4YDLB

Crystal structure of broadly and potently neutralizing antibody c38-vrc18.02 in complex with hiv-1 clade ae strain 93th057gp120
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVRLVQSGNQVRKPGASVRISCEASGYKFIDHFIHWVRQVPGHGLEWLGWINPRGGGVNYSRSFQGKLSMTMTRDNFEETAYLDLSKLNPGDTAVYFCARGFAGYEWSFIWGQGTLVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 41
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydlB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydlB01
1MJUH 4HWNA 3TN0B 1EJ6A 3WS3A 5BXFB 2EXYC 4K94H 1ZGLP 5FYKU 5JXAH 4NDMB 5BQ7B 1T7VA 2OI9C 5LGJB 3GUTB 1KJ3L 5IB1A 4JKLA 4C59B 3UTSB 1P1ZA 2VC2L 4X7FC 1X5YA 5K9OA 2NW3B 2AXJA 3GIVA 4KJWC 4U31A 3SDDA 2R2EB 4GRLB 3MYJA 3D85B 4NJAL 4IRSB 4EN3A 4OZIF 1VFOA 2VISB 3FQNA 4WO4C 3I6GB 3IETA 5DFWH 4H20L 4YC2B 4LGSB 3TP4A 2Z92A 3U46A 4YDJB 1E4KC 4PJCE 3UTQA 1X3DA 2GTWB 1Z5LA 3QDJE 2GQHA 3V5DA 3NFPA 1DBKL 3O8XD 1H3VA 4H5SB 2B4CC 2HRPH 4X7SH 3TA3B 4HF5L 2P8MB 1X5HA 5HYSA 1M05A 4JVPA 1V8HA 4Y16D 4APQD 1Z0MA 1AGFA 2JCCE 2BY1A 5DVNA 4TTGA 3MROB 2J6EL 1U8NB 3GSNB 3PP4H 4GLRH 5JA9A 4AENB 1J88A 4ONHB 1IQWH 4YPJA 4MJ6B 4KXZH 4ELMA 3M17A 5MEND 1IARB 5CJQL 3BE1H 5JHDB 3IF1A 3HI1B 1HIML 2DN7A 1J1OL 3VFGH 2DF3A 3C6LC 3LIZH 1INQB 1GSMA 3RDTD 4IRZL 3LH2H 3S4SA 4DUWA 4ZNEA 1OTSD 1OL0A 3BPLB 1VPOL 4AIZB 4QRPD 5T1KD 3NZ8B 5F7FA 4NHCL 2YA1A 3IFNL 2NZ9D 1G0DA 1BOYA 3OBAA 4XNYL 3T0VA 2IBGA 5FHBL 2C3VA 1BM3H 4GKNB 4XCNB 1S7VA 3Q5TA 4YAQA 1MJJA 3QUXB 3CAFA 3ARRA 1FG9C 4Y5VC 5EWIH 3KYNA 1J0ZA 4JFQA 1HCFX 1ROWA 2YSSB 4NN7C 3TO4B 4D9RD 1YMMD 4GBXC 3OR7A 1UM5L 3T2PA 5EZIL 1TJGH 1V05A 5IP4A 4M5YH 5I75C 1I75A 3UAJC 5DZOA 1NLDH 4JFOA 1D7FA 4TYUA 1R0AL 4X83A 1U3HA 3EYVA 5E03A 3T09A 4E0RA 2RGSA 1IGTB 3I75A 2DTSA 3HI6L 1GZQB 2NY0D 1WF5A 2HRLA 3EOTL 1FP5A 1CICD 5CBEA 1YY9C 1NMCB 2C1PB 2YN5A 2Q7YB 1OT1A 5C0JA 3I02B 4NQUA 4LCIL 4RFNC 3QUMA 4QCIB 4X6DE 5FYLD 4Z95L 5GGTA 4F9PA 3OQ3B 1YN6B 5GISL 1DZBA 3PHQB 2YN3A 4A6YH 3P73A 5C6WH 5IJKA 3HRPA 2W0LA 3FQWB 3B9DA 4JFFB 1FL5A 4WW2C 4ISVB 1TQBC 3VI4E 3ZO0A 2JELH 1TNMA 5KVDH 1F90L 2OR8A 4Y2DB 4NM4L 3CGTA 1CDCA 4ALAH 3RGVB 3BKMH 4OZFG 3S5LG 1CGVA 4L9LA 1KJMB 4KJPC 4JG1L 1XGYL 2QHRL 1WSST 4HUWA 4X9BA 4F8QA 2HTLC 4N8CH 3UEZA 4HBCH 4S1DC 4R96B 5ESVB 2YD4A 3C6SA 2NXZD 4G6AD 2HLFD 3QDJD 4ODWB 3LD8C 1U8QB 3VJ6A 2AERT 1LO4H 4JKPL 3S35L 4XVUC 4UTAH 4Z7NF 3BW9A 1FFRA 3C9NB 4LLDA 2K1MA 1NAMB 3MBEC 3WJJA 4OBSA 4LKXB 3U30B 5DRWB 4TULL 2MWCA 4UQ3B 1OAUH 3DX9A 4MNQA 1ZEAH 2DLFH 1TZGH 25C8H 2DBLL 1HZHL 1F58H 5IB3A 3NZHH 2D4DA 1Q0XL 3AMKA 3GJFK 2VLJE 2APFA 4L29B 2Y36H 2EDYA 4N8VG 3WKNA 3GMQA 4N0FB 5JORA 5E94B 1XZ0B 1YNLH 3RWGB 4L4TD 4E41B 2NY6D 3VD5A 1WAAF 4Q9RH 1S9WA 1WBYB 4MJ2A 4NQSA 8FABB 1WFTA 4WEUD 4P5TA 1BD2B 4GBXB 1BJ1J 1IE5A 4V1DA 3QIWA 1DR9A 1KTKE 4PJDA 2LABA 5FYJL 1QOKA 4XT1C 1FIGL 2GW5A 3HE7D 2F54B 2DDQL 1FYHB 4PLOB 3P4OA 3VWKA 2VDLL 2JTDA 3EDDA 4NYLB 2MQCA 3T0DA 1A1NA 1AQKL 3IDGB 4K8RL 2P5EE 1RVFH 3BQUD 4HJ0D 5F9AC 3FB6A 2M1KA 3MO1B 4HAFA 2A9MH 4WFED 3OGOE 1AKJA 5CD3B 2UY7A 3H42L 2DM3A 4LEXL 3PDOB 4JO2L 3BGFB 4EIZC 1E28B 4N1HB 1W72H 4WJ5A 4EI5A 4JEGB 3QNZB 5A3ID 5AZEH 1U93B 2VLRA 3CFEB 1YEEH 2ZSVB 1RZ8B 2RCSH 1Z9OA 4KY1H 3B2UC 4WW2B 1TQBB 4OT1H 3RWCB 3U1SH 1ZHKA 3B9KA 2LTQC 5D1QC 1HHJB 3NAAH 1V7MH 5IG7B 1D5MA 3Q5YA 2CPCA 