4YDLB

Crystal structure of broadly and potently neutralizing antibody c38-vrc18.02 in complex with hiv-1 clade ae strain 93th057gp120
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVRLVQSGNQVRKPGASVRISCEASGYKFIDHFIHWVRQVPGHGLEWLGWINPRGGGVNYSRSFQGKLSMTMTRDNFEETAYLDLSKLNPGDTAVYFCARGFAGYEWSFIWGQGTLVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 41
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydlB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydlB01
5FYJU 1OL0A 4UT6H 3W0WA 3QEQB 3CSPA 4L8DA 3N1MC 4OZHB 4Q97A 4OV5B 3LKNB 4AZ8A 2WM0A 4LK4A 5GSVA 4AG4L 4JE4B 1EEYA 1CF8H 2CK0L 1KIQA 1NFIA 2ADJA 2ICES 2B1HH 3MMEA 1I4FA 1QEWA 4J23A 1IAIM 1W2KT 1UXWB 1YZZA 4RZCA 1ZEAL 1A9BA 1DEEB 5IB1A 3MZTA 4NC2B 3FO0L 4JY4A 3SPVB 2ZUTA 4LCUB 4I0PB 5LGHL 3BEWA 3RQ3A 3VFPA 5SWQB 3I9GH 3TBSA 4X6DF 5KVEL 4F58L 1KEGH 1FPTH 3GJFA 5L8LB 4JVWA 4CMHC 4Z7VB 3GIZH 1KPVA 4JZOA 5AWNL 1H8OA 2CDFB 3OKKA 3IETA 4BFEA 2NY5H 5CWSB 2GSIB 1VFOA 3HZMA 4UOW1 3W9DA 1OWRM 2H9GA 5JOFB 1AQDA 4BZ1H 1TPXB 2H2PD 1INDL 4K3EH 1U8NB 1EFXB 3MROA 2VLJE 5DRWB 4O5LH 1ZTXH 2YA1A 3G6JA 1RZKC 1G7JA 1F3DH 1I8LC 4KTEH 5IJKA 3ULUC 3BAEH 2VISB 5KANI 2EDQA 3C5ZB 3CVIH 3CVHB 4PD4J 1T6VN 4PJ7F 3SDAA 3CGTA 2EE6A 2IQ9H 3BXNB 3BGAA 5JHDA 4LHUB 4XI5D 1F00I 4QT5B 1E4WH 4R3SB 3I3BA 3DMMC 5EO1B 1CFQB 3HE6C 1RURH 4IRZL 2ITCB 1WWBX 5FO9A 3O3BA 4PG9B 4W4NA 5D1XD 5ID0A 5I18H 4FS0A 4L4TE 3BX7C 4S10A 1JPFB 1TJIL 1RZIB 3HNTL 4X4ZA 1Q9WA 1CDUA 4N9GA 4NGHL 2WWKT 2X1XR 5ALBL 2J8HA 4UDTB 5GJTH 4X6DB 5EULV 4IDJH 4JFPA 3MFGB 3MLZL 4BKLB 1I8IB 2DTMH 2WAHA 2GSGB 1IAKB 1R5VA 3P9MB 3VXUE 3WCYA 1BFTA 5DRZA 4PY7B 4WI7A 2BSSB 3FL7A 5DYOB 3BKMH 2IADA 3P4MA 4HJJL 4NRZA 1CD1A 1MCPL 3KAAA 2IPUK 4OD1H 3JWOC 2B4CH 4HXBH 1YMHA 4JKPL 5J06A 4ACPA 4JFZL 1MHHB 4Q6IC 2W65A 2AK4D 2HFGL 2ZUYA 2YPLD 5GGVH 4FXGB 5IR1B 5DJ6A 2OP4L 4N0FB 1HYSC 1KCRL 4JPKH 1GIGH 5T1MB 2F53E 4WFHE 2OXGA 2HJLA 4PBWD 3FTGB 4U6XB 3AMKA 4RGMB 5HVHB 4F15C 5A43C 4JRYE 1WVZA 1QVOA 1D5ZB 1KG0B 2HVJA 2RFXB 3RRQA 3BW9A 2VLLA 4OQ1A 5GRZA 1LDPL 4LRIA 3O2WH 3PHOB 2UWEF 3VFOA 3MLWL 1RZKH 3KJ4B 1ADQH 3WE6B 1U8JB 3B3IA 4KVCL 3RI5K 5DHVH 3SDYH 3UTTE 4WIQA 3WHXB 1SJEB 4MD0A 1MHCA 4PJIE 3QDHA 9CGTA 4ISVB 5CILL 3FB5B 3LV3A 5JQ6L 1CICB 4K2UL 3B83A 1KN4L 1P5UA 4G8FA 2JJUA 4TOYL 4AG4H 2IALA 2YK1L 1I3UA 2G9HB 4JHBA 4PJ9D 1EAPB 4NBYB 3FZUC 1SY6A 3FAWA 1ZWIA 1ZEAH 2R1WB 5F6IC 1KIRA 4I2XB 4F80A 3UROR 5ICXB 1WZLA 1CDJA 3FO0H 5CKGA 5F9WB 4UBDD 2GK2A 1Y18B 4U6HA 4MS8C 2OL3A 4BH7A 2AV1B 4LHQB 5LGHH 5IB5B 3L3KA 3G08A 4YBHA 3VFMB 5J11B 5ACZA 5K33A 1LD9B 2VMFA 1NMBH 5AWNH 1YA5A 4P2QB 2ZSWB 3V6BR 1XIWC 1OW0C 5IW1B 3WFEL 5D7IA 4PREA 4WUKL 5C0JA 3BQUD 3RX8A 3QEGH 5DJDA 2VB5A 2UWEB 2OQJB 2V5YA 3RPIB 1INDH 4O51B 3UJTL 1T04A 3IDIA 1EH9A 4X4XA 1O5DT 5CINH 5GGRB 1J10A 5FOBA 3EDJA 2GI7A 2BOBB 4FTVB 4XAKE 4OBRA 4MCZB 3BDXA 1ZLSL 1PKOA 4JB9H 5INCA 5TE7H 4JFEA 2Z35B 4MAYD 5E70A 1GHFL 3PGFH 4MDJB 1BVZA 5ESQB 3PWJA 4K94L 1YC7A 3F8UB 1AKJB 2MQ3A 1IEBA 3SE3C 5IM7A 2V7NB 3F7RA 4LNRA 5ICZB 4FQPA 2XWJA 3BDYL 3S3SA 3QUZA 5HVGB 2DQFB 4OF6A 3ZL4L 1NDGB 5JA9A 2BRRL 5CGTA 2PTVA 2R2BA 1TJIH 2EE2A 3VXMD 3QNXB 3M17A 3JUZA 1I7ZB 3UZVB 4HUUB 1AY1H 2A6JA 2DB8A 1KPUB 5F9OL 4U05A 3MJ6A 5I16B 4X6FA 3A6CL 3CSYA 4PGCA 3V4VL 3MLZH 4LCCA 5LQBL 4FQXD 1RI8A 1WT5C 1KFAL 3K4DA 4R8WH 4EXKA 2V6HA 4G6FD 3RFZC 2P1YA 3WIHH 3ZE1E 4WDIB 3F5WB 4HJJH 5EFIB 2XN9E 4UV7L 5LAXA 4JKPH 2OSLB 3I6KB 1SEBA 4PRHE 3EW3B 3SDDD 5JIPA 1A6TA 1ZAGA 2PO6B 4MHHI 2R56L 3ALXA 5E8EA 1Q0XL 1KCRH 3P4OB 2XA8L 5CJXC 5TDNB 1C7SA 3DHMA 4LQFH 1JPTL 4HCRL 4Z7UA 2FJHA 5KSBE 3CU1A 3GSNB 3DX6A 2WW8A 3Q6GH 3SGKA 4WO4D 2DL2A 4LF3A 2D4DA 2A6IA 3EOAB 3S36X 1MJ8H 4GBXB 4HXAL 2CRYA 4AEFA 3ZT6A 2APVA 4QRUA 1F11A 3WL9A 1MEXL 1SQ2N 4JGMA 5EBMB 4XC3L 4QTHA 3MRQB 1RHHA 1L6ZA 4OLYL 2Z0BA 1LP9F 3FB6B 5DA4A 4OUUB 4XVUC 5F7YC 5F7EL 4P2OD 3KPSA 4CVWA 2RGSA 3LIZH 4QRSA 4JPVL 5CILH 4JRXA 3VGFA 5JQ6H 1KN4H 4U33A 2Q7YA 1F2XK 4TOYH 3OF6A 5CD5C 3NA9L 3MFFA 2B0SL 4PP2A 2NX5A 3TPKA 3BPLB 2R9HC 3EYFB 3IFNL 1H5BC 3ARDB 3WDHA 4D0CA 3PP4L 1UWEL 3EO1B 3TM6A 1T89C 2A77L 2VERN 5EOCJ 3QEQA 1RZ8B 4OZHA 4WRLA 4OV5A 2VKWA 3AM8C 4B53A 4QRQB 2E3VA 3N85L 3ARUA 4HK3J 2CJUL 4MCYA 1UXWA 4ZUTB 2FATL 2NXYC 4ODHL 1DEEA 1RULH 4WUKH 3SPVA 4LCUA 5D2LB 4HKBB 2VUYA 2D7OA 4FQHB 4H5SB 4I0PA 3UJTH 4OF5A 3ZTJG 4LSQH 1NLDL 5SWQA 5IB2B 5FDWB 4Z7VA 1ZLSH 3QQ9C 2IPKB 4YHYC 2CDFA 1N59B 5AAWA 3LS4L 1ZLWK 5C07D 2GSIA 1D9KB 1GHFH 3PWVA 5JOFA 4FFZL 4OCRL 5ISZE 1PZ5B 2QADC 5F1SA 4X6CE 1YEKL 3BEVB 1U8NA 1EFXA 5BJTB 5FM8A 1OP9A 1D5BB 3WS3B 3ZKMC 4F8QA 5FO8B 3THML 1JI1A 4NOFA 3BDYH 5FCSH 4EQ3A 4QHNB 4Q2ZB 1QLFB 4FQQB 2BRRH 5DQDL 4PJCE 2VISA 2VNCA 5J0BA 3C5ZA 3CVHA 3SKJL 3QXAB 4JHAH 1ZT4B 4CAGA 5I30L 4HKJB 3BXNA 4KJQC 4MNQB 5F9OH 4M8VA 3RX5A 4NCC2 4LHUA 3T0VA 3STBA 4QT5A 4R3SA 2Q6WB 4OGXL 1KFAH 5EO1A 2RAMA 1E4XL 1CFQA 4Y5VC 2BC4A 3L3HB 4WGVB 5A1AA 2C3XA 4Y8AA 4PG9A 3HZVB 2HMID 3D2UD 1JPFA 3NPZB 1RZIA 1JYNA 5I1GL 4UV7H 1F97A 2Y72A 1IM3B 4YAQB 2VKXA 1JGUL 4M5YH 1Q94B 1OP5K 4PV9B 1I8IA 3QP3A 2GSGA 5E2TH 