2N7SA

Solution structure of leptospiral liga4 big domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
MPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQVTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ig-like repeat domain protein 1
publication title Solution structure of leptospiral LigA4 Big domain.
pubmed doi rcsb
source organism Leptospira interrogans serovar copenhageni str. fiocruz l1-130
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2n7sA00
4AQ1A 1E5UI 1F00I 2MH4A 2MQGA 3NCWA 3NCXA 1F02I 4HU8A 1CWVA 2ZWKA 2N7SA 2MOGA 2L04A 2ZQKA 4AQ1C
chains in the Genus database with same CATH superfamily
2BOBB 1S46A 4EZKA 1NC4A 3CUPA 2YUWA 4WW1A 4UQ3A 7TAAA 2Y1YA 1Z1WA 2VDPB 2OR8A 3QQ3B 4I77L 4EKJA 3TXAA 2IWKA 4L0ZA 1MW1A 1V7NL 4W9KC 4IIQC 3A0OA 4MX7A 5F3HA 4LLDB 1O6VA 3I85A 3M46A 5J12B 4O5LL 1FE8H 1EUTA 4ZX3A 1WTGT 1Z9OA 2WBJC 5EIIG 1A0QL 1BVLA 4BH7B 1BVNT 2VW7A 5BZWA 3MRHA 4IMKC 4HEME 3ZO9A 2HCZX 2DM2A 4NIYE 5DJYB 2FZ3A 1WZKA 1CXIA 2A77H 1RZJC 4GG8A 4Z8FH 5T5FH 2NYZA 4V33A 5IK3B 3U2SA 3QWOA 5E51A 2P24B 3QQ9D 4LOVA 3JTSB 1RH8A 1YEKL 1U8CB 1KXQA 1T2QH 5FGCE 3HC4H 3CXHJ 5HGDB 4W9LC 4HAFA 2CGYA 4K5PA 4F7TA 1JVLA 2L7QA 3A5VA 2FATH 1BOGA 5K5YA 4N90D 3WDHA 3EIFA 4QRPA 2GFBA 3BIAX 2YA1A 2X6AA 4MCMA 1L7TL 4A2EA 4ZD3L 1YUHA 2NY5C 2F18A 4QHPA 3B2VH 2DTMH 4AYFA 4M7ZB 5FX3A 4MJID 4MQ7A 1PX3A 1U3NA 4PH8A 3L3JA 1GZQA 3D0LB 4G5ZL 4K3EL 5T3XD 4LSTH 2FX9H 4G6AC 3E6HB 1IIIA 3MROB 2XKNA 4QKXB 4PRHD 1OTSC 4FG6C 2VSCA 3TV3H 4HETA 1HWHB 1TVDA 4P9HH 4ZYKA 5D7IE 3TNMA 2M1KA 2X89D 4FXTA 2FBOJ 3CU7A 3NQKA 4ACTA 2ZYIA 3BISA 4PGEA 2Z93A 1GW6A 4AVJA 5LWYH 1DN2A 4YQXH 3BWZA 1E3XA 1U8IB 4XAKE 1I1AC 3WS3A 3B9KD 3I75B 3X3GH 1L9TA 4IRSD 5AZ2H 1TVHA 3GBML 4FNRA 4C4KT 1KJ2B 4Z7QB 3MRGA 4MCZA 2E8ZA 3WTSA 4H25B 1E9OB 3NZHH 2F15A 4K7PY 4M7KL 4P2QB 1SYVA 4WJ5B 4AENB 3ULUD 3SKOB 3LX9A 1JV5B 1IT9L 1P1VA 3PHQA 4N26A 3DOIA 4KMLB 3RWIA 2YEZA 2VXQA 2FDBP 5EUOB 5INCA 5TPWH 1DSYA 1DUZA 2OL3L 3AXLB 3JWNC 5H4ZA 4H8WC 4IEFB 1C9SA 1G9MC 1EEUA 1OSEA 5FYLH 4NQVA 2AAVA 1ZA3A 3GHEH 4RGNC 1NGXA 2CK0L 5AVWB 1XSIA 3KNBB 3QNXA 4G8GA 4FYTA 5ANMB 4J12A 4ZRGA 1MCKA 4AQAA 3V52H 3GRWL 4GS7B 1CXEA 2GCYB 2R29A 1TU2B 3GJFB 1H15B 3KXFB 4JDTL 1U8QA 5CLTA 2XVGA 5CMAA 4Y2NA 2ZPKH 2B15A 4WLCA 4EUPH 1TKWA 4NQDA 1GGCH 1USQA 3NA9L 4JQIH 4ZUTA 4MXQD 2R0ZL 3UCQA 5E2VL 3RNQA 1CDUA 2J1YA 3RHWF 3W2DH 4FFZA 5IKCB 1ID2A 4H1LA 3PDOA 2PYEB 1GIGH 5C09D 2GTQA 2PWHA 4IKJA 4AM0B 5AW8B 3BSHA 2IC2A 2BVOB 2VDLB 1B3JA 3VXRE 1CFQA 4I3SH 4XR8C 4HS8L 4NZFA 1EHKB 4RAVA 2ZSVA 2FEDD 4JJOA 2VKWA 3V5KB 4S1QH 2X2JA 4KAQL 4JRXE 3WE1A 1PL3A 5B1KA 5E1AB 3ETTA 4L0YA 3HW7A 1IGFL 4OZGF 3EDFA 3HE6D 1ED3B 5G4OA 3R7RA 1EHAA 1YNTB 1KGCE 2HSIA 5C2BL 5IFJB 1DO6A 3Q06A 5KWYC 1AQHA 1EAJA 3T65A 4U7MA 4G83A 1LQSR 4I3GA 4QOKD 4J1UA 2N0MA 2YGPA 5L4FA 4NJAL 5GS1C 4MDIB 1HZLA 1EEZB 1AMYA 3QH3B 4ZNCD 1NMAH 4CDGC 1SEQH 1EJOH 3UJIH 5DJZB 4RQQA 2M83A 4JR9L 1UD2A 1UWYA 5L9DH 4LLVB 2FIRT 3RIFF 4OY9A 1S3RA 2H26A 3AACA 3D4GA 4HAKA 1TQCB 3R1GL 4OF6A 3GXTA 3BXNB 2WXJA 3OKLA 4KHTL 3O8XA 3OKNB 4XVUC 5BZDB 2XFXB 3CMOL 1ND0A 1TJXA 3JVGA 1AYRA 3O3EB 1FBIH 4DERA 2XACC 1VPOL 2VAAA 3QDGD 4OKVB 1KMGA 4QRRD 3MA9H 1BQUA 5IB5A 3WL9A 4N2BA 4B9JA 2OX5B 5IM7A 1I7UB 1S7SB 4NO0B 5T1LA 2Y24A 3F6JA 4D0BA 4E41D 3O8XC 4PJXF 1KFGA 1NA8A 1WISA 3WMSA 4JM4H 3DECA 5F7EL 4I1RA 1NBVH 3JVGC 3L48A 3P2DA 4UZUA 5EH1A 4BEIA 1RK1B 3CIAA 2D3LA 3G6DH 4DGIL 2DL9A 5FHAL 1INDH 5AB1A 2EEFA 4PRID 3V0JA 4E9SA 3TVMD 3NTCL 3FF8A 4MJ4A 5AD0A 2Z4QB 3VXSD 1M9WA 1VIWA 2P47B 1ZOXA 1B4RA 3OMZA 3CNKA 5BOJA 3K72B 1XGQA 3KPNA 5KBMA 2EVJA 2LOEA 3MRMA 4TNGA 2F5BL 4Y16A 5D7JC 1L7IH 4Z9KB 4PJDE 5GRVK 1U2CA 3GSUB 2NLJA 2ZKMX 3AREC 1R3LB 4JBSA 4HA1A 1KB5B 5GGQH 1KPRA 4D0DA 3VFOB 4B5EA 2CIIA 2H32B 4Y16C 1IGYA 4PG2A 3VFWA 5TJWK 2PYFB 2VZVA 3LQZA 3QGVA 4FP8L 2BY2A 1IKNA 3FQNA 5DFVD 5MENB 2XICA 3ZT5A 4HG4K 2CQVA 4GBXD 4JDEB 3ZOAA 1VF5C 1AD9B 1JK8A 3IFLL 1T80A 3BQVA 4WO4D 3MLTB 1UWGL 1I8AA 5F1OB 1IKNC 4NCC2 4PJ9C 2HPTA 1WV7T 2O6PA 1ONQB 5JZ7C 1CXFA 3IDXH 4XNQB 1RUAH 4ALAC 3G5XB 3BAWA 1JPSH 4V2BA 3ARTA 5TDNA 1TPXB 1JZHA 4CMMA 1UB5A 3FULA 1U8KA 5I8EA 5C7XH 3DTXB 1XCQB 1BWMA 3II1A 3CD4A 1AXSA 2JIXA 2XNAA 3EDJA 4NLHA 2XN9A 4L5FH 2OMNA 2HFGH 6CGTA 4U1MB 1Z9NA 1C5DB 5JXEA 1L9RA 4NM4H 5H94A 5B3JE 5SWZB 1H3XA 1T04A 1ZWIB 3O6FB 3B3BA 3R0NA 4LAJH 2A9MH 1QSZA 2GIXA 4N20A 5LVEA 3QA3B 2K8QA 5D1QD 1HC1A 1T7ZA 1NC2B 3BPNC 3FAWA 3MV9B 5DZ9A 2CJUL 3W0WB 2GTWB 3RNKB 1X6LA 4PU2A 5AW7B 3U1PA 2YWZA 1T03H 1FRGH 3ISYA 2ZG2A 4G7RB 2VDRH 3U7YH 4UQ2A 5BS0E 2DLHA 3WNKA 3MGOB 4H40A 1O9VA 1ODAA 1II4E 5BRQA 1D5IL 5I2IA 3WMPA 4ZMPA 4CNIA 4LARH 4MJ5A 5L8JB 4HKJA 1KJ3L 2WB7A 1EVUA 4KVNL 4OGZA 4KKZA 5SWSA 4ENED 4J3SA 4FLOA 1UM6L 4Z5RB 1IC7H 5FEBA 5I6XC 1HKLH 4OLXL 4MA7L 5H35A 2XQ0A 2ZZUT 1LO2L 4KQ3L 5FKPB 1UWEL 2W65A 1X5FA 4HJ1A 2D9CA 5JO5B 1JZ8A 4MVBC 2MCG1 4HSCX 1H8OA 3BN3B 3QXVA 4D9QE 5DJ6B 3U46A 3NFSH 4ZOEA 1QSEA 1LEGB 3MNVB 5HHQA 1T5WB 4BELD 3BWSA 3I02B 3VM5A 2XWDA 5SX5K 2OCJA 4PJFE 3JWOL 2EIZB 5TE7L 4E9WA 3TZVA 1S7WB 1ZK9A 