4P99A 4G6FB 3CFCH 3SDCA 3OKEA 4YBQD 1I7RB 4YFLI 3WD5H 2EDQA 4J8RB 1F4XH 5AYUL 3I50L 1CT8B 5D96B 2HFFB 3S97C 2FO4A 3S35X 4NO0A 2CK0H 4NQDA 4Z7UB 2YRLA 4NZTL 2O61A 5LCVH 4YHZL 5HHXH 1CDIA 4S1SH 2Z9TA 3RX7A 1AXTH 1WICA 1U3ZA 2Z8VC 3CFKA 3BEWA 4G42A 4J3VA 1AGCB 3SJVB 3EYOA 4QWWC 3X13A 2NY2C 5EC2A 2Z91B 2D31B 4XNUL 1V3KA 5ICYA 5HHVH 3G6DL 1WIUA 4OZIE 3FJTA 1BWMA 5FCUH 3MLZL 5FGBC 1ZLSH 1I9IL 2W0FA 3VXSB 1GHFL 3L3HA 5C0NC 2OQJB 3SE4C 4PV9A 4L1HA 1CGSL 5GS0H 3AREA 3V7AG 2B0SH 1PSKH 5J3HD 3ME0A 5C07A 2XWJB 4U05A 3MBXH 5T1LB 4MVBC 5FO9B 1DEEB 3KDMB 1SBSL 3MRHA 2IG2H 1KELL 5I16A 5CS7A 3U2SA 2E6QA 3CMGA 3FT3A 4WW1A 5I15H 4HWUA 5ECJE 2ESVE 1HSAA 4DKDC 3DTXB 4N1EA 4C56A 3F58L 1RURL 1A6VL 4PV8A 3F6LA 2UVEA 2VZUA 4LPXA 2BNRA 1MCQA 5E1HB 4FMKA 4PS4L 1QSZA 4PGDA 3GSQB 1H3XA 4LCUB 1S9VA 4ZD3L 3P9LA 4WU7A 3ULSB 4UV7L 3MV8E 3BT2L 4GRMA 4FQXA 4BM7A 2MNUA 1NJ9B 4LCWB 2VZTA 3PABB 1PYWB 1TVHB 4YH6A 2WUCL 3RVWD 2CLZA 1PEWA 1A9BA 1BBJB 1KB5B 1IAKB 3HAEH 3CMOH 3HCVA 1SY6A 5DJAA 2HH0H 4M7ZC 1EO5A 1IBGH 3DMMA 2R29H 4JVWA 5LAXB 5D1QB 3G5VB 4PGEA 2P5ED 2GJZA 2EIZB 1YQVL 1T1YB 1QYGL 1MIMH 2OMNA 3NABH 5L2JB 3BIAX 1Y6KR 3BUTA 4I0KA 5CHNA 4EUPB 3QDGD 1ZOXA 2H41A 1X7QA 3U6RA 3EJZC 5GRUH 3KHQA 1VB9A 5AYQA 1D9KD 1INEL 3MV7D 5TE7H 2AK4A 3O3UN 2VE6A 2BVYA 1FFOB 1ZHLB 3ULUD 1AGBA 2DI9A 3RWEA 1FYTE 4PB0H 1IM3A 3GI8H 1XIWB 5EZLA 2AEIT 4P2OC 5E1AA 5HVHC 2EYTB 5ID1B 1UJ3C 2NY2B 2G9HB 3VFUB 3RNQA 1P7KB 3SDDD 5JMRA 2Q8BL 2BK8A 4EN3D 2VABA 3L3OA 1T83C 4NKOB 5KSBA 4WY7H 5EPMA 3TT3H 5INDB 4L8DA 1I85C 3MLVH 1WGOA 1GGBH 1WZ1H 4R26H 2I9TA 3FN9A 3NCYP 4YXKL 4LLQA 4DGVL 1J10A 3EBAA 3GMNB 3BN3B 4MDJB 3TZVC 3NCJH 1C08A 4FQPA 4HS8L 3MA9H 3VRIB 5F7EH 3IU3A 2GT9A 4U6HA 3AS3A 3BXNB 5HTSA 1FCCA 1NFIA 1U92B 1XH3B 1ADQA 4YWGL 2W38A 2EECA 5EOCL 3C8DA 1BZ7B 1R6VA 3QUYD 3MLPA 1CD8A 3QEGH 3G9AB 2DM4A 1T6WA 3F7YA 1XR9A 4XAWL 5GGVL 3K4AA 1U8HA 4Z7NE 5DJCA 5L2KB 1FIEA 2C26A 2WQ8A 3I84A 1YQ2A 3DARA 4S1QH 5ICXA 1KYOJ 2ESVD 4M7ZB 4U1SA 3FRUA 2Y6SC 3MC0A 1ZT7A 5SWQA 5E6YA 3CCHA 1DBAH 4AMKH 2DQIH 3OHXB 5FCSH 1U6AL 4H1LG 1WAAE 3ZYOA 3EDJA 4KKCD 3H6JA 3PWJA 3MV8D 2P8LA 3INUH 2V7NB 5FO8A 4PJEE 3RUGF 4OZGB 3MRIA 3O2DA 1CLZH 1QLFA 4F7TA 3FRPA 5JPMA 2EXWC 3NN8B 4YDLB 4NM8H 4XBGB 3L5WA 2WUBL 3LQZA 1K6QH 2EDRA 5EU7C 4JM2B 3ZSSA 5JR1L 5IVZB 3N0PB 2ADGA 5EFIB 2KQNA 3D0VA 4NWUH 1OLLA 3JXAA 3TYFA 5C6PB 1XT5A 1UJ3B 4ZXBA 4PJHA 1I9JH 5DK3A 2V9TA 1DN0B 3HNSH 4LL9A 1I9RL 4PTTB 5DJ0B 5I6XC 4DEPB 4NO3B 4D3CH 4F7EA 1CFBA 1J8HB 2K9UA 1HILA 4ZQKA 3ULVH 3SKJH 4O00A 3UX9B 1T1XB 4LHJB 2VL4A 2BNQA 2X4NA 3SKNA 5ADPH 3QNXA 1V3LA 4PGCA 4PYGA 1C8PA 4AIOA 5DXWA 5E6IA 3OF6A 1H3PL 1VFAB 1TENA 3RPKA 3VRJB 2ZUVA 5JXEA 4MAYD 1EAJA 5SWSE 2XIDA 3M1BA 3WDHA 5EN2B 4BQCA 4P0DA 2AABH 4MHHG 1LDSA 4UTBL 3STBA 3SBWC 4QGTA 3VXRB 4XGZA 3TZVB 4F3FB 3G6AA 1FBIL 4M7LL 2VLLA 4LGRB 2QQKL 1KCRH 3ZTNH 3WLWD 3VGBA 3P77B 1YUHA 5IFHH 4PRIA 5BW7C 3HUJF 2E7MA 4FFYL 3MJ6A 1T2JA 2VDOH 4DOHB 3Q2CA 1KJ2H 1JHKL 5GSRB 1N8ZB 2GFBA 1YDPB 4CDGC 2B8OT 2BVPB 4LKCB 3UO1L 1HH6A 2F5BL 2Y1VA 4QRRB 5BZWB 2C9AA 2ZCLL 3FT4B 3MV01 1T0NB 5E5MB 4HS6B 1KCSH 3VFTA 2J8OA 3WFBH 4MNQD 4OGYH 1G9NC 5LWYH 1BZ9A 1JGUH 1MFDL 4WI9A 4UMGA 4WFGE 4M48L 5FYKL 3HUJA 3FO0H 1OTSC 3BEVA 5DWUH 2VQ1B 3KPRE 1MVFA 4XMKH 4G7VH 1QBLH 4UQ2A 3QR2A 4RGOH 3JTSB 