL6B 1IRAY 5J0BA 4OFVA 3HUJE 2V5TA 4HWBL 4WTZG 1D5XB 3IDUA 4QXGL 5JXEA 3RHWF 2QR0A 4OKDA 3DECA 3VG9B 2QQLL 1G9NH 2AJSH 1E4JA 1CDBA 1GGBL 1CD0A 3DURB 3RWCB 5LJYH 3VWKA 1AXTH 1BQHB 3U36A 5A43C 1IGTB 1ED3A 3GI8H 3TPUA 4DVRH 5HHVL 4I2XE 5L8JB 4QRUB 3RZWA 3ZKMC 4PR5B 4M7LT 5JW5B 5JOFB 1BIIA 3H9SB 2NLJB 1IBGL 3C87A 2ZUVA 3BI9X 2MJWA 1J0IA 3KJ6L 3TA3C 3QQNA 4DEPB 1Z9OA 1HDMA 2VLLB 3RIAK 4KKAC 3JVGC 3MOAL 4J3WA 1KB9K 4JFEA 5EC1A 5E9DA 4HK0B 5HHNA 2FLRT 5DVLA 3MREB 1BQHG 3WS3A 1MAJA 5I2IA 3L1OL 2FEEL 3O3EA 4ZUSA 3VFPA 1T2QH 5CGYD 3VDAA 2MPAL 4ODBD 3TH3T 5ICXA 1WIPA 3MMEB 3KPLA 3AMKA 3HZYA 4UTBH 4K71C 4PJBA 5E8PA 3ZLQC 1FBIH 4QRPB 5CCKL 2DICA 3G6JF 5ADOH 3ARFA 32C2A 5J12B 4KI5C 2HN7A 4QWWD 1Q9OA 1ZKAA 3F7YA 4WDIA 5BOZG 1RJYB 2JCCA 4XNMA 2GJZA 3ILQC 1TDQA 2R15A 1NEZA 2YN3A 1X5XA 3NH7L 4JFDD 4Y5YB 4XCFL 3PV7A 3OKLA 3DXAD 2ZOKB 3LEYH 1JMXA 5DJAA 1L9MA 2D31B 1FNAA 2N1KA 3RWJA 3STZB 1T5XA 5CD5C 3CMOL 4IDJL 2AQ3A 3WHE1 2UWEB 4U3CA 4A6YH 4GW4A 4GRLB 1RULL 2XKUA 4LSSL 5F88A 3E6FB 1LDPH 3RWFB 1HNFA 2YMXH 4GUPA 3TCXA 2PUQT 2GJ6D 4OJFL 4P5TA 5EBMB 3ULVH 3OF6D 5IOPB 1A64A 3B9VA 1R3IH 2NZ9D 4XCEA 4JGMA 4HJ0D 1QFPA 2IPTH 4TTDD 4EVNB 4Y2DB 1TTGA 2FHBA 1WT5C 4E41A 2VH5L 3FT4A 5MEPB 1T6WA 2FSEB 2H6PB 4GRWF 5KVEL 3HE6B 4BK4A 3KGRA 5LXGL 1UH4A 3RDTB 3QQ3A 8FABA 4RBPK 4Y1AA 1K6QH 1OQOA 3TNNB 1AE6H 1BVLB 1LK3L 3IDMB 1TVHB 4UAOC 3I6KB 3MOBL 4RGOL 2Y07H 5I16B 4R3SA 4P5TC 1MCFA 2YPLA 3RL1A 3L3DA 3L5XL 4UT9L 1AFVH 2D7MA 1TZGL 4DTGH 3OX8B 3WSQL 2CDFB 5CZKA 1YNTB 1NUFA 2FX8H 3P73A 1F11B 1LO4L 3BWAB 5FV2A 1FZOB 4QNPE 1ZK9A 1W8NA 2DWDB 1IL1B 1PG7W 2V2WB 5HDOA 1M05A 4OZ4B 4LU5L 3VFTB 3PABA 3QIWB 5INDA 4LPXA 4IIQC 4V1DD 2OTWB 4KVNL 1H3PH 1NH6A 4NJ9L 4W4NA 2H2SC 2WUBH 4GG6E 2R1XA 3ZKMD 4NHCH 1EHLH 4GKZA 5J13B 3L5WB 3HI5L 3LQAL 3U30B 1CDUA 2R8SL 3PF2A 2ILLA 4HSQA 1RZJL 5TPWH 2EDXA 1UKQA 3QIUB 2ESVD 1YN6A 4YHIA 2FWOA 5HYFA 1PZ5B 1X5HA 2BNQB 1RURH 3FB6A 4BSWA 4HJJL 5FECB 1J5OH 5IT2H 1LP9F 1HHHA 4OFDA 1LEIA 3MRJB 1U95A 4X6DB 4XP1L 4PTTA 4MA7H 3FO0H 3EDJA 4UIKL 1YEJH 3OZ9H 2CIKA 1JPFB 3SDXF 4Q9RH 1A6UH 1X7QA 1A1NB 2X70B 2CDGA 4YHNA 3R0NA 4X5WA 4XP9H 1Z9SA 3RAJL 3DWTA 5JPMB 3GJFK 4U31A 1P5UA 2Y6SC 4I48A 1BWMA 4MD5B 3DIFB 1MIEL 4OFIA 3MCLL 4NNYA 1OPGL 5EBWA 3PGCB 4E5XA 2VXSL 2DQEH 3VMOA 4Y19D 3PGDA 5HD8C 4GRMA 2BSTA 4ONHB 4BZ2H 5D2LE 4MQXC 2XRAH 4RFOH 4EI5D 5DO2D 2JB5L 3VA6A 5E56A 3WO4C 2QR0B 4KV5E 4Z77B 4Z95L 1IGYB 4I18B 4MNGE 1EEZA 5DLML 3A0OA 1B9ZA 3VXOB 3FRUB 2FECI 2ZUUA 3AC0A 3DV4A 3VWKB 1EMTL 1JNLH 1HE7A 3DHJA 5E2WL 4P2OA 1QZ1A 1DUZA 3P9WB 5SWZD 3T2OA 2X4TA 3GGWB 1A7RH 4PRID 1KN2H 3DETC 4XPBH 2N56A 4KTYA 3CGTA 3SE9H 1AO7A 2YXMA 4XPAH 4B53A 2PW2B 1HDMB 2YD1A 1A1OA 4XNYH 3I50H 4YR6A 4JE4B 5KW9L 4JFEB 5EC1B 2QHRL 1A4KA 2HVKB 4NC2B 5MP6L 1N6QH 3BKCL 3GIZH 4HIEB 4DN4H 4Q9QH 5HHOE 1DJSA 4ODSH 5BCAA 4KKLC 2XI9A 3VXUD 4M61A 1QSFA 2EEAA 3OKEA 4ZSOB 4M6NH 3RL2B 4F58H 3B8YA 4ZUSB 4XMPL 1LO0L 2BVPB 2AJXH 4O2CB 3ZYIA 5DMGC 1U58B 4RNRA 4MDJB 5GS1A 3KPLB 3WXVL 3VXTA 1J0ZA 3MRKB 1I3VA 4PJBB 5E8DL 3B3IB 2DDQH 3ARFB 4OZIA 1RIHL 2X1PA 5C0AA 5CSZB 4M62L 3S9DB 1Q9OB 