2N7SA

Solution structure of leptospiral liga4 big domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
MPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQVTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig-like repeat domain protein 1
publication title Solution structure of leptospiral LigA4 Big domain.
pubmed doi rcsb
source organism Leptospira interrogans serovar copenhageni str. fiocruz l1-130
molecule tags Structural protein
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2n7sA00
2N7SA 1CWVA 2MH4A 4AQ1A 2ZWKA 1F00I 1E5UI 2MOGA 3NCXA 4AQ1C 3NCWA 2ZQKA 4HU8A 2L04A 2MQGA 1F02I
chains in the Genus database with same CATH superfamily
2VLKA 4ENZA 3X14A 3LNHA 4NN5B 3IFLL 3M1OA 1YRKA 5D5MF 2A5UA 2C9RA 2CAKA 2WXPA 4ZMQA 2FECL 1K5NA 3OL2A 3A6BL 1Y1DA 4WEBH 2DQHL 1ZT1A 4LLAA 4D3CH 1WBXA 5HHOD 4DGYL 5KUKA 4B9PA 1C08A 5K5YA 3EJZC 1N0XH 2VXTH 2OI9B 1L9RA 2Y24A 1M05A 2CQVA 2P28B 2CK0H 4IIZA 4P5KB 5IFAL 4A68A 4OGQC 3LH2L 3DVGA 2OLDA 1F6LL 1D3CA 3I50L 3Q1EA 4JN2B 3DURB 3LQAH 4U1MA 3ARUA 1ZXKA 4X5XB 2NYYD 2FJHA 4PU2A 4GP4B 5ABDE 1A7QH 1F1GA 2AJSH 1XIWB 4JFXB 4KQ4L 4DEPC 2R27A 2YK1H 3H6JA 1NFDA 1UM5L 3TX4A 2DWXA 2ICEA 5DJ2A 5JHLL 4KY1H 2WVVA 4XAWL 1MNNA 1AGDB 4YJZL 3S96B 3DDGA 5CLZA 2P3YA 4G7YL 4WUKL 5D1QC 4MJIB 2Q2EB 4KC3B 4YBHA 2AXFA 1XBRA 2ZCKH 1BAGA 1X5JA 3LKQB 4OLYL 4OJYA 2AEQL 5FGBA 4RFEB 1FZOB 5CR8A 3FH5A 1FYTB 3FQWB 1D9KB 3MFGB 2JJTA 3QHZH 4UIKH 3VXSD 5FKPB 4Z7NF 1FBIL 5HYQA 4KQ0A 2Y1YA 3RL1B 2XXGA 3WE6B 2OMWB 2GUOB 4JFOA 3IJHB 2OS7A 1R47A 4QOKB 2NYKA 4Z76B 2QMKA 5F7NC 1G1KA 4IRZH 1OPGH 2EXSA 2EUWA 4S1RH 1ZLUH 4YSTA 3H2PA 4YHYB 2F5AL 1U3JA 2F1AA 2FYVA 4MAYB 2FDBP 4CL7A 3P9MA 5BQ7B 1OARH 3HS0A 3F7YB 2CBPA 4WV1A 5D7LD 5AZUA 5B1KA 2C1PA 3VUAA 3VTMA 2VITB 1AXTH 1BAFL 4IBLT 1A2YA 3ZDZE 5F7DB 5KW9H 4FFZH 3VH8G 3FT2A 1QA9A 5C0CB 5E7BA 1A14L 5JLZB 5D71H 4AK2A 1F4AA 4Y7MA 1EO8H 2ZX9A 3IPBA 5EIIB 5HGDA 3B7RL 3HJEA 1EDHA 4AYSA 4K94H 3D8MA 4YQXH 4W9HC 4O9HH 4TLUA 4ENED 4Z23A 4P46A 5E8NA 4JUSA 1T2QL 1BIHA 1BXVA 2Z91B 4Z7UB 3GDBA 2WVSA 1KB5A 2HVJA 4P59H 5BV7L 5DD5L 4RFOH 4AK1A 4XI5D 3SPCA 1NEZG 3H55A 3W9EB 2KERA 1R24A 3BH9B 5EEVA 3LKSA 4KUCF 5H37H 3HN5A 5IFJA 2JQZA 1U95B 2Q87A 4QRUB 1JZ6A 3GMPB 3PIQB 1H3VA 4PSPA 4Q6IA 3ZDXF 1IMHC 1II4E 4OCXH 3RU8H 3EOAB 3BVUA 2DJUA 5I66B 1W2KT 4ODTL 4NQQA 3O2DA 3OHMB 3D0VB 3FT3B 3L16A 3WO4B 2Q3XA 2MCMA 1S7XB 3HKFA 1HL9A 1QFHA 4CADA 1ZXQA 2FECI 1Z5HA 1WF5A 1PZ2A 5TE6H 2R7EB 3VW3L 3T6WA 5J89A 5M94B 5KYWA 2PYED 1NPJA 3HPJA 2ZG3A 2GAZA 2H32H 2B1HH 3ECWA 3NCWA 4P57A 1GZHA 4V33A 2Z8WC 1PIFA 5TE7L 5KANI 5I1DB 1MCOL 1E43A 3RZCC 4C4KO 4JHBA 3J2PA 5LCVH 3K6SB 1N6UA 1JWSB 1LEKB 2HLFC 4Y16C 4ONHA 4H0IA 4AXWB 5CKAA 3I3EA 3OMIB 5CHNB 4ODBD 5EWIH 1WPCA 3QNZA 2FSEA 4I5BA 3F12A 4PJBA 3HE6D 4RA0C 3HHRB 2J20A 4NXKA 4J3SA 4Y4FD 5LBSL 4AGNA 3HE7A 1ET8A 1TQSA 3AUWB 3DROA 3LEYH 3NPZB 3TIEB 1YMMA 2OW7A 1KYUA 4WRLA 3UPAA 3KEDA 2QADB 2NNXA 2Q6WB 5A1AA 1LNUA 1W80A 2DAVA 5KVDE 3ZE0E 4YNYB 2QQLH 3BLKA 3F7KA 1O7VA 1CICB 1ZHLA 2EICA 3EBGA 2J1WA 4GQ9H 4RMRA 3RZWA 1UOWA 4GMTL 2OFQA 2ICWI 1R33A 1J5DA 2ADFH 3LRKA 4PCKA 3V4VB 1J9CT 5ESVA 3DXAB 1AIFB 3FRPB 3QEQA 1OKEA 2FLMA 4F7CB 5HPMB 4GI9A 4Z0XA 4V1DE 2X4UB 3KE0A 2Z8RA 5D1ZA 3CPLB 4MVBC 5L2KA 5CU9A 2ENJA 4X6FA 4EN3C 3RGVD 4PD4J 4L1LA 2NCEA 3BT0A 1U6AL 4ZW5A 2EXTA 2EVFA 1VKXA 1BQKA 1TO4A 3PP3K 1Z9MA 4M6NH 3CMGA 2P5EB 4K2UH 5A40E 1MLCA 2KDYA 3C60B 4GBXB 5IJVB 1THAA 3RIKA 4ODUB 3ZKMD 4BKSC 1AR1C 3HUJB 2J8UB 1RUQL 2OMUB 3IETA 2E7HA 3QDME 3QJUB 4MJ6B 4P07A 3VXPA 3KPNA 4XPGL 3VGHA 2VSCA 5ISZD 4DOHB 1Z66A 2LAGB 3JV6B 2W94A 1EVTC 3US9A 3QIBA 4DPBX 4LLMB 5EUKA 3IAPA 3NJNA 5I74B 2HSIA 4AGMA 5D2LA 3D06A 1OP5H 2K78A 4AQZA 4YO0B 2D73A 4GAGH 4ZFFA 2IEPA 3KYOB 1BVNP 3KR3L 3QDAA 4EMZA 2VMEA 3BWAA 4YHNA 4YDMA 2NNRA 4ZDHA 2LLNA 3PHOA 1MWOA 1O6TA 2Q76A 4BHUI 5C08D 4HIEA 5HI3C 3QUMH 2XWXA 1HEHC 4QWWD 4YDZA 2GFBA 4E9WA 1A6AB 4PJ9D 2P8LA 2YO3A 1SHSA 4R90L 1XF2A 3VI4E 4BWWA 1DJHA 2R69L 4L2LA 2H2SC 5FO2A 1A22B 4C47A 4JQIL 5B38G 2V0AA 1A8JH 2FGWH 5A2IH 2YPLD 1NL0H 4NN5C 2WZPA 5PAZA 1HHKA 5D72H 5JHDA 3MLUH 5ELIA 5HI4D 1PJ9A 1U8PB 3VU1A 4O2FB 2DQEL 1FG9C 4O58H 3JTSB 3CBJB 3KH3A 3D4YA 3MV7B 4MBOA 3DETC 1YPZB 2YAEA 4JRFA 1FF5A 4JFYB 1O5DT 2KLTA 1FRGH 3UMNA 5IESL 5J6SA 1AS6A 5JOPD 5GRVL 2Q8AH 5E23A 5D1QA 3ECBB 2P7TB 3RIAK 3MUJA 3M1BA 3G5XB 4YFDB 2G75B 2DW5A 3MZTA 4GW4A 2APWA 5D7KD 5JXED 4IW4C 2JIXD 3LPGA 4HWEL 4FYTA 4H1LH 4FQJL 3ZKNC 2ZWLT 4ZJ9A 2VJXA 4NQCA 1S5HB 3N40P 1RK0A 1GGIL 1XIWC 3BX7C 3HAEG 2ADIB 3L3IA 1QRNA 1YCSA 1CCZA 4NGHH 1CFTA 1DBKL 2ZIDA 3NGBB 3SE8L 4FQ1H 4HD5A 4QHMA 1G9NC 2BW5A 3T6VA 2ZCZA 4MTMA 4WWKB 1AXSA 2NLJB 4K3EL 4TNWF 1SHWA 1U58A 4KRLB 3GM8A 5BQDA 3ZYIA 2IDSA 4IRSB 3QIWD 2Y06H 4LLDB 4HLJA 1JK8B 5D2LE 2XBTA 3QCVH 2HXAA 2X6AA 4JO3H 4JCMA 2CGYA 1HZHH 2D3JA 4JGNA 4WI2A 4Z3GA 4BJLA 1E9OB 4P49A 3T04D 2X6BA 2NY2D 4MCYA 1DBBL 1E3FA 2YA1A 2BVUA 4GO9A 43C9B 2DV6A 1WGOA 2VQ1A 4DERA 2HKAA 3WNPA 2HP4A 4OJCA 5MENA 5D1XB 5AW9B 2A3TA 2CKNA 4YHYC 3BDXA 5GGSY 3T9WA 4MAYC 1M42A 1P4UA 1UZ8A 2VDNB 3QFDB 