4YHKL 1QFUL 2O5YL 1HXMA 2CMRL 3MRCB 4NRXB 4P5TD 2EDFA 3GSVA 3L5HA 3VFWB 1OAKL 1QFWM 2DYPA 3BGMA 2HFGL 5IBTH 2QBWA 2I5YL 1MCLA 5EIVA 5F88A 4KZEL 3B9EA 1VGEH 1LMKA 1G1YA 4XC3L 5BO1L 2OR9L 4JFZL 3PWNB 1JGLH 4M61A 1BQHG 3LS5L 1ACZA 3NPZB 1B4RA 2FJHA 4DVRL 5IFJA 3DRTA 1AFVH 4O2EB 3TBYB 1DDHA 4RWYL 3KR3L 2JJSC 1GC1L 4L8SB 4K55A 4OCWL 5F96L 1LD9B 2KKQA 2QQQA 3FOMA 4KUCF 2BCKA 1AKJD 1DE4B 4UAOC 1F02I 3TCXA 3SO3C 3LOWA 1MCWW 4MDIA 2R2BA 5IFAL 1IM9A 1AO7A 1KV3A 4KZDH 4EI5D 5I1JL 3B4NA 2EDNA 1I8MA 5J4MA 1BOGA 3ARYA 3PE9A 1CICC 3PGCA 4Y5YC 3L9RB 3BYYA 4O58L 1A7QL 5J6GA 1BREA 5FO7A 1OTUD 1HKLH 1ZA6A 3B9KD 4LSPL 5JUEL 3MYZA 3OXSA 1FNGA 1JPFB 4BUGA 4OCNC 4G5ZL 4LQ1A 5DMGD 1FVEB 1QSFB 1FZMB 3SDCD 4ZNCD 3MRPA 1ZSDA 1UKSA 1EK3A 5J12C 1YPZB 2VYRE 1CGYA 2R4RH 3LKPB 4R0LA 4I2XA 3UC0L 4HC1H 1RQ5A 4G6JH 2D9QB 1S9KC 4PJGF 2C1OB 4NQDD 4Z7OF 4FABH 1N59A 4FP8L 5FDYA 2AKRB 3FTGB 2VZ1A 3V0VB 1XF1A 5SWSD 3VW3H 2ATPA 1TQCB 1L6ZA 3V95A 2FIRT 3W5NA 1I1AD 5C08E 2QQLL 1A7OL 1UB5B 4LVOC 1G7MB 3W2DL 2NXZC 4PRAA 4G6AC 4CNIB 2F8OA 2HLFC 7CGTA 4QGYA 4OV5A 3O6LL 5IM7B 2PW2A 1QLRB 32C2B 5TQ0L 2D7TL 1S8DB 5I1DA 4QRPB 1KOAA 2YMXL 3DYPA 5DO2D 2XN9B 4L9DA 2YPLE 3ARED 5DJZB 3L7EB 5DVOA 5C07D 4NFDA 4ZUSB 1ZWIB 4FXKB 1TVBA 2X4RB 5F1KC 3WHXB 4JE4B 3NCBB 4ZOAA 1CLCA 3RKPA 2PN5A 4MNGA 4JPIB 2NY6C 4NRZA 3HC3L 1F2QA 2B1HL 3IFOB 3VA6A 2UYLB 3LDBC 3FO9A 4HUXB 15C8H 2IPUG 4FQCL 2BXZA 4C56D 1J0HA 4LCCC 3O2WH 5ALBH 1G1CA 2BNRD 2JK5A 4QHUB 5DUMH 5DJ2B 3OAZK 1BLNA 1FFNB 4XBEH 1RZJL 1S5IH 5IIEA 4HULB 3EYSL 1CXEA 3G04B 3VFPB 2ENYA 5J56B 4MWFA 4MB4A 3VFMB 4LLYB 3N50A 4X98A 5DSCB 4HJ0C 1BJMA 1MELA 4Y5YB 5C09E 3DURB 3RY5A 2H6PA 2W9DH 3LSOB 1BAFH 2F8XC 4FTVD 1JWUB 1NFDF 5CJOL 4EEEA 1RIHL 5GZOD 3TM6A 2VO5A 3H7BA 5A3IC 3QIBC 1UACL 4HH9B 5C2BL 5ETUA 1D5ZB 5F9DC 3P4LA 3VGFA 3IVKA 1P6AB 2O5ZL 3UPRB 3X3FL 2KZWA 1VFBA 2R4SH 4HSQA 4OLUH 1K4CB 1T66D 4FQLL 5EC1B 1GAFH 5IW1B 3UTZB 4YBQC 2EKSA 4QHKJ 1J7VR 3EIFA 1Y6MR 2E8YA 4CJ1A 2VZ3A 5F7UA 4I0PA 4TN9A 1NFDA 3BVNA 3D2UA 2WBJA 1UM4L 5F7YC 5ICZB 1KYOK 4YX2H 4PJCB 3PL6C 3LRSB 2I9LA 3CDFA 2PF6A 4OD3H 3QDJB 2X4QA 1K8IA 3CFDB 4QTIH 4ORZC 5I1HL 1KPVA 1RK0A 2Y4SA 2D9CA 1VCAA 2V5SA 5GSVB 1E4WL 5BMFH 4OCXH 1JPTH 1GPOL 1EFXB 4I4WB 2WM0A 1Y0LB 4LPWA 2FEEI 2JCCB 1Q9OA 5AWNL 4JHAL 4ZFOB 4AZ8A 5EO9A 4OD2A 2GUOB 4BH7B 2YBRA 3IT8D 5KJRH 3DGCR 2PR4L 3L3JB 3B8SA 1ZT4A 3Q3GA 3X14A 4XWGL 4OCRL 3LDBB 1FDLH 5DT1H 1E0OB 2UZXB 1CR9H 4LCCB 2X70A 1IGYB 3ARGB 3Q6FB 3UTOA 1A7PH 4FN0A 2IH1A 4D8PB 2PW1B 1G7IA 3KXFD 2ADJB 5K59F 5KBNC 3DSNA 4UB0L 3LKNA 1EXUA 4KTDH 4OSUH 5E8OA 4C57C 5BVJA 3AB0C 2BVQA 3UDWC 1MNUL 1PVHA 4C4KT 1B0GA 2B2XH 4DW2L 5C0AD 3EW3B 4O9HL 4ZPTB 4HUUB 4P46D 3WJLC 1SJVA 2OZ4H 2X4UB 5KN5B 3AAZA 1DLFL 3I6KA 3QYCA 2ICWB 4JN2B 4M5ZL 3GHEH 2P8PA 3STZA 5GGRB 3OTTA 3L6FA 4TUKH 2O93L 3S5LB 3QIBB 2PTVA 43C9B 4PG9A 3MRJB 1SBBA 4G9FA 3HMXA 3HG1E 3WIHH 3NGBB 3QEUB 1DVFA 2VDQH 5SWZA 2CXKA 2YK1L 3U4BL 1S78D 1UC6A 4S1RH 1YY8B 1XCTB 1OB1B 4JG0L 2EDWA 4AEFA 1MLBB 1NGWB 1I7UB 1RIUH 2XG5A 4Z0BL 3QUZD 1FLRL 1GIGL 2CH8A 4I1NB 2ERJC 3ZDZF 4R97B 5DMIL 3IFLL 1E4XL 2WP3T 4PJ7A 4OLWH 4JO3L 5BZDA 5CWSA 2D03L 4X6DB 4LLMB 5I2IB 1ORSB 4HFUH 5HYQA 1D9KC 4M43H 3PL6B 1KSRA 4ZXBD 3WBDA 1MI5A 1N4XH 3BZ4A 1PX4A 3SQBA 1MREH 3X11B 1NDGA 3MUZ1 4YHPA 2BRRL 4N8VB 