2NR6D

Crystal structure of the complex of antibody and the allergen bla g 2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
213
structure length
213
Chain Sequence
EIQLQQSGAELVKPGASVKLSCTASGFNIKDTYIHWVKQRPEQGLEWIGRIDPANGNTRYGPKFLGKATITADTSSNTAYLHLNSLTSEDTAVYFCARWVRQMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartic protease Bla g 2
publication title Crystal structure of a dimerized cockroach allergen Bla g 2 complexed with a monoclonal antibody.
pubmed doi rcsb
source organism Blattella germanica
molecule tags Hydrolase/immune system
total genus 34
structure length 213
sequence length 213
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nr6D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nr6D02
1D5ZA 1GHFH 2Q8AL 5I1DA 2F5AL 5F6HI 3ARQA 2R8SH 5FYLL 4RGND 2QSCL 3FJTA 4HIXL 3FFCE 2FX7L 4XVSH 4S11A 1JF6A 1EEYA 4BKLA 1T0MA 3VXOA 1OHQA 4XI5C 3IRZA 2JIXA 1YEKL 4N68A 2VKXA 3P9WB 4OJFH 4XC3L 1EGJA 3BPCA 3RVWD 2X4QA 5T1DL 2XNAB 1Q0YH 2VNCA 2PR4L 2HJLA 3QDMB 1KB9J 3IVKA 1T2QH 5I1CL 2W92A 4JN2B 3BJLA 1KIPA 3QXAA 4JFXA 3SJVE 3MBXL 4O5LH 3HCVA 2O93L 4MS8C 1TQBC 1UFUA 1M1SA 4ZYKB 3MRHA 2OR7A 1HKLL 5J6HA 2EDFA 1MI5D 4WO4C 4OLZL 3WL9A 3IFLL 3HNSL 1KENL 3VXUA 5E6ID 4RMQA 2KQMA 5DWUH 3UROR 1T7ZA 3RWJB 2QQNH 1FG2B 4ZAKA 5FOJA 3HUJA 2CRMA 3FT4B 1IKNA 1LEKB 2DMKA 1IM9A 2VLRA 3LH2L 1IKFL 2YSSA 5I1AB 4Z7UE 2QBWA 4KXZH 4WI8A 1FORH 3DUUB 3FQUB 5JDSA 4BA8A 1T1WA 4AJ0A 4URTB 4V1DB 2XTJB 5CP3H 3PL6A 1U36A 1RURL 2D31A 5F7DA 2NW2B 4NKQB 2WIIB 4XPFL 3MLXL 1L7IH 2IBZY 4F7CB 3CZFA 5HGBA 3RWGB 1L9MA 4ONOA 5C86A 1DLFH 1M05A 2F53A 2DLHA 5HTSA 2C1OA 3CXHJ 3U7WH 3ZHLA 3HLAA 1H5BB 4ZTOH 1HHGB 2J5LB 1QFOA 3IU3A 1N6UA 2I07B 4TNWK 1HQRB 2AJ3A 4BZ1H 1X5JA 4ZAKC 1KJ3H 4ZUVA 3MROB 3TT1L 2B5IB 3EGSA 3KPRE 4IJ3C 1RUML 2DMBA 2ATPB 2F19H 2NY6C 4U2YA 5IESL 1TTFA 4ORGA 1MY7A 4B7IA 4DTGL 3VXRE 5T1KD 4ORZC 5TQ0L 4MAYC 3FB7A 3HPLB 4EXPX 1CL7I 4Y5VC 1UCBH 1RHHA 5D1ZA 4P5MB 1YC8A 3M1BB 3CSGA 5I9QB 3RWIB 1VGEL 1BM3L 4KKLD 5FECB 3IDYB 5I1HH 2ADGA 2LAAA 5E8DL 3NPSC 3CFIC 3KPSE 5FA4B 2R29L 3PL6C 1VACB 3IFNL 4WU5B 5JQ6L 4UQ2B 3U0TB 2BVOA 4JZOB 1KYOK 1SEBB 2WBJD 1N59B 3QUMA 5L2KB 5I1JH 4HF5L 1H15A 1ZVSB 4XWOD 3QNYA 4XAWH 3X13A 2HFFB 3X3FH 1YC7A 3BISA 1QQDA 4QKXB 1GPOL 3EYUL 3QG6B 1OARL 3LKSA 4JVUA 5C7XH 4NZTL 1EA9C 3KDMB 5D8JH 3QDJB 5DJ2A 1QVOA 4KRLB 3VCLB 1PW3A 4LF3B 4NO5B 2XWBB 4RQQA 3BP5A 4PJCE 5B4MC 3PG2A 5BXFA 3RPIB 5IVZA 5KVMC 3VD5A 3QQNA 5EZJA 2GI7A 1Q9LB 1N7ML 4WNQB 1JGDB 4PJHA 3STLA 5KVGL 1YEJH 3D0LA 3ARBC 3I6GA 1W0VB 3QXWA 1NH6A 5FDYA 4YAQB 3P4LA 3MJGX 4AEIL 5KS9A 2NY4D 1KXQE 5ILTH 1S7SB 2VXUL 5F9AC 1YMHA 5IV2A 3GMMB 4ODWA 4ZPTB 4NQDA 3NFSL 4NZJA 3LKPA 3FT3B 4WTWA 3BIKB 3IXTB 3V95A 5DMKB 2QQKL 1YDPB 3S34H 1L4IA 2XWTA 4WFHD 1GRWA 4HJ0C 5FOBB 1E27B 1T22A 1ONQB 3ZTNL 1BJMA 5IT2L 5D7LB 1MJ8H 3V0VB 5DMJB 5ICZB 5MEQB 3SKJL 3WKNA 1ORQB 5GS0H 5MI0B 2CUIA 4BFEA 3LEYH 2D7TL 4CNIA 3BPOB 5D7JD 1A3QA 4U7MA 3ZKND 1Z9OA 5DD3L 1IC1A 4C56D 3GIZL 1QSFB 4XMKH 5DGRA 3VI3F 3KLHC 2BVPB 1F02I 3HC0A 5EO1B 5FYKH 2W38A 1G6RH 1DQML 3QEUB 4RDQF 1C8PA 1I8KA 4PJEB 2DQDL 1X4ZA 4YIQA 4L8CA 4CVZB 1GIGH 3GMLB 4R7NA 4LAQL 2QHRL 2FX8L 1BQUA 5T1LA 2BRRH 4NN7B 5C0CB 1UWXK 2EH8L 1PKOA 3O6FC 1NFDE 3I02A 2QQLH 4IBLT 4IDJH 1F3JA 4YXHL 2ADIA 3SO5A 3T65B 5DJAA 5GGTA 4ODSL 3MRQB 4L3CA 4OF6A 1DN0B 2YK1L 4ZOEA 5E8OB 5A2JH 1U9KA 2AQ1A 1A5FL 1UKTA 4HEPG 4JFDD 1VGKA 4MNHA 4XVJH 5CEYB 4XNMA 3GMRB 3QQ4B 4CJ0A 2YPLB 1U92B 3UXFA 5K9OB 3MXWL 1VB9A 5E2UL 1RK0B 3SN6N 1IAIL 5IMMA 4N0FA 2OZ4H 3TNMB 5DQ9A 2Q1EA 4LASL 3DBXB 3LZFL 2VH5H 3H9SB 25C8H 4P49A 4FQQB 3FFDA 1ES0A 4NJ9H 1H3TA 5JW3L 4IOFD 4IMLA 3P0VH 5GRWA 1RJYA 1EVUA 5F71A 2XN9E 3HI5H 4XXCC 4ONHB 4LLYA 4UAOB 1AXTL 2MNUA 2EIDA 3BKYL 3QP3A 5CZKA 5J1AA 4M7KL 1MCPH 2Z8WC 4N5ED 4PJAE 1U2CA 1ZLSH 4HWBL 3IS1X 2ENSA 5EBGA 5DRZB 1A1NB 8FABA 4NUGL 4KXZI 1JNNL 1U8MA 4PREA 3IRPX 1A6ZA 4KROB 1BD2A 1UZ8B 1O5DT 4LPTA 3MZTA 4Y4FB 5C0AB 3UTOA 2YD2A 3N50A 4S1QH 5C0BE 2APFA 2I25N 1AO7B 3G08B 1RULH 4NM8L 5C08D 4NO0A 4YHIA 4PB0L 1OP3H 4N90D 1L7TL 3VXSE 5MERA 3PV6B 1GL4B 2P44B 1GZPB 4I2XE 1JRHH 1RUPL 4PY7A 5C0GA 5HXMA 1MI5A 1HHJA 4G3YH 1I8LA 3HC4L 3DX8B 3GDBA 4L8DA 1ZT1A 1Z6JT 3SGJC 3VFNB 2EKJA 2B8OT 4Q9BA 3QJHA 4FABL 2WQRA 1IC5L 1RZIA 1AGCA 1AR1D 4OLUH 1PVHA 4GKZA 4UDTA 1T04A 2YMXH 4HJGB 4GAYA 1TZIB 2Y07H 2AXGB 3D25A 1VKXA 5D7SL 1RI8A 1I8IB 2WUBH 2MSPA 1QLRA 5ITBH 3DIFA 3MBEB 3QIUD 4Q6IB 1F13A 4CVXA 3SDDB 1UM5L 2GY7B 1JK8B 4P3CL 3S96A 1AKJB 1MHEB 5DFTA 4Q0XL 4DCQB 2HP4A 4PGDA 3U6RA 3O0RH 2FD6L 3S5LB 2ZOLB 2JK5A 1U91B 5EU6D 4P2CG 4Y19D 1SJXA 4LU5H 3HG1A 4WW2F 3B83A 4NQVA 4JM4L 2QADC 1KCLA 4HIHA 5E8PA 1LO5B 3UTSB 4L29A 3JWOH 2Y36L 1A64A 3ARGC 4OQTL 3ARED 5JW5A 2DQHL 2XZAL 1CXKA 1PAMA 3UO1L 1WTLA 1BWMA 5T5FH 1ZE3C 1BJ1H 2R15A 3DO3A 3VXNA 3S6CA 1ODAA 4HLZH 4Z7VE 1BEYH 2GAZA 5DGQA 3LQAC 4HJJL 5L9DL 1OGTB 2HG5B 3ULSB 1T0NB 2VLKB 1J1OL 4EUPH 3JXAA 3PGCA 1FHGA 4O2FB 1NC4A 2J1KA 4JY6A 5CZVH 4L3EB 4Z76A 4OD2B 4LLQB 1S7XA 1KTDA 2IH3A 2X1QA 4X5XA 2NZ9D 5DSCA 2VZTA 4ZD3H 3EYOA 5IW1A 5E94A 4H0GA 4LIQE 5TE4H 4LSQL 