2NR6D

Crystal structure of the complex of antibody and the allergen bla g 2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
213
structure length
213
Chain Sequence
EIQLQQSGAELVKPGASVKLSCTASGFNIKDTYIHWVKQRPEQGLEWIGRIDPANGNTRYGPKFLGKATITADTSSNTAYLHLNSLTSEDTAVYFCARWVRQMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Aspartic protease Bla g 2
publication title Crystal structure of a dimerized cockroach allergen Bla g 2 complexed with a monoclonal antibody.
pubmed doi rcsb
source organism Blattella germanica
total genus 34
structure length 213
sequence length 213
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nr6D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nr6D02
4JLRB 3B5HA 4JPWL 3RZWA 3WXVL 1TVHA 4HUXB 2GK0A 3FB7A 3S97C 3IS0X 3K8KA 4BZ2L 4ZPVA 2EDXA 5FM4A 1J18A 2PNDA 3OKNA 5E6YA 5A3IC 4L5FL 4Q9BA 1WBXB 3L6FB 5JXED 3QEQD 3ROOA 1ZT1B 3EFDH 1CN4A 4QF1A 4ONFL 3QUXD 4OCLC 1HYRC 5CD3B 4NM4L 3TBSB 1PVHA 3CCHA 3CLFH 2DKUA 4KRPB 4OUOA 4XNZC 3WFBH 4GAGH 1PG7W 5C2BL 4BQ6A 3MV7E 3F7RA 4NHUA 3KXFD 4HIXH 3WIHH 4ETYA 2OXHA 5I1CH 2W9DH 5CZXD 1U3JA 3KPRB 3MC0A 4AEHH 2YEZB 1L7IH 3GSOA 3MJ8B 2YPVH 3G5YA 2R1XB 1A1NB 3FN3A 4P5TD 5C0JA 2F53A 5DMKB 3CVHA 4MJ6B 1K8DB 2W38A 4I2XE 2KBGA 5GS2H 4YGVA 2ITDB 4NC1E 4XXCC 1JNNH 3CK0H 1G7JB 3ZYIA 4XRCA 4LLMB 3I84A 3D3VE 4JVPA 2CLRB 4G9DB 5FIEA 4NQXB 4JY5H 2XQYG 1AO7D 4R4NC 1BVLB 5DI8A 1H15B 1H3TA 4ZD3H 4M9PA 2CK0H 4DKFH 1OW0A 1IGFL 4P9ML 5T1MA 1X5XA 2ID5A 2VDLL 3KPNB 4TSBH 4WFFD 4BSVA 1SYSA 2P8LB 4OFPA 4S1DD 5CD5C 4LEXH 5CP3A 2ADGB 4R9HA 3Q2CA 3S3PA 4GBXC 1P9MA 1MQKH 3MLZL 4LRNL 3ZKND 1OTUC 3T65B 4HCRH 2DICA 2EYTB 2CO7B 3MLXH 1FJ1B 1G7QB 3HE6D 3PJSB 2BJML 3AM8A 3UTZA 1KENH 3P4NB 3PGFL 4PJXB 4WDIB 3HPJB 5CJQL 3DIFB 4NO0B 5J56B 4QXGL 1KB5B 2EKSA 1XGPA 4OD1H 3KPSD 1P4LB 1VA9A 3UDWC 3LKPA 1I75A 1MVUA 5E4EB 2IQ9L 4HIHB 5GS3A 1QLEH 3VFNB 3TBTB 3REWA 4HUWB 3G5ZB 4JG0L 3BH8A 3MBED 5DSCB 2P42B 2YN3A 3EJJX 1F13A 3GK8L 4L8CB 2ZOLA 2LQRA 5CILH 4I13B 1BWWA 3S6CA 1TETL 2PKDA 3D25A 1DVFD 1YPZB 2ATKB 2N1KA 4JO2L 5KBNC 3QDMB 2FZ3B 1OM3L 3GHBH 2JCCE 5I2IA 3PWLA 1JWUB 5C0IB 2V2XB 1H3PL 3FJTA 3G08B 1IGYB 3QUZA 2QL1A 4KDVA 5I1KL 4KRPC 4NKDB 1U93B 1CF8L 1WAAE 4P2QA 1BX2A 4X9GA 3O45A 5L2JA 2WBJD 3SOBL 4YH6A 4L3EB 4HKXB 1JZ4A 2COQA 2EXYC 4PJAE 3NA4A 1BD2B 5GGRB 4Y5VA 2G5RA 3QWRD 3HAEH 2R2EA 5LCVH 5AUMB 1REIA 2Y1VA 1N5AB 3O6KL 2VISB 4DCQA 1FQ9C 4X7SL 4MD0A 4RX4A 1ZHBA 3ARGB 2LV4A 5JIPA 4TRPH 2XTJE 4EI5A 4J2XA 3OKOB 3P9MB 4K3EL 4DTGH 4HAFA 5DLMH 2V7NA 2HFEA 2ZJSL 3CSGA 3GBNL 4KI1A 2N7BA 3DRQB 4DZ8A 4PRPB 4OQ1A 3O6FA 4N9GB 3TT3L 1E4XH 3U83A 5D1ZD 2YN5A 1MJ7L 3H9ZA 4RAVB 2DQEH 3RWFA 5TPWH 2X1QA 2AK4A 2JK5A 1LP9E 4Y4HB 1IM9D 5J1SC 3ZE2F 5DJYA 4LCYA 4LLVA 3WLBB 5IB5A 1FNSL 4OCMC 3DECA 4PTTA 3TNMB 5HHPB 2M8XA 2H32B 2YRZA 4KXZI 1TNMA 5DJ2A 3QFDA 1X7QB 3M8OH 2VITA 2EDBA 4HG4J 3GEWB 4IOIB 3FN9A 3LEXA 4GW5B 2NY6D 3EGSB 4OZIB 4LCWE 4MJ2A 3DX9A 3G9AB 4OCWH 4DGIH 2VAJA 4QRPD 5E4EC 4I48B 4BJLA 4Z7WB 3T0DA 1RSFA 3P4LA 2Y07H 1KLUA 5C0RL 3C6LC 2R9HC 1KF9B 1MY7A 4NZRH 5TH2B 3M1BB 1QFWH 1T1XA 1EEYA 2VDRL 3P4OB 4G9FA 4PJ7B 3U2SB 4N68A 4YHLH 1OARH 1QBAA 1JZ8A 4M7KH 2FECI 2GSGB 5A43C 1LO0L 4BSWB 3FB5A 3N85H 5I71B 3FMGH 4PRIA 5ERWB 1J8HE 1ZS8B 4MA8L 3MRJA 2HRPH 3UZEA 4PRAB 1FV1B 3O8XD 4BFIB 5DHVB 1T4KB 3SDAD 4AEFA 3SDDD 4K2UL 2PO6D 4HJ0D 2MJWA 4ZUSA 3ZDZE 1U8QA 3F7YA 12E8L 1K4DB 1YYMH 5TF0A 2HKHH 3MLRL 2E9BA 1JMZA 1HH6A 3WDIA 4LCUA 1RHHA 2BVPA 4NCC1 4DGVL 2RIKA 1J11A 1H3XA 2UV3A 2YKLL 3MLPA 2PF6A 3FB7B 5FHAH 3UPCA 3TJHD 1YEKL 1JBJA 1H8OA 1I4FB 2DD8H 2FBJH 4XMPL 5IQ7H 4WHYH 1V7ML 3ARGC 1KIQA 1T1ZA 1P7KB 5B4MC 4FFZH 3MBXH 3QUMB 4MCZA 2IQAA 3MOBH 4AL8H 4PJ8D 5F96L 3U9UA 3M17A 3X12A 2NY2C 4L9LB 1JNHB 1NCUA 5JOEA 5HSFA 3CD4A 2X5PA 4HUUB 3DXAB 4XNMB 2P24A 5B22A 1CDHA 5E2WH 4HGMA 1OB1B 1UENA 5DRZB 4ZS6C 3JTTB 4FNLL 4I3SH 2C3VA 2RFXA 1NBZA 4V1DE 4F9PC 1J9CT 2NMSA 4Y4HC 1K4CB 5LQBH 2G2RB 3VCLB 3HG1D 1T80A 1AD0A 4XAKE 3U48A 4O4YL 1DZBA 5C0JB 5HGDB 1ZA6B 5GZOC 2BHYA 4GAYA 3JVGA 2X7LA 2IH3A 4YGVB 2X4QA 5SX5K 3LRSB 3RZCA 1T2QH 3C9NA 1FORL 4XRCB 3I6GB 4Z77B 4JQXA 3SE3C 4WENB 5IBUG 5KSBF 1OGTA 2CSPA 2Q8AL 3QO0B 2APXA 4IDJL 2ZUTA 3TVMB 4PGCA 2F58L 5GJSH 4AJ0A 5C0CD 5FYKE 5MEPB 1IQWH 5C0AE 3F65A 5T1MB 4AG4H 1JUFA 4FRWA 5SWSE 4EQ3A 4BK4A 4BSVB 3QPXL 1PX3A 4D9RE 4KAQH 2P44B 3CPLA 4MD5A 4UTAL 4G5ZH 2VZUA 3K2UH 3O2WL 1IEHA 5AZEH 2LVEA 1IC4H 3BD3A 4G6AD 1G7HA 3VE0B 1ZT7B 4H26A 3RIFF 5I71C 5IV2A 3B3IA 4PJDA 3KLDA 2YMXL 3KPLA 4HPOH 1R3KB 2NYYC 4X98A 4Z7VB 4UBDC 1T3FB 4LFHG 1ZOXA 2W9EL 1DQQA 3UJIH 1A6UL 4NO2A 5B8CA 1D6EA 4Y16D 1SJVA 2EXWC 3G5XB 1MVUB 1R0AH 1NLDH 1DFBH 3F6LA 5F7YC 4XP5H 2BFVL 4OCSH 3REWB 1S9XA 4FA8A 2ZZUT 2WZPD 5CIPA 1SJXA 2C1OA 1MEXH 3EYUH 1N8ZB 4N90E 5E5UB 4L9LC 4U1GB 3JV6A 2ZSWB 2Z35A 5HHVH 5I2IB 3JV5A 4LPTA 3FZUC 5ICXB 2P1YA 3OAZH 4Z8FL 5D4QA 2AS5M 3WS3A 3NCJH 4P2QB 4PRDB 1I85A 1AY1L 4M4PA 4DKEL 2ED7A 3O45B 4Y5VB 1JFQH 5AAMA 1QRKA 3P30H 1ZVSA 3HPLA 1MCDA 4PB9L 3NA9L 3QDGB 1TJIL 3QQ9C 4FFYL 1MRDH 4MD0B 4UOJA 4PTUA 3K1KC 2JB6A 4FQHA 4ZFFA 1PKQA 3MV7D 2Q76A 