1HHGA 4KC3B 4U1HB 3F7VB 1AE6L 1IAKA 1S7RB 3P9MA 3QEUB 5F7LB 2XA8H 2A83B 2H32H 4Q9CA 4PRBB 4LCWE 4PY7A 2BSSA 1IAII 3OPZH 1AHWC 3BIAX 2V7HB 3GMOB 5KS9E 3MRFA 2VDLL 1MHHA 2XRAL 4JKWA 3VGBA 4JAMA 1KT2B 2MMXA 3O4OC 4HXAH 4J3UA 4R9HA 1CT8B 5F72S 2BHUA 4FXGA 5CEZL 4KWUA 4TTGA 1MEXH 3T65B 5IR1A 2MWCA 4N0FA 5EUOA 1OGAD 4XC3H 5ANME 2DYPD 1TZHB 5CZKA 3U30C 4ESKA 3RIFK 4ZMAT 3KHQA 1J87A 3FTGA 4U6XA 1LO0H 5HHOB 4YZFF 5F7EH 3RVWD 3V0WL 1J8KA 4H20L 1D5ZA 3DETC 1KG0A 4IOFD 4MQTB 3UP1A 2IQAB 4JPVH 4ENED 2VQTA 1SM3L 1OB1A 1U58B 3CH8A 43C9B 5HTSA 2UUDK 3PHOA 3T2QA 1A3LL 3B6SB 2HTKD 4RGNC 3WE6A 1U8JA 2B0SH 2FHFA 3K2UL 5FGCB 1BBJB 3IFNH 3WHXA 3WXWL 2YS4A 2HKHL 3PP4H 4NQCE 1NBVL 3MYJB 2XQYG 2A77H 2FRGP 3LD8C 2VDOL 3LEXB 4ISVA 3FB5A 5D6CB 3D39E 4OLXL 2KZ1B 4KJWC 4K7PX 4KDTA 2HTLD 1NC2D 3VXRD 2G9HA 5CJ5A 4ZAKC 2I27N 3N85H 4OCXL 3PGDB 3QIWD 2FATH 4U1MB 2R1WA 3VG0L 4ODHH 4JZNB 4I2XA 4QRTB 3W0WE 5ICXA 4YFLI 2IBGA 1X4XA 2DOCA 4V2CB 3DGCR 3EKCA 2AV1A 4EI5D 2ZSVB 3QDJA 3BH9A 4OFYA 4RGNE 1NLDH 1SEQL 3UEZA 3JWDL 3VFMA 1ZLWH 4JY6B 4ZO9A 3K74B 4MQXD 5C08B 3C8DA 4P2QA 4GRWE 5D5MB 5IW1A 4KU1A 4PRNB 1HNGA 3R1GL 1DBML 3VRLF 2UY7A 1BGXL 4NO3B 2UWEA 1YEKH 2OQJA 1XT5A 3RPIA 5SWSD 4EKXA 1FCCA 4O51A 3SDXA 2ZP0T 4F3FB 1TQBC 2BVUA 5CBEB 3S37L 2BOBA 4FTVA 4YNYB 1DBKL 4HAFA 3CMOH 5KANG 4HLJA 3MV7D 1MCWM 2CO7B 2LFGA 3SKJH 1N7MH 2Z35A 3P4NA 4KROD 3WNLA 4HIJB 4MDJA 12E8L 5ESQA 4G9FD 4I4WB 3VMOA 1DANT 1AKJA 1BIIB 2NY2C 2PETA 5BMFL 4ELKB 2X9WA 5ICZA 4GQ9L 4Y4FA 2GFBB 2MOVA 5EORL 2DQFA 1NDGA 2O61A 2ZOKB 5C9JB 4Z8FL 4L3EA 3OJMB 1DFBL 3BGMB 3UXFA 1A3QA 5K9JL 3O6KL 5I1GH 3RWCA 3E0GA 4ZS6D 3WSQL 1IC4H 1I7ZA 2VAJA 1OP5H 4FABL 1C5DB 4HUUA 5HGHB 1KPUA 4GRWH 5I16A 1KB5B 3JWDC 1MCOH 5DD0H 5DO2C 2MTPA 2EO9A 1MFEL 5BS0A 3DV6B 2ADIB 2PYED 5IMOB 5DQ9B 4WDIA 1WAAA 3G6AB 3F5WA 5EFIA 2VOTA 3MRHB 2X40A 4QLRA 1QSEE 3I6KA 2QKIB 2WLYA 3QPQD 1X5HA 4Y4HD 4N8CL 2XRAH 2BHZA 5AZ2H 2RHEA 4RFOL 3LDBB 5HYJB 1IEHA 1T3FB 2PO6A 3KPRB 1FDLL 3I2CL 3OAUL 2JJTA 1JZ8A 3NCJH 2EYSB 1NCWL 4PJ8C 2OMBA 3P4OA 5TDNA 3GB7B 4KRPD 4XGZB 5IW6B 4WTZA 5AAMA 3SOBL 5DSCB 4OJFL 1BZ9A 1RD6A 3VGAB 1JFQL 1LO4L 3QIBB 3GSNA 2QTEA 2UUDH 3UDWA 4H20H 1MCCA 4YBQC 3FONB 1ZT7B 1SM3H 3EOAA 2DKUA 3VFNB 4GBXA 4CKVX 1A3LH 4JY5L 2F58H 4HZLB 2APFA 5EBMA 4P0DA 3K2UH 4MD4B 4WFED 4HDIB 5D8JL 3WXWH 3FB6A 3TZVD 1UB5B 1YNTB 4YHLH 4OUUA 4I9WD 1NBVH 1QFUL 3CU7A 3FAXA 4OIBA 2CXGA 1F4WL 2G75B 4KXZI 4OLXH 1AC0A 3SKNB 2AS5M 5FIEA 4PJDB 4I0CC 3TT1L 3VD7A 3QPXH 1FNEA 3MO1B 3ZDXF 4UTBL 3VG0H 4M4PA 3EYFA 3TYFA 3BPNB 3AS0A 4I13B 4ZXBD 3ARDA 5IP4A 1F8TL 4MNHA 3EO1A 3PF2A 4GG6E 4NQVB 4GJTB 2I60H 3I6LE 5M95B 2AI0L 4M6ML 3WJLC 1SEQH 3JWDH 2HAZA 5GXBB 4KV5F 3BZDA 4U1KB 1YEEL 3PWPB 1QSZA 1L7TL 4ZYKB 3QQ3B 4QRQA 4MJIA 4XAWL 3MUHL 5D96B 4X0KB 5EU4A 3B9KB 3OR7A 3SJVE 4ZUTA 5D1XB 4KPHH 2JKXA 4P4KC 1A6UH 1IGJB 4YDVB 2IAND 1BGXH 3QIUB 2EDTA 5D2LA 3O9WB 3GMQB 4HKBA 3G5ZB 4FQHA 4H5SA 4YXHL 1KJ2B 3VWKD 4U3HA 4ORZC 2IEPA 5KSAD 4OI8A 3S37H 3QUZC 5D7IE 1OSPL 3QHFL 5J7CC 3AAZB 3VFVB 4DVRL 3IB4A 5DD3L 2IPKA 1N59A 2MFNA 4NKQB 3TH4T 4B41A 5DA0B 1NJ9B 1D9KA 2Z31C 2LTQB 3B2UC 1PZ5A 12E8H 4MQSB 4P2RE 3BEVA 2AK4B 5BMFH 4WFFE 3WS3A 3ARBC 4HC1H 1OCWL 1H0DB 2VE6B 4GQ9H 4CN4A 2B5IC 5EORH 1WC7B 1MAML 2FHBA 4AQOA 1MRDH 1QLFA 4FQQA 4Z8FH 3BZFB 1DFBH 1NUNB 3QXAA 4N0UB 4Y16D 5K9JH 3O6KH 1HEZB 1ZT4A 3WSQH 5HYSB 3O4LB 2YN5A 2XKSA 2YSSB 3FOLB 5HHME 2MKLC 2OLDA 4QOKD 2H2SD 4E41B 4JO2H 3UO1L 2BDNL 1YEIL 1MFEH 3ARGC 3L3HA 3M1BB 3ALPA 5DGQA 5SWZD 1KCVH 3X3FH 1I8KB 4YO0B 35C8L 1WFUA 3HZVA 3RX7A 3UYOD 3EO9L 4LVNB 4ONHB 1U6AL 1VGKB 1RUPL 1I3GL 4WWKB 1J8HB 1IM3A 4HT1L 5IEKB 1BM3H 5JW3L 1X3DA 1Q94A 1Q9KB 1B4RA 1U3YA 4MHHG 4PV9A 5T3ZD 1FDLH 3I2CH 4CMMB 1S7RA 3KLSA 3HR5A 1QNZL 3QEUA 1QYGL 4WWID 2A83A 4IIQA 4PRBA 4BFIB 3H3KA 3SOBH 4OJFH 5E9DB 1JFQH 2NW2B 4YFDB 1LO4H 3MLXL 1EX0A 4V2BA 3UBXB 4RBPK 3CLEL 3PL6B 1KT2A 1EUTA 3MNVB 1CT8A 3RUGB 2AGJL 2M26A 3L95B 4PJBF 3QUXD 5EC2A 4NQED 3T65A 4NUGL 1K4DB 3LPFA 5E8DL 5LWYH 1A14L 1TZHA 3TF7C 3MGOB 4CUCA 2A6KA 3CVHL 5D8JH 4H0GA 4ODVL 1G84A 1EHNA 5HHOA 1QFUH 1R3KB 4WFGD 5MENB 4RGOH 1F4WH 2IQAA 3PDGA 1CE6B 4WI3A 1U58A 4JQXC 5KVFL 4H88L 3B6SA 2VC2H 3TT1H 5DMGC 3P0YH 5ILTL 4C57C 4P23D 4KZDH 1TTFA 1BBJA 2QQKL 2VXUL 1MFCH 1RJZB 2IMNA 4RFEB 1DN2A 4UOW0 5C3LD 2PW2A 4MAYB 2FX7L 2O5XL 1MCLA 5DFVC 3LEXA 5FDYA 4M6MH 1BWWA 3HNVL 1FLTX 1KOAA 4G7YL 4MA7L 2NLJB 3T2NL 1YEEH 1L7TH 1N0LA 1E4XI 4XAWH 3V52L 4FRWA 2CPCA 2D31B 5FYKD 3PGDA 4U1MA 1G6RA 4JZNA 5KOVC 4QRTA 1FE8H 1EAJA 4FQCL 2OZ4A 1B4JL 2B7DT 4PJBB 5FV1L 4PP1C 2ZSVA 2DJ4A 3HMXA 3RKDC 2FIRT 4JY6A 4ZO7A 1OSPH 3QHFH 4U7MA 5KAQG 4DVRH 1RUQH 3JWNC 5C08A 4GAFB 5D5MA 4OF0A 3T0EC 3GMMB 3HG1E 4PRNA 1R3IH 3IDGA 5CGYC 1NKOA 4D9QE 4NO3A 3CFCL 4MJ2A 2VZ3A 2WBKA 5F7WC 3SDDB 1PLGL 4J1UB 3UMTA 1JZ6A 4EJ1C 1FVEB 3VG9C 5CBEA 1DEDA 1MAMH 3UTSE 2XWBB 4YNYA 1CE1L 1K4CB 4G42B 2OJZL 1KACB 1CLCA 5LBSL 1AXSB 4APQD 2XZAL 4HIJA 1N4XL 4OM0L 3SY0B 4I4WA 3TBTB 2J8UE 1BIIA 3VGHA 2EC9U 3UO1H 5E08L 4ELKA 1YEIH 2GFBA 5L8KB 3O3AB 4X83A 5J9PB 1CFSB 5CMAA 1FFRA 