2HUEA 1HQRA 5LXGH 4TVPL 1BIIB 2WSDA 4Y4KB 3V9EA 2V5YA 3CTTA 1RIUL 3P73A 3HN8A 4OCSL 3G6AA 1SBSL 2EIMB 4DGYH 5GZOA 5HYJB 1OCWH 2EXWD 4QNPF 4DP2X 1MW0A 4JFDA 3TZVC 2COQA 3QT2A 1UUSA 4WFFE 5AZUA 1UUNA 1KTJA 4PGZA 2JJWA 4RFNC 4MZRA 5IB1B 3KYMB 1DDTA 1KLFB 5I8OH 3LKQA 3HI6H 5HDBB 2IBZX 5GZOC 1JNJA 5DUBA 2H0PA 5E8OB 5E0QA 1HXMB 5HDOA 3ZMNA 4UTBA 3VXUB 3UFIA 6PCYA 1J86A 4LP8A 3O11B 1YEIH 3NJNA 3L1FA 1FE8L 1JGDA 5KSBF 1F3JB 1RZIB 4UTCA 2BVQA 4P46B 1J8KA 3FS9A 1X4ZA 1CLCA 2FJSA 5DQ9A 3F8UB 2XTJD 2YD7A 2A77L 4K94H 3T0VA 4DP6X 4Z8FL 4NO2A 1HDMB 5HYQA 2ZXDA 4OFYA 4UM9A 5JQHC 5LJYH 1BQHG 1UCBH 1ACYL 4N0CD 4ODVH 4PS8A 4R2GD 5B38B 2NR6A 3QEHA 1E9QB 1NIEA 2A5UA 4R83A 1VKXA 4TULL 1LP9F 2F5AH 4PW3A 4U1SA 1SJEB 1WFMA 3L1GA 2O72A 3MFFB 4QTIH 2EDTA 1LXMA 4GW4A 2AEQH 3LZPA 5AB2A 1P6AB 1BPLB 2DDQL 4XE0A 2O1AA 4G72B 4OFVA 3G9VA 3GRGA 2EYTB 1PZAA 4JFXB 3D7PA 3T2NH 3VD3A 4QAMB 2E9BA 2FQDA 2DTML 4LGRB 5EFIB 1MCHA 1QTYT 3AU1A 4POZD 3ZE2B 5CIPA 5FDYA 2V0AA 4FI8A 4NNYB 1KT2B 2FX9L 3AT8A 3KYOB 3OR6A 3GZQA 4YSPA 4XP1H 4XP4H 4XBPB 2QQQA 4P9HL 1I7ZA 1J0KA 1HNGA 3QO0B 4XMUA 3P9MB 2YGVA 1YDPB 4MRBA 4YQXL 4X4ZA 5CGYD 3X3GL 2HT2C 5ID1B 1ET8A 4ABQA 1QD0A 2DD8H 3MRBB 5AZ2L 4YK4B 4PD4K 2FX7H 3SY6A 1EEYA 3NZHL 2OJEA 2X5PA 1B9KA 1VDGA 2F8OA 4XNZB 1TO4A 3TCTA 3FUJA 2NTSP 3IFOA 3OF6A 3QEQB 1RU9L 4FTVA 2B8OT 3D85B 5L2KE 5CR1A 4L3CB 3IU3A 5TPWL 3TBSA 3EJUA 1JOIA 3TPUA 3BIBX 5DS8B 3DURA 4GXFA 4O2CB 1KN2H 3MACL 5B21A 3RAJL 3RGVD 2QMKA 3DX0A 1HT6A 3E2HC 4PTTA 5D5MB 5CEXA 4EJ1C 2QVTA 5FYLL 2W94A 5HHOB 5E08H 2IMMA 5F0JB 1LMKA 2ZP8A 1U8OB 5IW6A 3QDME 3LMJH 1U91B 3ZDYE 1A9EB 2DYPB 1R3IH 1AJ7H 3VQMA 1HHKB 5CEZH 1T83A 5IOPB 5LUMA 3RWFB 5F96L 2XI9A 1TLKA 4BCZA 1FO0A 3LS4H 4YSRA 3KBHE 3T8XB 2BOBA 4P05A 2YFNA 4KK5D 3EYSH 3UDWA 4ZMVA 4PWKA 4M3JA 5AW9B 1GGCL 1KZYA 3QG6B 2ORBL 2BSCA 3W2DL 3IGAB 4WWKA 3IMBA 2JKTM 3ASOB 3L3GB 3Q8CA 1D5MB 4HWBH 1LM8V 3SHSA 1PFOA 4XHJC 4EDWH 4KJPC 5IIEA 4HZ1A 5BVJA 3UDWC 2QDVA 3O3AB 4I3SL 2AV1B 3M7OA 1MRFL 5DT1H 1U2HA 3QS2A 2N1TE 4JQXC 5FO9A 1FJ1B 2EIEA 3QBTB 1G7HA 4S1QL 4BUQA 5ICYA 3DUUB 3HG5A 4XAKD 4M6NH 3BFQG 1LTXA 4PAZA 4YUEH 2YK1H 3GMLA 3OKMB 2H2SC 2A73B 2OAAA 1OGTA 1UG9A 4JO2L 1RSFA 4X80H 1E2ZA 5KJ7E 2Z7WA 3GSWB 2WQSA 1RP8A 3TJPA 2ZSWB 4FNSA 4HBCH 2CK2A 3LEYH 1D7FA 3WN6A 4GLRH 2ZXAA 4HF5H 3BSGA 3NJXA 3TJHC 3T1WA 1LQBC 1OARL 1T1WB 1NMAL 3NBNA 5CP3A 3OZ9H 1EJOL 1QI3A 3SOTA 3UJIL 3GSRA 4PJIF 2JB5H 4L3FA 2AJYH 2VC2B 3BPLB 5LGHH 5L9DL 1NPUA 1J9RA 2YD0A 3NN8A 4X6DB 4BCYA 5KSUB 4G8IB 2JTDA 3I6GA 4GSQA 1AAJA 3QIWB 2XOTA 1G7IA 3BO8B 3ESUF 4F37K 5CZXC 4AW7A 2UX7A 2EDWA 1S8DB 4JZJA 1FBIL 4N0UB 4DOHE 1EV2E 4G6FB 3MA9L 3T6VA 1K8DB 1DCLA 3AUVA 1R3KA 2VDML 2VUOA 1KNOB 1JZFA 2N1KA 4TQIA 3X11B 4M7ZC 4S11A 1F4XL 1SXAA 1NMBH 4Z7VA 4GXVL 4R8WL 1XGTA 2BSSB 1KUMA 1RUMH 4JM4L 1CGUA 5I71B 2YQ2A 4JZJC 2GIYA 4OZ4B 2AQSA 3HC3L 4ANKA 2MFNA 5DEJA 1N4XH 3CFKB 2AKRB 3MSPA 1OY3B 4BBWA 4ZTOL 4ADIA 2PW2A 2XJLA 1ZAGA 2LLNA 2PCFB 2J6EA 3H42H 4LL9A 3CZSA 4ZFOB 3KPRA 2PETA 1VGEH 1CFSA 2X2IA 3UTSD 3RDTD 4H8UA 4B9GA 3IGLA 4NO5A 4S1DD 5IROD 1T1YB 1L7IL 1AZZC 3CFDB 4AGMA 1KEMH 1T22A 2QGDA 5CZVH 3RUGA 5B1BB 5GGQL 1UT2A 5EBWB 5BQDA 2H6PA 3LIUA 5TQ2H 3V5DB 2L04A 4LOUC 4ZS7H 3HNSL 5ANMA 5T3XH 4TUKH 3S96B 1Z0NA 3VXQB 2OMXA 1Y0LB 5DJXA 2DQTH 1G94A 4MB4A 1OD9A 4F7EA 2VLRE 4FF9A 3TURA 8FABB 3D4ZA 5IZ7A 1QSFB 4ZPTA 4HUUB 2CLVB 3PWPB 4O9HH 2BOCA 2OL3B 2YOAA 3W9EA 2ICEB 4GS7C 3P69A 3VFSA 1TTUA 2FJFA 5C0GA 2VLJA 5JA8B 1K72A 3IDXL 5DJ2B 4F91B 1RUAL 3IB4A 5L4JA 4L37B 1JPSL 3B43A 4Z7QF 3STLA 3ULUH 4YSTA 3JWNE 3SDCD 4MKTA 3F83A 3L5WA 5E6SB 1ZVHA 5C7XL 4PJ5A 5T3ZE 3D3VB 3V5KA 4RGNE 1B2YA 3TV8A 4L5FL 5HHME 4OV5B 2HFGL 3FBQA 4PJGB 5EUOF 3ZXAC 1SJXA 3Q7JA 4UUJB 2BVPA 2V17H 3LVTA 4FXKB 1EZVX 4Q6IB 4OZGE 1ED3A 3ASNB 4KKQA 2A9ML 3TYFA 5IQ7H 4JFPA 2OSWA 2E9WA 2WTRA 5GSRB 3N6YA 4R97B 3NYKA 2HT4D 3C6LB 1JNHA 2ZX6A 5F89A 3RKPA 2NMSA 2YUVA 5EPMA 2VDQH 5JHBA 3D9AH 2H1XA 4I2XA 3TBWA 1FRGL 4P04A 3H0TA 4KROD 2D0HA 2VDRL 4MNQB 3U7YL 3V4VH 5G4MA 3DVGA 3UBXA 3ZYOA 4LQ1A 4RGMB 4LLVA 2JKWA 3QSKB 1A7NH 3G5VA 5HJ3B 4PM1A 1J8HE 1OP5K 1N8ZB 2MIZA 3KWWB 4P2OB 4LARL 3QUZD 3OKNA 4ZMZA 5B1CA 1URZA 1RZQA 1NUFA 3BH9B 1N5AB 1WA0X 1ZANH 3ARDA 2Z8SA 4RAUB 1IAOA 5CJ8A 3MX0B 4ZAKA 1IC7L 1YRKA 4YHIA 4YHZL 7FABH 1YEJH 1TQCC 1CLZL 2BY1A 1HKLL 1WICA 3EOTH 2R15A 1TSHA 4I0PB 5MI0C 4PJXE 5F8QC 3BE1H 3EJRA 5DGQA 1DBAH 2ZWYA 3RIAK 4K3GA 3ARDC 3QG7H 1KBWA 4ZAKC 3QHZH 3NFSL 3ZTEA 2J12B 4L8CB 2D31A 4GUQA 5FFOA 2CLRB 3F84A 3LNFA 3W81A 1YNTF 2AK4E 3US9A 3UYPB 2F1AA 2W91A 2ZONA 1IGJA 3QUYB 4RGOL 4PY8J 4Y8AA 4EF3A 1NCAL 1FN4B 3K72A 2H3KA 4POYA 1ZHKA 3QCVL 3VM7A 4WUUD 3UPAA 3MQIA 5C0JA 5LXGL 2XPZA 2RFXA 3GSUA 4WSJA 3ATFA 3D25A 4HCIA 5HGAB 4PVBA 1W0VA 1R3LA 3B3IA 1IRAY 2KZWA 5FW6A 2VB5A 4FADA 4BA0A 4Y1AE 4DGYL 3VFOA 1DQIA 2ZD0A 1NCGA 5D93C 5E9AA 1TTBA 3UTPD 3BUPA 3VI4B 4L4TD 2G5BB 5K1VA 1ZHNA 4AJVA 5DTFB 4MCYB 4GW5A 2F8XC 3O45B 4FHKA 1T3FA 2R1WA 5I8OL 1TQUA 1CE6A 2XQBH 5K39B 2UXVA 3VUAA 2YBGA 3CDZA 4EN2A 4U1IB 5G5DA 3T0XA 1NANI 4YBQC 1HEZB 4JY4B 3MYZA 4UQBA 