1C1EL 1YN7A 3IFLL 3OKKA 4PLNC 4EI5B 5KSVB 4WO4D 4M1DL 1EHXA 5I17B 4JHZA 4U7MA 4APQD 5F8RC 5E1AA 2V7NB 1I8IB 4AT6A 2YA1A 4DGYL 3ARBA 2GJZA 4PLOB 3GJEA 1OW0C 2A83A 3O6FB 5INDB 4G7YH 5T3XH 3D3VD 4JQIL 2AK4B 1EBAA 2YA2A 4G7VH 1RQ5A 5BCAA 1ADQH 4OBSA 3E3QE 4PLKD 5DJYB 2X9XA 3VMNA 2VZVA 4OZGB 4QHNA 1FVCB 1FZOA 4HXAL 3MLYL 2H1PL 2X41A 4O9HL 4FTVE 5MEOB 3QHZL 1E28A 5KZCD 4UIKL 4UOW1 4B53A 2VH5L 3LEXB 2A73B 4L8BA 1HYSD 1A0QL 1T7XA 3D0VB 3DX9B 2IGFL 3B2VH 1I1RA 3H3PH 1KLUB 3QHFL 1KGCE 4KK6D 3O9WB 4NUGL 1MRFL 4PBXA 5KSAA 4JDTL 5JHLL 1T1XB 4R0LB 4PJCE 5HYEA 5DZOA 4YX2H 3D87B 4JAMA 1XGUA 1FLRH 1I7TA 3FB5B 3MTRA 4WJ5A 2ESVE 4U1GC 3VFRA 1F2QA 2LTQC 1LEIA 4YK4B 4Y1AA 1IAII 3FT2A 3MRJB 3JWDH 3QUZC 3TZVB 5I6XC 1DEDA 1TZGL 4MQXC 4ZUSB 2XG4A 1LK2A 1U8QB 1D5IH 3F7YB 1QSFB 4MLIA 1KCVL 5DMGD 3F58H 3O2DH 4D8PA 3AROA 4Y5VC 2EYSB 1J5OH 3HAEG 4JY6B 4NGHH 5LGKA 1KBGL 4KUCD 4NJ9H 5DYOA 4H0IA 1D5MA 1KIQB 4KMQA 1T1ZB 1CDCA 4I0CC 3SN6N 4EI5C 1M6OB 5MP6H 1SJHB 4OFYA 3QXAB 1QBBA 1K5NB 4HWEL 4WTXA 3TM6A 3PF2A 1BFTA 3U9UB 3M17B 3HB3D 2D2OA 4F7MA 2BX5A 3RWEB 2QSVA 4P0DA 2E7MA 3OAYH 4PUBL 3VRIB 5IW6A 1GVIA 2P24B 1OGAE 3O6FC 2XTJD 2XYCA 4PJIF 1O7SA 2Y36H 1JYVA 3V5DB 3MOAH 2C3VB 1NBZB 5JTWA 2YD7A 2ZKHL 3C5JA 5C8JB 1C12B 2GCYB 5C0ND 5CWSB 1G6RB 1UB5A 4J3XA 2AV1A 3QNZB 4PPTA 3RWCB 5B3JF 1KYOK 2GHWB 2JF1A 3I9GH 4S10A 4YGAB 3GI9H 3C09B 4PJGE 2IH3B 3HNVL 3RZCB 3C9NB 2X4NA 1H8SA 1UVQB 3AMLA 4EN3A 2OQJB 1ZTXH 4U6HA 5FB8A 1WBZB 3W9DA 3O6MH 4H5SB 2OZ4A 1AJ7H 2J8UA 5DWUH 1NC2A 2ZCLL 2EZ0D 3LQMA 4Z7OE 1EUTA 3QUKA 3BKJL 3ZDYE 1EX0A 5BOZG 4G42A 1JUFB 2BSRA 3VGFA 1U58B 1Z0MA 3CPLB 4R0LC 1MI5A 5HHOB 1N59A 3KYKL 3MRLA 3DETD 1QTYT 2IALA 3EO9H 5EUOB 3MGOA 1HXYA 1RZ7L 1LK3L 3PNWA 1FN4B 2D31B 1E4WL 4CKVX 3KPLB 3UTSA 1A4KA 4YK4C 2ZG1A 3NGBB 4X98B 2XRAH 3RHWF 3ABZA 1W72H 1U8JB 3OKDA 1ZANL 2Z31D 3W11D 3AY4A 1CXLA 1P4IH 1UZ6E 4NO2B 3S35X 5B8CB 1MREH 3GSUA 2WMPA 3CFJB 5J13B 2BY3A 4K9EH 5IVOA 4M1CC 5CEZL 2NR6C 4KMTH 1J8HD 1CVSC 1DUYA 2V7HB 3Q5OA 4NNYB 1S9XB 1NBVH 1ZHLA 1OPGH 4XXDA 2AXGA 1ZHNA 3ARDB 3ARQA 4FABL 2IANB 4TQEH 1MFDH 3UTTE 5DK0B 2RCSH 3F62A 1ED3A 2C1OB 2AJ3B 4YPGB 3S88L 1CGUA 4LHUA 2BCKA 2ORBL 4PJ9B 2YPLE 3RNQA 4WV1A 3PHSA 5EULV 4KH2A 4YHNB 5D93B 1U91A 2P49B 5HYJE 1Q9OA 3MXWH 1JYWA 1DDHA 1YQVH 5GS1A 1H5BB 3DV4B 2VLRE 4Y89A 2XN9E 1ZVSB 1JGEA 2XZAH 3L3IA 1I7UB 1I1FA 1LO2H 5F7WC 4AM0A 5ITFB 5EZIL 4HUNB 2MSPA 2DLTA 3NIFF 3C09C 3FB6B 4XBPA 4ZFFB 3VRJA 4F2MB 2Q76B 3RZCC 2FDBP 3G6JB 1UXWA 1YN7B 3OKKB 4V1DD 4OJFH 5C07A 3DNKA 4JQXC 4OLVH 3IF1B 4HPYL 4U3CA 3GMLA 3BUTA 5KN5A 3GGWA 5F9WB 5C9JA 4XAKD 5H8DA 5F7MC 4S1RH 4LFHD 5CGYC 4DN4L 4LQFL 2FATL 3BISA 4WI5A 2A38A 4BH7A 2B4CH 5I18L 2HFGL 5LWYH 1N2RA 1L6XA 2EDNA 3THMH 3KJ6L 1MWAB 5IFHL 2XZQH 4F15B 4U1IA 5BVPH 4X6DB 1GC1H 5FYKD 2BRRH 4RBPH 1FZOB 1T66C 5C0AD 1F4YH 3LN5A 5SWSD 5DRWB 4M7LT 4D9RD 5ILTL 1FBIH 4PV9B 1GGTA 4EUPH 3NGBC 5KSBA 3QDJB 2LAGB 5E6IA 1WSST 5FEBA 4WFHE 4OI9A 3JTSB 1INDH 5D70H 5INCA 1X4XA 3TT1L 3NIDE 4L8BB 5B8CC 2B1HL 3FQTA 4XMLH 5J13C 1AHWA 4K94H 4F3FB 3BIAX 4ELKA 3TO4A 3IDXH 4HX1A 3Q6FA 3S34H 1WFNA 1GCFA 2W91A 5D96B 4O51B 3ARDC 3BD4A 4JB9H 4XVSH 5DFTA 5ESQB 4KHTL 3QA3B 3IDGB 1YN6A 4G3YL 3C5ZD 1BOGA 3MCLH 5GS0C 1YY8A 3BD5A 3JWNC 5JO5A 4WJ5B 5FYKU 2NY5L 3VFRB 4G6ML 1X9QA 3RAJL 5GIRA 4LSQH 2E9WA 4Y1AB 3VWJB 2FHCA 1TJGL 5T3XE 5D93C 4X9BA 4BFBD 1KPVB 3VFSB 3DO3A 5K9QG 4HUVA 1J87A 1H5BC 4P3CL 4N90D 4D8PB 3MRHB 2XY2A 4LSTH 3RP1A 1RZKH 5F1NB 1C16A 4JN2A 4DAGL 1HIMH 4KI5E 1JPGA 1PEWA 3DSFL 3PV7A 1F6FB 1JP5A 2DL9A 1ZA3B 4ZFOA 4H88H 5DYOB 1YEHH 1FL6B 5D2NE 2R56L 1D5MB 3V5HA 1SQ2N 4XVUC 1RIHL 4M1GH 2CIKB 5JDSA 3ZTNL 3S35H 2X4UA 3AB0B 4P3DA 5KJRH 25C8L 4YXLH 3ARBC 1OP3H 1ZLUK 2VR9A 2DM2A 3VW3L 4Q9QH 3FT4B 3QWOA 3VWKD 1D9KB 15C8L 5IW6B 1F90H 4LIQL 1LVEA 4XZUB 3V6FA 3U7YL 2A9NL 3VRLE 3VGGA 1T04A 5TF1L 3WBDA 4F15C 4L9DA 3VD9A 4HSQA 3K1DA 1KPRB 4FQPA 2AV1B 4FZEL 3F12A 2QR0A 4OZFH 4XP9L 4C58B 5DD3H 3MXVL 1X5FA 4NNPL 4H0HB 3VD7A 3W82A 2WIIA 5CJ8A 4CN6A 3K81A 4XH2A 1XMWA 1IEAB 1QFWM 4EN3B 4U6HB 2R0ZL 4ODBD 2VLKE 1A7QH 1BBDH 4XPBL 5FHBL 4FTVD 4GLRH 1NC4B 3GMRB 5BZWB 3BX7C 4G42B 3GB7B 3AC0A 5D96C 4DVRH 2CMRH 1MI5B 1MFCL 1N59B 3MRLB 5KTEH 1AXIB 1GGCH 4FN0A 4Q0XH 2CLZB 3L3OA 1HXYB 4P23A 3PNWB 1A6PA 5FYKL 3VA2C 2IH1B 4OQTL 4WUUB 3ZTJH 3QH3A 3ECBA 4N8PA 4KZDL 1T20A 1A4KB 4HF5L 5E7FA 3VWJC 5ICYA 1U8LB 3OXSB 5DURD 4XWGH 3LHPL 2F19L 1FVEA 3HR6A 2WM0A 3GSUB 2DQJH 4W4OA 5DJDA 4NJAL 1OAKL 1J8KA 4N9OB 4WU7A 5I19H 3GHEH 4PB0L 3PWPE 4GAGL 1QG3A 4UAOB 4XXDB 4DZBA 1ZHNB 4TSCH 4DKDC 4XPTH 4KK8C 4M00A 4TTDD 2P5WB 5GRJH 4J1UB 4RNRA 3T2QA 4AEHL 1PW3A 5I1IH 3JWOC 3AB0C 4YBQC 1Z9OA 2BCKB 3O3DA 2PXYD 4Y19A 3RNQB 4WV1B 1G7IA 1L0YA 1DQJA 1ZWIA 1Q9OB 1BIHA 2IADA 1JTTA 5LXGL 5GS1B 2AJVH 3T1WA 2EDJA 4KTDL 4J23A 2CK0L 1SEQL 5KVDH 1WCBA 5I76A 4E9LA 3PG2A 1DQML 4JY4A 2H2PC 4XWOC 1OGAD 4LEXL 4H8WC 2MKLC 3CC5B 4K7PY 3DX6B 1OWRM 2J88H 1UXWB 5JXEA 3QEQA 1DANT 3UC0L 1MQKL 2BXZA 4EN3C 3QUXA 1KB5H 1NUGA 3EOYG 3GGWB 1EEZA 1DL7H 4JN1L 4PJIA 3GSRA 2Q3ZA 2XXCB 2HT4C 2A0LC 2VYRE 1NGWB 3MLVL 3HE7D 2BNUB 