4XT1C 5BRZD 1RSFA 1V3JA 2ZOKA 5C9JA 4HS3B 5T1DL 2UYLB 3HPJB 3BGMA 3WDIA 1KCSL 4YEFA 2E9IA 3Q48A 5M94B 4DW2L 4DZ8B 4CADB 4R26H 1C5DA 1P7QB 5HGHA 1VA9A 4HT1H 3JV5A 3V95A 4WW1B 4M7ZB 4UDUB 3O6MH 1KB5A 2C3VA 3BI9X 5DJZB 4MQ7A 4DQOL 1W72B 2B39A 4PJFF 3PHQB 5DEFB 2F54E 1GGTA 1QYGH 4HUXB 1EVTC 3F7YB 2CO6B 4JZJB 4ZNEA 1CFVL 5DQ9A 3WS6C 3G6AA 3HC3L 4N0CD 3BPCB 3GBNH 4GSDH 2FJFA 2NNAB 4ZFGL 3VFGL 5IHBA 2QKIA 1P84J 4LAJH 3ROOB 3HI1B 5HYJA 3CLEH 2O26U 5E8NB 5H2BB 1T3FA 3RY5A 3GMRA 3L5JA 1AH1A 3KPRA 1UH2A 2AGJH 2EYSA 4NUGH 1FHGA 4ZUSA 3D85B 5E8DH 4YDLB 1A14H 3GB7A 2CLRB 4QXUH 2C1OB 4XGZA 3G5XB 5IW6A 2PTTB 2IH3B 3QIBA 3PXJA 3LSOB 5T1LB 4EVNB 5K59E 2MKWA 2NR6C 2X44D 3RGVC 1LWRA 3TH2T 3ZE0F 3FONA 2HWZL 2AJYH 3M07A 4W6XB 5EUOE 2GCYB 1J0JA 1QR4A 5EOQL 3V5DB 5KVFH 1UWGH 4H88H 2OR7A 4KRLB 1OLZA 3RA7L 3GM0A 2JTDA 4OZGF 4HZLA 5ILTH 2P8MB 4MD4A 3CK0H 3WYRA 1FL3B 2QQKH 4U31A 1P84K 2QQLH 5EZLA 5C07B 3QDGB 1CD9B 2R29L 3TBVB 2EZ0C 4MMXC 3ZDYF 2O5XH 4OFPA 3DYOA 4PJFB 3EHBC 2G75A 3B2VH 3HNVH 3CFKB 4G7YH 3MRMB 3SKNA 4JQVA 4PJDA 3T2NH 2Z8VC 4Z7QE 5FGSA 2VLJD 2QR0B 2G60L 5JXEC 1HH6B 3MO1A 3NMEA 1TVHB 4POYA 2DQTL 2F5BL 5HGDB 5FYLL 5DEGB 1NUDA 2EH8L 3LH2L 2AJZB 4NKDB 2KH2B 3FT2B 3RHWF 4XPGL 5BQ7B 4NYLB 4FQCH 3RVXD 1B4JH 4XNMB 4NQVA 4KHTL 5F9JA 3GHEL 3NIFE 2EDLA 4AY0A 2GW5A 2C5DC 3V0AC 3PWNB 3D9AL 4U1KA 3PWPA 2FO1A 4ZYKA 3QQ3A 5C0GB 1TNMA 3CDFA 1IQWH 4X0KA 4PRIE 3B9KA 4HGWA 4PG2A 5D1XA 1JN6A 5I8EB 3D2UB 4K8RD 1IGJA 2J5LB 3QDJE 4YDVA 3GSNL 3T3MF 3QIUA 4BA8A 3O9WA 3GMQA 3G5ZA 3S4SG 1KJ2A 1PLGH 3GMLB 2VL4A 2AQ3A 3ESUF 4RNRB 3PDOB 3I02B 5HHVL 5JQHC 3L3DB 4MB3A 5F7UA 2OJZH 3VFVA 2NTFB 4N0RA 3F7PC 2HRLA 5LBSH 2NXZD 2DQHH 2QV2A 3SDXE 3OXRB 5E03A 3VH8B 4U0RC 4WCYL 4JFHE 4XNXL 4OM0H 4ERSL 4JFFD 3GI9H 4GG8B 3CIQA 3VXQB 4MAUL 3FFDB 2ICWB 2DM4A 5IEHB 2VE6A 1H0DA 5L7XH 3RNKB 1WC7A 3H9YA 5GRUH 3RZCB 1AQKH 2MHAB 1SYVB 3BZFA 1FN4A 2NYYD 3MJGX 4N0UA 1HEZA 1L6XA 4EN3A 1S78D 4GMTL 3O4LA 2BNQD 2YSSA 2F53D 3FKUS 4WFHD 3SE8H 2BERA 3NBNA 1OAZL 5F1IA 3TGXA 5DZNA 3OXSB 4S1RH 1WZMA 4DQOH 5A2KH 4E41A 3L9RA 4L3EE 4IMKC 4XPTL 3ZHKA 5CP3A 4YHPB 3M1BA 1YUHB 4P48A 4M7LL 1OTUD 1TMCB 5I8CB 2V9RA 1LGVA 1I8KA 5AD0B 4YO0A 1CFVH 1YQVL 4S0TD 3TYGL 3HC3H 1EDQA 4ONHA 1VGKA 4ZFGH 2OI9C 3VFGH 4WWKA 1J8HA 4X6BA 5IEKA 5C0FA 2ID5A 2UZIL 5E8PB 5BS0E 5J3HD 1Q9KA 1IKFL 3DBXB 5MI0C 1TETH 3KS0H 2QQQA 1WAAE 1S7QB 2PR4H 4CMMA 1U91B 4ELMB 1IGMH 1NC2B 1P9MC 4NKIL 3VXRB 3D3VD 5AYQA 1MY7A 4BFIA 3NFNB 3QIWB 1FYTB 1CXKA 5E9DA 5FUOH 1UB6B 2NW2A 1MWAL 4ZTPH 3KXFE 4ZUVB 5TF1H 5TJWK 3RDTC 2H6PB 3UBXA 3MGTB 2VZTA 1EXUB 4LPYA 5TE6L 3PL6A 3DWTA 2YPKB 3KPNB 3MNVA 4K9EL 4NN6B 3RA7H 3RUGA 5BV7L 3VGDA 3L95A 3MRLB 2JJVA 4XVSL 1K4DA 4K3DL 4TSBL 2FECL 5JDJA 5I66A 1IKNA 2VZ1A 3I50L 1AR1C 4JPWH 1MI5E 1BLNA 1PGRB 1R3KA 5C09B 3TO4C 5MENA 5IFHL 1B0GA 5IVOA 1CE6A 3PWUB 3FO1B 3JVGA 1KTRL 3KR3L 4JM4L 4X4YA 4XH2B 2G60H 3ZKQD 1BVLB 3FZUD 2DQTH 3MV7B 2F5BH 1N6VA 1RJZA 3DV4B 2VLRB 4LSTH 4P99A 1G7PB 1F4YL 4RFEA 2EH8H 3LH2H 2EXYD 2DQIL 4KROB 3VXTB 4XPGH 3V7AE 2AXGB 1ORSA 4MS8D 4QRPB 3IDYB 2HT2D 4G9FB 4KHTH 1ZLVK 2P5EE 5GGSY 1OOAA 3D87B 4FFWD 3BP6B 2NLJA 5HI4D 5E00B 3D9AH 2EDEA 2HLFD 2I9TB 4TUJB 2BNUB 3NAAL 1CIDA 5IROC 1JTTA 5B8CC 2WQRA 4ZSOE 5JW5B 4CNIB 5ECJE 1KJMB 5ITBL 3MRGB 3TA3D 1P4IL 1QA9B 3L1OL 5L2KA 5CSZB 1IC1A 1OQXA 4PJXB 4PJBA 2NTSP 4MJIE 1ZANL 4LLWA 3DRQB 5BV7C 5C6PB 1VACB 2BNRD 4P57B 4KKAD 2WK2A 2ARJB 3SGEI 1WJ3A 2QSQA 3GMMA 4XVTL 4JDTL 3MBEC 1MHPH 4WCYH 3IDXL 4XNXH 1WIPA 3GFUA 4NHUB 4ERSH 2FEDC 4Y89A 5D6DC 3SDDA 4MAUH 4J1UA 1AGBB 4MXWL 5JR1L 3OTTA 4M43L 1FVEA 1CDIA 4PRHD 5DC0A 2XWBA 5KZCB 2X1QA 4XRCB 4HJ0D 1K4CA 4G42A 4W68A 1UKSA 2YKLH 2CDGB 4KRPB 3UYPA 1UWXK 3U2SB 5DD5L 1AXSA 3QUYC 3FFCE 1S7WB 2J88H 3D0VB 5TGBB 3SY0A 4XWOC 1OAZH 1V3MA 2K1MA 4D9RE 3TBTA 3FJTA 2JB6B 4YFEA 5DEZA 1ZXQA 1U0QA 3G6DL 1CTOA 2VAAB 2PTUA 1GGCL 3O3AA 5J9PA 4HULB 2M1KA 3MA7A 5LVEA 4GMSL 1YQVH 1KLUB 3TYGH 2Q3ZA 2UYLA 2D7MA 2BVYA 4BM7A 3QUMB 1G6RL 3CFEB 2ZUQB 4CADA 1ITCA 1P7QA 1H3PL 4WW1A 3EFDL 3QI9B 5HHQB 2OZ4L 4UDUA 5L88L 5DJZA 4J3TA 4JM2D 3HMXL 5L9DL 3C6LB 5F96L 1W72A 3PHQA 1FCGA 5DEFA 3ET9F 2KQNA 1CGSH 4PJEB 4NKIH 3F7YA 4JZJA 4OFDA 2JF1A 1LK3H 4AH2B 3BPCA 3FQRB 2NNAA 1MWAH 2CRMA 5FKAB 4G8IB 1UT9A 1M6OB 1H8NA 4O9HH 3CUPB 4U4BA 3ROOA 3HI1A 5TE6H 5GRXG 3ZDZE 1BQUA 1VESA 3NIDF 5A40E 3HE7D 3A0OA 5HVWA 2PKDA 5BV7H 4NIKB 4XVSH 3EOYG 4TSBH 1RVFH 3D85A 2V2TB 5MP6H 1K8IB 2CLRA 2C1OA 3G5XA 3RIAK 1BBDL 5D1QC 2CGRL 3I50H 2IH3A 4MVBC 2P8LA 3U7YL 3BKCL 4BUHA 2IANB 5T1LA 3RAJL 4Z76B 5E94B 2AP2A 4MYWB 2PXYC 4NNYB 1PQZB 2YWZA 4PLKD 3S5LG 1CYGA 1U8OB 3BKJH 3V5DA 5KSAB 4J4PC 3KR3H 3T0WA 5CD5D 5TF0A 2XKNB 5EWIL 1QBLL 2P8MA 1FL3A 4O58H 4OAWB 1UZ8B 2R9HD 3HAEH 1ZLVH 1OAQL 2VLKE 5C07A 1KN2L 3QDGA 5IMLA 1NCDL 2DQIH 1PYWB 2X10A 2J6EH 3MLTB 3PWLB 1T0NB 3TBVA 5GGVY 4KXZH 1WBZB 5GISH 2EDJA 1KB5L 4MMZC 3CFKA 2Z93B 1R5IB 3MRMA 3C60D 1KYOJ 1K6QL 3LN4B 3HI5H 5DJAB 3VW3L 4R0LC 1PKQE 3NAAH 1HXYB 2QR0A 4N8VB 1FZJB 1HH6A 1TVHA 4UQ2B 5I1HL 2W9LA 5ITBH 1K3IA 2C4FU 1I1AB 3WJJA 5HGDA 