3CSYB 1RHHB 2NXYD 3GZPA 4DO6A 1E2VA 3CZNA 3BPOC 4XAWL 5EO1A 1KEGH 3MLSH 1J0JA 4XNQA 4XX1G 3GZOA 5SX4I 4YVUA 2PR4H 3AROA 3FQWB 1FFQA 4K0OA 5AAWC 2HLFC 3ULVC 1WPCA 1C7SA 3EYQD 3QDJD 4UMGA 5INDA 1IB5A 4N1HB 12E8H 4PRPD 4BZYA 3DTXA 4XOEA 1ILSA 1HFUA 4MS8C 4Q89A 4UF7C 1UCBL 1S78D 4ODVL 3MREA 1P84K 1J0IA 1NM4A 2F2HA 4U1KB 1S7XA 1U2YA 3VFRB 4BFFA 2F5AL 3OWRA 2HT3C 3SKUD 3LEXB 5K69A 4HUVB 1OOAA 1PDKA 3VH8G 5AW3B 5D4IA 1WCQA 3ABKB 4QTIL 3KLHC 4JFEA 4BE5A 4PBVC 1BD2E 2QHLA 1NC2A 5FM8A 3WE6B 5LKNA 1QP1A 1E2WA 3DSNA 1EAOA 2Y36L 3MV9A 4UB0L 5FECA 4K7PX 1A65A 4AK1A 5GRYA 4M3KB 3T2NL 3O6FC 4KRPD 3B5TA 3DHPA 3E8VA 4XRCB 2OZ4H 1XB8A 1JZJA 2EH7L 3EJCA 2W07B 5EC2B 1ID5I 1PSKH 2J1XA 3VFUB 1MF2H 1N5YH 3LPOA 5DSCB 4E9LA 4L9LB 2B0SL 1VZIA 3EYUL 3TBVA 4DCQB 3SQOH 2CWRA 2L3BA 4XP1L 1BP3B 2GUOB 2HJKB 4JFFD 4TKWA 4WFFD 4XP4L 1S7RA 1HCFX 3FFDB 5HXMA 2QV4A 2Y6SD 5EN2A 2CXGA 4LCIL 5JUEH 3EO0A 1FZKA 2K7QA 3OWEA 3HRZB 2Y5QA 3D07A 1NCWH 2Q7AA 5IMKA 5EF3A 4LRNH 5C07E 1WIUA 2PP9A 2DD8L 4HC1L 2CUAA 5T1KD 1HU8A 3GMOB 2FX7L 1CPUA 4QTHB 4YZFF 3T77B 1IGMH 5FM4A 2LU7A 1JPGB 4TLTA 4FYRA 5FO2A 2X4QB 1JG9A 2ZCZA 3OLDA 4AJ0A 1G6RH 4E9TA 2YEVB 3PG2A 3GT6A 3MOAH 4X9HA 3S35H 3F7VA 4PWIA 4XO4A 1DVSA 3MLUH 5CWSB 5FR3A 5F71A 4LSUH 3CSBA 2XV3A 1QBAA 3GTNA 3O9WB 3TCLA 1IILE 4AKQA 5CD5C 5KN5A 3CQPA 5DVMA 4A63A 4Y4KA 3MODH 5D1ZD 3LMJL 2P80A 3V2AR 4OCXH 5FYKE 4TLKA 1QA9A 4FG4A 1R3IL 2R2CA 3DGGA 2LAAA 4UTAH 1PKQE 5CEZL 1KN4H 4QNPE 1VGKB 4X6EA 2YRLA 5F0PB 3LS4L 2LU3A 2F53D 4N3TA 4APQA 4N2LA 1MI5B 3RVVC 4Y4KC 3SYCA 3VFNB 4CW1B 3F12B 3CVHL 2B4CH 2BNQA 3GDCA 3PNRB 4QY8A 4GEIA 2NDFA 4JRYE 5ALBH 1HXMA 3SDXB 2FSDA 5DMKB 1EXGA 4M1CD 1E28A 1E9PA 4CVXA 2DYSB 3UBXI 5DJ8A 3C5SA 2VZ1A 4APQC 3VG9C 4EDWL 1QOKA 2OP4L 1GTFA 4OZFH 5KSBE 1AZNA 1U95A 3H9ZA 5DT1L 1UOLA 4LU5H 1IM9D 4AWJC 4R0LA 3HG1D 3MTRA 2W88A 3DBXA 2YK1L 3MLVL 3T5WA 1UXMA 4BDVA 3FU5A 1ES0B 4NN7B 4AC4A 1N64H 1MFUA 5I66A 4AH2B 4P46C 3LOWA 1X5JA 4R0LC 1LP9E 4X80L 3WUWG 3U9UA 1SLXA 3FYEB 3LH2H 4B9ZA 3A47A 1AR2A 3P0GB 4OF5A 43CAA 4JW3A 1V8HA 2NTFB 4HF5L 3G6JA 1MY5A 4LB8A 2YXWA 3X13A 3OZ9L 5JW3L 4YHPB 5C71A 3RB5A 2JB5L 4LCYB 4XO3A 5E70A 5LGHL 4JG5A 2ICWJ 2WOYA 2WQWA 3TA3D 3O0LA 3NRQA 2E6PA 5FA4B 3OXRA 4WDIB 4XWOC 3BZ4A 5DVLA 3N44B 4ZQTA 1BZOA 5EFIA 4XN9A 5HDBF 3P3YA 3TASA 3EXLA 3OQRA 4CKQA 4PFEA 1K6QL 4PMEA 3WCYA 1A3LH 1KT2A 3UCRA 4BKSC 3GSNA 2CO6B 1I3GH 3L1EA 1URLA 1XF3A 2ZYHA 5DMJB 3QIUB 4KITB 2XBTA 1NMBL 2CKBL 4KRLB 4BA8A 1QZNA 3BW9A 3Q5TA 3INOA 4AIZB 3M7FB 3GMQB 3OC8A 5FO8B 3LJ3A 1ZDSA 4KBPA 4XZUB 3T04D 2DH2A 5HI3D 1N4XL 5CAYB 2EDHA 2HVKB 2K3TA 3ARFB 3CHRA 4LLUA 1U92B 1DBJH 3MCKA 4J3UA 2XG5A 2XQYG 3H42L 4NX0A 4Y9FA 5KTEL 5C6TL 5LHDA 4YFLF 4PVMA 5KSVA 1PQZA 2DBJA 3LZRA 3AY4A 4L3CA 4MA8H 2XCMC 4YK4C 4U0RB 2PTUA 4IOIB 4FQHA 2CRZA 2E47A 2F19H 2VSMB 3TBTA 3BFWA 1KV3A 4QHMB 2VW6A 3HNTH 2LT9A 3NCWA 4IIZA 1RJYB 5CZVL 1JRHI 4XNZC 3UROR 2X09A 4PV8B 4OUUA 5TQ2L 1MJUH 4LOFA 4G71B 2NXZB 4MNGA 4ZS7L 3GB7B 2H41A 3LNGA 1J1XH 1WWCA 3CSGA 3HPLA 4TUKL 5E1QA 1U3HD 3WFEH 3ZE2F 4B9PA 3IPFA 4F3FB 2ESVD 5IOPA 4WFGE 3O4LE 3VMPA 2DQTL 4U1LA 3QZWG 3BFOA 1I8IB 5D55A 3UBHA 5J1TC 4O9HL 1NC4D 5DHVH 4X7TA 2DI7A 4PW9A 5C9JA 1AQDA 3VFGH 1I7RA 2WQVA 1PZBA 1JF1A 2D03L 4FRWA 4KKBC 4L1SA 1XBDA 3BP7B 4WGVB 4WFHD 3DXAE 4LLYA 1U30A 3MNZB 4ZMTA 3UPRB 1JERA 1T20A 1NKRA 2I07A 3ULUL 1F11B 1ZPUA 2RD0A 1UVQB 2H4EA 4P3DA 2PNDA 3WJJA 1TETH 5A3IC 2UYLB 1CC3A 1HYRC 4DTGH 1BYPA 3HS8A 4I5BB 1YVLA 1SVCP 4IBYA 4FXGB 1HINH 4GJTB 4UU9B 1WS8A 2WXQA 5D5MF 2O6EA 1P0SE 1BAGA 4RZKA 3QNYA 3CJJA 3WJJC 5ID0B 5ILTH 1ZSDA 4XBMA 5IBUG 3BZFB 4NBZB 2BHFA 2EYRA 3FQ4A 2EO9A 2VDQL 3FQTA 4PN6A 1AS6A 3EDKA 4XODA 5A2FA 4L1DA 3US0A 3WTYA 4GG6A 5JHMA 2IG2L 4BZ2A 4PJIE 5GGSA 4QRPD 5C0BB 4YMPA 4MXWH 1A7NL 3ZDWA 3QO1A 1D7BA 3HPJA 1C12A 3U0PA 1TEFA 2BCKA 2CHDA 2C9RA 4K71B 5IBTH 2P8PA 5C7ZA 1BW8A 1T0MB 2WCSA 3GSVB 4ELMB 3BPLC 4X2UA 5HDWA 3QHTC 1WCBB 3U0TA 1CQKA 1WRFA 2QQLL 1P5VA 1MCPL 3DROA 4GSXA 4F80A 7FABL 1YEJL 5GGVH 4YPGA 3EOTL 2ZUUA 3J07A 1OT1A 2JMRA 3BE1L 1DBAL 5EDSA 2V5SA 3NMEA 4RZCB 4NKOB 5AW5B 3QG7L 4ZO6A 2V7NB 3QHZL 3CFKA 1YYCA 1N6UA 3ZL1A 2YR3A 3S4SB 5I71C 4N6QA 4OM1H 1IFGA 1M6OA 4G7QB 5AOMA 1E5AA 3LB6C 3IKKA 3GMPA 2WQXA 3CH1B 4BFNA 1E5CA 1QPKA 5HHMD 5DJDB 1RJZA 4BQ8A 2JCCB 2KMWA 3EOYG 1GPOH 4LZKA 2V8MA 4NQEA 2Y3NA 3GI8L 3H6AA 4RSYA 3D39A 4DN4H 4XNDA 3L1OH 3LPWA 4P2RA 5IWLA 5GSVB 1NCCL 3WXWL 4X6DF 4IW4C 4P07A 3OGOE 3UTTB 4G8GD 1Y6MR 2Q8AH 3S97C 2AMUA 4E9QA 2QJDA 2D0FA 2P8LA 4IHOB 1CZ8L 1X7QB 3KYNA 5IWLC 5A6MA 3D69A 3ZHNA 1AMXA 5I1LA 1R0AH 1P4LA 3D18B 4NQDD 1KEGL 2NNAB 1A8ZA 4CBZA 5IVXB 1O6SA 4NQCB 3WFZA 1CTNA 4CJ0A 2CRIA 4MA3B 1BSIA 2FTAA 2YJLA 4Z7QE 5GRJH 1DEEA 4WGKA 4Y2DA 3HKFA 4Z0BH 4H5SB 4A1RA 5C2UB 2D7QA 1KDJA 4P2QE 4CBPA 1OE1A 5CEYB 5F3BA 2JB6A 3CXDH 3GKWL 3VMOA 3QPQC 1IBGH 1WAAA 4I4WB 3NSFA 5I15L 4ISVB 1KIPA 3FT0A 5EUOE 2DI9A 3TT1L 4UUJA 3E6FB 4Y2DC 3F85A 3IDUA 3UYRH 4Q6IA 1PIFA 2R9HC 4WK2B 1LYQA 2EAEA 3QJVB 3R0MA 4H0IA 2DEYX 3BUTA 3KYKH 2YC1A 3Q1EA 1A21A 1T2XA 2FECL 5IEHB 2XWTB 3WIHH 3EJTA 4J2QA 