3RTQD 3RVUC 1ULVA 1F4AA 3KXFA 4OD1L 4KY1H 5DT1H 5JLZB 1N2RB 1FIGL 2X05A 3NH7H 5I9QC 1EHLL 3V52H 1MHCA 3G9VA 5CP7A 4U3HA 4P5TA 4C56E 5ALCH 4XCNA 2JB5H 5KVMC 3LN5B 5FYLH 3D9AH 4UDTA 5C3TA 1JRHL 4U6XB 3TCLA 4CVZA 2CUHA 2Q8BH 3VXUB 4OZHE 1F4WH 2O5YH 1GRWA 2DQHH 3BAEH 4ELMF 1AO7A 1MCJA 4JHWH 4CNIA 2B8OT 1QR1B 5KW9H 3L3KA 3OJMB 5DJ8A 2DQIL 4MAUL 2CIIB 3Q6FB 4GT7A 2VDML 1PGRB 1CICD 2OTPA 2CJUH 4LLYA 4UAOC 4WTZG 5HHMB 4YHML 1RZIA 1HE7A 2X4SB 2EO9A 2VUYA 1K85A 5DS8B 5D7IF 1HHKA 3OG6B 3BW9A 1UH2A 1KNOA 2R0WH 4OT1H 3SJVE 4Y4KD 5IMOB 4GQ9L 4DUWA 1AGEA 2YXMA 4XMKL 4WV1C 4QRRE 3EDEA 3FO2A 5IKCA 1B4JH 5EOTA 1DBBH 3VXNB 1S7SA 3KPSA 5GS1C 2AGJL 4OFVA 5EUKB 3FL7A 1Z9SA 2PCPB 3MFFB 1JZ5A 2BP3A 4JN2B 2YPLD 1ZT4A 3MBEA 4F7EA 3AS1A 1G7LA 1PYWB 5HYJD 2JCCF 2C3GA 3WUZA 1YJDC 2GK2A 1MRCL 3IKCB 4ZFOB 4X4ME 2NTFB 4F8TA 4R3SA 1DVFA 5JDSB 2VLRD 3RWGB 2Q3AA 3WKNA 4HGKC 4ZO9A 2XN9D 2IMNA 5F3HA 4MNGE 3V8CA 4LU5H 1OCWH 3H3BC 1DBKH 4L29A 1IGIH 5D2LF 2X1WL 3KS0J 3ZHLA 5J0BA 4MNQB 4FQXB 3V6FB 1EHNA 3BPNB 2WBJA 3QQ3B 2JELH 1CE1L 4F58H 1WWCA 5CEXB 1T04B 5GRVL 5H35B 5K93A 1A14H 1XFPA 1NAML 3QWRA 4KQ4H 1VGEL 3T4YB 3FHQA 3N9GL 3S37X 3GRWA 2AJSH 2YHGA 1R3JB 3BKCH 2GAZA 4AK1A 1J1OH 1MJUH 3MLSH 3HNSL 4HZLA 3WFZA 2LU4A 3ILQD 3SDYL 3I85A 5E6IC 2FB4L 3GIZH 4N0UE 1OAQL 4GO6B 2LFGA 1N0LA 1Q9KA 2Q20A 4G6FD 1FZJA 1AHWC 1AQKH 1I1AB 5ETUB 2D3VA 1CGSH 3TO4C 3TYFA 2ZOKA 4FG6D 3ZT5A 1G7MB 5D1ZA 3ZYOA 1HDMA 1QBMH 4WFHD 3HMXH 1LEKA 3VU2A 1IM9A 5TQ2H 3Q48A 3WHE0 4OF7A 3TBVA 1BGXH 3W9EA 4P23B 5I8EA 3QUMH 3H9SE 4GXVH 4L4TB 5DD5L 5EBWA 5E95B 4K3JH 5D7SL 1V05A 1CDGA 3O0RL 1JV5A 3OHXA 3QH3B 4U05A 3MSPA 3LQAC 1ZSDA 2VR5A 3P9LA 4WGVB 2HVJA 4QOKE 5ACZA 4TUJA 5IUSA 1EGJH 2C3XA 4KROB 4HKZA 4PGBB 2OP4L 4CVXA 1FVEB 4QRPA 3UYPA 3MRPB 3GI8L 1FRGL 5I1DA 3OR7B 1QP1A 3BPOC 4WU7B 5T3XD 4I3SL 3NN8A 4YWGL 3ZYJA 3J8F7 1BZ7B 4Z7UF 5FDWA 1QSVA 5JPNA 4PREA 2P47B 2Z93A 4FQQA 4QTIH 3BFOA 5DD1L 4ESKA 4KI5D 4X80L 1IKNA 3WFCL 4Y19B 3EJZD 5E2VH 2VLJE 5E8PA 1G7IB 1FLTX 4HMCA 3O8XA 4PJBF 1ZWIB 4IOSD 3SDAA 1K6QL 3SDDA 2PO6A 2WWKO 2YD4A 5FKPA 2FSEA 3C2AL 2W60B 5BRZE 4U31A 3C5SA 3PWUA 3D18A 4M03A 2AQ2A 5T5NF 4S1QH 1Q0YL 3MACL 3I02A 4Z0XA 2Q1EA 3MGTA 1U8KA 4AIOA 5D8JH 1BVKB 1RK1B 4OZFG 4IBLT 4N1EA 5BOPA 1H9VA 2HVKB 4N5EC 4JPIA 4PJ8A 3HC3H 3KPRE 1EEZB 1GHFH 2VTFA 5FO8A 2DTMH 1MAML 1XR8A 3QULB 4EVNB 4DUXA 2G9HA 3GSRB 4GRMB 5J06A 5F9JB 5BQ7A 1KJ2L 3KLAA 4IHOA 4QCIA 1NMAH 2IPTL 3UPAA 3VXSE 4YXHL 5HD8C 5TDOA 1BJ1J 1Q1JH 3KWWA 4QKXB 2NXYB 3HG1A 4CMMB 4WI3A 4OM0L 2VLKD 1JZ7A 1M4KA 1KLGA 4P23C 5CP7B 3O4OC 1CXFA 1Z3GH 1OLLA 3RWJB 1LD9B 1WVZA 3KLHD 4NKIL 4QT5A 1I9JL 1YDPB 4UDTB 3TCLB 3DVGB 3ZTJG 1FC1A 4CVZB 4OLEA 1VEOA 1KFAL 5FOBB 4KROC 1E4KA 3IDUA 5TFSL 4KKAC 4LPWA 2MCPH 1AO7B 3HZMB 3UJTL 4CNIB 2GSIA 5E2TL 4W4OC 5C0CA 4Z76A 1ACZA 1UEYA 3OAUH 3L3KB 4JQVC 1F3JA 4NZDA 1LO3L 1DSFH 2ED8A 1MCPH 3BVNB 5T33H 4HC1L 1RZIB 3K8MA 3MR9A 3OKLA 5I73B 4PGJA 3JV0A 3KPPA 3P30L 3B9DA 5F7DA 1GZQA 1UQSA 5F8QC 3HE6B 2DQTH 4K23H 1KNOB 1CFQA 5IOPB 2BVQB 4LSRL 5GGQL 1ZGLB 3KPQA 1E27A 2F15A 3MREA 1O0VA 2I60L 1XGRB 3ESVF 2E6PA 5EOTB 3T3ME 3TP4A 4L8SA 5IB3A 5EOCL 4Y16A 1BFOA 3CLEL 1BZQK 1N0XH 3RUGA 1UH3A 1I8LC 3C8KA 5L2KB 3QDME 1ZT4B 3SDXF 3MBEB 1OSZA 5FYLE 4ZUWB 1A6VL 5CGMA 1QFUH 4KJQC 3GJFB 2CLVB 5IIEB 3U4BL 5JXEC 3CXHK 4R3SB 4I77H 4L3EE 1DVFB 1WICA 5C70A 5J1AA 2AEPL 3QUXC 1Q9LA 3G6AA 2QKIB 3V4UL 1R24A 4PY8J 2DS4A 4NQEE 3VD5A 4L1HA 2HJLA 2OTWB 1RUML 4NQVA 3C87A 5GRVK 1I9RL 2AKRA 4JFFE 3V4PL 2FHFA 4AENA 2Y9RT 3SGKA 4JHAH 5IESL 2AJUH 1Q9WA 2VOTA 4YNYB 1KXQE 3NIGE 4NRZA 5C6PB 1BF2A 1ZV5A 2FWOA 4HK3N 5JORB 2FLBT 1TITA 5IB4B 1YEIL 3VFMB 2GAZB 3MV7A 4PJEE 3TIDA 3C6SA 1WISA 2NY4D 3GKWL 4YIQA 3U6RB 4WO4A 5J11C 3QIWD 3CFDB 4APQA 2GUOB 1J7VR 3K0WA 4XNXH 4C56D 2J3SA 5JHDE 5EOQH 1T2XA 4BQCA 4I2XA 4G6JL 4LBEA 1SVZA 1BFVH 1JGLL 4PD4J 3MJ6A 4W81A 3TYFB 4XI5C 2FNBA 1J1PH 3R0MA 4S1DC 4NCDA 1HDMB 1VGKB 4WEUD 3D3VA 4HHAA 1LEKB 3F58L 5I73C 1IM9B 2W92A 3FRPG 2FGWL 4QWWC 3IT8D 4OZIE 3QEUA 3QJFA 3W9EB 1QVOA 3BT2H 1S7UA 4Z7WE 4I3RL 5DC0A 5EWIH 2V5YA 4PP2A 3HE6C 3SE8H 1NCWH 4J3SA 1T03H 3GSVB 4JFXA 5JMRA 1IBGH 4AEIL 4KUZL 1BM3H 2ED9A 1IC7H 4HKZB 1R3IL 5HGHB 4IRJD 4QRPB 4EBQH 3MJGX 2CXGA 3ARED 4NQCE 3SJVD 1IGMH 1XF3A 3B9KD 1G6RH 1HILB 1CU4L 3KYMB 2AXFB 2NX5A 5AYUL 1HK6A 3VJ6B 3MBEC 3OXRA 4QRRD 4X9FA 1NCDH 3BZFA 3ETBF 1EJOH 3MOAL 4ODUA 4B7LA 4MJ5A 5L6YH 4G8GB 1KJ3H 3MV9B 5DEGB 2VABA 1DVFC 2P43B 3V5KA 2QQNH 4HWBL 4GRWB 3TJEL 2HFFA 3P4MA 5FKAA 5M7QA 1QSEE 4MB5A 2WAHA 4JJ5A 4QHLA 1AC0A 1RIUL 1XCTB 2CGRL 3CU1A 4OLWH 4ZUVA 3HUJF 4MXVF 3O8XB 2DQDH 3CXDH 1LGVA 4UB0L 3SDDB 2WBJC 3BEVA 1G0DA 4XPFL 43CAA 5FOJA 3C5SB 4M6ML 3D18B 4KMLB 5IVNA 2JCCA 2VQ1A 3O2VL 4F7PB 1GIGL 2R1YA 2W0KA 3IDJB 4XC3H 3I02B 1U8HA 4RSVA 2ERJC 3V0VA 3P77B 3MGTB 3DXAE 3MRMB 5CFHA 2PYEB 3MZTA 4LPXA 3MRFB 2UZYB 4Y8AA 5DVNA 4BQBA 4PJAA 5I15L 4J4PD 4LAJH 1XR9A 3WKMH 1B90A 4JFQA 4JPIB 4KHXH 3I3BA 1YC7A 1QLFA 5IFAL 5F44A 5HBBA 3B43A 3IJHA 1VDGA 5I1HL 3L95B 5IK3B 1CIDA 5BQ7B 4PG2C 5IG7A 4IHOB 3LKRA 1U8PB 4QCIB 4PYGA 1MLBB 1OD7A 4XCCH 5TDOB 