1P4IH 4NKDA 3FT2A 5BQ7A 4NYLA 3DVIA 3O3EB 5I1KL 4XNMA 4G6KL 1OAYL 3IAQA 1C5BH 2DDQL 3FOMB 2HFTA 3MLVH 1PD6A 4YXLL 3DGGB 1S5HB 3PWNA 4QWWC 4A6YB 2YUVA 5C0GA 3QQNA 3CXDL 3OKOB 3REWA 3AROA 5I8EA 1U36A 5EO9B 4XVTH 2D4FA 1FORL 3IDXH 3GO1L 1A6WL 4ZTOL 1DLFL 5GS0L 1KYOK 5D7JB 1OTSD 4K7PY 1WF5A 2P7TB 3GMLA 1KTKE 1RV6X 5CBAB 4MXWH 4RNRA 3PDOA 5JR1H 1TITA 2AJXL 3I02A 4HWBA 4M43H 4KK8C 4PTUA 3BSZL 4OD3L 3L3DA 5DURD 1NAMB 2NTFA 4K3HA 2ED7A 5DD5H 2KDGA 2X1OA 3OXRA 3VH8A 4ZNCD 3E8UL 3MV9D 4GG8A 5C0NC 1T1XB 4LDOB 4HFWA 3DYMA 3VXQA 3FFDA 3HMWH 3FN3A 2ICWA 3MV8B 5AUMB 5IEHA 3SO5A 2VSCA 4KMTH 1GGCH 3RNKA 3RZCA 3V9FA 1EEQA 4NQEB 1X4ZA 2MHAA 4JHZA 1SYVA 1EJ6A 3IT8D 4HMCA 1ED3B 1NGWB 1G6RH 1PY9A 5D7SL 1FFOB 1AO7E 2DQDL 1H3PH 5F8RC 3EFDH 4LCIL 3DXAE 3PQYD 3FB8A 1MJUL 4XHJD 1EK3A 4D3CH 1A4JB 3PIQB 5IBTH 5L0QB 3HMXH 2ERJC 2W0LA 5F96H 1YPZE 5L9DH 4G6AC 1N64L 2P48B 1YUHA 5F71A 3MOAH 4Y5YC 1DE4B 3ULVL 5AD0A 4QTIL 4M1CC 3VRIB 3EYVB 3DUSA 3NPSC 1S9YB 3ARPA 3VXOB 2FGZA 5MEPA 3IDNA 5F89B 1KIPB 2ADFL 5EIQA 1BREA 1FNLA 5E8PA 5C0AB 1KJ2L 3O6FB 3D6GA 4ZNEE 1IC5H 1M7IB 1QOKA 1T20B 1U91A 3IDUA 2ZCLL 4ELMA 3D39D 2NY3C 3CSGA 4MA3B 1SJXA 5DS8B 2AJVL 4P46C 1BBDH 3U82B 1MCSA 3NFNA 2CGRH 1FYTA 1F2QA 1UB6A 3O3UN 5DD1L 3U7YH 3BKCH 1G7IB 4ZUVA 1I9IL 4MNGB 4GS7B 3RAJH 1U8QB 3DETD 5DI8B 2H6PA 3RWHA 2KPNA 3MGTA 3W0WD 3WXVL 1EXUA 1HNFA 1GOGA 1VADA 2QSCL 3KPNA 5HY9B 4JR9L 2A9ML 4JKLA 4BSWB 2AERT 1OT1A 3OKYA 5EWIH 3NABL 1QBLH 4BH8B 4LEXL 1XCQB 3T0AA 1E6OL 5D1ZB 1RZFH 1T2XA 5D72H 1OAQH 1KN2H 1ZA3B 1LQSR 2D9CA 5C09A 4OCSL 1E6JL 4JLRB 5C0RL 1CDYA 4HLZG 4MXQD 5I2IB 3F6LA 1I9RH 4IMLB 3PWUA 3FO1A 1K6QH 3VW3H 4XH2A 4NO5A 1BVLA 4DJMA 3MV7A 5I1HH 3ECBB 3OAZK 3SO3B 4BZ2L 2PUQT 2VLRA 3DV4A 4Y5XB 1G7PA 1P4BH 5GRJH 1T2QL 4WHYH 3H9SE 4APQB 1F4HA 3NA4A 3LS5L 5GQBA 2PYFB 2AXGA 4QRPA 4G9FA 4R97C 2DDQH 4N90D 5AYUL 4U7SA 5CEZD 1BVKB 4FQ1L 4OB5L 4OTXL 5E00A 4LDEB 2I9TA 4TUJA 2DI7A 2BNUA 4DTGL 3CXDH 3BGFB 5JW5A 4CNIA 5BRZB 2CLZA 1KJMA 2I26N 2IGFL 3SDAD 1MF2L 1FORH 1QA9A 3GO1H 1A6WH 3IU3A 4ZTOH 1DLFH 4UB0L 5CSZA 4OFIA 1CLYH 4I0KA 4PJXA 5E56A 1T1WB 2H26B 1TZGL 2AJXH 4Z7NE 3DRQA 1UZ6E 5HYFA 2BVQA 3BSZH 4ZQKB 1VACA 4P57A 1C5CL 1A7RL 3OHXB 2P8PB 5IF0B 1AJ7L 3X3GL 2ARJA 4EN3C 4XX1E 2C4XA 5GZNC 2P24B 1UM4L 4BQ8A 3RJDA 3E8UH 4NHUA 4TSAL 4FP8H 1REIA 3WIIL 1AGBA 1EBAA 3HNSL 4NZJA 4DEPC 2H45A 4XRCA 3DVGB 2R0KH 4QRRE 2CDGA 3U2SA 3RWEB 2FECI 4XXCC 3I6GB 1S7WA 2DQDH 4KRNA 3D0VA 1G1YA 1NBZB 4LCIH 5TGBA 1WTLA 1MJUH 2JB6A 3C5JB 5E5MA 4XP5L 3PDDA 3UC0L 1DDHB 5CJOL 3BUYB 1X6LA 1UJ3B 4L1HA 1N64H 2VAAA 4OLUL 4HUKB 1BWMA 1KLUA 4Y4KC 1D3CA 3IGAB 3CFEA 4MJ5B 3LN5B 3MRCB 4PGBB 3BD5A 4KK9C 2ADFH 3QI9A 5HHQA 3T2PA 1UACH 1AFVH 3EYQD 3IKCA 3C6LA 2XG4A 1RJYB 2VDPL 2ZCLH 4PJEA 4PJ8D 4X9GA 5HBBA 2IF7A 2VLJB 4XNQB 3GIVA 4UMGA 4AH2A 3FQRA 1J0ZA 5DD1H 4ZOAA 5FKAA 4G8IA 4LPTA 4NWUH 3FRUA 1M6OA 2XZQL 2Y6SD 2VITB 2VQUA 4BSJA 4NZUL 2QSCH 4P49A 3HUJF 5I1IL 4JR9H 2A9MH 1D6VL 4FFVD 5FV2A 2MPAL 3KJ6L 3PV6B 3T2OA 2NPLX 3TJEL 1FH5L 4CMHB 2V2TA 4LEXH 2FJGA 1E6OH 3D25B 1JVKA 3BZ4B 4MXVF 5JDSA 4U1GC 2IANA 3TC9A 4Z76A 1LEKB 4NNYA 1E6JH 1ZA6B 4L4TB 2AVGA 5TE4H 1I1FB 4ODSH 3OG4B 2X4QA 5T3XL 4YC2B 5JMOC 1U8OA 4OIAA 3OAZH 3WO3B 4P2CG 2XKNA 1FVDA 1JMXA 4OAWA 5DHVB 1UZ8A 5GGTL 1T2QH 5J13C 4S2SB 3VXUB 1PYWA 3PWLA 3MLTA 4C4KO 1XZ0B 1T0NA 3LS5H 3VD9A 5C0IB 4IHOA 5FYJD 4MB5A 1CGXA 1J0IA 1WBZA 4L29B 1R5IA 5EIVA 3BWAB 1NMCC 4FQ1H 2Q20A 1MFAL 4OTXH 3SQOL 1FVCB 1W72L 3LN4A 3N1GC 5DJAA 1OTTD 3HE6B 2RCSH 1EZVX 1HXYA 4XVJH 4N8VA 1K3ZA 1NL0H 4UQ2A 4N1EA 4GT7A 5DGRA 1JGLL 1I1AA 4G8GE 3EZJB 2DQCH 3FQNB 3WNMA 5IHLB 2F53B 4UB0H 5E95B 3M45A 3WNNA 2EDBA 3O3EA 4L4VE 3MSPA 2NW3A 5HHMD 1TZGH 3VFRB 4XBEL 3FOMA 1A3RL 3Q3GB 4JRYB 2ZUXA 4L4JA 1SYSB 4WI9A 1XGUB 1S5HA 3QUZD 4NP4L 1H3XA 1NSNH 4A6YA 1A7RH 2QQNL 4GRLC 5EZOH 5B3NA 4OGZA 5L2KE 3BRGC 3OKOA 4KMLB 4N9OB 4NUJB 1AJ7H 3X3GH 1NFDE 4R4NC 4IRSC 4NFDA 5EO9A 5IBLD 2EDFA 1UM4H 5IMKB 1UQSB 4AIOA 1QTYT 4TSAH 4WTWA 4R2GC 3UTTB 2MJWA 5D7JA 2P7TA 4YGVB 2CKBA 4Q6IB 1QPXA 1ETZB 4PJGF 4NNXB 3HNSH 3B9AA 1DQLL 4PJIB 4O2FB 3GSUB 3S98A 4DGIH 1VB9A 4I8DA 3MA9L 4HMDA 4L9LA 1HDMA 1EHXA 3L3GA 3N1FC 4F15B 1JWMB 4LHUG 1JRHL 2EE3A 4G5ZL 1VFMA 3MV8A 5CJOH 1V3LA 2E27L 5DK0A 4MX7A 3NIGE 5E2JA 1FRGL 3DPBA 3V8CA 4NQXB 1ED3A 1NGWA 1FFOA 1RZJL 4P59H 5T3XE 4PB9L 1JTPA 2P5WE 1FGVL 4I48B 2BOCB 4O2CB 3P9LA 2F8XC 5FM4A 1A4JA 3PIQA 2ZJSH 5CEXB 3EAKA 2NZ9D 4O2EB 3BH8B 1RZ7H 3MRBB 3FO9B 5JW4R 5J57B 3VRIA 1F58L 1HILB 2XPGB 3EYVA 1S9YA 2NQCA 5F6IB 3S35X 5I1DB 3VXOA 4WHTA 1A22B 4PJGB 3BMWA 1KIPA 2ICEA 3MQIA 4GXUN 5J89A 2HG5A 3H42L 5C0AA 4JRXD 3ZE2E 3O6FA 1RIHH 1D6VH 1M7IA 3OF6D 3LEVL 3P0VL 4V1DE 1OARL 1VCAA 4HPYL 1T20A 2MPAH 2X6MA 4TNVF 1HK6A 3CLFL 4B5EA 3KJ6H 1T5XB 3TJEH 3VD5A 2NX5D 1T66D 5KSBF 4MA3A 5DS8A 1IILE 1S7SB 4Z7WE 5GJSL 1XIWB 1G7IA 2LAGB 1RUAL 3EJJX 3SHSA 3U7WL 3W81A 1N8ZB 5GSRB 2F74B 1U8QA 3OQ3B 5DI8A 1R0AH 2GAZA 2ESVE 2V5TA 5DF0A 3L5HA 3QEQD 4AIZB 3BDBA 3EFFB 5T3XH 2NY6C 5HY9A 2HVKA 4TPRL 1WZKA 5FM5M 1T83A 4KKLD 4BSWA 3TEUA 4FQ2H 5HGBB 4BH8A 