1OT2A 1WAPA 3DHJA 2WKOA 4NB7A 3PWVB 5T5NF 4Q6IC 1BZ7A 1UFUA 4FX5A 2FCBA 4PJAB 3GS0A 3KXFE 3MN8A 3W1ZA 1WC7A 4MQSB 1SPDA 2MNJB 3CN2A 4RMWA 5HJ3A 3C6LC 3IJYB 1PSKL 3QRFM 5D6DC 1MF2L 3IDNB 1UT9A 1CGVA 3DI2B 3N5AA 4J28A 1N5YL 2YD9A 3STBA 4ADJA 1CXLA 5GGRB 3IMRA 5FGSA 3SQOL 3O8XD 2CJ3A 4FI7A 1WITA 3LTVA 1K4DA 3BH9A 2PYEE 4JMNA 1M3IA 5JUEL 4HVBA 4RAUA 1M7IB 1T6VN 1WTLA 3SDAA 4P2OC 1Q8MA 1W72A 4LRNL 4XVJH 4AJYV 4DT2A 2A3TA 1SLWA 5T1LD 1ZPLA 2VDRB 3MRNB 1FWXA 1KB9J 4E9YA 1WAAF 3MJ6A 1IGML 3VD5A 5SV3A 1KJVA 1NDMA 2R1XA 4G43A 1RLWA 2O6FA 1EMTH 3SDAC 3GSXB 3UAJC 3FB5A 3DYPA 5D7JD 1SYSB 4B7IA 4KY2A 3MOAL 4I0PC 3WD5H 3K1KC 3O81A 1YZZA 3K7UA 1WUNT 3P54A 3JWNG 3QR1A 1K2DB 4DKFH 1BQRA 1EDHA 5TE4H 1KXVA 2B1OA 3FTUA 4S0HA 1P7QD 2Z31A 4ZW3A 5CCGE 1QTPA 4HFWA 4OGXH 2X41A 4Y16D 5E8DH 3DO7B 3ZQ9A 3MODL 1MH5B 3EGSB 4OCXL 4NHCH 4Z77A 3QUYC 3NCFB 1FG2B 4UTAL 2Z4TA 2EDXA 2RR3A 2JK5B 1J5HA 1MG2C 3TCXA 1AYOA 1M2VB 1RSYA 1JP5A 3GBNH 3EGXA 1SLUA 3U0WL 2H45A 2FUQA 2YAHA 3KL3A 4PI0A 1VFUA 1S2EA 2H3NA 4QO1B 4M3HA 3S37L 2IAAC 2NYKA 2FYVA 1YN7A 4MQXC 1AHWB 2NY7H 2JFCA 3TX4A 4XPGH 4WHDA 4BD4A 4XCEB 1MFDH 4FQJH 2H8PB 4EMZA 1XSOA 5AVUB 1SQMA 5CFAA 1ZJBA 2WZ0A 4LU5L 4OIBA 2AK1L 3MCLH 3RL2B 4CADA 1VSCA 2YAMA 1AKJB 4H1LG 1AS8A 5E99L 1WHOA 4JPSA 1IBFA 3OB0H 5DZOA 4WIQA 5BW7C 4HG4J 1N64L 1Z9SA 1C5BH 2JIXD 2YZ8A 2YHGA 1B0GA 5KVGH 2PABA 3B9EA 4N2NA 1VACB 5JXED 1FFNB 1GY2A 2F58H 2R0KH 1S9VA 2JELH 1JWSB 4TVUA 2VITA 1LNUA 3SZ6A 2MKLC 3NUKA 2HPOA 1MVFA 2ZJSL 1CBJA 1PYWB 4X6CB 4XBEH 3VI4F 5FDWB 1MCRA 1XF4A 5CILL 4LLWB 4WKXA 4M8QB 1VRSA 5MENE 3C09B 1PS3A 5BPPA 2DN7A 5I17A 5EA0H 1CDHA 4Z7WB 3CC1A 2G60H 3EHBB 1H6TA 2LTQB 1N0XH 1A3LL 5K1JA 5DSCA 1LDSA 4M9OA 2WBXA 2WQ8A 2HRLA 4X6BA 4XBGA 1NCUA 1GJUA 4I0KA 1KJMB 4R90H 5KVDE 1QO3B 1I82A 4JHBA 3FT4B 5CSZB 2A7BA 5SWSD 3IGUA 4A2FA 4TF4A 3CZFB 2E8YA 4L9LC 3EUDA 4HJ0C 5DYOB 4N87A 2F68X 1IM3B 4YZFE 1T5XA 1WF5A 1G5AA 3UZQA 1DBJL 1JPGA 3NJFA 5AB9A 3MJWA 2Y7QA 4JVUA 3ROLA 4H8VA 5I0DA 2CUHA 2Y5TB 1T2JA 2WLJA 5EIIB 3VJ6A 5A1AA 5KSAA 5SWZE 2EO1A 1K9TA 1WZMA 5J57B 1Y1UA 1QSED 3FCTB 3CDGB 4MA8L 4AQ1B 4XCNB 2VGLM 5A7BA 2F19L 1KCVL 3PGCB 5CP7B 4OZIA 1CIDA 4ZTPH 4G9FA 3W0WE 2QPDB 3HNTL 2KZBA 2V9TA 2WUCH 4A37A 3BI9X 3V7AG 3TZVD 1MJUL 2VUYA 1G1YA 1J1XL 3WFEL 1QVOA 4G1MB 3TEYA 1WWWX 5AVSB 4J8RA 4C56B 1U8NB 1ZHBB 4XOCA 3HBGA 4BUHA 5GZOD 3PIQB 4PJ8A 4Z3GA 4X5QA 1Q9LA 3O9WC 1WD8A 1AXIB 4JFDD 2R0WH 5EZJB 1O75A 3KLKA 3IJEA 3BAJA 5CU5A 2XXGA 5E24E 1A3QA 5L7XH 4KKLC 4QWWD 3JT2A 1FNHA 2FYYB 2R23B 4KMTH 3VFGL 3PDDA 2ODIA 1PAZA 2FJHA 2DLTA 5EU6A 3V5HA 4PJ8C 1MWOA 5I1AB 1ZV9A 1SEBB 1UKQA 2IALA 1S7UB 3QUML 1F42A 3C6SA 1QBLH 3HC2A 1G9NC 1XDTT 2B59A 3EG9A 5F9OH 1FZJB 2C1OA 1XZ0A 4OCMC 3ZT7A 4DAGL 2FSEA 1TETL 4N2EA 2Q8BH 3S98A 3S0PA 4DTGL 3H56A 5FA3B 2ATPA 4JZOB 2L7EA 5CCHE 2W80C 3GLDA 3DLQR 5BOZG 2ADGB 5JW4Q 1LVEA 1HINL 4UM9D 4OFYD 2V5TA 5BRZA 5E8PB 1S9YA 5I5MA 2NR6D 5ILTL 2Y0SA 2ENSA 3IJSB 3DWTA 1FVEA 1NMCB 2XLLA 2AGJH 4QJ4B 1UYWH 3SCMB 1JPTH 4OR1A 2KC0A 2J44A 2ZUWA 4GUCA 3U2IA 5L4MA 4O2FB 5F72S 2M26A 5HYJE 1YY8B 1F58L 1JDCA 1YYMH 2ENPA 3X1NA 4ELDA 3K6OA 3A4AA 4MXWL 4P4KB 4A6YA 3TH3T 5HDBE 3AMLA 4BH8A 5IBTL 4PGBB 2XVBA 3SDXF 3SBQA 3K8KA 3FQXB 3VXUE 5D72H 4P4RA 3SGKA 1M05A 1FV1A 4KTYA 4NQSA 4Q9QH 5D96C 2HT2D 1CDJA 5EO9A 3WG7B 1JF6A 1AGFB 3DOHA 1I7TB 4U6HA 5GGVL 3LHPH 2J5WA 1UJ3B 1YLBB 2E27H 3U9WA 1UD6A 2ZCHH 3AFLA 3MRQB 5ETUB 1P5UB 4DP4X 2IQ9L 1FGVL 2AXJA 4M6AA 4OGAD 1GMEA 3SGKC 2YN3A 3BRGC 5IJKA 2EZ0C 2Z64C 5EMYA 3QIUC 4JFYB 2WNXA 4P57A 4UIMA 2GITA 5FOBB 5EZPA 1U92A 3SE9H 4DO4A 2X1OA 1DQJB 2CE6A 3F5WA 1FPTH 4G6JH 2HRHA 3OF6D 4FTVD 1OWRM 3F58H 1GSMA 2AAAA 5JDSB 3HHRB 1GPOL 1KIUB 3ARFC 35C8H 1A1MB 1XCTB 2A6IB 2ZE0A 4IBLT 4DN4L 1IZJA 3KPPB 3L1OL 5CLWA 1D6VL 2VDOH 4P9HC 5FUZL 3BEVA 5DR5H 3BKJH 5F88A 3N44F 2ARWA 4CUCA 4IBZA 4PD4J 4PYGA 4F3FA 2Q8AL 3ZE2E 3BZEA 1DZBA 4XN1A 4MD5A 2GBTA 1M1SA 3L2MA 5T1MA 4P23A 1GTNA 1A6AB 3L8QA 4EDXB 4RAHA 3VCLA 3HI5H 5AENA 2BWIA 2NXZC 2TSAA 1R0AL 1ZLVH 4JO3L 3DHMA 2ROYA 1G4RA 1TCRB 3GRBA 4HIJA 3B6SB 3BVDB 4PHXA 4IMLB 4YO0A 1DVTA 3TNNA 2QQKL 4P23C 3LZQA 1OTTD 3CAFA 4MSWB 4WWKD 4XMWA 2BSTA 3Q5YA 1TJIH 5GRJL 5C97A 2Y69B 4Z0BL 4L3EA 4PRHB 1TJMA 3VYNA 2H2SD 1WFOA 3CXDL 4BIKA 1YJDC 3QEQE 3KPMA 5DU7A 3G5ZB 3SKJL 2JJTA 1IBGL 2UYLA 3EJJX 3OMIB 4B3EA 4PP2A 5F3FA 3ECVA 4I5BA 3HB3B 4W81A 3FCSB 4FXGA 4HCFA 3B9KB 1ADQH 4NKMB 1FVCB 1A7PH 4WFEE 4IRSB 3W39A 3OMAB 5D5ME 1QG3A 4X9IA 3BLPX 3KYKL 3L3KB 3NZUA 4KQ4H 5HHOE 4JK0D 4A04A 3BZFA 1MQKH 1A6ZA 3T0BA 2WMPB 3IDJA 2VLLA 5LCVH 3WIHL 4B0MB 2JKLA 4FXGC 5F7AA 5FF6B 2OW7A 1H9VA 4GAJL 2EVHA 4PBDA 2A9NH 2WPGA 3DOSA 5J1SC 4LKCB 2C7FA 1TZGH 4UDUB 5E03A 2F7QA 3PNWA 5FW7A 4LEBA 3UAEA 3BUIA 3R8BB 2N0KA 3K74B 3LXBA 4G8FB 1TMQA 3AU0A 2AW2A 4J39A 3EOBB 4JN2B 4MNHB 2K9FB 4F5CE 2ADFH 1HZHH 2PWGA 3CWGA 5KBLA 3D2TA 3ESNA 3RWJB 3BDXA 2YO3A 3MBEA 2Y7NA 2X6UA 1HXYA 2NY3D 3HN3A 3KGSA 3L4ZA 2GB2A 4FG0A 4HS3A 3MNWB 3C2SA 5AKTA 2VDQB 4JGJA 4GIOA 4AEFA 2MCPL 1U3YA 4M1DH 4XVJL 4I48A 1A4JA 2O5NA 3HIZA 4IJTA 4K3JL 2CO7A 4RFOL 2C9UA 