1GGYA 5I1GL 4NKMB 3GK8H 2NX5A 5FM5M 1HYSD 4U6YB 1T1WB 2BNQD 3QHFH 4WRLA 5IKCA 3HC4H 5E6ID 3OF6D 4QXUL 5JXED 3K3QA 2PTUA 3BP5B 3CSBA 5FAAA 4BSVA 4K2UL 4KGJA 4UT9L 4WIQA 2E9BA 2IQAA 3KPSE 4HIJB 2XQBL 4OQTA 1T2XA 4XP1L 3IRZA 3QJHB 3QQ3A 4LCYB 2HLAA 4WU5B 3UYRL 5CEYB 4S11A 3D9AH 2ZCHH 4MA3A 1QPXA 1XGTB 4PJGE 4L4JA 4P59L 4Z7OE 1LP9F 4MQSB 1H8NA 4XCCL 4OBRA 1GOGA 2ZOKA 4OCYL 4MSWA 3VE0A 3AB0B 4AK1A 4R7DB 3PP3H 3GHBH 2VLJB 4RFOL 1Z3GH 5LXGL 1GGCH 5CSZA 5CZXD 1EZVY 1A7RH 2FGWH 1F4WH 3OKOA 2VL5A 1FGNH 4Z18A 1BIIA 3CLEL 3QUYC 1PZ5B 5TPWH 3CU1A 2BHUA 4EI6A 3SY0A 2B1AL 4Q58C 5E2JA 1JL8A 3FQRB 1IAII 4O51A 1MAKA 4UIMA 1HHHB 3FQUA 1PKQA 4P2QE 4R4ND 4KMTL 1R3HA 7FABL 3QCVL 1NCWH 3G6JE 2C3GA 1F45A 4Y19A 5EOQH 3T2OA 1P84J 2ENSA 1PW3A 4YJZL 3TO2B 1GH7A 4G8GE 2G5BA 3IKCA 2WWMD 1JGEB 5IVNA 2IPUK 2DYPD 2ERJB 2ZG2A 5CGTA 4N68A 1EV2E 3MJ9H 2PCPA 5FB8B 4AJ0A 1FO0H 2GJ6E 5JQ6L 1LO2H 4HWEL 2BERA 4JN1H 3TBTB 3TJEL 2DIJA 2BSRB 1NUFA 2V2WB 1MCKA 3OSKA 5F89B 1SVZA 1ZV5A 2YRPA 3ZL4L 1U91A 4XNMA 4R7NB 2IPTH 1GVIA 4LFHD 1KG0A 1RJYB 4YR6A 4K71C 1IM9D 4YE4H 1AO7D 1G7LA 3VXMA 4KTEH 1PQZB 2DQHL 3NIFF 5IROA 4Q2ZB 3TNNB 4MB5A 2R0KH 5EOTB 3SCMD 3T65B 4PRPA 4GG6F 1ETZA 1FORL 4UILH 2VB5A 2KPNA 3O6FB 2JKXA 1BFOA 3EKCA 2A1WL 4B41A 4URTB 5ITFB 4HX1A 2OTPA 5D6CB 4GKSB 5FF6B 1OGTB 4MCZA 4ZSOA 4F9PC 1IZKA 1IAIH 1CD1A 4KUCD 3VXOA 3UJIH 3BO8A 4HUVB 3DI3B 4JGJA 2CDEB 4RGNE 4W81A 1CFQA 3GSNH 5DQJA 2Z8RA 3T3PF 3LKSB 4MAYC 1TNNA 3LKQB 1T5WA 4X4YB 3K46A 4LSSL 2BP3A 2EC9T 3HPLB 4RMUA 1AXIB 2AEQH 3WKMH 4LGPB 3SDXA 5I1CL 5DK0A 4OZIB 4LDOB 1FRGL 1MLCB 1CIUA 3K4ZA 1AGDA 3EGSA 3VXUB 3WLWC 4XRCB 1XCQA 1FV1A 2YD9A 5IEHB 1WT5A 1ZGLA 5DEFA 4UBDD 2HFTA 3IDIA 1A6ZA 1UADC 1LEGA 3CFJB 1IQDB 5EU3A 2VC2H 4EDWL 4Z8FL 3RZCB 1A9EB 4Z77A 2APXA 3MNWA 5FK9B 1CXKA 4KRPD 1A6WH 4NJAH 3UPAA 5KAQF 1K3IA 4MJ5B 1F6AA 1WTGT 1OGAE 1T22A 8CGTA 4H20H 1JZ2A 4F7MA 1C1EL 3TGXA 1UFUA 3DX6A 1NDMB 4OTXL 1DUYA 3V8CA 4TNWF 1OCWH 1DBKH 1PLGL 1MFEL 3A6CH 3W9DA 3TH2T 1LE5A 1MFBL 1VERA 2I07B 1R24B 1KGCE 1SEBB 3MV8B 4HF5H 1FHGA 4NO2B 5E8EB 3QXUA 4PP1D 5EU5A 1RUML 4X9FA 4ZTPH 4JPWH 4LVHC 1S7UB 4P5TC 4Y88A 2G75A 4P2QD 3CC5A 1HHKB 1UVQA 1KENL 3H9SE 1TLKA 1HK6A 3TIEB 3JBG7 4XMPL 5E2WL 5CJQH 3GMMB 2APWA 2N1KA 4LSRL 5J0BA 1HIMH 3DXAA 4HK3N 2IMMA 1EX0A 4ZOCA 4IRZH 1W0WA 2DQJL 2HA1A 5KOMC 2IQ9L 1VPOH 1UH2A 3GSOB 3P9MA 5HDOA 1XGUB 3MNVB 4XP6L 3QXAA 1IGJA 4NHCH 3IFNH 4DQOL 4XNYH 2UWEA 5H2BA 4KRMB 5FHBH 4D9LH 1EHNA 3FB8A 4M7KL 1FYTB 5E95B 5LVEA 3T4AB 3WS6A 4RDQG 5IGXH 4ETYA 4UU9A 1OTUC 3B9KC 2QR0B 3BSZL 2D4FA 2D0HA 2ED9A 4X4MA 1R5IB 2YWZA 2ILLA 5DMGC 3SDCC 1UM5H 5EZIH 2FCBA 1LVEA 1JNLL 4QRTA 3GSWA 4BZYA 2NQCA 2CKBH 3EO0A 1F11B 5HXMA 1JYXA 2DLTA 4I0PD 3ZTJH 1U41A 4XBPB 2WBJD 2Z4QB 4XZUA 1MFNA 1MFAL 3L3GB 5GIRA 1HH9A 4U4BA 3HI6H 4CDHA 4PJ8A 4OLXL 4MD4A 4HIIB 3OKNB 1QRKA 2FECL 4R3SB 3EOTH 1LO3L 2FBOJ 3HZYA 5D1ZA 4KQ4L 3LB6C 4PY8I 2BY3A 2RQ8A 3L95B 3CFBA 4H26A 4ZUUA 1I1AC 2FRGP 4XWOC 5IV2B 3QEQA 4BK4A 3SOBL 2PXYB 2PTTB 4Z95H 1K5NA 4IIQC 3MA7A 5GISH 2IFGA 4LLUA 2N7AA 2MFNA 3QI9A 1WWBX 4QXWA 2GITA 4TSCL 3EO1A 3AU1B 3K2UL 5K9JL 5DO2C 1RUQL 1K8DB 4KAQL 1F90H 3SE8L 4J1UB 1FFPB 3KPTA 5EORL 5INCA 2XOTA 1F2XK 4NM4H 2EYSA 4LVHB 4X8JB 4NQCA 1XF3A 3DGGB 2OJEA 5F3BB 3SKOB 1M71A 1GYAA 1BEYH 3MXWH 3QULA 4JG1H 