2NR6D

Crystal structure of the complex of antibody and the allergen bla g 2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
213
structure length
213
Chain Sequence
EIQLQQSGAELVKPGASVKLSCTASGFNIKDTYIHWVKQRPEQGLEWIGRIDPANGNTRYGPKFLGKATITADTSSNTAYLHLNSLTSEDTAVYFCARWVRQMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a dimerized cockroach allergen Bla g 2 complexed with a monoclonal antibody.
pubmed doi rcsb
source organism Blattella germanica
molecule tags Hydrolase/immune system
molecule keywords Aspartic protease Bla g 2
total genus 34
structure length 213
sequence length 213
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nr6D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nr6D02
1I7RA 1MFCL 3O6MH 5J11B 1S78C 4LEOB 1LO5A 1EFXD 1AJ7H 2P24A 4YHYC 1KPRA 1GGUA 4NN7B 5E2JA 4WI7A 4PIRF 5CP7A 5DTFA 3REVB 2GJZB 4Q2ZA 1V3JA 3MYZA 4JDTL 4RRPA 5ERWA 2KBGA 1BZ7B 2JJVA 1CE1L 4L9LB 2CDEA 3L5JA 4PGJA 1QLRA 4WY7L 1YPZB 1FL3A 5H2BA 3GUTB 1CD9B 2DB8A 3EJYD 1G0XA 1YPZA 4O02H 1QR1B 4JPWH 4G6FB 3TEUA 2QSQA 3EFFA 1TDQA 2WANA 1QR4A 3OXSB 1BQHB 3MRIA 4XNMA 3GSWB 3U7YL 2L7JA 4X6CB 4X6FB 1KEMH 4XXDA 3EYSL 4JPWL 1I9JH 1X5GA 1T80A 4LRNL 2D9CA 3T2NL 1Z5LA 2YN3A 3GRWA 4P59L 1IMHC 2BNRB 5CGTA 1JF6A 1IGCH 1NMCB 1EO8H 1ROWA 4PJAF 4WWID 3TN0D 5HYSB 1DLFL 4F7EA 2ORBL 5LQBL 4I18A 1RI8A 3KPSD 5DD5L 3BWUC 1GC1L 4GQ9L 5EZOH 3NCEB 4JGMA 1AO7D 3QAZC 3WFBH 5DRWB 4OCWL 4JPVH 2A0LD 1VADA 4AMKL 3BQUA 1PG7L 1FFNA 4CVZA 3W9EB 4OIIL 3QEUB 5E2WH 4UBDC 4HMDA 1ZT1A 5JA9A 4M1DH 4L1HA 3O9WB 4FN0A 3B4NA 3UTPE 4NBZB 1G0YR 3SKMA 4U1GC 2D7NA 4HJGA 4RWYH 1WWBX 2AEWA 2BSSB 3BP7B 4I1NB 5HDLA 2EDNA 1S3KL 1VFBA 2VE6A 3C09C 3L3IB 5J1AB 1WICA 1VPOH 2G9HA 5DDHB 1NC2A 5ENWA 5TGBA 3MNWB 4XRCB 4Q9RL 2N7AA 3F7QA 4G8GE 2OMNA 4E41D 3G04B 1MCRA 3CH8A 3PQYE 4XPTL 1IKNA 1IZKA 3PHSA 2O5YL 4XCNA 4ZTPL 1NAMB 4CL7A 1CLZH 3VXMD 1TZIA 1K6QH 4KAQH 1X5LA 3UYRL 4JO2H 4NKOB 1LO3H 1A7PL 5C07B 4P46A 4JGUA 2KQNA 3EOAB 2V2TB 3AVEA 5FYLE 4KROC 3FB5A 3GBMH 1TVHA 3NVQA 4RAUA 3BZ4B 3FB5B 2HAZA 4XHQA 1RZJC 2PO6C 3FO0H 1EMTL 1JPST 1MCHA 4HCRL 5I0ZA 2VB5A 1I3RA 3OR6A 2H2PD 4MQSB 4ZUUA 1S7QB 2YS4A 1CDHA 2W60A 1S9WB 3F7VB 3VFMA 3CNKA 1AIFA 4JGJA 1IBGL 3L7FB 3OHXB 3DO7B 5KS9E 1O5DT 4H5SB 2ATKA 4XNXL 1RHFA 1OAKH 1NCTA 2AEPH 4LBEA 3TNNB 3ZDXF 2Y7QB 4U1GB 3FB7A 1EPFA 2R23A 1PZ5B 4IJ3B 4OAWA 2VZVA 2W38A 5GRXG 3QNXB 5BRZD 4PJCB 4WV1A 4YHPB 3UJIH 2AEQH 5C0CE 1A9EA 1FC1A 3RVXC 4G6AD 3VD3A 2GUOB 1UYWL 4NHCL 3WFCH 1J8HB 1IC1A 4P2RB 5DSCA 1MRFH 1BX2A 4CU8A 4BQCA 5D9SB 5FCSH 4J3OC 5FYKL 3U82B 2C3VA 4UDTA 5C2UB 2Z93A 4WU7B 4GRLB 1CDCA 1RUML 5J13B 1U91B 4ZUVA 3UYOD 4YHIA 1UZ8B 4JQIL 3GMRA 2Y4SA 1TMCB 3GK8L 2VXUL 2Q7NA 2Z31D 4EBQH 1HXYA 1UFUA 5KS9A 1PYWB 3ARWA 1A6ZA 2FEEL 3S8WA 4WUUA 3MRPA 4JQVA 4WTZG 4WI5A 1FGVH 3QEGL 1DFBL 4I0PD 5DO2D 2O5ZH 4X7DC 1ZLWK 4FMFA 2IJ0C 1LEIB 4PRIB 1WAAA 2ZJSH 3STBA 1M6OB 5GS1A 2XTJC 2J8HA 1CXFA 1HHKA 2ZCKL 5H94B 1C5CH 4PJCA 2AQ3A 3OX8B 4KROD 3WFBL 5I1CH 4MXWH 1F3RB 5SWQA 1MRDL 2O26U 3NA4A 1CXHA 2C4XA 5EU3B 5CEZH 3NPSC 3H7LA 1A6UL 4JO1H 3IJYB 3LKQA 2Q7YB 3U4EA 3RWEA 4NOFA 4LHQB 1BBJB 2CO6B 3B5GA 3FRUB 1A2YB 1XGUA 4DEPC 2RBLA 5D8JH 3ZE1E 1GZQA 4GAGH 4LCWE 1MCPH 1GZQB 2ZPKH 3UBXB 5C6WH 3TVMB 2DLFL 2D7MA 3HZMB 3QFJE 4F58L 5KW9H 5IFJB 2E7CA 4I9WD 1W2KT 5BCAA 2BSTA 3O6FB 5CZXD 3CFKA 4JQXC 2HT4D 3CMOL 1PYWA 3KJ4B 5ITFA 4FXGA 4MA7L 5HHVH 5F89B 4KPHL 4JFFE 4JG0H 3S98A 3RVWD 2W0KA 4OD1L 1JV5A 3VWJC 3L3JA 2AK1L 2GSGA 4JANA 1T22B 4CN6A 1EUTA 5D5MB 1MFCH 1VHPA 2A73B 2Z31C 5TDPB 4APQA 1BD2E 2F58H 5T5NF 3LKSB 5EC2B 3QDJB 4AY0A 1YMMB 4MA8L 4KQ3H 5L2KA 4YEEA 4EZMA 3CFCL 3GSXB 2ZZUT 4I18C 3LVEA 4ODVH 2VXTH 2IBBA 3MRHB 3QQ9C 1SBSH 1JTOA 4FQCL 5IFJA 2DRUA 1Q72L 25C8H 3T0AA 3WSQL 4RFEB 1KLUB 2ENSA 4XCFL 2ICES 4HUXB 5I17A 2A77L 1ZLVH 1I8KB 1RUKH 5HJ3A 4OLWL 3TBSA 4XZUB 3T1FB 5F96H 5K33A 3CFBA 3TBSB 4YDLB 5L2KD 1A5FH 3B6SA 2FATH 3TJEL 1T5WA 2A77H 1HH9A 3MV9B 3F58L 4M7KL 4KK5D 4WHCA 4XNQB 2VLJA 3WHE1 3VFWB 1X5IA 3MGTA 1QD0A 4JO3H 1I7UA 1Z3GL 5HHQB 5HGAB 3UO1L 4P2YA 4ODXB 1EFXA 3D9AL 2I9TB 1S7VB 2NTFA 1CCZA 4XNZC 2CLVA 4PRBB 1SJXA 3DNKA 1XF5B 4R0LB 5F7EL 1HIML 1V3LA 2CGRH 3FTGB 2VDPH 1X9QA 2VDRL 4UQ2A 3QUMA 3JWDH 5EO1B 5DJAB 1L4IA 4Z77A 5EO1A 4CDGC 4GW5B 2ZG3A 5DUBB 4NQED 3L3OA 4AL8H 3W5MA 5C09B 1ZKAA 4LSUH 4P2OD 4IIQC 1YECH 3HUJA 5DT1H 2ILLA 1QVOB 2FX7H 3IJHA 2SEBB 3ZKND 1LO2H 2BXYA 5IK3B 2Y36H 4P3CH 3OKMB 3KS0J 4NNYA 5KANI 3D85D 4NRXA 1D5BA 4PJBB 35C8H 2EE6A 3MNZB 5BZWA 1OW0A 3QUXD 5KN5A 3SOBH 4JZOB 1NBYA 1KXQE 3ZLQC 4OUOA 4PJFB 2DWDB 3V5DB 1ZHLA 3ARZA 4ENEC 1JWSB 4PJFA 3TN0A 3TWCH 2W60B 3F7VA 3MUJA 1JPFB 3VD5A 3ULUL 4ZDHA 2WP3T 3WIFA 4NWTH 3D48R 4P2QB 4P46D 4OZHA 2AGJH 3IAQA 5GRVL 3HI1A 1WK0A 3VWJD 4AT6A 4G7VL 3QAZB 1IAIM 1OGTA 1KCUH 1P2CA 3S96B 4GS7C 1MFBL 2BVQB 2M8XA 4NBXB 1TZHB 1EMTH 1B6UA 5A2IH 3S9DB 3VH8A 1A1MA 2I24N 1PAMA 4OCYH 4ZUTA 1RUAH 4R8WL 3R1GL 2X1OA 1AD9B 3MROB 4U6HB 2AERT 4BSJA 4HGWA 4XP9H 1MELA 2P48B 4L4VB 2FD6H 3IDNB 2H2SD 3QNYB 5GGVH 1A6VH 4L3AA 4PGEB 5EU6A 1T83C 3JSSA 3CXHJ 4CJ1A 2VOTA 3REVA 1NEZA 3WS6A 