4YDLB

Crystal structure of broadly and potently neutralizing antibody c38-vrc18.02 in complex with hiv-1 clade ae strain 93th057gp120
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVRLVQSGNQVRKPGASVRISCEASGYKFIDHFIHWVRQVPGHGLEWLGWINPRGGGVNYSRSFQGKLSMTMTRDNFEETAYLDLSKLNPGDTAVYFCARGFAGYEWSFIWGQGTLVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 41
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydlB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydlB01
1ZTXH 3DI2B 3GDBA 3HR5A 1MCWM 2L7UA 3DURA 5KS9F 3BT2L 1CZ8H 4F9LC 1H5BB 4FMKA 2VSCA 3WIFA 4PREB 1JGVL 3A6CH 1OCWH 4Q6IC 4P4KC 1CFTB 2CJUL 5J1AB 1FO0B 1OTUD 5F88B 4PJ9A 3BPLB 3UROR 2MQCA 3L3KB 4YXKH 2PYED 1AGFB 4OZGF 4HXAL 3V8CA 1KJ2H 1EV2E 1UM5L 4OFIA 3WL9B 5GIRB 3K8LA 4WWKD 3JV6A 3NCJL 3S34H 4HKXA 3BRDA 4AM0A 3ZE2F 1CK0H 4IMLA 2QR0A 1A1MB 5C0GB 1N6VA 3HRZA 3RIAK 5HHME 1TENA 4BQ6A 5F1KC 2CRZA 4MDIB 4L9LC 1A22B 1FZMA 3OKEB 3TCLA 1B0WA 3QFJE 1DN0A 2BNQB 3O6MH 3VG9B 3MROB 3KLHD 1U92A 2ATPB 4HIXL 3SGEH 1ERNA 3IDJA 4P4KA 2IPTH 1JK8A 4XBEL 4ZO6A 5EOCL 1X5ZA 1K4CB 5EUKB 4URTB 3SCMB 3LEYH 5F93C 4JHWH 3SQBA 1KLUA 3C5ZC 2KPNA 1V7MH 1QG3A 4LSPH 3MNZA 1LO5B 2PYEA 1DSFH 2EYTB 3B2UD 5CD3A 1OB1B 3NPZB 3RVXC 3KS0H 4TPRH 3WXVH 4HFWA 3I85A 12E8L 3HHRB 3QIWC 5DO2C 3DUSA 1P2CB 2ZPKH 4L9LA 2AEIT 3NFPA 5KSUA 2VLRB 3BRFA 3QB7C 3PHOA 5IEHA 5GGSB 4JDVA 3EGSB 2EDWA 4QEGA 1ES0A 2R0ZH 5I17A 1IVLA 2IMNA 4PD4J 2DN7A 1JZ4A 3Q2CA 2PTUA 4MNHA 3TVMD 4MCYB 2BOBB 3C5ZA 4NWUH 2CKBA 1CDJA 3FZUD 4KAQH 4DN4H 5IQ7H 2FEDC 5CP3A 3K0WA 4LHJB 5HTSA 4PJDA 1KJMA 1S7WB 3ULUL 3T1FB 1F3RB 2YD3A 1PQZB 5E8DH 1C12B 3QIWA 4JM2D 1BEYL 5ITBH 1M7XA 1KJ2B 5TDPB 4GFTB 1P53A 2MSPA 1QO3A 3ZTJH 2EYSB 4MVBD 4PV9A 4RGMC 5I2IA 1G6RL 2WQRA 4ELME 2OQJA 3VFOB 1L9NA 3UJTL 4YO0B 4KV5F 5F97E 1MOEA 3LQAL 1BOYA 2CK0L 1MI5A 3KPOB 4P57A 3BP5A 3GSQA 5JR1L 1DUYB 3AB0B 3TVMA 1T6VN 3WNPA 1QFHA 3ZDXF 2D9CA 4M1GL 3HI6H 5TPWL 3RGHA 3PV6B 1E27A 3LCYA 1XGTA 4BQ8A 3O3UN 1CF8L 3A0OA 3HG1D 1A6UL 3L5HA 1TJHL 1SHMA 3CLEH 4HCRA 4JM2A 4LFHD 2VQ1A 4NT6B 4XTRC 5BRZE 2FLRT 5CIPB 3MRQB 4R97C 3WE6B 1AR2A 1LK3H 1JHLL 1KT2A 3IS0X 4K3GA 4M02A 2Q8AH 5LGKA 2IBZY 4DW2H 1L7TL 4DKEH 3TM6A 2FHBA 1LHZA 4HQQL 4JFHD 3P4OA 5F89B 3HMWH 4WHYH 2UYLB 4MNQD 1KPRB 3V6OE 3EJJX 1HHHB 1MWAH 4YPGB 4AMKH 4NO2A 3QSKB 1BM3L 4PRNA 4R4NC 4XWGL 5AG8A 4LMQI 1A3QA 4L4TD 3GJFK 5MI0C 1BREA 4ZFOA 5JIPA 5FK9B 4FQJL 4ZUTA 3RWDB 5JPNA 4BFIB 4OGYL 4NJAL 3ULSB 4NM4H 3ZZ1A 3LDBB 4I3RL 4Z7WB 3AMKA 4U1NA 3O9WB 4Q9BA 3BWAB 4DCQB 2VYRE 4AT6A 5BZWA 1E6OH 1JFQL 1N8ZA 1KNOA 2V6HA 1VKXA 5D1ZD 3SDDB 2I25N 4QRPB 1LO4H 3PUCA 5KSVB 4GBXC 3ARED 5IGXL 5JIIA 1IM3B 1FNGB 1LO0H 2EKSA 3ARUA 4WJ5A 1EVUA 4MA1C 4X7SL 3TZVB 3DTXA 1XCQB 4PJ8C 3VJ6A 1YNKH 2YPLD 3OX8A 2ED9A 4X5WA 4XPAL 4HC1L 3OQ3B 5TDOB 5GZOC 3BJLA 1P6AB 1XGYH 4TSAH 1FH5H 1NBZB 4OV6F 4L4TA 5ANME 2EH7L 2JIXB 4JG1L 4X99A 2XZAL 3RX7A 2A6DA 5TF1H 2MQ3A 1J8HA 4D0DB 1F3DH 4YAQA 4OUOA 3MLRL 3B3IA 3CDFA 4U1HB 4GBXA 4KRPC 4PLKD 4NQCD 3KAAA 1RU9L 4DEPB 4UV4L 1YC7A 1QBBA 5EN2B 4ODTL 4ZFFA 5EWIL 3WIHA 1QUNA 4M6ML 4Z5RA 4XAKD 4RRPG 1WICA 3U0WL 4BK5A 2XTJB 1CVRA 1I1FB 3V7AE 5KTEL 1QRKA 4XWOD 2AV7B 4AEHL 1Q9OB 4HUUA 5EU3B 4CGTA 1RFDH 2BNUA 3FB8B 3IF1B 1AC6A 2VITA 4GAFB 3T0EC 3WO4B 1QBAA 4X6DB 2ENSA 3GIVA 2CIKA 1DEEA 5D2LB 4ZD3L 2HRPL 3MLXH 5IFAH 3LPWA 3HUJB 5CJ8A 3TJHC 1WJ3A 5IVZB 3T4YA 4ACPA 4ZXBB 1YYLH 1HXYA 3CGTA 5JMRA 5J6GB 2XTLA 4B50A 4EN3B 5IW3A 1HKFA 2COQA 1EEZA 4XP4H 1VFOA 3PWUB 4HT1L 2X05A 2ADJA 4E9LA 4ZS6C 3OTTA 1RUMH 4K9EL 4OD3L 2P8PB 5C07E 5I1LA 2EXWD 1GCFA 2B0SH 4AQ1B 1UCBL 4YGVB 4PP2B 1PG7H 2LU3A 1TVBA 3HR5B 3CVHA 1X6LA 1CCZA 3DURB 1CXIA 1U42A 4P2QD 3TNMA 4LLAA 1TPXC 1ZTXL 3KPLA 3WIFB 4WFHE 3MJ9H 1FLRL 1EGJL 4QRRD 5D1XD 4BZ1H 4MA8H 4PJ9B 5HDBF 4OGAC 4LAQH 3OKYA 1VCAA 5B3NA 4P23C 3SDXE 5EORH 1YEHL 1OCWL 3LRGA 2HT2C 1V8HA 1MCLA 1MAKA 3QCUL 1DN2A 2HFFA 3JV6B 4PY8I 1MIMH 4HKXB 4LCCC 2C1OA 1RIHL 2IFGA 4AM0B 4IMLB 2QR0B 5DVNA 1KIPB 1N64H 3HRZB 4YXKL 5KJRH 1NCDH 4HW6A 5F71A 4DVRL 4G43A 4NQDD 1FZMB 3TCLB 5F9AC 1DN0B 4R0LC 1CK0L 3KPNA 1QEWA 5IW6A 5L8JB 1U92B 1C1EL 2I5YH 4WI8A 4P4KB 2X9XA 4GAGH 2EICA 3O6ML 5D1XA 1KLUB 1VPOL 1O5DT 2XXCB 2IADA 3MODH 4ODVH 2X9WA 2PYEB 4KGJA 4Z95H 4LCCA 5FYKD 4K3JH 5CD3B 5IK3A 3PXJA 4DAGL 4WV1C 1A5FH 4TNWK 1J1OL 4HFWB 3BSZL 5GS3A 3A67H 1U6AH 3DUSB 1U91A 1ZT4B 1FIEA 4H1LA 4L9LB 4LSPL 2J7LA 2EZ0C 4LPWA 3NFPB 5KSUB 3C9NB 1ZHLA 3QDME 3NIGE 3PHOB 5IEHB 4MQSB 3MLSH 4ZDHA 3VU2A 1DL7H 3P30L 4JDVB 2Y5EA 4TPRL 3GJEA 3L3DA 5D71H 1ES0B 1T21A 4PY8J 2F58H 3RPIA 5I17B 2AERT 4EOWH 2A0LD 3LKNA 3WEXA 3W39A 3M1BA 4YHPA 2K1MA 4Y0GA 4MNHB 3RUGE 3C5ZB 1UXWA 2CKBB 2XY1A 2Y06H 2QTEA 5IVXE 5GRUL 1I9RH 4W68A 5FYJD 4N90E 5KVDL 4U6TA 3UTTE 4PJDB 4X4YA 2VDMH 1KJMB 4LLQA 3I3DA 3MRNA 2DI9A 3QIWB 3NCFB 3GFUA 4U6YA 1ITBB 1X9QA 3BMWA 5IQ7L 2YZ1A 3IJHA 1BZ9A 1QO3B 3SJVE 4PV9B 2ZOKA 1AE6H 4TVPD 5E8DL 1MREL 5I2IB 4WY7L 4TRPL 1LE9A 1BQHG 2CRMA 3S5LA 5CZKA 5J57B 4WO4D 2OQJB 3O3DA 3OB0K 5ISZD 2APBA 4Z7UE 4U7KA 3GBML 2M2DA 1YECH 1MI5B 1T1YB 3IXTA 3BP5B 3GSQB 