1GAFL 3UAJD 1MREL 4PJ5E 1QEWB 2OL3H 4R8WH 4LSVL 4PIRF 3ALPA 3BI9X 1KLGB 2RB8A 2VB5A 5GS0H 1EVUA 5A16A 2Z0BA 1NBVL 1YZZA 4Y2DB 4QT5B 3P0GB 4R7DA 1HZHL 1LP9A 5EC2A 4C54A 2XA8L 1A6TA 3OAZK 3HCVB 2NY6C 1VADB 5K9KA 4IJ3B 3MRCB 5F88B 2GSIB 5IJVA 1UCTA 4R26L 4Z76B 2VXQH 1J86A 3U0WL 4GSDH 5F71A 1F3JB 5ECJE 3D2UB 4RMWA 3QISA 4Z7VE 3PL6D 5HDQL 4QOKD 2EKJA 3VFPA 1KCSL 3FQRA 3TIEB 3RPIA 4HFWB 1FL3B 1RV6X 3CZFA 4X4ZA 1A7PL 5I1EH 1D5ZA 4AYFA 2GT9A 1LO2L 1UZ6F 5F7DB 1GZQB 3L5IA 4KPHH 4ZUTB 1IKNC 4TUKL 2AJYH 5HYIA 5ALBL 2BNRE 3QCVL 3O8XC 1WBYA 4OJFL 3SDDC 3MREB 2PO6C 4HJ0C 3UYRH 4CMHC 2Z31A 1NDMA 2DIJA 4B50A 3T4AB 4U1LB 4FXLA 3CFEA 1S5IH 3LS4H 4Y16B 4ZPTA 7CGTA 1MWAH 1BFOB 5JW4N 1HHIB 5C71A 1LE5A 1YMHB 5DRNA 2VLJD 3FOMB 4TNWF 3ULVE 2FL5A 3CSPA 4Z78A 2KZWA 3TJHC 4HW6A 5SX4H 4JZJB 3FAWA 5BRZD 5DJZA 3NOIA 4WW1B 4L4JA 1Q9LB 3G6AB 4PJ8C 2BRRL 1NGYB 4PJBA 1K2DA 4NT6A 4EEEA 1F4YL 3QDGE 2HJLB 1FBIL 4KRPD 4O5LH 2B2XH 4JPVL 3RI5K 2DB8A 5DEFB 3U0TA 2R23B 3HNTL 3MPCA 3KPRD 1RJZA 3LKOB 1UM6L 1H3GA 4YHKH 2XNAA 3QCTL 1WZKA 4ONHA 1S7WB 4BH8A 5GSRB 3WN5A 1MJ8L 4KJYA 3ZE1F 4U1HA 1S5HA 5EU7E 1WEJL 2ADFH 3JZ7A 4NWTH 3MV7B 3TIDB 3RVXD 2NW2A 4V1DA 1N6QL 3VXSD 1FVDA 4PG9A 5DMIL 4UNVA 4D0BB 1J0JA 4BFGA 1E4KC 4XHJC 4TOYH 1KJVA 2BRQA 4HWUA 3NFSH 3PWVA 5DDHA 2Z8VC 4I2XB 3TV3H 4LBEB 3LH2H 4GW4A 1GXEA 3BP5A 1E6JH 4M8QA 5KS9F 1MPAL 5E8OB 1RUQL 2VXVL 4G6AC 3X14A 3B9AA 2EH7L 1U3YA 3QJFB 5EZJA 4HKJB 1S7UB 3JWOH 5C0AA 4NO5B 4PV8B 2YK1L 5SWSA 4NRYA 1V5JA 4XC1H 4GMTL 1SVCP 5KZCB 2CKBL 4NO0D 5H94B 5DK3A 4Z7QF 4R2GD 3GSWA 4LARL 3OAYK 4Y8DC 3S35L 4L8SC 1MY5A 2H3NA 2YR3A 4UT7L 1GPOH 4XBGB 2L0DA 4Y16C 1CLYH 4YXLL 4B7IA 3QCUH 1XF3B 4XVJL 4NZTL 4HLZG 1KPUB 3MJ7B 4MDIA 4PJFB 4AH2A 4Q9RH 3WIHA 3BZFB 2AV7B 4LKXA 4ODUB 1NH6A 3RDTB 1A3LL 1IT9L 3LQZA 1BQLH 1HQRB 5FUOL 4YZFE 3MA9H 1ES0B 3IFNL 3C5ZA 1RMFL 3M45A 3WJLA 1P84K 1UB6A 1D6VL 3HA0A 3QPQD 1FNEA 3QDMD 3LEYL 4HQQL 2HFFB 1MELA 2H41A 4XAWL 5DD3L 4FP8H 4S2SB 5ADOL 5FYLD 4QHLB 4F9LA 3R0NA 4ZUVB 4RFOH 2P5EB 1RUKL 3SO3B 2R8SL 1WZ1H 1QO3A 4L3ED 1KC5L 2BVYA 3IRPX 4C59B 4JGJA 5J4MA 1SMAA 4F57L 43CAB 4CJ1A 4PRNA 4NQED 2Y06H 3ISWA 2VQ1B 5GJTH 3HS0A 1MFAL 2FJFB 2IG2L 3UEZA 5ADPL 2X10A 1J0ZA 3WFHB 5E08H 1FAKT 3U7WH 5LGJB 1JIBA 3ULUF 4FQJL 4Q0XL 5C6TH 2VXTL 1W0VB 4WO4C 4HCRA 2HJKA 4H20H 5KG9B 3BPCB 4JFQB 5HY9A 2IEPA 3REVB 4OZ4A 3BP6A 1QLFB 2GJJA 2GEEA 4DK3A 4M61A 2VXSL 1JPFA 4NC1C 4ZS6D 1CL7L 1GGUA 4X6CF 5JIKA 5E00A 3T1FA 5ID1B 4ZS7H 3QB7C 5L8LB 4X7TA 4Y4HD 3GUTB 2J8OA 4POZC 1MIEH 5FCUH 1L7TH 3QO1B 1D3CA 4ZTPH 5JHDD 2OSLB 5HVHB 4RGOH 5A16B 1WC7A 1LDSA 3H8NA 2AK1L 4JDVA 5AEAA 1CD1A 5E24E 3U36B 4JRWA 3DVFA 5HHOE 3UZQA 3BP4A 1BEYH 1QYGH 5CSGA 3T2NH 3X3GL 2XKNB 1EAPA 3PWNA 1J0IA 1HYSC 1WQVT 1F4HA 2F54E 1MCLA 4ZXBD 4NP4L 2ICWB 3EKCA 4D9QE 3HI1B 1FAIH 5IJVB 4FTVA 4KK6C 3BRGC 4X4XB 2AJZA 2VN7A 1YJDH 3RVWD 2ADIA 3RDTC 3HAEA 5I30H 4LCWB 3RPIB 1CFNA 5IEHB 1NCCH 4NQCD 1A1MA 4XCFL 3A6CL 4QNPE 2GT9B 4J3OC 4ZFZA 3I6KB 4OM1H 3DROB 4JZNB 1IARB 1NFDE 1GJIA 2KDGA 5M95B 3CSBA 2NYYD 4M4RA 4LAQL 1RZ8A 4OLYL 1LQSR 3L7EB 1E4XI 3L7FA 3SO3C 3WIIL 6FABH 3U9PL 4GXUM 2F74A 5DMGC 3CFEB 1N5YL 5F7HA 3UJJH 5A2IH 4HBCH 1QSED 1J8HB 1LE5B 5E94B 1PG7L 5DRNB 5EZOL 1Y6NR 4P46B 1JGVH 4NYLB 5JXAH 4HIIB 1YEFH 3FO1B 5SV4A 4OV6F 2V9RA 3NH7L 4RBPK 1DQLL 5GRUH 3CFBB 4XGZB 4FQ2H 2UUDH 3CSYB 2VDPL 4NHCH 2BOBA 5DD0H 1JHKL 1K2DB 2AP2A 3HB3C 4NT6B 5ITBL 1FO0L 2PXYA 4KKBD 5F7NC 5IBUB 2AJXL 3DXAD 3GMQA 5CUSL 4FQ1H 5IF0A 3VMOA 1G9NL 3MYZA 2A6DB 2Q8BL 1QFWI 1O7VA 4YDIL 5EO9A 3G6JE 3BZEB 1QRNE 3QG7H 5HGBA 4YDJB 4ZAKB 1RJZB 1A9BA 4XNUH 1B0RA 5HVHC 1UYWL 1ACYL 4YHPB 1OGAA 4OD2B 2XICA 4YDKL 1KEGL 4U1HB 5F93C 4ERSH 5GGVY 3RWIB 1DLHB 4V1DB 4YJZL 5F1OB 1RZGB 3BO8A 4PJ5D 4J3VA 3HR5B 2JLLA 2OR8A 1AXTL 1UWGL 1V7NL 3ZL4L 5HJ3A 3TVMD 1WFOA 4X6DE 4JPWH 4LLQB 2EZ0C 1GYAA 1I9IL 2AI0L 4N0CC 3WXVH 3PWVB 4P57A 4N8VG 5FECA 5TDNB 4PJGA 4HIJA 1L9MA 1JWMA 3HE7A 4BZ2H 3RTQA 1U9KA 3QDJE 2XZZA 3P11L 4L5FH 3VFGL 3DETC 4O2EB 3NZ8B 4WUKL 3P3YA 4ONFH 2HAZA 1CTNA 3X14B 5EZJB 2NY5C 4NM4H 3IXTA 5C0AB 1F6AA 4LCCA 4OF8A 1I3RA 4NRYB 2PUQT 1UXSB 4DEPB 4Y5XB 5FGSA 4FQLL 5C2BH 4HFUL 3W11C 1OP3K 4P2RE 5EA0H 3MCKA 5D6CA 4P2OD 2NY1B 4RAUB 4MA1C 2D03L 2BNRD 1CICA 5AZ2L 4X6BA 4P46C 1WFUA 4AH2B 4FXKA 5IMLA 3UTPE 1RVFH 3GSXB 1XT5A 1FFPB 3LQZB 1FNGA 1A5FL 4X0KA 5GGUB 1R5VB 3MO1B 1FNEB 4YDVB 4Y4KA 2C7UB 1RJYA 1AI1L 1JJUA 1ITCA 4NRXA 1GOGA 5J6HB 1YEDA 4MJIE 3BUYA 4P9MH 1PSKL 2VDNL 2VDLH 5D1XB 2UWEF 3ARTA 4IRSD 1U8IB 4OFKA 4MQXD 4MQ7A 3DLQR 5DRXB 2VZTA 5GISL 5FCSH 1MFEL 1MCOL 5EIVA 3MLZH 3ES6A 3EO1A 4LRNH 4OGYL 4ZAKC 2YPLA 5DUBA 3QDGD 3HS0B 2Q6WA 2FX8L 3D0LA 4LVHB 5BV7L 5EZLB 1WLHA 1A4JB 2BJMH 3WN5C 1X44A 5HYJA 4J7RA 1QBML 3PGFH 3TEUA 5CJQH 2VLRA 2YD6A 4QXGH 2D0GA 2HJKB 3QNYB 2XN9A 1N26A 5F7KC 2YOCA 3UPRA 4HJJL 2SEBB 2IQ9H 2VWEE 4OZ4B 3BP6B 3OJDA 4U33A 4KK5C 3VWKB 4JG0H 3LEVH 2OS7A 3KAAA 3Q6GL 1IC1A 3GK8H 4G80B 5FK9B 1F3DH 2B0SL 5E00B 3T08A 5IHLB 3AU1A 1TETH 1UADC 2JIXD 2EE2A 1DN0A 2ZUQB 4JO2H 4D0CB 1OM3H 1SEBB 1VEPA 2A9ML 5LAXA 1H3PH 5I1KH 3O3BA 1CF8H 3NVQA 1C5DB 3V6OE 