1XCQA 4JM2F 1AD9B 5GGTH 2FL5B 5D1ZA 5L8JB 3U9UB 4FZ8L 3LZFL 1ZA3A 4F9LA 3TJHD 4JLRA 1MFBL 4OCMC 1UCBH 3AS1A 1IGTA 2XN9B 4D9QD 5I2IA 4IMLA 2I9LB 4PRHB 5J56B 1BFSA 1FJ1A 3ARFC 4Z7OE 3ECBA 4Y5XA 4NQUA 4EI6B 4TVPL 1MFDL 1MREL 2PYFA 3NGBC 1XF2B 2VZOA 3EYUL 2GKIA 1EFXD 4PP1D 4XBEH 5KSBB 1A3RH 3PGCB 1O0VA 4WY7L 1CFBA 2B2XL 4NP4H 5GZOD 4K23L 3C5ZD 1DN0B 4CRPA 1K9TA 4HK0B 5BRZA 1KGCD 1VFAB 2YC1B 4LSSL 4Z77B 1IFHL 4LHUD 2RIKA 4O00A 4GAJL 1MCEA 4YHNB 2H26A 2JJSA 4JQIH 2Q8AH 4JN1L 3V2AR 3VCLA 5BCAA 3TNNB 5D7LA 4ZQKA 3CFBB 3BN9C 5AG9A 3OMZA 3OHXA 5F9AC 2P8PA 2HA1A 5IF0A 2NY7H 3TT3H 4FQIL 1CBVH 2P24A 3ZKNC 3JBG7 4KRMB 1OAXL 2DBJA 1IJ9A 4PS4L 1CS6A 5I1AB 1M1SA 2DKSA 1JRHH 3V5KB 4G5ZH 4DUXA 1P4LB 3JV0A 1BD2A 1JPGA 4JKKA 1Z5LB 3MRDB 2D3VA 5HD8D 3DVGA 2CKNA 2V17H 1EA9C 4PB0L 3RWEA 1RZJH 1Q8MA 1TQCC 1Z9OA 2VWEC 3I6GA 4JCMA 4PB9H 1A6PA 3C9NB 1FGVH 1XGRB 5DJ2B 4PJ7E 1D5XB 3BUYA 1CICC 3QSKB 1CDBA 1Z9MA 2VIRA 1XFPA 3QA3B 5FGBA 1RZGB 4XP1H 1YEJH 3P73A 1F58H 3IGAA 1ACYL 2HT4C 2EIBA 1M71B 3MRCA 2VH5L 2VR5A 3LN5A 1H5BB 5IB3B 1SMOA 1XAUA 5LXGL 1XR9B 2DKMA 4HKZB 3BIKB 2J1KA 4X99B 4UI2A 3QEHB 4JRWA 1DSFL 5ISZB 2D7NA 1OARH 5CKAA 1SBSH 4X6CB 4RAVB 5J11C 4TVPE 2H32B 2VWEE 4XNQA 1HI6B 3RVUC 3QAZC 4HQQL 3EDKA 4WTZG 1I1RA 4PJCB 4PJ5E 2VITA 1NANI 4I77L 4BZYA 2Q87A 3UBXI 4K55A 4TPRH 3S3JA 3FCTA 4EDWL 3OV6A 1BQLL 3TIDB 1JF1A 3PV6A 4ONGL 4QHMB 3SCMC 4C55A 3K81A 4IBLT 7CGTA 1R5WB 4YHYB 3T0XA 2E7LC 3BZ4A 2C1PA 4FG6C 4G9DB 1DQQB 2EZ0D 1RY7B 4YHOH 1LEKA 1ZA6A 4L4TA 1JWSB 1MFBH 1I1FA 3QNYB 3QDJD 4OFYD 3I75B 3GBLA 3QXDB 4PGEA 1GL4B 1RFDL 3GNML 3OZ9L 4TQEH 5DFTA 4KI5D 1ADQA 4X7EC 4LSPH 1FQ9C 2CD0A 3UAJD 1JHKL 4P2QD 5DURB 5DHVA 2ZG1A 4DUWA 4OFVA 1NCAL 2XT1B 4S2SA 4NCDA 1F6AB 4TVPH 3VXUA 1MFDH 1XZ0A 3MLYL 2VXTL 4LCWB 5JOPE 4F7TA 5C0IA 3MNWB 3EYUH 1U9KA 5IQ9B 2V2XB 3MUJA 4L29A 3QCUH 1F13A 4L8CB 4JFHD 1T6WA 1UEYA 3BWAA 3NCYS 4QGYA 5KS9B 3GEWB 4WY7H 1FVCA 3DMMA 5F3HB 1GGBL 1EO5A 4FTVD 3ARTA 3HE6A 5I74C 4K23H 2X4TB 3EDEA 3QFJE 2RR3A 2YXMA 3ZYJA 1AD0B 3FQNA 4LSSH 5ANMB 5H37H 2F53A 4XNZC 7FABL 3BE1L 4JHWL 1AKJD 4GAJH 3BKYL 3VFRA 3E1F1 2BJML 3Q3GA 4JRYA 4Y4FD 3DX7B 3HRZB 4GRWF 1CXFA 4CN1A 1D6EB 1XGUA 4I1NB 1XGYL 1RPQA 2APBA 2ZOLB 2H1PL 3O0RL 3C8HA 1DBAL 4L3ED 4NUJA 3GI8L 3OAYK 2RJMA 4ONOA 5FUZL 5IMKA 5ADOH 1UQSA 4DCQB 1AHWB 1S5IH 1OAXH 4PS4H 3UTTA 1I7TB 1BPVA 1ZVSB 2GJZB 3EJYC 3F6IA 4PRPE 4YGVA 4Q6IA 5C2BL 4NQCB 1ETZA 2NY4D 4LLMB 5EH1A 1U3JA 3O4OB 2EIZB 1C7TA 1HQRB 1PG7L 4PJIA 4O2FA 5BS0D 5HXMA 1DP0A 4L8SC 4LSUL 4OT1L 3K4ZA 3GSUA 3D39B 1H3VA 3G6JF 4PB0H 1DQML 4GH7B 5FYLD 4E9LA 1IGYB 2W07A 2BVTA 2F5AL 1U42A 2A73B 1DZBA 5HGAA 2CUHA 1JWMA 4M1GH 1Y6NR 3W0WB 3I85A 3L5WB 4L8DB 3SBWC 1L0XA 1BF8A 2ZCKH 3ZYOA 4Q74A 3K1KC 1NGYA 4OZFH 2ADJB 4RGNB 3UTOA 4NQXA 1FBIH 2WUBL 1ACYH 4DK3A 1DANU 5HPOA 2VH5H 4X5WA 2EXWD 1K2DB 1I3VA 4I48A 3X13B 3TO2A 5LXGH 4GRWB 5DLML 1RUKL 3LD8B 2GIYA 3FN0L 4QO1A 2X5PA 5CEXA 1DSFH 3ISWA 4X4ME 4O2EA 3BH8A 2HRPL 1N26A 5FUCE 3GJFB 3MRBA 3FO9A 4A6YL 1WEJL 2Y06H 4IOIA 4ZAKB 3WIHA 3H9HA 3MCLL 3HR6A 1HILA 1KV3A 2XPGA 4XP6L 4HQQH 5I1DA 2GJ6E 5HI5C 3WDJA 3TCLB 4ALAL 3P30L 4I77H 5IWLC 4F33B 1OF2A 2CKBL 2CMRL 5HJ3B 2HT3C 5T1KB 4EDWH 1TVBB 3MXWH 2VQ1B 1T5XA 4F7MB 2ARWA 4LVEA 4W6WB 4NOBA 4JO3L 2JCCA 4F7EB 3ARDD 1S7SA 5TFSL 1XIWA 1OW0A 5EUKB 4IDLA 1KJVB 1N8ZA 1FC2D 5GSRA 2F74A 2BSED 2R15A 1N0XH 4AIZA 1T22A 3EFFA 4PUBL 1T5WB 3LQAC 5DMKB 1GZQB 2YR3A 4JG0L 4LSRL 4MJ4A 4WI6A 1PEWA 1X5KA 3FO2A 1TQBB 3LN9A 1U3HA 2VZUA 1IAOA 3GNMH 1BQHB 3GSQB 1L0YA 3OZ9H 4MJID 5HGBA 3OJDB 1AD9A 1EV2E 4JDVB 4OGAC 5LCVL 4NDMA 5ID0B 4QCIB 2FL5A 2OX5A 4ZFFB 3MLYH 2VXTH 3MRNB 3ULSA 2KUTA 4LRNL 5JTWA 1HCVA 4KQ4H 2W1NA 2XN9A 1LP9E 2NY2B 2I9LA 1QSEB 3AVEA 2AAVA 3SE3A 1KNOB 1JGDA 1GGBH 4LIQL 4PRHA 1R5VB 5GRVL 1MRFH 3B9DA 3HFMH 5DRZB 3H3PL 4W4OC 1AP2B 4Q9BA 5IESL 4HS8L 1R3LA 2IADB 4XP9L 3QYCA 1ZV5A 4NRZB 4XMPH 2FWOA 1D9KD 4EI6A 4DKFL 1DVFC 3J7HA 2FB4L 2FBOJ 4H26B 3BE1H 7FABH 1Z9SA 4KK6D 1XF2A 1KIUA 2WBJC 5HI3C 5DD6B 1KLFA 1U8LB 1WT5A 3PP3K 1XGYH 5J1TC 3O0RH 3SDCC 1RHFA 5CS7A 1DN0A 4NZRL 4HK0A 3GI8H 2HJLB 3P0GB 2ORBL 4GLRH 3AREC 2VR4A 4O02L 5FUZH 2YC1A 1ZHBA 2Z8SA 5KJRH 4TTDC 4Z77A 1V3KA 5ICYB 5CCKL 1WWAX 5D7IF 1IGFL 4YHNA 2Y7QB 5C2BH 1INEH 4NN5C 4JCLA 1J7VR 2Y23A 1HZHL 3S36L 4LSUH 4OT1H 3CFBA 4PJ8B 4EOWL 4WNQB 1OP3H 5CJXA 1FL6B 1UEMA 1C1EL 1TTGA 4G6ML 4HPOL 5AG8A 4HF5L 5CSBA 5B4MC 4LAQH 3V7MA 4XWOD 5HSFA 2A1WL 5I1AA 5F7HA 4Z0BH 1X44A 3V5KA 1P4LA 3LQAH 5KW9L 4RFNC 4PLJC 4GG6B 2EECA 2ICWI 1Z5LA 3MRDA 5B38B 1VGEH 3LKOB 4ZO6A 2W9EH 3R06B 1G0YR 1KB9J 5I9QC 5KN5B 4WTXA 2OCFD 2NZIA 4WJ5B 3C9NA 3DURB 2NY1D 3CZJA 3WFDL 4U6HB 3SJVB 1XGRA 1RUKH 3MCG1 4RA3A 4DGYL 4RAHA 5DJ2A 4UT6L 1NH6A 3SE4C 3L3KB 4OLEA 3GSXB 3BJ91 4NPYB 4QKXB 4JO1L 4LLUB 4TNWF 4YIQB 3QA3A 1RZGA 1QBAA 3MCLH 4LPXA 4XP6H 3GBML 4XNYH 5D7IB 1CLOL 1IQDB 1B9ZA 1H5BA 5IB3A 5FB8A 2D0HA 2A0LD 3MXVL 4K71C 5DJDB 2E8YA 4HKZA 4ALAH 1T89A 4RAUB 4LGRB 1T04B 5ESVB 2CKBH 3BIKA 2CMRH 4KGLA 4X4XB 4X99A 3QEHA 3HZYA 5ISZA 4X5LA 3CX5J 1KEGL 3TWCH 4P2RB 1FPTL 4RAVA 4X6CA 