3SO3B 3F7YB 4WDIB 4E9LA 5C0JA 1T83C 3JUYA 5DA4A 2VXUH 5E5MA 1UGNA 5H2BB 1RUQL 5CIPA 1OD9A 5F97E 3QFDA 3NFNB 2WQ8A 4AEHL 1U8MB 1C7TA 1BWWA 3LPWA 1FFPA 3TCLA 4I5BB 2GITB 2VUOA 5DJAB 2WUCL 3JZ7A 2QHLA 1P6FA 4GKSB 3GMPB 3PGFH 1R3HB 2ZCLH 4FXLA 1ZAGA 1NCDL 2W0KA 2H32A 2OL3L 3C6LC 3GM0A 4LBEA 4FQXC 3W2DL 2NX5D 4K3JH 5E95B 3RWIA 5SV4A 3HLAB 2QSCL 4KDTC 5F88B 2PCPA 3OSKA 1CFTB 4R90L 1YEKL 1QACA 4GUPB 4OUUA 5BRZE 5I17A 1TJIL 4MJ5A 5F7UA 4ZYKA 4P2QD 4X4XA 1YEDA 3HNTH 4Z7NE 3IAGC 1IGIH 1EAPA 3SKMA 3WV0A 4TNVF 3FT4B 4QHLA 4GKNA 4UTAH 1R3KA 3IFPA 4EKXA 2OTPA 2NXYB 3I6GA 1MRDH 3RU8H 3QQ3B 1UVQA 3TN0D 4G9FB 4P4RB 4Y1AB 3VGFA 4WW1A 3F8UB 3U4BH 4CN1A 5GGRB 4NWTH 1MFBL 4AEEA 1KEML 3GMRB 2ITCA 4LHQB 2PETA 3SDDD 5JIPA 4FQHB 5GGSY 3B2UC 2LU4A 4R3SB 4DKDC 2YPLB 3EO9H 2MSPA 3RL1B 4F3FA 1XZ0A 1BJ1H 3MV11 2YUVA 4RQQA 5GSRA 1J1XH 3DYPA 3NN8A 1ZT7B 5KVFH 2R39A 5FF6A 4K8RH 1UADC 2JIXA 3QDAA 1I1AC 4MAYC 3WUWA 2B4CH 4AM0A 1YECH 3L95A 1G9MH 5C6PB 3BKML 3DVNA 3CX5K 5INDB 1CQKA 3QEQD 4XXDA 1EV2E 4YHPB 4N0UE 3KLDA 4JFYA 3KPQB 3FN9A 3CX2A 2X7LB 2GY7B 5FHAL 1JRHI 4P49A 3RVVD 4WW2A 4PJEA 1CG9A 4RGND 3SEPA 3V6ZA 2CO6B 1MREH 1U8PA 2CK2A 4POYA 4HPOH 4YHIB 5SX5K 2FWOB 2Q8BL 4RGMC 5DUMH 3MXWH 2B1AH 4XVJL 2MQCA 4X6CA 5C0CD 3FB6B 2CD0A 4OZGE 4ERSL 5E7BA 1OGAD 2AKRB 4ZTPL 1HHHB 2OL3B 5FA3A 1LEIB 3KPRE 1FNEA 5I30H 5FYJD 3FO9A 2F53E 5E8NA 5D1QB 4LHUD 4WENB 2VLRB 2BSRA 1CXFA 4PJXE 1X7QB 2ZUQB 3ES6A 3ZE0E 5ISZA 1ZVHA 5I1GH 3QAZB 5JMRA 2V9RA 4HZLA 1MJJB 3TJHC 1U8JB 1DLHA 1GH7A 2DTML 4UNVA 4NM8H 5T5FL 4EOWH 4Q74A 5EBWB 3ULUF 4UBDD 4WWKB 1E4XL 2V9QA 3OR7A 3PGDB 4GJTB 1NUNB 3GFUA 4GRMB 2X44D 3MODL 4RA0C 2P47B 1RUKH 1S9WA 3P2TA 4YHOL 2A1WH 3AS1A 4YE4H 2P24A 4GXVH 1L7TH 4M7ZC 4R4ND 2BNRE 2CMRL 1EEZB 4ONGH 4OLZL 3DVGA 3SDCD 2NTFB 1MCRA 4DUVA 5I8EA 1HEZA 3FHQA 2P5WE 1S78C 5CP7A 1HSBA 1MCWW 4BFBD 1B4RA 3LRSB 2PF6A 3OAUL 2ERJB 3U7AA 1MJ8H 1BD2D 4P2OB 3ARBD 4XPHL 2P8MA 5DRZB 4NWUH 5E03A 2DQJH 4PRHD 3Q6FA 3NA4A 5DJ0A 4NJAH 3BDYL 4GBXC 4X7SH 1SJHA 1KENH 2GT9B 3WFEL 1AO7B 3CAFA 3OPZH 4WUUD 1QKZL 1X5AA 2BNUA 1L9NA 1BGXH 4Y4FD 3UCRA 4XP6H 3FTGB 2RIKA 4XMKH 5DD6A 1U9KA 3RVWD 5IVNA 3DX6B 4JDTH 5F7NC 1VFBB 5HGGS 3TJEH 5EU5A 1DQMH 1YPZE 3PWPD 3V0WL 3D0VB 3QG7L 3OKEB 2G2RA 4ZUWA 4DGVL 1IEBB 3HG1E 5ILTL 1CFBA 5CINH 4LP4A 2H1PH 1JK8A 1BBJB 5GS1B 2ARJB 2AABL 5K59F 3UYRH 4A6YA 3G08A 4MMXC 5F7WC 3O0RH 1DN0A 3LEXA 1CDCA 3BOVA 1MCKA 4OB5L 1NL0H 1TXKA 3VWJC 3WFDH 2VLJD 2DMKA 4LEXH 4KUCF 5FAAA 5C0AB 3EOBB 3O2VL 1YMMB 1TTUA 4JY4B 4MAYD 4O5LL 5TE6L 4LQ1A 2ZPKH 3ARUA 5FGCE 3ARDC 4HJGB 3ETBF 4PGJA 4XWGH 4LCUB 5E5MB 2GKIA 4XPFL 1EFXA 4OM0H 3QFDB 1IGFL 5I9QB 1FFPB 3TCLB 1H5BA 4PYGA 1IMHC 4R4BB 3GMLA 1IM3A 2CK0H 3BKYH 3L5IA 3LHPL 1J8KA 5FO8A 3RBGA 4IMKC 1FHGA 2BOBA 4G7VH 3WS6A 1GCFA 3TO4B 4GW5B 3C8KA 1O5DT 4WTXA 1BM3H 1A5FL 2O93L 2UYLB 4LBEB 4NFCA 3I2CL 1U92B 4N8CL 3LQZA 5IJVA 5I76A 3V7MA 4LAQH 4FZEH 1G9NL 3SJVE 2AJSL 4GQPH 1N6UA 1YEGH 4AEIH 3MC0A 1ACZA 4MAUH 5FV1L 5IMKA 4S1DC 1FZKA 3S7GA 1BHGA 3ZO0A 2FGWH 1K4CA 1BIHA 1ZHBB 4CAGA 5I17B 3GI8L 4DVRL 3DRTB 1HH9B 3MLSL 1C12A 2YPKB 2X40A 