1CGWA 1WWAX 3ZYIA 3TVMB 4KRLB 4NHCH 3WO3B 1RMFL 2X41A 5GGTA 3VFGH 4A2LA 1UA6H 1DANT 5FGSA 3I9GL 1PSKH 1E27B 2NXZC 3P4MA 1XGTB 5E4EC 2E6QA 4JM2B 2VQ1B 4HX1A 1OW0C 4AEIH 2FX9H 1IGFH 4RGMB 2AJZA 5FA3A 3TBVA 3WCYA 1KT2B 4PJHB 2VN7A 2B20A 4FTVE 2F8XC 3VXRA 3P4OB 5FKPA 3SGEI 4WTZG 4XMKH 4WO4A 2R9HD 3Q3GA 4N0UA 1JPST 2H26A 2IALA 5ISZA 4DW2L 4PRNB 3EO9H 4DKEL 4HF5H 2UUDH 4WEMB 1FNEA 4ZFOB 4HWEH 3HMWL 4ZUTB 4JR9L 2DQUH 1MWAL 4AMKL 3Q6GH 4LLMA 4JN1H 5FA4A 4XP1H 4Y1AA 1XGPA 5I1IH 3MBXH 4U1NB 2OMBA 4M1CD 3WLWD 2H32A 5H2BA 4A6YL 2EDYA 1OW0A 4LBEA 3RWFA 3V6FA 4OFYD 4R97B 4AT6B 5BZWB 1N8ZB 1KNOB 1VKXB 2HKFL 2VH5H 5GRVL 4WFFD 5CEZE 3BD4A 3ULVD 3HC3H 3SGDI 4K3DL 1OM3L 2GYSA 3ECBB 3UYRH 1WEJH 4HH8A 5LJYH 1IE5A 2EKSB 3VXME 4WJ5B 1UB6A 3EO0A 4DGIH 3DTXB 1LO4L 3WFZA 3HR6A 3VJ6B 4F7MA 3OX8B 3CVHH 4EUPG 4X5WB 4W6YB 2M1KA 4V1DE 1QFWI 3DHMA 4L4TB 2B39A 3L3IA 2WQ8A 2NX5E 4X99B 2NY0D 2OTUA 2A6DB 1YNKL 2WWMC 1T89C 5D7LD 4KZEL 1J8HB 2UY6A 2Y7QA 1QQDA 5FDYA 4YAQB 4H26A 3KXFD 3B3IB 1I85A 2P49B 4TVSa 2BNRA 3O0RL 5IB1A 4GBXB 1CD1A 3BYYA 4DOHE 1YQVH 3WJJA 4MA1B 5HHQA 1RZKC 4WEBH 4ZFFB 3QUZD 1AKJA 5HI5C 1T1ZA 4Z5RB 3NACH 3H9SE 4U0RC 1WWBX 1BJ1H 4HPOL 2X70A 2Z8SA 5ETUA 3CPLA 2EO9A 2CSPA 1BIIA 1ND0A 4HUUB 4KQ3L 4NKDA 4Z7OF 2BNUB 2BRRH 4I3SH 4YWGH 3C5SA 3CIQA 3LEXA 4KK9C 4XCEA 1J87A 4Q0XL 3CK0H 5JA9A 2VITB 5C3LD 3GIVB 2CIKB 1DEEB 3BP7A 2J6EA 4KRPB 5TJWK 2WWKO 1JHKL 1RFDL 1IGIL 1U8PA 4D9QD 3UTPD 5C0FA 3BPNC 3T4YB 1EH9A 1GGTA 1UGNA 3QHTC 1D5BA 1HXYB 3LKPA 2L0DA 4OI8A 4F58H 3IAGC 3MLXL 3QHZL 5IFAL 1H8NA 1EEZB 3IJYA 4P2OD 2ADJB 3S96A 2IJ0C 3QUZA 4H1LH 3RVVD 4PJGF 4W81A 4XNXH 4P2OC 5JQ6H 4Z7VA 4XP4L 3MX0A 3WFBH 3CVHB 3EBAA 2D9QB 2WAHA 2NY1D 1JZ8A 4WUUD 1KEMH 2R69H 2XI9A 3P0YH 3TNMB 2F19H 2G60L 3QUXD 1PG7L 3A6BL 3B9KD 3BZ4A 3KPLB 4Y5YC 4DGVH 5CP7A 5H35A 4XMPH 1JL8A 4M9OA 3INUL 5JOPD 4PJXA 5FYKH 1PVHA 1I8LC 3TBWA 3TBSB 3MJ9L 2YWZA 5CINH 4BZ1L 4P2OA 4JRXD 2HFFB 3PP4L 1F00I 2C1OB 2LAAA 3KPRE 2A9NL 5EORL 5DZNA 4G43B 1OSPH 2MKLC 2HT3C 3ULUE 4NN5C 3Q1SH 1MQ8A 1IEHA 2AEPH 4RDQF 1B90A 2E5EA 2C7UA 4W4NA 3KPNB 1QEWB 4P2QB 4WUUA 5IW6B 3OXRA 5KJRL 4IOFD 1PZ5A 4EJ1C 2WLZA 3HNTH 3B9KA 4KUZL 4X7CC 5L2KE 5FYJH 3T0WA 5D1XB 4LRNL 4P5TC 1MRCH 2IADB 3WUZA 1X4ZA 4LCCB 3CFCH 1INQA 5IK3B 1UM4H 2X89D 2F8OA 2V5SA 2WIMA 4TVPH 3C5JA 1U91B 4H1LB 4U33A 3W81A 3VXPA 3EYQC 1ZHLB 4K7PH 5TF0A 5D2NE 4ZDHB 5F7MC 2A83A 1P7HL 1A5FL 3GJEB 2L4OA 3L3DB 3IDUA 4LVHC 2WUCL 1U6AL 1T21B 3RIFK 3RPIB 1GGIL 3LKNB 2YA1A 3WEXB 3W39B 4BSWA 5CEXA 3M1BB 4YHPB 4BH7B 1FV1A 5DC4B 3MLSL 15C8L 1MCOL 3O8XC 5D71L 3EYSL 5A3IC 1NUGA 2H32H 4ZODA 4EOWL 4L9DA 4X4YB 3DUUA 5I18H 2DTSA 4LLQB 3MRNB 2Y06L 1K9TA 4R8WH 4U6YB 1G0DA 1Z6JT 3B6SA 1CTOA 1BZ9B 3DJ9A 5E4IA 5CJXA 3E3QC 1BZ7A 2ZOKB 3EYOA 3O6LH 4H0IA 3GRWA 1LE9B 4Y4KD 5FUCC 3S5LB 3O3DB 2ENYA 3EZJB 5DT1H 2IBGA 4K8RC 2X4NA 2V17H 3O8XA 5KAQF 1AE6L 2HA1A 3IXTB 3EOTL 4U1GC 3HMXH 1HK6A 2VDLL 2MHAA 3MXVL 2C3GA 2VXSL 3O2DA 3RX5A 5I8KH 5JNYA 5DJ8A 4RISH 5HGDA 4ELMF 1D6VH 4KVCH 3P4MB 4TUKL 3SDYL 3LHPL 3F7RA 3HI5H 4NHCL 2YD4A 4JPVL 2GJ6E 5IG7A 5JW4N 1KN2L 3QUYD 3ULVH 3NFNA 3K2MC 2AJZB 1TVHA 4G3YH 5FA3B 4L8SC 3TBVB 1NGZB 4KKLC 3HKFA 5HI4D 3VXRB 1QFOA 5FKPB 4PBWD 5EC2A 2FX9L 1Z9MA 4WO4B 3Q3GB 4N0UB 1NQBA 2H26B 2IALB 3OKOA 5ISZB 2YK1H 5F21B 1RZJC 1N2RA 4P48A 3RVTC 1FNEB 4LVOB 4PJBE 3TIEA 4M7LT 2NXZB 3LMJL 4IMKC 1T2XA 2NTFA 5CGTA 5E4EB 2J6EH 2DDQH 2ZUXA 4EI6A 1G9NC 3DROB 3GMLA 3LAFA 1XGPB 4Y1AB 5EIQA 5FA4B 1JYNA 4HF5L 1FG9C 2H32B 5H2BB 3V6FB 5HYJD 4UNVA 3PNWA 4U6VL 3JWDH 4IRJD 4L8SA 4Y4FD 3Q6GL 1DDHA 1VGEH 3HRPA 3QUYA 4JN1L 4NBXB 5T5NG 2IFFH 5I1IL 4U3HA 3MBXL 3WFDH 2EDFA 2IH1A 4YDKH 4LCWD 4C56D 3HE7D 1UB6B 4YEFA 3EO0B 5F7HA 1LP9E 4U6HA 4F7MB 2DM7A 3HC3L 4PGBA 1D9KC 1H0DA 1CI5A 4KUCD 3UYRL 2W38A 1TQCC 4IMKA 1WEJL 3L3IB 4OTXH 5M7QA 2OTUB 3SOBH 5C08A 5IP4A 3VGAC 4Q9RH 4PYGA 3QWOA 2Y7QB 1QQDB 2VL5A 3MRDA 3BD5A 4H26B 4KMTL 3QNZA 3UYOD 1FVEB 4U4BA 3IDYC 3QDGA 5IB1B 4IRJA 1CD1B 4Y4FA 2AS5M 1RI8A 4FQHA 4MXWL 2UUDK 3JWOH 1YEFH 2F5BL 5HHQB 2R4SL 4GRWE 5C0DA 3NBNA 3M8OH 1T1ZB 1DUZA 4HFUH 1N6UA 1YQVL 3UTQA 1M6OA 1KLFA 4HJJL 2X70B 4WEBL 4Y2OA 3CPLB 4G80A 2Y72A 1BIIB 4IJ3C 1ND0B 3NACL 1AI1H 1J88A 2QQLH 4NKDB 1AFVL 4WTZA 4QWWD 3C5SB 2NY0B 5GGVH 3LEXB 4XCEB 5F9OH 5GS1B 4P46D 4I0CC 5KG9A 5DVLA 3SGJC 1JGEA 3BP7B 2NY5C 4PJIE 2ZJSH 3QULA 2EDOA 2BRRL 1IGTA 1S7QA 3TPKA 4YH6A 5C0FB 4FQ1H 1D5BB 4LPUA 3LKPB 2D7MA 3GKWL 4K94L 4U0RB 5B4MD 3IJYB 5T33H 3S96B 2OTPA 3QUZB 3T04D 5GS0C 1JZ2A 2NY6D 4HWZA 5KS9A 4FABH 2O5XH 5E95B 2EDXA 3KR3L 3OV6A 4Z7VB 5FGCE 2L7JA 1X4XA 2AJXH 5C0CD 1R5VA 2VWEC 5JDJA 4LSUL 4Z0BL 3BKMH 4D94A 1UVQA 4XNXL 2DOCA 5BW7C 4L5FH 4LLUA 4OZGA 1OARL 4G6AD 3BZ4B 4ZO9A 4B0MM 5CP7B 3IVKA 2EO1A 5H35B 1OPGH 1Z2KA 1S7XA 5DD5L 5DMIH 1KEML 2R69L 1AGCA 2F19L 3Q48A 4PJXB 3QO0A 4UT6H 4DGVL 4GLRI 3TBWB 5HY9A 1JF6A 1QSFA 1HYSD 2DJSA 4P2OB 2HJKA 3EOAA 3GRWH 1EVTC 3IDGA 4JCMA 5E5RB 2ADFH 2R4RL 5JPMA 4NFBA 2V5YA 1I9IH 5BW7A 3VW3H 5TQ2H 2C7UB 3SDXF 1OSZA 4WUUB 3OXRB 2KL6A 4I77H 3V0WH 1PZ5B 4XVSL 3AS0A 1IC5L 4YUEH 4OZHE 