1T0NA 5K9QI 1MCRA 4K3GA 5GXBB 3SOBH 2WUCL 4QTIL 1J1XL 1NBQA 1EAPB 3PWNB 3R1GL 4P9HL 1Q38A 1F3DJ 4MQSB 2NY1C 3LPWA 3O9WD 3O6KH 1QBLL 5IVXE 3STZA 4OGAC 4WHTB 4WUUE 3L3JA 4I5BA 3LRHA 1BECA 3OR6B 3R8BB 5K9OA 2WIMA 1HSAA 1IMHC 3TLRA 1NGXB 1Z6JT 4K3EH 4IDLA 5A2KH 1UGNA 3KG5A 1UJ3B 3WJLC 4G8FA 4KGLA 3E2HB 1A1MB 1KTDA 2ZJSH 4WU5B 3GBNH 1QQDA 4MGXA 1AIFA 3ZYZA 4PJCB 4GKZB 1RZ8B 3TT3H 5D1XC 3IYLW 1BFSA 3TZVD 2XWTA 3P40A 4MSWA 1QSFD 4G43A 2P5WE 2YSSB 4NKQB 3NMEA 3WSQL 2ESVB 4CN1A 4GOSA 1Z0NA 1FNSH 1IRAY 3QAZB 4N0FA 1RZJL 4E41A 4OCRH 4LLUA 2E7LA 1E0OB 2NY3D 1YEJL 1WWWX 1ADQA 1Q1JL 3JUYA 3OF6D 4KKLD 1QHOA 1YY9D 3PP4L 1IC5L 4NC2B 2ADJA 5F97E 3VH8B 4KK9C 4LSUH 2Y23A 2PXYB 5C0RH 2DBJA 3ULVL 3D69B 5DVOA 3FQXB 5HHQA 3QFJB 3SE9L 3VWKC 3ZLQC 2VAAA 5D2NA 4RMVA 1OTSD 2EIZA 3GBLA 2VDRH 2Z9TA 4ACPA 1NAMB 2MCPL 3RL1A 2ZCKL 1LO0H 3F7QA 2ZUQC 1EEQA 3S37L 4R7NB 3OAUL 3ILPA 5E2JA 5J1TC 1J88A 3HZYB 1MCPL 1ZK9A 1M05B 4A2MA 4MA8H 4Y5YA 1MCEA 2NXZB 3BXNA 4URTB 2E8YA 5I1GL 3L3DB 4LRIA 1LO5A 4JCMA 3EYOB 12E8H 3E3QC 3MLRH 2VLME 5HJ3B 3RQ3A 1DQTA 3PIQA 4DGVH 3RPKA 1F00I 5IW1B 3BE1L 1FG2A 1R3LB 4PJGB 1JWMB 3RTQB 1JVKA 4XMPH 1U8OA 5HHOD 1V7MH 3O2DA 4L8DB 1TJHL 1XCQA 3GJFH 4PJHF 3VXUE 5IWLA 2F54D 5DF0A 2NLJB 2VLKA 4G8EB 2QBWA 1UJ3C 5F96H 4D9QD 3WNNA 4F37K 3E2HC 3PDGA 3K8LA 1M7IB 4LCCB 1XZ0B 1I3RB 1EV2E 4JRXE 4KRLB 1QFUL 1D5BA 4M7JL 4P5MA 4KJWD 4FNLH 3UBXG 4PJXF 4KFZC 4UUJB 3QIBD 3CH8A 2W07A 3SY0A 5HHNB 5IVZB 2DWEA 2XFXB 4YO0B 4CVUA 3QAZC 1EFQA 1CICB 2ZNXA 1MJJA 1J0KA 1UA6L 1IJ9A 3O4LE 2AJUL 4NFDA 5FF6B 1WWAX 1LE9A 1FORH 3ELAT 3RX8A 3UYOD 5CINL 4U1KB 1JCKA 4TTDC 2VXUL 4HWBA 1PY4A 5GS0D 1OHQA 4X7FC 1T21B 2MWCA 4IDJH 5GGSA 2D9CA 4PJ9D 2PXYC 2F58H 4Y4KB 2RGSA 1RJYB 1YPZF 3OGOE 4MXWL 4GMSL 3UTTB 4YXKL 2XTLA 3JSSA 1NFKA 4Q6IA 3ARPA 3ZE0E 3O2WH 2C4XA 1BIIB 3FTGA 5I1LA 3STLA 1JHTA 2N4IA 3EO1B 1KYOJ 2CO6B 2YPLB 5DUBB 2AEIT 4OCYH 4F33A 4GKSA 2AXHA 4MWFA 4MNQE 2ITCA 1UM5L 1YQ2A 4HT1L 5JOFB 3NCEB 2W9EH 2CDEB 4M93B 2QADB 1S9WA 5MERA 3DX7A 5TE6L 4TN9A 3EFFA 2BFVH 5ELIA 3K2MC 5E4IA 1T03L 1MHEB 1KJ2B 4OGZA 1W72A 3H9HB 5ISZB 1IBGL 1H8NA 2HMIC 3RTQC 1AR2A 2R4RL 3AU1B 3AGVA 1YNTA 3DI3B 3DJ9A 4BZYA 1FFNA 4WTZA 4O2CA 1CD9B 3L3GB 1IGML 3GSNL 2J5LB 1PY9A 3CH1A 2EE9A 4GRWH 1NCDL 4LCCC 5E70A 4Z8FH 5DVLA 1U6AL 3QDJD 1KJ3L 2DWDA 4IOFD 2J6EL 1AY1H 3ZT7A 4DKEH 5JNYA 1T0NB 1E6OL 3QIWA 5T1DL 3C8HA 4LQ1A 1ONQB 5F6IB 2HTLD 3LS5L 1CDYA 4C56A 4G6FB 3WNLA 4KDWA 4L4TE 1H0DA 1TJIH 3A6OA 2PYFA 3HZKA 3TA3D 2DQDL 2FJGA 4Z7WF 2P4AB 1T89C 1CICC 1OAUL 2ZCHH 4WTWA 1C1EH 4OZHA 6CGTA 4P2RD 1B0WA 5KSUB 4M1DH 1JK8A 1UACL 4PJ7F 3S98A 3QXUA 1HHJA 4QHMA 4RQQA 1ZAGA 2DJUA 2HN7A 4CDGC 1NCAL 1ROWA 3IJYA 4Y4KC 4N0RA 4NBZB 2GTZB 1JPTL 4GW1A 5J9PA 2YPKB 4F7CA 3WKML 4JQIH 4LLWB 4QXWA 4IRJA 4K71B 3MLUL 3AREA 3SJVA 3B9KA 1AQDA 1BZ9B 5L9DL 4MJID 4ALAL 3HTLX 4HXAH 3MLYH 5IB2A 2H1PH 1OAZL 1OT1A 3AAZA 4O9HH 4QRRA 3RGVD 1A47A 4LLUB 1J10A 3KYNA 1Q94B 4UIKH 1FH5L 5IR1A 1I1CA 2OL3L 1HQ4B 2EDRA 3LAFA 2QADC 1EO5A 8FABA 1V3LA 2UWEA 2IGFH 3TC9A 4DW2L 3QHFH 3W39A 4UIMA 1D9KD 4HKBA 4X4MA 5CSZB 2VAAB 2VMFA 5JHLH 2Y5TB 1JWSA 5E03A 4RGMB 4MNGA 4NZUL 4JKPH 5F1SA 4PBWD 5F21B 2J5LC 2ZPKL 3B6SA 1JN6A 3T09A 2H2PD 3M07A 4HBQA 4Y5YB 3VXQA 2DMBA 5JW5A 4X99A 3ILQC 3MRDA 4J4PA 5BS0B 1TZGH 2E8ZA 3BN9D 1KCVH 4D9LL 5F6IC 5FO9A 5E6ZA 1KCUL 2X70A 2HWZL 3F8UB 4NC0B 1EXUA 1R3HB 2A0LD 2HG5A 2DJ4A 4FG6C 1KBGH 3RVUD 5DMJB 5HDBF 4N0UA 3IDNA 5JIIA 4OFDA 3DVNA 4HWEH 2O5XL 2GJ6B 5CEYA 4I4WB 3BZ4A 5LG1A 1HNFA 4WUUD 3ULUL 2FEEL 4M7ZB 2WSKA 3VFTB 1ORQA 2OXGA 4PUBH 4XXCA 1IILE 3LB6D 1A6ZB 3SBWC 4GG6E 3X13A 2BC4B 1IL1A 4JRYE 1YMME 5EU4B 4M5YL 1X4ZA 1ZLUH 4Z7VF 2G75B 3OBAA 2JE8A 5KAQF 1IGCL 2ZKHH 4K71C 3DTXB 5A40E 3BGFC 5MHSE 4OLUL 4HH9A 2A6KA 5EFIA 1RJLB 3SY0B 4JZOA 5EBGA 3CDYA 4LSSL 2CQVA 3BPLB 4NQUA 4QOKA 3QEGL 3HNVH 5HI5C 4NQSA 4HK0B 4A6YL 1LE9B 2P5WD 2BSSA 2JJWA 4KQ3L 1DQDL 2H9GB 3FKUS 4JM2B 5IQ9A 4KI5C 4OZFA 2E9JA 3X17A 1FFQA 5GGSB 2ZCLH 5L2KE 1WCQA 3PWPB 4HS6B 1S9VA 3BKJH 5IBLC 3A6BH 4ZNEE 3EJZC 1KELL 4CJ0A 4GLRI 5IMKB 3MYJA 3L5WA 4CU6A 5D2NC 4OKDA 4NCC2 1AKJB 4Q6IB 4N5UA 3KYKH 4RGMC 4E5XA 3STLB 1QFPA 1RZ7H 4WFED 1LK3H 3EOBB 5GGRY 1E4WH 4F33B 1AGDB 3NACL 4UT9H 3CMOL 4JFEB 4YE4L 4Y5YC 1Z9MA 2OLDA 3SGJC 1WBXA 3L6FA 2EC9T 3FQUB 2Z91B 5BRZA 1T22B 4Q58C 1ZT1A 4LRIC 4U7KA 1MLCB 5AD0A 2I07B 1ZANH 2DBLL 1CGWA 3S3SA 3HRPA 1D5XB 4JKKA 5CD3A 3TBSA 3K4DA 5CEZH 5H37H 3P0VH 3T0AA 3EFFB 3LZFL 2P45B 3JWDC 3PQYB 4EZMA 1EZVY 1SY6H 4FABH 1N4XL 4ODVL 4Q2ZB 1B88A 3KPRA 3QHTC 4K8RL 2VLMD 1FFNB 3S88H 3CDFA 2R1XA 4WW2B 1A1NA 2Q86B 2BK8A 2Q87A 2R0KL 2ORBH 3UX9B 1K8DA 3VXPB 2ITDA 1ZLSL 1S9YA 4OZGF 3KLHC 1HSBA 1G7JA 5ENWB 1AFVL 3TPUB 2NY4B 3DVIA 3VXSA 4LLMA 5JNYB 3MA9L 3VXUD 2P46B 5JW3L 2LE9A 4NQXA 1KEML 2GQHA 1BVLA 3SCMB 1H15A 2LAAA 1U36A 4XCEA 4LPVA 3OJVC 4XP1L 3KPNA 2AEQL 4JRXD 3IDMB 2PYFB 2YWZA 4RFOL 5EZIH 3PGCB 2ADGA 3BPLC 1WZ1L 1OAYL 2IAMB 4N1HB 4OZHB 4LF3A 5ESAA 5CMAB 5D5ME 1X5IA 2J4WL 3T65A 4BELD 1JK8B 1QZ1A 4HPYH 4JM2C 2PW1B 4RQQB 1FJ1A 1G7QA 1V3KA 3PJSA 3A0OA 3LPFA 4DN4H 3P4NA 4LQFH 5LBSL 2FATH 