3KXFD 1YEDB 4QTHA 5HBBA 3OBAA 1GYAA 3SKMB 2COQA 2R69H 3NZHL 4QHLB 4U1IA 4EN3D 4GKNB 3K4DA 2QADD 3IFPB 2X4OB 4QY8A 5LCVL 5I8CA 5C08B 2NYYC 1WWWX 4HDIB 4D3CH 1ZGLP 1S7WA 2ZUTA 5TDOA 2X9YA 3DMMA 3REWB 3T1FB 2Y4SA 4TUKH 4C83A 1NCTA 5I73B 2ITCB 3VJ6A 3RGVB 2YS4A 4NC1C 4Y5VA 3EDFA 5EUKB 2O5YH 1VEMA 1T7VA 4XT1C 4M5ZH 2NY4D 1T2QL 3EIFA 5IHZA 4OZHF 1XZ0B 4JFQB 1ZVYA 4L9LA 1KJ3H 2W9EL 5GRVK 5GSRB 3ZYOA 1ONQA 3NN8B 5F1NA 1L0YA 1UM4H 4UTBL 4KKCD 1FBIL 2JIXB 2HH0L 4R96B 4F15B 2F54E 4GRWH 5ADOL 1G6RL 1F6AA 5CBEA 3T3MF 4AM0B 4R7DB 1UB6A 2YPVH 4MCZA 4HKBB 1XGTB 3DVNB 4I4WA 3OXRA 3KS0H 5IEHA 3MQIA 1QYGL 4NKIH 3OMZA 3ORJA 1U91A 4PJ9B 3HC0A 3ARRA 1FYTB 4PB9H 3O6KL 2JJUA 3LEYL 3NTCH 2DQDH 1CFVH 3AAZB 3HAEH 4JFHE 1S9XA 5JDSB 3RX7A 3LVEA 3W0WA 3LKOA 5CGMA 1U8PB 4HEME 5CZVH 3BO8A 4MGXA 2D4DA 3WL9A 5IBLC 5IK3B 3MUJA 4BQ8A 5HYQA 1HOCA 4ZFZB 4X7FC 3CSYA 3TT1H 2DIBA 3ULUD 3P40A 4TOYH 4OLVL 3RI5K 5B38A 2AJZB 3CCHA 4XH2B 2PYEA 2IPUK 3ARGD 3BEWA 3ULVL 1U3JA 1FNEB 3FO9B 4X6DE 5E8NB 3OKDA 4Z6AT 4NGHL 3CDGA 5I1DA 1ZHNB 3BP6A 4PRDA 2R4SH 1DANU 4APQB 1J8HD 4WCYH 4G6FD 2FH6A 4ZAKA 1UA6L 3MA7B 5LQBL 4ODVL 4LVNB 4GKOA 3MV7D 3PNWA 2NY6D 4Q0XH 3VI4E 3R06A 2OI9B 1KB5L 3EBAA 3HZKA 5DJ6A 4D0DA 1VPOL 3OR7B 4P5MA 3PJSA 2V7NA 4RFNB 4KPHH 5DK2A 3QUXA 1RZ8B 4DFHA 5C9KA 4K9EH 5E24E 3D69A 1YDPA 5T1LD 2XWBA 1N7MH 3VFGH 1F8TH 3ABZA 2DIAA 1AFVL 3L7FA 5DRWA 4MXWH 4DTGL 5D1ZC 1NFIA 5DJXA 3QDGA 2FX8L 4S1RH 5A2KH 1D5MB 4PJAE 5FKPA 2ZKHL 5C6TL 4RBPH 4NOBA 2H8PA 1MFAH 4LARH 1INDH 3F58H 4PRPD 3KHQA 4Y8DC 3FCTB 2WP3O 4OLWL 5JA8B 4HIJA 4LOUD 1Z5LB 3GRWA 2E9JA 1UFUA 1G6RB 1H3PL 2Z8WC 1P1ZB 1NGQL 2WUBL 5DJ0B 1S3KH 1WWAX 3L3JB 4NHCL 1EHLL 4FOMA 5FYJH 5MEQB 3QXDA 1J12A 2A6DA 5BXFB 2P5ED 4KI5E 3RA7H 1BAFH 4Z0BH 4D0BB 3MRGA 2YD7A 5DD6B 3RIFF 1LO3H 3QUZD 1WAAE 5TPWL 2NY1D 5E9DE 5I1AB 5EU5B 3OKMA 4LSDA 4NN5B 1CD1B 1MNUL 5KSAC 2A74A 4ZUWB 3O45A 2VNCA 5C07D 2JB6A 3TV3H 2WQRA 3Q1SH 3TH4T 1CGXA 2D7NA 3AS2A 2D2OA 5IT2L 1D6EA 1I3UA 1WF5A 3T3PE 4LLMA 4R2GC 5DXWA 2OP4H 4Y5XA 1CGTA 3G08B 1G7MB 4MA7L 2XXMB 1DN0B 1YEJL 3U46A 1JTOA 4HMEA 4D9QE 4YDLB 4DKEL 1F3RB 4UT7H 3BE1H 5FKAB 1CWVA 3X13A 5L7XH 2JCCE 2AEWA 3P4NB 5TF0A 5C92A 4XVSL 5D6CA 3VFUB 3MFFA 3P4OA 5C7XH 4QT5B 3SDAC 4KK8D 4L4VA 4X6BB 3PL6B 2JE8A 5GQBA 5GZOD 5FO8B 1JFQH 2DYPD 2NR6D 1JJUA 1KB5B 4RFOL 5ALBH 3C8KB 3GSWB 1UCTA 1P7KB 5D2NC 3RVUC 3THML 1U8QB 4NRZB 4NRYA 4JDZB 1AP2B 3LQZB 4CVZA 5IJVB 4NO5A 3WJLA 3QEHA 3GJFH 1NGZA 2APXA 3OQ3B 1JGUH 4JFDA 3AXLA 1FZKB 2DQGL 4KHXH 2E6PA 4N0CC 3DXAA 1C12B 4MXQD 1NBVH 3U0TA 3VXNA 2K3TA 2ZOLB 4QTHB 1NGPH 1FCGA 3C8DA 5AYQA 2DQTL 4PD4K 1X5FA 1A7RL 2DLFL 1VKXA 4TVPD 4E41E 1KN2L 4JRYA 4XPBL 3MXVL 4QY8B 1OSZB 1OWWA 3T4AA 5J1AB 3CPLB 5HDQL 1QRNE 4XPAL 1X44A 4LKXB 1S7WB 5TDOB 5JXAH 3G9AB 3DMMB 4L3ED 3OF6A 1I4FA 1IAKA 1BZ9A 1FPTL 4LPCA 1YYLH 3GIZL 2IANB 4P3DA 5A2LH 1F4HA 4DN4L 4JQXC 1LQSR 4Y5VB 1QEWA 5I66B 4F7MA 1J86A 1GSMA 1IZJA 4H0HB 1D7FA 2X9WA 4Q6IB 3ET9F 3EO1A 5INCB 3MV8D 1XF5B 2AJXL 3K2UH 5IBUB 1SEBA 3L3KA 1I8IA 2YPLE 1J7VR 4OCSL 1I1CA 1G1YA 4K8RC 4JKLA 3GRWL 2DQUL 3FAXA 4I9WE 5IIEA 1G9MC 2YWZA 