3ZYJA 3DX7B 3VDAA 3MV8A 3EZ8A 4NFCA 3WL9A 2NXZB 1G9MC 1MCPL 2FL5A 3QPXL 4Y4KD 2JIXA 3O0RH 3OG6B 4MJ4A 4QGTA 4RGMB 4CNIA 5DUPH 3BEWA 3KPLA 4WDIB 5ADPH 3HFMH 2D9QB 4NJ9L 2MTPA 4ELMA 4XC3L 5MENB 1DN0B 3MLSH 5FUOH 4NHUA 4K8RL 4OFYA 3QDHA 5DC0A 5INCA 5IOPA 4F15C 1OF2A 2NNAA 3ORJA 4DEPB 2X70B 3KPOA 2BJML 4ODSH 1U8JA 2A1WL 1FQ9C 2NY1C 5EUOE 2FX9H 3VFNA 3LEVH 1A6TB 1C7SA 3QCTH 4V1DE 3P9LA 1MHHB 5TJWK 1MH5B 3HG1B 1XF2A 4JY4A 4GRWB 2YMXH 3OKLB 5E6ZA 3MBEC 4LHUG 1OHQA 1RZ7L 2DQGL 4M7JL 3MSPA 1A7OL 1CI5A 1YEIH 2DJSA 2XN9B 4TNWF 5H8DA 1MI5B 2ZSWB 4DOHB 5A43C 1LO5B 1GGIL 3RVUC 2XN9A 4X9GA 1FN4A 4FABH 5LQBH 3QXVA 3B3IB 1IGIL 5C6TL 1MCLA 4QRPD 1ORQA 1AP2B 4UIMA 2DM3A 1RULH 4NP4H 4D0CA 2A6KA 1AGEA 3NA9H 3KPRE 3WXVH 3B9KC 3TPKA 3MLVL 3N1MC 2BVYA 1IC5L 2JF1A 3ZKNC 3WO3B 2XKNB 3O6KL 5LCVH 5F7NC 1NL0H 5E1AB 4Q6IA 3HE7A 5E0QA 2OYPA 3S5LA 3O2WL 2O5XH 2LU4A 1T4KB 4JLRA 3GSWA 4PP1C 2VDLH 5ITFB 2H9GA 3VI3F 4QRRB 5E9DB 3TBWA 5HI5C 4YC2C 5IB3B 4AEHL 2DI8A 1FYTA 3DYMA 3RUGE 1BD2D 2QR0A 5BW7C 2HP4A 5I18L 3FQRB 2H45A 4NN5B 3RIAK 3O6ML 5HHMD 2A2QT 1N6VA 3ILQD 5DRWA 1BWMA 2BNUA 4NHCH 1EHLL 1YNKL 3NZ8A 5D70H 3DHJA 2NY7H 2EYRA 4PY8I 1DQMH 1GOFA 2NY2D 5J8OA 2VABA 1EVUA 2BSRA 3WFEH 3V8OA 4Y5YC 2ZUQC 1XGQA 5IGXH 3ZTJH 1WZ1L 1MCSA 3KWWB 3GJEA 4H20H 3VGDA 2DIBA 1N6QH 1DE4A 4WWKB 4HUKB 5HPMA 1AHWB 1U8OA 4H0GA 4MQ7B 1YC7A 1UB6A 2HVKA 1JFQL 3O11B 2YD8A 43CAB 2CR3A 4X6DE 5HHNB 2DKMA 3H42H 2DQFA 3F6LA 5CP3H 5JMOC 1G84A 2YD2A 3D3VD 1V7ML 1C1EL 2XZZA 3W0WD 4Z0BL 4I3SH 1JUFB 4U0RB 4HLZG 3H0TA 4BZ2L 4RAHA 3NH7L 1CICA 2A83B 4L8DA 4ZTPH 4LKCB 3AS2A 1OTTD 4PJXF 5ILTL 4M7LT 5HHOA 2Z31A 1A7NL 3VRLE 1CDYA 3RPIB 3A67L 4YC2B 4HX1B 5IW1B 5I8CB 3GBML 3J8F7 3C8DA 3MMEA 4WW2B 3PWVA 3VG0L 2DIAA 3FAWA 5JOEA 3N9GL 1E6JL 3H8NA 3T0ED 3KPQB 2EYRB 3GSUA 3O6LL 5IBTL 2OL3A 2VQTA 3TO2A 1RHHB 2A1WH 2JJSA 3DROA 1S7XB 3B8YA 2QKIB 1S7XA 1FORL 4M1CD 3ARDA 1XGYH 3KLAB 5FCUH 1MOEA 1FIEA 1BREA 2BP3A 5C3LD 3MJ9H 1S3KH 4OUUA 3CSYA 2D0GA 4XP4L 1RUPH 3EYVB 2I26N 1DEDA 5AWNL 1UVQB 2O5XL 4PJHF 4XVSH 3V9FA 4P5MB 5JHDB 5B39A 4Z0XB 5EUOF 4P5MA 4QHKJ 1MCBA 3ZZ1A 4N1EA 3T0VA 1DCLA 3VRIB 4S1QL 4O2EA 3O3DA 4YXHH 3MRFA 4LASH 4L3EB 5F7MC 5C0FB 5JW3L 3SCMC 1HCFX 4G6KH 3ARBC 1AGCB 2A6DB 3O6KH 1W0VB 4X9IA 4Y1AD 1HEZB 1YN6A 2UZXB 3HZKB 1CFTA 1GZPA 3QFJB 3DURB 5TFSH 2AQ1A 1XAUA 3F12B 3MRLA 1CICD 2FECL 4O02L 5EZOL 1H5BC 5F1NA 2BCKA 5D96C 3GHBH 5E6IC 3NBNA 2XRAL 3SDAB 4X4YB 4WTWA 2VXTL 3HPLB 5DRZA 3X13B 1R3KA 2LV4A 3BXNA 1D5ZA 3P77B 3CCHA 4PJ7F 4I0PC 2PYFB 3T8XB 1I9JL 4MXQD 3ULVL 4KHXL 3QCUL 4QEGA 5ALBH 1A3LH 3QEHB 3UPCA 3OKDA 5C7XH 5GGTH 4NWTL 2P46B 2WM0A 2YRZA 4NO0B 1Q0YH 4IOFD 4WUKL 3V4UH 4MD0A 3CSYB 1M7IA 1QBLH 3NA9L 4PJ5A 4OCNC 3QI9C 4KZEL 3VXUD 4MNGB 1BWWA 1S7RA 5K9OB 1EJOH 1BZ7A 3VGHA 1QRNB 4U1MB 1WWAX 2HLAA 3FFCA 1TFHA 5DK0A 1T1XA 1F4HA 1IKNC 5J9PA 2WUBH 1KCRH 2Z4QB 4O2FB 2GW5A 1EXUB 1JI1A 4HWBA 5HGBA 1FG2B 4CRPA 3BPCB 3BZDA 3SCMB 1JWMA 4ETQA 3GNML 4D0DA 4R3SA 1KACB 1ZVSA 4YFDB 3V0VB 4J2XA 1WBYA 3FB6A 1BOGB 3IFNL 4AZ8A 1IT9L 1XIWA 3GKZA 3MRKA 4TVPE 4KHTL 5FGRA 4Y7MA 3LDBC 3R1GH 1OL0A 2V5YA 4P4RB 4G6JH 4MB3A 4UQ3A 1J18A 3ZE0F 5EUKA 5KTEH 5IG7A 4XWOD 1YNTB 2A9ML 3S3JA 4Y19D 2X10A 4JJHA 2LABA 5IG7B 4WO4B 2KH2B 2HG5A 1A7RL 3W2DH 2E27H 1T04B 2HFGH 4PRPD 5IV2A 4M7KH 3MFFA 3OKNA 4EDXA 3LKOB 1E4XI 1FFPB 1N7MH 4P57A 2F53D 5JPNB 5KG9B 2AXFA 4M7ZC 2K7QA 3IDMA 4M9OA 5F21B 5TDNB 3RVVD 1ZLWH 4PFEA 4XVUD 1RUKL 5GXBB 4X80H 4Y1AE 5A16A 2C3GA 3S35H 4JJ5A 3KLSA 1U8LB 2NY0D 3MGTB 3EDKA 1VACA 3LSOB 1QFUL 4PJIF 3DARA 3ZE2E 4OCYL 3L3DB 4WEBH 1ND0A 4GAYB 2F53A 1VACB 5IBLC 4OCXH 1WBYB 1XFPA 2KZWA 3FB6B 1CL7L 5H37G 4S10A 3FCTB 4YDIL 4J23A 5J3HC 2DI7A 3GSVA 3SDDA 2XWTB 4Y5XA 1JGLL 2Y07H 5D7IA 3GRWL 5EOCH 3VXSD 5C09A 4LHJB 4QOKA 4JDZB 2B0SH 3JV4B 2DYPD 1EHNA 4MHHG 1JRHI 4NO3A 3WFDH 4Z7NF 3H2WA 3RUGF 3KR3L 4NIKB 4H1LG 2VLRE 4HUMB 4RGOL 4J7RA 3U0TB 4B41A 2XQBH 5JDJA 5IMLA 2HN7B 2E6QA 1NCDH 3TBVA 3E6HB 1RU9H 1U3HC 2QHLA 3SQOH 1BQLL 1S7SB 2Z35A 3H6JA 1DBJH 4S1SL 5BZDB 5TDNA 1IC4H 2R2HB 4HK3N 3BIBX 2E9BA 2ICEA 1AFVL 3DX9B 2VLJB 4U1IA 4LSRL 3L9RA 2H6PA 4OCRL 4OLUL 4G42B 1QBLL 1LD9A 1ZTXH 5I1DB 1XF5A 5F6IC 4PRHA 3CUPB 2Y23A 2ZUUA 5ESQB 4M61B 1FHGA 4U49A 1HHHA 1TVBA 3WLBA 2NY3B 1V7NH 4Z78B 4OCXL 5DI8B 4LVEA 1G0DA 4MWFB 2JCCA 2AK4B 2ICWB 5BOZG 4D9LH 5B38G 2EIEA 1D7FA 5DRNA 1RVFL 1F00I 1JTTA 1NCNA 3QG7H 5GSVA 5HHOE 4CN1A 5DHXB 5DQJB 5TE6H 1NEZB 1YEFH 5F96L 1CK0H 4Z7OF 3VFSA 5DMIL 5I1IL 3MNZA 5BZWB 3D2UD 2X7LA 1MLBA 1WJ3A 2BVPA 3FQUA 2L0DA 4P9ML 4KXZI 3DXAA 4PS4L 4LASL 4LPVA 5F88B 2Z0BA 4TYUA 1CBVH 3DYOA 5FXCH 1NFIA 1H15A 1OAYH 1J86A 4FQLL 3ROLB 4J3UA 4X6DF 1FJ1B 4XP4H 4X6CA 3SBWA 2K7PA 1GPOH 3EOBA 3SJVB 2FO4B 2R0KH 2YBRB 2FGZA 1VB9A 3O4LA 3TNMA 2G5BB 1IM3B 2ADFL 3QIWC 4PJFE 1XF3B 4HK3J 4ODHL 5CWSB 3P2TA 3B5HA 3JWNC 1LK2B 4HFWA 4LVNC 5E2UL 4ONGL 2ADGA 3BD3A 3SDXA 3PIQA 1G7IB 4JFQA 4CU7A 1IAOA 3EAKA 1F3DH 4OZGE 1HSAB 5LGKA 5L2JB 3S3PA 4YFEA 2VISB 1C12B 3AS1A 4NZJA 5B4MC 4X98A 1GCFA 1VFOA 1FN4B 4LQFH 4U1NA 4MXWL 1F4WL 1T1YB 1TPXB 4HHAB 3FOLB 4KUZL 4X7TB 2EC8A 4AQ1B 1ZGLA 1RZFL 