4XC1L 3V4VB 2O61A 3PHOA 1XO8A 4BZ1A 1D5XB 1WBZB 3BHBB 3ES6B 4OT1H 5KG9A 5CGTA 1TMCB 4GPVA 4UANA 3JSSA 1WAEA 4U1NA 1EMTL 1U6AL 2A2QT 5C09B 4NHUA 3RWEB 3S4SA 4ZFFA 3D08A 3WD5L 1E27B 4PVLA 2NUPA 3GGWB 2BX5A 4GB9A 5HYFA 4W4OA 2WJ5A 3WIFB 4DKFL 4JZNB 5TE4L 4W9EC 1G1CA 1V5JA 5FB8B 5I1CH 4LOUD 5J1AA 1U4FA 4X4XB 1D2OA 4JDVA 2DEXX 4LBEA 4JUSA 5E8DL 2FGWH 4P3WA 1TTFA 4ZOAA 3B9VA 3GEWB 3B83A 3GSQB 3O2DA 5AW4B 3HE6B 4HH9B 1ZTMA 5GSVA 5JMOC 4M9PA 4N0FA 2QADB 4X6DE 4HLZG 3UAAA 2CCLA 1NJ9A 4OLWH 4F1SA 1KDIA 3UTTA 3W57A 4PLKC 3B9DA 4U6VH 3GBNL 3OKOB 1EUUA 3ZTJH 1R24B 4ELMF 4N0UE 2ZWSA 3HG4A 2XWRA 3LVEA 5FCSH 5BJTA 1X7QA 2CO2A 2CO4A 2XTLA 4F33A 1EANA 5CXPA 4M93C 2OMTB 1FH2A 1I8LA 2NY7L 1MCQA 2Y7SA 4CVWA 2C9VA 3QJHA 3MRLA 3FYIB 4XPGL 2I32A 3D8MA 1MFDL 1VHPA 4B9IA 1TOXA 3IJ8A 2DWXA 4PRNA 3V0VB 2E4TA 4NZRH 2VLJD 4UDTA 1MUJB 3MCLL 4FFVC 3V6OA 4Y2OB 3E1ZA 2MPAL 3QDGB 1MCDA 2X4TB 4H8WH 4QRRB 4QPEA 1I8LC 4YR6A 3VSVA 3TN0A 1OCCB 3V0HA 5JR1L 5AW0B 2YSSB 2VXQH 2BP8B 4E68A 3O6MH 4UQ9A 4PJ5D 1QR1B 1BF5A 2IDCA 2EIDA 3I84A 4JO4H 3HCVA 2CCVA 4ISVA 3OHXB 5KVGL 3TF7C 2XT1B 3MBWB 3Q2LA 2JCCF 3E6FA 5GJTH 3V6OC 2Y9RT 3X12A 4MKMA 4MA1B 5DO8A 4KQ0A 3S36X 2R0KL 1UACL 3PXLA 4KXBA 3CFNA 3TN0C 4PRIB 5G55A 4UV4H 4AM0Q 2VXSH 3OGCA 3HMXA 3W5MA 4OGQC 5HVFB 3FONB 2AC0A 4U3CA 1JHTB 3VXSB 3V0FA 5AOLA 2ATKB 5E4IA 4LDLB 4I89A 1AGDA 2C3HA 1SFHA 2QELA 4XBEL 1HNYA 5E6IA 2R29H 1X7TA 5F7MC 2BC4A 1F8TH 3BDBA 3POCA 2Y2YA 3BJLA 4Z7NB 1KGJA 5EA0L 1QSFE 2G60L 3SYAA 3PWPE 3LPGA 2BSRA 1NBCA 3TU6A 1NCIA 1Z32X 4FFZH 4ATWA 4ZMNA 2BHZA 4H1LH 2IWGA 2FIKB 5EOCJ 5IVXF 1HHIA 4TLUA 5I28A 1P4BL 2MOQA 2W9LA 4MQTB 3QXAB 3ARDD 4DQOH 1J8RA 3MRKB 4ZAKD 1AHKA 1XIWA 2GUYA 3FSZA 2YBRB 3WIIL 1NUNB 3FT3B 2X2HA 2WNWA 1LO3H 4QF1B 3D3VE 4WO4B 2ZG3A 3EXJA 2XYCA 4Z95L 8PAZA 2VWEE 3DJTA 3U4EA 4PJGE 1T7WA 3UTOA 1WIPA 4NZUH 1QFPA 3B2MA 4F9LA 1H3UA 3AC0A 3H9SA 2QVIA 5A2KH 3LRMA 1UXSA 4GSUA 2HLAB 3QJFB 4ETQA 1BQHB 3AG3B 3GXMA 3HOGA 1U8HA 1FSKB 2ICCA 1ITCA 2WUCL 5DK0B 1ZD6A 3BUBA 5KANI 1AE6L 2Z8WC 3H9HA 3VVWA 3DO7A 1U9KA 2IDUA 4PJAF 4MNQE 5D7LE 2F7RA 4HISA 4C4BA 3L3IB 3X17A 3GK8L 4JB9H 4ZW5A 4UT7H 1W80A 4DZ8A 1UH2A 3LKRB 2DKSA 1G6RB 1XMWA 4HFUH 3LEVH 3DHUA 5D1QB 2OZNA 4W6WB 4XT1C 5JOFB 1F90H 3I9PA 2IAMA 5EOTA 1NEZB 4RFEB 3NCEB 1CCZA 4LVNB 5H2BA 1OCOB 3PABB 2VR6A 4FA7B 3IJHB 4HGKC 3ULVD 2NPLX 4KZEL 4XXWC 1FYTE 2KH2B 4XO5A 1E90A 1BZ9A 1QBLL 2N7SA 4XNBA 4MS8D 2V4LA 4GI8A 5F9OL 4YN3A 5IQNA 3PAVA 2Q7YA 2K6WA 2A6KA 3RL2A 2Q8BL 2BJMH 1BAFH 3V8CA 4KK9D 2HT3D 1AHWC 3HZKB 4S1RH 5F9JB 1RIVH 2DV6A 2J1WA 4EZMA 4FABH 5DEGB 3P3TA 3G08B 3PWJB 1V54B 4O4YH 4S0TD 1JFHA 2FO1A 1LD9B 2AGJL 4CC1A 1UYWL 4G7SB 1JPTL 4OZFB 3FPXA 3P4OB 4X5LA 3SJVB 1W16A 1BAWA 3QRGH 5KZCD 4JFED 4KO7A 4HAGA 1NC2D 3SD2A 1PYWA 2X87A 1PD1A 1YYML 3MV9D 1HKFA 1NGZB 3VI4E 1PCSA 4RESB 1X5GA 1HH6B 3BMVA 5BV7H 4QHLB 4ALAH 2VO5A 1ZA6B 5C0CA 1YPZB 3STZB 5D72L 3HEIB 4K94C 2CIKB 4Q9QL 2E86A 4YLCA 5GZNA 3OL2A 3C09C 3LHPL 3LRGA 3LV3A 1QO3A 4HJGB 3PYCA 2XXMB 4G80A 3SO3C 4RWYL 4J2XA 3IAGC 1MFAL 2EO7A 4HWEH 3MRCB 2LTQC 3MO1B 4TYUA 3TEXA 3BD5A 4Q97A 1OT4A 2YFOA 3ARYA 1IGIH 1DBMH 3FOLA 3G5YB 4GIPD 3QJXA 1IBHA 3DK2A 3PWNB 1A4BA 4ZX5A 1ZDQA 1JK9B 3IXAB 5AW2B 4DKEH 2BCMA 3AY2A 4G6JL 1J05A 3DUSB 3BLKA 2DYRB 3CDGA 1Z9PA 1XF1A 3VRLF 2XTJB 1AGCA 3WXVH 2F7IA 35C8L 1QUPA 5FWQA 4GRMB 2ZP9A 1H5BB 3UC0H 3OR7B 4X6CF 3RI5F 4Q2ZA 4GRLA 3BAXA 1GGBH 2Z1KA 3G04B 5CN2A 2MCAA 3POHA 4R2GB 1AGEB 1UXWA 5CJXC 2VDOL 4Y4KD 5DR5L 4AQ1C 3BKJL 3RVXC 2DWEB 2P80D 2OLDA 5E00B 4XP5H 1IFHH 4Z7WF 1F3RB 2R51A 3FRPB 5JMRA 2Z91A 4TSBH 5AFAA 1S9XB 1VESA 3N9GH 1MHHA 1IGTA 3HI5L 2C9SA 4APQD 1KCSH 4BHUI 5A2BA 2VN5A 3KPTA 2J21A 1FFPB 4JG0H 2GHZA 2A6JA 2EDKA 4KGLA 2CBTA 3SIKA 4TTDD 5K59F 1NM9A 4P5KB 2DL2A 4N5UA 1EO7A 1TJIL 1NLBH 2CM5A 3SPVA 2HKHH 3ILDA 4NO3A 5ERWA 5I1JH 4PRAB 3VVVA 1V3KA 3DGDA 3TJEH 4D8PB 4F8PA 1MLBA 4J6IA 3GD1C 4JZOA 5DFAA 5DHVB 2GQHA 4BCXA 2OMVB 1A7PL 4QI3A 5C0EA 2GT9B 2P5EA 5AYUH 2Q76A 4KQ4L 4HZLA 3U6RB 1NAKL 1MQKL 6TAAA 4AGNA 3UEZA 1ZXQA 3VD0A 2VISB 3SCMA 3HBQA 3Q0HA 4XWOD 2XY2A 4O2FA 4NN6B 3S88L 4XCYA 2WZAA 2A9NL 2BP5M 2QGBA 5CKAA 2KBGA 3ABZA 1MI5E 2VL4A 5DVNA 1NMCC 4GKZB 3RGVB 2MQCA 5F1NB 2JXMB 5EO0B 4F93B 2ITCB 3SCMC 4P0DA 1I1FA 2GYSA 4YSSA 3QXDB 1HZHL 4UTBH 3TWCH 4PGBA 1UHVA 5IV2A 2OSLA 3SDXE 1RZJL 1ZKAA 2NY6D 4TVPE 3SBRA 4KFMA 1NWOA 3RILA 4YC2B 3VU2A 5DQDL 4P4KC 4X0KA 1QBBA 3ZHLA 1BF8A 4RMTA 3PFQA 2YQ3A 3IF1B 4GYBA 4M1DL 5EDXA 4UAHA 1AIZA 4CSTA 1Z0MA 2DS4A 3X1BA 3VFTA 3RWDB 3GMMA 3HUJB 1P1ZB 1C08B 4FTDA 4XO8A 5DZNA 3BGAA 1ET7A 3C60B 5CLYA 1UJ3C 3TFKC 3T0DA 3CC5A 3WKNA 4EN3A 4E9VA 3NDYE 4BK5A 5J4MA 1FDLH 1P5UC 2NY5L 2PWEA 2VXTH 4PJCB 2AQTA 3CFJB 5HJGA 4QRUB 5I1CL 4GMTH 5JDSA 1EFXA 2JKXA 4LRIC 2IMNA 2R2HB 1KIUA 1BV8A 2NYYC 5L6YH 4ZMQA 2A6IA 2EKJA 4EN3C 4YDIH 2P7TB 2N56A 1VZHA 1OSPL 2QLVB 3D2UA 1JGLH 2DQCH 1WA1X 3PQYA 3L4VA 3MUJA 5CIPH 4OLWL 3NJMA 1RFDH 3ARBA 2VQTA 3V0AC 2YUZA 3OKYA 1INQB 4KKBD 4XNYH 4XX5A 2VAJA 5JW4R 2XZQL 2BIQA 2ZAIA 4XPBL 5KS9B 3FF7A 5IQOA 2OA9A 1JF5A 4OI8A 3NFNB 2ED6A 3B6SA 2AJXL 3H3PL 