4IOSA 1TQUA 1NFKA 3UTTE 5A6MA 2GT9A 1RUAL 5JQ6L 3POCA 4PRPB 2BO0A 4ZO6A 1D6VL 3N9GH 3QFJB 2BZDA 2R29L 4NQVB 3ME0A 2MCPL 1BVKB 2XZCH 4LEXL 4M48H 4MNQE 2FRGP 3K5SA 4ZFZB 4ATTA 3ABGA 4BCYA 4YN3A 3MLYL 3DUSB 4FQQB 1JERA 4KROB 4TNGA 5HVHC 1DSFL 3HR5A 2XICA 4N0CD 1A1MB 1G0XA 1KENH 1L6PA 1Z6JT 2XY1A 3F7PC 4NI3A 4CKVX 3DHMA 2D7MA 3HC2A 2VIRB 3FBKA 1IQWH 4P3DA 5HJBA 1RURL 2J88L 3U0WH 1GHFH 4LSRL 5I8KH 4QKTA 2ICCA 5SWSE 5IB2A 2J12B 2V33A 2IBZY 1C5DA 2OV0A 1M9WA 3IS1X 4S2SA 5C07D 3ZL2A 2GKIA 1AGFB 2MHAB 2GHZA 4DEWA 3NSCA 4OKVA 5C3TA 1FGVL 1SXBA 5A6IA 4L3EA 1MG2C 2FUTA 3WS3A 4YS4A 1T66D 4RDQF 5E8OB 1VFAB 1X7QA 4PV8A 4BE5A 4XNQB 2F18A 4P2OC 1PYWA 2ESVA 4YHML 3RZCA 5DRNA 1WCBA 3WO4C 6CGTA 2VDLL 2FQFA 5FEBA 4P2QA 4P9HC 4KKBD 5B1JC 4Y16A 4JFEA 3MV8E 4PRBA 4EIZC 4LSUL 1TG8A 4Z7AA 4JN1H 2DEWX 3S5ZA 4LASL 1E5YA 5AVXB 1KV3A 4FQ2H 5IVZB 1RK1B 4WFGE 3MLVH 4BZ1L 1EANA 2XJLA 5ENWB 2FWOA 4WUUB 4F3FB 5ECGA 2A6IA 5C3LD 1NLBL 3EG9A 7PCYA 2MKLC 3F7VB 3MLTA 1X5GA 6PAZA 3QZBA 5F8QC 4FQLL 5LQBH 1RUKH 4OI7A 2XA8H 4G6FB 5H37G 2CO6A 2AKRB 1A7NL 2HRHA 3G6AA 3I9PA 4ABUA 5IMMB 4X83A 1I3GH 2B4CL 2WZAA 4HKXB 4NPKA 3NT0A 3WNIA 3FHAA 4L4VA 1A3LH 4EAEA 3VI3A 1OM9A 3BGFB 3GUTB 4NN7B 5DJ8A 1WV7T 1Q90A 2APSA 4WO0A 4QCIA 4RGNE 3UG4A 4EN3A 4JHZA 3QIUD 2P80A 3A21A 4OFQA 2ZZUT 3EKCA 3AT8A 5C0RH 4BFIA 2QADC 3WEXA 1F41A 1JGVH 4ZW3A 1MW3A 4U1GB 2J71A 4XNUL 1MIMH 5BS0D 1CICC 2D9CA 4FCHA 3CSPA 4OTXL 2ZUTA 3O4LE 5ILTH 4Z7OE 1NCJA 2N3JA 4RDQG 4XWOD 3K2KA 3Q05A 5KJ4A 1B0RB 1E67A 1M6OB 1TFPA 4HPYL 4Y88A 4PJ7E 4EIBA 4KPHL 3HZMA 1MHHA 3J8F7 4K9JA 5DURB 4NO5B 3B8YA 4L4TD 3VYOA 3V6ZA 2BPBA 3JV4A 3B5GA 1OD9A 3MRHA 5IF0B 1N7MH 2OL3H 4YSRA 4U1KA 5AYUH 3FU5A 2DWEA 1WBZA 2AI0H 5DFAA 1ZVYA 1T5WB 3HC4H 1OGPA 1RZQA 3UP6A 1WZ1H 5CCHE 4NCDA 2MQ3A 4GBXC 1NIEA 3IJEA 1FGNH 1N8ZA 2X4OA 4XC3H 3RAJH 4Y19E 1JPSH 4OCYL 4BELD 2NTSP 1OW0C 3OKNA 4XB3A 3KGUA 3LNFA 4G7VH 1GXEA 1HWGB 1Q0YH 4UT6L 1KIQA 1N4XH 4WI0A 1F2QA 2BOBB 3B4NA 5I74C 5LAPA 2VDRB 3TWYA 2KT6A 3VD7A 4GG6E 1FFTB 1EBPA 1H3PL 3QGVA 2RMNA 5AOLA 1UWGL 1HILB 2AQ3A 5KVDL 3OBAA 1G4RA 1FVEB 4PJXB 1JUFA 4G70B 2CPUA 2X7LA 3X1FA 3MRCB 3W82A 3HCVB 1JWUB 4BFJA 5KS9E 3IKKA 3D85D 4PRIE 3A6OA 3WTSA 2RCSL 1I9JH 4OZIB 1JS4A 4ICWA 4M6ML 5CU5A 4JFPB 3HB3C 1NCIA 1PD6A 2NYZA 4H8HA 1PG7X 2O5ZL 3IDMA 4LT7A 4P5KA 5DUML 1UQSB 3U4BL 1AKPA 1DQLH 4N5ED 1IE4A 2HPTA 3V6OE 1GR7A 2R15A 5FYLE 5FHBH 2X6MA 4JN2A 4WEEA 3BQUB 3DURA 3VO0A 4HF5H 1BMZA 3HHSA 1P6FA 4X5XA 4YZFE 5DZJA 2DM7A 3SDAC 4BQBA 1EZLA 1XIWA 4JFXA 1T2JA 4AJVA 4A66A 3RNQB 3ULVD 3E6FB 3GEWB 3AQYA 4WAFA 2OP4H 4J4PC 4LPYA 4LVEA 1AGDA 2VW7A 3S96A 3QULB 3HC0A 1S9KC 1WFOA 1VHPA 3UMTA 4MJIA 4G3YL 1IJNA 1QFPA 4HWNA 3TT1L 4DQOH 3LKQA 4RFEA 1FZOA 2Y7LA 1NWPA 3O4OB 3HMXL 2C26A 2Z7UA 4LESA 1FYTA 1D9KA 1UD8A 3KHOA 2A1WH 5FKPA 3F83A 3WFEL 2H1LM 3A67L 3RL1A 3WE6A 2OMWA 2VR4A 3ZUCA 5CBAB 1KB9J 2GUOA 3IJHA 4GKNB 4U1NB 3T3PE 3SDCD 4AQAB 2BINA 4QOKA 4Z76A 3KM2A 3L4WA 3S35X 2HVBA 3SYPA 3I75B 4WGKA 2AQTA 3NGBC 5CF3A 5F21B 4PIRF 3W0WE 4G9FA 4MAYA 3ZHKA 3K0YA 3LIZA 3NCXA 4WWKC 5BQ7A 1PZUB 4LL1A 3F7YA 4D8OA 2ADYA 2FLRT 3MRDB 1BQ5A 3QDHA 1QABA 3AG4B 1AS8A 1J1OL 1U3YA 4JM2B 2VITA 2G2NA 3R06A 5HDBE 3VQMA 3V9CA 3LN9A 4QHKI 2ZOUA 3DUUB 4PJHF 3VU2A 4QXVA 4CW1B 1FNLA 4HXBL 1J1XL 5DUBB 5C0CA 3AQXA 4MQTB 4QNPF 3NABH 5TE4L 3ATDA 5DGRA 3RY6C 3WS6A 3MBED 5EIIA 2H3NB 1AY1L 2BSCA 2YC1B 5CZRA 1T04B 4AVHA 2Y72A 4W9CC 2UWEF 1L3WA 1Z5LB 1R5WB 4TPRL 5KBMA 1DQKA 4Z7UA 1ED3B 4KMTH 1BLIA 1G6RB 2BCKA 4JGUA 2OTPA 1QWNA 2YAHA 2YWYA 2IBZX 2X4RB 3CDGB 4XHQA 4YMPA 5CCKL 3KGRA 3W9EA 1NBYB 5IV2B 3DI3B 3NEEA 5ETUB 3QISA 2AJYH 1TEYA 1DVFD 3DO3A 2B9BA 3ROLB 3S88H 5E8DH 1U95A 5T3XE 1OZTG 1Y6MR 3GMPA 3PIQA 1F4YL 5IW1B 1S78D 3EOAA 5I66A 3GC3A 4LHUD 3FT3A 4ONOA 4I87A 2H0EA 3H53A 3ZIMA 1YECH 5FV2A 1S7XA 3L1FA 1U42A 5B1JA 5DJ0A 4G1MB 1JTTA 4RGMB 4WI9A 5GISH 1DDHB 2GC7C 3TFKD 3JVGC 4YDLB 3NCYP 2YEQA 4V1DD 1OF2B 3L5JA 4NWTH 4ETYA 1UWFA 2Y2WA 3E9TA 1BQHB 1GJWA 4ZMVA 2ZCHH 1N64L 5I0WA 3FOLB 4P4RB 1BBJB 4K5OA 1S3KH 1PKQA 4XVTH 3LPWA 3BVNA 4R7DB 4BKLB 1A4JB 3HFMH 4KKQA 3MBXH 3FCGA 1VDGA 3OXRB 5D4JA 2E9BA 5I1DA 2DQTL 1AQKL 3QORB 3VM7A 3QEGH 2EXWC 3K6SA 1LEKA 3NA9L 1OCWL 4X8XA 4AXWA 5FIEA 5CHNA 5IZ7A 4OT1H 4A7QA 4PRAB 4C59B 1RD6A 5BZDA 4K73A 2QQKH 3RJDA 3T3ME 2BIMA 2Q5BA 3NIGE 4OIIL 3TIEA 3EYOB 3PJSA 5KZCD 4UV4H 1X3DA 2VZOA 3IKCB 4FQXB 1ZCRA 3SYCA 1QFUL 3P0VL 2ZKXA 4PYHA 4YNYA 4B53A 12E8H 1CICA 1FWXA 3L54A 5HDQL 1SMOA 2CWRA 5FYKH 1KYAA 1TNMA 3N85H 4A67A 2Z4QB 4ZFQA 2ZTBA 4HWBL 3V4VA 2EUXA 4PVBA 4KJYB 3V0IA 1I3RB 3DXAA 4TS6A 1AIFA 3FRPA 1Q9LB 1A6TB 3GPSA 4F7CA 1JZHA 5KYXB 4LZKA 1RVFL 2HFGL 4P5TD 1HU8A 2WLMA 5I1CL 2GUYA 4KWUA 3CPLA 3BHBB 4PP2B 4KO7A 3PWNB 1AZUA 3HA0A 2EYRB 5BJTB 3TCTA 2QSQA 1V8HA 4X6DE 3VFPB 5GJTL 4FADA 4U1GC 3QJHA 4RMVA 5IJCC 1RFDL 4J6RL 1MVYA 4GBXA 1UGKA 5IJVA 1OAYH 4ODUA 2GJRA 3HUJA 5E0QA 2J8UA 2OMUA 5EMYA 2H0FA 1RIUH 2Z93B 4NERA 5JXAH 3RUGE 4KBPA 1MPAH 1A3RL 3JV6A 2OA9A 4JMXA 5ACMA 4LLMA 3OVUB 5I1EH 1OPOA 2Z31D 1AQMA 3IU3A 3S3CB 1JF6A 4AY0A 1T0MB 1VEOA 4YO0A 4BD4A 1LP9F 