5C09B 4I0KA 1ND0A 4PJ7E 3CPLB 1T21B 3MA9L 4PUBH 2GQHA 4AIOA 3D48R 5DTFB 1NL0L 2KZWA 4MA7H 3BESR 4RMVA 2BRQA 3SY0A 5BVPH 4LCUB 1IGTB 4NC0B 4KKBC 4PJ5E 3VGAB 4ZNEA 1U8OA 4G6ML 3W11D 1LK3L 4RAUB 2AJVH 1R6VA 3BQUC 4E5XB 2IC2A 4H0HB 2P8LA 1MPAL 2IGFH 5DQDH 3TESA 2AQ2A 3QAZB 1FYTE 2CXGA 4YXKH 1RUKL 4OKVB 4WWKD 5GRUL 1U8LA 1FVEB 4L4VA 5IVOA 3I85A 4QO1A 7FABL 4A6YL 2W9EH 1TCRB 4H1LB 4M1GH 5T3XH 5DHVH 1FZJB 4MNGE 1Q1JH 2GJZA 4EUPA 1J05B 3ZT5A 5EA0L 2QSVA 5ISZD 3U7YL 1MWAB 5GHWH 1HINL 1XR9B 5DRWA 5I1KH 5TE6L 3OJVC 3SQOL 1QLFA 4LSPH 2DQUH 2P45B 3VJ6A 4MXWL 5HY9A 2IG2H 5J6GB 1T20A 3BMVA 4CN4A 3F5WA 1MRDL 5IHBA 3QWRA 3PWPB 1INEH 4ZMAT 3L1OL 5IROC 1NCDH 2A9MH 3Q0HA 1PY9A 3KYOA 5CWSB 1FL3B 2KL6A 5D7JA 2BCKA 3H9HA 4HKBB 4KK8C 4M9OA 2B0SL 2D4DA 4XPHL 3B2VL 4XBEH 3IAQA 1MFDH 2YD4A 2XOTA 2FLBT 4O00A 3O8XD 2P47B 3JWOC 1LNUA 1ZOXA 3FB6A 2JCCE 4PGBB 4R2GD 4C83B 1RJZB 1C5CL 1KIQB 1PDKA 5GQBA 1HCFX 3G5ZA 3IFPB 4MX7A 3ES6A 5HHOB 1NMAL 1E4WH 3HFMH 3QI9A 4EIGB 4OCXL 2HRPH 3O4LB 4N9GB 3D3VB 1U6AL 3QPQD 4M7LL 1J9CT 4FQXB 1QO3A 2EECA 4DGVH 1BFTA 2AI0H 5HYQB 4NQEB 4JZJB 2EDKA 3PWLA 3REWB 3VWKB 1N8ZA 3P73A 1KPVB 3BEVA 2X70A 4R0LC 4P9HL 1MH5B 1QLEL 3EFDH 3A6OA 4RSVA 2VXTL 5LBSH 4NHCH 5F93C 5DHVA 4HLJA 1OF2B 1KEGH 2XA3A 3RGVD 4JQIL 2VC2H 3NIFE 2PW1A 2AEWA 4FMKA 1FNEB 5DJZA 3LRGA 1B0WA 1J8HD 3DNKA 3VXMB 3T0EE 1ORSB 5F1KC 3F6IA 2BNQD 4P2RB 5EC2A 4LQFL 5EG6C 4P2OD 4GRWE 4OB5L 5SWZE 3V4UH 2V5MA 1SBSL 2WWKT 2Y9RT 4OCRL 4ZFGH 2UZXB 3W9DB 2H6PB 1BIHA 4XP9H 3GMOB 1WBZB 2L0DA 1JRHI 2DQJL 1HDMB 2CDEA 1GOGA 5L7XL 4MSWA 3CMOH 3GJFB 3CU1A 3D39A 3RVUC 1QACA 3GHBL 4BH8B 4M5ZL 4CADA 3EW3B 2ESVB 3G5VA 3HR5A 4XP6L 3HR6A 3ZSTA 5GZOD 2OTWA 3U9UB 5I16B 3L5WB 3VFPA 1D9KC 1DQDH 3VFSB 4XHQA 5IB3A 3MYJB 2OP4H 3PV7A 1DEDA 1DQLH 4EVNB 2FYYB 5JXED 3MNWB 2DQTH 4PV9B 5HD8C 5CBAA 3RWCB 4MYWB 4XVUC 3H9ZA 2R39A 4X99B 5EPMB 1AE6L 3O3EB 4JANB 5JHDD 3RDTC 1IGJB 4XWGL 3LCYA 4BZ2H 2CR6A 1N5AB 4JB9H 4DUVA 3NIDF 2IADA 2E9IA 1WZ1L 3MJ7B 3AB0C 2CIKA 3MGTA 1WFTA 3G6JA 1MCJA 3V5DA 5L8JB 1ZMYA 4FQ1H 1NMBH 2HTLD 3LV3B 1CD1B 2X4OB 4JFFB 4X80H 3VFMB 3VGEA 1HI6A 3DJ9A 2P5EB 2NY1B 1NGYA 4ALAL 1OAZL 1CICB 1U41A 4XNUH 4HDIA 4PTTA 2R1YB 1MFAH 4NFBA 4JY4B 3CFKB 2DF3A 3LPWA 2E8YA 3IGAA 4RGMC 4ZOCA 5IFAH 1UWXH 3Q1SL 1GVIA 3RNKA 2XKNA 2DJSA 4C4KT 5B3NA 3LVEA 4GXUN 4Y5YC 3WXVL 1MNUH 5CSZB 1HHIB 1KB9K 1SYSA 5DHYB 2APBA 3BIBX 1MLBA 2K9UA 3FFCD 3WFHB 1PZUB 3LN4B 3TO4B 2BVUA 1LQSR 3BO8A 4P23A 2C1PA 1A4KB 1RZ7H 1JGVH 3ZZ1A 5I0ZA 3DSFL 3BKCL 4OZFA 4JFHE 3NBNA 1IFHL 2VE6B 4Y19A 2NLJA 3AXLB 2PTTB 3PDOA 3KPMA 1RZGA 2YKLL 1TXKA 4XHJD 3SKMB 3L3KA 4PRPB 4PJXA 2Z93B 3SJVD 4OLWL 1B88A 5FGCE 1ZKAA 2IJ0C 3BZEA 3I2CH 2WSKA 4JO1L 4YEEA 5BVJA 1NLDL 4X4YB 4K3EH 3GO1L 1NKOA 3SDXB 2FECL 4OLYH 1M7IB 1X5AA 1N2RB 2EDQA 3F7PC 4IRSD 4HX1A 3S35L 2EEDA 2P43B 2VDQH 3ABZA 1DBAL 3FTGA 5MENE 4M61B 5D7KE 5DA0B 2MQCA 3RKPA 3ZKXB 1GH7A 1FAIL 32C2B 2M2DA 1R5IA 1ZHBB 2ZCHH 3MNZB 1E6OH 3LQZA 1GXEA 4HLZG 2CRIA 3IFOB 3QH3B 5C0IA 1KN4L 2GT9B 5IMOB 4ZG1A 5DHXB 2EKSA 4PTUA 4F7EB 4P23C 1G7JA 1PSKH 3CXHK 2NY3D 3LS5L 3KJ6L 3I3EA 5D70H 1PYWB 4M9PA 2AK4B 2ICWJ 1BIIB 3QO1A 4HGWA 3ZHKA 1MJ7H 2EYTB 3VD7A 5JLZB 2GTZA 1CF8H 4LPUA 2LAGB 1JPGB 1U3JA 4S1SH 3AFLA 3N1FC 5CSBA 2CK2A 2P8MA 4AT6A 3T4AA 4R97B 4B0MM 1WFUA 4OF7A 5FA3B 5AZEH 4OFVA 1LP9E 4WWKA 1V3KA 3KNBB 4QF1B 3CXDL 4F8QA 1DVFB 1XGUA 2Q3ZA 4MAYD 3GIVA 5I8CA 2VDPL 3ISWA 3FB5A 3C60A 2P48B 1NCAL 2VDMH 5HHVH 2DIAA 4Y2DC 5IG7B 2OXGA 3H0TA 3JWDH 5EWIL 2FHCA 4PP2B 1TQCC 3KPRD 4HWEH 5C9JA 4FNLH 4FXLA 4QHLA 1PX3A 1NAML 3O6MH 3QXUA 5B39A 3VXRD 4QYOB 1G0YR 3EYSL 3FQRA 5E4EC 3IU4H 4OCSL 5FUOL 1WFNA 2OQJA 4YBQC 1FVCA 1MFCH 3MLYH 1NMCB 4GS7B 3QCUL 1MF2H 2ZCLL 3KPSD 4S2SA 3DWTA 3QFJD 4IRJC 1S7TB 4TUKH 4TUOA 1XF1A 5CKAA 1Q0XL 3VFRA 4ELMF 4J12A 1KELH 3STBA 2E6PA 3UJIH 3Q3GA 4OCNC 4OV5B 1HILA 4U3XA 3EJYC 1GGBL 3HI1A 1AI1L 4U6HB 3ZKMD 1BFOB 3GI8H 3O8XA 1H3WM 4IHOA 4XBGA 5IQ7L 3WJJC 1QEWA 3KYAA 4HD9A 4NJAH 4X6EA 1DQQA 3CDFA 3G04A 3EDJA 2RGSA 3H7BA 1KGCD 1M6OA 5I8EA 4KJWC 3U4BH 5F9JA 4FFYH 4DVBB 4LLVA 3C60C 3K0WA 4D94A 3MLRH 1J7VR 3CSYA 1CG9A 1KLGB 4HJ0D 4RFOL 3BP6B 1KFAH 4OD3L 3KXFB 3D1MC 3LB6D 5DUML 1J8HA 3GSOB 3K2UH 4UOW0 5IVXE 2VAAB 2AJZB 2BNQA 1ZLWK 4P2OA 2V5TA 4XNQA 3KG5A 1K2DA 4XVTL 2FGZA 3RA7L 5JW4Q 1ZTXL 3FN0L 3SE8L 3MUZ1 3RKDC 4P4KC 3NACH 1UJ3C 5A43C 2A74A 5IB2B 3QDJE 4JN1L 1OAKH 3ULUH 5EOCL 2RJMA 5I74C 3LIZL 3GHEH 3JSSA 3AM8A 4UILL 4GKSB 1PY4A 4GBXD 5GGVY 3QCTH 4TSCH 4Q74A 3W0WA 1IGFL 5K59F 3CFDB 4J3OC 1XEDA 4TQEL 4JFXB 4F80A 1AH1A 3OB8A 4WW2B 3GSRA 5JXEA 1M71A 5HYJB 4BZ1L 3CH1A 3O6FD 2E9WA 4NQCA 1UEMA 2NY2B 4HUWA 3L7FB 1P5VA 2DI7A 2F8OA 1MY5A 3WL9B 3FO9A 5B3JF 2C4FT 1AGBB 2H2PC 4PGZA 4NC1C 3VXUB 2IANA 3JWDC 4MDJB 4PJ9B 5SX5K 5K33A 1S8DB 4IRZL 1RQ5A 1ACYL 4TSBH 1T1YA 2F58H 3PWNA 1ZHKB 4KRMB 5ICXA 5DD6B 1J0KA 5I1HL 5CZXD 4LHUA 1IAOA 2GY5A 1I9JH 3ARSA 3EO1B 1UM6H 3SGDH 1KCUL 4MB4A 1MIEL 3C5SA 4NKOA 3D85B 4LPCA 5I15L 3C6LC 3O3DA 4JFEB 2FWOA 2ZPKL 1PZ5B 1CS6A 3ZDYF 5C0NC 3BPNC 1KTLA 4AIZB 3AM8C 2VTFA 1OAQH 1QZ1A 5D1QD 5EZOH 2I9TA 4JG0L 2W9DL 5T1MA 