1KB9K 2XTJC 2H32A 3AM8A 1HI6A 3IDMA 2Z92B 4JO3H 5INCB 1LEIB 1IM9A 5TFSH 4P4KB 5F7FA 2IPTL 5CGMA 4XWGL 4PJCA 4XNUH 1ONQA 4Z7UF 4BZ1L 4EUPH 3A6OA 3GSOA 1WSST 4ODUB 5HHMB 1G9ML 4OIIL 4JG0H 4J4PD 1ZTXL 3TIDA 2XWJB 3QUZB 2CDEB 4QHMA 1OD9A 3BPOB 5LCVH 3CVIL 1F4XH 4Y88A 1W0VB 5TPWH 3O2DH 3RTQC 2FD6H 2IQ9L 1VKXB 1DQQA 3NACL 4Z0XB 1HCFX 4LRNH 4F37F 2X09A 5K9OA 2XTJE 1MLCA 1CXIA 3QXDA 5DFWH 3O81A 1EHAA 3BIBX 3VD4A 2B5IB 2YD6A 1IARB 1QLRB 2X1WL 1YEFL 5C08D 1WCQA 5GRWA 4C56E 1H3WM 3OR6B 2DLIA 4HS8H 1VERA 5I18L 4I18C 4C4KT 1F6AA 1G7QA 1P7HL 4WGWB 4HS6B 5LAXB 2FB4H 3VWJA 4LCWA 1EJOH 1WK0A 2VXQH 1SJVA 3N9GL 3MNWA 1XH3B 5IQ9A 4L8CA 4PJHA 4GKOA 2FH8A 2DTML 5I73C 3W5MA 5KS9A 3VXSE 5GIRB 5F3HA 4Y5VA 1F42A 5E8EB 3ARGB 1YJDC 4BQ6A 2X4TA 4CVXB 1YMME 4NZRH 4J3XA 2ORBH 3BKML 1AD0A 5ETUB 1CFNB 3KYNA 3VDBA 5ANMA 3P9WB 4YPGB 4OD1L 4HXBL 3CSBA 4LMQE 1AXTL 1QD0A 5CCKH 1IGFH 4LVOC 1G9MC 3UZQA 1HZHH 2E6PA 3S36H 3DX7A 3DXAD 3HRZA 4NO2B 5GGVL 1D6EA 2ZOLA 2H8PB 4H1LH 4QTHB 4YWGH 4LARH 1JHTB 2I24N 5BO1L 4Z7VF 5C9KA 4G6MH 4HPOH 2XKUA 3CCHB 4HF5H 1AHWA 5JPNB 1I7TA 1T7YA 1ZVSA 2A1WH 2GJZA 3GMNB 3HZKB 5C0ND 5D7LE 1E0OB 4NQCA 2E6QA 3SEPA 2CR6A 2X70A 1HQRA 2YN3A 3SGDH 5IGXL 5I15L 1Q72H 3MFFB 5E1AB 3D39A 3LRGA 3MREA 2FGWL 3ULUL 1FFPA 1CCZA 1U2HA 2J8UF 1IGYA 1RQ5A 4D0CB 2A73A 3WFDH 5HYSG 5MHSD 1Z9LA 4AT6B 1BZQK 1BD2E 4DGYH 5HYJD 2AXFB 5FA3B 1BOGB 2H2PC 3L5WA 4QHKI 3KPRD 1FO0H 5A2FA 4KKBD 4JO1H 4K7PL 1G6VK 3OJ2C 1EHLH 5MEOB 4MCYB 4LU5H 3GBMH 2ZUUA 4XMKL 3QIBD 5JW4M 1CLOH 3KPLB 3BPNC 1XF5A 1K2DA 4NT6B 4QYOA 3MXVH 5GS0D 3X13A 5BW7C 5M7QA 3HG1B 2E9JA 3V4PH 3DHJA 5K93A 1QSFE 5DDHB 3W11D 5BZDB 4POZD 1NGQL 1NMBL 3BYTA 4LBEB 4FMFA 1ZKAA 4ZAKA 1YJDH 4XCCL 1JZ7A 4U2ZA 2Z8WC 3UTSB 2IPTH 4LKXB 3PWVB 4XWGH 3TCLA 3JWOL 3QEGL 4QNPE 3RP1A 4GW5A 4F33A 3D48R 3UBXG 1G9MH 3ZTNH 3GHBL 4OIIH 5HJ3A 1JCKA 5T1KA 1TVBA 5CINL 2VQ1A 2GTZB 2J8UB 5A2LH 4F7MA 3CJJA 1FL5B 4NKMB 5K59F 1P69B 5EB9A 4JB9L 4F7EA 5EUOF 5TE7L 2L7UA 3HHRB 5EUKA 2W9DL 4X9FA 1KJVA 3NACH 3PGFL 4U1LB 5FKPA 3FT3B 5T5NF 2JB5L 1CXEA 5GS1C 2C9AA 3H3BC 1T5WA 5DMKA 1GZQA 4GAGL 2VDMH 4UILL 4M5ZL 1ROWA 3PWPD 2BC4B 3VG9B 4KZEL 1BQHA 3GSQA 3QJHB 1YEFH 3ULVD 2X4UB 3B9KD 3BJLA 3DX9B 2W0KA 3OJDA 4JDVA 1TIUA 4QCIA 3QWQB 2F54B 1HKFA 4ZFFA 1XCTA 3QIUD 3Q1SL 1AY1L 2DMKA 3O9WD 3MRNA 3N9GH 4MWFB 1QACA 4Z7QF 3NCFB 3ULUE 5AZEL 3ZSTA 4BUGA 1HHGB 1QSEA 1OD7A 1KNOA 4PD4K 4R8WL 1LEGB 3WIHL 1AP2A 3DSFL 1NMAH 5EOTB 3DARA 3MRFB 1AXTH 4H26A 4P4RB 1P2CB 2YPLE 3ZDXE 3BHBB 2FO4B 3AS3A 1FNHA 1HQ4B 4JAMB 3H8NA 1T7WA 2Y36L 5DD6A 3C2SA 1VEOA 3S34L 2BVEA 1U8LA 4AENB 4F2MB 1NDMA 5EUOB 4J12A 4AM0B 4LQFL 4PJ9C 4QEGA 3BOVA 1R6VA 4EN3D 5BO1H 1TCMA 3DECA 3O4LD 4OF3A 4KI5F 2SEBB 1Q9OB 3MACL 3Q6GL 1N5AB 2R0LH 4J6RH 4UT7L 5ICYA 4UBDC 5D9SB 3MC0A 2Y7QA 4E41D 2JIXA 1EZVY 1OB1B 1MJ8L 4CL7A 5JORB 5IGXH 3SDXF 4CW1B 5I15H 4PJ8A 4WNQA 1OSZA 4NM8H 2YMXL 1II4E 2FGWH 1FL6A 3ULUH 3K1DA 2GITB 4WWKD 4U1NA 1SVCP 1J8HD 5B3JF 3BQUC 4LVHC 3RGVB 2MNUA 4J2XA 5C0BE 3LIZL 1OY3B 1X7QB 4N1HB 2Z4QB 5IK3A 3MCKB 4HC1A 5F7DB 3BP7B 4GG6A 4K7PH 4Y8DC 5B38A 1MNUH 1GOFA 3LKOA 4Y4KD 3R06A 2KZWA 5E9DD 3N06B 2DM2A 5KN5A 4JN2B 4U1JB 4XMKH 3HB3D 4RWYL 4WJ5A 3DURA 4PRIB 4KK9D 2CH8A 4MAYC 3SJVA 3PL6D 3QDJB 3BH9B 1X5XA 4HV8A 3GSXA 1NGQH 4NPYA 4P3CL 4LLUA 2IG2H 4LSVH 4YIQA 4XCCH 4MA1C 1T1ZB 1IQDA 1RULL 5MEND 2FEEI 1WAAF 3JWOH 1JK8B 1I7UA 4Q9RL 4KUCD 3MRIB 1KUMA 4RAUA 3SDXB 5ESVA 3PE9A 4LSQL 4PR5B 3S8WA 3GHBH 2UY6A 3WJLA 4FQXC 1U3HC 4P2YA 4P2RA 4BK4A 3O41B 2HH0H 2F19H 3V79C 3D69B 2Z92A 1LEIA 3K8KA 4H0HB 3P4NB 4P4KA 3V5HB 2W9DH 2XA3A 2XG5A 4HKXA 2P42B 2F8OA 4JEGB 2N1KA 2JB5H 2XIDA 3FHQA 3RGHA 3I3EA 3L7EA 3DIFB 4ODUA 4OLZL 4GAGH 4S11A 4UILH 4M5ZH 4Y4FB 2JCCE 3HI6L 4KZEH 1P6FA 3RBSA 1J88A 2CDEA 3VXME 2O61B 4BSVB 4LGPB 4X9HA 4L3EB 3RWGA 3NH7H 4GFTB 3HKFA 4Y2DC 4JHAL 1W0VA 3RWCB 1E28B 1FSKC 5L2KD 3KPOB 5HPMB 3Q1SH 1VKXA 4Z0XA 2Z31A 4U0RB 2VDRL 4N5UA 3QXWA 1DUYB 3T8XB 4WO4C 3HPLB 2FHCA 5DZOA 1LVEA 5AZEH 2NY4B 3AB0C 3ARBA 2MQCA 1QLRA 5BS0B 3KPPA 1X4YA 3OR6A 4I3RH 4FQLH 1LE5B 3DSFH 4NKOB 3P4LA 4HS6A 4OI7A 1U92B 4Y7MA 3WN5C 1XH3A 3U4EA 4M5YL 1GZPB 4PBVC 3LHPL 3KXFB 4P2OC 3AFLA 2X2YA 2Y36H 3S34H 1ORQA 5E2TL 5GIRA 2WINB 3EOTH 3ARGA 4CVXA 3E6HB 4NN7C 4LLDB 1ZK9A 1BZ9B 3OPZL 5ETUA 1CFNA 4DGVH 2OI9B 4YPGA 3VXNB 1FIGH 3MACH 4UT7H 3BO8B 3LMJL 4P3DA 3A67L 5T3XD 1MI5B 1EEZB 1UXSA 5D2LF 5MI0B 4NO2A 1CDCA 5DJYB 3T1FB 2H8PA 1O7SA 2VN4A 3LY6A 1JHTA 2YMXH 1RIVL 1JI2A 2ZPKH 4P9MH 3KLAB 4OLVH 4G43B 1LO0L 3CCHA 5IUSA 1P7QD 2D7PA 1IVLA 2PW1B 2EDHA 5JPNA 1S9XB 4KDWA 2BRQA 3VH8G 2R1YB 3GMNA 3HZKA 2CRZA 4G6JL 2D03H 4D8PB 1W8OA 5B21A 3TESA 2P5EB 2E9WA 1FNEB 5E1AA 5D70L 3CX2A 2CUIA 3TYFB 4RWYH 1ZMYA 2GUOB 4RCAA 4EIZC 1MH5B 1U8HB 1SBBA 2HFEB 4ZSOB 4MNHB 4KI1A 4AT6A 4LEOB 3TO4B 3JXAA 1MCHA 1QFHA 2AXFA 5FA3A 1BOGA 2YUZA 2QL1A 3OKEB 2VXSL 4JQXA 4P3CH 1I8MB 3D85D 3JZ7A 5AEAA 1AGFB 4MJIB 5EU4B 5MEOA 3OR7B 1WCBB 5IG7B 4D9LH 3KPLA 1DR9A 5T1LD 4LKCB 4NT6A 4DOHE 4WV1C 3BVNB 4Q9RH 2X4PB 4S1SH 3RHWK 4HH9B 3HG1A 5GRYA 3KPMA 3WKNA 2F9BT 3DVFA 