1IE5A 2D2CC 3ILPB 3TYGH 4JRWA 4U6YB 1PEZA 5AQ0A 1A6VH 4IKKA 1BYNA 2WOBA 3C9NB 4NZRL 1NIDA 3T71A 4Y9EA 2IOOA 4H8WL 2CUMA 4AXWB 1G9ML 2OQJA 2B3IA 3UYOD 2OYPA 1E6JL 2DWDB 1DLHB 4YGVA 3VAEA 4M1GH 1A6PA 3CZGA 3O6ML 4WWNA 3HS0A 4BFGA 3P4MB 3ZKMC 2J20A 4A7GF 4OI7A 2OTWA 2CBPA 1U8PA 4QUOA 3FOMB 5A2JH 1OSYA 4OJDH 4HLZH 1GZHA 4P48A 4JM2A 1OD7A 5FO7B 2A6DA 1E50A 3GLAA 4ENZA 3L3KA 1PEWA 2BSBA 2OYMA 2VXSL 4NPYB 2FQFA 4OJFH 4LCWA 4NKDB 3N40P 4X4ME 5I6KA 1X7SA 1IVTA 4KI5E 4KPHL 3HB3C 3NCCB 3B9KC 4HKXB 3UTSB 2ZX7A 2R29L 1FO0H 4IRSC 1GZHC 1IC0A 1F8TL 4OZHA 3N1QC 3X2QB 1GS7A 1RPQA 2IADB 3NSJA 4PCYA 3WFCH 4O02A 3K46A 4HUXA 3NJGA 3FU7A 4KDTA 1H3GA 4FFZL 3H4HA 5FYLE 1FVDB 4IRZA 3ZL4L 2Q2EB 4F7MA 4F7CA 1SN5A 4AZ8B 1G5GA 3R19A 5I16A 3TWYA 2ZOKB 1F45A 4A2LA 5ICZB 1MJJA 2Q2LA 2AJ3A 3S8GB 4AEEA 2BXYA 4A38A 4FERA 1KCBA 4KX7A 3PL6A 5CBEB 3HA0A 1QRNA 3RX9A 1D9KA 4JUTA 2HMID 4OTXH 4I3RH 1WBZA 2DQFA 3ES6A 3LB6D 4NWTH 1ZIAA 3QWRA 2LU5A 4JANB 1D7CA 2ZAHA 2GY7B 3DDFA 3SGEI 4NZUL 3OJ2C 1MHCA 3T9WA 1CG9B 4WI0B 3RWEA 4PHZA 1D9KC 2YPLA 5HY9B 5EUKA 3SDCB 1PPIA 3NPSB 4MXQC 4K8RC 3ULUF 3ZSTA 1A3RH 5CP3H 1JZ7A 3VRJB 2MNWA 4F9PC 4WKZA 5EZIH 1FHGA 1L4IA 2NY1D 2FLRT 5B8CB 4NQED 3KPOB 4DEUA 2Z7ZA 3D39D 5D7KD 5C0BE 2PP7A 2ZOOA 4UT7L 3KGRA 4P2RD 1UFGA 3DX7A 2FEDC 3LEVL 4HZAA 4LSQH 3TT3H 2V2WB 1FZOB 5F7KC 3QCTL 3VB9A 4MMXB 4RISL 32C2B 1OAYH 4D9LH 1JV2B 3REWA 4ELME 4JE0A 4U1HA 4HDIB 4LL4A 3OAYK 1K4CB 3HE6C 1BVOA 3N1GC 2AVFA 5KJRL 4HIXH 4B60A 1YEDB 2QADC 4CU6A 2GPZA 3JV5A 1CE1H 2X7LB 3JZYA 2BFGA 4GKNB 4JO1H 3VG0H 4YDJA 4Z76B 3P4NA 2EP6A 1FL6B 4JPIA 4W70A 4Z7UA 3V0VA 5J6HA 1AD0A 4MJ6B 4TNWK 3RTQA 1I8KA 3FQ1A 3KH3A 2BJML 1BAFL 5HHXH 1AGBB 2J6EH 4Y2DD 4FQXA 4S1RL 5JPNB 3BP5B 4PGCB 2R9HD 4LP4A 4MRCA 3FDWA 1WSST 4Y0GA 1RIVL 5ADPH 5DEFB 2V2TB 4FABL 3EF7A 3NABH 2Y2WA 1IEAB 5F7WC 4X99A 4FKKA 3WV0A 2BXZA 4O4YL 2ROXA 4HS6B 3P40A 4FN0A 2QSCH 1NCHA 2HP4A 5IG7A 2JCCE 4HMCA 4BFEA 1M56B 3SOBH 4PJ7B 1YYLH 1D6EB 1XH3B 4OJAA 2B5IB 4IU2B 3QRGL 3A24A 5HGHB 2VQ1A 1CDGA 3OLIA 3BLBA 3OHXC 4YJZL 2DJUA 1I1CA 2QPEB 3QQXA 2CLZA 3V9CA 2EC8A 2C1PA 1WBYA 2VOTA 2ALWA 1ULVA 4KX8A 4WUUB 3MU3A 4ALAL 4JREC 1EJ8A 2X4PB 5IFHH 1HSAA 3VI3B 3ZQWA 2FNWA 4ODHH 4H88H 1PX4A 4GY4A 5KW9H 3HLAB 2GSIA 2CA3A 2RB8A 1CLVA 4CRPA 1X5AA 3IS0X 5IVXE 3PCYA 4L4TB 4NQCE 1BX2B 4AV5A 2ETWA 4B27A 5EC1B 4KOBA 4Z3IA 1WIOA 1A6TB 1L9SA 1OALA 1KFAH 3IM1A 1FZMA 1I85A 3SDAD 2AF2A 3UAJD 1Q9KA 4H8HA 1F4YH 1IGIL 1DBML 3NACH 4HHAA 4XE5B 4KTEH 5C8JB 3HHSA 2VMDA 3BT2H 1U21A 2NXYB 5C0FA 1MCCA 4DKEL 4M48L 3RWGA 4PEEA 3RY4A 1I85C 1ODUA 4PJBA 2WZ5A 4E2OA 1N6VA 4YHOH 3VO0A 3O41A 3QDJB 3SYPA 3WHE0 3WXVL 2HLAA 1DQDL 2R2EA 2BNRA 3BWAA 3L9YA 4PRPB 5JA9A 3KWTA 1DYZA 1BYOA 1I1RA 5ITFB 1DVUA 3UC0L 5T1JA 2Z31D 4HCGA 5F7UA 2WAQA 1RKRA 4KWUA 5FYKL 3WUWB 2EXSA 1LEIB 4PJAE 4ESKA 2UY6B 3U30B 3MGTA 4L5FE 43C9B 4L8BA 1F5WA 1P7KB 1XVSA 3C8DA 4MB3A 4Z7NF 1NDGA 4UT6L 4CSZA 3L95A 4YSAA 4BUGA 3T0AA 4ERSH 1FSKC 2A99A 3PV6A 4JJ5B 3T8MA 1NIFA 3N43B 2BMKA 3N9GL 4GW1B 4OM0H 1V55B 5LN4A 2QSQA 1KCSL 4F8OA 1T1XA 1OK8A 4JG0L 4JKPL 5T5NG 5DQJB 2FL5A 4KRPB 1K5NB 3PABA 5JOPE 1BZ8A 5K9KA 4G6MH 1QACA 2Z92A 3IJHA 2JJSC 2WWMD 4OCNC 2EICA 2ZNWA 4HPHA 1R5WA 4F7PB 2R1YA 4U0QB 4BINA 2DMHA 3DRQA 2HKHL 2WBWB 4IOSA 1ZVSA 2J6WA 1RY7B 3K6SB 1ESOA 4LVNC 5AVZB 2ERJB 4JFFB 1QUNA 2IEPA 4RSVA 4HIIB 3BIKB 4W9GC 3TJEL 1DSFH 1ML0A 4BWWA 5I9QB 1KBVA 1UD8A 4M8UA 2XX1A 2B2XH 2FJGA 2GSMB 2WVVA 3FFCA 5EOCH 2A38A 4H44C 4UNIA 2HG0A 3P02A 3KJ4B 3PWJA 1ORQA 2NT0A 3LYRA 1UZ6F 5T1KB 3WDIA 4ENEC 1QEXA 3DV4B 3WHXB 2UWEA 1OSZB 1P4IH 3CK0H 3CX5J 2B4CC 1YN6B 2B1AH 2IPUK 3SJVA 2J73A 1CD1B 2YAPA 3GDBA 3MJ9A 1OP5H 1GYVA 1CS6A 3ZZLA 5C0AE 4PRBA 3QUKB 4P5MB 1NCJA 3PREA 5LQBH 3HZVA 3WNMA 3MRFB 3FUHA 1OAZH 3ULVH 4AE0A 4ZSOA 5L2JB 4LQFH 1A1OA 3I50H 4UTBL 1ZLUK 4G9DB 3TWCL 3MRPA 1TO5A 1JD7A 4E9RA 3QZWB 1J7VR 1FAIH 3MJ7B 3K71B 4J6RL 4TSAL 4W1TA 4YDLC 3EJPA 1SVBA 1EZUA 2XDHA 4HX1A 2F53B 3S34L 1DDHB 2YD3A 4AQ8A 4CA4A 3ULSB 4JDZA 4N2KA 5IQMA 5JHLA 2ZWZA 1DANU 2X6BA 3X1FA 4N22A 3PHAA 1S7TB 1XH1A 2A0LC 5E9DA 4OQTH 3VXPA 1PU0A 3S3JA 2FWUA 4KDWA 5B22A 1BGXL 4TNVF 1ZS2A 2ZF9A 2YN5A 4GKSA 3PWNA 3ZYZA 3CVBA 1EXUB 5DRWA 1JK9A 1YNKH 1FDLL 1JHLH 5KSAD 4Q14A 1SJHA 5JHDB 1R3JB 4WK4B 1IM9B 4GMTL 1IO4C 3UO8B 2G30A 4NPKA 3HG1B 3VRLE 5IJVA 2ZX9A 4KY1H 2EEXA 1EHXA 5L6YL 2WLLB 2RAMA 1NCDH 4YDIL 4X6CE 4G9FD 1SQ2N 3SQBB 3RJOA 3WFHA 1ZHLA 5IBUB 2E9IA 1JGLL 2DQCL 3KWXA 3QAZB 4QLRA 1E42A 1PLCA 2X4SA 3LH9A 4Y4HB 2XTJC 5TFSH 1NICA 1RFDL 1T21A 3AT9A 3FO2A 1L9PA 4RA0C 4Z7WE 1YPZF 4HD5A 5I75B 1UH3A 4DWHA 4PJ8D 4XNYL 5I0WA 1WHPA 1CU4L 2Y4SA 2YXVA 3GIZH 4N0CC 5DS1A 2E0PA 2EDEA 1N6QL 1MI5D 1G43A 3QWNA 1JXJA 3RVTC 4KZCA 5E7BA 3TA3B 3PPEA 1EHLH 2H0EA 3KLAA 1AZUA 5GISL 5EU6D 1A6VL 2QBWA 5ID0A 1FNSH 2FHBA 4BXVA 5K59E 1HHJB 4YDZA 2VDOB 3MHZA 3ZRFC 1JHKH 1MVUA 1J12A 3T0EA 3WO3B 5ESQB 2IBGA 2UZYA 1CYGA 4PRAA 3KPSA 4M5SA 4X7CC 5EBLA 2NNCA 4WW2A 4ZQKB 4POZC 1HHHB 5C70A 4N2AA 3T0EC 3ZR5A 3K3QA 4NYLB 3VFPA 5CGMA 2CMRL 3CHOA 3ECBA 3MRDA 2ICWB 5AWNL 4OCRH 1NFDB 1XGUB 4WW2C 