3EDDA 3O45B 4KK6C 3DXAB 2IBZX 3OF6D 1MWAB 4U1LA 3RQ3A 4POUB 3TVMA 2PO6D 5L7XH 2AXGB 2P49B 1RUQH 1BM3L 2I60H 1I4FB 3INUH 5GGTL 2F8XC 1OAXH 1SYSB 3WN5C 2X2YA 3ULVH 4F9PC 5JO5A 3WYRA 2RJMA 5HDQH 3RL1B 3HG1E 1DFBH 3QEGH 1HILB 4O5LL 3C9NB 4WI6A 4S1QH 2Z8SA 3DX6A 2APVA 3DRQB 2EYTA 3O8XB 4JPIA 1XMWA 3T2OA 1CN4A 2NY6D 5CIPB 3QUZD 4LLVB 3TA3D 4OGAD 3PWPB 2C5DC 1SY6L 2R0WH 4GRLC 4Z7VB 5KVFL 3QXUA 5DEZA 2GAZB 4NZRL 1ZANH 3UTOA 4JQIH 4WUUD 3A6BH 4XMPL 3W5NA 3H9SA 4YFLI 3WHE0 2CK0L 4I8DA 1PQZB 3RY6C 5CEYA 3A6OA 3OR6B 3GKWH 4ZFOB 1HHJA 3AY4A 3C5ZB 4LLWA 4YDJA 3ZKQD 4DN3H 1MHCB 4G7YL 1HHJB 2H8PA 3LEXB 4XMPH 1XIWC 2CD0A 4YH6A 1ZXQA 3MBEB 3CAFA 3CU1A 2HMID 2Y5TB 5FB8B 5IVXB 2GIYA 5I15H 5D6CA 5ISZB 4C4KT 3TYFB 5E8OB 3D0VA 3EGSA 4FQXB 3PGDA 1MCQA 3P73A 1RK1B 1B4JL 2CK2A 3R8QA 3BZFB 1UXWA 2R2BB 4NYLB 5I17B 2OSLB 1IAMA 4JM2B 3IS0X 2R2BA 1WTGT 1BAFL 1NLBH 4MQXD 2WIIB 3R06A 3KJ6H 2FBJH 2NY4D 4PRAB 3SY0B 1FYTB 3S4SG 3R0MA 3CPLB 1V7MH 3VG0H 5D93B 1BAFH 5I18H 2ERJB 3EIFA 1RSFA 1UB5B 4RX4D 5JZ7C 5DSCB 1QO3A 3D25B 3BHBB 1KEGH 1C08B 4OFPA 1RZIB 1U93B 1S9YA 4UBDD 4J8RA 1HKLL 3RUGA 3BRDA 4TOYL 1MHEA 1HNFA 1VA9A 3O6FC 3QDMD 4G3YL 3TT3L 4QLRA 3RX7A 3IXAB 5J6HA 1OAZH 4PG2C 5CJQL 2R2EA 2CJUL 4UZGA 3FO1A 1KCLA 5D7JB 3ME0A 2J5LC 4KV5F 1FGNH 1FH5L 4GW5A 3VRJA 3CK0H 3ALPA 1OW0C 1BGXL 3JWOH 1QSEA 1VEMA 1KXTB 2VN4A 3QUKB 3EYOA 3RGVA 2QEJA 4P2RD 5D1QA 1J05A 1R5VB 4AIXA 2CH8A 3DVGB 3QT2A 3H9HA 5BS0D 4YBHA 1F4WH 3G5XB 5JPMA 4PREA 3KHQA 1S8DA 3SQOL 1Q1JH 4GKZA 3A0OA 4TUOA 3WE6B 2OZ4L 2V5RA 4C59B 2J6EH 1QNZH 4NGHL 5B3JE 3I2CL 3ZE2F 2LVEA 2B0SL 2X4RB 2EE3A 4KQ4H 3QJFA 3WFHA 1AO7E 4Q58C 4YQXH 4Y19A 1N64L 4OM0H 5IM7B 4LCCB 3WFHB 1EAPB 4CN4A 1RZ8A 1S9YB 4WEMB 4ZPTA 4LCWB 1MHEB 3VFGH 4LSTL 1I3RB 2J1KA 3MRGA 5IF0B 2AEIT 4IOIA 3D6GA 4ZFFB 4YZFF 3GIVA 1GHFH 4F7CB 4M43H 1WFUA 4X8JB 3U46A 5IESH 12E8L 1AE6H 1KCKA 4YAQB 2P5EA 4KROB 2IANB 5GRWA 1FVEA 1UXSA 3T2NH 2VUYA 4PGDB 3DBXA 1U8KA 5DHVA 2IANA 1S9VB 4XH2A 4PJ5B 4OFDA 4OBRA 3VFTB 2IPTL 2BRQA 4PJCE 3DRTA 4R7NA 3W39B 5CBAB 1RUQL 4IS6A 3LB6C 1F42A 2XICA 4O58L 4GW4B 5K9OA 1QQDB 5D7LD 5F6HI 2FL5B 3RIAF 4H0IA 2X4UA 5EOTA 3VXPB 4F7TB 2X4PA 3BFOA 1UCTA 1A7OH 4P2RA 3I6LD 3QO1A 4UV4H 2FHFA 4WY7H 3DURA 4JPKH 5JLZA 4RBPH 1XF4B 1NC4D 3QXAB 3MGAA 3C09B 3QUXC 4LQFL 2C1PB 2Q87A 1CLYH 4LCWA 4HUNB 1U91A 3B2VH 4Q97A 4H1LB 1I1RA 2BC4A 4CMMB 3PQYA 4GMSH 2MOVA 1WWCA 3RJDA 3I6GA 1NCCL 1WITA 3KR3H 3HPJB 1YNTA 4QXGH 3U0PA 5E5RB 1IKFL 4UQ3B 3HG1A 2YPLE 5GPRA 1A6VL 5AUMA 3FMGL 1J11A 3RTQB 4NQDD 3QWQB 3VI4F 2IH1B 4HH8A 3QCVL 1BZ9A 4Q9QH 3QIUC 5GRUH 1IM9A 3MTRA 1Q38A 1KTKE 1LE5A 1MFEH 1NCDL 1AKJB 1K2DB 2CKBL 2KL6A 3MREB 1ZT7B 4MAYA 5CJXC 1IEAA 2FX7L 4P49A 2CDEB 1CXIA 4OLZL 1I3VA 2EIDA 4PY7A 5GZOD 1ZLSH 3SKNA 5IT2L 3IETB 5EN2B 5DA4A 3B2UD 3S36L 5DJZB 4RMQA 2D7TL 4GAFB 4LKXB 1UCBL 1WBZB 3KYNA 2ARJQ 1NKOA 3S37L 4KZDH 2BNQB 5E1AA 1CWVA 1UADC 3RWEB 3K2UH 4XWOC 4L3CA 5EZIL 1MCEA 2X4TA 1NC2B 4LVHB 3DMMB 3K8LA 2R4SH 5L2KB 1JHLH 1MIML 1M4KA 4JHZA 3DUSB 4U0QB 4NNXB 4U1JB 1NAMA 3HB3C 4HW6A 5KSBF 4Y5YA 5JIIA 4RGNB 3L3KA 4PJHE 3D0LA 2MNUA 4UT7H 2RGSA 3RHWF 5A2LH 2QQKL 5C70A 2AP2A 3U0TA 4Y2OA 2PW1B 3QXDB 1RIHH 4CVXA 2GTWB 4KDWA 3I50H 5CEYB 1E4KA 4XPFH 2QQQA 3S5LG 5CUSL 4XNYH 4Z9KB 4LHUD 5BZDA 1G6RH 3B9KD 4LLDB 4S1RH 5DJDA 1Q72H 4P2OB 4IRJB 1EFQA 4MZ3A 4U1HB 5FEBA 1HQRB 3MOBH 4MNHA 5D1XB 5D7IF 4FS0A 4DKFL 1J8KA 3QFDA 4APQB 1HK6A 3QXWA 3OV6A 4NC2B 2XYCA 4TNVK 3UXFA 4IHOB 1T20A 1KB5L 1OP3K 1UA6H 4NKDB 4LSQL 6FABH 4IHOA 4JEGB 3E6FB 1B0GA 3BSZL 4R2GD 4O58H 1IAIH 2J4WH 5ESQA 2R8SL 1JZ3A 3L5WB 5FGBA 4D8PA 4YDIH 4GBXB 4H25B 3L5HA 1U3HD 4TTGA 1HH6B 5FDWA 2F53E 2NW2B 5ADOL 1A4JA 1KCRL 3C87A 4PRPE 3PABA 2DJUA 4OBSA 4WCYL 4HIXH 4L4VE 1AD0A 4Z7UA 2CMRH 4M43L 5EA0H 3QA3B 4KV5E 2HTLD 4ODVL 5EUOA 3WN5A 5FGBC 4KHTH 1U92B 1A9BA 2C26A 3N1PC 3RDTD 4F15B 1EK3A 3M8OL 5HHOD 5CSZA 4U1IB 1E27B 4ZUSB 1UCBH 1FJ1A 1DDHB 1T0NB 4PJ8A 1Z6JT 2IGFH 4ODWA 1R5WA 4FOMA 2E27L 3GMLB 4R0LA 3X3FL 2EIZB 4DK6A 1K4DA 3QWOA 1E4XL 3QRGH 4L4JA 1H3PL 4XP6H 3RZCA 4KH2A 3MOQA 2NXZD 1J1PH 2PNDA 1JF1B 3VWKC 4LCUB 3TNMB 4K3DH 3LS5L 4I77L 4LSSL 2KUTA 2GJ6B 4PBXA 3VRIA 2FEEI 1O0VA 5IMOB 2HFEA 3F8UB 3U0WH 4MA7H 5HHVL 1OLZA 3RWCA 1AC0A 2X1XR 3EOTL 1MWAH 3RDTA 3OB0K 5EFIA 4ELMF 2ICCA 2OK0L 1TCMA 4XBGA 1N3NA 5EU4B 1XR8A 3SDXB 5KZCB 3QIUD 2EH7H 3UTPD 2CRIA 3LEYL 3V4UL 3DUUA 3BWAB 1NCCH 1NDGB 2IBZY 4C4KO 1IGTB 4HKXA 2A6JB 3KS0H 1FRGL 3P0YL 2BHUA 4L1DA 4X98B 1HYRC 2IMNA 1WCBA 4WI9A 1CXKA 1QEWA 2A6KB 3RWDA 3VFSB 2R56H 4LIQE 4WGVB 2XTJB 3GSNB 1QP1A 4L8SC 4ZOBA 2VC2H 1DEEB 5DURD 1MCNA 2AW2A 1EJOL 3AM8A 2DN7A 4ENED 4Q9QL 3V6OE 1X5FA 5JW4Q 3LIZL 4M8QB 5FOBB 2PYFA 3FQNB 3EUUA 1MCCA 2V5TA 3DECA 4JFPB 1OB1A 1SJEB 3DTXB 1T0MB 5F1KC 4O51A 1SJEA 3DTXA 1NL0L 4DAGH 4OKVA 3O41A 1FYTE 4HKBB 1A6ZB 1E0OB 3MRIB 1C5BH 1MRCH 3MLVH 3HC0A 2GTZB 4HJ0D 1WBXA 1CGYA 4I4WA 3LPFA 5FM4A 5FDYA 1MJ7L 4GRMA 1U8JB 3T0EA 3U9UA 1F97A 2BOCA 1LK2A 3LKNB 5IQ9A 1FNSL 3BP6B 1MF2L 4UIKH 1QSFD 2NCMA 3ARED 3VXRE 4JY4B 4KTDL 3QQ4A 3VFRA 5FF6B 1KNOA 4P5TA 1FAIH 3MXVL 4RMSA 4ZFOL 3TESA 4EIZC 3ZE0E 