3BD3A 3U30C 4RMTA 3SE4A 2ADJA 3OJDA 2BXZA 1U8JA 5DJXA 4NWUH 4ETQB 1A9EB 1K8DB 4BH7B 5ANMA 3T4YA 4Z5RA 1C12B 2XN9D 3U7AA 4M6AA 6FABH 5ESQB 4DQOL 2BMKA 3B3IA 5DJ0A 1P53A 3U1SL 2WMPA 1YEDB 1A6UH 4JRXB 1T66C 4A2MA 1I4FB 3FRUA 3MFGB 1MOEA 3GI9H 3B9KB 3DVGB 5DRNA 1W0YT 4PJIA 5GS1C 3TIEB 4B53A 3J7HA 4ENEC 2IH1B 1XZ0A 4QHKI 3MLVH 1CDYA 5K9JH 4QRQA 1QRKA 5D2LF 2O5ZL 2YPLE 3WFCL 3SJVA 4GKNB 4ZUTA 4ZFOL 5C0BD 3F62A 4K8RC 2YN5A 5LXGL 1OGAA 3GMPA 1P7QA 3K8LA 4N0UA 4NN6B 1OQXA 2UY7A 5DD0L 5FV1L 4Y1AE 3VXSD 4ZS7H 4JRYA 5K9KB 4C58B 5D1ZB 2ZUTA 1R24B 4YFLI 1VHPA 1I7TA 1WC7B 3BGAA 2ID5A 2OK0L 5DZLA 3ULUC 1A3LL 1YEFL 2P7TB 1BOYA 4M43L 4HIJB 3MNVB 1RK1B 2BSSB 3WLBA 4I0PD 4I77H 4N8VB 5J8OA 2NX5A 4HHAB 1KC5H 3FB8B 5GSVA 2J4WL 3AS1A 3AMLA 1CFVH 1H15B 2AGJH 3OKDA 1KTRL 4U0RC 3HE7B 3UTTE 5CEXA 4E42A 5KTEH 3FQTA 4P2QE 5L2JB 1U3HB 3L5IA 1G1CA 3SE9H 4PD4J 5E6ZA 4DN3L 2R23A 2W65B 1ZSDB 1XIWB 3T2OA 2Z8SA 5E8EB 2ZUQB 4APQC 1DL7L 3I75A 3ARGD 1JTOA 2PF6A 1AGEB 3UTZB 1LEIB 3SCMB 3AGVA 3BAEH 2IAMC 2HJKB 4PJXF 1YMMA 5IB4A 3QYCA 3EKCA 3B2UD 5E9DB 3C5JB 3FRPA 4OD1L 2DRUA 2E9JA 4DGYL 3ZE1E 3ARYA 1IL1B 4ZO9A 1NGPH 1YJDH 2I5YH 5KAQF 4FTVB 3DMMD 2D7PA 4P5TB 3MV8B 4R4NC 2DWDB 3UTQB 1CLCA 4JDZB 4NSKB 4Y16B 5EORL 4EOWL 3S88L 1DQTA 3BWAA 3LQAL 2GITA 3L3DA 3T0WA 1NAMA 2BZDA 3DX7B 4K7PL 1IEBA 4HPYH 5FGRA 4X5WB 4HUMB 3QQ9C 2IFFL 4OIBA 4NZUL 1NANH 1VEMA 4NKMB 35C8L 4K2UL 1I1CA 4CNIB 4JDTL 1CU4H 2A9NL 5INDB 1Q72H 1ZT4B 4XRCB 2FO1A 2O26U 4EN3D 3ZYOA 3KPSA 3WYRA 3QFJA 2QTEA 2BVTA 2HVKA 1BECA 4FZEH 4LLAA 3NCJL 3NCBB 3BQUD 1QTYT 2Y06H 2YA0A 1I8KB 2R2EA 3MV9E 1I3RA 1WWWX 3DETD 1MJJB 3PNWB 1EZVX 3JVGA 4JZNA 1P84J 5KZCD 3RBSA 5CJOH 4K94L 4G7YL 3RNQB 5LGJB 2VIRB 3RY5A 1J0JA 4LIQL 4R3SB 4WY7H 4C57C 2DTMH 3U0PB 4PJ5D 5J0BA 2X4UA 4Z0XA 2ADIB 2Y25A 5HHQB 3I9GH 1OD7A 4ZPVB 4L4TE 3WNMA 1AQKH 3FT2B 1YA5A 5K93A 4YHML 4FFWC 3TYGL 4WDIB 1CGXA 4KJQC 5E8NA 1FYTD 4EI5B 4WV1B 2YZ8A 3BZ4A 4IIQB 3QG7L 1CLOL 3DXAE 3VH8G 1WLHA 2VDRH 3MCLH 3MO1A 3CX5J 3P30H 2FJHB 3S37H 1H3GA 3KS0J 3T3ME 1CFQB 3KPLB 1TFHA 1YQVH 4TTGA 3NIGF 4RGNB 1D6VL 4GJTB 1B0RB 4UU9B 1D5IH 3NGBB 2ZUYA 3OKLA 2JKXA 2FECI 4GRLB 1XF4A 1QD0A 1S7WB 1T80A 5J11C 1BBDL 3TA3A 1OM3L 4MXVE 4U6XA 2DKUA 3AUVA 3GSNB 4G6KH 3CFCL 4AEHL 4OZIE 5FEBA 5HVHB 2AQ3A 1DBKH 4MLSA 3DV6A 1EEUA 2JJSA 4K3JL 4U6YB 3GMNA 4YHIB 1R3JA 2Q3AA 4PJGA 2Z91A 1DN2A 5MERB 4N0CD 4Y4HC 4DN4H 3CSBA 5C8JB 3V8OA 5DC0A 1EFXA 4DK6A 2ORBL 4KI5E 3E3QE 2DBLH 5B8CA 4NO3A 3FQXA 5E6IB 3VFVB 4HK0A 5GRXG 3TN0B 4X8XA 3MJ8A 2A73B 5I1LB 1I1AA 3VI4F 4LLDA 4KHXL 4WU7B 3DVIA 3F7QA 4G9DB 2GCYA 1NFDA 3KPPB 4RX4D 3C9NA 4HZLA 1EX0A 3PWPE 4NQSB 5F44A 5TF1L 2VLJB 4U1HA 5D5MF 1WAAF 1YN7B 4DAGH 1RJLA 2IALB 3T0ED 4F7TA 5FCUH 1UZ6F 3F7RA 5SWZD 1BWWA 3CK0H 1ADQL 3KHQA 5IMLB 2ITCA 1UWEL 2FJFB 2VDLH 4P46B 5D1QA 4I8DA 4PJFE 4KKNA 5F6HJ 2VZVA 4OZ4B 1K8IA 4OTXL 3U6RB 2ITDA 1R5WA 1FZMB 5DUPL 2ZP0T 3DHJA 2VABA 5HD8D 2DM2A 3OKNB 4HMEA 1NBVH 1J11A 5FAAA 4UINH 5DJCA 4XVUD 1FL5B 4JPKL 5EUOE 1L9NA 1M7DA 3U9PL 4LEXL 2HKHH 2YD6A 5EU3A 1CLZH 1I3UA 5D93C 3RDTD 4HKXA 2R2BA 5CD5C 3QHZL 2X4PB 4KPHL 1J8KA 3MCKA 4PJAA 5CUSH 3DI2B 1Z3GL 1R3IL 1LDPH 4RISL 5LVEA 1I1AC 3VXME 1NAKL 5HPOA 2VXVH 5GJTL 4YHNA 4P2RE 1F6FB 1HHHB 1FLTX 4YO0B 3WHE0 5KN5A 1S7UA 5C0BA 3TNNB 3FN3A 3TT3L 2ARJQ 5T1KB 2DYPA 1ULVA 3TYFA 1Q94B 1MQKL 2FIKA 2FBOJ 3SPVA 3F6LA 3PWJA 3SDYH 1RUAL 4LLMB 3P0GB 2V2XB 1X7QA 3R1GH 1TITA 4RFEB 5DSCB 4PRIB 5FHAH 5JO5A 3B9DA 2Q76B 5EZLA 2WBJB 4CMHB 1JMZA 3LS4L 4YBHA 4QRTB 5I8KH 3C08L 4AQ1B 4X7SH 3ZLQC 4NCC1 3UBXB 1JJUA 1FN4A 3CU7A 4ELMB 1INDH 2BJML 1FVDB 1KPUB 4HBQA 3WUWG 4PV8B 4H0IA 1BP3B 3NABL 5DRXB 1P6FA 2VISA 1ZVYA 3DUHA 5IBUG 1F2QA 4G6AC 2OL3B 4R4FL 4M7JH 4K3GA 5BV7L 1AHWB 4DOHE 1MJUL 1S3KL 4HPOH 5EOQL 4GAGL 3EOTL 3FQNA 4YHPB 3C8HA 1UYWH 2NY4B 4GG6E 4UV4H 4JFHD 2CLRB 4M48L 4OF3A 5DDHB 4PJ8A 2Q7NA 4U1MA 1MHPH 3ARFC 1DLHB 4F9LC 4QY8B 5I30H 4PRHE 3DMMA 1KJMA 3RAJL 4DVRL 1YYMH 2H26B 4UT6L 3LMJH 5EUKA 4F9PC 1H3UA 5H8DA 1GCFA 3MOBL 1FBIH 1MFEL 1TVBB 2BVYA 4RCAA 4X9GA 4Z18A 2PXYD 5I8OH 3SE3A 1H3PH 2VZSA 4L9LB 4JFYA 1NGZA 3O6LL 1MQ8A 1RU9L 3L5JA 2HRLA 4XB7A 4ACPA 3WO4C 3TO2A 5A16B 4JLRA 2FSEB 4HMDA 5DC9B 1IE5A 3HA0A 1H8OA 5DA4A 4Z7UF 5C92A 1F8TL 3JV6B 1TZHA 1T3FB 3EFFB 1FV1A 2B2XL 3RVTC 5MEND 4EN3A 4F2MB 2JELH 5D7KD 4HZAA 4C56B 3SO3B 2W60A 5ESVA 1YN6A 1K5NB 1PKQE 2YPVL 3A0OA 4KMQA 3PDGA 3BDYL 1W8OA 2G5BA 5I1IH 3CFBA 5FK9A 4KMTH 5DYOB 2QSTA 2GJJA 4NC2B 5E08H 3WD5L 3MA7A 4FXKB 2H9GA 3ES6B 2YC1B 4OUUA 2QKIB 1NUDA 1F90L 2FX9H 4PJ7A 5ERWB 4U6VH 3T77B 1M4KA 3UC0L 5KVFH 4M6NL 2XQYK 4PYGA 3MV7A 4GMSL 4W4NA 3UTPD 3WN5A 5T5NG 1YEEL 4BUGA 4MDIA 4RNRB 3A67H 1D3CA 2OTUB 2OJEA 4Q9RH 3QPXL 2VWEE 4LCCA 3ARDC 1YZZA 5ADPL 1A1OB 4QXUH 3SDXE 3UYPA 2PW2B 4Z0BH 3N1PC 3KPOA 3EOYG 4OCYL 1CIUA 4JFDB 1WVZA 3ROOA 1EO8L 1W0WB 1CDJA 3N0PB 5E1AB 4KAQH 5C6TH 4ETYA 3C2AL 2LU7A 5I1EH 3OKEA 4LKXB 3D9AL 5SWSA 4G7VH 2EDJA 1AD9A 5ACZA 1CTNA 1B90A 3UAJC 4FFZL 4V1DD 3VXTA 1T1XA 1NJ9A 3LHPH 2AK4E 4ZOBA 1S9KC 1V05A 4DKEH 4A2LA 3G5XB 1WZKA 3BW9A 4G6JL 5A2FA 5C2UB 2QJDA 3FOLA 1DFBL 4XMLL 5FKPA 