1OGAD 3MLYL 1AH1A 2QHRH 3N85L 1LP9E 3IKKA 4DZBA 3CSYA 3ARUA 4TSBL 5F1SA 5E70A 5KSVA 4YDVA 1S7WA 3IS1X 3KJ4B 1MWAB 1N6UA 4XI5C 4XAKE 5CIPB 1A21A 1TJHL 1Y6NR 3HRZA 1ONQA 4JKPH 1E4JA 2Q7NA 3S35H 5E0QA 4ERSL 4K7PL 1KGCD 1HSBA 2X7LA 4XP9H 4X6BA 4JRYE 3UYPA 3ULVE 4PJEB 1F6LL 4TULH 2RHEA 3ZKXC 4GAYA 3GMPB 5ELIA 5J1AA 1QHOA 3U4EA 2DBLH 1HZHH 3OL2A 5IEKB 2MQ3A 1L4IA 4PREA 2V5TA 3UBXA 5IOPA 4PY7A 3CDGB 4P5MA 4G9FD 3SE3A 1ZVHA 2BMKA 5CSBA 4MA7L 3RI5F 5SWZD 3D3VA 2BX5A 2QADC 4FOMA 2AJUH 2HJLB 4HGWA 5F7MC 2DOCA 5GZOC 3G08A 4P4RB 1P5UA 2J4WH 3O3EB 5DHVH 2FL5B 1T7YA 2Q86B 2DWEB 1AQDA 3IGAB 1FIGH 2K3TA 1SVCP 3QUKB 1AI1H 1CE6A 2DDQH 4GOSA 3DUSB 3UTTA 4ELME 2VDLH 3C2AL 4TUOA 4KVCH 3O4LE 3K4DA 1UQSA 1MI5D 4ENED 1A3LL 4K8RH 3CDYA 3MACL 4MGXA 2J1KA 5SWSB 5BRZB 4DKEL 1J5OH 4S0SD 4GAJL 4JO2H 1N0XL 1T3FB 5JQHC 1QKZH 3OJMB 4P23B 3IDNA 3ZE0F 4ZUTB 3NIFE 2X1PA 1EEQA 4FXGB 3WN5A 4JQIH 3RX5A 4P2RB 5C3TA 2XWTB 4GG6E 3FZUD 2X42A 1PDKA 5D2LA 3KPQB 1HI6A 2E7LA 3HZVA 1AD0A 1S7SA 2Q3ZA 2GK0B 4POZD 5HYSG 2J88L 5E4EC 4ONFH 3GSUA 5H35B 1BBDL 1FVDB 5I1IL 3T3PE 3O45A 4HKJB 4HBQA 5HYJA 4MLSA 4BFIB 4K3HA 1A6AA 2HN7B 5KVEL 3BGAA 5GQBA 2MCPL 2NW2A 1CLYL 2J8UE 5AYUH 4G8EA 4X5XB 4B7LA 2A38A 3CXHJ 1U8JB 4ONOA 4U1MB 5C0GA 5AG9A 4NC1C 1T5XA 5BJTA 5D8JL 2X4OA 4NZTH 3GB7B 3KPRB 3OGCB 3S4SG 3T1FB 4Z78A 1N2RA 2IBZX 1TTGA 3OR6A 2A6IB 1NBVL 1KLUA 5E9DE 5IMMB 3C8KA 4MLIA 3VGHA 5GXBB 4NWTL 4U33A 4QKXB 1NCDL 1ITCA 4Z7WA 1ZK9A 4P4KA 4XNUH 2ORBL 4QF1A 4P46C 1FJ1A 4Y19D 3QDHA 3BAEL 5DVMA 1NCUA 3V6ZA 3OKKB 1WCBA 3O9WB 3QRGH 2HG5A 1GHFH 2QADB 3GI9L 1FL6B 2AJSL 1C5BL 1CGSH 4DFIA 1E6OH 5I8OL 3PV7A 2A6DB 4XAKD 4K94C 1IFHH 3RKDD 1T21B 1E27A 4F80A 1BMGA 4KQ3L 3L3IB 1SBSH 5F6IB 2FR4B 4JRYD 2R2CA 1KLGA 3FN0H 5F93C 4CMMB 3BYTA 3E3QE 2AXFA 2X4TB 4RAVA 4CUCA 1YJDL 3W81A 3MRBB 1IL1B 3DV6A 3FB5B 3QJFB 3QUZC 1RURH 1A6VH 1MCSA 1U95B 2GJJA 2XTLA 3QWOA 1JI1A 4KK5D 3MOBL 1QEWB 1QQDB 1U8MA 3V6OA 1JPSL 4PS4H 4Y1AA 4ZD3H 2H26B 2YPKB 1CG9B 4UV7H 3BT2H 4ZXBC 3O3DB 3BN9D 4JFPB 1S7QB 1BFVL 3PWVB 5ESQA 4R4BA 1MHPH 1WEJL 1ZVSA 4JRXA 4PRPD 5F1OB 5JXAL 2KDGA 3JV6B 2NY3B 4GUPA 4PJIF 5DEZA 3IDJA 4M8VA 1YQVH 3GGWA 1QYGH 4QTHA 1QA9B 5E6IC 2I25N 2OL3B 2C7UA 2G60L 3MLXL 4PRHE 5C08B 3U36B 3X17A 4LMQI 1HXYA 3HTLX 2A73A 3K8MA 4HZLB 5B8CC 1INEH 5TJWK 5CMAA 4IS6A 3TJHC 4ZAKA 3ZYIA 4D0BA 3OKLB 1QRNA 2HRPL 4U1JA 5D5MA 5F7KC 4X7SL 5CP7A 3L3DA 3U48A 4K9EC 4WNQA 3RPIB 4NNYB 2YPLB 3I6LE 1FZKB 4AH2A 3Q6GL 4MQTB 5T5FH 5K9QG 1G6VK 5CZXC 5BXFA 3X3GH 3D69B 4KFZC 3B6SB 3JWOH 5BQ7A 3W11D 4LPUA 5LGJA 3GUTA 5DUPH 5F6HI 4K7FB 3MRGA 1OTTD 4WFFD 3VFGL 4IOIB 1A7BA 2NW3A 3BP4B 4MD0A 4HCRL 4R4NC 1G0YR 2R2EA 4GRLA 5L8KB 3D85A 1ES0B 1MAMH 4TSAL 3O0RH 4IRSA 5DTFB 1P9MC 1KB9K 4YXKH 2VISA 4LU5L 4DGVH 1RJCA 3I6GA 5GS2H 3TT1L 2E7HA 5HGDB 2ZNWA 4YDJA 3HPJB 1BM3L 1JHTA 3RY4A 3B5TA 4LP4A 5C09B 2WK2A 4Q7DA 4YWGH 4FG6D 5EOCH 3PGFL 2EDEA 3TA3A 4HKZB 2NNAB 4EQ2A 3ESUF 1F4HA 1G7PB 3F7VB 4V2BA 5C86A 3BH9B 5I1AA 3ARFA 4L3CB 2AJZB 5GGVH 1CXLA 1QZ1A 3MROA 1OP3H 4M5YL 3GSNA 1SMOA 3VDAA 4AENA 1NLDL 3J8F7 4MJ6A 3RIAK 1DN2A 2PNDA 5DD1L 1K9TA 4W6WB 4X8XA 3HI1A 3RFZC 1Q9WB 1INQA 4N9GA 5F1NB 1RV6X 3T2NH 4XHJD 1CFSB 4R2GD 1P5VA 2IALA 1TTFA 3SCMC 1U6AH 2FX9L 4AIZA 2EO1A 5CJXC 1OPGL 4I18B 5B8CB 4GKNA 4A6YL 3PWPE 2ZOLB 2DQUL 