4WWKC 2BDNH 2E7HA 1WZLA 1G7PA 4MS8C 5CP7B 5DTFB 3T0DA 1KPVB 2Y6SD 1H9VA 4HKXB 2A6JA 3QUZC 4KK8D 4R97C 3BMVA 5EORH 1F6AA 1ZT1B 3GJEB 4ALAH 2BJMH 5HYJD 3KPRA 1OOAA 1LMKA 3BJ91 3PQYB 1AXTH 3H42L 4JFEA 3BH9A 4J4PC 5E00B 3BIKA 2VR4A 5HHNA 1MCFA 2AXJA 1YEEL 1R3HB 5GISH 4MQXC 4JRYD 1NCAL 4HBCH 5E5UB 4ONOA 1IAII 4Q6IB 1QPXA 3L5XL 1RUPL 4OKVB 5GRZA 1JGDB 4YDKH 5FHAH 4PLKD 4DJMA 2HG5B 4ZD3H 4HMEA 3SN6N 2DQUH 3OGOE 3RL1A 1IRAY 3WNKA 2J3SA 3OGCA 5T1MA 3P4MA 1CIDA 2R69L 1N0XL 4YDKL 3T0BA 2V6HA 4HXAL 1EVTC 1E4KC 2ZSVB 4KRLB 4BA8A 4PTUB 4GG6F 4Z0BH 4Z95L 5LCVL 2EDTA 4NQDE 2VLMD 3RX5A 1KNOB 2VO5A 4M8VA 1XZ0B 4HXAH 4HDIA 5D2LA 2P5WA 2QBWA 1BFOB 5ELIA 2EDQA 5D2LB 2FB4L 3N9GH 4KJYB 3C2SA 3EJYC 4N0FA 3I6KB 4ETYA 5FO8B 5FUCE 1N8ZB 1X7QA 4Y4FC 3SBWC 4R90H 1UEMA 1AQDB 4XPHH 2H3NB 5EZJB 3LMJH 1AHWA 1U8OB 1FDLL 4M5YH 2EEDA 3IDYC 4OUUB 3VCLB 1OAQH 1I8IA 4G8EB 1Z2KA 1OAXL 1NGPL 3E3QC 4M1DL 2G9HB 1CGXA 2DQFB 2OQJB 3RGVB 4PP1D 4NQSB 2I07B 2D2OA 3RIFK 1UC6A 5AEAA 4XCNB 3G6JA 4L5FH 4HF5L 5CJ8A 2MCG1 2W91A 3GI9H 5IHBA 1X4XA 4ZUWB 4JN2B 3PWJB 2JELL 1OT1A 4JDTH 3C60B 4M6OL 5HI3C 1KYOJ 1H3XA 1W72A 1ZHLB 4OF0A 2BY1A 4PJHA 3G5ZA 5HHQA 3F7RA 3V6OC 1IGCL 5I16A 2Q76B 1BFVL 4WHTB 3MRLB 5JDSB 1G7QA 3QCTL 1OSZA 5BMFH 3KDMB 3MODL 2UZIH 2K3TA 3S34H 4JO2L 2FSEA 4D0BA 5SWZE 3OKOA 1EAPA 4WFFD 5DYOB 4QRUA 2L4OA 2EDYA 3I6KA 1R3KB 3CLFH 4QT5A 1HHGA 4JFFB 1JYNA 3S88H 3VFMB 1FPTH 3FZUC 3UPRA 4MD5B 3FQWB 1FVEB 1UXSB 2H3NA 2OK0H 3FHAA 3VD4A 4IBLT 3IXTB 3LZFL 4F7CA 1TTGA 5KVFH 4P0DA 4BQ8A 2C7UA 1NEUA 4MNQE 4OJFL 2YD6A 3ARGC 4TQEH 4FQLH 5KVGL 1T2QL 3HS0A 3O4OC 3LHPL 3DRTB 4PG2A 2IWGA 3P4NA 4R7NB 4X83A 4DKEL 1RZKC 5DD5H 5CZVH 4UAOC 4O00A 2YMXL 1G9ML 1RFDH 3VMNA 4DUVA 1BEYH 1BVLA 2EDLA 4FFZH 1L7IH 3QI9A 4O2EB 4Y16B 5KN5B 3MLTA 4ZUWA 1T1XB 4NQEA 3CH1B 3UTQA 1A9EB 4C58B 1KJMA 4NSKA 4JFOB 1I1YA 2QQLL 1J8HE 4QO1A 3K4ZA 5EPMB 4EKXA 4OLUH 1G7JA 1TENA 4XC3H 3BRGC 1K85A 1KB9K 4PBWD 5T5NG 3QUYD 4OIAA 1N2RA 2H32H 2APTA 3P30L 4FQ2H 5FGSA 2BC4B 4CMMA 3GSRB 2P1YA 4XXDB 1T1WB 1TZHA 5I1EL 1R0AL 1QRND 2GY7B 5D7KD 2F54B 3IU4L 2YPKA 3Q48A 5IQ7H 3VI3E 3HPJA 1EHXA 3WUWG 3T0WA 5FKPA 2WQ8A 1CE6B 4FMKA 1GIGH 4MD4A 4JZNB 3VDCA 3PGCB 1S9VA 4XH2B 1NFKA 5EU4A 4MD4B 1RJYB 4PJEF 1AGDA 1A4KA 4FTVB 2AXFB 1EJ6A 2V2WB 5GIRA 35C8L 2CIIB 2R69H 2C1OA 1DBJL 1ORQB 5IVNA 2VC2L 3GB7A 4I77H 4OV6F 3MV7E 3ARGA 2VZTA 3NFPA 4K8RD 1NGQH 4NQCB 1U8HB 1UZ6E 3EYFA 5DUPL 5JOFA 3ZTNL 2BNQA 4P4KB 2Z92A 5EU3A 5E94A 4JFPA 4N68A 2BXZA 5E56A 3F12A 2BSSA 4KWUA 4L4TB 4PRPB 1BQHA 5D7LE 3S5LB 1A2YA 1XGUB 3WEXB 5HPOA 1ZVSB 2YD1A 5GGSB 3IKCB 1KIQB 1MCKA 5K93A 3I3EA 2CSPA 5DVKA 1VERA 3BE1H 2BRRL 3EDJA 1JI2A 5F7WC 2AJXH 5DR5L 3TC9A 1CIUA 2BSED 2CLZB 4Y5VB 3L3KB 5H35B 3HNVH 3ARTA 1D6EB 4MVBC 3UROR 2YWYA 3QXDA 3D18A 2DBLH 1D6EA 2O93L 3HE7D 4EUPH 4X7FC 2GKIA 5JNYB 4WI3A 1OY3B 3FL7A 2YKLH 2BVUA 1OQOA 5DMIH 5I1IH 3MLUL 3V4PH 3MREA 1VGKA 4J3WA 2JKXA 5DQ9B 2ZKHH 3ECBA 3KXFE 1HKFA 3NZHL 1KB5H 3BMWA 1NJ9B 1ZS8A 3BH8A 3BKCL 5DJZA 2ED8A 2DYPB 4QOKD 1JZ2A 1UB6B 2HVKB 2Q8BH 4UNTA 2EDJA 4DTGH 5J1TC 5FK9A 1HE7A 3D9AH 3GI8H 1NGQL 4OGZA 4XRCA 1P84J 4ORZC 4XP5L 1MNUL 4NO5B 2NX5E 4U6TA 1N59B 3Q6GL 2EE2A 3QNZA 4K07A 3WIIH 5I1AB 4PTTA 2B2XL 2BHZA 4TSBH 1NH6A 3D2UA 3RBGA 4OTXH 1MUJB 1JNLH 3FFDA 2OP4H 4RQQB 3PP4L 1CLCA 4FG6D 4OZGF 4EI5C 1FZMA 1N4XH 3ILPA 3X14A 5ICXA 2YA2A 3WIHH 4LEXL 4KY1L 2HRPL 3BOVA 3BKYL 3QUYA 4K9EC 3ZSSA 4AIOA 1B4RA 5FYJL 2VDRH 3WUZA 1C08A 1MFEL 3IRPX 2RB8A 4ZS7H 2GTWA 3HC3L 3SKJL 4C57C 3IDGB 5IHUL 4MSWA 2GSIA 1NSNL 4IOFC 1HXMB 4L8CA 1A6UH 3ECBB 1NFIB 1HQ4A 2AK4D 4AQOA 4KZEH 1AIFB 1CXEA 5B8CB 4MNHB 5D1XA 4NFDA 3OSKA 4Z7UF 2HT3C 1NKRA 1V3KA 3BUTA 4BSWA 1IM9D 4YDLC 1QFWH 1UG9A 2X5PA 2DLFH 4HT1H 3QCUH 1EERB 4XAKE 2NX5A 2EKSB 4TULL 1EIBA 4P5TC 1LEKB 3SE9H 4HWZA 1A7QH 2DDQL 2A9NL 5F71A 1W72H 4M61A 3BP4B 3FT4A 3ZL4L 4PRIA 5I74B 2X4NA 1G1YA 2ZNWA 4QTHA 1J88A 3RU8H 5F9AC 5MI0B 5FYJD 4XBGB 2AK4A 1T03L 5EG6C 4G6AC 4NOBA 3SE8H 1C16B 2Q6WA 4C83B 1CF8H 4JG1L 3DGCR 1U3JA 1CICC 2FEDD 4KGLA 4RGNE 1QEWB 5D1ZD 1LDPH 2Y06L 5JOPE 1WCQA 1E4WH 4LLQA 5CHNA 1RZ8B 1HHIB 2UY7A 2OS7A 2RR3A 3SDDD 1BEYL 2CR6A 4HUVB 1TETL 4W6YB 2BFVH 4X4YA 4OZFG 2DICA 2DWDA 1X5YA 3GNMH 3V5DA 1MREH 2UZIL 2XACC 3CX2A 4LARH 1P53A 4GAJL 3HZMA 1XCTA 3ZTNH 3QUZA 4K23H 4OJFH 2BK8A 1J12A 4I5BA 1AXSA 3LKRB 3TLRA 4G6JL 43C9A 4UTAL 3KLDA 4MHHI 3S36X 3JV0A 3K8KA 4LAQL 1IQDA 2G75A 3QDMA 4LGSB 2WBJB 1ZK9A 3RY5A 1RPQA 3KNBA 3N1QC 1CQKA 2QQNL 4J3TA 4MWFA 5IMOA 2IFFH 5EIQA 2EO9A 4OLEA 2VLRD 2C3WA 3M17A 4OFVA 2MHAB 4P5TB 3WDJA 2J6EL 3GMMA 4I0CC 5HGDB 5C0AB 2WUBL 2X44D 5IP4A 1VGEH 4MNQA 5BW7A 2X09A 1F2QA 4IMKA 2IPUK 3PV6A 1CT8B 2CJUH 5CEXB 4PB9L 3RNQA 3DX7A 3RA7L 1MLCB 2XZAH 4LFHD 2WW8A 3V7AG 4BQBA 2VLLB 4NRYB 4UIMB 2XPGA 3QHTC 3REWB 4PJEE 4N9GB 4BSVB 1MQ8A 1H3UA 4KFZC 1Q9WA 3PWPD 2NY7L 2XY1A 3ARVA 3I6GB 3T8XA 2AJVL 1KOAA 2OI9B 1H5BA 4U6XA 1MRFL 4Q74A 5FKPB 4MD0B 3UYRH 1QKZH 43C9B 3Q0HA 5GS0H 2KQMA 4ZNCD 1RFDL 2XRAH 4QRRE 2X1QA 3MV01 2V2WA 2VDKH 1I7TB 1UJ3A 5GS3A 1BZQK 1ZA6B 1UM6L 1YJDC 1KJ2A 3ZYZA 3IDJB 2W65B 2WBKA 4FQXD 2PTUA 