4WEBL 3KYOA 2UYLB 2DL9A 2XN9E 3SDXE 1K8IB 3OZKA 1TTAA 4FI6A 2W65A 1MIEH 4HUXB 4NRXB 5C6TH 1HS6A 3V0VB 4D3CL 5JPNC 1EXHA 5BZWB 4I7ZC 4BUGA 4XT1C 1N0XL 2IO5A 3H9HB 2VXTL 3EF4A 2YBRB 3O11B 3TO4D 4D9RD 4DP8X 1QFOA 2CK0L 1ITBB 2HRPH 3ZOAA 4B9YA 4EQ2A 1FZJB 2W0LA 3IFNH 4FS0A 3DJ9A 5IROC 1A6AA 3WNLA 4GXFA 4QYOA 3LQAL 5F7YC 2C9SA 4ES9A 1JNNH 1ZJBA 2X40A 5IBLD 5FGCB 1A7QL 4H8UA 4ELMF 2AJSL 1W8OA 2J1ZA 2YK1L 3S7GA 4UQAA 4Y2OB 1WYJA 1U8PA 3U1QA 3JTSA 1ZHNB 1T1YB 3DPBB 3MV7A 4KY1L 3SDAA 3ULUC 1YPZA 5EU4B 2GK0B 2F8XC 3BWUC 4JVUA 2X4TB 4JFYA 4M00A 5LN4A 1HKLH 2ZCKL 1KLGB 4RMWA 5LGJB 1U2CA 4J4PA 2FZ3B 3D33A 3DJZA 3QHZL 4OZHE 4UIKL 3RWFB 3U7AA 3ECBA 2P7TA 2WOBA 2XNAB 4ZOEA 1MJJB 1ODAA 1U8MA 3QE5A 3TS8A 2DY2A 2G75A 4X6BB 3SBWC 2KL6A 3MRNB 3HMWH 1PDKB 4KV5F 2YD4A 4IRZL 4R4ND 3W1ZA 3ARSA 4S1RL 3VSUA 4LDCA 3CX5K 4O4YH 3CVHH 4N4YB 4HW6A 1S5HA 4M5ZH 4Z1PA 1JXKA 1OARL 4QUOA 4ZX6A 4YX2H 3ZHLA 2LABA 4OLVH 4HJUA 2P5WD 3GS7A 3CIAA 3KVPA 4P2RB 1A47A 1PW3A 1ZV2A 1AXTL 1CN4A 5KVFH 1VGEH 2BP3A 3S4SG 5KW9L 3L9BA 4FFZL 4P4KB 3AG3B 4NBZB 2VM9A 4WWKA 4KO5A 4MS8C 2F19H 1PJWA 3AACA 5FUOH 4LLDA 1G7PB 5H8DA 1JK8A 1ZDSA 3O4OC 2K8QA 2WW8A 1TQBB 4K94L 4YQXL 4NOFA 4O9HL 2YUWA 3NSXA 1E9OA 3Q8EA 3T2OA 3RY6A 3VJ6B 4Q2ZA 2HX9A 1NSNH 4P59L 1U21A 2NZ1A 4HIJB 3T2LA 3UJIH 4RFOL 2R0WH 4HUWB 3FYEB 4APQB 4NKOB 2FO8A 5EU7C 5GJSH 2QSCH 1X9LA 5B1CA 3FS9A 5E5UB 4YVUA 3CZSA 3RWGB 5F9WB 3QFDA 2VLJB 3VX1A 4OCXL 2QLYA 4MMYB 1BZ9B 4YDNA 3RU8L 2HJKB 4N9OB 3M7OA 3QFJA 3K1DA 2YJQA 2ZP8A 3N1PC 4NQVA 1BVKA 1THCA 1HKFA 1FORH 5GSVB 3Q6FB 4ZFZA 3SJVE 1YNTF 4U1HA 3VD2A 3V8OA 1HJBC 3DUSA 4FQQA 1T03H 2OR7A 4Z18A 5DC2A 1HQRB 2CGZA 3DSFL 5TE6L 2V2TB 4DHLA 1A1MA 5DJCB 3U4EB 1TLKA 2VAJA 3LEVL 2VIRA 2HTLD 4IJTA 4MGXA 2L3BA 3BQVA 3HN3A 4BCXA 3JVGA 4PJDF 4PRHE 3E2HB 3HOGA 5CSGA 1PVHA 2FSDA 4K8RH 2MHAA 3ULVH 4XGZB 4HKZB 4W6YB 5LCVL 3V0HA 2VLRB 3S5LG 3U46B 5KN5B 1P6WA 5E8OA 1VFAA 2FQGA 3MAWA 5EWIL 4XNQA 4XN8A 4QR7A 2LW3A 4PG2C 1ZGLB 3E3QC 1YQ2A 2EDJA 3O3UN 2Y36H 2P45B 3P69A 3C6EA 3LEYL 3PP3H 3FONB 2EO9A 3N91A 3BDYH 3FQNA 3O6KH 3JWDH 1QTSA 2EEAA 2WLYA 4PLJC 4S10A 1IVLA 2QQLL 4YDLC 5LN8A 4GQ9L 2Z0UA 4G6AC 5IVZA 1RK1A 5AALA 1W15A 3IN2A 2ADFL 5ENWA 2MOGA 4G71B 2EDNA 4WUUA 5F1NB 4F3FA 4M7JH 4Y2DD 3W38A 1KYDA 1FL3B 3ARED 3DGGB 3F7VA 1RJZB 3EO9H 2EC9T 1J0KA 3FB7B 1IJ9A 3P2BA 4YOKA 4XRCB 4NLAA 1A02N 2YGNA 3QORC 5IMMA 4AE1A 4GRMB 3DTDA 5HD8C 2G2RB 1KJ2B 4KRNA 5GZNC 4HKXA 1AC0A 2HFTA 3FCUB 1M57B 3GZKA 4NT6B 3BISA 1JXDA 1EAJA 3EJPA 3VXUE 4M6NL 3GUTA 2AV1B 3MRGB 4XNBA 4K2UL 3W3BA 1UWYA 4NM8H 1JZ5A 5SWZE 4FQXC 2D7OA 2C3VB 1NIBA 2EEDA 4JZOB 4NFBA 5F1SA 2PW2B 3SY0B 4L1HA 4PJBE 3EOYG 3ARRA 4GP8B 1M6OA 2IFFH 5HGBB 4PRID 1Q0XH 5HGAB 2A74B 4YAQA 2GYSA 2WCPA 3VD5A 3F7RA 3MRJB 4GAGL 4NO5A 2F54E 4YR6B 4C56E 4A2MA 1Y0LA 3CU1A 5IF0A 3L3HB 5FXCH 1IGCH 3ABKB 4ZUUB 3GK8H 3B56A 4I9XA 5KTEH 2FHFA 1O5PA 3BLBA 3QUML 8PAZA 1GGTA 1T5WA 3R18A 5FDYA 5FYLD 3PWLB 5JPNA 4N2HA 4RGOH 3GQFA 4QRPE 2DLIA 2WKGA 1X4ZA 3TZVB 2WUBH 3MUZ1 3DVIA 4TLTA 1EFXB 4B9FA 1GCFA 1ZPLA 1G0YR 5L8LB 2CR0A 2FGWL 1YYCA 5IROA 1NL0L 1PX4A 4YEFA 4Y4HD 3GKWL 5D72L 3MLUL 3B1UA 3LS5L 1X7SA 2K6YA 2BOBA 1KPRB 2KC0A 2AZUA 2EDQA 4O58L 2FIKB 4FZ8H 3TBYB 4DT2A 4Z7WB 1LO5B 1HILA 3CD4A 3MODH 3R1GH 3UERA 2KQMA 2EZ0D 1GVIA 1FVEA 5C2BH 4PJXA 4W70A 5E4EB 3QXDB 4U6HB 4JRWA 3MRCA 1F18A 1LWJA 1FRGL 2I25N 4GXVH 1JWUA 1P6AB 4JVWA 4EKJA 4JRXD 1GW0A 2Q8AL 2IFGA 4OZIA 3ASNB 2EEXA 2DWTA 1V05A 5K59F 1CXFA 1LYQA 1P4IH 1RKRA 4JFPA 1DVXA 4CC0A 3U1PA 3GSOB 1XMWA 3GIVB 4Y1SA 3GSQB 4BFRA 2UVFA 3OKLB 1UQSA 3NP4A 2K6WA 3PABB 4XBMA 2Q86B 4F1SA 4U1LB 4UDTB 1XR9B 1XF1A 1IKOP 5GRWA 3SBWA 4HIIB 3OJVC 1OTTC 4EXPX 4CN4A 2EIEA 3ELQA 4J8QA 4LLUB 4NGHL 5KSUB 2H2PC 2O93L 3OF6D 3LZQA 4FQ1L 1P9MC 4WQOA 4RRPM 2AK4B 2NPLX 4RRPA 2XFXB 3I9IA 1BFOB 1RSFA 1TQCB 2CPCA 4TNFA 4X9IA 5B39G 2G3MA 4XB8A 3RNQA 3BCDA 2WNKA 4GIAA 5DU7A 4WFFE 2R4SH 2Y06L 3AVEA 2Z4TA 5DK0B 1BX2B 1U92B 3B2DC 2OMYB 4JO3L 3GSUB 1HZHL 3QULA 1QSFD 4PV9B 4F8NA 1BPLB 1F42A 1JG9A 4BM7A 4KQ3H 4PM1A 4EUPB 2KQNA 7CGTA 4L18A 4KHXL 4PJ5D 4YBQD 2BY3A 2WLIB 3KG5A 1U2HA 1A9EB 1P1VA 3EJJX 4PS3A 5CBAA 1CYGA 4GKNA 4U1NA 4AQAA 3RILA 4FXLA 2FT8A 3BCFA 5T1LB 1P69B 4BSVB 1B88A 3I75A 4UZUA 3IMTA 1KN2L 4AGLA 1JXJA 2FX8H 1PLGH 4P4KC 1IU1A 2ZUWA 4W68A 1S7RB 4APXB 3CZKA 4LRIA 3MRDA 4M8VA 3NSFA 1XGZA 3IAGC 3NIDE 2NSQA 4JEGB 5FYKE 2LGNA 3DUUA 1QRNE 5I2IB 3LRMA 1KENL 1WAEA 1EUUA 1LDPH 3DX6B 3G6JB 2X41A 4PTTB 3CH8A 5DUBA 3T8XB 2P52A 2ERJC 1IQWL 2C4XA 4U05A 2Q7AA 3U0WL 1GHFL 5I8KL 1JTOA 3DMMB 4LQFH 1IEHA 2YC1A 4WIQA 4JFDE 4K3HA 1I8AA 1T04A 2IOIA 3CGTA 4XCEB 1N19A 4QLRA 3IE9A 5E6SB 1Z5LA 1R5WA 4KI5E 4DJMA 3APNA 1ED3A 1G6RA 1GC1H 4JG9A 2X4RA 1T7ZA 3HPLB 3T8MA 5I1JH 4GLRH 5F9WC 1NBYA 3ZE1F 5IV2A 3V4PB 5ETUA 1GKEA 4PJCF 2R2EA 3SE4C 3GMRB 3VNYA 3ROLA 3ULVF 2JKXA 3K4AA 4HC1A 2FEEL 3WE1A 5IB4B 5IW1A 2J1XA 3SCMC 4QEGA 3BKCL 3V4LA 1ZDQA 4PG2A 4JN1L 1U8KB 1ZT4B 3CK0H 4G7QB 2JFCA 4PJAB 4R97C 4FQ2L 2XV0A 3S37H 5INCB 2NY4B 1DDHA 4N1HB 1KTJA 1OZUA 4FFYH 2NR6D 4DSYA 3B83A 4PGJA 5D9SB 5LQBL 5EU6B 1OF2A 