1WFOA 3B9KB 3Q1SL 5GGRA 3HNSH 3CXDL 3RKDD 1DE4A 5F8QC 1S7RA 2AK4D 2X1XR 1NEZG 3SBWC 1HHIA 1QBLL 4UU9A 1Q9KA 1OD7A 4CNIA 4Y8DC 4OT1L 3SDCD 1INQB 1T0PB 5FHAH 3JTSA 4ODWB 1IGML 3GSRA 4LARL 4NN5B 3G9VA 5J0BA 4XHQA 3VXPB 4X4ME 2H8PA 5I0ZA 4PB0H 2EIEA 4Z78A 2A83B 5ADPH 5KANI 2W1NA 4M6OL 1CLYH 1ZMYA 5E6IC 3EDFA 4PV8A 4BSWB 5CEXB 4DZBA 1DANU 1FVCA 1F90L 1FV1B 4UB0H 2YRZA 3TO4D 4U1JA 4NOBA 3C6LD 1QHOA 2CUMA 1EFQA 5LGHL 3STLA 1R24A 3SBWA 3W9DA 4O2FA 1IJ9A 3NIGF 3D85D 3DV6A 4YDIL 3UTZA 3DUUB 2H6PA 4X98A 3L6FA 3MRMA 1FFNA 1K5NA 3SDCA 4IRSD 2OJZH 3MV8A 1P9MC 2DLTA 3B6SB 3UZQA 2CGRH 1LO2H 3RUGF 5I18L 5IVXF 1BZ7B 3EYOB 4K55A 5HDQH 4RAVA 5TQ0H 1FZJA 1FPTL 4KJWC 4AG4L 3SE4C 1P7QA 2X4NB 3O8XB 1G9NH 3O6LL 3S35H 1CGVA 3LKSA 2MHAB 1L9MA 1QHPA 2KKQA 4NM8H 4WW1A 1RAMA 5JNYB 2V17L 1L6ZA 2R1WA 2A6IA 3D85A 5DJ8B 2LFGA 1DFBH 4UV7H 4IRZH 4U31A 3HMXL 2FATL 1P9MA 3U7YH 3UCRA 5FCUL 2FL5A 4Z7UF 5IG7B 3EHBC 1NCCL 4IRSA 3NFNB 4ONFH 5F70A 4QRTA 3U83A 4RISL 3RZWA 1TVHB 1PFCA 5SWZE 1D6VL 1KUMA 3HI5L 2AQ2A 2NXYD 5EC2B 3OHXA 5KVEL 3ULVL 1IMHC 3P9MA 3NH7L 4G3YL 5BS0E 4N9OB 1FG2A 4U1GB 3OR6A 1A7RH 1FL6A 1LDSA 2VERN 1MRDH 3MPCA 2YUXA 3IAPA 1N2RB 3ZLQC 1II4E 1AGBA 4LSRH 1FVDA 3TIEB 3O2VL 3V4VL 2NTFB 1G7LA 3DGCR 2I24N 3GMLB 4P99A 2YK1L 4EI6B 2H2SC 5ALBH 2ARJA 3ZO0A 1D6EA 1TJGL 3PNWB 4Y7MA 2DYPD 4L8SB 5IT2H 4XB8A 1DDHB 3QUYB 2YMXL 4OFVA 4UAOC 1KCSH 2CR3A 4Z76A 3KHQA 2IH1B 1YEKH 2D3VA 1ZHNA 2BVEA 3JWDL 5B3JE 5E2VH 2VN4A 3FT4A 3ZTNL 3C2AL 2Z31C 2IFFL 4OFPA 4U6HB 2E7CA 1S78D 4PGBB 3WFDL 4G9FA 3RTQD 4LGRB 1H0DB 1WTLA 2IANE 1WFUA 1IC7L 2NY5H 3QEUA 2EXYD 2NY4D 4RA0C 4EUPH 5C08B 3HLAA 2Y1VA 1NCWH 5D8JH 3X3GL 1C5BL 3QWOB 2VL5B 4N5ED 1EHAA 1KCUL 3FONA 3QNZB 4OTXL 3WSQH 3QP3A 1R5IA 3QDHA 4NKIH 4RDQG 1B9ZA 1Z9OA 3GHBH 3QDGB 4Q9RL 2R2EA 1RZ8A 4IRJB 4Y4FB 4FQHB 4NN6C 3BH9A 4X7EC 4LEXH 1KELH 5HYFA 1KYOJ 1KBGH 5C0DB 2YUWA 4P9HC 2BZDA 1A7NH 1R5WA 1TXKA 2XICA 5IMKA 1DUZB 4LCWB 4N0FA 1TQCB 5IR1A 3CZFA 3UTQB 1M6OB 5IBTH 5SV3A 3DLQR 4O58H 4G80B 3RL1A 3M8OL 1F4XL 3VXTA 4HFUL 2VDKL 2GAZA 5EUOE 3JV5A 5CJ5A 1UQSA 1LDPH 2WWKT 2P5EA 5D4QA 2DS4A 1ADQH 5AAMA 4CU6A 3NABH 3Q0HA 4PRPA 3TJEH 5B38A 5KG9B 3IDYB 5C0RH 3MV7A 3QULB 3K81A 1AI1L 2QQLL 5C0EA 1NCUA 1IGTB 1S7QB 5GGVL 3BDXA 3O4LE 1HQRA 2YXMA 3RKPA 1JGDA 1NAKH 4ERSH 3OJVC 3ALXA 1GRWA 5F7EH 5B39G 3FO2A 4FQLH 5A2IH 4DQOL 4LLDB 2FLBT 4QTIH 3C08H 4HWZB 2EDJA 5KS9B 3CFDA 3ARDC 2BVTA 5DVOA 1XF4A 3M07A 1G7HA 4IJ3B 5HYIA 1HN1A 2OXGA 3HZYA 1BQUA 1R5VB 1CQKA 3RWEA 4FABL 1UVQB 1LEKA 5E2UH 4MXVE 5FM8A 5T1DL 2AXFA 4J3OC 4LLUB 4OZGB 2YA2A 2AJXL 5BZDA 4OQ1A 3IVKB 3P0VH 1T7YA 1S7XB 1FLTX 1G7IA 5TH2A 3NIDF 2VLLA 1AGCB 3RWJB 3BEVA 4H0GA 3QO0B 5KAQG 3DSNA 1JN6A 4MA7H 5FFLA 5HY9B 1OPGL 3ARDA 1QSFB 1RUKL 1O7SA 4E5XA 2PF6A 2EE3A 2HN7B 2HJKB 4ZTPH 1DBMH 4HUKB 2NY6B 3EOAB 1CFSA 1X7QA 3OZ9H 4UT6L 1NANH 3IDGB 1OWRM 1EUUA 1B4RA 4KXZH 4GO6B 5JPMB 1QFUH 4M43L 5E56A 4XXDA 1DP0A 4H8WL 1LEGA 2NYYD 3L1OH 3S36H 4NQVA 1OSZB 1NC4A 2OSLA 5J9PA 4XHJD 3DMMD 3GMOA 1LQSR 2D4FA 2NYYC 3BO8A 1LK2A 3QNYA 1I9IL 5GGRB 4ZUVA 1P4IL 1DE4B 2X4UA 1S7RB 1DQDH 5EFIA 5TFSH 3GK8H 4Y5XC 1HHIB 4YUEL 4AEEA 5C70A 3ULUF 1WBYA 4UU9B 1Q1JH 1Q9KB 2GITA 4CNIB 5GSRA 1CLZL 4FS0A 3BIBX 1XIWC 1NLDL 2JCCE 3R06A 4UINL 3QZWA 3GSRB 1JNLH 3ARXA 2QHRH 4P5MA 1WBZA 1RVFL 3ARGD 2H8PB 4FQXD 4O02H 3ZHKA 4Z78B 5KVFL 1JWSA 5LBSH 2ZG2A 2X6MA 5I1EH 4C83A 1U8IA 5EU6E 5ICZA 4PV8B 4JY5H 1I1AD 4DZBB 1FVCB 5EZLA 4IDJH 1K6QH 2CQVA 4N8VA 4U1JB 5F1OB 1ZSDA 2E7LA 4Y5XA 3STLB 2GJZA 1R24B 1YZZA 3MREA 3MV01 4RFEA 3W9DB 4O2FB 4LSSL 1CLYL 3DV6B 2NNAB 4X7TA 3UTZB 2VLJD 1QYGL 1XIWA 3IJSA 4UB0L 2H6PB 4X98B 2M8XA 2QEJA 3JV0A 3SKNA 3L6FB 3MRMB 1FFNB 1K5NB 3T65A 3SDCB 3R8BB 4BA8A 4K2UH 3MV8B 4L4VE 3TA3C 3VXUA 2YPLE 4NBZB 4PJ5E 4I18B 2BVPA 2FECI 3VXNB 4YBQC 4X80H 2I27N 4RAVB 2OJZL 3MLTA 1KCRH 4JO1H 3F7PC 1FZJB 4PTUA 2IPUK 3MUJA 4NRYA 3F58L 1EO5A 3B43A 4I1NB 1P7QB 1PGRB 1W72A 3PQYE 1I1AA 4KZDH 5HDQL 4XH2B 3SE3C 2JF1A 2QBWA 3LKSB 5TQ0L 4QYOA 4WWID 3CJJA 4WW1B 3D85B 2R1WB 2A6IB 4NBYB 4LU5H 1OGAE 1BQLH 4UTAH 2AW2A 4J3VA 2MMXA 3TA3A 5BVPH 3OXSA 3TGXA 4XAKE 1XF1A 3DRQB 1I7ZA 2FL5B 4TSBL 2ZZUT 4IRSB 3FMGH 3CFEA 4NC1C 4QRTB 1NEZA 2EDNA 1DFBL 1F8TH 3SE8L 2IQ9H 4IRZL 2A77H 2MFNA 2VZSA 2E9IA 1OTSC 3OHXB 3QCVH 4O2EA 3OKLA 5INCA 3P9MB 5C7XL 1O0VA 1FG2B 3IKCA 3OR6B 2WBJD 1FL6B 3ARYA 3IFOA 4M00A 3C60C 2YUVA 1TIUA 4LNVA 1AGBB 2YRPA 1FVDB 4ONHA 1T2QH 4C4KO 2VJXA 1G7LB 3KYAA 1A7RL 2DMBA 1MRDL 4LLWA 2ARJB 2XWTA 1D6EB 4HS3A 5DRNA 2Q8BL 1LD9A 2YPVH 4PJBF 4Z76B 1MFEH 2CK2A 1WZ1H 4YDJA 2V7HA 4DUVA 2FSEA 4F8QA 1ZHNB 2NXYB 2Z4QA 3FT4B 5KW9H 5C9KA 3UTSA 1KCSL 4RAHA 3G5ZA 4MQXD 1NGPL 2C4XA 4I48A 1E4WH 4JFDE 5K33A 1OAQH 2AVGA 4QRRE 3QEUB 5E2VL 5CSGA 5DMYA 3QISA 1UWXH 3WNKA 1QFWL 5JHDA 3HLAB 1B6UA 2D7QA 3ZE0E 2P43B 1T7WA 3V95A 1QRND 1HWHB 5L88L 3FONB 1LP9F 4GMTH 1R5IB 1UB5A 3QDJE 4XPTH 2R2EB 1RZ8B 4NFCA 3MA7A 1A3LH 1UT9A 5D8JL 4PLOB 1DQQA 3BH9B 1YJDL 1MY7A 3GNMH 4GKSA 4OD2A 3VG0H 4NQDE 2XN9D 4NKIL 5CWSA 2RB8A 2IAMC 1R5WB 4BUHA 1OGTA 5EA0H 4NQED 5IMKB 4N0FB 2AEQH 