1FL6B 2Z4QA 4O2FA 3RL2B 2FBJL 1R24A 4Z8FL 5IB4A 1R5IB 2NXYB 1I1FA 3D39A 3THML 4PRPA 2MSPA 2W9DH 5C71A 4XPTH 2EECA 2OR9H 1BBJA 3B2VL 4I0PA 3AREA 5SWZB 4GT7A 4R0LC 3G9AB 5D7LA 1JIBA 3EO0A 2QLVB 3D69B 4ZTOH 5HHME 2R9HC 1I9IL 4M48L 1RURH 2UWEE 3SGKA 1MCOL 2YD9A 4JFDA 3IJSA 1XGYL 3MCG1 5CJXA 3CSGA 4J6RH 2I27N 3C9NA 4KI5C 5C0IA 5AAWA 1JZ8A 4S11A 1KULA 1MJ7H 1KTDB 5HHPB 4OT1L 5GGQL 3MZGB 3DVIA 2RCSH 1PG7H 5FM5O 4M6ML 1II4E 2XKSA 1XIWD 2R2HA 3LB6D 1P7QB 4AEIL 5E08L 1FAIL 3MXVH 2IANE 2NY5C 2F15A 3BZ4A 5HDBE 1EGJH 1PSKL 1I7ZA 3FRPA 1OAUL 3FO9B 3H9SB 4NM8L 2ORBH 5AYUH 5CGYD 1GHFL 1FNEA 2NW3A 4XPAL 5C0DA 1J5OL 3O3BA 4O5LH 3FQTA 5B21A 3RNKB 1INEH 2QKIA 6CGTA 1WWWX 3EYQD 4MQ7A 4DQOH 4K8RH 4H8WL 4DN4H 2HTKC 4U6YA 3MX0A 4OIIH 3EGSB 4FQXA 3RJQB 3KPNB 4ELKA 4EN3D 5DDHA 1OGAA 5ENWB 4NZRH 1JCKA 1YJDL 5DRNB 4E9LA 2ZUQB 1FNGB 4V1DD 1OGAB 2E9WA 4PPTA 5D1QB 5DK2B 3MFGB 5IMMB 3BO8B 2IAMD 2WWMC 1YC8A 5TE7L 1UM5L 3OKEA 1SBBA 5FO9A 2BVOB 2DQDL 1OP5H 2CDFB 3G6JB 2BVOA 5IB1A 2YD7A 3ESUF 2E7LC 2BFVL 3P0VH 4LRIA 2YZ8A 4JFED 4YJZL 3W81A 2OTWA 1NANI 1RV6X 3O2WH 4F7PB 2A74B 4FRWA 2IAND 4FQXC 3NPZB 3V52H 1L7TL 3UTSB 1AY1H 1ZSDA 4AM0B 3EOYG 4OCLC 3QXAA 3SE8L 1SY6A 4GXUN 3WXVL 1KLGB 1R3IH 4KMLB 4XNUH 3IGAB 1ES0B 1DQDH 5INCB 2VDKL 1UZ8A 2JJUA 4OV5B 3V5KA 5MERA 2Y5EA 5ID0A 3QI9D 5DRZB 2OM5A 2AS5M 1QFWI 1BMGA 4XVTH 5AYUL 1EO8L 1JGVH 3FT4B 1ACYL 5EH1A 5INDA 3ULVC 3FHQA 2K9UA 3IKKA 4GSDH 3G5YB 4GQ9H 3RWIB 2EDDA 3S6CA 5IEHA 3QUKA 2OL3H 4WCYH 4QF1A 1XGRB 1BJ8A 3OMZA 4JRXB 3V4VL 2Y7QA 4EUPA 1DN2A 1VDGA 4Z0XA 4KJQC 4NM4H 5L7XL 4G6ML 3G5XA 1S5HA 5DD6B 1LEIA 1FLRL 1JN6B 5E6ID 4FXLA 2CUIA 3SOBL 3PWLA 1F58H 2DAVA 4RZCA 4NQCA 4QXTB 1EUUA 5MI0C 1TQCC 3OB0H 1QLRB 3DIFB 5F88A 3W0WE 3ARGB 4M6NH 2Y36L 5IROC 2GUOA 4KI5E 1I9IH 4DUWA 2UZYB 4EIGB 3S37X 1KC5H 3BEVB 1VGEL 5C0BA 2XXCB 3ZSTA 5FYLD 1NBVL 4LLUA 4KRMB 4P2QA 1CFVH 4HH9B 4YIQA 1SJHB 4A6YH 1GVIA 2OR9L 1IM3A 2WLZA 2YOCA 4HJ0C 3VXTB 4L29B 1P2CB 3S96A 3O9WD 2B4CH 1K8IB 4Y4HC 3QEQA 3DRQA 4OGAC 4BH7A 5E2VL 3PP4H 5ESAB 4KKCD 4LSRH 5GGRA 3S35X 5A40E 1JGLH 2Y07L 5GGVL 5H35A 1NFDA 3UO1H 2B2XH 3WS6C 3SDAC 1AQKL 4J1UA 4EXPX 3MJ7B 2APXA 4CVZB 4NCC1 1WFOA 3GJFB 4WNQB 3FN9A 2H2SC 1KPVA 1K5NB 1G1CA 2NX5D 1QRNA 4F3FB 1GOHA 2XPGB 1BQSA 1QKZL 2NY5H 1MFDH 2DBJA 1TQBB 4HT1L 2VZ3A 5TE6L 1Q0XL 3X12B 4HKJB 1QSFA 3GRWH 1Q9LA 5I8EB 1UH4A 2BERA 3GJFK 4MNQD 5EOCJ 1B2WH 3E6FA 3RU8L 1AFVH 1MAJA 1YQVH 4MAUL 5CSBA 3ULSA 4PTTB 1DQJB 2XI9A 1JHLL 2JIXD 4ODTH 3BP5A 4ONHA 3NIFE 4S1SH 4HUWA 3L3HA 1UJ3C 4IMKC 3CFKB 4YPGB 2AKRB 1HN1A 1T2XA 1ZT4A 3AFLA 3DV6B 1GGBL 3G6DL 3RPIA 4P23D 2X4SB 2BNUB 2GFBB 2HJKB 4QHMB 4EDXB 5CLTA 5CCKL 4LDOB 5E2UH 1F90H 3UJJL 5F1IB 4LSVH 1NGWB 3CFBB 3VD7A 1IEAB 4HPYH 2XA8L 4W81A 4XBPA 3ZDZF 1WZKA 3QEUA 1XGQB 3O2DH 3BKML 1JNJA 3MBEA 1BFTA 3VXNA 4CMHB 4JKPL 3IFOA 1L0YA 2QADB 2NY1B 4N5EC 4U31A 3L9RB 43CAA 3FKUS 1TJHL 4XMKL 1BBDH 4R26H 3U1SL 1P4BL 3IAGC 4YR6B 2ATKB 5GZNC 2ITCB 1QPPA 4K94L 3SDCA 1RAMA 4YHZL 1D5MB 4FQJL 2I9LA 5J1AA 2EDOA 1A3LL 5C09E 2FYYA 3OB8A 4MJIE 5AD0A 2X4NB 5DFVC 2WIIA 3R06B 5MP6L 5E9DA 2VZSA 3WLBB 3Q6FA 4JG1H 3LQAH 3MJGX 4OLVH 3F7YA 1X6LA 2HKHH 1EA9C 4LPUA 2Z31B 4HKZB 1G9MH 2YSSB 1KB5B 4DGIH 1CZ8H 4DGVL 1YEKH 3BWAA 3UC0L 1KELL 2UWEA 4MJ6B 4S2SA 1JGVL 2AJUL 3F58H 5FM8A 1F4YL 2GK0B 1QA9A 3MRNB 4FQ2L 4R6UA 3FO9A 5BJTA 3QDGB 3FT2A 2C3VB 4UDTB 5I0DA 4XGZB 4JAMB 3OKOB 3UZEA 4XMLL 5E8DL 1B6DA 3GDBA 4TPRH 3Q5OA 4A2MA 3RY4A 2H26A 1N7ML 3JXAA 4BQ9A 5CAYB 1Z9LA 5HHXH 1S7TB 4MYWB 3VGEA 5KZCD 3ARUA 4AK1A 2QHRL 3QO0B 3QZWG 1KTRL 4PGDA 4ONFH 1NBVH 4ZSOA 4JO4H 4E5XA 4XVSL 2ITCA 1WEJH 1LDSA 1OARH 5FGCE 5DJ2A 1LP9F 5C2BL 4XPGH 1SM3L 1XR9A 1CDGA 4G5ZL 3DLQR 4N1HB 4HUUB 5IKCA 5HVFB 4AH2A 5KS9F 4POYA 3I3DA 1TQCB 3GBLA 3BYTA 1A14H 1CVSC 4Z7VE 3VFUB 4AIZA 1H3VA 3V4VH 2VITA 2ZOLA 4UB0L 4GS7B 5HSFA 1D5BB 4KRPB 3IU4H 4JFEE 1JVKA 2JJTC 4KDVA 1V5JA 5E4EB 1T2JA 1WCBB 3V6FA 5D8JL 2HT2C 5IEKB 3IAPA 3KPRB 1LNUB 5I1EH 2HFTA 3GMRB 5LGJB 2WUCL 5DMKA 4XVTL 5ILTH 3TN0B 5MERB 3V5KB 2JK5B 3H3PH 3P11H 3VGFA 3BN9D 1TIUA 4RFOH 1N5YL 2R1WA 1DQDL 3QUMH 1D5IH 3ABZA 5ISZE 1GIGL 4Q7DA 4LP5A 1Q0YL 1J0KA 1BVZA 1GSMA 1FORH 3EO1A 4U1SB 1CD1A 4HXBH 4HWBH 4M5ZL 3TBYB 5K9QI 5ECJE 2EXYD 3ULUD 4OZIB 2G60H 1G9NC 5ACMA 2QSVA 3HN3A 3T0EE 1L7IL 3QUYC 1NPUA 2CIKB 3I75B 3MRMA 1AI1H 3ISWA 3RWCB 4YBQD 3V0WL 2J88L 1F3JB 5KSVB 3L7EA 1J0JA 5CILL 1E6OL 2VAAB 3NCYS 4Z5RA 3SDXE 1EEYA 5C0NC 2VXSL 3VFRB 4Y2DC 2A73A 3SGEH 2DM2A 1VFAA 3QIBC 3Q3GB 4ZOCA 2AJXL 2HLFD 2XA3A 2L7UA 1A3RL 5HVHC 1RD6A 1BJMA 4XB7A 4DN4L 3ETBF 1W0WB 4YHNA 1DEEA 4Z7WF 3BKJL 5DRXA 3NTCL 3X11A 4UINH 3CZFB 5EBLB 3VU2A 4KQ4L 4WDIA 4MX7B 4NCDA 3D69A 4TN9A 1WT5C 4LGRB 5E95B 3P77A 1QNZL 1W8NA 1RJZA 1D6VL 1JWUB 3PGDB 4JPVL 4I2XB 4K3GA 2FHCA 1KC5L 2JB5L 4NKQB 4IRSD 1YUHA 4NO0A 2I25N 2BNRE 3O4LE 3DX8A 4URTB 2ZCLH 4FQQA 1UGNA 3V95A 2B8OT 4LQ1A 1MPAH 1NBQA 4LCIH 4X6CE 1OCWH 4PJGA 5BQ7B 2IPUG 2YEZB 3QJHB 4N0RA 1LWRA 4LPWA 4EN3A 1GGCH 4JQVC 4P2OA 3X12A 1WBZA 3KYNB 2PYEA 4BYHA 3E8UL 5EIVA 4AEHH 4KK8C 3ZMRA 1YN7A 2X4QB 1UWEL 4KJYA 4N0CD 4BZ1H 2N56A 5AAMA 5LJYH 