1JMXA 2WUBH 3QUXA 3QXVA 4GXUM 3NMEA 1KFAL 2V5RA 3FONB 5KVDL 5HGHA 3L5JA 1JF6A 1RJZB 2AJXL 4JDZB 5JR1H 1QVOB 2YSSA 3TO4A 4PJ8D 4ALAL 3MLSH 4KUZL 4WWKC 3VMOA 5D1ZD 1NBZA 1NMBH 2VJXA 2XTJD 3UPCA 1UKTA 4MXWL 2EIEA 4YBLB 3TVMD 4N8CL 4UBDC 3V52L 3CZFB 3QEQD 3ZE0E 2FX7L 4PD4J 1IGTA 2Z31D 4JVUA 3HE6D 3RA7L 1GZQA 2J6EA 4OFKA 5I73C 4RA3A 3QXWA 4DWHA 4KDVA 4KU1A 4KRPC 2Z8WC 1LO4L 3FAXA 1A4JA 3PG2A 1H3PH 2EEDA 5FOBB 4HEPG 3QPXH 5DGRA 4XPBL 5EUOA 2IAND 4D0CA 1JWSB 3V0WL 4N0YL 4QCIA 2DLFL 2H32A 1E4KA 5CKGA 3PHQA 3NZHL 4MJIE 5K9KA 1FBIH 2AK4E 4M7LH 2Y36L 4OI9A 2QQKH 5C9JB 3FQWA 4JFFA 4PGBB 1TXKA 2CR6A 4ISVA 1QD0A 3S6CA 1MCRA 2NR6D 4Q9RL 3PHSA 4FFYH 4WHTA 4Y2DA 2P5WD 5JOFB 5JIHA 4A6YB 1OOAA 1KPUA 1JHKH 1XR8A 3GJFH 3HG1B 3IDXL 2F5BH 1HN1A 1KJMA 2BDNL 3UO1H 3EZ8A 1FG2B 2ZCLH 4UDUB 4IJ3C 3KLDA 4MCYB 3K1KC 4R96A 4OLVL 5KSBE 1MFDH 1QSEE 4PP2B 1NCCL 2YZ8A 1U8QA 3I2CL 3D87B 5IHUL 3RIFK 4M48H 4IM8A 2VMFA 5FYKH 2I26N 2LFGA 5EO1B 3SCMB 3LQAC 1HCVA 2SEBB 2BVUA 3PWUB 1NAMA 2AAVA 4JFDE 4LKXA 4M1DL 5DRWA 1CFVL 1NCTA 2UZIL 3NCMA 1QFUH 2CMRH 3CXHK 3H3PL 2MHAB 2VLKA 2Y72A 4HK3J 1HDMB 4XC1H 1YEEL 2I5YH 4L29A 1RZKH 4N0FA 5E94A 1XZ0A 5BO1H 2OR9H 4OT1L 3RWGA 1X5IA 4L4VE 5C0BE 3U1SL 1B3JA 3P0GB 4E41A 3JV5A 3UTTD 3WNPA 3BISA 1AHWB 1DANT 3DI2B 1TVDA 3LS5H 1V7ML 1WBYA 4DVRH 1HYRC 2FZ3B 4NKQB 2FEDD 4QRQA 8FABA 1BD2A 4GBXA 4Q6YA 4WWKB 3KR3H 4OCWH 1GC1H 4KJYB 5F96H 4I0PC 2GAZA 5L7XH 5GS0C 2F54A 4Y4HB 3KPSB 1KPRB 5IFAH 1UWXK 3C5ZC 1EERB 2CK0L 1G7JA 4KROD 3V6BR 3IDGA 4EOWL 1MUJA 3JTTB 4RGNC 5HHXL 3MLUL 3MO1A 4HXBL 1JNHB 1NKOA 2PYFB 4O58H 1T4KB 4Y4KC 1A7QH 5CD3A 2VUOA 5HVFB 2FJFB 5JUEH 3D39A 1JRHL 1VGKB 5EU6A 1HE7A 3PNWB 4F7PB 1IZJA 5J89A 3QNZA 4N0UA 1U93A 5HYJD 4LHUG 3CFEA 1YEGH 1RZ8A 2A6KB 5D4QA 4JFYB 5FCUL 4Z7UF 1CU4H 1S9XB 4JY5H 4WW2A 1H3WM 3UC0H 1FL3B 3RWCA 2VLME 3TH3T 1W72B 4PJAA 3ARTA 4UT6L 4FQQB 5CEXB 2JJUA 1JF1B 1HHJA 2B0SL 3UTSE 5IG7A 5D7IE 5A2IH 4P2QB 3K0WA 1XF4B 1I7RA 4HXAH 5MEPB 1H5BC 3G6JB 4J8RA 4Y2OA 3WFZA 4DK6A 3TFKD 4IJ3B 4G8GB 1CT8A 2HFFA 1JPGA 5HI5D 1P7QA 1D5BB 4IHOB 4P4KD 5MERA 3O6LH 4Z7UA 3MOAH 5CGYC 4QY8B 2A0LD 1REIA 5TQ0H 2D7TH 2GJ6B 1Q1JL 3SDAB 3CVHL 3RVTD 2IADB 1EGJA 4Q6IB 1AGCA 5E7FA 3G5ZB 4CL7A 4FHBD 5A2FA 2X1XR 2Z91A 1OD9A 3SPVB 2D31A 3MJ7B 2CR3A 4OGXL 4DN3L 2F19L 3QFJE 3NIGF 1RK1B 1NLBL 1JI2A 3CMOL 4YIQB 3BDXA 1D3CA 3HC3H 4KKAD 1ZLVK 4MA8L 2B1HH 3P4MB 4PJ5E 5T1DL 3U9UB 2R29L 5JHDE 4FQCH 5DFTA 4RBPK 5DS8B 1XF5B 3NABL 2XWJA 4TVPD 5T1LA 1C7TA 2Y9RT 4Y1AD 5FO9A 1DEEA 3KDMA 5JW4N 2BVEA 4JFDD 1RZJH 5E2VL 4GXVL 4L3EE 3EYSH 3QIUB 3MCKA 4JFEE 3V5HB 3C5ZB 4NPYA 3NFNA 3DTXA 2V2TB 4OZ4B 4ENEC 4RGNB 2IF7A 2C5DC 5B39B 5HDBF 3GI8L 1FN4B 2R0ZL 2RJMA 4PTUB 1I1YB 3GSQA 4PFEA 4L4VD 1XGPB 4LCUA 5C0BD 2AV1B 5C6TL 4Y4KB 4U3HA 1KTDB 4YNYB 1QSVA 5CJOH 4CW1B 1WLHA 1RIHH 3ZT6A 3Q5OA 2K7QA 3PABA 1J0YA 1TVHA 1BBJA 1KB5A 3FZUC 4PLKD 4FQHB 2YPVH 3CVHB 4EDXA 4U2ZA 4POZC 4XB7A 3X3FH 4WY7L 3T4YB 3TT3L 3H0TB 4LVNB 4U2YA 5LAXA 5D1QA 3MLVL 3G5VA 4ZFFB 5TE4L 2EIZA 4P2YA 1T1YA 1T04B 4BQBA 1WZ1L 5FDWB 3HAEB 4R26L 4ZAKD 1H5BB 5FOJA 1MY7A 3AM8A 1U8IB 5HI3D 4EUPA 2BOCA 4NSKB 1UM4H 1HQRA 4HFWB 5D72L 5CKAA 2NY4D 2WQRA 1K4DA 5ANME 5FUCC 3MA9L 1UXWB 1ZHLA 3TN0D 4QRUB 5I1HH 4OZFH 3ES6A 1XIWA 3JSSA 1E4WH 4GKZA 3MR9B 1GPOH 3L3KB 3QEGL 1WZLA 3UTSD 