4KJQC 4EI5C 3BXNA 3GO1L 5IR1B 3CZFB 4ZNEE 1BD2D 5CFHA 2FB4H 4HS8L 1A1OA 4KKAC 4WFGE 1A7NL 3RL1B 4JVWA 3VXTB 1FNAA 2Y25A 2GAZB 5BJTA 2QHLA 2DQHH 1UQSB 3D9AL 1ZVHA 2BDNH 2P5EB 5IBTL 4GRWF 4PRPB 1P7KA 1WBXA 3R4DA 4GW4A 5EBLA 3T0AA 5B38B 4O58L 1EHNA 3KPPA 1QRNA 1QBML 3MV7B 2OR9L 4JB9L 5JHLH 5C0EB 3U36A 5CSZA 4Z6AT 5GJSH 3BQUD 4PJGA 1JYVA 3E2HB 1LDPL 3PWPA 1ADQL 5E7FA 3NABL 1HQRB 5I75C 2KBGA 1JGDB 2IAMA 4M62L 5I15H 5C0RL 2ZUWA 5IF0A 4EI5A 1U36A 3FO2B 5C0NC 2R23A 2P46B 4MNGE 4XNYL 5E5UB 4D3CH 3CFDB 4YFLF 4YEEA 4MJ2A 4PJIF 1NAKL 1XF4B 3QRFM 4GMSL 1BD2A 3MLZL 1G7HB 1YYMH 3STZA 1T7VA 4FQLL 3HZYB 2EC9U 3PL6C 1ORQA 4CJ1A 5HHMD 3MUGA 3RWEB 1HDMA 3BN9C 1UYWL 2QSCH 1LEKB 2BVOA 1CL7H 5L7XL 2AXFB 3CVIH 3QFJD 5CJQL 5E5MA 1OP3H 3RI5F 5BZDB 4JN2A 5CZXD 1BOGA 4Y8AA 2HMID 3MLVH 2PXYC 1G7IB 5TH2B 1RZGA 5E2UL 2VLLB 3EJZC 3V4UH 2A9MH 1FFPA 2J12B 4KK6D 3BEVB 5JXAL 1VESA 1IL1A 2DQGL 1S9YA 4KJPC 3ARDB 4PGZA 2J8UE 2EE2A 4E5XB 4WRLA 5GHWH 3NCBB 5JXED 1OAZH 1X7QB 5DGRA 3L5XL 2MCPL 5IFHH 4HG4K 2E9JA 3ZHDA 4N9GA 3VH8G 5JA8B 3GHEH 3QWQB 3FB7A 3LKRA 3RAJH 3REWA 5MEOA 1AO7D 4XXDB 1CBVL 3QG6A 1W72H 4ZTPL 1LEGB 1S9WA 4NQVB 1NC4B 1HHJA 2OSLB 5J9PB 4AIXA 3GMOB 3FQTA 3LQZA 3VMNA 2PXYA 1QFUL 3BO8B 1LK2B 3QNYB 3L1OL 4ZUVB 4NP4L 5C0BD 3S36L 4OCRH 2X4UB 4J4PD 5EULV 5EFIB 1A4JA 5F9JA 2O5ZH 2WBWB 4NSKA 1WBYB 1MFBH 2GITB 4APQC 5C92A 1B0RA 5GSRB 1WGOA 5DUPL 5F1SA 4ENEC 3R06B 2DTMH 3QZWB 5AD0A 3GK8L 4OZHF 5JXEA 4P5MB 5HGBA 1Q1JL 1WBZB 4X6FA 4RMTA 1DBAL 1E28A 4KI5E 2P5WD 4KTEH 2IGFH 3FO0L 1JWSB 3EFDH 5CLTA 4K3HA 4C83B 1OF2A 1U8IB 4AL8H 2QHRL 5ICZB 1KG0A 3KJ6L 5EZLB 5DA0B 5SWSE 4N8VB 5J3HD 1ZSDB 4Y5XB 2GJZB 4JQIH 2GSGA 5I1EL 4RFEB 1ZKAA 2VUOA 5F1IA 3ULVE 4X7TB 2VKXA 4JHAH 3B2VH 3K46A 3DXAE 1XIWB 3IJSB 3SKNB 4IDJL 1J1XH 3OL2A 4JFZL 3OF6D 3T65B 2C9AA 3LN4A 1DCLA 3VXUB 3AC0A 3FN9A 5BRZD 2DLFH 2BVPB 1PW3A 3D39E 4MAYD 5GISL 1M71B 3ARGB 4ZOEA 3DVGA 4S0SD 5DC0A 4U49A 4LQFH 4MD4A 1MHPL 3UEZA 4EDWH 3MLTB 4OZIE 4LSTH 1HZHL 3V52H 1GC1H 4MAYC 1U2CA 2DQEL 2OP4H 4O51A 4PTUB 4YHNA 5IB5A 1W72B 3KXFE 1I1AB 4R3SA 4Y16D 4X80L 1EFXD 4CN1A 4KHTH 3U7WH 4QYOB 2DLEA 1V7NH 3V6OC 1FZKA 1XMWA 2G5RA 4MJ6A 5LCVH 5C6TH 2H9GA 2EE9A 5AWNL 4GXVL 3UX9B 4OCYH 4UI2A 4S1SL 1OTTC 3OXSB 1I7ZB 1NANI 2DLGA 3OF6A 4X7DC 4XMLH 4BELD 4PG2C 1T03H 4KXZI 2NZIA 3CFEB 1NEZB 3NCCB 1BQLL 4FHBD 1AJ7L 1SEBA 1YMME 5BRZA 2HTLC 4MMXC 1OQXA 3RY6C 4MAYA 3TT1L 4KK8C 4O2EB 4I13B 3OKLB 5INCB 3QG7L 3IKCB 4AENA 3IFOB 2IG2L 1HI6A 3V6OA 4Y16A 1J10A 1H3UA 3GI8H 3LIZH 3QCVL 4P2YA 5ICYA 3U0PA 3G6JE 4JREC 4ONHB 1P5UA 2D0HA 2AK1H 1XF3A 4FXKA 5J89A 4HCRL 4LLWB 1JGUH 5ELIA 2YD5A 4PG2A 2FHCA 2XWTB 2APVA 2ZCHL 5DMGD 4HAGA 4HS3B 5DRNB 3DYMA 1T2QL 1LD9B 4ZQKA 1FDLL 3HZKA 3RY6A 3LN5A 4PP1D 4YDJB 2V7HB 2FSEB 3MOBL 1A7QL 4JEGB 4JO2L 2H45A 2HT4C 1M7IA 2J4WH 3FN0H 3UBXI 3UTSB 1MVFA 1DTUA 2YPVL 2YHGA 3G5ZB 2D03H 1MFEL 4CN6A 5CGMA 4I48B 2WBJB 3N1QC 3SO5A 2F74A 1KEGL 1LGVA 5AZEL 5KW9L 2VR4A 4G6MH 4R90H 4CVXA 5JHDB 5JOPE 3MRPA 1MJ8L 4NZUL 5ANMA 1VGKA 1E4WL 5B3JF 1OAQL 1VERA 4OCXL 1XF5A 5KZCB 4JRXE 3VD5A 1CXLA 5MEQA 1UB5B 2N7AA 4XCFH 3DGGA 3MLYH 3MA7B 1OT2A 2UWEE 3H9HA 4RSVA 1DQQB 3W0WD 4GKSB 4OD2B 2D7NA 1H8SA 1VSCA 2VC2H 5CWSB 3UYPA 1PKQB 1OGTB 2FD6H 2Q20A 3BXNB 2YRLA 3LV3A 2C4FT 2OTWA 3GNML 4M5YH 4G6JH 3UZVB 3VG0L 4YHOL 2OYPA 4OJFH 1A1OB 5C07D 1FNSL 1LNUA 1MFNA 4GAJH 2NMSA 2AEQL 5BJTB 3K7UA 1DVFD 4P3CL 1P7KB 2FB4L 5L0QC 1WBXB 2FRGP 1A1NA 3BHBA 4GW4B 5EBLB 1QKZH 3KPPB 1QRNB 4AH2A 2C3WA 3SDAD 1SEQH 3RBSA 3U36B 5CSZB 2XA3A 4PJGB 2BDNL 1B3JA 1DR9A 3PWPB 4QOKD 4OCSH 3WHXA 4L3EE 2XOTA 2IAMB 3ES6A 5EUOF 5IF0B 4EI5B 3F7VA 4M93C 3M45A 1UWXK 1DBJH 4M3KB 4LAJH 4NQEB 5T1KD 2NY3D 1FFOA 2QQNH 4GKZA 3O6FD 1BD2B 1KC5H 4JRYD 2CDGA 4M48H 5I15L 3STZB 3MV9E 4EBQH 3IFPA 5C07A 3AY4C 4S11A 4R7NA 2VZOA 3MUGB 4J6RH 1HDMB 2BVOB 4CJ0A 2JB5H 3MRKA 1AC0A 1DVFA 4LLVB 5GZND 4A2MA 5E5MB 3FB6A 4JN2B 4KTYA 4RFOH 1BOGB 3CCHA 5I75B 1QSEE 1IAIM 4DUWA 2QSCL 1RZGB 2NW2A 3X13A 4ONGH 1CL7L 4RIRA 1FFPB 3CVIL 3EOBA 4LSQH 1I4FA 1IL1B 3NFSL 3TCXA 2DD8L 2X10A 1S9YB 3OGCA 2B4CH 2C26A 4MXVF 5E99L 3SDXA 5DQJA 5AAWA 4PJFE 3FOMA 4IM8A 3BYTA 4O00A 5EPMA 1G1CA 3HE6D 4MAUL 3RA7L 4N9GB 3FB5A 5MEOB 3REWB 3TC9A 3FB7B 3LKRB 5GHWL 3QG6B 1S9WB 5HHMB 1HHJB 2R0WH 1RY7B 1N6QH 2XKUA 3FQTB 3LQZB 3T8XA 3QFJB 2PXYB 5CBAA 1U93B 5I73C 4JO3L 3W11C 3CMGA 7CGTA 2I9LA 1A4JB 3BJ91 4UQ2B 5F9JB 4NSKB 3TIDA 1H15B 5L8KB 1SJVA 3HI1A 5FECA 4TULH 1KCVH 4ZS7H 3UTTD 4XP9H 5MP6H 2IQAA 5AD0B 1MCRA 4CDHA 1OP3K 2ESVA 4HK3N 3DV4A 5HGBB 3TESA 1AHWC 4X6FB 4TSCL 1CICC 3EJYD 1E28B 2N56A 1J9CT 3HE6A 1P4BL 2DTML 2BCKA 2XIDA 4YNYA 3QDMA 4Q9CA 1OF2B 2VDOH 1KG0B 1BFTA 5HYJE 2JCCF 3C8KA 4KTEL 4QHNB 1FCCA 1A02N 2GSGB 1G9MH 2PO6D 2X7LA 2R1YA 5F1IB 3MUHL 1A14H 1ACYL 3RUGA 3ROOA 3QQ4A 5IVXA 1BFSA 1XF2A 4BK4A 3BI9X 3S88H 4ODSH 3C2SA 4C56E 3FL7A 4JQIL 4PLJC 4F9PC 3B83A 2YD8A 1TJIL 4OB5L 3UTTA 3LN4B 4FZ8H 2IH3A 2O26U 1CICA 1VENA 3ZKMC 1J18A 3BVNA 2JJUA 4DK3A 3DVGB 1RULH 2Y6SC 4MD4B 2GCYA 3SJVA 4OZFA 4O51B 4FTVD 2BHZA 4YHNB 5IB5B 2DLFL 3CU7A 3BX7C 4ELMB 