4PJXA 3O4LD 4WDIA 3KR3L 3HPJA 2QQKL 3DIFA 4NO0A 5JIHA 5DC9B 4YHZL 5I18H 1KB5A 2HFGH 3BN3B 3MV9E 4Q6IC 1RPQA 1CDJA 3KJ6H 5IFHH 3BHBA 3EW3B 3A67L 3EO0B 4U6YA 1YNLL 3VFNA 2X40A 3TBTA 4HUWA 5DSCA 3H3KA 3V4VL 4KV5F 3QT2A 4X5WB 3AAZB 4QRRB 4N0YH 1WWBX 4L8CA 1RU9L 4Z7NF 2X42A 5ILTH 3AS0A 1NMCB 5GHWL 3KYNB 2I24N 5TGBB 4GG8B 4QRUB 2GYSA 3B5GA 4FS0A 3TT1H 3ME0A 2VDQL 4F7TB 4UDUB 3QDMA 2FZ3A 3QI9D 2B1HH 4JFYA 5CSBA 1JWUA 5C0IA 4CN4A 3G08A 2CUMA 3W39B 3IVKA 2DKMA 4NKDA 3RFZC 4MNQD 4FQXD 1TCMA 3UMTA 2V6HA 1NLBH 2X4RA 4L3EA 3T2NL 2DLFL 1S3KL 1QHPA 4KHTH 4WEBL 5GGRA 4MNGB 1JL8A 4NM8L 4NQEA 1N5AA 4G3YH 3MUHL 2IBGA 2QHRL 2VISA 4WW2C 4NWUL 4ZDHB 2NY5H 1JN6B 1VACB 4G6MH 3E6FA 3RAJH 3FRPA 5I8KL 3NZHL 5C0EA 2NY4C 3P9MA 3MRDB 2JJUA 3PDDA 3IJSB 4HUMB 1R5IB 4HULB 4N5ED 3F7PC 1BVZA 1KT2B 4P3CH 1UZ8B 4RAHA 5FO9B 3V0WL 4X8XA 1I1AD 3SCMC 4R4BA 4H25B 4DAGH 1MCSA 4N9GA 4NSKA 3DSFH 2NPLX 3LN4B 4RAVA 4IS6B 1CD0A 1J12A 2R56H 2IAMC 4Y4HA 1RIHH 1ZHKB 1X5GA 3HFML 5JHDA 5IMMA 3LOWA 3WLBA 4IRZL 2AABH 3EYQD 4L4TD 2OR7A 3VI3F 2N56A 1LDPL 5EUOF 1IFHL 3TNMA 2ZG2A 5HHPA 5BXFB 1EO8L 25C8H 1K8IB 3VW3H 2UY7A 15C8H 2CKBB 1X7QA 4PJDF 4LIQH 2X2YA 4IOIA 3U7YH 2A9NH 2APWA 4FQ2L 4KROD 4GS7C 2NY0B 5TF1H 4OZIA 4Q97A 4ZXBA 4LASL 1NDGA 3H9SB 4I48A 4Z7WA 4TNVF 3L9RA 4LVOB 3KPMB 3AREC 3MRGB 4LOUD 4QXUL 4NO3A 4FZEH 5DQJB 4XP9H 3T3PE 1N3NA 4NNXB 3MXVH 3PL6B 4NNPH 3U2SA 1NMCC 2GSGA 5E2UL 5E5RB 4TULL 4BSWA 2WP3O 4U2ZA 2R0ZH 1N7ML 4NQCA 5ERWA 5EO0B 3QIUB 1ZS8A 2H6PA 3ULSA 5FHBH 5A2JH 1U2CA 3EZ8A 4PRBB 4ELMB 2EECA 3UTOA 1K4DA 4OUUA 1MFCH 3EYSL 1ZGLM 1QACA 5D7LB 4K94C 2F9BT 4E5XB 3NBNA 3SQBA 1QSEA 3BDXA 4ZYKB 1MCKA 5FYKH 2VLJB 2YUXA 3DHJA 4OQTH 5I0DA 1I4FA 4KZDH 3HMXA 1NMBL 5BZDA 4HF5H 4KJQD 3T2OA 1PD6A 4GFTB 1P7KA 2V5MA 3VI4F 4OKVA 5BRZB 4KZEL 4J4PC 5AD0B 3QUMA 3LHPH 4L9LA 1JNHA 2F19H 2MCG1 3SQOL 4NJAH 1OAKH 1HWGB 4HUUA 3DXAA 3LV3B 4XNMA 5DJCA 1OB1A 4PB0H 5DRZA 3LSOB 1EGJA 3JTTA 5EB9A 2ZUWA 3OKYA 5EA0L 1K4CA 1RZKC 2DDQL 2NXYD 2G2RA 3EUUA 3H42L 4LHQB 3UAJC 3VCLA 5D72L 4K55A 3VA6A 1C5BL 5HGDA 1CWVA 1ZA6A 4JDZB 3U4EB 2CPCA 1S9YB 1RVFL 3LRSA 1HSBB 2DOCA 1VFUA 5IJKA 3VXSB 3BJLA 3I6GA 4GJTB 4Z77A 1L4IA 1EEUA 2C4FT 2XZCL 1CR9L 4PJ5A 5LXGH 2HTKD 3QRGL 3FQNA 3QO0A 4Q6YA 3TYGH 3TVMA 4LDEB 4KTDH 5MEPA 1U41A 4XCEB 4CW1B 1RURL 1SEQH 4XI5D 1DQMH 1N6UA 2YZ1A 4W6WB 2CDGB 5IGXL 2R0LL 3PL6C 4JRYD 1YMMD 4I1NB 3Q3GB 5C0DB 4LF3B 4M5ZL 3DMMB 5ESAB 2MQ3A 4QWWD 3UC0H 3VE0A 3QP3A 1ZT7A 1BQHB 1MHPH 5E8NA 5CEZE 5LJYH 5CJXC 1OWWA 1HHGA 4JN1H 4ODWB 1R3KA 4Z7VA 4KKNA 1T3FA 2DLHA 2FD6L 4PJFE 1NGPL 3MLVH 1JNLH 4WHDA 5TE7L 1TZHB 4R2GB 4MDJB 3IFPA 1WF5A 3CDGB 1FIGH 3G5XA 3BHBB 1MCWM 2PTUA 4P2OA 1EHLH 3ZKXB 4U6YB 1EPFA 1JPSL 5L2KD 1KIRA 3KLSA 4KRNA 3LEVL 3CDCA 2ICES 2BNRA 4ZFGL 4E0RB 1I8MA 4OBRA 4CADB 2P5EE 1JRHH 1EK3A 3H0TB 1MFBL 1N8ZA 1NCTA 2X1PA 2E5EA 3VGAB 4IMKA 3LMJL 2ZSWA 4JFYB 1A7RL 4J12A 5ICXA 4MCYA 4AIZA 3IVKB 3D39B 2DQIH 4AMKH 4MAUH 3DURB 2DQCL 4PRDA 5H37G 2VDMH 4XP4L 4OI7A 2EYRA 4IRSA 4YHMH 4P99A 2X4RB 2IC2A 2FO4A 3P0YL 4J3WA 2DLGA 4NN6B 2BVEA 4NQEB 4OV5B 4A2LA 3QDGA 5C0FB 2RJMA 1EHAA 4F8QA 5F1IB 4Z7UB 3FN0H 4JFFB 3WCYA 4GQ9H 5A2LH 3E6FB 5HYSB 4XMKH 4JGUA 5CHNB 1PLGL 3I2CL 3DUUB 3RVXC 5C0EB 5KSVA 3MJ9L 4UU9B 1MF2L 5I17A 4PY8I 5EIIA 2CXKA 4HMDA 2AGJH 3OPZL 2D7TL 2VZSA 5EH1A 1I8IA 1FCGA 3DGGA 3K4AA 1A2YB 2VLLA 4R4BB 5F3BA 2J8UF 4PJEB 5INDA 4NSKB 1ND0B 3CX5K 3TNNB 1MRCH 3NFPB 2QEJA 3NPZB 3MUZ1 3DMMC 2JIXA 3V7AE 3VD3A 4OZGA 2X1XR 4HH8A 5IMMB 5JHDB 5EO1B 2CD0A 1FVCA 3OG4B 5MEOA 2GY7B 3BSZH 4WI6A 3IXAB 4OCRL 2UUDK 1CCZA 4G6KL 1XF4B 2EICA 3BGMA 1CE1H 3LKQB 2A73A 4R2GC 5FA3B 3D0VA 1SBBA 2UZIL 1NAMH 2X4TA 5F72S 4LSUL 4ZXBB 1NDGB 1VGEH 3L9RB 3N9GH 1RFDL 1U8MB 3O9WA 1B2WL 2DQFB 4NO3B 1DJSA 3MLTB 5B39G 1N3NB 1GH7A 4M3KB 4R0LA 4M9OA 3CXHJ 2GITB 3HNSH 4G8GD 3MV9D 4MS8D 4Z0BL 3SDYH 2XG5A 1RZFL 2FB4H 1OAQH 4Y0GA 4TSAL 4KTEL 4NQCB 3VGAC 3QPQC 5CS7A 2H6PB 3PWJA 4G8IA 3ULSB 3V7AG 1P4BL 1SHMA 4DVBB 1CVRA 5EDXA 3TZVA 3BWAB 2EEAA 1QSFA 3AMKA 4OUUB 4GKOA 5E8DL 1DEEB 2EYSA 5DJ6A 1QD0A 5DR5L 1QSEB 5BV7B 5DD5H 3RL2B 4JY6A 5D7SH 2YD9A 1U95B 1CLOL 3DBXB 3O0RH 5A2FA 2FIKB 3O11B 5BZDB 2PYED 2VIRA 1EFXB 4LIQE 4M8VA 2QSCL 5CJOL 1QUNA 2XKSA 3OF6A 3MA7B 4OKVB 3PGDB 1M6OA 5HI4C 1SJHA 3QXAA 4OAWB 4XNQB 1K5NA 2R15A 4LP5A 4U6VL 2HKFL 2OP4H 4J8RB 4GKNA 1MCQA 3GI8H 1FRGH 3RWEA 3I3DA 1X4YA 3IFOA 3VRIA 1XIWB 4MZ3A 5DJCB 3O3EA 1W0YT 3V5DA 5GGTL 4ZQKA 4UV4L 4YWGH 3HMWL 4Y4FB 2H45A 3WDJA 5C8JA 1C12A 2DM7A 2GCYA 5CWSA 1G6RA 5DD1H 2V5SA 1KN2L 3QNZA 3RWCA 4X80H 3WFCH 1X5LA 4RX4D 4Y2DD 1XF2B 1UVQA 2V2WA 1K6QH 3RWDA 2OQJA 3DUSB 1WBZA 4PJ5B 3C2AH 4YEFA 2ARJB 4H5SA 4XHJD 3FQNB 4ZXBC 1U0QA 2VDOL 1Q0YH 3MACH 1F45A 3KHQA 3T0VA 1A1OB 1X5KA 4HS3A 1J05B 3MRNA 3D2UD 1U58A 3Q1SL 1BP3B 5HHOA 1KG0A 1BLNA 2A6JB 3RVWC 5EUOA 2F54A 3HI6L 2E7CA 1YEGL 2R4SH 5E8NB 1FN4A 3DV6A 2D31A 4OCYL 5DGQA 1MAMH 1HHGB 5F9OL 1CFSB 5AG9A 4N8CL 2JJTA 3CVHL 1SYVA 4JFPB 1KJ2H 4QXTB 4XP6L 1U8JA 3ZE2E 3NABL 4YUEL 2IPTH 4YXHH 4EI6B 3IFPB 3CFJA 5GZND 3MQIA 2C9AA 1S8DB 4UQ3A 2CKNA 4OM0H 3QIBA 1MNUL 4P2OB 2O61B 1NFDA 