3CQQA 5BRZD 2QQNH 3A67L 1SHXA 4OJFL 3UPCA 4Y9CA 3KEHA 3BUYB 3T4AB 5EWIH 3EO9H 2VDNH 2AJVL 4RIRA 4BKLB 3KLLA 5J0BA 1VZGA 2IH3B 4UV7H 4PJEA 2PTTB 4C56E 4RNRB 1FO0L 2R2BA 1VLXA 4NAJA 3VSUA 3B4NA 1LO4H 1I9IL 3FSWA 5DD6B 3SGJA 1ZXKA 2X88A 3M07A 2W9EH 4ZTEA 4FNLH 5EU4B 5A7EA 3LD8B 3PS6A 2K6ZA 3V95A 2HRGA 2JXMA 3WFCL 1TYJA 4YHNA 1OB1B 3V8OA 5IOKA 3UTQB 1LEKA 4LEEA 4TV3A 3WY1A 4NN6C 2RJMA 5K9JH 3KDMB 4DP9X 1F6AB 4M5YH 2P42B 2PN5A 3T09A 1U3HB 3RY6A 3DBSA 2CNZA 3KZ8A 2ESVB 3RGVC 4NQQA 4KV5F 2XXFA 5IMLB 1S9WB 5CEZE 4P99A 1COBA 4HMDA 2XA8L 2XKSA 3FN0H 2BZCA 4WW2F 2W1NA 5J6GA 3CUPB 4WW1B 4UQ3B 3RY6C 5LGKA 4YC2C 2X4UA 4KNQA 2Y6TE 2KS0A 5EU7E 3BVNA 1F1DA 1RLBA 4F8LA 1DJHA 2YGOA 2LW3A 4EAEA 5CKGA 4GQQA 5DF0A 3V4PA 4MX7B 3LNDA 5F3HB 3GIVA 2FD6L 4EI0A 3U9PH 4P9ML 3K5RA 4X8XA 3FSVA 4PCTA 4X98A 1YAZA 1BVLB 1A3RL 5BZWB 3MRHB 4PGJA 2Q3ZA 3C60C 3OLEA 5EZIL 2XVLA 4QIRA 2FZ3B 5I73C 4GG8B 3K91A 3COOA 2YPVA 4LSSH 2P7TA 2ISDA 3U2SB 2BNUA 1GKOA 3BP6B 5ABZA 2NXZD 1TCMA 5HJDA 4FZ8H 4LSQL 1OAKH 1QPXA 3N41B 4JG1L 3W11D 4ECNA 4ONGH 4PMFA 3GSNH 5FGBA 1KTDA 1OAYL 1Z6JT 1CF1A 3QHFL 1A7OH 4GP5B 4XP6H 4F7TB 1MCIA 4P23D 5I5IA 2BZDA 1HSBA 3BUQA 1BOGB 2F1BA 2BPBA 3KBEA 3AAZA 3C6EA 1QLEH 4QRPB 1CE1L 1IZKA 2GFBB 3NAAH 4JO1L 5C08A 1OCZB 3R7QA 3I3BA 3VG0L 1FNAA 5CR8A 3WKYA 4M7JL 3FTZA 1YUHB 1EWHA 1W0WA 1MCSA 5IVZA 3VD1A 4AYFB 1XMEB 4M7LL 2H2PC 3SBPA 4MQ7B 1E6OH 5AAMA 3V79C 4MZIA 4S2SB 1QQDA 2F8VA 3L3JB 1GZQB 3CIQA 2GY5A 4I9WD 4CC4C 5HHXL 2J6EL 2BH0A 3NCBB 4ODTL 4AQEA 4PUBH 4L3ED 3IFPB 1IQDA 3NABL 4PJCF 5F21B 4ZYKB 3S5LA 3TNMB 5I8KL 1O7DE 1SVZA 3ZU8A 4PGEB 2Z93B 1L9NA 2AXGB 3VGBA 1U58B 4DVBA 1YYLL 3WS3B 4ZUSA 1GS8A 3WLWC 1AC6A 1TVHB 1TFPA 3MRGB 4MCZB 1R46A 5C0IA 2UUDK 4XGZA 3RPKA 1YY9D 1SYVB 5LBVA 3DX4A 3MLYL 3ZUCA 3PHQB 2FBJH 3RWIB 3BC9A 1F1GA 2YAFA 4H0GA 2YEZB 1PZ2A 3FT1A 3ZR6A 1QR4A 4YX2H 5INCB 3KJ6H 4YLQT 1DUZB 4N90E 5C92A 4FI6A 2IADA 1KBBA 1XB3A 2O5XL 1T0PB 4H88L 4NP4L 2L4OA 3SDDA 5KW9L 1UM4H 1U8JA 4ZMAT 4Y9BA 4ABUA 4NGHH 1XFPA 1ZA3B 2VE6A 1NGXB 2ZWNA 4H13C 3NCMA 3PWLA 3GUTA 4MJIE 2R4RH 1MRDH 1B0WA 3FKUS 2P5WA 2VDLL 3MBED 4AQAB 1BFSA 5T3XE 1SOQA 4W9FC 4GUPA 3B7TA 3EBAA 5TE6L 3SDDC 4FLHA 3LNHA 5KYXA 1NCNA 4PRHE 1U8QB 5CMAB 1F4YL 3NACL 1J5CA 5E1GA 4KTEL 3NSCA 4GI9A 2ZUXA 2KZKA 2XWXA 2D7TH 3BT2L 1TKWB 4ODUA 4NQDB 5LNDA 2WXHA 4ZUTB 2FQEA 1PZCA 3RNQB 3KMDA 2BW5A 4Z7OB 4WI0A 4H1LB 1A6WH 4YHOL 1FIGH 1DP0A 5ANHA 5A6IA 3U6XS 4M29A 1CFQB 2I27N 3GTTA 4TM9A 9CGTA 3ULUE 2BP0A 4Q6KA 4LGSB 1OL0A 2M2DA 4G11A 4RAVB 4BZ2H 1EJFA 4H4NA 1IMHC 1SUHA 2DOCA 3SBWA 3FZUC 3G3LA 3O3BA 1AI1H 1NOFA 1O6TA 1WUZA 3SDCC 5E8EA 3NPSC 3WI9A 3LHAA 4ERSL 4HBQA 1SFDA 1JL8A 5E5RB 2RCSL 3HVNA 3P3RA 4DUWA 5HPOA 1OIOA 4OM0L 1YECL 1CGSH 2BWQA 5AB0A 1X9RA 3UTTD 1SRDA 3FHAA 5D7SH 3T65B 1G9HA 3SBWC 5CO1A 3CPLA 2F08A 4WHTA 4J1UB 3NCJH 1CI5A 1KYOJ 4G6ML 4JCMA 2NY4B 4JKMA 4BQ9A 4RQQB 1A9BA 4Q58C 5FV2A 3D06A 2VN7A 4JFHD 1HESA 2HT4C 4UOJA 4XMKH 1GOFA 3VE0A 5M95B 4MTMA 4QGTA 2FT7A 4RMVA 5EU5A 3O0RH 3H2QA 3OKLB 1YO4A 5F1IA 3K4DA 4KRMB 1ND0B 1DSFL 1DL7H 5C09E 1OW0A 3NG5A 2VAAB 3MJ8A 3PLYA 4JO8A 3ME0A 4AVIA 2B2XL 1E5YA 3N1MC 5EOCL 1QHQA 4Z78A 4G3YH 1FNEA 3WL9B 3FRUA 3TN0D 1IEAA 5IM7B 5IB2A 5T1LB 3A23A 4AUUA 4D0BB 1XX9C 1Q0YH 2RTTA 5T1DH 2IF7A 3U4AA 1OW0C 5DZVA 1NL0H 3CK0L 1P4IL 1KB5L 4ZO7A 5ITBL 1Z2KA 2LE9A 4FQCH 2VLMD 3T4YA 3IRCA 4HHWA 5HGHA 4FEIA 3LRHA 2VXVH 3FO1A 4NS0A 3AITA 2EJ1A 3AW5A 4JM0A 1O9WA 2WQAA 1OGAA 3EYFB 1J8SA 4QOKE 3LS5H 5E6ID 4ZMXA 3UOAB 2B5IC 1XGQB 3KPNB 2X4PA 3MRMB 1OOWA 1JNLH 3ULVL 3VI3A 1G7LA 1HL9A 1UCTA 1CR9H 3I50L 1D5BA 4MXVF 3WEXA 2NLJB 2B39A 3IDIA 3X3FH 3GJEA 1JXFA 1DVZA 1KPRB 2G3MA 3VX1A 4AYID 5KVDL 4D0DB 2BO0A 3T3MB 1RPKA 3K1DA 5IEKA 2CIIB 1MCOL 4P3CH 2IANB 4Y4FA 1SF3A 1OZUA 1IGYB 3VFWB 5TTRA 5B1AB 5LDSA 3LQZB 4LBAA 5IR1A 3QDGE 3FQNB 4XCCH 4QRRE 3O3DA 4U4BA 2HKFH 4U7SA 3OJMB 4AIEA 1XIWD 5BV7B 4PJHA 2OCCB 2LVCA 4JQVC 5K9QG 2WIIA 2F54A 1JK8B 2FH6A 3DVIA 4WV1A 5KVFH 5F1SA 1NBYA 1CTOA 1RXLA 4M61B 3ZZQA 1JHLL 3FU8A 1I3RA 2F74A 4D9RD 1GGIH 3NDZE 3ZHKA 4PRIE 3H9SD 4HJJH 5TDNB 2KDYA 3ZW3A 4KY1L 3HKZA 4X4KA 1UB5B 1V3MA 1XCXA 3IDGA 3S4SG 1U8KB 3VXSE 4CMMB 1T0OA 5I8EB 2EDLA 4UNTA 1PG7L 4PB9L 1EGJL 4TQ8A 1MLCA 5D2NA 1AXSB 2JIXB 2XNAB 5GJSL 2XN9B 2OK0H 3F6LA 3NIGB 4KTDH 2EADA 4PTUA 4Z7NE 3VI3F 5H94B 3PXJA 5AKVA 3D5OF 1T04B 4RCAA 2Z7YA 3D52A 4JJ5A 5IT2H 3DPBA 1AS7A 1S78C 3CVIL 1TQTA 4KOCA 2Q86A 4Z3JA 1C16A 2ZOTA 2IAMD 2CXKA 3U30C 5DQJA 1W72H 4WO0A 5AW1B 4TL5A 1IIKA 2QHRH 4UQ2B 1FNSL 4MDJB 1KBPA 3TIEA 3ZKNC 3ZZ1A 1JHKL 2P28B 4H26A 3UBGA 4LEXH 1CN4A 3MLZH 2AEOA 1A6UH 1XHHA 5KVMC 5I2IB 4ZPVA 1FGNH 1N68A 4CNIB 4MJ5B 5I6XB 2B14A 4HKJB 4HH8A 5AYQA 5IHZA 3VDAA 5JIIA 5SWSB 4N0RA 1AOZA 1G7QB 1P9MA 2EKSA 4JAMA 2C3GA 1A2YA 3EFDL 4LCUA 3NPZB 1FL5A 2IJ0C 5H35B 2EC9U 2ERJC 1CVSC 3WENA 3ABMB 2W65B 3FUEA 1DE4B 1JUFA 1KLUA 2QQNL 2Y6SC 2BS9A 3BSZA 3LN5A 3Q3GA 4XPTH 2X05A 1EQWA 3MXVH 5I30H 5I9QC 3ZJAA 3U46B 1CD1A 1QSEB 3KJ4C 2EEBA 5HSFA 5HHQB 4YXLH 2A9AA 1BM7A 3T1FA 5D1QE 3N43F 4GSDL 1W91A 4XXCC 4OJYA 4LPYA 4FNLL 2JJUA 1FH5H 