1QHOA 5DDHA 5BZDA 2CRIA 1B0RB 5EOCL 1DBJL 4LBEA 3O2VL 5D93C 3S88L 5B8CB 4XTRD 3BESR 3FT4B 4WUUA 1MWAB 3OB8A 3QDGD 1HINH 1NBQA 1MAKA 3UTSA 2HMIC 2C7UB 4LKXA 3TLRA 1YECH 2DLHA 3H7LA 1J0YA 1C08A 3O8XC 3FFCB 2NY6D 4OLZH 1U3ZA 5BV7B 3HI6H 4OSUL 1QRKA 1WISA 2GTZA 5C8JB 4XBGB 3GGWB 2J8UA 1HH9B 4BYHA 3CMOL 1FL5A 4NKMA 1EMTH 3MGAA 5DMIL 1N7ML 3KYKL 3T0EA 4N68A 3S6CA 3VWJC 5IT2H 3BP5B 5ALCL 4GUPB 3MBEB 4U1LA 3FT3A 2VDRH 1JMZA 32C2A 1EUUA 3L3IB 3UTZB 4R96B 1RK1B 3GSWB 3TVMC 3QJHA 3ARFD 2CUMA 2X4UA 3DX9A 3T4YB 2F54A 3HAEB 4UUJB 1NCCH 1IC4L 3QUYB 4OZGE 3RVWC 4MWFA 4XXDB 1INQB 1T03H 3LHPH 2VDNL 2BSRB 4ENEC 1MCOL 3RWDB 5DD0L 1RMFL 1NEZB 2WP3O 3ZDYE 3HR5B 2IH1B 4IIQB 2HTKC 1LEGA 2LQRA 2EO1A 2XY2A 1FZOB 4YDJB 4U6YB 4JG1H 5EOTA 4PJHE 2A9NH 3VFSB 2NY1B 1WLHA 4P4RA 1P2CA 3LMJH 3A67H 1JPST 5AZ2L 3BHBA 2FO4A 3OB0K 1HQ4A 4RMTA 1OGAE 3A6BH 1LNUB 4AENA 3RZCD 4ZO8A 3NCJL 5EC2B 4F2MA 1Z0MA 2HTLC 4AM0A 1RIVH 4ODBD 5EBWB 2A6KB 2P45B 1F4AA 3WS6A 3QIWC 2SEBA 1Q9OA 5F1NB 1N5AA 5D5MF 5I17B 4G6JH 5D9SA 3RNQA 2VLKB 3NCCB 4UZGA 1ES0B 4EI5C 3GRWL 4P5KB 2H3NB 1FAIH 3OGOE 5JORA 3T3ME 1SHMA 4CW1A 3BMVA 2F58L 1T0PB 1QPPA 2YD5A 5D70H 3JTTB 4RMSA 1TCRA 4MQXC 5D1QB 4QHKJ 2IFFL 4YHLL 2GITA 1PKQB 2PW2B 1JUFB 2WBWB 2EDOA 3T77B 2PXYB 3RGVA 2AJSH 1X7QA 2Z4QA 3MCKA 2VXSH 1CD0A 5F7DA 3BP7A 1MIEL 5I1EH 1GH7A 3QPXL 1JTOA 1FYTD 3CXHJ 3FQWA 3B8SA 4JN2A 1CL7H 1G6RB 4U1JA 3W39B 5E4EC 2ATKA 3CFDB 5ADPH 1PSKH 1YPZF 4PRIA 4KROC 3RVTD 4LNVA 2EDXA 3AGVA 2I60L 4ZD3L 1QHPA 1X6NA 2N4IA 2XQYK 3WFBH 2HLAB 4M00A 4WEMB 1VFUA 4AMKH 4DN3H 5EOCH 1DBJH 2P44B 3O2VH 1HHIB 3S88H 1CGVA 5JXEA 3UTQA 2HKFL 1ULVA 1T1ZA 4KPHL 3KLHC 1A6UL 5DC4B 2BFVH 3IDGB 3P2TA 4F8TA 5C09D 5SWSE 1JK8A 3MRIA 4N5EC 3ZTJH 1F90L 3FB7B 5DUMH 5KVDL 4HUNB 4PR5A 1A7BA 5JOPD 4OSUH 5CZXC 3CXHK 3O41A 2FLBT 3PHSA 2Q8BH 1A7OH 3MUGB 3D69A 3SCMD 4LCYB 3ZT5A 2VLRD 5DMIH 3KYKH 4TULL 4FG6D 5ALCH 3V5HA 2EYTB 4QRPD 4M7KH 4J7RA 3QPQC 4Y4HC 3D0LB 1S7TB 1AO7B 3DIFA 3IAPA 1WTGT 4HC1L 3DXAB 2P47B 1AGCB 5CMAB 3TFKC 4NZTH 5T33L 3B5HA 1MRDL 4BSVA 3UX9B 2YXFA 1YPZB 4DUVA 1P1ZB 5ERWB 4XB8A 3WLWD 3GZKA 1E28A 4JO4L 3KPOA 5HPMA 1GYAA 4L3CA 2EE9A 1BEYH 2W0PA 4WI8A 4UT9H 2C3VB 2VDNH 4MQ7B 1DUYA 1HSAA 2OS7A 4M3JA 4JO2L 3HPLA 4OLWL 4XPFL 3T8XA 1RMFH 2K7PA 2ZKHL 1EO8H 2PYEE 1K8DB 2MQ0A 3VFWB 1QBML 1KCVL 3X3FL 3DSNA 4LP5A 4PJDF 4N8VG 1LE5A 2FJFB 5CZVL 4NKOA 3OB0H 5JO5B 4ZDHA 3TZVC 1QFWH 1U92A 3MODL 1BM3L 1GZPA 3KXFA 4L1DA 3QCTH 3GMRB 1IT9L 2APWA 4OQTH 2ERJB 2FBJL 1LK2B 3IXAB 4IMKA 5SV4A 2WINA 1X5FA 2NY0C 3LEYL 3LB6C 4ZUSB 1HHJB 3CFIC 4OKVB 5KZCD 3TV3L 3IS1X 4PV8B 4Y5YB 3E6HA 4LLDA 5C0CA 4KGJA 3AUVA 3ULVF 1I3RB 4ZXBC 4Z7NF 3VXNA 4ETQB 2A38A 3BO8A 3H2WA 1MI5A 1EEZA 3GRWH 5DJYA 5K9KA 1A7PL 5K9QG 4KAQL 3T1FA 3PV7A 5SX5K 3RJQB 4KKCD 3MOBH 1P9MA 5ACLA 5LWYL 3QRFM 2YRZA 2NY3B 5FHBL 5SX4I 3KLAA 4G43A 4I9WE 5CIPA 5EZLB 2IFFH 5DK2B 2XV6B 5JMRA 4NNPL 2PW1A 2V5MA 3QI9D 1S9XA 1XGTA 5GS2D 1A6VL 4H0IA 4RGOL 3LCYA 2R1YA 1UJTA 3RDTA 1Q0YH 5J6GB 2GJ6D 5F93C 4D8PA 5TQ0L 1FZKB 3H9SB 3C6LD 4NWTL 2VUOA 3VWKC 2VZSA 1FGNH 4M62H 2WWMD 5KSAC 1MIEH 3T0BA 3D18B 2VC2L 3NTCL 2P5EA 3P0YL 4YR6A 3RL1B 4DKAA 4KZDL 1MFCL 5B22A 1T7XA 2GUOA 1MH5A 1U8HA 4JVUA 3SE9H 2HFEA 4ZSOA 3JSSA 4LEOA 2YD1A 3TO4A 3WKMH 5F9JB 5D2NC 4ZD3H 4NRXB 2YZ1A 3OKEA 4ODTH 2E7MA 1I8MA 4PJAA 1M4KA 5KTEH 1AGFA 4HGWB 1WCBA 2HKFH 4XHQA 5C0DB 3MJ9L 4YX2H 1JN6B 5DUPH 4FA8A 5IG7A 1FE8L 4Y16C 3BD4A 4LKCA 3QO0B 5HI5D 3X11A 3BVNA 2Q7NA 2X4PA 2UVEA 4HEPG 5I19H 1F90H 3WUWB 1PFCA 5KVDH 4HH9A 3SGJC 2H2SC 3ETBF 1B0RA 3L7FB 4DFHA 4HG4J 1RUQL 2RB8A 5B8CA 5IROA 1WITA 3HS0B 3WO4C 3FT4A 1MPAL 1MWAA 3EZ8A 4TULH 5D2NE 1R3IL 1KJ3L 2C7UA 4QRRB 4WVRA 2VR9A 1RIUL 4U3XA 3MLRH 5E8OB 3FFCA 4IJ3C 2AKRA 2X4OB 2CK2A 1I85A 3KPQB 5C8JA 4KJPD 4XBGA 1FYHB 3GGWA 4LPWA 5T33H 2DICA 1HH9A 4L9DA 3RUGF 1FN4B 4WHCA 4P9HC 1OT2A 1I1AD 4EN3B 5FYKL 4JO4H 3IJSB 3AY4C 3BP5A 3W5NA 4QOKE 4GUPA 3MBEA 1W0YT 5F1IB 5D6DA 4OLWH 4XPFH 2PF6A 3ABZA 3L9RB 3QZWB 3L3IA 3UTZA 4R96A 4HG4K 5KG9B 1RK1A 2ZKHH 5SWZE 4KUCF 3GSWA 1S9VA 4DEPB 2VN7A 3REVB 2X7LB 5GS3A 1QBMH 3QUXC 4X8XA 5F9DC 4LLVB 3T4YA 1MELA 4RRPA 5IVXE 5CZVH 1NBYB 3HAEA 4KUZH 4UUJA 3F12B 3IXTB 4J8RA 2J6EA 4ZS7H 3QUYA 4R26L 4X6BB 1BJMA 1H3TA 3MODH 5D7JD 5C0FB 4XXDA 1INQA 1IAMA 3L3OB 3KGRA 3O6ML 5T3ZE 3CPLB 2BSRA 2XXMB 1V7ML 4N8PA 1IT9H 3RWDA 2QBWA 2FBJH 1NEZA 3LEYH 2IH1A 4HWNA 3SDCD 3TV3H 2LU7A 4PBXA 4Y4KB 4P23C 1FZOA 4AYFA 3GBNL 4GSDL 4U6YA 4YDJA 5I1JH 4E42A 1CFTA 1K5NB 3VFSA 4B0MM 1Q1JL 2D2OA 1JGEA 5T5FH 4D2NA 1LE9A 3MV8D 1C12B 1U8PB 2FZ3B 4JFDA 1GGUA 1NFDF 1A7PH 1CGUA 1LNUA 2FLRT 3ILQD 4HWEL 4KAQH 1YN6B 1NUGA 3QXTA 4IRJC 1J0HA 5EBWA 5I66B 4QXUL 5FHBH 3EYSL 4WFGE 4OGYH 3QULB 3Q5OA 4EDXB 4NNPH 1BLNB 2XI9A 5F1NA 1CVSC 5B4MD 1A6VH 1FNAA 2APXA 5I17A 2P46B 4HUWB 1B0GB 2AJYL 2VLKA 3G5YB 1MOEA 5TQ0H 1ES0A 4M8QB 4NWTH 4P5KA 1UWGL 2X05A 2H3NA 4N0YL 3HN3A 3NTCH 5T3ZH 3SKUD 2JELH 4X4YB 3CK0L 1CXLA 1G0XA 3JTTA 3QISA 3SKMB 4P9HH 5D1QA 2QQLL 4XP4H 3ZYZA 1PKQA 1JUFA 1A7NH 5TH2B 4U1GB 4JFQB 4PY8I 5C2UB 3T77A 1ORSB 2PXYA 1CIUA 5C0AD 