5JHDD 2B0SL 2EZ0C 1YY9C 4FNLL 6FABH 1UB6B 4MCZB 3T4YA 4H88H 5D7IA 3EW3B 4I4WB 3OXRB 4CL7A 1MPAH 5IEHB 4GMSL 1S7XA 5A40E 2GTWA 1C7SA 1AGEB 2VXUL 4ONFL 5GRYA 3QWQB 5MI0C 3N1QC 4GOSA 2J1KA 3HC0B 4P46C 5IBUG 4NQED 5DDHB 5HI5C 5AUMB 3LKSB 1S9XB 4Z9KB 5EU6D 3W0WB 3LKOB 2XWJA 3O6FC 2R2HA 3PGFL 2ZCLL 1X3DA 2NY5H 4V1DA 3WL9B 5EB9A 1AQDA 2EIBA 5GGQH 3TBVA 5HYQB 1HOCB 3WDJA 4HKZA 3CSYB 4R26H 4YC2C 3MRIA 4JFPA 3S4SB 3TVMC 1QFWH 2XTLA 4DK3A 1R24B 3B5TA 1RZ7L 1ZHKB 2UVEA 3CCHB 2PYEB 3FQXA 5A2JH 5K9OB 4J3UA 2IAMC 4I77L 3HNTL 1AY1H 3OKDB 1IGIL 4KVCH 2ESVA 3V2AR 3RNQB 2HJLA 3BP6B 1LGVA 2Q86A 4EI6B 4UTAL 3CC5B 4ZAKB 1JHTA 1F97A 3IFLH 5E5RB 4P23B 3O3AB 3VRIA 2MNUA 1XF4A 3STLB 1MRDL 3BYTA 3PNWB 4P2YA 1R5IA 4CMHB 3R06B 5DJ6B 3S4SG 5DFTA 4D0DB 3H7LA 4L4TB 3U4BL 2EDDA 1KCUL 1A9BA 4D2NA 3PJSB 4AIOA 4LRNH 5DK2B 3I85A 2Z31B 1DBBL 3G04A 3QUXB 3MYJB 1YDPB 2XWBB 3UTPD 2APFA 3C5ZC 5DRWB 2E5EA 1Q94A 2ZSVB 4UUJB 3O6MH 3O8XD 3O9WD 1NFIB 1J1XL 2H3NB 3QDGB 7CGTA 1IM9D 2AEIT 2ICWA 5CP3H 3BPNB 2Y06H 5FKPB 1CDIA 1X5LA 1R5WA 4Y19A 4XRCA 2B4CL 2VIRA 4U6VH 1YECL 4JJ5B 2BY0A 5DURB 4WFGE 1HYSC 4JFZH 3QDHA 3K80A 3ULUH 1MLCA 3D48R 4EI5A 4X4YA 3QNZA 5JW3H 1MCJA 4Y8AA 3QXDB 1MRFH 1AO7E 2X4PB 2VZTA 4JN2A 1KPUA 4QHNA 4EUPB 2Y25A 2Z8SA 1LVEA 1D9KD 3MRHB 2NTSP 5TF1H 5LGJA 4HPOL 2XV6B 5AZ2H 1QHOA 5DUML 2B1AL 3O45B 4BFEA 1QSFE 4M1GH 1CXHA 2JB6B 4PRIA 5HHQA 4U1GC 3T0WA 1C5CH 3G6JA 1CVSC 4LLMB 2JJWA 3IRZA 4Y5XB 1EEQA 4JZOB 5I30L 3VI3F 3V5HA 1CICD 1JI1A 4Y88A 5I6XB 1FO0H 3C60D 5HDBF 4OZIE 5I71B 4EUPG 4M6OH 2B5IB 3J8F7 5I1GL 5SX5H 3QCTH 5C0AE 4U05A 1E4KA 4G3YH 1I8MA 4YAQA 1LEGA 1FNGA 4NM8L 2HFGL 3EOAA 4EOWL 5D6CB 3P4OB 1AHWC 1ND0B 2LTQB 1EJOH 4TSCH 4XC3H 2K1MA 3PDOB 1D6VH 1RUKL 4PY7A 4AZ8A 3QR2A 5DI8A 3VFVB 2A1WL 4YE4L 5HVWA 2ATPA 3WLWD 5IB2A 4GXVL 4OD2A 1WK0A 1L7TL 4F57L 4PLKC 9CGTA 4GAJH 4CVZB 1LO5B 4NO5B 3S3PA 3QEHB 3O6FD 4UV7H 3MNWB 1QPPA 4M1CD 1JV5A 3WIIH 2UY7A 4JFDB 4TTGA 3AXLB 3VFNA 4P2CG 2J88L 3GSUA 3DXAB 5CEXA 3TVMD 4LLVB 3U0TB 1MJ8L 3QUYD 2FB4L 3MRBA 5T3ZE 4U1SB 2EE6A 4NWUL 1RZFH 2NX5A 4NJAL 4ZUVA 4X7SL 1KENL 3OPZL 1WFOA 3FN0H 4U1KA 1BGXL 4KU1A 2FO1A 2BXZA 4L8DB 4XP6L 3FO2A 4FFVD 4XMKL 2GJ6B 2Q87A 3MCKB 1IAKB 2F19L 3NOIA 1V7MH 4P2QA 4K55A 4ZFOB 4P3DB 5T1DH 3TJEL 4XTRD 5EBGA 4LVOB 3HAEA 3MGAA 3L7EA 5GGSB 3O4OC 4G80B 5IF0A 4V2CB 2WWKO 1UYWL 4LCCC 4YUEH 5C0ND 2HTLC 5IKCB 1I8IB 4M9PA 2OZ4H 2V2TB 3MJ8A 5E5UB 4I1NB 4G9DA 3TN0A 5D93B 3F7VB 3KLHD 1CFQA 3C5ZD 1CQYA 1SQ2N 5IIEB 2Z8VC 4HUUA 5JA9A 1YJDC 1NL0L 1T1YA 1CE6A 2HT2D 3WFDL 3T4YB 1URLA 5E99L 3SDDA 4X4ME 5F1OB 3O2DL 2FZ3A 5DZNA 2DJUA 1MHPL 2ZPKL 4MX7B 4OUOA 4XWGL 2GTWB 3CXDH 1HYSD 3E3QE 4OM0L 3ARSA 5ALCH 3FL7A 1F4AA 5F93C 2VC2H 5BZWB 2YD2A 4MNQD 1T4KA 2CK0L 3BKYL 4WI8A 1AJ7H 4GAYA 1HHJA 4PJEE 1ZOXA 3NIDF 1U8LB 1J1OH 2XWJB 4HS6A 1BM3L 3WCYA 2D9QB 3QEQA 1C16A 1PKQA 1OAQH 3Q0HA 5BV7H 1NAMH 5C2BH 4J4PC 1LP9A 4LAQL 4LSUH 2P49B 4HKZB 3MRIB 4X6CE 1F4WH 4AEIL 2FBOJ 4MAUL 1OY3B 5EA0H 3PUCA 3GBMH 3FQXB 2FGWL 1HHIA 5DA0B 4OSUH 1PEWA 4JZNA 3SDXA 3TA3B 3X12A 4RISH 2LU7A 1HINH 1YEFL 1ORQA 1U3HC 1MHCA 1VADA 2VDKH 