32C2B 3FT3B 1HCFX 1KIRB 2V7HA 4NNYA 1UM4L 3UTSE 2BNRB 3ARDA 2IANA 3SPVA 4P2YA 1RD6A 5DK0A 1I8MB 4NKIH 3L3HB 1I9JH 2R2HB 5HGAB 2OL3A 2AJ3A 1RUAH 1KFAH 4YPGA 5EIQA 5TFSH 3ZE0F 1OSPL 3ZHKA 3UJTH 5IEKA 4PJ9A 2FH8A 5E2TH 4LGRB 4UTBL 4KKBC 4MCYB 4AIZB 4YHNA 1UCBL 3RNKB 1LHZA 1LO3H 5HPMB 1CXIA 3BKYL 4HC1H 2IJ0C 2EYRB 3BDBA 4IRSB 4MVBD 4RMQA 5HHXH 1CE6B 1H5BA 4LP4A 2FCBA 3DV4A 2FO4B 4N8VA 4NBXB 3N1MC 3ARUA 1I7UA 1CFTB 5ITFA 4QY8B 3FB6A 4LSRH 5MENB 3O41A 5GGQH 2ZCHL 4F2MA 3G6JA 2I5YL 3O6LL 4WY7L 5IJKC 2I60H 3BZDA 4FQCL 4XCYA 3RVTD 3IF1A 3Q5YA 1VKXA 3OV6A 5EIIB 5EOCH 3HUJB 5DUML 3CLEH 3TVMC 3DGGB 2VLLB 1DE4A 4YHIB 1KB9J 3FRUA 5DFVD 5F3BB 2E27L 4D0DB 1HKLH 1KN4H 4MAYB 1NANI 3W81A 1A6VH 2H8PB 2KH2B 3EZJB 3NTCL 4LCIL 5IBTL 1MQ8A 2VERN 3ZDXE 1U92A 1MWAA 4POZD 1U8NA 5SX4I 3U4BH 3VFVB 1YECL 2JIXB 4X6DA 2AEPH 1P2CB 3V4UH 4ZUUB 3ORJA 2APFA 2EIBA 5DRWA 5IHZA 5EOCJ 1FG9C 1RUMH 4PV9A 3QDJA 3VGEA 2LU3A 3RBSA 1I9RH 1SMOA 3CFKA 3V4PH 3JTSA 2QQQA 3BGMB 5IESH 4O58L 2E7HA 5CEZD 2X4TB 4F3FA 3LRGA 4P2OC 3GMPB 4X9IA 2VO5A 5EU5B 1RZJC 1YEIH 4O51A 1A7NH 1RULL 3MX0A 5ESQA 4UV7L 3RDTD 5GRZA 3QA3A 3GKWH 4P2RA 3IDGA 4JKPL 1FE8L 1NGZB 2AQ1A 1F2XK 1L0XA 4WI8A 3LIZL 1TPXB 4IMKC 2FHBA 2HJFB 2D9QB 1AGCA 4YQXL 3ULVC 3PWJB 4G8IB 3VWJA 4G6JH 1JGLH 2P5ED 5I66B 4IRSC 1KPVA 3VFSA 1CK0H 3WFEL 3MRHA 2YC1A 4OIAA 1INQA 5SWQA 5F1NA 2FGWH 5DJ6B 4XPAL 4MJIA 4I0PB 4I3RH 5C92A 3GJFK 4CUCA 1AXSB 1ZA3A 3QFJE 2VIRB 1FL6A 2NY3B 2CIKA 5FUZL 4AEIH 1T6WA 4KUZH 4GRLD 1FIEA 1XGTB 1R3IH 4GKNB 4CDHA 3QUYD 3LKSB 1FYTB 4YPJA 3FT4A 4F80A 1D9KA 3IFOB 1CU4H 5EU7C 5AYUH 2FECL 4XZUA 3O3EB 5CZVL 4MAYC 4ZQKB 1CGYA 3RIAK 4S1SL 3HC0B 1W2KT 3OB8A 5DJXB 4ORZC 5KVFL 3GSNB 3SKMB 4WCYL 1KPRA 4HWBH 1ZVHA 2UVEA 1GGIL 4KJPD 3TJEH 1Q0XL 3Q5TA 4ORGB 3TH2T 4OCNC 1HH9B 3S4SB 4Y88A 4U1NA 2DQUL 3BDYH 2CGRH 1RIUH 3VH8G 3EYFB 3U4AA 1IEAA 2V2WB 4UB0H 4HS8H 3RWDB 3MMEA 5M94B 1INEL 4XPFH 3GDBA 5CAYB 4M6MH 2ZUVA 1B0GA 2V17L 4N0CD 3O9WC 1NC4A 2DM3A 3A6BL 1GIGH 3GMRA 3O2VH 5BZWA 2AEWA 4HV8A 5JA9A 4ZSOB 4HS3B 3GB7A 1YYLL 3MRNB 2X1OA 1G7PA 2JJVA 1CFVL 2E3VA 1KG0B 1BLNB 2FO1A 1P84J 2CLZA 4LCWD 1F8TL 5I15H 2F54B 2YUZA 4I3GA 3INUL 3VXOA 5IVXA 2IH1A 1TPXC 1XF5B 3DV6B 4WUUA 5IFAH 1Z5LB 4UT9L 3S36X 5I1HH 1SYVB 1WTLA 3NCYP 1U8LA 2C3WA 3OXSA 1WZLA 2V2TB 4EOWL 4KKCD 3TZVC 4HWNA 1BPVA 1FDLL 3I6LE 3H2WA 3L5HA 1GAFH 2APVA 4JR9L 4KVNL 4LSVH 3JBG7 4UQ3B 3NCBB 3P0VL 3QIBB 1NFDB 4WI7A 2IFFL 2ILLA 3WL9A 1G0XA 2J1KA 1Z2KA 4I0PC 5KS9B 1SY6L 4QTHB 5KSAD 1R6VA 2V9QA 4P46D 3SPVB 5HPOA 3TGXA 2NY3C 1HZHH 2OL3B 2P5WA 4J1UA 4KKLC 2XA8H 5FXCH 1TXKA 1YY9C 1NCBL 2OTUA 1C7TA 4HZAA 4LVEA 5IEKB 3IB4A 3V79C 4R26H 3WO4B 3U0WH 3WUWG 2R29H 1F11B 3ZHDA 4TTGA 3NCCB 5I0ZA 1OTSC 1CLZH 3I50L 5HDQH 4Q74A 1FZKA 5ICZB 1KCSH 4HLJA 1CFBA 4N8VB 1FGNL 3WEXB 4ZAKD 1A7PH 2F5AL 4D2NA 4TUKH 3DRTB 3CC5A 3DX6A 4JO4L 2RBLA 3O41B 5ALBH 2GI7A 5ISZE 2Y7QA 3QCVH 3QXDB 3UBXI 1QRNB 2YUVA 4XCYB 4NQDB 1VKXB 1TENA 3NAAL 2MQCA 3OJ2C 3JUZA 4S0SD 5CGTA 3U46A 1HI6B 4KK5D 1DE4B 5EBMB 3UBXA 3FRUB 1NGWA 4NKMB 4M02A 3QZWG 4YAQB 1KJMA 2BNUA 2KL6A 5JLZA 4P59L 1U92B 4OGXL 1U8NB 5I1JL 1R5WB 1D7FA 5AAWA 2XACC 5FA4A 4ODXA 4PJIE 4N0YL 5IFJB 2JJTC 2NY7L 1C5CL 3QEHA 5IHZB 4U6XA 4X4YA 4FXGA 3CFKB 2W0LA 4JPVH 3VG0H 3X11B 2AW2A 4DK6A 4TVPE 3VXUA 4KJWC 4LNVA 3KXFE 1GGBL 3ROLB 5B3JE 3HNTH 4O2FB 2DI8A 2NY1D 1QR1A 1NC2D 1UM6H 2EDHA 3QIBC 4LLAA 5T5FL 3QCTH 4OGAD 3MRIB 4PR5B 2CIIA 4JRXA 4ODSL 3TA3B 1MJ8H 1NLBL 1WEJH 1AE6L 1JF1B 2CK2A 4WI9A 4A6YB 4ZTOL 1N6QH 2X4SA 4P2RB 1AD9B 3DPBA 5DMIH 1DBJL 3FB8B 3O81A 5DS8A 2FX9L 5D6DC 4PYHA 5FUCE 4MX7B 5IMOA 2X6MA 1AGCB 4PJ9C 3UTSD 4GRWF 1ETZA 3S7GA 3WO4C 3O4LA 1VFBB 3H7BB 5D1XD 1UKTA 3SKUD 3GMOA 3WIFB 3MRRB 2W65B 3VXNA 3MODL 1IAMA 1RK0B 5EUKA 1MPAH 2HT3D 2PCPA 2YC1B 1RUQH 1INQB 3MFFA 5SWQB 5EC1B 2VXVH 3L5XH 5J12B 2EH7H 5MEQA 5K59F 2EH8L 1ZE3C 4MJIB 1PG7X 2VZ3A 1PYWA 2YK1H 5EPMA 3RGVB 3S36H 3IKCA 4GMTH 4P4KB 2NTFA 2KKQA 1AR1D 5E9DE 1C08B 1QLRA 2CKBH 5D71L 1NSNL 3RWGA 1KIPB 4LARH 2HRLA 2Z4QB 5F9WC 2AABL 4KK9D 3QI9A 4UT7H 4I18A 4CU7A 4Y2OA 3KVQA 5F7FA 3B9VA 2EDFA 1QA9B 3KDMB 4MNQA 3GSQA 4XVJH 4NZTH 4FQXA 4AIXA 3QQ3A 2ICEB 2CUIA 5CEXA 3SGEH 5H35A 1OQXA 1A3LH 1IT9H 1GL4B 4AQOA 5FUOH 5BS0E 2PW2B 4ZODA 2WQRA 3C60D 3T4YA 2WP3T 3IFNH 1RMFH 1IAIL 2NW3B 2HYMA 1I3UA 1D6VH 4RWHA 4HQQH 1R3JA 3LEYH 1RIVL 3UZVB 2V5RA 4XAWH 4BKLA 5DQDL 5ADOH 4U1NB 3BYYA 3U0PB 1CD8A 4IOFC 1RUKH 5E7BA 3MMEB 3S3JA 2R8SH 1KC5H 4OIIL 1VCAA 4F57H 2HTLC 1I1AA 4ZO6A 5ETUA 4MNHB 2GJ6E 1B0GB 3NIFE 1MFAH 1XF1A 2IG2H 5ADPH 4HV8B 3WNPA 2KPNA 3TA3C 1G7MA 3GNML 4W6YB 1SJEB 2VL5B 3N50A 4X83A 1G7PB 3EAKA 4B5EA 3AXLA 4FQJH 4TYUA 2VXTH 2EEBA 5GSVA 5F7EL 1KGCD 4L4TA 2CDFB 1ODAA 3VXOB 1I7RA 5IVXB 2DN7A 3RY6C 4UMGA 4X8JA 2VXSH 1F58L 3CGTA 4H8WL 2IPUG 1F4XL 1CL7H 1JI1A 2P8PB 4PGBA 1Q72L 1LILA 3MRPA 2OZ4L 2ESVD 2UVFA 3OR7A 4UT6L 5J12C 1F3RB 3DX8A 4JQVA 3WL9B 3FFCB 4YFLF 1M71A 2AK1H 3RUGF 3RGVC 1NAKL 3MV8E 7FABL 1BZ7A 1NEZB 5AWNL 3X3GH 2OTUB 3ZSTA 4MA3A 4NP4H 3DYPA 3W0WE 3QFJD 1D9KC 3AFLA 1P7QD 1CTOA 4JFEE 1OL0A 3QQ4A 4L4VE 3AVEA 5AG8A 2W60A 1FZKB 1F6LL 