4D9QD 5J6GB 5ICZB 2PCPB 4P59H 3F62A 1GGIH 3STLB 3VWKB 3TM6A 4D8PB 3NAAL 4ELKB 1KJ2H 1VKXA 2R1YB 4RDQG 2QQLH 4APQC 3B5TA 1TCRA 3EYOB 2NZIA 3PABB 4PLKC 3VWJB 2VL5B 1J8HD 4YGVA 4NQEE 2X4SA 2FCBA 1DUZA 4XAWL 1NCUA 2QSCL 4DZ8B 4HCRH 4HFUH 4DAGL 1PZ5A 5DFWH 1L9NA 3AS0A 4JZOA 4JKMA 3RAJL 1B4JH 2OTUB 3RVXD 4GO6B 2GCYB 4L8CB 4WFHD 3TPUB 1P7KA 2V17H 4OZHB 3WBDA 1VSCA 5CINH 5I16B 4AM0A 3D1MC 4WW2A 1UWGL 1MREL 4V1DA 4DFHA 3HAEA 2WWKT 2UVEA 3MLZH 4PRBA 4OV5A 2ATPB 3INUL 5ACLA 1D5MA 2EH7L 1S9XA 1XF3A 3HHRB 4JR9H 3L3OB 4LNVA 2APWA 2CUMA 1RK0A 2GJ6A 1XH3B 2R2CA 4HS3B 2VDLL 1VKXB 3WUWB 4Y1AA 4L4VA 1GAFL 2ADGB 4H5SA 2HJFA 4K23L 5DJ8B 1RJYA 5EB9A 2FJHA 1CR9L 4G7VH 2IG2H 1UQSA 5J11C 3DVGA 1DL7L 4MCZA 3GBNL 2ICWI 2V5MA 1MVFA 1MFBH 4MJIA 2V7NB 2QTEA 3TIEB 1C5DA 1M6OA 2DL2A 3RHWK 5GS1C 1UKQA 5E9DE 2WAHA 2HH0L 4NQXA 5DD1L 1OPGH 3GHEH 5ALCL 3M8OH 3HI6L 1T89C 3ES6B 1P6AB 2Z91B 5EOTB 3VXPA 5I8CA 1CGSH 5IW1A 4M8QA 3WHXB 1TJHH 4XMKH 4QHUB 4A2LA 1G7JB 1U9KA 1X5KA 1IGML 5JW4N 5EU6D 3DROB 2IALB 4X6FA 3LRGA 4LLYB 2DDQH 1A7QL 1BQLH 2LFGA 5HD8D 2GITA 1J1OL 1PKQB 2BOCB 2P5EB 3EFDL 3THMH 5CMAB 5EFIB 3JWDL 5ESAA 2HJFB 3WNMA 2B5IB 2BOBA 3KG5A 1Q9KA 5J89A 1TVDA 3C6LD 3CDFA 2R29H 5FO7B 6FABL 1ED3A 4UTBH 4X7SH 5EZLA 5LGHL 2ZCLL 4GQPH 4ZS7L 5C2BH 1P4LB 3MXWL 3AXLB 3DV4B 1MCWM 1EZVY 1T6VN 4EEEA 3SPVB 1TJGH 4BJLA 1BD2B 4L9LA 2EO1A 1KJMB 4NSKB 1ZHNB 5HYQB 5J12B 4GUPA 4YPJA 1AHWC 3GM8A 5I8KH 4LKXA 3O4OB 2VMFA 2FEDC 2ARJB 1KJVA 4XPFL 1NFDF 4M00A 1QFWL 5DEFA 3FONA 3P73B 2CXGA 4OF3A 1Q0XH 3LPGA 1SEBB 4R9HA 3MYJB 5I8KL 4OCRH 5FUZH 5T33L 3UX9B 1CDBA 3LS5H 1CL7H 4OLXH 8FABA 4HC1H 2ZUWA 1FZMB 2YPKB 4C54A 3W11D 2AJUH 3T65A 1YQVL 4X4XA 2PO6A 1JNNL 2DLEA 4RFEA 1QBML 2DTMH 3B9VA 4QRSA 3TH4T 3H3BC 4D9LL 4MA8H 1KFAH 4DGVH 3K80A 2VWEC 1UB5A 4XVJL 1GRWA 4O4YL 4G8IA 4M02A 1GL4B 3T0EC 3LQAL 4OLVL 5DMGC 5I1JL 4G9FE 2P5EE 1DLHA 5IIEB 5DHVH 4MSWB 2YKLL 3GEWB 4ZFZA 3GB7B 3FFCB 3MV9E 4ORGA 4F3FA 4YHML 4KVCL 1NMBL 3BW9B 4PJAA 4CKVX 1LILA 4GG6A 1QHPA 2PTVA 5E94B 1Q9LB 5C0CD 3IF1A 3OTTA 1EFXB 4P2RE 4TUKL 2UUDH 3LN5B 2YPVL 3WLWC 5EC2A 2D31A 4DTGL 1KG0A 3LV3B 3WEXA 1D9KA 3DVFA 1JPGB 3NCJL 4LARL 4JM2A 4RMWA 5IHLB 1A6AA 2OX5A 5DJAA 1QFWM 3UJTH 4KUCD 5DD3H 4JLRB 5GGRY 3BDXA 4H26A 2IQ9L 3JBG7 4Y4FB 5I19H 4PV9A 3CZJA 1UT9A 2ZKHL 1MHPL 2EIBA 2APFA 5B38B 5GZND 4G6FD 4ZPVB 5DJYA 5IFAH 2VDPL 5BQ7A 1QVOA 2YPLA 4JN2A 4S2SB 3CLEH 3CVIL 3O2VH 3VFOB 5IJVA 3EHBC 4P46B 4PJ8D 3KYMA 3RWJA 1BX2B 1QBMH 2DTML 3S97C 1D9KD 4KK5C 3GMPB 5BVJB 3I85A 3CFEA 1QA9B 1GAFH 4ERSH 1KTLA 4E41A 3GHBL 3KWWA 3WN5B 5F7UA 4PJXA 4K71B 1IQWH 3QQNA 9CGTA 3TO4C 4XNUL 3P9MA 2H8PB 4LSPH 4ZUUB 5CSZB 2OTPA 5F7HA 1G6VK 1M71A 3QFJD 2EH8H 2COQA 2C7UB 2MKLC 2W0PA 4RX4A 1BF8A 1TITA 4M3KB 2VZUA 4GSDL 25C8L 1ETZA 3SDDB 3CVHH 1X4YA 3PHQB 5I1GH 1OQXA 2XTLA 4L3EA 4NO2A 3F6IA 2NXYC 1PJ9A 3FQXB 4NNPH 1IL1A 3RAJH 3HNSL 2JCCB 3X3GH 1B9ZA 2FJGA 1EEZA 1P1ZA 1LQSR 1R3IL 3CH1A 1LO4H 4UT6L 1YEHL 3UAJD 3Q5TA 3ZHKA 4YX2L 2ZG2A 3MGOA 3QJFB 4U6VH 4CVUA 3VXUB 1IE5A 4WU7A 3GMPA 3BVNB 4ZAKB 3UJIL 2AJYH 3JWDC 4S0SD 1R3JB 2NY0C 4F57L 1CFVL 4Q0XL 4Q6IC 2VDOL 1YYML 5JHLH 5C07D 1HDMB 1AO7A 3QHZL 5C0AD 4PJCF 4TOYH 4Z7QE 3TIDA 4XVUC 4IIQB 2BSTB 4KDTC 4TUKH 4U0RC 5CJBA 5CEZL 1N26A 2VUOA 4NQVB 3BDYH 1SEQL 3RP1A 4XCCL 1QFPA 3AU1A 4W4OA 4DKDC 3NZHH 3VXSE 1WBXB 4DZBB 3CLFL 3FB7B 3PXJA 1G7MA 1EZVX 1A6TA 5GIRB 4N8VB 1FZKB 3L7EB 5JXAH 1HCVA 3KNBB 4NZTL 4RNRB 2RFXB 2EYSA 4MQTB 5EBMA 4BH8B 5HYFA 5ALBL 1OVZA 1FIGH 1OAQL 4YK4B 1VFAB 2FIKB 5C0JA 3EYFB 2Z91A 4ZNEE 1ERNA 4Y4HD 2V9QA 4EVNA 3LHPH 4DGYL 5JLZB 4MMZC 3RKPA 4L4TA 3VFPA 3GMOA 2FBOJ 3E3QE 5D7SL 3T3PF 1YPZE 3FRUA 4OCSH 4XNXH 5DMKB 3E8UH 4MXVE 1GH7A 4KAQL 2R29L 2M1KA 3EKCA 4LFHG 1QBBA 1U8PA 1FNAA 4ZAKC 4S0TD 1T3FB 5HHMB 4EI5B 5E8EB 3WFCL 1MEXL 4PJ9B 3UTTB 4HG4K 1ZANL 4PD4J 2NLJA 4XPHL 5B4MD 3VFTA 2XWBB 3AU1B 2Q1EA 4YUEL 5FAAA 1PW3A 3MLXL 5HYSA 5SWSD 4L9DA 4FFVD 3U9UB 4TVPD 1AQKH 5FYKU 4H88H 1AI1L 3OKLA 4LLVA 3ARDD 4PJGB 4WWKD 1HHKB 1DQLH 2VAAA 4WHYH 5DVOA 3VXSB 5HDQL 3KPMB 3P4LA 3VDBA 1MFNA 4YO0B 1NJ9A 4JJ5B 3VI4E 5FHBH 1U6AL 4EVNB 3N0PB 1DVFD 4KTEH 1REIA 2VABB 4D3CH 1P84K 4A6YL 5HI3D 4HZAA 4OZFH 3MRKB 1B0GB 2EDHA 2QSTA 4FQ1H 5MENE 3ZKXB 5CJOL 4MX7A 5J12C 1XIWB 3O11A 2M2DA 2XKUA 4HEPG 1EBAA 3PWUA 1L0XA 1P9MA 3BI9X 1F02I 5CGMA 1RZ7H 2DQGH 4M7JH 1ZAGA 1HWHB 5JO5B 4DFIA 5TE4L 4PJIA 1I8KA 2AJZB 4GW1A 5DD1H 1NGZB 4X7CC 5EWIH 3HRZB 5IW3A 1LO0H 4PLJC 1MPAL 3QPQC 1KBGL 1DL7H 1BLNB 4WU5A 4LSDA 4IRJA 1W72B 4EN3B 1KN4H 3QHFH 2ERJC 4PJDF 3FT3B 1S7VA 2NTFB 1YEGL 4KK6D 3KPSE 2FLBT 4TQEL 1DDHA 1T0NA 2M26A 2WLYA 4ZFOA 4O9HH 3WO4B 3U7WL 3VFGL 3OAUH 4XCEB 3NTCH 5EO9B 5T3XE 5A2JH 3AAZA 5J13C 4ZUTB 4MAYD 5INDB 2XWTA 4YDVA 2WBJC 3L95B 4GKOA 4S1DD 4JFYA 4YDVB 3VCLA 5B38A 1JNHA 3IFPB 3QULA 4G43A 4HS3A 1NAML 1OGAE 4QCIA 4HV8B 1NC4A 1A3QA 2Z8VC 4HUXA 5IB5B 1OWRM 3VWJA 1KIPB 1MY7A 1YYMH 5C07E 4GAJH 1YMMD 1CICB 3AMKA 4X6EB 4Q9CA 2YHGA 5F1SA 5J4MA 4JHAH 4R96A 3BGFC 1LP9A 1G6RB 2CK0H 5DVNA 1JBJA 1YY8A 4G8GB 4XCYA 5FA3A 3BEVA 2GEEA 2VDML 3HZKA 1UACL 1YY9D 4GXUM 1KLFA 2Q76A 3ALXA 1FBIL 