2Y9RT 4HUWB 4LSVL 2HJLB 2R69L 4XNZC 4DW2H 2Q86B 5DD1H 4L3CA 3VGGA 1JGLH 3CZJA 1JF6A 2WBJD 5CJ8A 4X8XA 5ISZE 5C0CA 3FO1A 5GGUA 2D0FA 2PYFA 4LGRB 5HHMD 3VRIB 1U8IA 4D3CL 3MV9D 4PB0H 1XF4B 4P48A 1OGAA 4PYHA 3QH3A 3HC4H 5HYJA 1IQWH 1T1XA 5HGHB 2CUHA 3OJVC 5CWSB 3CXHK 4TUKL 3K2MC 4OCRL 4OCNC 4WO4C 4LHUA 5TE4H 2O5YL 5FUZL 4TPRL 4NO0D 1K2DA 4M5ZL 3IDNA 5HHXH 4KJPC 3OJ2C 3B9KA 1WCBB 5BZDA 1LNUA 3BQUD 4F7PA 1Q94B 1NLDH 1VFMA 4JVUA 3SCMD 4M7LH 5DJCA 5J6GA 4PLKD 1OWRM 4Y19B 4FFWC 2VIRB 1QSED 1DVFC 4EZMA 4XXCA 2UZIL 1CL7I 1MLCB 4C56D 1JPGA 1MUJA 4EI5B 2O61B 3QPXL 3K3QA 4NKIL 3RPKA 5LVEA 2IPKA 5BVPL 5HYSB 5F9WC 4UDTB 3SDCA 2AJUH 4ZQKB 5ID1B 5DFVC 4PB9L 5DS8A 1SEQH 4Y4KD 3HFMH 5KANG 3NTCL 5E4EC 1CFVL 1I3RB 1X5JA 3B9KC 4KK9C 2QSQA 4S10A 5D5MF 3SQOL 1BD2A 2LU3A 5LGJB 3AY4C 5IWLA 4P57A 2NY2D 3ARBA 5SWZB 1T22B 2CLVA 2DM2A 3SE8L 5HHQB 5EUOF 5IB4A 2BSSB 4TOYL 3MGOA 4WUUA 1F3DH 3G6JB 5HYSG 3JWOC 4OZFH 4RWYH 4Y4FA 4DGIL 5GS0D 1JNNH 1S7UA 1A02N 2KKQA 4LVEA 1TNMA 1S7QB 3GJFA 3OWEA 4HLZG 4Y4HC 3KPSD 4OV5A 1OB1B 3FB7A 4WFED 2R4SL 4XHQA 3VXUB 2VITB 3OAZK 4WCYL 5I1LA 4AENA 3ULVE 3T0ED 2BVOB 2ZJSH 5EZIH 2IALA 1NGYA 1AGBA 5CAYB 2PW1A 2VWEC 4Q0XL 1FG2A 3UO1H 1RU9H 4ELMF 1I8LC 3MLRH 5BMFH 4FQCL 2VLJA 4IRJC 5DI8B 2Q8AH 4K9EL 2ATPB 5IB2B 4OD2B 3BP4A 1N7ML 3VFGL 1F8TL 4HK3J 2RQ8A 4WY7H 3H7BA 4ODUA 4MXWL 1M6OA 3GIVA 1I9RH 4L1DA 1T0MA 4S1RL 1T0PB 4AQ1B 4IIQB 1DQDL 1BFVH 4AMKH 3VFNB 1MFAL 4LARL 1INDL 3GSUB 1M7DB 4U0RC 5SWSA 5KS9B 1H3VA 5CEXB 4FQJH 2AEPH 1TQBC 1JGVL 3HNSL 3UTSE 1WFUA 2YHGA 5ITFB 5D9SA 4WVRA 2X5PA 1Y6KR 5FOBB 3HNVH 2ITDA 1D5IL 3ZT6A 3VGBA 2Z35B 2NX5B 3MLZH 1F90L 4HK3N 3EYVA 1FV1A 4G43B 5FYJL 4CVWA 5EOQH 4I8DA 1MFNA 2FL5B 4U1KB 3MNZA 3QG6A 3RA7L 2DKUA 4Z0BL 3RVTC 3WBDA 1MVFA 3VD4A 3ZDYE 5JPNB 3VDBA 2A0LD 3D18A 1LO3L 1B0RB 1O0VA 2K7PA 3KXFA 4NIKB 4L8BA 2VZUA 2BRRL 3IS0X 3GNML 2HWZL 2GTZB 3M1BB 4NQDD 2VISA 2P48B 4MNHA 2OTUA 3WMSA 4EN3A 4YGAB 1MRCH 1CLCA 3TV3L 3Q1SL 4MA1C 4MJ4A 3V5KB 3PWNB 1QBAA 4GAGL 4NZJA 3WEXB 2P8PA 5IROC 3ARED 3MJ8B 3SOBH 4G9DB 2V2XA 2OP4L 5FUOH 3TN0B 2OR7A 2IH3B 2CDEB 1CFQB 1T20B 5CMAA 3PWUB 1BFTA 3C5SB 4HUUB 1T1YB 4KI1A 2D0GA 1DANT 4OLYH 3SDDB 2RAMA 1H0DB 1SMOA 4AEFA 3PWJA 1TQCC 5ERWA 4DZ8B 2WINA 3CFJA 1DVFD 4U2YA 3WKMH 2NY0D 4XVUC 4JKPL 3DRQB 1MLBA 4M7KL 5C7XL 1U3YA 1LILA 3WO4B 1QBLL 4HC1H 1DFBH 3EYSH 4GAYB 1JFQL 1FZMB 4M6MH 4MJIE 2V5RA 5FCSH 5J11C 5IW3A 5DFVD 2C9AA 2VDRH 1QSZA 3OB8A 1PG7X 3VFOB 1C16B 2L0DA 1XFPA 5DWUL 3RUGF 4ETQA 1PJ9A 5C0IA 1UXWB 2CKNA 3RTQA 4J3TA 5FB8A 3OAYH 1JGUL 3FQNB 4QXWA 43CAB 4KMQA 4F9LC 4KHXL 4K7PX 4PPTA 1DP0A 3QFJD 4F7TB 1MCEA 4JZNB 3SDXB 1S9KC 4WUKL 4JPKH 1HSAA 4RGNB 3WDIA 3MRQB 5CP3A 1NGPL 4JRWA 4MDIA 3VE0A 1ORQB 1EH9A 1MHCB 1VADB 2FCBA 3K7UA 2AGJL 5H8DA 5C0BA 1OQXA 4L3CB 5I19H 3IU3A 3QUMH 5B4MD 1EDQA 4Y89A 5GGUB 2PYFB 1JZ2A 2RGSA 5A3ID 3JUZA 4G8GA 5E2VH 1OGAB 1T1XB 2C3VA 3ARGA 3BD4A 3TBWA 2FRGP 4LSPH 1HILA 1YYLL 3IDIB 3NFSH 4OCYH 4JEGB 1J8HA 1T1WB 3IDNB 3NIGE 2JJVA 1HKLL 3IDYB 3NCBB 5EZJA 1DQQA 1LNUB 3U0PB 4F7PB 1LHZA 3MV7A 5DYOB 1QR1A 4LF3A 4XB7A 2VZ3A 5DJCB 1OAZH 3ROOB 2M2DA 