3GKZA 4R3SB 4XCYA 3DETC 5F3BA 3IDMA 2JLLA 2BK8A 3B5TA 1FE8H 4Z7UA 4LSTL 4TOYH 2OP4L 1FZKB 2PO6A 4MJ6B 2H9GB 1OLLA 1A7OH 3VD3A 1QPPA 2OCFD 4MXQC 2JJSC 3G6AA 1KENL 5FO8A 1DEDA 3ZYZA 5C6TL 1FYHB 4ZO7A 3F65A 4PJEE 1SEBB 5BRZB 2DRUA 1YPZE 4OCYL 4MAYB 1A2YA 2NR6D 2O5YL 1HILA 4QNPE 3X12A 2QL1A 1CIUA 4LLYB 4BQBA 4E41D 2AJVL 2NR6C 3FHQA 4FTVA 4AENB 5I1JH 2BSRA 2UY7A 3VXMD 4UBDC 3GSNH 1J1PH 4LDOB 1HI6B 4MDJA 4Y16B 4C4KT 1I8MB 3RU8H 3HAEA 3U0PB 1HHGA 5ICYB 4NPYA 3GMPA 3CLFL 5F7FA 4V1DD 4J7RA 4NNXA 4OIBA 4FXKB 1XF3B 4OV5A 3UAJD 1IZJA 5I66A 2XACC 3LIZL 2CUHA 4O2CA 2ITDA 2EEAA 1A9EA 4ZQKB 2DM2A 1JNHA 3HZKB 1F02I 1A9BA 1ODAA 4BSVB 4ZFGL 2ZNXA 3F8UB 4OM1H 3RWHB 1TCMA 3LN5B 3SPVA 2WINA 5C0CE 5EOTA 2P44B 3KDMA 4Z7NE 4MS8D 4PTTA 4FFVC 2V9QA 1DLFL 3CFIC 1M7IB 1BAFL 2PTVA 4LSDA 3H9SD 4HJGA 3VXMA 4UMGA 4CRPA 1VACA 1BBJA 5EU7E 2APTA 2F74B 5DQ9A 3WLBA 2JELH 5HVFB 1Y6NR 4CVXB 3MRPB 3BUTA 5C2BH 5HI3C 5ANMB 1VGKB 2VDPH 2NX5A 4WDIA 3GM8A 4OLVH 1XF5B 2X4RB 4LGPB 5MEQB 2M26A 1G0XA 3HB3C 4R90L 3DGGB 3H9HB 4UIKH 5A2JH 4Y2DD 4M1DH 2H2PC 1B2WL 2AI0H 3P9WB 4U1SA 4DGYL 3L3JA 3ZE0F 1NAMH 1TCRA 3P11H 1UEYA 3LV3B 3TT3H 1ZHBA 3H3KA 2EH8H 1KJ3H 2OTWB 2EDBA 4IHOA 3H9SA 2VC2L 4R2GD 1LNUB 2FD6L 2HG5A 4P59L 2AK4E 2VKWA 5DHVA 4G6JL 4KTDH 1A1NB 3BHBB 2DM4A 3CX5K 5IHUL 4LVEA 5D6CA 4AH2B 1BBDH 3O4OB 1BVZA 5J8OA 1XT5A 1CGUA 4LVNC 3RY5A 1E4KC 2A2QT 3ARRA 3WHXB 1BQSA 1RZ7H 3ES6B 5HJ3A 3BKJL 2R8SL 2ORBH 3F7VB 4FRWA 1GGYA 4S10A 5TE4H 1VFUA 2J8OA 4XNUH 5ID0B 1F4WH 1NMCC 5GRWA 1DBKL 1FFOB 3MBED 4GKZB 4QXGH 4TTDD 2CDGB 1MJ7H 3R0MA 4PRID 1H3VA 3IFPB 5C07B 3KPRD 3K1DA 3MRGB 3V0VA 4R7NB 1MFDL 5L0QB 4I2XE 4JDZA 2WUBL 2DKUA 5DJ6A 5HGAA 4F8TA 5A2LH 3MRKB 1DVFB 2ZSVA 4M48L 3MO1A 4ISVA 3FOLA 3FB6B 4RNRA 5E2TL 3X3FL 2DQJH 1BPVA 1RZKL 4XAWH 3ULUC 1GGCH 3QIBC 2NW2B 3X13B 1S7TA 4M93B 5L2KD 3EOBB 2J5LC 4XCNA 5JW3H 4GS7B 5DFVC 3OGCB 3V2AR 5DVMA 4XPGH 3VXOA 3SDXB 4PGDB 5DQJB 4HUWA 3MA9L 2NY3B 1NAMB 3FOMB 4MB4A 2K7QA 5EPMB 2B2XL 1F45A 4KKCC 3LQAC 2G75A 2EC8A 3FB5B 4OZFH 1IEAA 3RVWD 3KPRA 4H5SA 4GRLC 5GGUA 1NKRA 5D72L 1GGBH 3MNVA 4FP8L 3T8XB 2J8UF 4RZCA 5CBAB 5H94A 2J88H 4JM4L 1MF2L 5EO1A 1KIQA 2I9LB 4JPWL 3OR7A 5E00A 3D2UD 5FB8A 1G7MA 3P4LA 1ZLSH 4ODBD 5L2KA 1UADC 4NCC2 3TIDB 5IVNA 1G6RA 3HI1B 1FQ9C 5L2JA 5FECB 1JZ7A 4Y19D 2E7BA 1SYSA 2BVQA 3D87B 4HIHA 1H3PL 2IQAB 5J13C 2IMMA 4JFOA 1CXKA 3JUYA 3TBYA 3DV4B 3RNKA 2KDGA 4KK5D 4GRLA 1HKLH 4BM7A 4ZS7L 1X5FA 3HE6B 4XP9L 5MP6L 2BCKB 4YNYB 2Z8RA 3CDCA 3QDMB 4HPYL 3PDDA 2GEEA 1OAYH 3E1F1 1NC2D 1IC4L 3C8KB 4H88H 1JYWA 5ACZA 4G42A 3WBDA 3MR9A 1HOCB 1FBIH 2X7LB 3UC0L 4LEOA 1N3NA 4KI5F 4DFHA 3RUGB 4LCUA 4M8QA 3ROOB 1T5WA 3QQ4B 3AFLA 5IVXB 2DL9A 1XF2B 1KF9B 3DYPA 5DRZA 3QPQC 2D31A 3B4NA 3UTTB 2EDRA 2IH3B 5D6DA 1CICB 3DI3B 4N1HB 1RUAH 2GJ6D 5CEZH 1CE1H 1U8NA 3BVNB 2GUOA 3D0VA 5EZIH 4GKNA 3PWNA 4M6AA 3ULVF 3HC4H 2GCYB 3SJVB 4GJTB 4OZFB 2DICA 3TPUA 1X5LA 2BSTA 4N8CH 4QY8A 2BFVH 2DBLH 2KQMA 5CCKH 1EMTL 4XCYB 4F7TA 5F3BB 2NZ9D 3IDMB 1NC2A 1INEH 1IRAY 4Z7UB 2Y36H 4ZUUA 1WAAE 2NCMA 3EYFB 4FQCH 2PO6B 5DS8A 2WLYA 1S9VA 4Y5VC 3CSYA 4OZIF 3QNXA 4NCDA 2W9DL 4ESKA 4JFEE 4G5ZH 4TOYL 3G6AB 5FO8B 3PWJA 3ARBD 5E9DE 1X5AA 3NN8A 4HC1A 2GJ6A 1R3IL 1BWMA 4YHYC 1EHXA 1A2YB 3X12B 4ZTOH 4S2SA 2BY2A 3MOQA 2CJUH 4FTVB 2BSRB 1KIRA 5DHVH 4MDJB 3N9GL 3HAEB 3VG9C 2RHEA 4HXAH 1HHGB 4NPYB 3GMPB 1W0YT 4Y5VA 1UM5H 5CKGA 2V2TB 2LV4A 4NNXB 5I1JL 4PJBA 4OV5B 3F7YA 5I66B 3NCJH 3GSNL 4HK3J 3SCMC 2WNGA 3I75A 3ZHLA 3RZCD 5E8PA 4NQXA 4BKLA 4O2CB 2ITDB 1A9EB 1PD6A 1JNHB 3ARBA 1A9BB 4LKXA 1AR1D 2ILLA 3MLUH 3SPVB 2WINB 3G6JF 5EOTB 3KDMB 2C4FU 2XQBH 4X6BA 1BGXH 2VOTA 5KSAC 4PTTB 5EOCH 1YNLH 3EDEA 5JMOC 5CD5D 4KMLB 4J3UA 3KLAA 3UJIL 4HJGB 3HS0B 3VXMB 1LP9A 2UZXB 5GJTH 1VACB 1BBJB 5DQ9B 3E6FA 4D8PA 5DJZA 3WLBB 1E4XH 4HWNA 4WGWB 4XX1G 4V1DB 5I8OH 2DLHA 1JMZA 4NJ9L 4JO4H 3ZKSD 2NX5B 4WDIB 1K3IA 1EJ6A 3RZCA 2JELL 2ICWA 3BUYA 4JZNA 1LWRA 5IM7A 5C2BL 1DQLH 4ETQA 5KSAA 5HHPA 4WENB 4YHML 5IBLD 4DOHB 4U1SB 3L3JB 1T5XA 1TCRB 3O41A 3MRLA 3NAAL 3BIKA 5JOFA 3IS1X 1P84K 2R29H 1FJ1A 1ZHBB 4X4ZA 4M1DL 4I0KA 1NBQA 4IHOB 3UPCA 2B1AL 2HFGL 3ARZA 3H9SB 5TGBA 3UTOA 2ZUVA 3X11A 1EGJA 2HLFC 2NY2C 2UWEF 4MCYA 5DHVB 3RWGA 1OL0A 1J8KA 3AB0C 4XXCC 4NFDA 5D6CB 5A40E 1CFQA 2YD2A 3T0EE 5FM5M 4PJIA 2WIIB 2W60A 3U0TA 5TDPA 3UJTH 1HSAA 5HYSA 3TH2T 5E2JA 3IFLL 4ZPVA 1X5HA 1NUDA 5DZLA 5JR1H 3DYOA 1JJUA 3ILQC 2ORBL 2QLVB 1CG9A 1L7IL 2YS4A 5TE4L 4R2GB 3V0VB 3IAQA 2E9WA 5E70A 4JDZB 1CF8H 4XXCA 5BVJA 3OJDA 5DJ6B 1F4WL 4J3SA 2VLJE 1TJHH 5HGAB 2OI9C 2ZSVB 1MJ7L 3MO1B 4ISVB 3WHE0 1KB9K 3FOLB 4GOSA 5IBUG 4KDVA 4S1DD 3RHWF 3LDBC 2YD1A 1L7TH 1RJYA 3G5YA 4JFFD 3G5XA 4QKXB 4QXWA 1S7TB 2W65A 3B8YA 2QSQA 2ZKHH 1RURL 4XCNB 3TNNA 4NDMB 3PHSA 2DQJL 3QXWA 4XAWL 3QCTH 2ADGA 1GGCL 2DI7A 1NMCB 1BM3H 1BLNA 3SDDC 4X9GA 4OQTL 3VXOB 1T04A 2HTKD 3U6RA 4FQJH 1ACZA 1CGTA 4OGYH 4YPGA 3U9PL 1IARB 4I3RH 2G75B 3WD5H 3TZVC 1IEAB 1EAPA 4XPGL 3IDXL 3KPRB 4H5SB 3QEGH 1GIGL 1R3JA 5GGUB 2QADD 5JW5A 1S7SA 2LE9A 1EA9C 3MNVB 5FXCH 5IESL 3CH8A 2HYMA 4POZD 4RZCB 4ZOAA 4ZMAT 