3HZMA 3FQYA 4JGUA 1N10A 4DVRL 3TZVB 3RKDC 1HQRB 3QULA 1G1OA 5K9JL 4F15B 1U36A 3T6XA 5MEPA 4M5YL 4RFNB 3BWUC 4OJCA 3EDDA 5C0CD 5JLZA 3P73B 1KGIA 3G6AB 4AVKA 4KK6D 2BS8A 1FFOA 3RJQB 2BHUA 2Q5BA 4HV8B 4JFDB 5GZND 4PBXA 4NOBA 2XG4A 2LV4A 5BMFH 4ZXBA 3WKPA 4OFIA 4Z0XA 3U25A 3LKQB 4L9DA 2CBQA 2I69A 1JWUA 5DUBB 4JFZH 3QCUH 3VSTA 5CLZA 5HI4C 2ZX8A 4JJHA 2Q3XA 2CA4A 3U9PL 1JGDB 1L9MA 4X4YA 1R3JA 2BVQB 1JCVA 4NBXB 3HTLX 5DQ9B 4NI3A 2CSPA 3S6CA 1BPVA 1IE4A 1P6FA 4FFYA 3UJJH 2Y1ZA 3EBGA 3IMUA 3WNJA 4OAWA 1THCA 3BWUF 1OF2A 4NO2B 5HYQB 4LSSL 1SOKA 3LIZA 5HYSA 4GRLD 2ADJA 4HXAH 3RIKA 3QEHB 1DBBH 4FZ8L 5EF1A 2PO6A 4Y4HA 4C59B 4L23A 5CBAA 1VKXB 5F9AC 3Q43A 3D05A 4PWHA 2G0KA 3GSNL 1YPZE 4MLSA 4U1SB 4XNAA 5L0QC 2YKLH 4XP6L 1X4YA 1J48A 4GW4B 3B2DC 3WS6A 4X7SH 3V55A 4PS7A 4X50A 4FC3E 5I74C 3K6FA 1QLEL 1PZ5A 2ITFA 3QAZC 1G7PA 2PO6C 3NAAL 4Y4HC 5A40E 1F97A 5FXCH 3VD9A 1UEYA 1F0LA 5I75C 2LHAA 1H8SA 1P53A 4JVPA 1E6OL 3AU1B 4HMEA 4UT9A 1ICTA 3CSPA 4WTWA 3MV7A 3NVQA 4NUQA 1DJXA 4XMTA 2YMOA 4R84A 4N85A 4YPJA 2JI1A 4PUBL 4XN2A 5CM1A 2ZQKA 3SE6A 1K5WA 2Q7NA 3LAFA 5EIQA 2XTJE 1DQQA 4NYLA 2IXQB 5EORH 4G70B 4FQIL 2VUKA 1RL1A 4BM7A 1KG0A 2P5ED 3QYMA 3B2PA 2EUVA 2ZIDA 1XEDA 3NJLA 4N9OB 1EEYB 3QQDA 2OJEB 1V10A 2WLZA 1QI5A 2R83A 3X14A 1J1OH 1MCNA 2IH3A 3SCMD 2FBJL 3IFOB 3GO1H 1AXTH 1ZLWH 1TTGA 4FTVB 4ZOBA 2PCXA 4EZJA 4GAYA 5J8OA 3EW3B 4YX2L 3IU3B 1R5IA 1RZGA 3KJ6L 3TBSB 3OG6B 4XMZA 2GJ6A 3I6KA 4X9BA 3TPUB 1G9NH 3T4AC 3DURB 3MUGA 1M71A 3V0DA 1KTLB 4PTTB 4A7UA 1UM4L 5CEXB 2W0KA 4NGHL 5FOJA 4JE4B 3PUUA 2RGSA 5IW6B 1TQBB 1NCBH 3I9GL 3DUHA 4RMBA 3RL1A 4AE1A 5HDQH 1MRDL 5K9QI 1HH9A 2XXCB 3LD8C 4CU7A 5GRXG 4KV5E 4EIGB 5FUOH 4BFJA 1FO0B 2B1HL 1FLTX 4J5VA 3E3QE 3TFKD 5I0ZA 2XSKA 4JGNA 1SN0A 4CJ1A 4HUMB 3BPCA 2D7TL 1U3HC 2DY2A 2WC7A 4WY7H 1ZE3H 1G7MA 4MHHG 1IAIH 2Z0BA 3QI9A 3APNA 3WY4A 4QRSB 4R7NA 3L4XA 4WWKB 3ZL2A 2X28A 5D1XB 1A6WL 1OP4A 2NYYD 2XVKA 3RWCA 2JI2A 1RJCA 1NFDF 3H55A 2B77A 4HQQH 3IETA 4EN3D 4NUJA 5IIEB 4DK5A 5BVJB 3F7LA 1D5ZA 1UKSA 1MZZA 1KIRA 4WEBH 2O93L 3BQUA 5FO9B 4FQ2H 1EFXD 4GP8B 5ICYB 1G7HB 1RZKH 2VC2L 3R18A 3LKPA 4N2FA 3CX2A 4PIBA 2YRBA 1H8NA 1AI1L 2WXKA 3GMLB 4A6YH 2VQ4A 3BP6A 2YMXH 3E0GA 1OGTB 2IH1A 4GH7B 4N1CA 4BSWA 3APDA 3D2UD 1R5VA 4HKZA 3SYQA 2EEDA 3PQYD 4A2GA 5FLVA 3QEGH 2QR0A 1J5OL 3S3BB 2IFFH 3ARBD 5JW5B 2I5YH 4DKDC 3NCJL 2CPCA 1BZQK 1PNCA 1XR8A 3GSRB 2XJKA 2AP2A 1XF2A 3N50A 4XMKL 1H6UA 3O4OC 2I25N 4BK8A 4FNTA 4WI4A 3HZYB 4CAGA 3NN8B 1WZ1H 4K2UL 4OIFA 3VXMA 3O0RL 2WUBH 3P3SA 3I6GB 2D9QB 3HUJE 3S3PA 3ZKMD 1SXZA 1G7IB 4S2SA 1ZS8A 3VGGA 4FCHA 5GGVY 3WKMH 1DL7L 2NY3B 4JZJB 2AERT 1LO0L 4HC1A 1IX2A 3EBHA 3Q48A 4ZFOL 1HIMH 4NNXA 3TM6A 3IFPA 4X9GA 1R3KB 1VENA 1CUOA 4PJCE 3BUDA 3QWQB 5FYJD 3IPEA 1YNLH 4IYKA 1I3UA 3EGDA 2WZPA 2VRAA 3A6BH 1G4MA 4Z7VB 4DP1X 1XGTB 2AXGA 5T1DL 5J5EA 1U58A 1YQ2A 3HB3D 4NRXB 4XCFH 3QRBA 5EEXA 1JSYA 3FTWA 3GTVA 5CHNA 4YDVA 4JM2D 4JPWH 1YEGH 4YDKH 1TEYA 5IMMA 1KACB 2MWCA 4PI2A 2R39A 2VXVL 1HILB 2PW2B 5IF0A 5FHBH 3HNVH 3VWKA 3N41F 4PWGA 3KPRB 4JHWH 4BFRA 1CFSB 2X10A 4DEPB 1I1YA 3LS5L 4C54A 4HOWA 3NCYS 4JL2A 4NO5B 1ZT1B 1PY9A 2NZ9C 1JNLL 2DH3A 5KS9E 1OM3H 3OC5A 1CR9L 4QJ5B 5GRWA 3OKDA 3X3FL 1T22B 1TF4A 1OGSA 4DHLA 5CF3A 2DLEA 3VWKC 3RUGB 1YMMA 3M1BA 2W59A 1YJDH 4FA8A 3TBBA 2H6PB 1ZLSL 3CVHA 2HXAA 2GJPA 4P3CL 1ACXA 3FO9A 3EJYD 3QJSB 4LVEA 2GI0A 4NZ8A 2OMXB 5DJXB 4XCCL 5DWUH 3BEWB 1BCIA 2HKFL 1NKOA 1BQLL 4PSRA 1DJWA 4F7EB 1BXVA 3PL6D 1QRND 2EDOA 4U31A 4W9HC 3IJ9A 3UAFA 1D9KD 4LLMA 4ZPTB 2KQNA 2BOCB 1CXKA 4AMKL 2KI6A 4HIHA 4FOMA 3P77A 5F0LB 4YXHL 3W9EB 2J5LC 4ZUVA 4K8RD 3QWRD 1PIGA 2EXTA 3VFSB 2FJFB 1U8LA 2A4CA 2D3JA 2VH5H 2VLJB 4MGXA 5C0GB 4PY7A 1GGIL 1NH6A 3UJTH 5IGXH 2FNBA 1GMIA 2R4SL 4HJJL 2A1WH 4X6FA 2YPLD 3STLB 2EVFA 3E38A 2B20A 4E0RA 4Q74A 1WBXA 2X9ZA 3L5WB 5AUMA 1SZNA 2KT6A 2LLLA 4PJ5B 3UTSE 2H1PH 4POUB 2OK0L 1ETZA 1VA9A 2F9BT 4ONHA 4QKTA 4DJMA 4WHYG 2BVPB 4Q9BA 4YSCA 1R1CA 4I1PA 3ELQA 4UQEA 4XZ4A 3QQ4A 3TYFB 3MTXA 1PKOA 5IT2L 2QADD 5JIHA 2J4WH 4JFPB 2WTRB 4C4KO 4JL1A 1PTZA 3ARGA 3K8MA 3IKCA 1JNHB 2HG5A 5F89B 4DF9A 3IMTA 5EPMB 4HSQA 3HR5A 4I2XB 3S36H 3TBWB 3BGFB 2K7PA 4ZNEA 1W72L 3H0TB 3CZLA 5FCUH 4LIQH 2QHRL 2WXGA 3WN5A 1CD0A 3DVGB 3UBXB 4BZ1H 3QRLA 4HKBA 3G5VB 4OU3A 1JZ6A 4LEXL 1Y18B 3MLZL 4TPRH 1A6UL 1A22B 4JFWA 2CKBA 1EZLA 3IMVA 2BRQA 1ETA1 3SDYH 2Q87A 4XX1E 2OXGA 5GGTL 5MI0B 2WQRA 3L4YA 2WXRA 3OBAA 3RTQD 2NY4C 1EBAA 4Z7OF 3WN5C 3SODB 2QVFB 1HZKA 3M86A 3S8WA 4LCVA 3ARDB 4FQXD 4KH9A 4IBWA 1IAOB 5AVQB 1BFVH 3FPYA 1BJ8A 4ZAKB 3WAJA 2AXHA 1PVHA 4YHIB 4F2EA 2WO4A 2BZ7A 2XWJA 2UZXA 2WD0A 4WI8A 5B7EA 4XPTL 1OAJA 3MXVL 2K1MA 3PDGA 4PS4L 3O2DH 4A66A 1NAMA 4IGBA 1I4FA 2D31B 1VADA 1T7VA 4YXLL 4N1EA 4NENA 3MOBL 1UXLA 1IGJB 3HI1A 4LVOB 1KXTA 3L4TA 1DFBH 3EYFA 4KKCD 4EQ2A 5D93B 3UTZA 1ZHKB 2K70A 1RMFH 5C0JB 2X1QA 3IMWA 2RFXB 4MXVE 3D25B 4JPVH 4U3HA 2WLIA 1W0VB 3B3IB 5TD4A 4K9EC 3V6FA 5B4MC 4ANXA 2YD4A 3SY0A 4IJ3B 3HMWL 1EHNA 2IANA 5I1IH 3VGFA 1TZAA 2VLKA 1AQKL 3NSYA 1ZHNB 3US1A 2G75A 3BPOB 1WEJH 4GW5B 4BSVA 2V9RA 1T3FB 1CLOH 1OXYA