5FUCE 5IB3B 3CC5A 5DF0A 2D03H 4WGVB 4PGCB 1FRGH 4YUEL 3TEUA 4DWHA 43C9B 3K8KA 1NFKA 1NBQA 4ZTPH 4G8EB 1KB5B 4KJWD 2JJTA 3HMWH 3S3SA 1JV5A 1YNTB 1IGCH 5C08B 2NTFA 5BZWA 3IDMA 3MX0A 3OXRA 1WCBA 1CZ8L 1NUNB 2RFXA 4PJCF 2D0FA 1KT2B 1NGXB 3RI5K 5CJ8A 3RL1A 4YHOL 3A6CH 1YUHB 3B5GA 4UDUB 5D2LB 4OZHF 1JBJA 1FG9C 4QXGL 3BRDA 3DURA 5CJBA 2MPAL 1NBZA 1KJVA 1AGFB 3FHQA 4RAVB 5HGDA 3W2DL 2ILLA 4AK1A 2RCSH 3PE9A 1CGUA 2PKDA 5B38A 1FFQA 4X4ME 1XCTB 4ZFFA 5LKNA 5DR5H 3RUGE 2X7LB 3TCLB 2EE6A 4MVBC 5T3ZH 4RX4A 4N5UA 4NNXA 2HAZA 1SM3L 3NAAH 3TBYA 2V5SA 4BQ8A 3K46A 3EDFA 5JOPE 3H3PH 3QIUB 3SDAC 2EC9U 4ELKB 3T0EA 4JAMA 3GB7A 1U8PB 4YE4H 5EU5B 3BJ91 4GQPH 2B4CH 3G6DH 1JGLL 2H3NA 4XC1H 4ZUSA 3A6BH 4UIMB 4LNRB 2YD8A 3MRLA 4XPBH 2UYLA 1RMFL 1F4YL 3QEQE 1JZ5A 3O6KL 4O2EA 4GW1B 2E7LC 3C5ZC 2NPLX 4KTDL 1H3VA 1IEHA 3QDJD 5I2IB 3ZT6A 4OCWH 3RU8H 5EU6B 4KHTL 5D7IE 1JPFA 4WUUB 3EYVA 3MODH 4G80B 5DJ8B 4DZ8B 4W4OC 1DANT 4X7TA 5FUZL 1RZKH 2GJ6E 5B21A 5GGSB 3E2HB 4I18B 3B8SA 3GZKA 2H2PD 4Z95H 1RZGB 1LO4L 3V6OE 5DS8A 2FCBA 3E1F1 3UMTA 1FH5H 4KY1L 2FNBA 3AREB 5EC1B 4LFHD 4RA3A 3I50L 2P42B 3KXFE 4CDHA 5GISH 3E8UH 3ULVE 1ETZA 2DDQH 3B9AA 1DBBL 3SGKA 5F6IB 5DUBA 1IMHC 3T08A 4YWGL 4F57H 1C7TA 3X14B 1DE4B 2P1YA 12E8L 1WJ3A 3OB0K 1MRFL 1CLYH 3O2DL 1UGNA 2FATH 2HT3D 5LAXB 3V6OC 1HZHL 1D5MB 5C0ND 1A9BB 1N4XH 2MCPH 1OLLA 5DLMH 5IJVA 1SY6L 3GUTB 2R4RH 2G75A 2V2TB 4WRLA 1MCCA 3MOAH 1G9EA 4NOBA 1LO0L 2VB5A 3NH7H 5I71C 4DW2H 4NFCA 1TNNA 1B2WH 3NTCL 1W2KT 4OLXL 3BFOA 4F8TA 2OJZL 4HUXB 3OAYH 2GFBB 1A0QL 1MFBL 4GW5A 2X89A 4ZSOA 4XPTL 5FYJE 5INCA 4X0KA 5JUEL 2YWZA 3X3GH 5CILL 1YEHH 1OT2A 3RZCD 2PYEB 4XGZA 4R7DB 5IEKB 1OB1A 1QFWL 4KTEL 4S1RL 5IKCB 4ZDHA 2V9RA 4PJAF 1RUQL 5JZ7D 5E6YA 3U4EB 2APTA 3QEGH 1CT8A 4OSUH 4A6YB 4N1HB 5CINL 4U1SA 4K8RD 4YFDB 1A6AB 2C9AA 2HA1A 1I3GH 2GSIB 4FXGB 4O58H 1XGUB 4G8FB 5I8CB 4R90L 3VWJA 2J6EL 4K8RL 4MCYB 2B7DT 2QR0A 4J3SA 3JUYA 2DS4A 4Y4KD 3LKRA 2D2OA 3GGWB 1G7QB 4GMTL 3IDXH 1TTUA 4HT1L 4UT9H 4NKIH 2YPLD 4QRRE 5DJDA 2EZ0C 5BS0E 4UTAH 1ZXQA 3U2SB 5ISZB 4KK6D 3RX8A 2HWZL 5K9QG 3VRLE 4RGOL 3L6FA 2ICEB 1P9MA 2B4CC 2FO4A 2KKQA 3SGEH 5HHNB 1D6EB 3BGMB 1K4CB 4D8PB 4AL8H 3VDAA 5J3HD 1N6QH 3KYKL 4PD4K 3BPLB 1FNSH 2H45A 3RP1A 4IMKC 3P11L 1SHMA 3MACL 5E2WL 5EFIB 2IPUK 1FLRL 2WAHA 5GJSL 3ARVA 3AC0A 1A7NL 1QSEE 1VFOA 1TJHL 3BIAX 2DBJA 5HHXL 1NLBH 2XNAA 2VDNL 3UTTD 3QDMA 4XH2B 4P2QD 4WI7A 4MWFB 4JN2A 1KEMH 1DBMH 4MMXC 1A1MB 4Y4FD 4OZGF 5ELIA 2EE3A 2W1NA 1AO7D 5DT1L 4ZYKA 1JPTH 3RGHA 3S36H 5E5UB 1NEUA 2FB4H 3WIIL 2AK1H 5HI3D 1T83A 4RZCB 1CG9B 3RGVB 5F9WB 4LMQI 4YHKL 3RWJA 3TJEH 1FG2A 4M8QB 3FT4A 1LEKA 4KQ4L 5JIIA 3DX9B 5IGXL 3GRWL 4N1CA 3ILPB 4Z7VF 5IMKB 5JNYB 5I1AA 5D5MB 2C3GA 3KWWB 4YDIL 1OLZA 3DUUA 1QBLL 3FQUA 3QXDB 1VFBB 5I76B 3LPGA 1F4AA 3SDDD 4KRPC 3BGFC 4V1DA 4GXVH 2BXYA 2UWEE 4LNVA 3K8MA 3WFBL 3RJQB 1AFVL 4TN9A 3L3JB 1FCCA 2NW2A 1U8QA 2WIIA 1INQB 1EJOL 1P84K 4F7CA 4NP4L 4G8GB 4HCRL 1N0XH 2XQBH 4Q9QL 3RWGA 5IQ9A 2AEPL 3EHBD 5AZ2L 2R0ZL 4HQQL 1J1PH 3QIBD 3PABB 4U1LA 4NGHH 3ZL4H 4P3DB 2V7NB 4DGIL 2VXSH 1A7RL 1BGXL 4KK9C 5I0DA 1EHXA 4XCFL 2ZCKL 4WWID 1E6JL 5JHDB 1T83C 3MV9D 4FFWD 1H5BA 1UWGL 4WI4A 4XPAH 4FTVE 3GM0A 1HHGA 4UQ3B 1XGPB 1T03L 1HQRA 2Z9TA 1UC6A 3MROA 3EJJX 5KVDH 4JY5L 1HH9B 2ATPA 1JPSL 1J5OH 2HKFL 4X6FB 3CX5K 3K1DA 4L4TD 3SOBH 4N8PA 1JGUH 4HFUL 4M5YH 4BJLA 1QBBA 2R56L 3HPLA 2JJVA 3MRIB 3KYNB 4P5MA 5LQBH 4OM0H 3RWIA 3OPZL 4L3ED 5FECA 1HQ4B 2J8OA 1RIVL 4X7CC 4XMPL 5FA4A 3DXAD 1W72L 1VACA 1FJ1B 4WU5A 3F58L 4NUJB 5E2VH 1D7FA 3U0TA 1UADC 4JZOA 1P4BL 1SEBA 5EOTB 2DAVA 2MOVA 1N59A 4F33B 5L2KA 1HHKB 5C09D 2EEAA 1ZVSA 4DEPB 1O7SA 2WUCL 2HFFA 1VFAB 3LN9A 4MNQB 2J7LA 1FZKB 3FFCB 3Q6GH 3SEPA 5HGHB 3THML 1FAKT 3QG6A 3NPZB 5F1IB 3KDMA 1K3ZA 1TQBB 3QDJA 5FYJU 1Z2KA 2FH8A 3VCLA 1CD0A 4LF3A 4NO5A 2XWBA 4H26B 1H5BC 3S37X 4UV7H 3NIDE 4JFOB 4Y4HD 2DQEH 1U0QA 3RPIA 4WO4B 1Q9LA 4FQ2L 2Z8RA 4HK3J 5LGHH 4K23L 4WNQA 3WS6A 1JGDA 2EYRA 2JCCF 5CS7A 4R26L 1I9IH 1W0VA 2B5IC 2EDHA 4YAQA 1EZVY 5IWLA 1MEXL 1WEJH 2X4NB 2ZNXA 3O2DA 5TFSH 1S7SA 5C0JB 2VQ1A 3O2VL 1BZQK 3HI6L 3GMMA 5FHBL 4ZPTA 3GK8H 1A14L 1S7QB 3FT3A 1BFVH 4KI5D 3BIKA 1FFOB 3IXTA 5I9QC 1TETH 4PJBE 3IDYC 2A1WL 1SY6A 5DMKA 3QEHA 1YDPA 4IRSB 1Z9LA 3NIFF 1E27A 1ONQA 4CW1B 5D7LA 5GPRA 3RPKA 3V0VA 1FPTL 4X6CF 4NFDA 2AEQL 1CCZA 1K6QL 4GRWF 3HE6C 5ICZA 5MEQA 2BFVL 3PWPD 4Z7UB 1ORQA 2MMXA 3BWUC 4E42B 4NKDB 2OR9H 1TMCB 3TBSB 3SKOB 1QSFA 1BJ1J 2H8PB 5CD5D 5ADOL 2BVPA 5CBEA 5EO1A 4XPGH 3SGEI 3QEUA 4TULL 4X8JB 4U1NB 4PJEA 3TGXA 4KQ3L 5F3BB 1BBJB 1YNLH 4UNUA 4CVZA 3GMLA 3ZO0A 4WFEE 3D3VD 4QGTA 4IJ3B 2X9XA 2PTUA 3BT2L 4HWZB 4FQXD 1GGUA 2LU4A 2FEEI 4ESKA 2V7HB 1VPOL 5C0CA 2J6EA 5E1HB 1FO0B 3VWKD 2ERJC 3HN3A 5CEZE 2FR4B 2PCPB 1NEZG 3B8YA 4MAYB 5HBBA 3IB4A 4LBEB 3T65A 4Y5VB 3HNVL 3MRQA 1DN0A 1Z0NA 4FZ8H 5E8OA 4U31A 4TNWF 2VLJE 4Y7MA 1I7UB 3VXMD 5AEAA 4B5EA 5BMFH 4P2RD 3KPRB 5CEYA 2Q6WB 3GMRA 5KANG 4JEGB 2YPLA 1U92A 5K9OA 3WIFB 1MCWW 2W07A 3DYMA 5A2LH 1RK0A 3FMGL 1KUMA 3MLSH 3O9WD 1G7LB 1VFMA 3P0YL 3VXRB 3TNMA 2DLGA 3DBXA 3FAWA 5KBNC 5MI0C 1X5KA 3H9SA 3QWOA 