1UH3A 3GIZH 4OLXH 5H94B 4LIQL 3OPZL 4PJFF 2J5LB 5EO1B 3EYUL 4OZHA 1GGBL 1KIQB 5HSFA 3V79C 3OR7B 2FX7L 5FB8B 2OX5A 1G7MB 5L2KB 4Z0XA 3RGVC 3O45A 1A21A 1G6RB 5L2JB 1HIMH 3VXSE 1SYSB 4XPAH 2BVQB 4HIHB 2YPKA 2E6PA 4JFOB 3WS6A 2EH7H 3RNKB 4D0BB 4EVNA 5DTFA 3T3ME 3T0XA 4GRLB 1EBPA 3BZDA 1IFHL 4POYA 4MB3A 3MLRH 3LB6C 3QXVA 2AKRA 3GM0A 1FYTE 5D2NB 2APXA 1RU9H 5ACZB 4KRNA 4AJ0A 4G42B 1H3TA 4QHUA 3MR9B 5I30H 3ZDYE 2EECA 1M05A 3WNOA 3RGVA 4ODTH 4NRZA 5EWIH 4LEOB 1N3NB 1OAYL 4LCUB 4M8QB 1T5WB 5EC1A 1QLEL 4OF0A 2VZ3A 5J13B 5DRZB 4ALAL 2FIKA 3JVGC 4HDIB 4RGOL 4OF6A 1SYVA 1A6PA 5JIHA 5ADOL 4MLSA 5IOPA 5ALCH 4AEHH 1Q8MA 3K2UL 4KROC 4XVUC 1S9XA 2P45B 3U9UA 4B7LA 2LTQC 5DD3L 1U8NB 1FZOA 2GUOB 3D0VB 4GG6E 4GKNB 2XT1B 3PWNB 1MWAA 5GQBA 4ZD3H 5T1MA 4G8FA 1I1RA 4XNZC 2HRPH 5E0QA 3ABZA 3TPUB 1T6WA 2BSTB 4QY8B 4GQPH 4A6YA 2CH8A 1MCNA 1WSST 4F7TB 1J0JA 1I9EA 1NC2B 4N0CD 5T3ZL 2XQYG 4NO5A 3HC4L 4FFWC 4ZUUB 3GEWB 1IAIL 2ZP0T 4N8CL 2BFVL 2DBLL 2FIRT 1BX2A 5DS8B 3JVGA 3CD4A 4K9EH 5MEND 1S9VB 2XN9E 3CSYB 3MLWL 4ZG1A 3RDTD 4CU7A 3PJSA 1N59A 2Y36L 3KPQB 3PWJB 2RBLA 4XPBL 3NN8B 4S1QL 5DD0H 2X4TA 5C3TA 4XRCA 2HAZA 5EBMA 4CW1A 2GJ6B 5KBNC 5F6IB 1KV3A 4R96A 4XI5D 5BQ7A 3MACL 4JZJC 4QF1A 5SWZA 4S2SB 5DK0A 1QA9A 3PXHA 3NCEB 4MWFB 2XV6B 1FLRH 4RBPH 1EGJH 5HHOD 1M1SA 1OVZA 1TTGA 5T1LD 1KIRB 3FN3A 5CILL 5BS0A 1DBBH 5EBWB 1CFBA 3PGFL 2EDQA 5BO1L 1YEHH 2IAND 3MGTA 3QFDA 4PJEF 4ZTOL 1FAIH 3OB8A 4Y5VB 1FC1A 1FORL 1YPZF 4UZGA 3QCUH 4LASH 4PJBB 3F7YB 3S3SA 4JFXA 4QNPF 1RIHH 3I75B 1AQDA 3U1SL 5E8PB 4NQXB 4BKLB 1OTUC 4BZYA 4DVRH 3ARBB 4YHYB 4LKXB 2I07A 4JZJA 3DECA 1IEBA 2F54E 1KIPA 4X6BB 3BE1H 1C1EH 4PRHE 2BNRE 4WWKC 1B0GA 4GKOA 3T0DA 5CGYD 4L3AA 3L5WA 3JZ7A 3VFRA 3MLUL 3U4BL 3KLAB 2ZOLA 1VPOH 2XQBL 1BGXL 2Q7YA 1LP9B 2VMFA 5SX5H 4ZOBA 3E6FB 5D7SL 4D8PB 1YNLL 4IDLA 5DJZB 1UKSA 2IANA 3KLHC 2Q87A 5HPOA 4DAGH 4Z7NF 1J1OH 1YEDA 1G1YA 3BSZH 4KQ4H 5EZJA 4Z8FL 5GJTL 5ERWA 5DGQA 1FSKC 3NA4A 5DFTA 3RZCB 4J12A 2ICWB 1E4XL 1QFPA 1MJJB 5EB9A 3BUYB 4JZNB 5IM7B 5I8OL 3P30H 4JO4L 3VDBA 2W07A 4WWKA 4LDEB 4ETQB 5KSAB 2HVKB 3FQWA 1ZT4A 3O4LD 5HHPB 3B2UC 4ODXA 1AO7E 3MRJA 2YA0A 3C9NA 4HGWA 4JJ5A 4M8VA 1T5XB 4L29A 3O41B 5ACLA 3MRLB 1DQLL 3BIKB 5JOFB 1AD9A 4GRWB 4RMWA 1CGYA 1FJ1B 4PB9L 5GRUH 1ZGLM 3BKYH 4OLYH 1F2XK 2CPCA 5TGBB 3X11B 5ITFA 5KVDH 4OFDA 5C0BE 3ME0A 3JXAA 4LL9A 1MCBA 2R29L 5DJDA 4O5LH 2EIBA 3RWGB 3DX7A 5INDA 5BOPA 3GBNH 3TVMC 5EUOA 3MJ9A 3FZUC 1CFQB 5E8EA 1MREH 4WY7H 3D6GA 4TRPH 1LO3L 5L6YL 2BVUA 5TE7H 1CDYA 4PJIB 2W60B 3U0TB 3MOAL 5E24E 4M6NL 1FFRA 4H20L 1K3ZA 2P5WE 1HSAB 4JM2C 4CMMA 5HYSB 3O4LA 3GBMH 4P49A 4XC3H 4ZPVB 4TQEL 2KUTA 3WHE1 4MVBC 4NNYA 4PYHA 1RMFH 2NY2B 4G8GD 3QI9D 4K7PY 3MGAA 4YFDB 3RY4A 3I9GH 1ZA6A 1QR4A 5DLMH 1CG9B 1T1YA 2FJGA 5BVJB 1KJVA 3OJDB 5FGCB 2G2RA 4DZ8B 5IMOA 3REVA 2EKJA 2QSTA 1RJYB 3G5YB 1MEXL 1UH2A 3MYZA 3G5XB 2W65B 3T0VA 2MOVA 2PYFA 5DEZA 3TNNB 2DBJA 2ADGB 4PJHA 1BLNB 1X5YA 3WNMA 1T04B 1JZ6A 3U6RB 4JR9H 2ZKHL 3ESUF 3KYOA 4JRWA 1IBGH 4DFIA 4CVWA 1G7JA 3QCTL 1QOKA 3PWLA 2ID5A 1EAPB 2OI9B 4YPJA 4EEEA 4A6YH 2XA8L 1R3JB 1UH4A 2LU4A 3ROLA 2AGJH 2IWGA 5JW5B 1S7SB 2HKFH 4U2ZA 3U4AA 4FXLA 5EU6D 3WD5L 5E08L 2RCSH 1CDGA 2W92A 4EXPX 3QEGL 4K3DH 5IQ9A 1OM3H 5T3XL 4OZHB 3AXLA 4QTHA 3HG1A 3CSBA 4Z0XB 3O45B 3BAEL 3GIZL 4OLXL 2HVJA 2YUZA 4HBCL 5MHSD 2GK0A 3ECBA 5D1ZC 3GMMA 5A2FA 4DTGH 3I02A 2YPKB 1YEIL 4P2CG 1JNJA 3AREC 4EVNB 3CXHK 4MNQA 5DTFB 4L4VD 1BP3B 2JCCA 1HIML 4KDTC 2G5BB 1QACA 1DQTA 4KZEH 2JKXA 1A6ZA 4PJ5D 4IBLT 1T66D 2VSDA 2BJML 1UC6A 4N8PA 2AKRB 2QADB 4MZ3A 4D9RE 1GJIA 1F6FB 3O0RH 3UZEA 4X6EA 1MCEA 5EU6A 4QHUB 3PQYD 4WVRA 1M05B 1TZIA 4MJIE 3RGVB 4NRZB 2XNAA 4G6FB 5D7IE 5D1ZA 4GXUN 5EC1B 1Q72H 2FIKB 3BZFA 5I30L 1J0HA 2KZ1B 4HPOH 3ZL4L 3G9AB 1OGAD 3AREA 4HUMB 4PLKC 1SYVB 4KDTA 1H9VA 2D7TL 5IOPB 3U9UB 4KQ3H 1XFPA 1S9XB 2AJYL 2R39A 1FZOB 2YXFA 4L4VA 2YPLA 2BP3A 5A2KH 4Q0XH 4JJHA 1MWAB 2AJUH 3E3QE 5T1MB 3L3GA 4G8FB 3S3PA 2DWDA 1AIFA 5ALCL 1JHKH 2DLIA 2R56L 1SBSL 1IGIH 4A6YB 4ZOCA 3MV11 1MCCA 2VZTA 4XWOC 4KJYA 5C8JA 4NO5B 3WDIA 3PQYA 3QHZH 4HZLA 3TV3L 2EDHA 1HYRC 1BFVH 3W0WE 3PDOA 1BX2B 4F57L 5FUOL 4NQCA 3BP6A 1SBBA 1A6WL 3PJSB 4KROB 1N59B 4FG6D 2LTQB 1ZGLA 2VUYA 2X4TB 4XRCB 2CO7B 5EBMB 4CW1B 4F7PA 4K23H 1JRHL 4XNZB 1WAAF 4R96B 2ZSWA 2G60H 5BQ7B 3A6BH 4QF1B 1NDMA 2A6JA 3CFJA 5SWZB 4XPFL 1IT9L 5DK0B 1GAFL 2EXWC 1C7TA 1QA9B 4YHIA 3THMH 4HSQA 4EZMA 2OR7A 5DD0L 4RA3A 5T5NF 1JMXA 3INUH 4FFYL 1RZIA 3IB4A 4KKBD 1S3KL 2CMRL 5BS0B 2HRLA 3MGTB 2FEEI 3QFDB 4JFDD 4QOKE 3D18A 5B21A 5GGVY 4CVUA 2CRIA 2MTPA 1F6AA 3PP4H 4JFXB 4ZAKD 5E6ZA 2ZUYA 4Q74A 1AQDB 2Q86A 1DBBL 2A9NH 5D1XC 4WFEE 3TBSA 1FAIL 3KLDA 3TLRA 4MSWA 4LASL 4JRYE 2BX5A 3QDJD 2I07B 4FQIH 1MCHA 4JZJB 4HGMA 4WUKH 4YHKH 1IEBB 2XKNA 2F8VA 1C8PA 4NQSA 1B0GB 3DUHA 4KUZH 3X14A 4UIMA 5CZVL 2Z0BA 3L5WB 3VFRB 1CR9L 3HZMA 1D5IL 3WJLA 4LRNH 4P2QA 2ZOLB 3BE1L 4I0PD 2Q7YB 4YR6A 4OLWL 2I9TA 2YN3A 1I7TA 5FGBC 2IANB 4JFDA 4FN0A 4JHBA 4WFGD 5JO5A 1NGQH 5DJ2A 4QRRA 4HLZH 2NLJA 5C71A 4UDTA 1YEDB 5EZJB 1Q9WA 5ERWB 1PZUB 3N1MC 