5J6GB 3QBTB 3VD3A 1KTDA 2G5BB 5DTFA 2CJUH 5C0RH 3RBSA 3C5JA 3X17A 2GUOA 3KJ4C 1ZGLM 2JJSA 2GQHA 2ICES 3WUZA 3V4VL 1JPGB 5T1LA 2EDQA 2Q1EA 2YD9A 3EOYG 4JY6A 2C7UA 1FO0A 4G8EB 1P4BL 5GRWA 4NZDA 4PP1C 1OCWH 3CUPB 5DGRA 3SDCB 1T1ZA 3EFFA 5EO9A 3MJ9L 4XAKE 1VFOA 4PRPA 4NFBA 5J3HC 4YIQA 1BD2B 3QI9A 1DSFH 3U9UB 1JYWA 1AGFA 4P57B 3TNMA 4LPYA 2NY5L 3ARBB 5ABDE 5JO5A 1GGYA 1TVDA 2QLVB 4PRHB 1X6NA 2AP2A 4R26L 4HUVB 2KQMA 5FGBC 1QFWL 5IM7B 3MGOB 4JGJA 4WUUB 2AJ3A 2P5EA 4L9DA 4L8CA 4CNIB 2VOTA 4JFFD 2I60H 5ICZB 5D2NE 1AY1L 3QUZA 4F7CA 4N90D 1DUYB 3BKJH 4NPYA 4OV5B 4KVCL 3FB7B 4HFWA 4BFIA 3PWPB 3PXHA 3LB6C 4AENB 5C0FA 5C07A 3ALXA 1J88A 2IALB 3IFLL 3C09C 4JRXE 5EC2A 1HWHB 4LDLB 5K9QI 4PGDA 4FMKA 1T66C 1FG2B 1NCNA 5LWYH 3UTOA 1IARB 4RWHA 4L4VE 4XI5C 1XH3A 5GZNC 4PJHF 4XVUD 1AXSA 2VLJB 4PJGA 4YHML 4XHJC 4OF8A 3QHTC 2P8LB 4MAYB 1JYVA 5IQ9A 3S36X 3CVHL 1KIQA 3B8SA 4ODUB 3GIVB 1KJVA 4M4PA 4DN3L 4FQ2H 3QHZH 4KHTH 3PQYD 2XZCL 2A6KA 4WRLA 4CJ1A 1NSNL 4JFDE 2OZ4A 2H2PD 3NCYS 3DXAE 2DYPA 3K8LA 4LP5A 1A7QL 4O02L 2X4NB 2JELL 4JFZL 2DLEA 3ILPA 3UMTA 1KLUB 4X7CC 3ULUL 4PJFE 4FQ1L 3WNNA 5JW3L 1SM3H 4UZGA 3LKPB 3X3GL 1PD6A 1U42A 3EYVB 1PGRB 4JRYE 3WN5A 1UEMA 3OHXA 1MRFL 3QNXA 4DZBA 3B4NA 4TULH 4RGMB 3MNZB 3VXQB 1OOAA 3QG6B 2A9NL 4GW1A 2G60H 3KVQA 3SBWA 4MCYB 4NKDB 4LIQH 5DUPL 3D18B 5KSBF 5TFSH 1EHXA 4F37K 2YKLH 2VZVA 2F8VA 3MO1A 4OZHA 5JQ6L 3MBEC 4YDJA 1L7IH 2BNQD 3JWDC 2OTUB 4MNHB 5F7EL 3ZKXC 2QADB 4M1GL 1UZ6F 5HY9A 1SYSA 4Q9CA 4IRSC 1FGVH 3TT3H 3EYFA 1A2YB 4ENEC 2HP4A 5IJKA 2LE9A 3GSVB 2X09A 2V2XB 1NAMA 1F6LL 2RBLA 3JXAA 4GAFB 4L3EA 4TSBH 1JPSH 5CMAB 3TBTA 3PV6A 4G8IA 4FG6C 1T21A 3O2WH 4R0LC 1AIFB 4ZXBC 4M6OL 5D7IE 3QCTL 3SBWC 1CLOH 4FABH 3EJZD 1WQVT 2WINB 3CFJB 3MV8A 2DLTA 2W59A 3OB0K 3M45A 2ADIB 2E27H 4M7ZB 3SKUD 4MXVE 2RR3A 3BPOC 1EJOL 5L9DH 4XC3L 4HIIA 5JHDA 1D6VL 3FQUB 4HD9A 3QULB 4X98A 5JNYA 5D72L 3VW3L 2R0LL 3AM8A 4RRPG 5IB1B 4V1DE 5ECJE 3L5JA 5EU4A 3U79A 4ETQB 3CU7A 3UYPA 3CFDA 4U1MA 2VLKA 3U7YH 5FB8B 2FJGA 3KNBA 3EUUA 4NQEA 3WIIL 1CD8A 3CVHB 4OGAC 5CEYA 2BMKB 2V5SA 3GSNH 5FUCC 1HSAB 3HPLA 5EU6A 1ITCA 3FFDA 1S7RB 3VE0B 3W11D 3PWLB 2ESVE 4X9IA 2CRYA 4DUWA 4TSAH 1ZVSA 3RVXD 1IZKA 1X5GA 3IU3B 3UTTE 4KJQC 1OAKH 1AD0B 4G6AD 3FN0L 5D6DA 1RZGA 3GMNB 3HS0A 5AD0A 4UQ2A 3ARGB 2XZQH 3C2AH 3C9NB 4I13B 1V7ML 5F96L 1HILB 3RWHB 5T1DL 5EOCH 5DJZA 1T66D 5D71H 4PLNC 3DTXA 4DFIA 1RJZA 1S9YB 1J8HB 3EGSA 2WWMC 4G6FB 3B2VH 5ESAA 4I0PD 4NM4L 2WAHA 3UZEA 1NQBA 1ROWA 1FZJA 4YUEL 1ZV5A 1YQ2A 2VKXA 5EZJB 3IU4H 3MV7B 1ULVA 4BSJA 4D8PB 4LF3B 2NY6B 4ZUTA 3ZYZA 3IFNH 1QVOB 3HZVA 2XN9D 3FQWA 5C09D 3D39E 5DTFB 4JG1H 3ZE1F 3C5JB 3WIFA 4OZFA 2GUOB 1ZT4A 1I9EA 1ZEAL 2JKXA 1K4DA 3B6SA 5T1LB 5K9JL 4CU8A 3CXDL 2F58H 3LIZL 2RJMA 2VB5A 3O8XA 3O9WA 5ALCL 1IM9A 1T1ZB 2VC2L 3EFFB 1R0AH 1DE4A 1F02I 5SV3A 3QHFH 4XNXH 1KJ2B 4FRWA 1WBYA 1AJ7L 2AK4B 4TVPL 4PRPB 2GIYA 3N9GH 1J1OL 4YIQB 5GGVH 1WFNA 2ZSWA 2EXYC 5F6HJ 5LGHH 4GO6B 1AGFB 1OW0C 1EO5A 3CIQA 3GHEH 1LWRA 3P0VH 5F8RC 3GUTB 2DI9A 1M4KA 4PRIE 1Q0XH 1YEHL 1BQLL 5EA0L 3GMOA 3V6OA 2P5EB 2R29L 1B4JL 2CR6A 4L8CB 2BERA 