1RUKL 2P42B 2XA8L 1Q94B 4H8QA 1BQHA 1OHQA 2VQUA 3OKYA 3OLEA 4WWNA 5E2WH 3RDTB 3FOLA 3A6CH 4P4RA 1BBJA 3ZU8A 1SJHB 1OB0A 1I3GL 4ZNEE 3NDZE 1LK3H 2E7MA 4BKLA 4J3WA 4XXDB 2PXYD 3IGUA 5CEZE 5CJ5A 5IVXA 4Y1AE 4ILDA 2XHNA 3OXRA 2J56A 3LKRB 3TLRA 1HEZA 1MQKH 3QORA 4J3OH 5A2KH 1XV8A 3J7HA 3PHSA 1G5AA 3T0WA 4G8FB 5GZNA 4BXSV 2PWEA 1IM9D 1MRDH 4TN9A 1LTXA 4PRAA 2ENPA 1JGVL 2IWKA 1O9VA 4L3EE 2X09A 1KCKA 3AXLB 1DQTA 3RIFK 1MIML 1LEIB 5DUPH 3DBXB 3EYOA 5ILTL 2WXIA 4YL4A 3U2IA 4IOFC 1BG1A 4FQXA 2DKSA 4Q6KA 1AD9B 4FFWC 1LWRA 4PJFA 2LOEA 3F85A 3D5OF 3VFVB 3IJ7A 4X4YB 4JDVB 3CDZB 1MW0A 1JD9A 5EFIB 4KJYA 1I3RA 1N7ML 3JZYA 1IQDB 3WN6A 3QHFH 3RX9A 2OL3L 2QTVA 1OK0A 5AYUL 3D3VD 1KTCA 5CBEB 2IGLA 1A6TA 1NGYB 1JMZA 4Y2LA 4DZ8B 5KYXA 1I3VA 1WHOA 2AI0L 3GO1H 1BFVH 4TUOB 1P7QB 3HC4L 3BHBA 3VSQA 1GOGA 4PP2A 3VGDA 1TF4A 1JYXA 3E7JA 5IVOA 1FGNL 1SXCA 1WFNA 2K4AA 4XC3L 1DN0B 3RAJL 1JPSL 1PEZA 1B0GB 4G59C 2CBTA 4G7VL 3U7WH 1Q0YL 1KY7A 1HHHB 5KVFE 3RIAF 3L7EB 4XMVA 2ZF8A 4JVPA 2W9EH 3EDDA 3QQDB 3FTWA 2A74C 3UBXB 2Z93A 5DVKA 2A9MH 4HOWA 1JGIA 1KCSH 2MCAA 1GRWA 4AEHH 2VLKD 2Z1KA 3HI5H 3KPOB 3LKNB 2IVFC 1R34A 1RPKA 3RVVD 2R51A 1BFTA 2HFEB 4TMPA 4NP4H 1UFGA 2IMMA 3IGAB 3VG0H 1X5IA 4LEOB 5FUZH 3FUIA 2G3NA 1I9JL 2UYLA 1K8IA 1WFTA 2OCJA 4NRXA 3V0VA 4HUXA 2JTYA 1AHMA 4UCFA 5K1NA 4JS7A 3TZVC 2NQ3A 3PPSA 3O11A 4AITA 2YBRA 4N8VA 4KKLD 5J4MA 2X3BA 3WY4A 1DQLL 3BUPA 1FSKB 3NJGA 1FZJA 2D3LA 2D7PA 2O5NA 1B6UA 3FL7A 3K8LA 3QDGE 5FHBL 1BZOA 1NBZB 3WBDA 2CO2A 4HF5L 2WXRA 5DD0H 4UT7H 4ODXB 5C86A 2KZWA 3NA4A 2A9NH 1GOHA 3Q8BA 4HUKB 4PJEF 4Y2OA 5E4EC 4LHUG 3MRIB 3WEOA 2YAPA 4FTVB 3VWJB 4OSUH 1P9MA 1ZHNA 3DPBA 3PWPB 2OP4L 4LNVA 3MGAA 2FIRT 2MH4A 5EU4A 1E5CA 2GK0A 2BERA 3DIFB 2X4TA 3BKMH 4IS6A 4DQOL 4G1EA 3BVXA 5IIEB 3MJ9A 1KLGA 4LF3B 1DJYA 1BV8A 2NSMA 2V7HB 5CFAA 3RWFA 3OX8B 5GQBA 2A1WL 4PRNA 4XN9A 1N26A 2XNAA 1HL5A 4HJEA 1MJJA 1MCRA 4X6BA 4MQXD 3MRNA 1MFAH 2FLBT 1EFQA 2JI3A 1PDKA 2DZEA 5J6GA 5LGYA 2E59A 3BE1H 3GDCA 4XP1H 1YEJH 4Y1TA 4NRYB 3V0WH 4PBWD 4W9GC 5T1JA 1YEKH 4MXQD 5I15H 4P2RA 4TNEA 1V27A 3MUUA 3ESNA 1RZKC 3EH3B 4P4KA 2IV8A 4JK0D 1F0LA 1CK0H 5IB5B 3NABL 3KDMB 5IBUB 3BUYB 5J9PB 2IBGA 5DMKB 4CSTA 4AW4A 1DBJH 5FUCC 4DFHA 4DKAA 3H3BC 4OZFB 4WZ9A 4Z0BH 5FGRA 1IBGH 3VJ6A 4KMTL 4P46D 3RWEB 4RMUA 2WBKA 4HIJA 4Z7QF 5HDLA 5DZLA 4LHJB 4OF0A 4R84A 2SEBB 3ARQA 4HUWA 5AW6B 1T0OA 5A3ID 4TYUA 5FO9B 2VZTA 4NKOA 3TWCH 4IDJH 1PLAA 2AJYL 4OF6A 4XO3A 5ITFB 3QR1A 1FYTE 2VR6A 3S88L 5E8DL 3RWGA 1LVEA 5EO1B 3HG0A 1LILA 1QNZH 5EUOF 5HGGS 4L0ZA 2VLJA 4HSQA 4RAUB 4MMYA 1BZ9A 1KC5H 1QRKA 2HJKA 3Q13A 3SE4A 3S97C 1RIHL 4X6CF 3PLYA 1YECL 5CGYD 5GSVA 3Q6FA 3SCMA 3V6FB 1H0DB 3QYNA 1VEPA 3VCLB 4DP9X 3DMMC 4JNXA 4WJKB 1HQRA 4IKKA 1KXVC 2ZPKH 4NWTL 2XIBA 4YEEA 3FW6A 3ZDYE 5DJCA 3U4EA 3QUYB 3HFFA 3W9DA 2ZCHL 1KLUB 4K9EH 5AYQA 2BVOB 1S3KL 4K0OA 4ICXA 4ONFH 2MSPA 3RPIB 4KAQH 2Y5TB 4XVTL 4KDTC 1CBVH 2IAMC 3HFML 3MBXL 4IBSA 1BOGB 3ES6B 4L29B 4HKZA 1MZYA 1QUNB 2IDUA 2AGJL 2WKOF 3QEGL 4MA7L 4AQ1B 1TETH 5EZPA 4ISVB 2VLRA 4AMXA 1ASQA 1F45A 3U46A 5KN5A 1YN6A 5MERB 1AXIB 1DQQB 4OT1L 4HWZB 4GSDH 2QV2A 1C16B 4RWHA 1HFUA 4B3EA 3ZE2E 1BD2B 1ZGLA 1L5GA 4X8GA 2GJJA 2WQWA 3FONA 3FUHA 4EE2A 2XYBA 3HE7D 1IGTB 1HH9B 3GLAA 4H40A 4UV4L 1GW6A 2NY4C 3GMNB 5JOFB 1YMMD 4X7TB 5L4MA 4RQQB 1HX0A 12E8L 2VZ1A 3KW7A 3LH9A 4G8IA 2YFOA 1S3RA 4LDEB 2BHZA 4JY4B 3N85L 5AKRA 3RDTC 4F2EA 3ASOB 2DIEA 1FL3A 3DGGA 2I07B 5CN2A 1PNDA 1AZZC 1RJZA 1UEMA 2ITDB 3EYSH 3NPSB 3T71A 2VR7A 4IRJB 3QEQD 1YNKH 4EPSA 5AWNH 2PN5A 4XRCA 3MLRH 3EBHA 1R75A 2XIIA 1BQUA 4GRMA 1W9XA 1KJ2A 3L4YA 4H0HB 5D1ZD 5J6HA 3T77B 5L2KD 2WGNB 3KYNA 2AV1A 3MRGA 2DICA 4M3JA 4H2AA 4HKJB 4G8GB 4XAKE 1OAYL 2ID5A 1AMXA 4AIZB 4CUCA 3KZ8A 1YQVH 5IOKA 2IH8A 5E6RB 2C3VA 1IAOB 2R2BB 1DE4A 3C5XA 3UZEC 2PP7A 4JZOA 1MZZA 1RIUL 4ZRGA 5JXAL 4FGMA 2PW2A 1A7RH 4J3TA 3SY0A 2J6EA 4K7FA 4EVNB 1MPAL 2BHYA 5JZ7C 1KYOJ 5HJGA 3P30L 5I1EL 3MACH 4NHCH 4O2EB 5HGBA 3VMPA 2CJ3A 5HGAA 2A74A 4M9PA 1SY6A 3QIBD 2H45A 2N56A 4AYEC 3MRJA 1BM3H 5I5JA 5DVOA 4EKXA 4YR6A 4ZMXA 1BJ8A 3LAFA 2MFNA 1RZ7H 3MKKA 4ZMOA 1MIEL 1WK0A 4WHCA 2NOYA 3IEAA 1I1YA 4FEMA 4UUJB 3LPPA 1IM3B 4ZUUA 3SYOA 3VGFA 4ACPA 5A2BA 1UWEH 1FVDB 4YFLF 5DS8B 1PMYA 3DXAE 2HRPL 3MREB 5CP3H 4LPCA 5I1KH 3IFNL 4N20A 3TZVA 5T33H 1EFXA 3P4MB 4UV7H 3EJZD 4P5RA 4MJHA 1CYXA 1JNNL 3ZYZA 5DMIL 1XB8A 1RZPA 3QXAB 2P5EE 1KPRA 1QR4A 1DJGA 4ZS6C 2BIPA 5TPWH 2WZPD 5JHDD 5DMGC 2FIKA 4Z7WA 3TBYA 4DN4H 5CLYA 1CQKA 1LO5A 1JDCA 4FDWA 4IMLA 3L3KB 1XL4A 3HUJE 3H8NA 2J8UE 4HOZA 1JHLH 1UT2A 3QXDA 4U6HA 3P3SA 1HKLL 1F58H 4DOHE 4HPHA 1PIGA 1KXQE 5GS2D 3JWNC 1TSHA 2KZ1B 2OXHB 2Z0BA 2QFPA 5D1QD 5E2TH 1FSKC 3NCCB 3HMWL 1G9EA 4ZD3H 4UTBA 5KSAB 5BV7B 3GSOA 3O45A 3TURA 2R1WB 3GIVA 4OZGF 3GSQA 3OKLA 1GYWA 2FO4B 3PABA 3CVHL 4O4YL 2Q86A 4U1LA 1XR9A 1GL4B 3OKDB 4M5ZL 4BFFA 4HIIA 2EDMA 1KGYE 2FBOJ 4NQCD 4YX2L 4LLUA 5KSUA 5TF0A 5BVJB 4OLVL 4ZQKB 5KWYC 4GUOA 1QRND 5KVFL 1W91A 1VGEL 1WWBX 2AK4A 2NY0B 1GCYA 4HCRA 1BFOA 1JMXA 2F19L 2KHAA 1CBJA 5D93B 32C2A 5FUOL 2MWCA 3UTPD 1KCUH 5DK0A 1BX2A 1U92A 1T1ZB 