4IDJH 2VL4A 1WFTA 1CXLA 1HINL 3HUJF 4P23A 3V5HA 4TPRL 4QXUH 4FFVC 3TYGH 4LLMA 4LPTA 1Y18A 2LVCA 4NO0D 4RCAA 5FYKE 3ZKMD 3CU7A 3FQTB 4YNYB 1MFAL 3QB7C 3WDIA 4PJBF 1INQB 3VH8B 4W70A 1QSVA 3IVKA 2WMPA 5C92A 2EDBA 5JQ6L 3LD8C 1YEDA 5GGRB 4U33A 1MHHA 4LP4A 2FB4H 4RAVB 4JN1H 4JDVA 2XQBL 3DJ9A 3QXTA 2A0LC 2B4CC 4DGIL 1NAKL 2VSDA 4U6HA 3QNXA 1YEJL 1KN2H 4KRNA 1A4JB 4PP2A 3HZVA 3BN9C 2LE9A 5J57B 1OD7A 1AGFB 1FO0B 2OP4L 3MGOB 4F7MA 4FQIH 4X6EA 2X7LB 2FD6L 2ESVB 2CIIA 3OR7B 4TSBL 2VRAA 3DI3B 3HC4H 5ID1A 2EDWA 2ESVA 4NQEB 1R3JA 2B7DT 5C09D 4OF7A 5AZEH 1S7UA 2X4PB 5FYJH 2HTLC 4M4PA 4FP8H 1JWSA 3L3GB 2HTKD 3LRSA 4Y19B 2XXMB 5I73C 4NZUH 5F1NB 3HZYA 3CD4A 4GLRI 4LSUL 1JGDA 1R5WB 3WCYA 1AR1C 1JZ5A 1DQJA 2G5BA 2YXMA 1OGTB 3QUXB 5I19L 3HE7C 4L29A 2F5AL 1OP5K 4I18B 3MBED 4OCSL 4HWBL 3BZEA 5BV7B 5IQ9B 1NCBL 3EW3B 4NRZB 4P9HC 1IEHA 4P2QD 3MRRB 1M7IB 2J12B 4X6BA 4XCFH 1H0DA 3CX5K 1Z3GH 3A6CL 5H94A 4MJ2A 2IH1A 5C0BD 5I6XB 4LRIC 1KELH 3H7BB 3SGKC 1RUAL 4R8WH 1PG7W 1UKSA 4Q2ZB 5T3XD 3LKOA 3N85H 5CILH 4JM2D 4HGMA 4KKLC 1NQBA 1OTUC 3NGBC 3HAEG 3BIAX 3MV7B 5D4QA 3MR9A 5F70A 2NY4B 5F93C 3NFPB 4KDTA 2YN5A 2DM7A 2MPAL 2F58L 5I1JH 4B50A 1YMHA 4QRPE 3OZ9L 4HJGB 1WLHA 1FFOB 4BUHA 5JIKA 4GOSA 1LEGA 2EE9A 5TQ0L 3GSOA 4LPCA 3C5SB 2NY3C 2D7PA 2X4TB 3LPWA 1SJHA 3IDYB 3LIZH 3G04A 4WFHE 3AC0A 1SQ2N 2WQRA 2ADJB 4MA1B 4D9QE 2GYSA 2Q8AH 1CGWA 3KPPA 1CS6A 5T33H 2ZUSA 5D7JD 5C08A 2PTTA 4WJ5A 3HKFA 3JUZA 1F5WA 2UYLA 1JV5B 1ADQL 3PP3K 3FFDB 4OQ1A 5GRYA 4X4XB 4OQTH 1YECL 5DT1L 5FYJU 2I5YL 4LVOB 3IB4A 5ITBH 2QHRH 4RGNC 3RWJB 4X6BB 4QRQA 2CUHA 5IV2B 1FL6A 5IBLD 5MEND 1JTPA 3X17A 2P5WB 5JXEA 4UDUA 3SGJA 5CP3A 5CSGA 3DI2B 3EOTH 1DSFH 2E6PA 5E8NA 2DQHL 3W9EA 1SM3H 3Q6GH 4XTRC 3T3PE 3WIIL 3CFEB 5A2FA 3M45A 5F72S 4FTVE 2GSIB 1U95A 4AG4H 3QDJE 1H3PH 3VRJB 3SDYL 3BGMB 1SVCP 2XN9D 2YPLD 3QIWB 2CLVB 2WINB 3QZWB 5L6YL 3LN5A 3TYGL 2BY0A 2WINA 5DUMH 1F58L 1KB9J 5BV7L 1J05B 1J1XH 1PVHA 4QRPB 5IHZA 3VMPA 3UTZA 1L7TH 4NNXA 5EU7C 4N8CH 1WT5A 2OSLA 3JTTA 5B39G 4L8DB 3FQXA 5JW4M 3D2UB 4GKZB 2OR8A 4X5LA 3VXUE 3WXWH 5BV7H 3PHQA 2FX8L 5MEPB 3U30B 4KHXH 3MACL 3C60A 2A74A 4B53A 1J87A 3CPLA 4HS6B 1I1AB 2X9XA 3C08L 1FE8L 1T66C 1T5XA 3RVTD 5DR5H 1RZIA 1U93A 3G6AB 1OPGL 3GHEL 4JM4H 3OBAA 4PJ9C 3VXMA 4MZ2A 2VIRB 5EC1A 3ARSA 5DC9B 3GMNA 4UQ2B 2R8SH 2XZQL 4OIBA 5FYLH 5DJDB 1CVRA 1LK3H 4PGBB 5GGUA 2GHWB 4PJXB 3L7FA 5K59E 2OCFD 4IIQA 1S78D 2VDQL 4QHNA 5DUBA 2V5SA 1NUNB 1XH3A 4DVRL 3CC5B 1CU4L 3QEHA 5KJRL 3TNNA 2UWEF 4ZSOE 4DVBB 3VXRB 3HI5H 1CLOL 1M7DA 1NC4B 3U36A 1ZGLP 2PXYC 1LHZA 1A4KB 2DQDH 4NBYB 4Y2DB 3TO4B 2G75B 1KYOK 3HC4L 5DD6A 4HFWB 4KVCH 4K7FB 4PRNB 4R7DB 1QG3A 5GGTA 2ZG1A 1ONQA 3GMQA 5M95B 3WNPA 1T7VA 5IFAL 4RIRB 5I75C 5F7DA 3L1OL 1BGXH 2AXHA 4KKNA 4J4PA 3JV5A 2V17L 5GSVB 1W0VA 1YEJH 2VXVL 4IM8A 4QY8A 3WNNA 4ZDHB 1NDGA 3HA0A 4H1LH 4IRSA 3HR5B 3WHXA 4PJHB 1JWMB 1TZGL 1XCQA 3NFSH 1NGXA 5DJXB 5AG9A 2ADIB 4U1NB 3W0WA 2X89A 5EUOB 4G8FA 1WAAF 2Q8AL 3OAZH 4NC0B 4K7PH 3GMNB 5CD3A 4ZFFA 4W6XB 4HC1L 2ITDB 1EGJL 2FNBA 4XXCA 3ZT6A 4C56A 4J12A 5E2TH 3O8XD 1I8LC 5JUEL 2NY6B 1T3FA 3DSFH 2P8LA 1H8NA 1AD9A 3MROA 4BELD 4BKLA 1EO7A 4HGWB 4ZSOB 2IQAA 1FBIH 1DVFA 4IJ3C 2NXZC 2FJFB 2H32B 3QEQE 4WUUB 15C8L 3TBYA 1ORSB 5D93C 1DQLL 2DLHA 3QDME 4FFZL 4MLSA 1ZHBB 2GJZA 2FGWL 1N0XH 1XGTB 2DBLL 1ZHBA 3MRMB 4QXTA 4PJ7B 2IMMA 4DKEH 3NGBB 2C3HA 3ARFB 4F7TA 2H1PL 1YYLH 2CDGA 4YUEH 5JOPD 3PV7A 3GK8H 1QLFB 3OXRA 2J8UF 2X6MA 5AZEL 2WZPD 4JFDD 3D39B 3WNLA 4J3VA 5GJTL 1TNMA 3QWRA 4LLWB 4YDJB 4MJID 5SX5K 3BX7C 4D0DB 4HIIA 1NMCC 4UU9A 3DPBA 2LQRA 1JGUL 3FOMB 1CDJA 4XNZB 4GLRH 3HE6A 3B9KB 2BNRA 3MODH 5D6CB 1T0MA 4IRJD 3T04D 1CDUA 3UTTE 1J5OH 3BZEB 2HJLA 5GRVK 3RZCC 3L3IA 2R0WL 3CXHK 3IFLL 3RTQA 5LXGH 1T6WA 1I9RH 3CDGB 2E6JA 2NLJB 4GKNA 4EI6B 2FIRT 2R0ZL 3HRZA 2H32A 4FXGB 4X7SL 4UTBL 5T1MB 2APBA 1DLHB 5IIEA 3NH7H 4HF5H 4WENB 1LE5B 2QR0B 4PRAA 1VGKB 3BT2H 5JXAL 4GBXD 1OM3H 3VWKD 4NP4L 2Y9RT 3MR9B 3U7YH 2GSGB 3EOAA 1U3HB 3VFWA 4ZG1A 2R1XA 4XWGL 3U4AA 1VEPA 3VE0B 1QSED 4U3HA 1HSBB 3QEQD 3SKMB 4XNQA 1G7PB 2PYEE 3RL2A 1AY1L 1A8JH 5FKAB 2PYEB 1FVDA 2W0FA 4DCQB 1DBKL 4CU6A 2Z92B 3FTGA 1PKQE 4CW1A 5JA8B 1GC1H 1JZ7A 1AE6L 4PRHB 3MRHA 3LRHA 5TGBB 3IXAA 5J6HB 1UWEH 4OI8A 1NMAH 3BRFA 4LMQI 2Y5TA 1DBKH 2OXHA 4JY6B 1YZZA 4F2MA 1DBAL 1UH2A 3ROOB 5DI8A 2YRPA 1C1EH 1MUJA 1TZIB 4QCIB 4UT9H 5HYIA 1IFHH 4WFEE 4TSCH 5J3HD 2QQNH 1U3ZA 1N5AA 4AMKH 4F8QA 1T1ZA 2VAJA 1N5AB 5J06A 5HI4C 3IDXL 4XP1L 4Y89A 4UT6H 1CFQA 2Y25A 3GBNH 3QA3A 2ADFH 7FABH 3KXFD 1FV1A 5BVJA 3VW3H 4HBQA 1MLBB 2W1NA 3CFJA 4L8SB 3WE6A 5FA3B 2ZUTA 3V6BR 4AEEA 3IDXH 4XP1H 3LZFH 4QHUA 2IGFL 3CXDH 4U7KA 3RUGB 4PJ5D 3WS3B 1CGVA 4HJJH 4MDIB 1AXTL 4OSUL 4CW1B 2LU3A 4LLYA 1YN7B 1AXSB 3LKRA 4M6MH 2AJVH 1K8DA 1ADQA 3GGWB 2D4DA 3U9PH 3NIGF 4F33A 1T20B 3QDAA 4U1KA 3QUMB 1HHHB 1RULL 5CJQH 1YEDB 4LSSH 1I9EA 2WBJA 4KK9D 1W0YT 2XG4A 1BFVH 5JR1H 4NUJB 5FA4B 4JFYB 3FO2A 2DQTH 3JTSA 4HUUA 5IKCB 1MIEL 1MJ8L 4KI5D 5D5ME 5HGDA 2QJDA 3HS0B 1HI6B 4X6DA 3GSQA 1V7NL 1C12A 4YXLH 5EU6B 5EOQL 3QDGA 3MRCB 4ZOAA 3WV0A 4WIQA 2X4OB 3WIHL 4MB5A 