2R69L 3WE6B 3SEPA 5AWNH 4JHAH 5ID1A 2HT4D 4HWBA 4F7CB 2G9HA 3QZWA 3H9SB 1BWWA 4M02A 1P7KA 4GRLD 1JE6A 1BX2A 1E4XI 3D85D 4S1QL 4IRSD 3QQ9D 2PR4H 1R5WB 3VG9C 5FGBA 3ZLQC 2P48B 4I48A 4O4YH 1NSNH 1I3GL 5INDA 3SE4A 4JCMA 4OCRH 5F21B 1CF8L 5HY9B 1VFUA 3MRMB 5E8DL 3RKDC 4KKLD 4XMLH 2ZUSA 3H7LA 3A6OA 2DM7A 3ULVC 4CU8A 3PXJA 4YHIA 5TF1L 3TA3D 2OBGA 1FC1A 2GKIA 2NY5L 4TTDD 4XNXL 1MNUH 4PD4K 4KK5C 2HT2D 4DW2H 2DBJA 3EFDL 3VGAC 5DDHB 3ULUL 1OF2B 1U92A 2FLBT 1AE6L 5FUZL 2FX8L 1BZ7A 2W9LA 4KI5F 1MCWM 3HR5B 1DLFH 5JHDD 1KIRB 3ECBB 5DK2A 3BN9C 4M5ZH 3OPZL 4M1GL 3QWRD 4RGMC 5IROC 1UM6L 1BIHA 5L2KA 3KPPA 1HWGB 4HEME 4L3ED 3VGGA 1P4LB 2DB8A 2YK1H 4JY6B 3ULVL 3SKJL 2VDKL 4JM2F 3O41A 1VHPA 4M6NL 4QHNA 2X1OA 2EDJA 1FLRH 1GIGH 5C92A 3OHXA 3HC0A 3P4NB 4P49A 1E4XH 5C1MB 1WC7B 4JO3H 4ELKB 5EA0H 1KACB 4JLRB 3TO4D 2D03H 2V7NA 4OZGA 4KHTH 5IJVB 4W70A 4OQ1A 4OFIA 4KKBC 4F37K 1MCIA 3NN8A 1BQUA 2EXYD 3ZTNL 2BRRH 1S9YB 1BJ1H 4RQQB 4JM2A 1A02N 1IGFH 1UEMA 3MOQA 5I1GH 4Q9CA 1Q94B 5IVZA 1KIPA 1U9KA 1Z9LA 5EFIA 1N3NA 3CDCA 4NQTA 3GKWL 3UROR 4OZHF 2VNCA 4P3WA 1UJ3A 3TYGL 1CD0A 2Z35B 3WFDL 1M7XA 4QXUH 1LP9B 5DJ0A 1HWHB 4DN4L 1U3JA 4M93C 3UJTL 1T83A 4Z76B 1J8HA 1JWMB 1OTTC 4OGYL 5LWYL 1T1XA 1I85A 3MFFB 3MV9E 5K9OB 5F7WC 2AI0L 4XP1H 1VFAA 3F65A 4NUJB 3VRJA 1DQQB 4QO1A 4JFFD 4JRYB 1T1ZB 4XMKL 3UYRH 4G7VL 1QBLL 2O26U 4QT5B 1C16B 5EN2A 1CE1H 4YUEH 3IETB 3CUPB 4Y2DD 2QSCL 4OCYH 5HDLA 3RGVD 3SJVE 1UCTA 3AS1A 1ZS8B 3TZVA 4F3FA 2NXYC 4PJXE 4OJFL 4RAUB 1Z5LB 4X99A 3V5DB 4FG6C 4H25A 5LGHL 2EH8L 4WHDA 1IAOB 3P77A 3H8NA 5KVGL 1JGLL 3SDYL 4ZOEA 3VD4A 5HYSB 2Y5EA 2FHBA 1AGFB 5GRXG 3VXTB 3WUZA 1N8ZA 3D25B 3RX8A 2BVPA 2KL6A 4LKCA 5JOEA 3S34L 7FABH 1FAKT 4QRRA 5BZWA 3E3QC 3FT4A 3EOAB 1T0NA 5E5MA 4ELMB 4HS6A 4J6RL 4RA0C 3O4LB 4UDTB 3NIGE 1KCLA 1EEYB 3U0TB 1OM3L 1RFDL 4BQ8A 3CPLB 4E41D 4XNZC 4YGAB 5JQ6H 3T0EE 3JTSA 2IFFL 2CGRH 2WLYA 1EO7A 1OP5K 3NCYS 5F3HB 4AEIL 2C3VB 3VFWA 1WVZA 4GG6B 2Q1EA 4HHAB 1D5IL 1OW0C 3NVQA 3UAJD 3TESA 3BMWA 1X5JA 3KYNB 3PJSB 2WIMA 4X7DC 3U0PB 5EBLA 3PWNA 4EJ1C 4UT7L 2EC9U 3T04D 5DMKB 4PJ8C 1DQDL 1P69B 3EYQD 4HIXL 2W9EL 5B22A 1XF2B 4O2EA 4RMQA 5D1ZC 3O11A 1Q9KB 3PV6B 1ZANH 2XTJC 3EFFB 2JIXB 2J8UB 2IH3B 1CCZA 1FORH 3TVMC 1JV5B 2HKFL 1DE4A 1JF5A 3QISA 4C4KO 1VESA 4L8CB 2Z31C 3HE6C 3WSQH 3S88L 3WDIA 3I75B 3OAYK 1KCVL 4MMXC 3BKYL 2MTPA 1T80A 4U6TA 1X5GA 3L9RA 1I8LA 1YMHA 1GJIA 5E9DB 3MRNB 1FQ9C 5FKPB 5T5NF 3IJYA 1TPXB 3NCFB 2B4CH 4ZMAT 1JPFA 5A1AA 4YO0A 3AXLB 1K3ZA 1MCOL 2XZZA 1FVEA 1QSFA 4G6FD 1S7RB 5I1CH 3OG4B 4WWID 4PJBA 2NXYB 5FV2A 1YPZA 4YXLL 4CMHC 1SHMA 4I77H 3LKPA 1NCAL 4LAQH 1H3TA 2VXTL 1FL5B 3FOLB 2NR6C 5C0FB 2HTLD 5ILTH 1FLTX 5J13B 4PJFE 3ARBB 5F72S 2WP3O 4LAJH 5E56A 4EDWH 4J7RA 5KG9A 4Z8FH 4M6OH 3O2WL 5ALBL 2YOCA 5FYJD 2AKRA 1CQYA 3FTGA 3RTQD 4XPHL 2OS7A 3V0VA 4L9LB 1YECL 4XVUD 1NFKA 1KULA 3WFEL 1A3RH 4FQJL 4HUKB 4AG4H 1OWWA 3S36L 3SJVD 1UB5A 3GJEB 2B7DT 4K8RD 3MRKB 4CNIA 5CLTA 4OTXH 3FT2B 3ZDXF 1RJLA 1HNGA 3H9HA 2V9RA 3EJYC 1PLGH 1WWCA 1MFEH 1QLRA 2ATKB 2X9WA 3OAZH 4QRPA 1BP3B 1MFBH 5T1KA 3DX7B 1H8SA 3VXSD 2ADIB 2XN9A 3EUUA 1EIBA 1FNHA 4XNZB 3OKMA 1RUMH 5DJZA 5EULV 4ZUWB 4MHHI 2FECI 4ZUSA 3B83A 1CGWA 1KENH 1ZWIA 4FXKA 5IB3B 2YRZA 2BHZA 4PR5B 3O6MH 4XMPH 3PGDB 5KANG 2EH7H 5E2WH 2R4SL 4H1LH 5CP3H 3IFOA 2UYLA 