3QPKA 2OMYA 3GSUA 5AVYB 3VRIB 5J11B 1PZCA 4PV9A 3WKMH 3SODB 3STLA 3L5XH 5C0JA 4JPIB 1JFQH 1NSNL 4EUPA 3S8WA 1YPZE 1AO7E 3GTNA 3KPRE 4GAAA 4YE4H 3UJIL 2R0WL 4QJ5B 2N7BA 5GGSA 2IANB 1Z1WA 2WLIA 2X0UA 4JR9L 1YEFH 5D7IB 1A9EA 5FAAA 2A0LC 5GJSL 3FSOA 2XWTA 3CFJB 5MEND 2YRBA 2QSCL 5F9AC 1W16A 1F5WA 4G72B 4TL4A 4U6TA 3KD4A 4NIKB 5T1LA 4BSVA 1J5CA 4P5SA 2CLVB 2DF3A 1CF1A 1XF3B 6FABL 2X4PB 4IOSD 2VO5A 2W38A 2OTWB 1T3FB 1F3DJ 3ULAB 4APXA 1S7RA 2GVYA 4R7NA 2OYPA 1FORL 3BZFB 4XZUB 1HNFA 3AJ7A 3J07A 1T03L 1BF5A 4X0NA 2NYYC 5I2IA 2IOOA 3DX6A 4PTTA 4AEFA 4BXVA 4F9PC 3UYPB 3T8XA 1Z32X 3ZBMA 3S37X 3DX1A 3IK2A 3DMMA 1S7SB 5CEZD 2F0CA 3CXHK 5IFHH 3QZWB 1KXVA 3AY4C 4GRLC 1KDJA 4Q89A 1B4RA 4K8RL 4E5XB 4LCCB 3ULVL 5ABZA 3GM0A 1KBVA 2I69A 3QEHB 4UIMB 2WAQA 2O4EA 1D7DA 3D69B 2PWGA 2VZVA 3HPLA 4KDTA 1WA2X 4L3ED 1VGKB 2IAMA 1YAIA 4XBEH 3V4PA 1KCWA 1OGAE 1PFCA 5FLVA 1O9ZA 1ZANH 2ITFA 3GMRA 3OB0K 2Y36L 3WIHA 2HUEA 3AC0A 3CCHB 2ZOOA 4PY7B 5IB4A 1P84J 1J86A 1UD6A 2ESVD 2FGZA 3A0OA 5D1XE 3U83A 3RZCD 3O6KL 4ONGH 2JXMB 3JWDL 1ZT7B 4FFVC 4GRWB 2HLFD 3BDBA 4P2QD 3V52H 3PHAA 2X42A 4Y16D 3UAEA 4JFED 1U8KA 1ZT4A 3S0PA 1GH7A 4PJAA 5INCA 4PRPE 5TTRA 4M7JL 3V0GA 3D08A 5GRJH 4H8WC 5D9SA 5EU6A 1FPTH 3P73B 3EO9L 4QHPA 1P4BH 1IFRA 4FQPA 4WI7A 3RDTA 4K7PH 5BOPA 3O0LA 2R8SL 1SJHA 3N41F 2ZSWB 3EYFA 3FUFA 3A23A 3VGGA 4CSSA 4RH4A 4XNXH 5TQ2H 4N68A 2K8MA 4BFNA 4GB9A 4L4VD 4RX4A 1ZLEA 4AJ0A 5F9JB 4G8FA 1FI8C 3P0GB 4MVBD 4NM8L 5EOCH 4EN3D 2P80D 4NFDA 3AXLA 3HG1E 1LEIA 5LUMA 3NP3A 3PL6B 3DBXA 4AL8H 2I9LB 4JRYE 3JUZA 5JW4M 2X2UA 1H15B 1J9TA 1ET7A 1AD9A 2IFFL 3CN2A 1IL1B 1Q0XL 5IQ7H 1AR1D 2FR4A 3FO1B 3VFVA 4X4YA 4JDVA 3CDZA 3UIZA 1MH5B 1BXAA 3I2CH 1KTRL 5EFIA 5IGXH 1ZLDA 2VR3A 1IQDA 5EU3B 1IGCL 4RZKA 5CBEA 2QSVA 3GK8L 3RA7H 1F11B 4KFMA 1NGYA 3AB0B 3WYRA 4DZ8A 1MWAL 4A2GA 3B2MA 4AKOA 3R4RA 5KTEL 2A4EA 4TUOA 4I3GA 1P7QA 4RGOL 4HZLA 2WUBL 2CRYA 2YQ2A 4KXAA 1QWUA 2QBWA 1QFWM 1B0GA 2ORBH 2OCFD 4L8BB 4UYPA 5HI3D 5I8CB 1MAKA 4ELKB 1WZMA 1HHHA 5DMJB 2DYPB 3L7EA 1SXAA 3KPSE 4NO2B 1XAKA 5I82A 1R3KB 3QQDA 5DEGB 3BUBA 4FZ8L 3UBXA 2H2SD 4Y4FC 2QGCA 3R1GL 3WUWB 4X4MA 4ERSH 1WAAA 5FC9A 3IBEA 3RWDB 5C2BL 3KPOA 3LKNA 3WTWA 4FJZA 2UZYB 4X6DF 2WO2B 4GXVL 1EDQA 2WQVA 5T3ZE 2HFEA 2YD6A 3LD8B 4MMXB 3CSTA 3W37A 1R0AH 1WCQA 1EIBA 1ZVHA 2ALWA 3MRKB 4LEOA 4BINA 4BWUA 1M71B 3VE0B 2AXHA 3DETD 3O81A 2KLRA 3ULSB 1PZ5B 3M07A 1FCGA 2WNWA 3VA6A 5F7LB 1P4IL 3UTQB 3WKYA 2NY6B 3N42B 2WBJB 2XSKA 1E4XH 4S1SL 4F20A 5C71A 4IMKA 1RK7A 1M3JA 1NBZA 2YKKA 4XNAA 2ZWKA 5CEYB 4HYTB 2X2HA 1INQB 4U3SA 2XG4B 3ZKND 3IGFA 1CWVA 4ODXA 4AUYA 1G7QB 5LBGA 3RRQA 2B5IC 3GZPA 1PF3A 3FQ2A 4FXGB 4QYAA 1XIWD 2NRDA 2H8PB 5ICZB 3MRIA 1QEXA 1WFIA 4R5TA 2EEBA 2R4SL 4UILL 1FFOB 1M1SA 2CH8A 3PWPA 1MCKA 3N1FC 5B7EA 3DIFA 4KQ3L 5IIEA 2PWFA 3BD3A 4LF3A 4MJID 5K93A 1IC1A 3O3DB 5BNXD 4X80H 5LG6A 2V7HA 3N3EA 3OX8A 2Y69B 4JX0A 4GKZB 5GRXG 5GZOC 5BV7C 5KSAC 5C0BE 3H4FA 1FYTD 4MAZA 1D9KD 4FKHA 5KBNC 1T4KB 4FG6C 3Q06A 2WXNA 3TV8A 3C2SA 1M9SA 5CS7A 2X70B 4R5VA 1CR9H 4PJIF 1Q8MA 1JZJA 3N50A 3OMZA 2OK0H 3KYKH 4QOKD 5HBBA 4X9HA 4BQ6A 1A66A 2FX8L 3FK3A 4HGWB 1OT4A 3RVWC 1PLGL 1ADWA 4J3BA 2NY0C 4QWWC 3OGOE 4I9WD 4NRYA 4G9FD 4MAYD 1I7UB 1KGWA 2VDLB 1J8RA 1HOEA 4AM0A 4FD0A 3S3SA 5IQLA 1LDPL 5J11C 2WPGA 5IB5A 25C8H 2ARWA 2WQUA 2UXVA 3KDMA 5IMOB 5C0CD 3BUYA 4MB3A 4ODHL 4H7VA 2X1PA 4ZI8A 5J9PA 1ACCA 4LQFL 2HLAB 3U7YH 2B15A 4F9PA 4OZFA 3RB5A 3BAEH 2OZ4H 3L7FB 3RWEA 1GC1L 4V2CB 3KBHE 3X3FH 4UF7C 15C8H 2SEBA 5I1JL 4LK4A 3AY4A 3CV5A 3MC0A 4GRLA 3TEYA 4HJ0C 5FO9A 2GB2A 4FCAA 4TSBH 2QDWA 5ITFA 3WU1A 1BP3B 5D6DC 2B7DT 2C3XA 4PIBA 1MCPL 5EO1A 5E6IB 1NFDF 4S0HA 4N8PA 4RAUA 2ADJB 5ID0A 3PQYE 1C5BH 4OQTH 1JPST 4LCYA 5EH1A 3CK0L 2BS8A 4FF9A 3VQLA 4JPVH 2XG5A 5HDOA 3S37L 4L0PB 5G2NA 3RY5A 3UO8B 1DJXA 3GSNB 2HN7B 1SJMA 3VCLA 2H0PA 5KBDA 3VXNA 1C7SA 2A77H 3QUGA 5J13C 1FFNB 3RX5A 1MI5B 3CXDH 4AENB 2B1AH 3CVDA 1OHZA 3OPUA 3QUYA 1J9QA 2XRAL 3OKOB 3QXVA 4LCCC 5E2WL 2DMGA 1KLUA 3A6CL 4A7UA 1VERA 1G43A 1HXYA 2BVOA 3PG2A 3RPIA 1TVBB 3HNVH 1A0QH 3MV9E 1I1AB 3GJFB 1QATA 4N2OA 1LK3L 1YHPA 3F5WB 3TONA 3FSWA 5HDWA 1T1WB 1BOGA 4QRBA 3ES6A 4L29A 1MQKL 3EUUA 1QUNA 5K9OA 1CL7H 5EORH 1OSEA 3MUHL 4ISVA 4YGVA 2NY1B 1MRDL 5MERA 1LJMA 3BZEB 1DQQA 4HWZA 1C16A 2DH2A 5C92A 1C8QA 2H4EA 4XTRC 1FNEA 5DUPL 2OMTB 4BA0A 1IGTA 1HH9A 3FYIB 5JOFA 3GMNA 5BO1H 1YAZA 5D5MB 3WD5L 4XMLH 4FYQA 4RQQA 2ED8A 3FT4B 2QADD 1TZAA 4OLXH 5DO2D 1BQRA 1CICD 1HESA 1EZUA 4JJHA 4JY4A 4HSAC 1XEUA 3T8VA 1ROWA 1TQTA 4HS3B 1HHGB 3QHFL 2VKXA 1W6WA 2I07A 3L5IA 2ITDA 2GIMA 2R1YB 4PP1C 3DXAD 2J7LA 4IRJA 4MXVF 3IXTB 4OBSA 4ZG1A 2JKNA 1Q0EA 5AZEH 4DESA 2R4RH 2Q20A 1F56A 3BRGC 1Y6KR 4JBSA 3DX2A 5IQMA 3KLSA 2J73A 4YC2B 3NYKA 4YPJA 1UUNA 3IDXH 3WO3B 3PL6C 3U7WL 4HKJA 4G8GA 1CE6B 4AIZA 1ETA1 1T66C 2W9EL 3CLEH 4FA7B 1CDCA 4GBXD 1FO0A 2P8MB 4JKMA 4K15A 2DLHA 2R2BA 3ZZSA 2DI7A 4LMQE 4AZUA 1OSZB 2A9ML 1KCSL 4MAUH 3GHPA 4EVNA 1SQ2N 1JCKA 4AEHL 3HI5L 5TDNB 3QDMB 2QMJA 4O2EA 1FL5B 3JTBA 1PL3A 3LQZB 3VGBA 5JHAA 3P11H 4NP4L 4ZPTB 2AABH 4Z95H 3VG0L 5FUZL 2QQNL 