4FQQA 4LVHC 4KVNH 4XCCH 3FOMB 5GS2H 1S5HB 3M07A 2HVKB 4ONHA 4YBLC 4PLKD 3MRMB 4LSUH 5AD0B 4MLIA 2AERT 4G6AD 3FO0H 4M93B 2LQRA 3LDBB 4GSDH 5DRZA 4HXAH 3WFEH 1A1NA 1V7NL 2OCFD 3ARBB 2XWJB 1OSPL 1JP5A 4ZOAA 1G1YA 2N7BA 5DEFB 4P2QA 3OKKB 1A6TB 4BUHA 5D2NE 1RZJH 2GEEA 5C0AA 4Y4FA 4FQHB 4HW6A 4Z0XB 1QNZL 1AO7A 3QUZC 4PJCB 3G08A 3ARFD 4JPVL 3WXWH 4AMKH 5F72S 3TBTB 1QUNA 4YDLB 3C8KA 5HHME 1UACL 1XGYH 3PV6A 4LP4A 4OZHB 3AU1B 1SEQH 4LKCB 3GBNH 1OCWH 1GZPA 1QR4A 1HYSD 1MCNA 2O5XL 1F4WH 3K3QA 3DX8A 3E6FB 1AQDB 3OZ9L 4QTIL 2JE8A 2AXFB 1F58H 3GRWA 4WUKL 4FN0A 3C87A 4MCZB 4ODTH 5ALBH 1MIMH 3MRFB 4PRIE 2VR9A 4YX2L 2Z31C 4X98B 4CVWA 1KXTB 4GW4B 1PLGL 1OPGL 4PRHD 3T0BA 4KI1A 2DQCH 4K3HA 4HJGA 4RRPA 3RVTD 1TZIA 4ZXBC 2AXGA 1FYHB 5M95B 4RMUA 1I8IA 2AJSH 4LRNH 3MBEA 4PLJD 4Q6IA 1F3DH 4KU1A 1P7KB 1ZAGA 5B22A 4LCWE 3SDDA 2A2QT 4L3AA 4GAFB 1JK8A 4HCRA 1RHFA 5BO1L 3T2NH 1AKJA 1F00I 1UKSA 4GBXB 3I84A 1MHEA 1ZHLB 1NSNL 4DCQA 1GGCH 4KVCL 2W59A 2VITB 1CGVA 2YUZA 3TIDB 1T0PB 3V4PL 1REIA 3QNZB 4KROC 5DXWA 3S5LA 3LN5B 2ZOLA 1NUFA 1U91A 2NY5H 1OWWA 3MRCA 4X7DC 3BHBB 5DZOA 3IXAB 3O6FB 1N3NB 3L5HA 1U8NB 2AP2A 5MEPB 2B1AH 4KMLB 1A6WH 4TVPH 2F5BH 1LO5A 3JUZA 3CVHL 3UTSA 4K71C 2SEBB 3BN9C 1HNGA 1TZGH 4JKPH 4QRPB 4PRPD 1RFDH 2EXYC 1B4RA 1C16B 1A7QH 1RIUH 5GGQL 3RWHB 1BQHG 5HYSG 4XP5L 4LOUC 5GRYA 3DSNA 3C09C 1LP9F 3L5XL 5LCVL 4H1LH 3C9NB 1G9MH 1CD8A 1ZS8B 4L4TA 1OGTA 1J1XL 4JHAL 3WS3A 2HG5A 3ULSA 4OGXH 1T0NA 3KGRA 3V9FA 1W72A 4L4JA 4O2FA 1MWAH 3VRJB 3ELAT 4Q6IC 4L3EA 4OD2A 4EBQL 4LLQA 3BP7B 4NNPH 5JHLL 4W6XB 2MWCA 2WW8A 4QXTB 1UXWB 2CJUL 5CJQL 3EO9H 3VMOA 3O4OB 3HNTH 2VL5B 1YECH 5C09A 3LEXB 3VFOB 3CFEA 3CPLA 3OV6A 2XN9B 2EE2A 1T21A 2DB8A 2AW2A 1RZJC 1S7VA 1XGRB 2AK4D 3GBML 2ZJSH 2BNRE 5DTFA 4YHLH 2BSED 4PJAB 4LCUA 1IGTA 4ERSH 1Z9MA 5CD3B 3GSUB 1E4XL 2PETA 4RAUA 4ZFOB 5ENWB 4FG6C 5LWYL 1JNLH 1RZFH 1CGYA 1I9RL 2CKBL 2DMCA 2NR6D 4RWHA 4WEBL 5JMRA 5J12C 5HYFA 4OKVA 4HV8B 1IBGH 4OGZA 5DVNA 1FVEA 1ZGLM 4HH9B 3RWFB 5E0QA 1A47A 1JF1B 4RWYL 1TCRA 3VXSB 1GGIL 4H1LA 1C5BH 3VD3A 3QULA 3JV5A 4JHZA 1FZJA 4I2XB 2I26N 2AJXH 4LP5A 4XAKE 3ZMRA 1J05A 1CDIA 3T3PE 1X9QA 3G6AB 1FDLL 2DJ4A 1MWAA 3CFJB 1XR9A 4Z7WE 4I0PB 1ZWIB 1G6RB 5BOZG 2VR5A 4JFQB 4YQXH 4BYHA 2F8XC 5H35B 5IVXF 4H8WL 2JB5H 4M62H 5I1GH 5J6GA 1MCLA 4LGSB 4JVPA 3PWPA 4Y5XC 1TDQA 4S0SD 1JN6B 1J0IA 4LARH 5CWSA 1FL3A 3TV3H 4U1IB 5JOPD 4JDVB 2YHGA 4HKBA 5IEHB 5TH2B 3GJFH 1MCBA 1B4JH 4D3CH 1ZANH 2QADB 5KVFL 2R69H 3HAEH 3QRGH 4F37K 2X41A 4XNXH 4GUPB 1QKZL 2YUXA 5D4QA 3ARGB 3GSXB 3Q6FA 3QEQD 3VG0H 4PGBA 1MHCB 4C83A 1RJZA 3QIWC 1KIQA 4KKCC 5JOEA 3IFPA 4OZGB 3PP3K 5HHOA 2A6KB 5F7UA 3WHXB 4Z6AT 4BFIB 3O4LA 4N9GA 3D3VA 4FQXA 3NA9H 2K1MA 3EYFB 2GJ6D 1U3ZA 2Z92B 4JZJA 4NQEA 5HYQA 3REWA 1LHZA 3VWKA 2N4IA 4P59H 1KPVA 1NCNA 1MH5A 5TQ2L 1P1ZB 2VRAA 4QHKJ 3KYMB 2GTWB 1A3RH 1CGSL 4M3KB 3KXFD 1FNEA 1FIGH 2CMRL 3ULVD 2ZSVB 1TNMA 2IPKB 5D1XD 3VXMA 1N5YL 1ORSA 4P2RA 2DD8H 4Z7VB 1JZ2A 3MC0A 4JQXC 4GAJL 3MJ9H 2E7HA 5TDPB 3ULVL 5CGMA 1S7RB 3W9DA 5ACLA 3ESUF 2H6PA 4JPWH 1TJGH 1N64H 3GMOA 1WBZA 1HDMA 1SYVB 4OCLC 5I6XB 1BREA 2VDKL 4WUUE 1HEZB 4GG8B 3GJFA 4ONFH 1VDGA 2G5BB 3ZTJH 4BH8A 2ESVA 4LEOB 3BQUB 2E6JA 2WWMC 3DX6A 3U9UA 2K7PA 5I16A 3GNMH 3L5WA 1XF2B 2DQGL 5KVEL 2HLFC 3ARWA 4X9HA 3VFSA 4WFFE 3TZVC 1FL6B 3MYJA 1I9EA 4EVNA 4TNVK 1A7PL 2NY0D 5FYJD 3PWVB 2Y4SA 1G9NH 1DR9A 3MLUL 4ZO7A 1IC4L 3VG9C 4PV9A 2XI9A 3AROA 2NY2D 4QXWA 4X99A 5EPMA 3W39B 4H88L 4PJ5B 3ILQD 3O3EA 4JANA 4HIIB 4PLOB 3QZWG 5FYJL 3CUPB 3AS0A 1IGJA 1BAFL 3OTTA 1N5AA 4PJ9D 3MJ7A 3PWUB 1EAJA 3T2PA 1KLUB 15C8H 1FYTB 4G9FE 2E27L 1E4KA 4WTZG 3RL2B 4UI2A 3PXHA 3W82A 1JF5A 3P3YA 3QDGB 4M1DH 3LV3A 1IGIL 1CD1A 2X4OA 4JFFA 3VFMA 1VFUA 3PF2A 3OXSB 5C2BL 2P5EA 4GQ9L 4MNGB 2COQA 2AJUL 1MREH 4N8CH 4I3SL 2BHZA 1OAXL 5J13B 4PRHA 2EDRA 4TOYL 3WFDH 3EDDA 5BS0D 2R1YA 5GRJH 2UY6A 2IF7A 1MLCB 3CFKA 2X4TB 5C0RL 4ODHH 4N0YL 2Y5TB 1DBJL 4WIQA 1SJVA 1V7ML 2HJFB 1AIFA 3Q48A 4NZDA 2EDTA 4U6TA 5CSZA 1WBXB 4M6MH 5TPWL 1IQDB 5DHYA 1LE9B 2A77H 3WFHA 3LN4A 2A0LD 3TO4A 3OL2A 1YPZE 5F9OL 1KCRH 1A4KA 2R0LL 3NCEB 5HI4D 5C07B 2QSQA 3IDMB 1C1EH 2VE6A 1WCBB 1QSED 1FGNL 3AXLA 1XF5B 4R0LB 2KDGA 3DV4B 2PTTA 3OBAA 2JCCB 4PP1D 5DMIL 3OG6B 4W68A 1RIHL 4HIEB 5ESAB 4OI8A 5TDOB 3SKMA 2CK0H 4PRPA 2Z93A 1DQJB 3DI3B 3MRKB 5B38B 1DUZB 2NY7L 4KDTC 4GKOA 4YDKL 2HT4C 4UBDC 2NY1C 4PPTA 5HDQH 3ZE1F 3H2WA 4X4YA 1CICC 1IEAB 4NT6B 3SDXA 3OMZA 3ARZA 1I75A 1M7IA 3MMEB 4YHZL 4CN6A 1N2RA 5D71H 3IJYB 2J3SA 5CGYC 5E5RB 2J8UE 3T0EB 4X6CB 4M61A 2DM4A 4GRWB 4FQJH 5SWZB 3S36X 1EEZB 4P9ML 2FGWL 4XTRD 1MCIA 2G60L 2YBRB 2IPTH 4EKXA 1ZHBA 1D9KB 5AYQA 3MNZA 3O41B 2IPUG 3I6KB 3IFOA 3QH3A 2GT9A 4H1LG 5IMOA 3TO4C 3REVB 3CLEH 4HS8H 3GKWH 2K7QA 4XNZC 3CZJA 3HZVB 4D9LL 4S1DC 4ZS6C 1PYWA 3BH8B 2AK4A 1XIWD 4CU8A 3RDTB 1CL7H 1BIIA 4U3HA 1HYRC 2AJYH 1B6UA 2EYTA 4G43A 4UT7H 5JLZA 4UTBL 3SCMD 3AB0B 1LDSA 4GO6B 2HH0L 1A6VH 5FA3A 4JVWA 1T7VA 4I48B 2P24B 3KNBA 1I85A 1ZEAH 2P46B 4QF1A 1DVFA 1QG3A 4EEEA 1U2HA 3RIFK 4FTVD 4P5TD 1T89A 3EJZC 3S4SG 1CR9L 1GAFH 1NCTA 4XXDB 2XZQH 1EVTC 4I13B 3BH9B 3DVNB 