3T2OA 3LVEA 3ZKQD 4RBPK 1EJOL 4XPHH 2A38A 4KQ4L 4WWKB 3QDJA 2WUCH 3SQOL 1WIUA 4JAMA 3FQWB 5EG6C 1GGIH 4ODXB 3MRJB 4HGWB 2KZWA 4JJ5B 3NZHL 5T5FH 1FL3A 5AEAA 3L95A 4L29B 1RIVL 2CLRA 3BIAX 15C8H 1MCOH 4ETYA 4NQDA 1AD9B 4NNPL 3EYSH 1T83C 1KXQE 3JBG7 5FGBA 3K8MA 5ITFB 4BH7A 1CQYA 3H7BA 4ZNEA 4GRMA 1JTOA 2QV2A 1XGUA 2ICWI 4HUVA 5DJDB 2A0LC 1FSKB 2FR4A 4MX7A 1QLRA 3BKYL 4OLYL 3DX7B 5INDB 1AQKL 3J8F7 3D1MC 4HEPG 5EUOB 4PJ7E 4NC0B 3RI5K 5DRXA 4R9HA 5E8EB 3K4DA 3FCTA 2HJLA 4O5LL 4I8DA 1NFDE 1WCBB 2CO6B 3GBNL 5SX5K 1YDPB 4CMMB 3BH8B 1XZ0A 4OLUL 3O4LB 4HIIB 1T83A 4Y4HD 3EOTH 4LIQE 5TE7L 4NNYB 2VDLH 3MXVH 3U4EA 2VXSH 1NCBL 5F96L 3VGBA 4MNGA 5MERA 4XC3L 1ZA6B 4WO4C 5HYEA 4OLZL 3SDYH 4TUKH 5IUSA 2DQFB 2FJGB 2Y4SA 5BOZG 1KJVB 2HJFA 3LHPH 2VWEE 3K80A 2G2RB 1ZLUH 4JPVH 3S3JA 1KN2H 2FBJL 4LVOC 5DLML 35C8L 5IMOB 3REVB 5DA4A 2ICWJ 3KHOA 3S6CA 1CXFA 2YWYA 2PYFB 3TN0D 4J3XA 1BECA 1TZGL 1UENA 3GGWA 1A8JH 3RX8A 1EK3A 1NGZA 3HPJA 2FBOJ 4KVNL 3GSXA 1CD8A 4RX4D 4RQQA 1A3RL 3KPMA 5JZ7D 4RWHA 1X4YA 3LMJH 1RSFA 2J8UA 5I1HH 3FJTA 3KYOB 1G7JB 3P2TA 3PWLB 1NKOA 5DJAA 2DQCH 3EDKA 3FFCE 2R9HC 2C1PA 5H37G 4GSDL 3TFKD 4KI5D 1OP9A 2OL3L 3ROLB 3NGBB 4U6VH 1TDQA 2RR3A 5DHXB 1IAKA 2LVEA 3BWUC 1IBGL 3DROA 4G9DA 1T1WA 5IQ9B 5HVHB 2AGJL 3VWJD 3AXLB 4QTHB 5SWSD 3HG1B 2I60L 4M1CC 3WLWC 1K2DA 1HSBA 1AXIB 1I85C 2FH6A 2RCSL 2HVJB 4MGXA 3DXAD 2GK0B 5EIVA 3FHAA 3GMMB 5T3ZE 3I02B 4E41E 3WJJC 3ULVC 2GSIA 4LPVA 4MNQB 1KB5L 3O3EA 1U95A 3T77A 2JCCB 3LD8C 2OR8A 3SY0A 1A6ZB 1IKFH 3ARSA 4DTGL 4RGND 3D39D 3OG6B 1KGCD 4KMTH 3I2CL 3HMXA 3KVQA 4MXWH 4OBRA 4X6EB 3OKDA 5EU6B 2NY0C 2WK2A 2F5BH 1TZIB 2R4SH 3T3MF 2P8MA 1FVEA 4OFYA 4XGZA 5GS1C 2XNAB 5SWSA 1KTLA 5D1ZB 2K3TA 3D0LA 4F7CA 3BZFB 4G7YL 4HJJH 3AREB 3KS0J 3DXAA 1KOAA 1MAML 3JWDC 5GRVK 3L5JA 4JKKA 1JPSL 1AFVH 3VI4E 3ZDYF 1Q72L 3QUZC 4L4VB 4MCZA 1U3HD 2YPLB 3BN3B 1TTFA 1YMMD 4IEFB 4NUGL 4PJ5B 5HHVH 2N4IA 3FRPG 3L3GB 2ZUTA 2JTDA 3N1GC 2DWDB 1AIFB 1FNHA 3T4AA 3T3PE 4QRQA 3ZYOA 2CUIA 5J06A 4OZIA 2G9HA 4KJYB 5C8JB 5D7LA 5GS1A 4J3TA 2AJUL 5FO7A 1PG7W 4GUPA 3GKWH 3PQYB 4K94H 3QAZB 3KXFA 4HZLB 1ZAGA 3GZKA 3LOWA 3PDOB 4GG6F 1RHFA 3QIUD 4NQCB 2OXHA 3BP6B 4V2BA 3I3EA 3KR3H 1L4IA 3V6ZA 4RFNC 1ZGLB 4I9WE 1BFVL 2VABB 4DVBB 4LSUH 3BDBA 4Z0BH 4F7PB 2YD7A 3JWOC 1JGLH 3NIDE 2ZSWB 1OARH 4MLIA 3RVVC 5D7JD 1NDMB 2A6JB 3CFJB 4BH8A 1YMMA 1UCTA 4YHIB 5FYLD 5DD5H 5F1NA 4K23L 1L0YA 1SY6L 3MYJA 1RZIB 2NY1C 1Q0YL 1P6FA 4KPHL 3D18B 3THML 4G9FE 1UM6H 1HH6A 3QUXC 1MSPA 3B9KC 1F6AB 5GGRY 1JZ3A 4G7VL 3G6JA 3UP1A 2XZZA 5DVKA 3VCLA 5HDLA 2Q86B 4PJAE 1J0YA 2R4RH 3LS5L 4MSWB 1EDQA 4PRIE 2XKNB 3MC0A 4HMDA 3FO9A 4XVSH 1IC5H 1MCQA 4NQSB 1WWWX 5AG9A 5D7JA 3X14B 4UIMB 3CXDH 5F7KC 4FQIL 3HZMB 1N0LA 4RRPA 4WUKL 4YHKL 5FKAA 3S8WA 1G7QA 4YR6B 2I9TB 3QUXA 1QBLH 1I7TB 3QXUA 4JFDB 4OT1H 4UNTA 3DNKA 4IOFC 5JO5B 5JOEA 4QRRB 5DJ2B 1IGMH 3SKUD 2NLJB 4UDTB 3DWTA 1R3HA 1EEUA 1Q9WB 4M7ZC 6CGTA 4LARH 5AZ2H 3GMRA 4F33A 8CGTA 3KNBA 2W59A 1RIUL 2XWJA 4U1LA 1EAJA 4ODWA 1NGQL 4JRXA 3QDJB 5D96B 4JAMB 5D1QD 4M6OH 4OAWA 4NQUA 1VEOA 4L3ED 1FL3B 1MHHA 2UWEA 4WHTA 3PHQA 3L95B 1F90H 4K7PX 2CLRB 3VRIA 1YUHA 2GY5A 2ITCA 4NQDB 2AABL 2ZG1A 5CJXC 4XPHL 2HH0H 5LGHH 3WKMH 1MCWW 4UILL 3E8UL 1NBYA 3RVUD 4L8CA 4R4BA 5BV7L 3PDGA 1Q0XH 4YDIH 4XZUA 5T5FL 1F2QA 3H7BB 3W5MA 4GRMB 3QXDA 1XGUB 3MV9D 1CGSL 4HUVB 1BVKA 2FR4B 4MX7B 2F53E 1QLRB 2VZ1A 4PIRF 1F3DJ 1QFWM 4ZUSA 2GK2A 4Y19E 2N1KA 1ZOXA 2GFBA 1Z0MA 3QUKA 5DRXB 4OF3A 3U79A 5K93A 1B88A 3C09C 1OHQA 2F9BT 2V5RA 3FCTB 2HJLB 4H25A 1JPTH 2IBZX 1QSED 1J0IA 4WW2F 2X89A 1FPTH 1UJ3C 1MFCL 1XZ0B 4AG4H 4D9LL 1OQOA 2B8OT 5C6WH 2RIKA 5K9OA 4MHHI 4ZYKA 3M17B 2FH8A 5CLWA 4QHKI 5T3XE 3U4EB 4YBLC 4MD0A 3ZKXB 4Y4KC 4MNGB 5MERB 2VXTL 4Z77B 5FOBA 5CMAA 1XR9A 4YHZL 2HJFB 2FATH 3MV9A 3BDYH 5FCUH 4JPKH 4N0RA 1NCCH 2E9BA 3GB7A 4HBQA 4E42A 1VA9A 2VLRD 1ETZA 2DIAA 5DK2A 3ZKND 5HD8D 2Q3ZA 1UJ3A 1RUQH 5KOMC 3FQUA 1A6VH 3L7FA 5KVEH 1CXHA 1QSEA 3NH7H 3GGWB 5HHXL 3HPJB 3QUYC 3GSXB 4RQQB 4Y4KA 3KPMB 1KXTB 2XZCL 4ORGA 4MMZC 2J8UB 3O2VH 1X5XA 1U8HB 3V4VH 5HI4C 5DJAB 4ZPTB 4PJFA 2C1PB 3GSVA 1GH7A 2RGSA 1TJGH 2Z91A 5I1HL 3UO1H 2MKWA 1IAKB 3DSFL 2YMXH 3BFOA 2DQCL 4G9DB 1T1WB 4PJCE 5FHBH 1OY3B 2FGWL 4XBPA 1K2DB 4X83A 1HSBB 3ZTNH 3C2AH 3WDHA 4IRJC 4Y4FC 1T0MA 1ZLUK 1IC7H 1D7FA 4YJZL 2GSIB 1NDGA 1U95B 3O3EB 3T77B 3SY0B 2FO1A 3X3GH 1C5BH 3HE7C 3WUWG 4C55A 2ERJC 3QUMH 1KCUH 3U30C 1BQHA 1V3JA 2E8YA 4OKVA 5HPMA 3T08A 3OKDB 1IKFL 2ED7A 1EHLH 3LQMA 5C1MB 5J56B 2P8MB 4XGZB 5HYJA 4POUB 5SWSB 6FABH 1KTLB 4CN4A 4OSUL 4O9HH 4X4XA 1FNFA 3BGMA 3ARFD 3D0LB 1KIUA 4F7CB 1MQKL 3DXAB 1SMOA 1I1YA 3LD8B 1F4XH 4YZFE 4LCWA 4C56A 2VDKH 5DYOA 3HE7A 2KQNA 4O4YL 4CL7A 4HLJA 4NHUA 4MCZB 4JKPL 3O9WD 2QQKL 1A7PL 5FYLH 5D7IF 2HWZL 4M7LL 4CMHB 3D39B 3T4AB 3DVFA 2XRAH 4Z7QE 2D2OA 3FT2A 2FDBP 5BMFH 4QRQB 4OZIB 4QRPD 2G9HB 5D7LB 2VRAA 5HHVL 5FO7B 4GUPB 4QWWC 3KXFB 5CKAA 3EO1A 4DKFL 4DQOH 4P46C 4TNVF 1ZXQA 4NZRL 5M95B 3KGRA 1ORSA 3V6ZB 3CFKA 4YIQA 3P4NA 4FQ2L 4LGSB 4LLDA 1HINL 3QQ9D 3VFWA 5ESVA 5K9JH 1PYWA 5K9QI 5B4MC 4EQ2A 4NC1E 