3F6JA 4KJQC 1E9QB 4LAQH 4NNPH 4D0DB 2E3VA 3LQMA 4UUJA 2UZXB 1IM3A 2MPVA 4JDZB 1SMAA 1FVDA 1Y18A 5DS8A 1I8KB 4ZZKA 1GTNA 3MREA 4NKIH 2GIYA 1WZKA 2YN5A 5DHVH 4B7IA 3P4MA 4NRZB 1HSAB 1SRDA 1M7IA 5DD0L 4UT7L 3Q9PA 3U25A 4L8CB 2OYMA 3AG2B 1GZPB 1VB9A 2DQIH 2A9NL 3GBLA 4PTUA 3VI4B 3QXAA 1DQVA 1S9YB 4J1UB 3KWTA 1J0YA 1RUPH 2FUQA 4OSUL 1BYNA 4LE8A 4MMXC 4PLOB 3L3KA 2D0HA 4HDIB 5KYNA 3SDAD 2N1KA 3MV7D 3BKML 2YGQA 4M8QA 1IAII 2ZP0T 4XMTA 3KJ6H 4DAGH 1YYMH 4QXWA 3PUUA 3H9SA 4QT5A 1MCFA 4HVBA 2NY6C 3O2VH 1X5LA 4TVPD 4J4PD 3QPXH 5F9OH 5TH2B 1EMTH 2BWIA 1CGSH 2OXHA 5AENA 2WBJC 4BGDA 3KLHD 3PAVA 2ZWSA 4FXTA 4PVLA 1MFAL 4DGIH 3PWUB 1LO0H 2VN4A 5GZOA 1TZGH 1ADQH 2D31B 4P3CH 5KSAA 3BAJA 2R1WA 1UM6L 3D39E 4M8UA 4WSKA 2FO4A 1EAQA 3ZRCC 4PHZA 3BE1L 4XP1L 1YEJL 3OKDA 5C0GB 5I30H 5KVDH 3V0WL 4WHYH 4X7EC 1YEKL 2CUHA 5BVJA 5I15L 4ZQKA 3DJTA 5F7FA 1E0OB 1VENA 3ISRA 5D70H 3DC0A 1AE6H 1CK0L 1ULVA 2ZG1A 4WWKD 1A9BB 4X4ZA 1VADB 1TFHA 3L4XA 1CLCA 2I60L 1E6OH 2MQ0A 1PQZB 1T1ZA 2XOTA 4IBQA 3TV3H 1DBJL 2ZYRA 1TKWB 3RX8A 1RZJC 4Z0BL 1IBGL 4LXFA 2MNWA 2WXQA 5D2LB 3T6ZA 5D6CB 1WUZA 4JPIA 4DW2H 3LN4B 5ESQB 4G7RB 4UI2A 1E5UI 1GMEA 4KXDA 4M62H 5GGQH 3SDDB 4UINH 2IANA 1SNRA 5D7IA 3W5MA 3TWCL 4IDJL 3WY1A 3B9EA 4HXAH 3QCUH 3CFJA 2XUWA 3HS8A 4FNLL 2LE9A 2G3ZA 1QNZL 1VRSA 3BOVA 4HJGB 4K5LA 4MQ7B 4UQIM 2OYLA 2GI0A 4CVZB 4X98B 2BC4B 5LAXB 4ZMTA 1KC5L 1A3ZA 2CLVA 1XF3A 1PLCA 2X4PA 2O61B 4M6OH 2OTWA 4HSCX 1T3FA 4NQDA 1KBKA 5DEFB 5DS1A 3QFJD 1PBYA 5LBSA 3BZFA 5HHVH 4XZUA 1QPKA 4PWJA 4YFLI 2C9PA 1MCHA 4JCLA 3LYRA 1SDYA 1XHHA 2YKLH 3OM3B 2DLTA 4MNQB 4A1RA 2PLTA 1GAFH 3UYPA 2O6FA 3T2NH 4N26A 4K9EL 4Y89A 1OSPL 5B38B 1S7SA 4ONFL 2C9AA 4KAQL 4WFEE 5T1MB 4WCYH 3QUXB 3QZWA 1CBVL 4TQPA 4HUCA 4PWGA 2QKSA 1O7DE 2GITA 3HG3A 4S11A 4KJWC 2JF1A 2OULB 4LCCA 3V5DB 4E5XA 1LQSR 2PUQT 3NIDF 3QEHA 4UIMA 5SWSB 3TYGH 3EGSB 3ZRFC 1TETL 3D69A 5B3JF 4U7KA 2W0PA 2ARJQ 3G7TA 4Z7IA 3C8HA 1G9NH 2EAEA 4GSDL 4B27A 3K2MC 3DSNB 1K9TA 3V8CA 2BVEA 4KXBA 3CCHA 4PY7A 2A9AA 2OMXB 2ZKHH 3ABZA 4F2ME 1U8IB 2EXWD 1ZT7A 2JXMA 3TIDB 3SQBB 2BK8A 2UXGA 2NDFA 2CSPA 4KDWA 1CU4H 3HS9A 1CLZH 2YMOA 4HAGA 4S0SD 1RAMA 5DZ9A 1NA8A 1I1AC 1BWWA 4WUUD 3EYSL 3OJ2C 3P73A 4TSCH 3ZL4H 1YNKL 5AWNL 4XP4H 3MLRL 4R7VA 4YSUA 3LIZH 3JWOC 5KAQF 4G6FD 4A2EA 1ETJA 5F7WC 2ZSWA 2YGPA 5KG9B 3M88A 5GRUH 1S5IH 1BREA 4TTDC 3X12B 5EA0H 2AMUA 4HUNB 5F7EH 2BNQE 2BNRE 1AP2B 2IIJA 1IO4C 1YQVL 5E4OA 3IWUA 2WTOA 2CBOA 2Z64C 3F65A 2VLRE 3BP5B 4RGNB 2R69A 3H56A 1DVFC 1SLVA 1UA7A 3PL6A 2AVFA 4NC1E 2I9LA 2DMKA 3WNJA 2WO3B 4NZJA 5DHEA 3QNYB 4AWJC 1H15A 3MACL 4NHCL 3FU9A 1WS8A 1GJUA 1IL1A 4TSAH 5AQ0A 5D7SH 3FO1A 3O4LB 4Z7OB 1BM3L 4HIQA 5FWRA 4RNRB 3ILPB 5DURD 4CNIB 1RZ7L 1MH5A 1NLDH 4I3RH 2JKSA 3TBSA 4PJ7B 1K8DB 1ETB1 3B9KB 5EU3A 5E08H 5CIPH 1F11A 3SY6A 4IU3A 1UWEL 1DN2A 2V8LA 2EABA 4YC2C 2JJVA 4YH6A 4CSZA 4OFPA 3NIFF 4P9HH 5CZVH 1L0PA 5D7JB 5I1KL 4A7GA 2EE0A 5F7UA 5T33L 3NH7L 4HAFA 4UV7L 1J0JA 5KAQG 4KK5C 3GMQB 2YRZA 4FE9A 4L8BA 2K7PA 5DJZB 5I8CA 1YEDB 4I2XE 4Y4KC 5LNGA 1P5VB 2DYPA 2YA0A 1ECYA 4IKLA 4Y19B 5IROD 1KEMH 4NO2A 1R3KA 3KCWA 5TPWL 5DEGA 3II3A 1QLEH 1NGPH 2YXMA 3WUWA 5AW7B 5LJYH 4M61B 1BBDH 2CJUH 5BZZA 5LB1A 1JHLL 3RWDA 4BCZA 4ZX3A 3MXVH 4PCTA 2UZYA 4GG6B 1MCCA 2M83A 3NCBB 4XPTH 1BMWA 1F58L 4WTWA 1XGUB 4MMXA 3UEQA 4KTGA 1DL7H 2G5BB 2IBBA 1UXLA 3ARYA 1EHAA 1M71A 3ULUD 1UACH 5DJAA 3VI3F 3HC3H 1PZ5A 3L2MA 5E2TL 2YSTA 1N6VA 4ZD3L 1ZTXH 1ID5I 3G9AB 1KN4H 1MHCB 4LBEB 3QDJE 3MNWB 5SX5K 5LVEA 2WBJA 4HD9A 1MG3C 3OLGA 4ORZC 2NUTB 4HS8H 4N24A 1PU0A 5CEYA 5C7XH 4LQ1A 2PR4H 5K9KB 2XG4A 4DUXA 1WA1X 1NCWH 5GGRB 4AI7A 1G7QA 2GBUA 4K3JH 4ZXBB 1T0NB 1TJIH 2R29A 2X28A 1V55B 2EO1A 4FXGA 2H8PA 5ICZA 2OJZH 5HHXH 1NANI 3WJJC 1MRCH 1FFOA 1KCUL 2IALB 3SHSA 1U8CB 2ZSVB 4QRSB 1QR1B 4LCUB 2PTUA 2OKMA 4Z3FA 1SYSB 1SEBB 1QZ1A 1Q72H 4MS8D 2V2WB 3L5XL 1JFQL 5J3HC 3VXRB 3K4DA 3O3DA 2Z31C 4PD4K 4G80A 4XMPH 4YE4L 2H32B 4GKZA 4P23B 1UZ6E 1SVZA 4CVWA 4TXVB 1YEFL 1NINA 1DEDA 1T4KA 5IHZB 2GCYB 4JO1H 3T4AB 3M17B 3KPLA 4GW1A 5E03A 1J05B 1DVZA 4GMSH 1JVOA 4IBWA 1F2XK 3A6BH 3TF4A 1NEPA 1P53A 3FZUC 3T3PB 4HGWA 2VL4A 1SEQH 2WYHA 3UAFA 3QWQB 3OB0H 3G5WA 3IF1B 3TJPA 3M46A 1RULH 3W0WB 1O6SB 3B2UC 3RHWK 4O02H 2FTAA 5J56B 1T2XA 3H7BB 5CO1A 1A4CA 4A55A 5HDBB 2ZYSA 4UM9B 1JGUL 4U31A 2VDQH 5I1HH 5IMOA 1IC0A 1NIFA 1OQXA 4AIXA 3FQYA 4BZ1A 1N5YH 1IV8A 2HLAA 3LNEA 5IFHL 4LVNB 3SDDC 3VRJB 5SV3A 4MDIB 1TUPA 4WHYG 4KQ4H 1EXUB 1TNNA 2PPDA 2WYZA 3L7FA 1S7VB 3PV7A 1HHJB 3CHRA 4M5YH 2J5LB 4XBEL 1KJ3H 2O5YH 3OXSB 1ZANL 2EYSA 2PCPB 4URTB 2JB6B 3HI1B 2D2OA 3MRMB 5E6IA 4E41E 4OLYH 1J87A 4ONGL 2ADJA 2CALA 2O1AA 4TVPH 3V52L 3BUTA 1XXDC 3UPRB 5K9QG 1N6QH 1VAHA 4GO6B 4RFNB 3RTQB 3GSNA 1KACB 2XPGA 1BJ1J 2GI7A 2HN7A 1SM3H 3S9DB 5GRJL 4AENA 2X6CA 4UQBA 2VWEE 4Y5XB 3QUXC 1FPTL 4PLJD 4UTAH 5F96H 1SHXA 1KULA 1P4BL 1S6NA 2DQUH 4K7PL 3MRRB 2ZX8A 4U0QB 1TQVA 1AJ7H 5G5DB 1TVBA 1QTYT 3NQKA 1HI6B 4ZUTB 1BVNT 1I1AA 3G6JE 3GJFA 2D7QA 2OJ1A 2QHRH 1T1WA 1KGUA 5FA4B 3WNMA 2VR9A 5TQ2L 4KHTH 3QH3B 4P8QA 1MCQA 1CGTA 2WP3T 3NRFA 1CDIA 3QUMB 