4JHWL 2VN4A 4PP2A 1KJ2L 4RGMB 5IJVB 3UZEA 2G75B 5F7EL 3ZKXC 1UEYA 3HC3H 3IDNB 1EUUA 1P7HL 4X4MA 4Y5YB 1OP3K 4QYOA 4ONGH 4M4RA 2WLYA 2Q8BL 3N06B 5D6DC 4H5SB 5IJKC 4I4WB 1YEGH 5JR1H 3T3MF 2ZOKB 2XG4A 4IEFB 4M00A 1F5WA 1S7TA 5JIKA 1JTPA 1EGJH 4CRPA 3T04D 3QUYC 5BV7B 5DEGB 3WIHL 3MLWH 2XKSA 4OV5A 2J8HA 5MP6H 4OM1L 4U6HA 4MXVF 2CUMA 3CDGB 4MJIE 4R97C 2XZZA 3QUXC 3WKMH 5IP4A 2XPGB 2YR3A 1KCVH 4M8VA 2LVCA 5D7IA 1DVFC 3MRBB 1DDHB 4OZIF 2VSCA 4QHUB 4FQCL 1HWGB 4DVBA 1MAML 2X4RB 3PQYE 4OT1H 2AAVA 2CGRH 2L4OA 3ORJA 1LO2H 3HAEG 2Q7YB 1CE1L 1KLGA 3INUL 4KI5F 1WBYB 4Y88A 3BP6A 1OTSC 3KXFA 5FGCB 2PTVA 1JMXA 4JG1H 4OF5A 4K3DH 3OAUL 4P57B 5IR1B 2VZ1A 3GSOA 3SDCC 1M7XA 2PXYB 2VAAA 2AJZA 3AS2A 5A3IC 3N85H 5FIEA 2YA2A 5KSAC 1DSFL 4Y89A 3NCCB 1BHGA 5EBMB 2XACC 4MNQE 4GS7C 1LK2B 1NC2D 3UPRB 4ZQKB 1U58B 1YYLL 2GK0B 5IB2A 5MENB 3S3PA 1CDCA 1JZ7A 4GRLD 1EBAA 3C6SB 4LLUB 4GKSA 3BZFB 4LSVL 4PJFF 5DK2B 1AJ7H 1VERA 2FEDD 4ZUWB 3CFDA 5I18H 4UIKH 5L6YH 4QRSB 4OQ1A 4WW2A 5DVLA 4JO2H 1FNGB 4XP4L 5HYJA 3GSNL 3UJJL 1LGVA 2XXCB 5EUOF 2D7OA 5E24E 5I75B 4MAUL 3R06B 3L7FA 1I1FB 5IFHL 2ZKHH 3IKKA 3QO0B 5AYUL 5EOCJ 3ZTJG 1AGBA 2XTLA 2DLFH 4I1NB 4WFED 4MDJA 4PJ9A 4NM4H 4PRAB 1YNKL 3TN0D 4NBYB 1S8DA 1JFQH 1JUFB 4KV5F 4MZ3A 5AWNH 1CTOA 1LP9B 3RTQD 4HULB 5CEZD 1ZHKA 5C0DB 1E4XI 1HWHB 5DD6A 3BUYB 5FM8A 3H42H 3EO1A 2R0WH 5E4EB 1GC1L 5TE7H 2GHWB 2BVQB 5EU4B 1PG7L 2VLJD 5CEZL 2R4SH 3D85A 1ZLUK 1HXMB 1WICA 4JFEA 3PP3H 1OW0A 1KN2L 4IRJB 3D2UB 3WBDA 1FFNA 1PZ5A 4J6RL 5CMAB 3D0VB 4AIZA 1QFUH 4P46D 3O3AB 2H1PL 3QUMH 4JFZH 1IGYB 5I19L 1QHOA 1U8QB 4YZFE 3QJFB 3OHXB 1KBGH 1P6AB 4L5FL 2IWGA 2HFTA 4I5BB 5IQ9B 5IFJB 2ZG1A 4ETQA 1A9EA 1K8DA 3QBTB 3QSKB 4BH7A 3HUJE 2CDGB 4U1LB 1NCBL 4LSSL 4WW2C 1C12A 3UYRH 4BQ9A 2EH7H 5ESQA 1X3DA 1MCRA 5CAYB 1DZBA 5IM7B 5DD5H 3IJSB 5KSBF 1YEDA 4JRXA 3OKMB 4OIIH 1I4FA 5TJWK 3ALPA 4Q2ZB 3D87B 5KW9H 3F8UB 3B9KA 4TRPL 4CKVX 3DVGA 4G5ZH 4K9EL 4TPRH 3AMKA 3ET9F 1LO3L 1PQZB 4NZRH 3TIEA 3NCYS 3R0NA 2IH1A 3FO1B 1IKNC 1LD9B 3HB3C 3MUGB 1MELA 3FZUC 4GKNA 4QT5B 4GG6F 3ECBA 1DUYB 1Z5LB 5HHMD 1FZOB 1YEIL 3BP4B 4POYA 3X11B 5D96C 5K9KA 1GZQB 2F53E 1R24A 2YD9A 4P4KB 5HVWA 1UJ3B 2I27N 1WC7A 2Y6SC 1JHKH 3QCVL 2P7TA 3PP4L 2VQTA 5I74B 4HIJA 3MNVA 1RK1A 2BSSA 5GGRY 5IVXB 2HVJB 3N9GH 2UZIL 3KPNB 4O4YH 4D9QD 4FFVD 4N8VA 4PRID 4HHAA 1RZ8A 2RIKA 3FB8A 1XCQB 3V5HB 3WLWC 1QBMH 1PBYA 2A6IB 4XPGL 4MA8H 2LE9A 1DCLA 4NQXB 4P5KB 3O2WH 2DJUA 4EQ2A 3HE7A 3DO7B 1TVHB 5C70A 2J88H 4Z8FL 4YXLL 5L2JA 1U3HA 3VGBA 4LGRB 4D0CB 1OAUH 3PGFL 4WHTB 1TENA 3FKUS 1EMTL 4LCWD 3M8OH 4DKFH 4DFHA 2W65A 1ZSDA 1BQSA 1XIWA 5E8EA 1IGML 1IC7L 3B9KC 2KQNA 4OZHE 1IAKB 2EYRB 4QLRA 3MGOB 2HYMA 2BDNL 5KSVB 3TFKD 1AGEA 2CH8A 3UTZA 4QHNB 3SCMA 9CGTA 1LEIA 2R0KL 4PS4H 1HIMH 2OL3L 2HJKA 1P4IH 5F96L 2MHAB 4XX1E 1S5IH 1J0ZA 5E9DA 1PD6A 2VQ1B 3C5JA 3LKNA 4OAWB 5GGTH 1IL1A 4QGYA 4KZEL 5D1ZC 3BRGC 4E9LA 3NZHL 4FTVA 2XZCH 4P5TA 1GSMA 3C6LB 3SDXF 1QYGH 2ZUUA 3MV8A 3QEHB 2DWDA 3UTQA 5DFWH 4JDZA 4NSKA 4Y16A 4JCLA 4F58H 3DX7A 2Q8AH 2F5AH 1QSVA 4R6UA 5JOFB 5FYLH 4X5WA 2HTKC 2QSCH 2CLVB 4HIXH 2FX7H 4NKMA 5D72L 4MXQC 4JO4L 3NN8A 2HMID 2A38A 3B43A 2BY1A 1YEKH 3HE7C 1UQSB 5KS9E 3VH8B 5INDA 4BSVB 1U3HC 1ZT4A 4XRCA 3I3DA 4YK4C 1MRCL 5T1DH 3WIHA 4R8WL 4OFDA 4NQDE 2VXQL 2PR4H 5CBEB 3RZCB 5I1CH 2B1HL 1WSST 4KDVA 3MBXH 4O9HL 5GGVL 2C5DC 5A2IH 2LV4A 3V52L 5JPMB 1BZ7B 4QRPE 5GS1B 1MJJA 3PNWA 2G5RA 2G9HB 2UV3A 2R9HC 1HKLH 3RNQA 2DI8A 1BF2A 5LGJA 2VIRA 4YC2B 4AIXA 3NMEA 2BNRD 4R3SA 1G84A 4JHBA 4OLZH 3IFLH 3HNSH 3MRNB 4PJDF 1KENH 3U0PA 5FV2A 4NWTL 5HHQA 4ZPVA 5ALCL 3FT2A 4HUNB 2F74A 4Y4KB 4FMFA 5I66B 4WDIA 1KG0B 3LH2H 4EI5A 1IKFH 2EC9T 3EOBB 4WV1A 5IBLC 2DQIL 4IIQA 4POZC 3X12B 4U1GB 2CSPA 4Y1AB 3QWOB 3DYPA 1TLKA 4IOIA 2GKIA 2VDOL 3RUGF 2FJHA 4U0RB 4XAKD 5HJ3B 1CFQA 3KPLA 1RURH 5IBTL 1B0RA 4ODXB 4XPFH 3MLXH 4NRYA 4TUJB 4UU9A 1ZLVK 4AYFA 2EDNA 4MGXA 1AC6A 4Y2OA 3ROLB 4GRLA 4APQB 1S7WA 4LLWB 2X4SB 1T7WA 4JM2D 3TPUB 3VA6A 4JKWA 3P4OB 1ZGLP 2VOTA 3UTTB 1NCCL 2V17L 3GSNA 4P2QB 1AXSB 2IQ9L 2NXZD 1CK0L 5ID1B 2ED9A 1XGTB 3V5KB 2YXFA 4U6YA 4RIRB 5D7IF 5IK3B 1KB5L 3C8KB 4KZDL 3TT1H 1DEEB 4LVEA 5SV4A 1RUMH 1XGQB 5C8JA 5IESH 5JXAL 1IQWL 4DTGH 2PO6D 3PGDB 4OGXL 5E6IA 3VFVA 3J8F7 4YGVB 2GIYA 5TQ0H 3TN0A 1PEWA 5FYKE 4MJ6B 2A73A 5IOPB 5I1LA 1NBYB 1JYXA 3ULVF 3LSOB 4WU7A 1VGEH 1BM3H 1CFTB 4G9DA 5GS0C 1S9YB 5E8DH 3KPPA 2R29H 3RHWK 2E7CA 3IFNH 4RGNC 3RZWA 5JQ6H 4NQSA 1BD2E 1K4DA 1NCWL 2BVEA 2VLJA 4Q58C 3FQWB 1YN7A 3NGBC 4I3RL 2IALA 3OGOE 4HF5H 1AY1L 3FO2B 4L9DA 2OMNA 3V7MA 1GPOH 3EYUH 5DI8B 4DFIA 5IMLA 3RVWC 1LEGB 1OARH 2FJFA 4K7FB 4P46A 4NZTH 2HLFD 4OZ4A 3BKJL 2ADFL 1RAMA 3TZVD 5IF0B 3STZB 1FZMA 4OZGE 5DQJA 1J0YA 3MRCB 3QIBB 5HVHC 3OKNA 4WUUD 1FL5A 1N7MH 1W8NA 5FO9B 1FE8L 5KVGH 3WE6B 4R4BB 3MGAA 1VCAA 2BNUB 2YD7A 5FGBA 4J7RA 4AEIH 2X4PA 4JJ5A 5EBLB 3F12A 3MV9B 4XX1G 3WUWB 1I8LC 4YPJA 4X4XB 4WFFD 3L3OB 5CSGA 1UA6L 2VXUH 1IT9L 1CVRA 4YR6B 3TWCL 3NFSH 4NN5B 2W0FA 1JGEB 5GS3A 1HHHA 1NDGB 4YO0A 2QQKH 3TNNA 1EO5A 4L4TB 4RMWA 3WS3B 3ZTNH 5T1KA 5IT2H 1Q94A 4QWWD 3IDGB 4WCYL 1CBVL 1W72B 4WHCA 