5T1DH 3FQXA 1EIBA 5D7KD 2NY6C 4BH8B 1NH6A 1YMMB 4PJEA 5A1AA 3Q6FA 1I75A 1YPZA 4HWBL 5F1NB 1JGLL 1WISA 1EEYA 4EUPA 1PLGL 3MYJB 2V2XA 2HKHL 1C16A 4P46A 3G5VA 2FGZA 1RUKH 3OAYH 1HH6B 4G6AC 3CC5A 4RFNB 3OG4B 4LCYA 3G6JB 1IGJA 3RWJA 2XTJD 3VCLB 1QR1A 4FNLL 4P2RE 4WHDA 3RP1A 4WEUD 4KKNA 1UM6L 4M43H 2HN7A 4H8WH 5ESAA 3H0TA 1IQWH 5IHLB 5DMKA 2ZUQC 1HYSC 3RWIA 3FO9B 1JUFA 3ZDZE 5J12C 4J8RA 5ILTH 2XQYK 2ZUSA 5D7JB 2CXKA 5C0CA 1P4IH 2NY1B 5FKAB 4ZXBD 5FAAA 5HGGS 3SKOB 3U2SA 1G7QB 4LPTA 5I71C 3QUXB 1OAKH 4EN3D 4WTWA 4JFFE 1ADQA 5EDXA 1WITA 1CLZH 1NLDH 2LAGB 4UINH 2OK0L 1R3HB 3SE9L 4HJ0D 2ZWLT 1R0AH 3GMRB 4F33B 3RKDC 1RVFH 3KNBB 2D0GA 2XWJB 4GW1A 4U1LB 4LOUD 4DUXA 4LSVH 2J2ZA 2YC1A 2DIJA 5KVFH 4JRXB 1B4JL 4FFZH 5I9QC 3MLPA 1YY9D 3FQRA 5AZ2L 2P8LA 4OIAA 3SDCC 4JG0L 3RFZC 4OAWB 3GUTA 4OIIH 1MHHB 2UWEB 2YBRA 4WHTB 3PHQB 3EUUA 1N5YH 1M7DA 3VRIB 1YUHB 3NCMA 2ITCB 4J3WA 4W6WB 4I18C 3CU1A 5DFWH 3BW9A 1NBYB 4PJ9D 4ZFZA 4L8CB 4R4BB 4LSSH 4F15B 4QO1A 1P69B 4XZUB 1TQBC 4H1LG 3G04A 1QYGH 4PD4K 3QXDB 1NCAL 3WKML 4CADA 2HH0L 4M7ZB 2LQRA 1BVKB 3WYRA 2PW1A 4ZUSB 3TO4C 2NNAA 1Q0XL 2AK4A 1GPOL 3C6LC 1XGQA 2GFBB 1IM9D 5E8OB 3R8QA 3QUKB 3AS1A 3LH2H 4U6XB 1ZVSA 1JCKA 4H25B 2IC2A 3LKOA 1RJCA 3F58H 5D1QB 3TP4A 4P4KD 4I18A 4IRSC 3VXNA 5DEGA 3WXWL 4L3EB 5K9OB 4U2YA 5C0AE 4ZYKB 1JPTL 5ESQA 5GRZA 4K3EL 1BJ1J 4MD0B 4PJ7F 1EZVY 4WCYL 1NL0L 3ZT5A 1G0YR 5DD1L 4YX2H 3TWCH 5FOBB 5CMAB 1XR9B 1NFDF 4XH2A 2OZ4L 3S35X 3TO4A 3MV9B 5EZOH 3C6LA 4ZSOE 4TSBH 3S5LG 4PBXA 2LU7A 1WK0A 5DUMH 3C09B 2JK5A 3D3VE 3GB7B 1GZQB 4I2XA 1KPUB 4YK4B 4E42B 4MA3A 3SE8H 3LEVH 1IM9A 1ETZB 2WV3A 5DQDH 5DK2B 3BDYL 3LPFA 4JPKL 4TUJB 1UJ3B 1X5KA 3DRQA 1H3GA 3FQUB 4F9LA 3L7FB 1ONQA 1QSEB 5C7XH 1MNUL 2VLMD 5FCSH 3WFHA 1MIEL 4Q6IA 4YBLB 1WIOA 1F58H 3C5ZD 1RUQL 4Y4KB 1U8MA 1K8DA 1A6VL 1R3LA 4ORGB 4YC2B 1N7MH 2MPAL 3NCYP 4B41A 2NXYC 3P9LA 3RVXD 2AJ3A 5HBBA 2DF3A 3OB0H 4PJFB 3QIWD 4UT7L 5DO2D 3GSVB 4M5ZH 1VEPA 5CIPH 2P42B 2Z91B 2CLZB 5H8DA 5DXWA 5MENE 2Q8BH 4S1RL 4M4PA 5H37H 5GSVA 2X1QA 2C3XA 1Z0NA 4XP5L 1MFAL 4NGHL 4QCIA 4XBPB 1YA5A 3IKKA 5DJ0A 5FV1L 3UO1L 1YEGH 3SGDH 4YXHL 2O61A 1NGPH 1MI5D 5FHBL 2VLKE 1T0MB 5F72S 5HHOE 2FEDD 3N85L 5SV4A 32C2A 3HNVH 3D5OF 3PGDA 1NDGB 1QFWH 1D3CA 1KTKE 2DQDL 2YEZA 3NA9L 1AXSB 4X5XA 4F37K 5L88H 1BQHB 5DWUL 1S78C 3RTQC 3A6OA 4OKVB 3AUVA 4ODUA 4OLEA 2EXYC 2NY4C 5HPMB 1OP5H 4XVJH 5IMLA 1YJDH 3QUML 4XCCH 5HYJB 1H3XA 2DYPA 3OGOE 2XPGA 2Z8VC 4N5EC 1PY4A 4X4XB 3LSOA 3GO1H 3BGMB 1EHLL 3E2HC 2HFEA 4HS8H 2WMPA 1I1YB 6FABL 4JFED 4O9HL 1UACL 1MCPH 4C56B 2A1WH 5DYOB 1XAUA 3HE7B 2ERJB 3D9AH 4NHUB 2DQIL 3U30B 5E9DD 2B5IC 4OCMC 1TNNA 4XTRD 3RTQA 5GRJH 1QBMH 4IOIA 2OR9H 4JB9H 2GTWA 4WGVB 3T2PA 3FT2B 2NTSP 5AYQA 3P3YA 5FYLL 4M62H 1OD9A 3VI4F 3QEQE 1CLCA 2XRAL 5IW1A 3ARVA 3EO1B 4R4ND 3MCLL 5BMFL 4UTBH 3L7EA 4XNYH 5DD6A 1WAAA 3VFPA 1ORSB 2Q76B 3ARFB 4GMSH 4KU1A 3MLZH 3CFKB 4YIQB 3IETA 3T3PF 3P4NB 4D2NA 4PUBH 4JFEA 3VFWB 1N0XL 2W9LA 5ESVB 1PYWB 1UYWH 1J8HD 3FQXB 5L7XH 5E9DA 5CJQH 5KSBE 1FC2D 4PJEB 2BERA 3Q6FB 1CD0A 1U9KA 3PV7A 1YPZB 5AYUL 5K9JL 4GBXD 3NOIA 1HWGB 3QHFL 1ZT7A 1EEYB 4OM0L 4EUPB 2W9EL 2V2XB 3IDNA 2XZQL 5JXAH 1C16B 4XX1E 2DQGH 4P46B 3WUWA 4PJ8D 3G5VB 4PBVC 4K07A 4L8DA 4QLRA 3CC5B 3TYFA 5GZOD 2FEEL 5I1DA 4LCYB 1CGXA 1IGJB 1QR1B 2MCPH 3L5XH 3J7HA 4OCNC 2OMNA 1VDGA 1BJMA 1CBVH 4G8GE 5ESAB 1YNTA 1Z9LA 3H0TB 3MJ7A 5DMKB 3ZE1E 5DMJB 2R0KL 2RFXA 3QH3A 3RWIB 1JUFB 4KRPD 4J8RB 1MRFL 5C0CB 2XFXA 4NP4H 25C8L 4G8EA 1IQWL 4P0DA 2VXQH 5I1KH 4PJAF 3S36X 5E7BA 3U2SB 1JHTA 3IRPX 2YKLH 1AXTL 1E6JH 1VHPA 5ILTL 1FO0L 3MRHA 4AYFA 3TYGH 3H3PL 4ONOA 1T4KA 3DMMC 4XHJC 5DUPH 2P48B 2XG4A 3BKCH 4PJ8A 2E7LC 1G9EA 3B9EA 1X3DA 3I6LE 3LZFH 1OAKL 1GGUA 5DI8A 1OLZA 1X5JA 1AY1L 1DBAH 4GW1B 3V4PL 2ZUQB 3L9RA 4X8JA 1DLHA 2YC1B 3T0ED 3FO0H 3T1WA 2J1KA 5J12B 3FQRB 1R0AL 2P8LB 1ZVYA 4GH7B 3MQIA 3KJ6H 3GUTB 4BQCA 2YBRB 3OAYK 4LSVL 3TJHD 1M7DB 2VDQH 5L8LB 4G6KL 4FFZL 4WIQA 5I71B 3ARGC 3GI9L 3BW9B 5GXBB 4ZFZB 2R2CA 4FQXC 1A0QH 3DMMA 4OIIL 4ZS6D 4OUUA 5JW4M 3G04B 1N5YL 4JFZH 1F4AA 1E0OB 4CADB 5I1GL 1I1AC 1W0VA 1SVZA 3PG2A 2PW1B 2AK4B 5I16A 1XGQB 4Q7DA 5MHSE 3N1PC 4C54A 5I9QB 5GISH 3RHWK 1ZVSB 1JI1A 3I50H 1RJLA 1MHPH 3LKOB 3T0EA 1HZHH 2DQEH 2X4SA 4C57C 3LH2L 2CKBH 1M71A 5DEGB 3ARGA 1ITCA 1S7UA 1ZHKA 4OGAD 4FQXA 3VXQA 5ESQB 1TQBB 4P23D 2DIBA 5CP3H 3FT3A 2AXGA 4OBSA 1CZ8L 2HT2D 2OJEA 4JY4A 5AWNH 4GXVH 4HWUA 3A6CL 3TO4B 1W0WA 3C6LB 4S1SH 5I74B 3FFDA 3IXAA 2DI8A 2JK5B 5HVWA 4OF5A 4I2XB 4YX2L 3TWCL 3S9DB 4MA3B 2VLJA 1AJ7H 1IM9B 1KJ2L 5EZOL 5JW4Q 5HDOA 3TT1H 4CKVX 1A6TA 4IS6A 4OI9A 1FCGA 1PX3A 3WNNA 5C09E 5DUML 3S34L 1ONQB 1AP2A 3QG7H 3FRUA 3LEVL 4PGCA 3WFHB 3IDJB 4Q6IB 4RMUA 5DQDL 1JK8B 2IG2H 3VGDA 4M7JH 1UKQA 3VXSD 1U8MB 1K8DB 4HMCA 1R3LB 3ESVF 2IPUG 3RBGA 3MCKA 4P23A 2DJUA 4Y88A 3MNZB 2IPTL 3P9LB 4HCRH 2AJ3B 1F58L 4AIOA 2ESVE 4DKDC 3LEYL 5IV2A 2ZCHH 2EZ0D 2WBJC 1GC1C 4NUJA 4JHWL 1ZWIA 5LXGH 1N7ML 5GSVB 1FDLH 2YD9A 1V7ML 5I76A 1FYTD 1KXVC 3QT2A 4NCC1 1T3FA 1DSFL 1S5IH 4M5ZL 4R0LA 4QCIB 3MOBH 4NWTH 1FGVH 5DJ0B 4C58B 1A7QH