3LPFA 3QORD 2VR5A 3FUEA 1YEEL 5HD8D 3BZEA 5EOCL 5I19H 5GZND 3X1BA 1BZ8A 3OJDA 4NQEB 4N2IA 3CIQA 3OKKB 4X8CA 4LB8A 3LJ3A 2EDEA 1AGBA 2OMTA 3VXTB 1JZDC 3U82B 1LO4H 4QJ4B 3AGVA 3BW9B 5D5MA 4UT6A 3VXME 4V2BA 1WJ3A 3FT4A 5IQ7L 4XPFH 4FQXD 4XOBA 4B97A 4G5AA 2YOAA 3DJRA 3I6LD 3UGEA 2WUCH 3ML9A 4Y9CA 3I2CL 4Z7UF 5KVMC 5IGXL 4PJAE 4HS3A 1HHGA 3I6SA 4X6EB 1J1PH 5I1AB 5E2VH 2R1YA 4FXKB 3OPZH 3RA7L 2EVHA 2ZWYA 3IXTA 1BHGA 4ODTH 2DIBA 2J43A 4UOW0 2IH1B 2GABA 3U9PH 3WXWH 1K3IA 1PY9A 5EU6E 2N0KA 1AHWB 1IILE 4JE0A 4KOCA 4ZO9A 5FM5O 3MRPB 4ZW6A 4H1LB 2NW2B 4RGNC 2ORBL 1VIWA 4D0BB 5GSRB 1CE6A 1TJGL 2P8MA 3BVVA 4AKPA 5JHMA 3VRLE 4N8CH 4Y4KA 4ERSL 1A7OH 1EJ8A 5TDNA 2ZP9A 3QDMA 4BK4A 3VFNB 1FL5A 5B4MC 3B9KC 4YLCA 3LQZA 1P7KB 1H6FA 5CILH 4ZPTA 4GI8A 3RUGB 3DX8B 1QHOA 1R0AL 4BUHA 5AEAA 1R4XA 4LGRB 1E9QA 4D0DA 5EBWB 4Y2DC 4WI3A 1QI4A 3G08B 2UZXA 2XN9B 4JDZA 2CUAA 3SDXB 3DGDA 4Y5VB 1I8KA 2OSLB 3HMXA 3HG5A 3F2LA 4QJ3B 1AKJB 5BXFB 1E4XL 4ZS7H 4RAVB 2Y7NA 3HEIB 2H7WA 3UTOA 4AJWA 1URLA 4RISL 1WT5C 5DJ6B 1HSAA 2G9HB 4L37A 3VDCA 2WANA 2JE8A 4L8CA 4P2CG 1GZPA 4PJHB 4PJGE 4JAMB 4CBZA 3AGWA 4MLSA 3VI4A 4KZEH 1S9YA 3O8XB 4J1UA 5FM4A 2VXQH 4L3CA 1OTTD 1E4KC 1P0SE 2H2PD 4MXWL 4XP6H 1SN5A 2DQFB 3LY6A 3HR6A 2WVUA 3N40F 1MFUA 2VXVH 4K94C 1EEYB 3SOTA 1TQWA 4UOJA 1SZNA 3UYOD 3IDYB 3WJJA 4X42A 3ZLQC 4HG4K 3I9GL 3M8OH 4XNDA 4ZW8A 3MKGA 2YPKB 3IJYB 3WAJA 5TH2A 5F7AA 4WEUD 4BIKA 4H2CA 1FJ1B 1QI3A 4Z78B 4OZHB 3EDEA 3QZOA 2A6JB 3BIKB 1CR9L 1D7CA 5AVTB 4BSJA 5GHWH 2D31A 3D4ZA 3HUJF 2OK0L 3KYKL 4NO3B 4OR1A 2PW1B 3KVDD 2F7PA 4LARH 4JO4H 3V6OC 5C0GA 4ZXBC 3US0A 2WN3A 3MMEB 2YFNA 1E65A 4WI4A 4DVBB 1JYNA 2J21A 4JZNB 1T7YA 4MA3B 1A4KB 4P2RD 1VA9A 1H6TA 4B96A 1UC6A 5D55A 2WLHA 2MPAH 25C8L 1RHHB 4Y4HC 4P4KD 3SGJC 3VXQB 1A9BA 4IEFB 4PVMA 1VADA 5AOIA 4N90D 1HSBB 1PQZA 1YEWA 3U7YL 3UTSE 3WGUB 4KITB 4ABVA 1TKWA 4Q9RL 3BAWA 4FTVE 3BAEL 3IGKA 1KGCD 1PLBA 3MFFB 3PAZA 1FV1B 2OZ4L 1BCIA 1CXIA 3A47A 3FRPG 3LN4A 3PWPE 5D6CA 5ESQA 4DPAX 1M1XB 1CZ8H 3X3FL 4Y9EA 15C8L 2G0LA 2GW5A 2VDRH 3SDDA 3N0PB 1H6UA 1M56B 4JPWH 4JFHE 4TSBL 4KZDH 3ZY7A 4DETA 4YHKL 3K8MA 4Z7VE 3MBWA 4ZX5A 3QWOB 3TC9A 3BXNB 4ZUWB 5HPOA 4HJGA 4KNTA 4MQ7A 1U8NB 4QXTB 3OD3A 2OX5B 4X98A 2BC4A 2UY6B 4MA1B 5LAXA 1C5BL 4OQTL 2O61A 2Z8VC 2VLJD 3BLPX 1OOWA 3PGFH 4JANB 5CP7B 2PPEA 4JPVL 1YPZF 2AZAA 3UTTA 1U4EA 5LO7A 1MJ7H 3DO7B 4HQQH 2A77L 4XMKH 4ZK8A 3SCMD 1ZSDA 1TCMA 3CXDL 4HMDA 1OD7A 2B1AL 1NUDA 2MRYA 2ZD0A 3VFGH 2KMWA 4LVNC 4MNQA 2Y22A 3SJVB 1OCOB 5LNEA 3F7QA 3AXHA 1MXDA 2E76C 3UAJA 1CC3A 2WZ5A 3HNVL 1A0QL 3BWSA 3EZJB 4J3UA 5T1MA 4HWBA 3QUXA 2J5LC 1DZ0A 1OB1B 4WKXA 4BWTA 4JL1A 4NOBA 4P9ML 5AW8B 5SWSA 4PRHB 1CL7L 3EGSA 5EORL 4ZMYA 3V0EA 4NXSA 2YD3A 1RH8A 1XGQB 2R56H 4XNMB 2VLRD 1NIAA 5BRQA 1EK3A 2PETA 3LKPA 3L4VA 4QGYA 3V5HB 5D1ZI 1P5UB 2PYEB 1AIZA 2KI6A 1MFEH 3T1WA 2OMXA 1U8IA 3TIDA 4BFOA 3SQBA 4YPGB 4OLXL 1ZK5A 2LTQB 3B6SB 4MD4B 2VM4A 3QW9A 4OZ4B 3MV8A 1BA9A 4B9JA 3MOBH 1UKQA 1ODUA 4IOFD 2ZNXA 3OC5A 4FFWD 1URZA 1QSEE 2RACA 2W5PA 1HC1A 4Z3TA 5AZEL 3SKUD 1ZTXE 2CKBH 2VR8A 2R4RL 5BRPA 2EECA 1BZQK 1M3IA 1X5YA 3VSTA 3HI6H 2NY3C 4NNYB 3TA3B 4J3XA 3Q44A 4IKIA 5KG9A 3X12A 5B3SB 1UXSA 4OD3H 4GI6A 3FTXA 4Q56A 5AKTA 3GMMB 3SKNB 3IDXL 1AP2A 5JA8B 4XBGA 1RURH 4WGVB 3VXUB 4YDKH 1FL6A 4FYSA 3CLEL 4WNQB 3FQ1A 4XMWA 3BP5A 1MCNA 3B34A 2W80C 3UXFA 4MAUL 3EUDA 5SWZB 1JPGA 1BD2E 3NJVA 4JFWA 3QNYA 3BT2H 5EEXA 1MEXH 2XWZA 2GQHA 1ZHKB 3P11L 3O4LA 4FXKC 2AABL 4Z95L 1TZIB 4OCSH 2BY2A 3D7PA 1NDMB 1VLXA 3ILPA 5HYSB 5KYYB 4F91B 4CNIA 4LAQL 1K8DA 3B9KA 4NNPL 3IDGA 4PJ7A 4F1ZA 2WXOA 1KF9B 2F54B 2ZXGA 4C56B 4OD2B 5GS0C 4LASH 2ADGB 3U4AA 1HEJC 3T0EE 5D7JA 4N2AA 4KNUA 3VD3A 2HT2C 3FQXB 3OQ3B 3DBSA 2F2HA 3TZVD 1SOQA 3K8KA 2PCYA 3GMQA 4F80A 1EFXD 4QRPB 5DJZA 3C6LC 1YEDA 1YY8B 5DCCA 3ECUA 3L4UA 1OK8A 1OY3B 1P5VA 1ACXA 5DFVC 4Y19A 1WT5A 1RUPL 2EIMB 3WIIH 2C7UA 1EEZB 2YS4A 2OMNA 3I6KB 5C08B 4M61A 4PMFA 4KTDL 4P06A 4GG6A 3KJ6L 5BOJA 3IDJB 4DAGL 1E4KA 1YYML 2Z3FA 4DO5A 1AQHA 1XGUA 4F33B 2ZNWA 2ZUVA 2G5BA 3O2VL 4F7KA 2MOQA 5ES4B 1HINH 4Y5VC 3L3GA 5H2BB 3QPXL 2ZUXA 2A6KB 1EMTL 1CGSL 2ZX6A 3RWIB 1D7FA 1WZLA 3W2DH 4ADJA 5KS9A 1NCGA 2X0WA 2AANA 4X9YA 4PAZA 1C1EH 3IDIB 1LO0L 3L1GA 3T0BA 1TZGL 3SE3C 1ADQL 4P3CL 5CJXC 2Y1AA 1BFSA 3PHQB 1MHCA 4LBEA 3MNWA 1KPUB 3B43A 4G9DB 5I30L 2NUTA 4B9ZA 1A65A 1PZSA 2VDKH 3O8XC 2GTWA 3CQQA 1YNTB 5K9KA 1IC5H 3KPTA 3C5ZC 3MOAH 3V6OA 5GGRA 1ZHBB 3ARGC 5D70L 4ZXBA 1T0NA 3REVA 1AE6L 5JDJA 2AK4D 1GSKA 3JVFC 4JUTA 3TBTB 1RJCA 3IDYC 4UOQA 4XO4A 1E6OL 1KXHA 3O0RH 3N6YA 1U8CA 3TV3L 2ZSVA 2CBQA 2R2HB 4LCUA 1QR1A 1SYSA 2ZUQB 1XCXA 1SEBA 2OR9H 3SGJA 4U0RB 4CMHB 4D7PA 2JKIS 5T8IA 4DW2L 1TZHB 4WNJA 2H32A 4M62L 5IOPB 2YGVA 4FG4A 4A2LA 4UINL 2IDQA 4N87A 3ERXA 3QCUL 4HXAL 5ECJE 1KTBA 5IHZA 2GCYA 1ZS2A 1LE5B 4AEEA 4YHZH 5DZPA 3TN0B 1W0YT 3ZTJG 1JZ4A 3LEXB 1J05A 1QW8A 5LCVA 5JO5B 4UBDC 1ZS8B 1B4TA 4M6OL 4R83A 1SUJA 5T1LD 1D5BB 2AERT 4AYID 3QJZA 1S7TB 3GBDA 4PJXF 5HHVL 4G2AA 3V5KB 1CVSC 2CD0A 3L9RB 3W0WA 4HGKC 1EHLH 1LO3L 1O6SA 4ODSH 1IEBA 3ULUF 3EYVB 3UJJH 2WVTA 3H7BA 