3RX5A 2P49B 4G9FD 2IBGA 3EAKA 2NYYD 3HG1E 4LLMA 3SKJH 3TVMD 2FH6A 2DL9A 1YY9D 2V2XA 1EHLL 3OAZH 2K3TA 3DXAB 2D7TH 2C3XA 4RFEA 3VRLF 5J11B 3ZE0F 2XA8L 4PY8I 4PRIA 4PG9A 3CIQA 3KPQB 1UVQB 5DD3H 2Q76A 2WBJA 3GIZH 1R5VB 3MRJB 4QRTA 5BJTA 4O02L 3U36A 1BFSA 3CFEB 4WVRA 1BZ9B 3BE1L 1VESA 1GYAA 1DQMH 3UBXA 1TJIL 1S7VB 3BSZL 3K74B 4ELMA 5KJRL 1FVDA 2Z35B 1KPUA 2DQDH 3MRRB 4PV8A 2PYED 5FGBC 3F7YB 3QB7C 5DRXA 1I1YB 3SKUD 1QPPA 4LAQH 2QHRH 2FX8H 4DZBB 1A7OL 4KUZL 4Y4HB 3MLZL 3R4DA 2OL3A 4BFGA 1VEPA 2EH8H 1ZHNB 3VFTB 1OP5H 1AHWA 1ZLUH 1CXLA 2XFXA 4YXHH 2F54E 4ODSH 4OZIB 2Z8VC 3H3KA 4YHPA 4BELD 2ED8A 1XF3B 2P5WB 2YK1H 3QDGE 3FCTB 2WP3O 2CLRA 1JHLL 4UOJA 1A5FH 4KTYA 4QOKB 5DDHA 3QULB 1DLHA 3MXWH 5E7FA 3HS0B 5E2UH 4QY8A 5F1NB 5CCKL 1IAIH 2A6DB 4KKLC 1OAYL 4ODVL 2R1XB 4LASH 2H26A 3LZFH 3CVIL 2AABL 1OTUD 2HFGL 5IHLB 1Q9OB 3MLTB 3HMXL 1TVBA 5E99L 5L88L 4L9LA 5JW3H 1HSBB 4JR9L 5F7NC 4XWOC 1T2XA 1AXTH 3BKYH 3MSPA 1FGVL 2YEZB 4P4RB 3ZDZE 5A16A 4M7KH 2IFGA 2FSEA 3IYLW 1EEQA 2LU3A 3KLAB 4HWBH 4L4VE 3JV6A 1T3FA 2H41A 3EFFA 4AG4L 2FBJL 4F2MA 4S1DD 3MLPA 4C56A 2O61A 5D93B 5C07E 4NUGH 1E28B 1K5NA 1CFNA 5F89B 4NDMB 4J4PD 3UDWA 4PJFB 1JNNH 2UWEF 3Q6FB 3FONB 5DYOA 5T33H 1AHWC 1MCKA 3K2MC 4WHDA 4FXKA 3EIFA 4NM8H 2YC1A 2QKIA 1KNOB 1U8KB 4PB0H 5ERWA 1L7TH 2NY4C 3T77A 5EUOB 3P40A 1MVUB 15C8L 1UCTA 1RUPH 2NXYC 4MD0B 3Q2CA 2WM0A 3HC4H 4PB9L 4RNRA 2OTUA 3CJJA 3EJZD 4NIKB 3MUY1 1K3IA 1A1OA 2PW2A 4FABH 2E5EA 4JO3L 3QNXB 4H20L 2V2WB 1IC5H 3AY4A 4JFDA 4N8CL 5ID0B 4X6CE 2RB8A 1JYVA 5M7QA 1WT5A 1W0WA 5FYKU 5E1AA 1YY8B 2EXWC 3O9WB 3UZVB 5D7SH 4HG4J 3MRDB 5LGKA 4X6DB 1YQ2A 3ARXA 4EDWL 4LKXA 1UM5H 4MJ4A 5D7JC 4KJPD 5EO0B 4P3CH 1ZT7B 1HH6B 2VERN 4Q0XH 4YFEA 4HWBA 2Y72A 1C7SA 1MCFA 4FS0A 4HUVB 3QUYD 4FQLL 1R3HB 4V2CB 2FD6H 5T3XE 1KPRB 3DX6B 3G5XA 4KC3B 3KR3L 2EDXA 4U49A 2FZ3B 4XZUB 4G8GD 3ZE2E 1N0LA 3MUJA 3V4VL 2YPKB 3QI9C 3QUXD 2D0GA 1UKQA 5BZDB 4JM4H 4PGCA 43C9A 4U33A 4G8EA 5MHSE 4OZFH 1KB5A 2H2SD 5KSBB 4NPYB 2Y36H 3RVVD 4OQTH 4HXBL 3QHFL 3VRIB 2DQHH 2XZAH 1YNTA 4HBCL 3ARFB 5C08A 3UO1H 4Z77B 1UM4L 4Z7NE 1ZV5A 4G6FB 5EIIB 1P69B 1KT2A 1NGXA 1J10A 3HRPA 4NQUA 1X5GA 1PG7W 2VN7A 1F97A 4MJID 1SQ2N 4NCDA 5EN2B 4DOHB 4LPWA 1YUHA 4TSAL 4LCIL 4UDUA 5D2LA 1V3LA 2OLDA 1OTSD 5H2BB 4HC1L 5L9DH 1MCOL 3D39E 2P8PA 4HJJH 3UBXI 4HAFA 1AGFA 4RAVA 2PO6A 2PYFB 4PGEA 4GG6B 1J1OH 4M6OL 3U0WL 5KSAD 1XCTA 5C3TA 2X7LA 3PQYD 3TCLA 1JVKA 3TM6A 4C54A 4R96B 3BKML 2HT2C 4PRHB 4YNYB 1CYGA 5BRZE 1NPUA 4IOFC 5GGRB 4PJBF 4XI5D 1KCSL 1EPFA 5DD1L 1RPQA 4XNYL 2O5YL 5EZIL 4LSQH 3QIUA 4ELKA 1U8PA 4N5EC 2D7NA 5EU5A 1AIFB 3MA9H 2VUOA 4UIMA 4LNRA 4IS6B 3G6JE 5CFHA 4MNQD 1HSAB 1NL0H 1G7HB 3OJ2C 4GW1A 5CJXA 4MS8D 4G6MH 1QA9B 5I2IA 1AD0B 1LK3H 5KSUB 2DIBA 3CVHB 3RY4A 5EU6A 7CGTA 1PKQB 4WUUA 1MPAH 2G2RB 3VFGL 4OQTA 4G80A 5DJ8A 5HDBE 4DZ8A 3ARDB 2UVFA 4PR5B 4WO4D 5GGSA 1RUKH 1RVFL 4I18A 1A6PA 5GRUH 4LSTL 4UUJB 7FABH 1BQLL 3AREA 4A6YH 1S9XB 5EC1A 4L8SB 2PUQT 1WFOA 1ZLVH 3HZYB 2Q86B 5C6PB 3OR7B 4QTHB 5EA0H 5GZNC 4KJYA 3X14A 3RFZC 1I7RB 1DE4A 3DGGB 3U7YH 3MXVL 4YDVB 1HINH 2W91A 4IM8A 5TE6H 5IHUL 3SQOH 2XRAL 5LAXA 2WANA 3H8NA 4M1CC 2JIXD 4MXWH 1D5MA 3P4MA 4LL9A 3UJTL 3QIUC 1A9BA 3TPKA 3TVMA 1MRDH 4RFNC 4AM0A 2AV7B 1OL0A 3RIAK 3VD9A 3GUTA 3L1OH 2JB6B 3H7LA 2V2TA 1A8JH 1AP2B 1C5DB 5J89A 5C6WH 3V0WL 1L0YA 2EDOA 2UUDH 4PBWD 4XP1L 5HPMB 2B0SH 4PRDB 4LSRL 3B2VH 4XPHH 1OP9A 1Y18B 4HUXA 2I60L 2GFBA 1IAII 1GGTA 4EUPG 3I6LE 4MA1C 4NHUB 1C5CH 3R0MA 4FP8L 2CKBB 5DURD 2YUWA 1NMAH 2PYEA 4I18C 4R7DA 5IEKA 4G43B 4OCXH 4FQIL 5IKCA 1U6AH 2CLZB 4M7LH 4OGYL 3U4EA 1NGQL 3RWEB 4ZAKD 4OLVL 2HLAB 3WSQL 3LRHA 3JWNC 4A6YA 2NY6D 4PJDB 4P9HH 1IM9D 1QLEH 2VXTH 3L3GB 1KULA 1A6AA 2R1WB 1F4XL 2GSIA 3CLFL 4FXGA 4JQIH 4G8FA 5E2TL 3VW3L 3RVXC 3ZKQD 3QR2A 1FO0L 4LQFH 4MCYA 3RI5F 4OB5H 4PRNB 1GHFL 2OXHA 2AV1B 1SBSH 3HMXA 4P3WA 3GGWA 1G7QA 2R8SL 1R3LA 3PL6D 4OCRH 4BSWB 3U2SA 3FHAA 5ISZA 1CXHA 1F6LL 3HKFA 4HFWB 4XVSL 2BSRB 4QRUB 5DEZA 1JZ8A 1OD9A 2NZ9C 2ICEA 3RUGB 5HHNA 1KIRB 2DQJH 1D6EA 3BGMA 2RHEA 4OJFL 1CI5A 5L7XH 2F53D 1K4CA 3C5ZB 4D8PA 3GHBH 3NCFB 3B6SB 4M5ZH 1Q0YL 4XP6H 1T2QL 2XYCA 3PXJA 3UCRA 3BYTA 4O5LL 5B4MD 1OT1A 2VAJA 4KKAC 5EFIA 1U42A 3W11C 4J4PA 5IB1B 3ARBD 1X5FA 4MQTB 3PJSB 3LD8B 1JYWA 3QEQB 2DTSA 1AE6H 4XH2A 2EIEA 4MWFA 4WTXA 4XWGH 4WWKC 4F15B 1A1MA 5D7IB 5DWUL 3ESVF 3L95B 3V79C 5AAWA 2QQNL 3CAFA 2GJ6B 4PFEA 3QT2A 3V8CA 3V6FB 4RZCA 3RGVA 2QHLA 1FORL 5F8RC 3IDJB 3WUZA 4ALAH 4KH2A 5D1XB 1OAZH 4N9OB 4J8RB 4M8QA 4MXQD 5I71B 2EDLA 2R2HB 3OG4B 3GSVB 1J88A 1FO0H 3DX9A 2E6QA 3ILPA 5IMKA 5JNYA 5D5MA 3Q1SH 1WAAA 1MHHB 1L7IL 3IAPA 3KWWA 3SKNB 3MJ6A 3WXVH 3IDIB 4X7FC 1PGRB 3JV0A 5FO7A 3ZSSA 3KLHD 3QXDA 1VFBA 1DLFL 5I76A 1CGWA 2X1OA 4UOW1 3U7WL 3O8XC 3L3JA 1INQA 1OSZA 4J3XA 4NC1E 4R2GC 4JPIB 4ZTOL 3DSFH 3BKCH 3OX8B 4G8GA 1IFHH 3U79A 4FHBD 4P9HC 4G42B 5HHPB 2BNQE 3QPQC 2NY0B 3V0AC 3PABA 4NQDD 4PG2A 4P3DA 2V7NA 1KJ3L 3OR6B 2YKLH 5ITFB 2F19L 3NZ8B 1U8IB 4M7ZC 4OLWH 1EH9A 3SBWA 5JHDA 4QHMB 4QRPD 1EIBA 1T5XB 1R0AH 4UQ3A 4X4ZA 3RGVC 1XGPA 3O81A 4JO1H 1UCBL 3K80A 1NLDH 3BI9X 3GO1H 1Q8MA 