2WINB 4D3CL 4OSUL 3TYGL 1P7HL 4UNUA 1I8LA 2VWEC 3TBWB 2D7QA 3HI5L 4XCFH 3A6CH 4DOHB 5DZLA 2OK0L 3FO0L 5L8KB 3BQUB 3BRDA 1BVKA 3PQYE 2NXZD 1RK1A 3MJ9A 4LAQH 2E9IA 2Y7QB 4HEPG 4OLYH 5DUPL 1CGVA 3WIIH 2HVKA 4Z5RA 5B21A 3U9PH 3BN9C 1MHPL 1OQOA 1N5YH 3QULA 4EVNA 3PXHA 3U46B 3ZSSA 1XGYL 4GRMA 3UBXB 3MRBB 5F9JA 1PG7H 5EZOH 1KJMB 1JNLL 2HMID 3DO7A 3V6OC 3ARSA 1WTGT 5IHUL 1MVFA 5DD6A 1DQLH 4CMMA 4DQOL 1B4RA 3CZJA 1IQDB 2VDPH 5C0GA 1PDKA 2H26A 1JHKH 5ITBH 2Y6SD 1FO0H 2UYLB 5FA4B 4ODXB 3RWJA 1LD9A 2QHLA 4HGWB 2AJXH 3QEHB 3LB6C 5CUSH 1YDPA 5F6HI 3DVGA 4X4YB 4FXGB 1G9NH 1QKZL 5FOBA 4YDIH 4LMQE 3HZMA 2DAVA 3VD4A 1DTUA 4AMKL 4NUJB 1UYWH 1ACYH 4JRXB 4GG6A 4XNZB 5A1AA 3BVNA 2BOCA 3D48R 3WJJA 4YDKH 3MNZB 1KEGH 4JRYA 2WV3A 3ARFB 4JPKL 3R8QA 1AGFA 3GMMB 3I6LD 4PS4L 5FYJE 3MV11 3T04D 1AXTH 4LSPL 1UWGH 4OLXL 2Z8RA 3QJHA 1V7NH 3ARZA 3ZL4H 4OCXL 1T5XB 3HE6A 1MH5A 4EJ1C 2BVQA 3FN0L 5IOPA 2ZNWA 2XWBB 1BOYA 1I9IH 2AI0H 2OJZL 1ZGLA 1ETZB 3O4LB 3UTTD 3GMOB 1XGRA 3SGDH 3S5LG 3P11H 2ARJQ 3VFGH 2BMKB 2X4OA 3KJ4B 4WUKH 3EBAA 5L2KA 5MEQB 4ZNEA 1SBSL 3ZZ1A 3BQUC 5C7XL 5EPMB 1B3JA 4ZUWA 1G1CA 4RWYH 3EDJA 3GJFA 2CLVA 5IIEA 3GIVA 5I74B 1QLRB 4FQLH 1WAAF 4KUCF 3WHXB 4GBXB 2B20A 4KTYA 2AQ3A 4HFUH 2QADD 2HLFD 2QKIA 4LDLB 5CLWA 3QI9B 4I18B 3SKOB 4PJAF 1XH3B 2A77H 3BSZL 2OTWA 1FNLA 2D03H 3GSQB 5ISZD 4NOFA 3LQAL 5AZ2H 4Z9KB 4YNYA 3VXTB 1N64L 1T1YA 1EIBA 1A5FH 1EBPA 2MOVA 3V7MA 5BO1L 1MIMH 3E6HB 5JORA 5IB4A 1T6VN 3KYOB 3VFMA 1AI1H 4PGEA 1UT9A 3T0BA 4BKLB 3VDCA 4M62L 4JFHE 5JW4Q 1PSKH 2VDNH 3B4NA 3F5WB 3U6RA 4ZFOL 5DO2D 2DMKA 4H1LB 3CFDA 2GUOA 3IETA 1G9ML 5GISH 3D6GA 1LP9F 1MFEH 1MCOH 4OGYH 3LDBB 1IAKB 3FONA 2FX8H 4NOBA 5BV7H 3PV6B 4PRHE 4PG2A 2DRUA 2YUWA 2Y4SA 5I8OL 1VGKA 1KCRL 4TVPD 3ARFC 1T1WA 1HKFA 3AXLB 1GOFA 3BYTA 4X5XB 3LKNB 4HJGA 5GSVB 4HJJH 1I7RB 2I9LA 2XPGB 1UKQA 4C4KO 5IP4A 1UEMA 3GSVA 4X8JB 3Q6GH 3WLWD 3LY6A 3ZT6A 2I26N 2Y25A 1GZPB 3GMNB 5D5MA 2B0SH 3SDCB 1FFOB 5TDPB 4R90H 5HGHA 2XY1A 3KJ4C 1A6AA 3OB0H 2DI9A 4PP1D 2MTPA 2YD3A 4J3TA 1HILA 3DX8B 3KYMA 2AXFA 3VJ6A 4LLDA 3OSKA 2A9MH 1M71B 4PJHB 4UILL 4ELME 5HI5D 1CT8B 4G8GA 3MV9A 3T0EB 5I74C 2QSTA 5DEGA 5DTFB 1KTLB 1CDUA 4LNRA 2EDQA 2FIRT 1EMTL 2WUCH 1J1XH 5D7LE 3ZDZF 3R1GH 4P9HH 2R69L 4JFZL 1I9EA 3QI9C 4MA3B 4I18C 5HVFB 1VSCA 1VEMA 5IBLD 1QBLH 1XCTA 1BF8A 2NX5E 1OF2A 5T1LB 4FQXC 5E9DD 3QQ4B 3BPNC 3ARWA 3K74B 1DLFL 5D7IE 1JZ6A 4GUPB 3W5NA 2XXMB 3UP1A 3C6LB 4F7PA 3IDJA 3V2AR 5BVJB 3DI2B 2B1AL 3FQWA 3P77A 3MRMA 1NEUA 2PYEA 3MRFA 2YBRA 5CBEB 5BS0D 4NPYB 4Z5RB 2VKWA 1JNJA 2R4SL 3E8UL 3WSQH 2G5BB 1AGBB 1I1AC 1UG9A 3LDBC 4M7LL 3L95A 5IK3A 1CG9B 3OKEA 3FFDB 1RZJH 1U8PA 3DO7B 3WFDL 1MLBA 2I25N 5JPMB 1BAFL 1YEJH 3TN0D 1QEWA 5DD6B 4TVSa 5C1MB 5D2LE 1EA9C 3PP4H 5J3HD 1JTOA 2GJ6D 1IC5H 4HWZA 3EYQC 5C0GB 2PTTB 2H26B 2X4PA 3QXTA 3I75B 4HDIB 3BJ91 3SE4A 3ULVH 1T0MB 4Y2DA 3RU8L 1ITBB 3SE9H 4DJMA 1MAKA 1RUAL 3SDCC 3HCVA 4W68A 1VADA 2NY2B 4X5LA 1WT5C 3MRCA 5F88A 2ZCKH 4LKCA 2OI9B 2F8OA 2Z92B 3S37H 1UH4A 5DZNA 4LOUC 4QRTA 1OVZA 5L88L 4CRPA 4GG6B 1WITA 3D2UA 1JE6A 2BOCB 2YS4A 1CI5A 5HHXL 4JRYB 1YMMB 2UY6A 4TVPL 5I16A 5I1GH 3CIQA 3T0EC 3VFOB 1AGFB 3TIEA 2HLAA 2DQGL 2WWMC 1PKOA 4HFWA 3BP7B 1FL3A 1MHHB 4U49A 4JM2D 4L3CA 3QJHB 1JF6A 3N06B 4ZUTA 2L7UA 1MH5B 3PWPD 4JVWA 4YFLI 3BE1H 1NQBA 4FQIL 3RKDD 3MV8D 1XAUA 3EHBC 2O5ZH 4LGPB 4XTRD 4GH7B 1AKJD 5C08B 5CCKL 3T4AA 1TTUA 1TJHH 4U1LA 1RAMA 2GIYA 3C08H 2X4OB 3WE6B 3G5VB 4N1CA 2XQBL 1HHIA 2BSTB 2IWGA 4HLZH 4DWHA 5I8CB 3W0WD 3WXWL 1YMHA 5SWZB 3FOMA 4PGDA 1HKLL 3RIFK 1F5WA 3D39E 1KN4L 1BQHG 1IM3B 1PX4A 3IU3B 4JFED 2C1PA 5DHYA 3BESR 4L4VD 4JZJA 5T3ZE 3GIVB 4M7JH 4WW1A 1KACB 2A74B 2Y5EA 5IT2L 1NGYA 4MB4A 1A7OL 1MOEA 3TWCL 1DBML 2W9LA 5D7KE 3PQYD 5C09E 3IDIA 3JV4A 3QXWA 4Z7UE 1DANU 1UA6H 3U1SL 1A02N 1T2JA 5DEFA 3OGCB 2R23A 3VGBA 1T1YB 4GAJL 2NNAA 5CINH 2NXYC 2VXUH 3LKOA 3RGHA 1X6LA 1CXKA 1S7WA 1ZXQA 1B6DA 2RHEA 4PJBE 5GSRA 1TVHB 2GK0B 1A7NL 5DFWH 4PGEB 4ZPVB 4MXWH 3X3FL 4GMSH 3OKNB 4WFGE 3RWHA 4YXKH 2WLZA 4XPGL 3ROOB 4D0BA 4QF1B 1Y18A 3FOLA 2HTKC 3IETB 3ZDXF 3SCMD 1BHGA 2OI9C 1S7TA 3FONB 5HGGS 3CCHB 2ENYA 1V3JA 3ZKSD 3WJJC 4D94A 1CK0L 2ICCA 2IAMD 1UM5H 4HT1H 4NHUB 5E8OA 1T1WB 1CBVL 1IVLA 4ZOEA 5HYSG 4HJGB 3GSOB 5LGHL 5FGBA 3G5YB 4HKJA 2XIDA 3QBTB 4K7PL 3LCYA 2K3TA 2I9LB 1M7XA 3GRWL 4NO5A 2F53B 4PV8A 5TE6H 3SKJL 3CVHB 5FFLA 4FFVD 2VR4A 4KDTA 4JE4B 5H94A 2ZSVA 2D7PA 5D5MB 2R4RH 3MZGB 5FYJD 4PJCF 1S7VA 2GTWA 4XBGA 4WRLA 3ARRA 2QSQA 1A6AB 5T5NG 2VDKL 2QJDA 4XNYL 1Y6MR 5DI8B 3R4DA 3GSNH 4PLJC 1SY6A 1KPUA 3VDAA 3MJ7A 1TQCB 4LLDB 4PJFA 4YHOL 2RAMA 1PFCA 1SYSB 2AV7A 35C8L 1U6AH 3RDTA 1HQRA 2J6EH 1ES0A 1E6OH 4I0KA 4LNRB 5K9JH 4K7FA 5T1DH 2GFBA 4WI4A 2WNGA 3LS5H 5TQ0L 4RGNE 4S2SA 3BDYL 3UTZB 2P5EA 1OF2B 4U7SA 2AVGA 3RVVD 1OAXL 1A3RH 4HS8L 5FM5O 3CVIL 1OAUH 2EKSB 3KNBA 5E99L 5FYJU 1XGPB 4ZOCA 5FM5M 3LKPB 1JTPA 4JHBA 1UACH 2FJHA 2FJFA 5GGVH 3EJYD 3WFHA 4C57C 1NCAH 3FQWB 1WAAA 3BH8B 3W2DL 2KQNA 5LGJA 1JPTH 4MA7L 2ZOLB 2YBRB 4LL9A 1W0VA 3D25B 4GRLA 5KG9A 3BPCA 2VZOA 3REVA 3SDXE 4X9HA 3MLUH 3QUYA 3I3EA 2LTQB 3QG6A 2BY0A 3PWLB <