5E70A 1AR2A 5JW4Q 4OQTH 1RD6A 4RISL 3OTTA 1HINL 3QUZB 5DHYA 3VXMA 1D9KA 2VDKL 5HI4C 4HFWB 4DW2L 4BFIB 1JGLL 5C0FB 1S8DA 2V7HA 1MFEL 2R0WH 4HAFA 3T0VA 2GSGB 2E7CA 1FRGH 1HXMA 1GZQA 3OKKB 2IMMA 1DQTA 1HQRB 5I8OH 4FQIL 4TUOB 4CJ0A 2FYYA 2YD8A 4HUKB 5E8EA 4CW1B 2G75B 4HT1H 5L8LB 4JM2F 5D8JH 4LVHB 1H3GA 4LCWE 2DS4A 5HVGB 1I7RB 2XNAA 3EJYC 1CICA 4HFUH 4OI8A 2VAJA 2XTJD 2NXZC 4MA8H 1QO3A 3C60A 4HG4K 1AXSB 3LD8C 1JGDA 3HMXH 4OT1H 5DRNB 2HT3D 2YWYA 1PVHA 4L5FH 2Q20A 1NCAH 1KJVB 3QIBD 3P3YA 3LN9A 4M7LL 3U1SH 3FFCB 2FBJL 1B0GA 3RP1A 5ESQA 4QHUA 4FQLH 1WC7B 2VDML 2DYPB 4HWBH 4KKBC 1JMZA 2WW8A 1VGEH 3SE3C 1A3RH 1G84A 4D9LH 4QXGH 3VD5A 4GRWE 2AV7A 3BGFB 4LSQL 3Q2CA 1U8KA 2QQLH 3QQ4A 1UB5A 3JV4A 3WN5B 3NCJH 2AJUL 3OHXB 2AJVH 4P9HC 5F7LB 2VLMD 1BZ7A 4HIHA 3HFML 3RZCC 4Z7UB 5HHVH 5H37H 3HB3C 3KYMA 3QUYA 4P2QE 3D3VD 3OV6A 1UG9A 4YDJB 4HC1A 3TO2A 2EYRA 5HY9B 2YUWA 4JKWA 5DRXB 1K8DA 3L6FA 4JFOA 4KMTH 1SYSB 4XBGB 3ZT5A 1G7IB 2PTUA 1WBXB 1KPRA 3BXNB 4WEBL 4RWYL 3MOAH 3NFPB 4Q2ZB 1JNNL 3MLXH 3CDYA 1ES0A 3HE7C 3PV6B 4YZFE 4AIXA 3MUGA 2FNBA 2XA3A 2DLIA 1KYOK 2KZWA 2QJDA 5FM5O 1PEZA 4WV1A 2ZJSL 3MV8B 1P4LA 1INEH 3WD5L 3FZUD 4JVPA 2VAAA 2FEDD 3KPPA 4WWKD 3ZKNC 1U8NA 3QUMA 4PJ7E 1RU9L 3UO1L 3MLRL 2R4RH 5CFHA 4YDKL 5BMFL 3S35X 2DOCA 3FT2B 5JHDB 5D1ZB 5E6IA 3WJJA 2BOCA 3CDFA 1O7VA 4MA3A 5FHBL 5L8KB 3OAZH 2H45A 4WY7L 1MCDA 3QEQE 1CGYA 4KV5F 4RMSA 1PKQE 1JNJA 4P59L 5EU4B 4LEOA 1I9RL 2EXYD 4YH6A 1LP9E 4X99B 2IF7A 1PX3A 4U1NB 2FJGB 3KNBB 1RJCA 1A6AA 4NQEB 4XCFH 1BFVL 4POZC 4AMKL 3V6FA 3UZVB 4HKJA 5CEYB 5GRZA 5DEZA 3P9MA 1RZIA 2OJEB 4POUB 4FQJL 5D7KD 1F00I 2AEPL 3SDXE 4LSTL 2EKSA 1A6TA 1UM5H 3FFDB 2D03L 3I9GH 3BN9D 3SGJC 4MJ6A 5IMLB 4YBLB 1HXYA 4IOFC 3HNVL 5EIIA 2YRLA 4IDJH 2E7LA 1ZVSB 4CMMA 1WIUA 3ZHDA 1T3FB 3GMMB 1RULH 5EOQL 5CJXA 5C0CE 5E6IC 2C1OA 3CK0H 1A1MA 3HS0B 1ZWIA 5AD0B 4JCLA 2XZZA 4UQ2B 4HXBH 4ONOA 3O4LD 5HYJE 2J4WL 2MKWA 2B39A 5E7FA 3IVKB 5C0EA 5DJZB 4RMRA 5L2JB 1XT5A 2VH5H 2NY7L 3DTXB 4LRIC 1X4ZA 1MRCL 5ESAB 2WBJA 5KVEH 2BHYA 1IT9H 3F62A 5LXGH 4AJ0A 2FX9H 3MV9A 5DGQA 4OGZA 1B3JA 2MCPL 1TITA 5FUOL 4QOKA 1G0DA 3RFZC 5GXBB 1BLNA 4WI4A 5DQ9B 3U6RA 1KXVC 4CGTA 4OZFB 3EFDH 4ZS6D 3OJMB 4OLYL 3ZDXF 3TZVC 3LRGA 3SDAB 1K4DB 4N1EA 4N5UA 1N6VA 3L5XH 2X89D 3KYNA 1WCQA 3OKYA 5T3XD 1FCCA 3BQUA 3WKML 4F7EB 4C59B 3ME0A 4TQEL 4MYWB 4RAUA 3SCMA 3L9RB 3LDBC 1EPFA 5F9OH 2QV2A 5DEGA 1WBYB 3UJIL 4HC1L 3EYSL 3Q3GB 2R1WB 3TO4D 4C4KO 1OGTA 4Z5RB 1BVKA 3IJHB 1I85A 1QR4A 5KTEL 2DB8A 2IBGA 4HLJA 5IFJB 1CBVH 5B3NA 4C56A 5L2KB 4KVNH 4WIQA 4G6MH 3D85D 1HN1A 4JZJC 3LZFL 4JM2D 4DOHE 4ODWA 2X41A 2R8SH 2C1PB 3BIKA 3BT2H 1OARL 1WWCA 5HVHB 3KPTA 4JPKL 5GIRA 5CEZD 5DHYB 1D9KB 4Z7VF 1N2RB 4HX1B 3W5MA 1VFAB 4YHYC 1Y6NR 1B6UA 5I19L 2J8OA 4W4OA 5C08D 1EBAA 3QUML 3MBXL 2AQ2A 3JV6A 4HJJH 4ODXA 4QXUH 3BESR 3R8QA 1NC4B 3DV6B 4NOFA 4QHMB 5E2VL 3WNMA 2FYYB 2VJXA 3F5WB 4M3JA 5DJ8B 4LSPL 4UIKH 4K3GA 3B43A 5JW4M 5JORB 4OCYL 3KPSA 4PJ5A 2FX7L 3UEZA 2XFXB 3C60B 4P2RA 3BUYA 4NC0B 4LHJB 2VLJE 2L7UA 5HHPB 5EBLA 3RAJH 1GC1C 2EXWC 4HKXA 4W70A 4U3HA 2HLAA 2PTVA 2WZPD 4HUXB 1IGMH 