3GSWB 4P2OC 1HH9A 2BY3A 3AAZB 4YH6A 3W0WE 4X6FA 3S35H 2I9LB 4OZFG 2LFGA 4MQ7B 1DBAH 2WIMA 4JKKA 2E7MA 2QLVB 1JWMB 3MRIA 1KSRA 3O45B 3KYNA 5I1JL 1FAIH 1FFNB 4XAWL 3X3FL 4QRRB 4NQCE 5BS0B 4J1UB 1HQ4A 3T3PF 5F7FA 5C7XL 5D8JL 1FJ1A 4NUJA 5FCSH 4Z7WF 5GZOC 2IANE 5EOTA 3LS5H 1AXIB 4F33A 3KJ6H 1HHKA 5T1LD 3WNKA 5J4MA 3W5MA 5EULV 3VMNA 1VFAA 4JM2F 1G7IB 4MNQA 2WINB 3FFCA 1FZKA 5HGHA 5JXEC 3L7EB 1YEJL 5F1IA 1T5WB 5FM5M 3S98A 2L7JA 4H26A 1BVLB 1QSEB 1VADB 4JFOA 5ILTL 1P2CB 4WO4A 1D5XB 2L7UA 3LY6A 3ULUE 3CXDH 3O3UN 3EOAB 3L3HB 2VDPH 1KXVC 3S34L 3JTTB 1NCAH 4AH2B 3ECBB 1F3DJ 5BCAA 2X4NA 5GS0D 3TBWB 1MJ8L 5C0JA 5EWIH 3GM8A 5ANME 1S7QA 1LMKA 2C3HA 1FFOA 1NAMH 5I17B 5GS0L 1J18A 2CKNA 1NEZB 3LEYL 4WJ5B 4IRSA 1BOGB 3EYSH 2YXMA 4KRPB 5FYKD 3BGFB 1SJEB 4OCSH 5FUOH 4CW1A 5HYIA 5IW6B 3PIQB 3SE4C 3PUCA 1RZ8B 3CGTA 4EJ1C 3QCUH 4XMKL 2ZCLH 4PJIE 2C3VB 1ACZA 4DEPC 5FYKL 3JBG7 1G6RL 4Z7UA 1BD2D 1Q0XH 2ZSWB 1UENA 4NKDA 1QRNE 3EO0B 4NO0D 1GGBH 1GIGL 3TBSA 5GSRA 1AI1H 1OGAE 3SKOA 3H9YA 4N0UE 2QADD 4OLEA 2H8PA 5IQ7H 1JL8A 2BRRL 2UWEB 4JRYE 1KIUA 4X83A 3QQ3A 1V3MA 4L1DA 5J1SC 1A4JB 5B39G 4F7MB 1FSKB 2QQLL 4IDJL 4X8JA 4U1NA 4XHJC 3BXNA 5BW7A 5F3BA 1BBJA 3F65A 1U95B 2BK8A 3L3IB 2NX5E 4HWZA 5BQ7A 2HN7B 2V7HA 4M03A 3LKNB 4XVJL 1FO0A 4RFOH 4HKZB 4B50A 2FR4A 5F88B 2PCPA 4OD3H 4MAYA 2OZ4L 1KJ2B 4LBEA 4Y5VA 5DUMH 5FDWB 3F7VB 2VH5L 1BVKA 1FNLA 5CHNB 4IRSC 1L0QA 25C8L 1I7UA 4XVTH 3T0XA 4NJ9L 3KPRA 2Q6WA 2NW3B 3RA7H 3P0VL 1ZTXH 3FN0H 3SE8H 3WIFA 1KTKE 3HI5L 2MJWA 5IB5B 3V7AG 1G7LA 4IOSD 3VXRA 1MCPL 3NN8B 4JN1H 1B6DA 5EH1A 5EOCH 4LDEB 1ZLSL 3LIZH 1YMME 3OGCB 3PHQB 3VA2C 4UILH 2PN5A 3HG1D 2NY3C 3FOMA 5F3HB 1S5HA 2BSTB 1IGFH 2DQFB 4KKBD 1X6LA 3MYZA 3P4NB 3MRMA 4TQEH 5AD0A 2GSGB 1HN1A 4S1QL 1RULL 4BK4A 1HE7A 2A83B 5DK0B 5CIPB 5BW7C 1OQOA 4V2BA 1SJHB 2V6HA 3ARBA 4KGLA 2XWJA 1UB5B 2M26A 5DEFA 1F4HA 1JRHL 4G3YL 3OKKA 1A6TA 3E6HA 1YPZF 1ZA6B 4QCIB 4FQHA 1I1RA 4PJCA 4IRZH 4Z9KB 1ACYH 1NC4D 3ME0A 3TBTA 2F74B 4OZHA 3AU1A 4LKCA 4OLUL 5C9KA 1NDMB 3P9LB 2YMXL 3QFJE 43CAB 3HPJB 2F54D 2H32B 3E6FA 3Q5TA 1AQDA 1BX2A 2Y07L 1KCUH 3HRZB 1MIEH 3QDGD 2AXFA 5CP3A 2WUBL 3TC9A 5I15H 5ITBL 4MCZA 3HE6B 4IOIB 2ZPKH 3MRFA 3VGDA 4X98A 1BQHB 5HYSB 2IEPA 4M02A 3WDJA 4GW4A 4PJBB 3LKQB 4JG0H 2ZUXA 3DRQB 1NC2B 4KK8D 3RBGA 4NRYB 2W9DH 5D6CB 3O0RL 3LKOB 1KGCE 1XH3B 2J8UF 4XCEB 1P7KA 1T7XA 3JV4B 3OWEA 4M93C 2MKLC 3LDBC 4LU5L 4LHUG 3JVGC 2OBGA 4GBXA 3ZKMC 5TDNB 1ZHLA 5E00B 4DQOH 3U1SH 2VITA 3G5YB 5C71A 4I0CC 3TIDA 3JWOL 4L4VD 3VFWB 3QNZA 2APWA 2ICWB 3LN5A 2NXYD 2P5WE 5C07D 1QR1B 2HFEB 2ERJB 3BHBA 4HGMA 1CE6B 1YJDC 3IXAA 3O6FA 4YPGB 1N3NA 5JA9A 1CFSB 4QOKE 1ZK9A 5T5FL 2WBWB 4YDLC 1U8NA 1TPXC 5MEPA 5DC4B 3WFCH 2O5ZH 5SWQA 3OSKA 2SEBA 1BEYL 3EZ8A 4O2CB 3OAYK 4QRPA 5LXGH 1C16A 2ICCA 1FFPB 2ICES 5DD0H 4OGAC 1P4LB 3LB6C 4M3JA 3RWHA 5CZVL 2EXWD 3RTQB 5CKGA 3M17B 4HG4K 3QWRD 5L0QC 4K55A 2OK0H 1A3LH 1VENA 1YEFH 4M43H 4QNPE 1ZS8A 5E70A 2DM7A 4LVHB 1K4DB 4ZD3L 3ZYJA 2X42A 5TE4L 1NCUA 2J4WH 5E03A 4XXCA 3VRJA 3RVUD 3BVNB 4YBLB 3QFDB 4PJGE 1V8HA 5JDJA 3BP7A 4PUBL 3TA3C 4GBXC 5DMGC 1D9KD 4QXTA 4MA7L 1UXWA 3QI9D 5BVPL 1F42A 1Q9WB 3P9MB 4DN3H 2AJVL 2VL5A 1T2JA 5DQJB 3LEXA 3VFOA 4BM7A 2JJSC 4YDJB 2DOCA 1DL7H 2IGFL 2XN9A 5DQDL 5DO2C 1JE6A 5DJ6B 1XGRA 3IETB 4YXKL 3QUZB 3U46B 5T3XD 4U7KA 2EYSB 3T09A 1DANU 3HZMB 3VFUB 4JJ5B 3F12B 2EDEA 3FAXA 4Q6YA 5B8CC 5CD3A 3GSUA 2F8VA 1U93A 4ZFOA 2W9EL 5ENWA 4OD1H 4BSJA 4M1GL 5T3XL 4KV5E 4DGYH 5CP7A 3SGJA 1Q1JL 3UEZA 5MHSD 2W0FB 1ZA3B 5D2NB 1FNAA 4MA3B 4HV8A 5CZXC 5GRVK 3W9EB 5GHWL 4EOWH 5EORH 3UYOD 3S88H 3LQAH 5I1KL 1PFCA 2Z31B 4HH9A 4K7PH 3RWFA 2A6JB 4LSPL 2DQUL 3V6BR 3T8XB 1JF1A 3CSPA 4X6DE 5HHMB 3VXSA 2HT2D 1KV3A 1ZGLB 4D0BB 2IFFH 2AXHA 2IG2L 4I2XA 5FF6B 3V2AR 4NZUH 4ZXBB 35C8H 1TTGA 3D39D 4K2UH 1INEL 4NO2B 3G6AA 1NCDL 2A9ML 2GUOB 3DROB 3WHE1 3CFJA 4JDTH 5D1QC 2A9NH 4I0PA 1G7PB 1ZWIA 1G6RA 3DPBA 1A2YB 3FRPG 4PG9B 3IF1B 4JFQA 2MKWA 5H35A 4XBEL 1PJ9A 3O4OC 3GJEB 5BJTB 1MFDL 3U36B 4U1KB 5BRZD 3EUUA 3NCJH 3WEXB 4E41E 1JN6A 3KHOA 3P77B 5KSBE 4U1IA 1CXFA 3PHOB 4JDVA 1E4WL 3B5TA 3HFML 5IEHA 1CWVA 5TH2A 2HRPL 4LCWB 3TBVB 1Y0LB 4K94H 2LTQB 4G7YH 1EDQA 5IHZB 4DGVL 2AI0L 2FJGB 4K71B 4NRZB 4LIQH 2WLZA 4GUPA 3ARGA 3GSXA 4YGAB 4QEGA 1MHCA 3EFDL 2GYSA 2XFXB 4CGTA 5LBSL 4NHCL 1L6XA 4LPYA 4OZGA 5J57B 1KEGL 2A6KA 4BQBA 3WHXA 2VC2L 4BFIA 5KOVC 4YHMH 2OZ4A 3C09B 3TYGH 5GZND 3EYFA 1WUNT 3NFNB 2Z92A 4HUUB 3V4UL 3O11B 4NBXB 4M1CD 3QG7H 1CLOH 4ZFGL 1I8MB 1P1ZA 3KYMA 2GTWA 3QZWB 1B0GB 4XP9L 4LVOB 4I0PC 2ZSVA 2CIIB 4PBXA 4X7EC 3W81A 5ICYB 2IPKA 2CRZA 4Z7VA 1D6VH 3CMOL 5E2JA 1HXYA 1QPXA 4M7LT 2XY1A 2OI9B 5TDPA 4P23D 1S7RA 5JA8B 5GGUB 1S9VB 1DQDL 1S9WB 5IIEB 1BBDH 2OP4L 1OM3H 1EFQA 2O61B 1DQLL 1SYVA 5FO8B 1CFNB 5JMOC 5L8LB 2X1XR 5MEOB 2DQTL 3GSQB 1HEZA 4GG8A 3CFCH 4D9RE 4AEHH 4LEOA 3BQUA 1OY3B 4YZFF 1XF2A 5I73C 4K3JH 4BZ2L 4JB9L 1BVZA 1FL6A 4LVNC 5J12B 3I6LD 3B2UC 2WWKO 1T6WA 3HUJF 1D5BB 3PWVA 4WEMB 1U8HA 2BNRB 4PJ8C 2ORBH 3QXVA 1CDGA 1JWSB 3RVXD 4FQ1L 3W39A 1NMBL 4PJ5A 4HIIA 2BOBB 3MREB 3DMMC 3CUPA 3OKYA 4X80L 4Y2DD 4MJ5B 4KHXH 3PWUA