5IR1B 3SPVA 3W9DB 3FOLA 1JPTH 3WL9B 3RZCD 2Z93B 2BNRD 1LNUA 4OTXL 5T1LD 4FNLH 1NBYB 2IC2A 4NQXB 2DLGA 5ETUB 3L3GA 4K94H 4XCCH 2X05A 1Y0LB 1OTTC 1RIVL 1S7UB 1AO7B 4P3DA 1G7QB 3UC0H 4JRWA 4TRPH 3H3PL 3O41B 3P11L 4NQDB 4PY8J 3WS3A 1U8IB 2KKQA 2FDBP 3IU3A 3QHZH 1BIIB 3PGFL 4IRZL 3HR6A 1A1MB 2R56L 3O81A 4YE4L 1IARB 3WLWD 4JFXB 2P8PB 1IAIL 2J4WL 4EUPG 3BPOC 2P5WE 4HIJA 1YPZF 5GS0L 1ZE3C 4N8PA 3MLSL 1UA6L 4PJ5E 2DQJL 4YXKL 1N4XL 2RHEA 1UWXH 3RVWC 1VFUA 1YEHH 3KGRA 3FN3A 4DKFH 4NDMB 1AGDB 4WO4C 4XVJH 1CDIA 1GGYA 4TVSa 1Z0MA 3U0WL 4BFGA 5C1MB 4X6CF 4IRJC 4K3DL 3GMOB 3ZL4H 4PJAB 2FGWH 3GI8L 4P23C 4PY7B 4N9GA 5DRXB 1PG7X 2VR9A 3JUYA 3CZFA 1F90L 3RGHA 15C8H 3AUVA 4LF3B 4NUGL 4X7EC 1ZEAL 4OZFB 1RJZB 1A47A 1KIRB 3BUYA 4BKLB 2YA1A 2YC1A 1SMOA 5JIHA 2MPAH 1K4CA 1CQYA 5BXFB 4I5BB 4QRTA 4KGJA 4I4WB 4XNMB 1ZLSL 3IS1X 1MVUA 3I3BA 3O3EB 3DX6B 3HCVB 1IILE 3VFNB 3ARBD 5D72L 4I3RL 2PTTB 3CFDB 4NWUH 1M1SA 1P5UA 4YGAB 5EZIH 4KPHH 5L9DL 1B0RA 3L6FA 2VLKA 3BP6A 3JWOC 1TVHB 2MQ3A 5GJSL 3QJHA 4BFIA 2CDGB 1FFNB 1KF9B 3O2VL 3S37H 4KZDL 4KXZH 3GMMB 5C0AA 3NZ8B 3MRJA 4QHLA 3SJVD 3NMEA 4PJXE 4U05A 4KJPC 4CADB 5IB4B 2DQJH 3U7AA 5IT2H 4WI2A 3E2HC 3BSZH 4GJTB 3KYOA 4R3SB 4HHAA 4X7TA 1BD2A 5HVGB 3OPZH 4KI1A 4POZC 4U6VL 3M07A 4UU9B 1HIMH 2CGRL 4U1HA 3U6RA 1I7UB 4ZQKA 4HKJA 4K94C 4JG0L 1DANT 4L8BA 2VE6B 2HA1A 2A9MH 1ND0B 3LN9A 5DJ6B 4NQCE 3RIFF 3NIDE 1TXKA 3OAYH 4EQ2A 2CRYA 1JUFA 4X5WB 4QRTB 1MAMH 3HI6H 2AJZA 4TUJA 1TQBC 2AJYL 5HDOA 5AD0B 3ZO0A 1WC7A 3MLWL 3IDMB 4NM4L 4RQQA 1I8MB 1U8NA 4JFDE 5DWUL 5IVXF 5EBWA 5CLWA 3BGAA 2DD8L 4JRYA 2ZSVA 4NO3B 2MCPL 5HHOB 4HS8L 4RWHA 2J8UE 4BUGA 2GFBA 3G5ZB 1JHKL 1EV2E 2HN7A 4M6NL 3TBVB 4UDUB 4JM2F 3D3VA 4YHLH 4GRLA 3PJSA 3P30H 3TBTB 2R4SL 1QRNE 4QT5B 2VIRA 2ZOKB 2BVEA 3SKOA 3TA3A 3DX9A 3NFNB 1FPTL 2FLRT 1FVCB 4OM1H 4JY6A 1F8TL 3R0NA 3G5VB 1KT2B 3IXTA 3QFDB 2RQ8A 3OHXA 4NUGH 3ARFC 5E8OA 3QZWA 4LIQH 2ZJSL 3DGGB 1RIUH 1G9NH 5BMFL 5HYSG 2FJHB 2HVJA 2GJ6E 1X6NA 4X5WA 4ZAKD 1TJIH 3OKMA 4XI5C 3DETC 2IH3B 3NCFB 4WV1B 4YHPA 3IDNA 5AWNH 4PRNA 4R7DA 5HHPA 5DLML 1I8MA 2NR6C 4LVNB 3GZKA 2IF7A 1J9CT 3MMEB 4QOKE 5F9WC 5HDBF 1RZKH 1A22B 3ZKXC 2LU7A 4LDLB 3BHBA 1RY7B 3CK0L 2OZ4H 4DKAA 5DQDH 3TFKC 5CD3B 2IALA 3U83A 3GSRA 1U92A 5C0ND 2OL3B 3MUGA 3BXNB 1JYVA 2ZOKA 2YK1H 5BRZA 3RNKA 1JF5A 4HSQA 2HT3D 2V7HA 1S7TA 1X4ZA 3LQZA 2E5EA 2BY3A 3RPKA 4JZJC 4Y4HB 4L4TD 1MJUL 1HI6A 2GTZA 1NMBH 2A6IB 5A3IC 2X70A 5KW9L 3OZ9H 5JHDA 1FNLA 1RJLB 1KCVL 5DD0H 3QDMB 2E9JA 1B90A 4G9FA 2AABH 4EN3C 3BO8A 3TO4A 1Q8MA 5HYJA 2HWZH 2OMBA 3ARFA 5KOVC 2R23B 5KANG 1QFOA 5C0FA 2BVPB 2IPTH 5FGCB 1S5IL 1KGCE 3B43A 4N0UE 2OL3L 5F7DB 3U4BL 1CFTB 4O2CA 1NEZG 1EEYB 5HYQA 4EI5D 4PJ9D 5T1KD 3UTTD 5IMKB 5E08H 2IPKA 4P3DB 5CZKA 5LWYH 5GSRA 1FFQA 2IAMA 5FHAL 1ZSDB 4IOSD 4WTXA 3KVQA 2IADB 5HI5D 4LCCA 2JCCE 1ZV5A 1CFSA 1OSPH 5B22A 3O4LB 3NABH 4PJ8C 2F54A 5D6DC 4IOIB 1N64H 1HDMA 1HZHH 4C56B 4RFNB 4J6RL 3BPNB 5E03A 1Q94B 5GJTH 4BH7B 3OKDB 5E2WL 1R3HA 1HXYB 3MLYH 5D5MF 4KRPC 3OJVC 4NGHH 3SQBA 2PKDA 1ZT4B 3G5YA 2UY6A 3FZUD 4XT1C 4HIEB 5IVZA 3PL6B 4M6OH 4G9DB 1G7HA 3FB8B 3BQUB 3C60C 5JNYA 4F9LC 5SX5H 1FZKA 4JKWA 1U2CA 4HFUL 4WHYG 4M1CC 5EO0A 5D70L 3SKNB 3QQ4B 3VE0A 3TZVD 4U1MA 4JKKA 3SO5A 2W65A 1U3HA 4N90D 1U8HA 3RNQB 4GG8B 1GJIA 2PXYA 1HINH 5KSUB 2VSCA 32C2B 3LD8B 2HH0H 1ZVYA 2QADC 5EU5B 3VFPB 4YR6A 1G9EA 1UM6H 5KSAC 1JFQH 3MA9L 4XHJD 3TT3H 4PYHA 4P48A 3O3UN 1MVUB 5F9DC 3BH9B 5E00A 4K7PX 1DBBH 3EO0B 3SDDC 5CZVL 4U3XA 5F3BA 5D7JC 1E28A 1I8IB 2DJ4A 3M1BB 3V6ZA 4B7LA 5AUMB 4HAGA 1EHLH 1U3YA 4QYOB 3LEYH 2VYRE 3PWPE 4CVXB 4LOUC 5HY9A 4NNYB 1KEML 4JM2C 4CADA 4BZYA 1F4XL 3MV9A 2Z35B 4HWEL 3KLHC 1L0QA 4JKLA 3GJFA 4WNQA 2DQIL 2D3VA 1ZT7A 4JHAL 4MAYB 5IW6B 3IDJA 3HE6D 3P4OB 3KYOB 1P4IH 3BDYL 2IG2L 1MCOH 5F7LB 3ULVE 5KSBB 1HQ4B 5FOJA 2H6PB 2RIKA 3NCCB 5I1LB 1A6WL 1R24B 4HC1A 4L9LC 4PGZA 5IVXE 4OZHE 1NFDE 3HNTL 2XWJA 1CGTA 3KPQA 4OKDA 2VDOH 1K8DB 1PX3A 4MA3B 5DMJB 3O0RL 3O3BB 4HWNA 2VJXA 2D0FA 2F74B 3FCTA 5SX4I 2FYYB 4IEFB 1A7BA 1OTSC 2DWEB 3GKWL 2KZ1B 3NIFF 1GGTA 1YNLH 5EZJA 4PJFF 4Q9BA 3F7YB 3IYLW 1A3RH 3QPQD 4PV8B 4KU1A 4OZ4A 4M4RA 2R15A 1U8NB 5L88H 4UT9L 5D7IB 4N5UA 5EBWB 3C8KB 4WGWB 2NY4C 1YEGH 3A67H 2B1HL 3HNSH 4Z7UE 3X3GL 4WW2C 5C0IB 4N0YH 3MACH 2D0HA 3ZKSD 1E6OH 1XEDA 4XZUA 2AAVA 3O3DB 3WJLC 2GQHA 3VXMB 5T3ZL 2Q86A 1KXVC 3MRCA 4FQ1L 5F1IA 5KVMC 3LQAC 2ICEB 3PDDA 3TO2B 3GIZH 1H3TA 4RMRA 1OAKL 2AEPL 4JB9L 5J56B 3MCLH 4ZODA 4RGND 3NFNA 1CTNA 1KCVH 5DD0L 1LVEA 1H15B 1TLKA 1IGYA 3VA2C 4K3EL 5ESVB 3ZTJG 4BSWB 1A21A 1FCGA 4ODXA 5IVOA 2I9TA 3PNWB 4PJGE 3AREC 3U1SH 5HTSA 2F8VA 5JUEH 1D3CA 1T7WA 4RFOL 3T1WA 2DIJA 3G08B 3QUXA 5KSBE 2XV6B 3ZHDA 4ZTOL 2XNAA 1A0QL 3D85A 5IHUH 5DGQA 4YBLC 4HIJB 5GS0C 1FFRA 1IC7L 4DGYH 4LHUB 3OF6A 2DMKA 4FHBD 1X5HA 4PREB 4XNYL 2UVFA 1TZGH 5T5FL 4H25A 5FYKD 2FZ3B 1EDQA 4KTEL 4OI9A 1FIGL 3QSKB 5JHDE 5C0CA 4JFZL 1XR8B 5I2IB 4NDMA 1MI5A 2ZSWA 2EYSB 1NCAH 4I2XE 3F5WA 5GGQH 1IAKB 2B39A 4TVPH 1KIPA 4OF8A 4D94A 5JQHC 1K6QL 1MWAL 4NT6A 1AP2A 2X9WA 4IDLA 4PLJD 4R2GB 4QRRD 1WZMA 2GK0A 3MRNA 2VH5H 2EC9U 3AXLA 3DV4A