1CFNB 5I76B 5IBTH 4JFZH 3AU1B 3BWUF 4L1TA 4UM9A 3T2NL 4OZIF 3US1A 3S8FB 2I32A 3GRWH 2BIHA 4WCYL 4YLBA 3DMMD 1MFNA 3VRJA 2IH3B 3B2XA 4MDIA 1L3NA 3GF8A 1XF5B 4Y0GA 5D8JH 1CFQB 2BSBA 3TYGL 1HHJA 4NZRH 4JFDB 3BWZA 2MEJB 2N4IA 2XIDA 3ARDB 2AXWA 3P2DA 4FHKA 1G9NL 4MA1C 4PGBB 3OXSA 1WC7B 2IAMD 2PCPA 2JB6A 3NJXA 3HI1A 1KJMB 3DHPA 1NAMH 3H9YA 4HIPA 1RL1A 3MRMA 4E36A 2CRZA 3MJ9H 2ZKHL 2IF7A 2DPKA 2YWZA 4OUUB 2VC2H 2J6WA 5TK4A 1CTOA 1PD0A 2F53B 1YSOA 1CU4L 3KYAA 3COOA 5MEQB 1E9PB 1CLZL 2WV3A 2NY4D 2YPVA 5BW7C 2O72A 4Y5XA 3K91A 2PF6A 1XGPB 4TSCL 3ZL4L 1OWWA 2X87A 5EU6D 4XP4L 2EDXA 3LIZL 2NXYB 3EH1A 3WTVA 3MLSL 1UCBH 5G5DA 2WSPA 3RDTD 1HI6A 4H8PA 4ZUTA 3STZB 5AVUB 1U30A 5GRUL 1S5IL 2H6PB 3MRLB 5FA4A 5B39B 4LCVA 3U2JA 1CFSB 2NDGA 4RLDA 3WENA 3QUMA 3BP6B 2KZKA 5F1KC 1SPDA 4Y1AB 4RX4D 1RIVL 3LN5A 1F97A 3QO1B 4NQEA 1CYWA 2BP0B 2K7QA 3WL9B 3OKKA 2J55A 5IP4A 4MJ2A 2LTQC 3VXTA 4CMMB 3ZT7A 4TQ8A 3ROOB 5DC0A 3BRDA 1EDYA 4KKPA 1ZLWK 5EC2B 4TSAL 1Z0NA 2OXGB 5D7SL 1CPUA 4RRPG 1T5XB 5K9QI 3BMVA 4OCRH 5CGYC 3TBCA 3RB7A 4HX1B 1NLDL 2PPAA 4I3RL 4C57C 5JZ7D 3QIUB 1MAJA 5ICYB 1E42A 3V9FA 4X6EA 2DBLH 1F4HA 3DTXB 4HBCH 1HIMH 4FXKA 3TA3C 5E08L 3FUMA 5BS0B 2GJPA 5H94B 2IH1A 3CE1A 4P9HL 3PXHA 4DKDC 5CZVL 3CX5J 2F7OA 3VDAA 2ITEA 1DANT 2E8YA 3MCKB 1DP0A 1QYGH 2YQBA 1P7QD 3EXLA 3KLDA 2XVKA 1S7QB 2YLHA 1WWCA 4N2CA 1MSPA 1EO5A 2ENQA 3MTRA 3OMNB 4U1IB 3MRPA 3Q48A 4H1LA 2NW2A 5DZVA 4OGAC 4E9SA 5FYJH 5GIRA 4D0BA 1XXFC 5GSRA 3NK3A 3AWEA 3CVHB 3QI9B 5E5RB 1UG9A 3V9EA 1KEML 4BEIA 4S1DD 5KSBE 3RJOA 3CZNA 1R5VB 3C6LA 2FBJH 1DQIA 1NGPL 1QLEL 4MX7B 4XX5A 1BBDL 2CJUL 4N2LA 1DVYA 2XZAH 3MXVL 3VFNA 4XPTL 2IWFA 1BECA 3DV6B 1P7KA 1KELH 4UANA 3RUGA 4ZS6D 1DL7L 5DMGD 5IVXF 1E4WH 4XPHH 1UACL 3RVUC 1L9MA 3HC3L 5EBWA 2I9TB 4RESB 3G08A 3BH4A 2IDTA 1WISA 1NDGB 1QFUH 1ZTXL 2WXMA 2XN9A 1S2EA 3SDXA 4Y5VA 2OSLA 1U4FA 1KN4L 2QT6A 4UTCA 1AKJA 4OJDH 5BXFA 4NKMB 5A7EA 4TLSA 4HS8L 5E8EB 3QUZB 3SE3A 5CJXA 5DJ6A 5C7XL 2PKDA 2PR4L 4YXHH 2G9HA 3UBFA 4PJFF 1U3NA 4NBXB 4XCYB 1NCWL 3QDGB 4PJHA 4YSEA 5PCYA 4K3JL 4JAMA 1I53A 1TJIL 3O8XA 5JDSA 2BFGA 2CHWA 4PI2A 1KJ2H 2UXTA 3UL4A 4NCC2 5HHXL 3C5ZA 1MRCL 3L3JB 1JZIA 3EXJA 2FH8A 5TGBA 2B39A 2DQFA 3K6IA 5FECB 3ARGA 3FF7A 1QBLL 2DDQH 1XT5A 3PWPD 4HUMB 1EEYA 1U3ZA 3O3BB 2J2ZB 1Q72L 1W6LA 2FJFB 4Z3JA 3BGAA 4XMPL 4F15B 3V7AE 1UTDA 1BQHG 4HLZH 1UUSA 5FGSA 3A4FA 2YPKA 5I75B 5FM8A 4LSSH 2J6EH 2QV4A 1FJ1A 3CSBA 1IBYA 4Z78A 4OZHA 1A3RH 4JO1L 4PGCB 2YD2A 2A6JA 3BIKA 5B1BB 3HAEH 1OL0A 5DS2A 5IT2H 3NCYS 4GMSL 1HOCB 2QVIA 3ETBF 4KK8C 4DPRA 1SY6H 1NQBA 1KOAA 2F58H 2Y1ZA 3FT0A 4NC0B 1SEQL 2EE6A 1G9HA 3QQ9C 3RPBA 1UH2A 2A0LD 5FM5M 1I7RB 3MMEA 2E9WA 1BDYA 5F9DC 4DVBA 4JZNA 1RULL 3CHXA 4FLRA 4O02L 1CE1H 1A4KA 3S3JA 4WK0B 2WQSA 4JDEB 3FSZA 3SYQA 1RHHA 2ZUQC 3VXQA 4IEFA 2VDQL 4CMHC 5I1HL 2DEYX 1N5YL 1HSBA 1T5KA 1OAQH 3X17A 5IK3B 3DX7B 5CN1A 2YARA 2WP3O 3MFFA 1FV1A 4M5YL 5GXBB 4JFVA 2WHVA 1DANU 3CN1A 1M1XA 1U33A 2NQDA 3TN0C 3BAXA 2O6PA 3DOSB 1KJ3L 2O5YL 3D30A 1AH1A 4GRLD 2C9QA 4LLQA 1JAEA 4FABH 1XD1A 3QWOA 3BXNA 1ZLVK 4ZUWA 3LH8A 4J6IA 3CXFA 3FQUB 5CJQH 1U8NA 4QXTA 2OX5A 2UY6A 4F5CE 4TVPL 2DLGA 1PG7H 4YHPB 1HXMB 2H9GB 4IM8A 4JANA 5CP7A 4B7LA 1N6QL 3K6NA 3GMOB 3RBSA 3UZQB 1SM3L 4JY5H 3DO7A 4L48A 2VDPH 1CO1A 3ZZLA 4FFVD 4BQCA 1XTLA 4UTAL 5IR1B 5F96L 3SJVA 1DBMH 4LOUC 5LXGH 2DQUL 4PWFA 2G60L 1D6EB 2WQRA 1TLMA 3KXFE 3QUYD 1AJ7L 2ZT9C 2JK5B 4TF4A 3UEZA 5BW7A 5DF0A 1CXLA 3ZDYB 5BZXA 2QHRL 3ARDC 4KI5C 4QDGA 4LHUB 4KHTL 5CJBA 4HCRH 3IVKB 5IW3A 4PRHA 3UP1A 2UUDK 4EZKA 3BMWA 2QPDB 3Q3GB 5HJ3A 4W93A 1XGQA 4J2XA 4N8VG 5I19L 1VF5C 2F5BL 3R7QA 1RZKH 5HSFA 2JTDA 1U8JB 3AABA 1A7BA 3PS6A 3V5HA 5IHUH 2F1BA 3GB7B 1P5UA 1WIPA 4BRVA 3G5YB 4PJ8B 1LO4L 3ZE2B 3S35H 5DD6B 1MCLA 2YAQA 4GFTB 4XPFL 4YPGA 3LHPH 2F7QA 4M7KH 1TYJA 3B6SA 3VGAC 5DDHB 5EOQH 4MD4A 4OZ4A 3QJFB 2WUCL 3GT6A 4FHJA 1JV5B 2BLFA 2NXYC 3ATEA 4MZRA 4GAYB 1J1PL 5E2VL 3W56A 1AQDB 3QG7H 4LDOB 3RGHA 1A8ZA 3OPZL 4BE6A 1GJIA 4PB0H 3D2TA 1MI5E 1DBAH 2OMVB 4IRJD 3U9PL 3WXWL 3MO1B 2BFVH 3IMWA 4FLQA 2WSKA 3CWGA 1RCYA 3F62A 1PY4A 4GAJH 4NNYA 5E2UL 3TA3A 1EWHA 4TUKH 3PV6B 3VQ1C 5F0PB 3MRQB 3DSFH 3W11C 3FBQA 5ACZB 2ZOLB 3QG6B 1Z9PA 3GMMA 4U1SB 1HHIB 1PX8A 3SKNA 3MX0B 1CGXA 3PU7A 3LEVH 5MEPB 3UH8A 3GXFA 3VXUA 4JKWA 2VN7A 4PJEB 4QD2E 4WNQA 4G8GD 4NHUB 1SN2A 1QQDB 4DWHA 1G7LA 1JPTH 1UEYA 2EACA 3OHXB 4I1RA 4N8CL 2W8CA 5SWZA 3TGXA 1A7OL 4WW1A 5DWPA 1WWAX 4DPCX 1ZHKA 3UACA 3MU3A 1A6PA 4QO1B 3FJTA 4J39A 3QC6X 5CILL 2Q0ZX 3UCRA 3WHE0 4H20H 1TZIA 1E8YA 3I85A 1NDMA 5D5ME 4D7BA 2BXZA 3WIHH 4ZUSB 2AP2A 2CDGB 2VLMD 1UADC 5KYYA 1B90A 4AVJA 4JGJA 3UO1H 3ZMEA 5HI5C 4PHXA 1OOAA 2F54A 4C56A 4OD2A 1IBBA 3GI8H 1IARB 2ADGA 1IM3D 2CRMA 4IU2B 4PY8J 5MP6H 4ZAKB 4ZS7L 1KPVB 3S8GB 1EERB 3FQXA 3QI9C 2A2QT 4FHBD 5ACLA 2AJ3B 1Q9KB 4RMTA 2BX5A 4QRPA 4FZEH 3APDA 1YY8A 3IJ8A 4RAHA 5C6WH 4KZEL 3P02A 2FEJA 1OVZA 5DD3H 5DZAA 2VXQL 2KS0A 4HK0B 1FDLH 2B9AA 2FJUB 5E9DB 2Y7QB 1EEZA 4XP6L 3I6KA 3K1KC 4R6UA 2VXVL 3RVTC 5E1AA 2HRGA 3B9VA 3R19A 5GS3A 5I16B 3FO2A 2WN2A 4Z7QB 3M8OL 3P4OB 2VSMB 4F33A