3K81A 5ESVA 1OPGH 1BJMA 4X9BA 1OAZL 1WLHA 5IVXB 1ZHLA 2FECL 4BKLA 3GSOA 1CLYH 3I6LE 2CJUL 4BQ9A 4KRPD 5C0RL 5GISH 5KSVB 5SWSE 2C4XA 4OAWB 2IBZX 3BPLC 1NMCC 4WFHE 1J9CT 3P0GB 3ZSTA 1FH5H 4Z95H 1RVFL 4PJCE 1EX0A 1UB5B 5IG7A 1OCWL 5DMIH 3O6FB 3QZWA 3OG4B 1FYTD 2EYSB 3HRZA 1BZ7B 1F4YH 1EMTH 4HIHB 3WHE0 5EIQA 3ARWA 4EDWL 5ITBH 1J87A 3ROLA 7FABL 2HJKA 3TVMB 3KYMB 5E2WH 5HI3D 3QUYB 1DSFL 3KXFE 5DK0A 1CDJA 4IS6A 1SBSH 4U6YB 5ANMB 3TO2B 3RJQB 5IMOA 4OZGF 4UNUA 4Y2OA 2NNAA 1CDHA 3L6FB 5J56B 2DRUA 5FGRA 1UENA 43C9A 3REVA 2V9TA 4FS0A 1A9EB 3SGDH 1P6AB 2HAZA 3QXVA 1WUNT 3BKJL 1HNGA 3MUGB 5TDPA 4PJXF 1RQ5A 3ZE0F 1P4IH 3ZTNL 3D2UD 1WBZA 3GSNA 3JTTA 4XMPH 4WV1B 1LO0H 4K7PY 2KZ1B 3MRDA 3WFCH 2G9HA 5J1SC 1PDKA 1P4LB 1IC7H 5SWQA 1QBMH 3WXVH 2VAAB 3TZVD 1CI5A 2HMID 3KPPB 1EGJH 3MRLA 1Q9LA 5D1XC 5E8DH 1XF3B 1XIWC 4RMUA 2BRQA 3C5ZB 4IJ3C 1A3LL 1RIHH 4HUMB 3WKNA 1BOGA 4ZUUA 1JCKA 4N5EC 3U9PH 1MHHA 3HA0A 4YO0A 4MQSB 3V0VA 4ZDHA 1RUQH 1EHNA 3V9FA 3T77A 4LEOB 4PD4J 3BH9B 4FQ2L 3AU1B 3QHZL 4AEHH 2VXQH 3S96A 1AGDA 1S7TA 3NGBC 4XNUH 4B0MM 2R56H 2LV4A 5HHOD 4HKJB 4MNQB 1FL6A 4FP8H 2EE9A 3P9MB 4Y16C 2EDHA 2WUCH 2X05A 4YJZL 3RKDC 2VR9A 4X7TB 1XGQB 4K7PH 3AVEA 1MCSA 1HXYB 1IVLA 1CTOA 1D5XA 3TBSB 5B21A 1NCDH 2OL3H 4CMMB 5C0BE 5GS0L 4UMGA 3VFMA 4JVWA 4X7EC 2C1OB 2OBGA 4TULL 3RWCA 1P2CA 3ULUE 1A1MB 1BQHA 1YEKH 2A77H 4PS4H 1ZWIB 3BMVA 4G8GE 2G60L 4M03A 1IKNA 1I75A 4LIQL 4PJDB 4U1GB 5TFSL 4QRUA 2YKLL 1QLFA 4PR5A 4CDHA 5JW5A 5C0EB 1YPZF 5JOFA 1HK6A 2NLJA 4RIRA 1L7IL 1GAFL 3QRFM 3F65A 3NCEB 4EIZC 2WBJB 2XQYG 1ZLWK 4RCAA 2A38A 3TT3L 2VLLA 5HHMB 4KMLB 2R2EA 3MV9B 4WGWB 1XAUA 1LE9A 3MV7E 1C5DB 3MROB 2VSDA 4JB9L 1MFBH 1KEMH 1JPSL 3VG9C 3MREA 2PXYC 4UB0H 3SE4A 1DQJB 3O2WL 3BMWA 4OLXH 4OQTA 4NO0B 1CLOL 4NT6B 4FABL 3G5XB 1TPXB 4RAUB 2DL2A 2WP3T 2BVYA 1KEGH 4A2MA 3FAWA 1WJ3A 4OD3H 2APBA 3X3FH 4KGJA 4DEPC 1JRHL 1QSEB 3SO5A 1BVKB 4OKVB 5TQ0H 1NAKH 4PG9B 4FFZL 1I3GL 2GAZB 5EUOA 1HCFX 1RJYA 4C56B 4G5ZH 4P4KD 1B0WA 3DNKA 3QDME 4D9RD 1CZ8L 3T2NL 1WTLA 2NY3D 4KY1L 4OQ1A 3VGAC 4I3RH 3OB0H 4LNVA 2CKBH 3HMXA 3P4LA 2V6HA 4PGBB 4XCNB 4ZFGL 3BIKB 2P5EE 5F7YC 1QOKA 4Y4KB 3GSNL 3N06B 2D31A 4RDQF 1EHAA 1CFSB 4YQXH 1IEAA 1P5VA 4P99A 4XVJH 2NY2B 3V6BR 4F33B 4HWBA 4N68A 3NZ8A 1OAKL 4GRLA 4X0KB 5C07E 2CH8A 1IEHA 3RWFA 2EYTA 3E6FA 5JHLL 4ELMA 1A7BA 5C71A 5DJ2B 1ZS8A 1CF8H 2RB8A 1GVIA 5IOPA 4JFFA 3C2AL 1TLKA 1MFDH 5EOCL 5DUBB 3UJJH 4OGYL 5T3XH 5D71L 1KBGH 5MEPA 3BUYB 4Y5YC 1OTUC 2NQCA 2FSEA 2J3SA 1J0YA 4PJGE 3B2VL 2H6PA 3RY5A 3T0EB 5EBLB 4HKXB 4NUJB 1PQZB 2R23B 3M8OH 5T5FH 3IFNL 5ESVB 1E4XH 3TNNA 3HKFA 5DHVH 2X4UA 3IDMA 1TVHA 1KULA 3LKRA 3I6KA 1L0XA 5DT1L 4NQXB 1C1EH 4PRAA 4OF0A 5I16A 1P9MC 1U8HA 1MOEA 1C08A 2CMRH 2F58L 3OX8A 4OLZH 3S88H 2DM3A 4N9GB 4Y2DC 2QL1A 1YNTA 3KPRD 5IG7B 1F11A 3BWAA 2W92A 3QZWB 1FZOA 2F53D 1G7QB 3PQYA 1FDLL 5CEZH 3K46A 3RHWK 4HWEH 2DWDA 5F89A 1R0AL 3TBYB 2RFXB 4F9PA 4KROC 3HE6C 3S37X 4MWFB 3OAUH 3VFTA 1P7QB 2OX5A 1FLRH 3RDTC 5JIIA 3N9GL 5TQ2H 2VN7A 3QIWA 2E6QA 5GGVL 5LGHL 2CLRA 4XPHH 1D5ZB 3GHEL 1AQKH 4ELKA 4OZHE 2I24N 4U6HB 3N85L 4PLJC 3P0VL 5F44A