4G8GB 3O6FD 3B2VL 1IGIH 2VLMD 3RVVD 3T1WA 4XPAH 1B90A 4L4VB 1GC1C 2VDQL 4J4PA 5FYKE 4NJ9H 2OYPA 3IU4H 1YEDB 4HW6A 2ZUSA 3MJ9H 3VRJB 1ACZA 3W39A 3CFDA 2ICCA 5J13B 3HRPA 5L2KB 4APQC 2ZNWA 1NFDB 5GGRY 3U0PB 1NUFA 4WEBH 4LLWB 2DM3A 5I8KL 1NMCB 2HLAA 4EQ2A 2LABA 5FCUH 4GKNB 3B5GA 1T2JA 1MIML 2AXJA 4R0LA 1IQWL 1HHIA 2AJ3A 5D1ZD 1MPAH 3BGFC 3UJJH 1NGXB 4NSKA 3ZE2F 1KJ3H 5H35B 1FIEA 4U1IB 1RIUH 5E2WL 4R4FH 3FB7A 2AEQL 1N3NA 1WFTA 3TBYB 1J5OL 5DJCA 3KVQA 4WUUE 4M1DH 1DBBL 3U1SH 3MUGA 4GRLB 2W59A 4LCYA 2R2EB 2EDNA 5JZ7D 5FYKH 2IAMC 2DQHL 4IRSB 4N0CC 5E7BA 3O3DB 3MRPB 1T1YB 2EYTA 4S1DD 2DQEL 3T4AB 3V6OC 3GI9L 1NLBH 4R2GB 2IBZX 4NQDA 4Y1AA 3D0LA 1S7TA 1AO7A 1C8PA 2P5WB 3RY6C 5L7XL 3DXAA 2ARJQ 1AGCA 3T0EE 2CXKA 2EKJA 5GRUL 3MA7B 1S7XB 1AQKL 5EZIL 3UJIH 1YPZA 5D7KE 1YQ2A 1P1ZA 5DJ8B 5ERWA 4XC1L 2VDKL 4RWHA 3DTXA 3SE8L 4TN9A 3Q5YA 1YY9D 1D7FA 1PX3A 4KJYB 3S96A 4S1RL 3QUKA 1V7MH 4DZBB 4U1SB 2DN7A 5D7LD 1UJ3C 1K8DA 3QG6B 3VFWA 4PYHA 4OV6F 4RISH 5GHWL 1WFNA 1HIML 4V1DB 3V6OE 1ERNA 4BFBD 4RBPH 5JIHA 5JO5A 1A6ZB 4X7TB 2YRLA 1Q1JH 1IBGL 3U36B 4Z7WB 1XMWA 5E6IC 5HDBE 4FQJH 1TETL 2B8OT 1BD2D 1LK2A 2PR4L 3IXAA 2ESVB 4J3VA 4NC1C 5A16B 3MLUH 4HWEH 4OZIE 5E1HB 4KMQA 1IGML 1HHJA 1Z3GL 4OKVA 6CGTA 4PV8A 4HX1A 4Y5YA 3QWOB 3WFCL 1IAIL 2R69L 2Y5TB 3EYSH 1ODAA 5FUOL 4B7IA 4ZTPL 4UTAH 3N1PC 2P8LB 5TF1L 1I3RA 1YNKH 4ETQA 2B4CC 3RVXC 4XBPB 1F3RB 1S9WB 4N0YH 2D0FA 4Z18A 2BXZA 3E3QC 1YYLL 1QSFD 3E6FB 4P46A 2N7AA 2DL9A 4JPWL 5DK2A 5IMLB 4K8RC 2FSEB 3MR9B 4PLNC 1FFNB 3KYOB 2GT9B 3JTSB 1P5VA 4NC1E 4RDQF 5J6GA 1FZKA 3H9SA 4I3SL 4YC2C 2NY6B 3QCVL 2ENYA 2VDQH 3D18A 4DK6A 8CGTA 1CU4L 3RL1A 1HKLH 1UG9A 4LSTL 1UC6A 1SJHB 4J3WA 2NXZC 1J1XH 5CJ8A 1Y0LB 4DKEH 3FQUB 2LAAA 4NRXA 3E3QE 5I8KH 1FNSH 3VJ6B 3C5SB 1MIMH 3ARFB 2KBGA 1DQJB 5C0DA 3REWB 2IPUG 1MCFA 2NYYC 3QO0A 1OHQA 1S78C 5EC1B 4L4TD 3VI4E 3ARSA 5E2WH 2AEQH 3NGBB 3WUWA 5E24E 3U4AA 4DN4L 1J5OH 3H9ZA 4PTUB 1DBBH 4UV4L 3L7FA 5EU6E 2KL6A 3ULUD 2D7QA 3LKRB 3HS0A 1OTUC 4CVZB 3QDMA 4ELMF 1JP5A 3VXUD 4JFFE 3W2DH 2DQEH 1BZ7B 1MHPL 1MCWW 4QRRA 1T0MB 5F88B 1CK0H 5C6WH 5CJBA 5DVOA 4HFWB 3DO7A 5E8OA 2JLLA 5FAAA 4KK5C 2YEZB 1MVUB 5J3HC 2X4OA 1KULA 3DMMD 3KPQA 3HE6D 5LKNA 2ZWLT 3T3PF 4PJ7B 5EZIH 5FOJA 2OR8A 2YKLL 3QJFB 2BNQE 4XC1H 1VSCA 3HUJE 3DO3A 2VDKH 5BOPA 3IJSA 4P5TC 1Z2KA 1EGJH 2J88L 4K8RH 5DRXB 4FZEH 3FB8B 4ODXB 4Y19A 5DWUL 4JRYD 4MXVE 3QZWA 5KG9A 1PG7X 4S0SD 4Q9QL 3REVA 2X7LA 1BIHA 5GHWH 2ITDB 3OSKA 4LLVA 1HIMH 3DUSB 1NBYA 3F12A 4QXTA 1TQCB 4XXCA 5MEPB 3IDNB 3IXTA 1JNLH 25C8L 2YD4A 3UTTD 1A21A 1IBGH 3L3OA 3H7BB 5ABDE 3CPLA 2DI9A 4M9PA 1Z6JT 2DRUA 4PJ5B 2WP3T 2P49B 3ARWA 3D3VE 1PDKA 4YE4L 5C0BD 1HWGB 2QEJA 1Z3GH 1CGSL 1M05B 3R8QA 1HYSD 2X41A 1NPUA 2CK0H 1LK3L 2J4WL 4Y4KA 2IBBA 3WFCH 1IAIH 2R69H 1N6QL 2G5BB 4MGXA 3STZB 4RQQB 1K5NA 1JF5A 4O9HL 4AEEA 4BFGA 2EXYC 3RWHB 1ZSDB 5IOPB 5ENWA 2DF3A 3IVKB 1ND0B 1UKQA 2HT2C 1KXVC 1VADB 1L0QA 1C12A 1U8PA 2FZ3A 4PJXF 4FFWC 1YN6A 5DJXA 5C0CE 5KVEH 5HI4C 4F58H 2EDKA 1RVFL 1YYLH 2HLFC 4TNVK 5MP6L 1HHKB 4IM8A 4XCFL 3QAZB 2ENSA 3WNPA 3QULA 4ORGB 3TA3C 4EDXA 3LRSB 5J1AB 5B39B 5IHZB 4R4BB 1FNFA 4HUWA 3G5YA 4M8QA 4I3SH 3BKJL 3QCVH 2XACC 4YHIB 3E2HC 1CU4H 2UZYB 4NO5B 2YPVL 4RMUA 4O58L 3SCMB 4KKAC 3M8OL 4PJGE 3DLQR 3SKMA 1FC1A 1JYWA 3F62A 5BOZG 1LHZA 4WU7A 4XAKD 2J6EL 5TH2A 3TN0C 3QFJB 4JFQA 2QHRL 3MRRA 1A1OB 4G8GA 5GISL 5KSVB 4L4VA 3HI5L 1BJ1J 4OZFB 1FNGB 1E4KC 4IRZH 1YEDA 2CLZB 4HJ0C 1KLGA 3VRJA 2J12B 1PZUB 1XIWD 4OBSA 1IZJA 3MV11 3QDAA 3HNTH 3IU3B 4NGHH 1KCUL 5ALBH 2IC2A 3VI3F 1VEPA 1NFDA 3U0PA 4PJAE 2CQVA 4AJ0A 1C5BL 4LLAA 4DN4H 1TNNA 1I85C 3MLVL 3C8KB 2BNRE 1U3HD 4GKNA 3KLDA 1DLHB 2BVQB 4UV4H 4PRPB 5JA8B 2EDRA 2YD2A 5I74B 3RWIB 4UNVA 2AQ1A 1NGXA 1GCFA 4PJEF 5CIPH 5IQ7L 2VSDA 4NO0B 5H35A 4HFUL 4U1IA 4XCYB 1FG9C 1MCPH 4XNZB 2Y4SA 3QB7C 2XN9D 1KPRB 4JFZH 5IVNA 1A6AA 1KEML 4GKZB 3TBYA 3MTRA 5I6XC 2HFGH 4JM2C 4L3AA 1T7ZA 1CWVA 2OP4H 4GRLA 3RL2B 2W38A 2R2EA 4Y2DD 4WW2C 2YBRB 3AXLB 2AK1L 3AMLA 4IRSA 3ZSSA 3O3DA 3MRPA 1T1YA 4NZDA 3T4AA 1WGOA 2JK5B 4E5XB 5E5MB 2DD8L 4K94C 5IFJB 3KPTA 5DWUH 3PABA 3HMWL 1LDPH 2N7BA 2P5WA 4RMQA 1GPOL 3HE7C 4KMTL 4Q9QH 2YZ8A 3MLWH 5DUBB 4L8SB 1S7XA 4ZFOB 4E0RB 1LO5A 5GGTA 5DJ8A 4KVCH 1TJHL 4LL9A 3MPCA 25C8H 4KVNL 5JLZA 1N6UA 2EIEA 2BSTB 3ZO0A 4KJYA 2GJ6B 4D3CL 4DZBA 4PLKC 5IBTL 4CJ1A 3IKCB 1YEGL 4U1SA 4YE4H 4K2UH 4TUKL 3QG6A 5I75C 2YK1H 3MOAL 2J4WH 3GIVB 3I84A 1N6QH 4V1DA 3NCEB 1PEZA 1JZ5A 3FRUB 4B7LA 1A6ZA 3S35L 4X7TA 1DJSA 2E8ZA 4K3GA 1QR1B 3U36A 4U49A 4Z7WA 2C26A 1QP1A 1IC5L 2VYRE 2ESVA 5A16A 3C60C 3MJ8B 3LKNA 2C3GA 2FJGB 5A3IC 3QWOA 1MCKA 3U0WL 4XCFH 5KSUB 2Y5TA 5L2JB 4MA8L 4KTDL 2P43B 3U4BL 5JDSB 4XPHL 4XVUD 1L4IA 3IFLL 3WFEH 4K7FB 4JFDE 2X4QB 4XBPA 1S9WA 3ARYA 1JZ2A 1AXIB 3O45B 4YK4C 2OM5A 4PY8J 1QRNE 1FVDB 1LP9B 2J7LA 2YPVH 1QFPA 3JV6B 3M8OH 5SX4H 3E6FA 1RZFL 3ZKXC 5D72L 1OAKL 2FSEA 5CWSA 3MR9A 2QHRH 4OD2B 1FFNA 3KYOA 4IHOB 2GT9A 3JTSA 4U2YA 3ARQA 1OTSC 1J18A 4K94H 5ISZD 1I9RL 5E5RB 4UU9B 5DRWA 2EKSB 4R7NB 3ZL4H 3ARZA 1IM9D 2NXYD 2X89A 4IS6B 1SJHA 5GRJL 1P4BL