4LSRH 2YXFA 1M6OA 1YMMA 3HZKB 4R4FL 1GAFL 3SO5A 2FEDC 1RPQA 4E5XB 1L9MA 4HG4J 2DQJH 5HGAB 4V1DB 2JJSA 2JLLA 4PRHB 3UZEA 4QHUA 5DJ2A 1ITBB 4XP6H 2YD5A 1I4FB 3P4OB 3KPNA 5JOPE 3HE6B 2OSLA 2F53E 4LCWD 3VFMA 1AD9B 4UUJB 4LLYA 5DSCA 3P30H 4M7KH 5JDJA 3IJSB 1CICA 3HNTL 4MMZC 3B5GA 2HKHH 4OGZA 4Y5YA 3DURA 2BY2A 3B2UD 3REWB 3LSOA 4OCXL 1JWUA 4JM4L 4OFDA 5D1QD 4HKBB 4ZYKA 1JNLH 4PJCF 3A6BL 5A16B 4HH9A 5KJRL 3C8HA 4QRSB 5CIPH 2BNUA 1D5ZA 2E8ZA 43CAB 1PY4A 2AQ1A 3UPRA 2E27H 4MZ2A 1MFAH 1FDLL 5EC1A 5IW1A 2A83B 3UTZA 3VXQB 1SYSA 1LO3H 1C5CL 2JCCF 1A7PL 2ICCA 1XIWD 2V7HB 4OUUA 5DJYB 5IK3B 3KPOA 5ICZA 5E8NA 4OZHE 5IMKA 5HI5C 4XXDB 4PJCA 4U3CA 2RFXA 4NO0B 3VXRE 5JW4Q 3QDJA 3CFDA 4QXTA 5HVGB 4OB5L 2QKIB 3FKUS 5GSVA 2H1PL 4TSCH 2JJTC 3TWCL 5K9JH 1RZ7L 2YUVA 5EBGA 4KAQH 1EFXA 4I4WA 5C0ND 5HJ3A 1Y0LA 2A77L 4G42B 2JCCA 4ZFOA 4OM0L 3G5YA 4ZG1A 3KGRA 3X13B 5EC2B 4DOHE 1F00I 2GUOA 3C08L 5DD0L 3SDXE 4BH7A 1GZPB 4JHZA 1FC2D 4G43B 1AXSA 1J1PH 4K3JL 3WIHL 4BYHA 3N85H 2VDQL 4KKAC 2YD8A 4TSBH 4S1RL 2W0FB 3U7WL 4PV9B 3WFCL 3MLRL 1RIUL 5D71L 1CLOL 5HGBB 4M8QA 35C8H 4LCCA 1T0MA 1TJHH 3ARGA 2GSIB 1W8NA 4D8PA 4K7PH 3MRHB 3WO4B 2FSEB 1TIUA 2ADJA 2ZUQB 1Y18B 5BS0E 4CADB 3FO1B 4HFUL 5I1KH 4WW1B 1CTOA 3ETBF 3PWPB 3RWHB 3ZHDA 1LEIB 4U6VL 5L2KD 1DP0A 4ZPTA 4HUUA 2X4UA 4YDKH 5KN5A 3U9PH 4MA7H 1LQSR 4WU7B 2GTZA 4O2CB 5ESAA 3ARSA 5F1IB 4CVWA 2ICWA 4FQXB 3HC4L 4NKDB 5DJ8B 3S5LA 3QIBA 4KI5D 1A0QL 3BIKB 4RNRB 43C9A 3GSXB 2APBA 2VH5L 1WCQA 3QEUA 4PRNB 1ZLWK 5DJAB 1A3QA 1YY8A 1XCTA 3VI4F 4WUKH 1DQMH 1MLBA 3C2AH 3DMMB 1NGWA 5BV7L 1OD7A 4PGEB 1PFCA 4JQXC 2GJZB 1A3LH 4ZAKC 3MACH 4ETQB 4JM2D 5HI3C 5GS2D 5ALCL 3VDCA 2MOVA 1ADQL 2NY4C 1IAIM 4X6DA 3N1PC 1X7QB 1ORSA 4P2CG 5I2IA 3PL6A 1TETL 4MJIB 2AVGA 2AK4B 1Z3GL 2NY1C 2VE6B 3TN0C 4X7TB 5FYKE 2FGWL 3NH7L 1EMTH 1MCEA 1F4WL 4N8VA 1IM3B 3OJDA 1ZA3B 2WIIA 4NKMA 2Z0BA 4QOKE 5TDNA 1J8HD 3HLAB 4M3KB 2J88H 2HT4C 1T1WA 4U6YA 3MLWL 2X2YA 1CGUA 1BBDH 3VFOB 4GRLC 5I1IH 5KSAC 3NCCB 1WBXB 3QQ9C 5E4IA 5EOQL 5IUSA 1I3RB 4C54A 3MX0A 2GCYA 3BP5A 5KSBB 3D1MC 3VXRD 1QSEB 2B5IC 4HIJA 2IAMC 3TBWB 3V6FA 3TZVD 3DRQA 1EEZB 4YDIH 4YLQT 5H94B 3O2DL 4LCYA 3OKDA 3JWDL 3KLSA 4YEFA 4JFDB 4ZO7A 5CEYA 1NBVH 4LLQB 1LO2L 1XGTA 5CEZE 5BV7B 4JN1L 5J06A 1NCDH 3UDWA 4XPGH 2ORBH 2VLJA 4HS3B 3T08A 3K8KA 5D7LE 4LHUB 2GT9B 4QRRD 3WJLA 4L4VB 2IPTL 5IESL 3KWWB 4I3SL 4U3XA 5C8JA 1KBGH 3GI9H 2BOBB 2AJSH 1C5BH 4YE4L 3ZDXE 1JZ4A 1T20B 5I8OH 3JVGC 3T77A 1ZHBB 5C0IA 3ALXA 1W0YT 5IT2L 5DJCB 3BPLC 4UILL 3CH1B 5BS0D 1J05B 1B6DA 3EOYG 3NPSB 4YXHH 1MVUB 2R8SL 3WXVH 4X7CC 1CGXA 4JO1L 4U1SB 3U0WL 3FRUB 4S10A 1QNZL 2OTUA 2ZUWA 5TQ2L 2P5EA 1U2HA 3UJIL 1IVLA 4U1HB 4F33B 3ARPA 3MOBH 4X4XA 5DRXA 1JPSH 5FB8A 4QHKI 1DL7L 4J4PD 3GO1L 2P24B 3OB8A 3ROOB 3FFDB 2P8LB 1AC6A 2EC8A 3RL2B 3TBTA 2HMID 1D9KA 4N5ED 2BSRA 1BFVH 5ERWB 2V2WA 2NY1B 1WEJH 5F89A 4DGIL 1A2YA 2XXCB 1RAMA 1TZIB 1FO0B 5EG6C 2CD0A 3LQZB 3MRRB 4R7NA 1G7HB 4I5BA 4OLYH 1RJYA 2XFXA 3QRFM 5D7IB 3D3VE 1BVLB 4UOJA 2M8XA 5TF0A 2ITDB 4U1GC 1HKFA 4G9DB 1HEZB 1F4AA 1PQZA 4OKDA 5KSAB 1A6WL 4Q2ZA 4FXLA 3TNNA 4OIAA 5EOTA 3T65A 2G60H 4IDJH 3MLXH 3VGDA 1UKQA 1NMCC 3H3BC 2H3NB 3O6FA 5J9PB 5DJDA 5EIQA 5EDXA 3FQXB 2FWOB 5D6CA 2VIRB 4GKSA 4HQQH 3ZT7A 2B5IB 2IAMB 1QSFD 4OFYA 2VITB 4W4OC 4G80B 4KK8D 4HUVA 1OCWL 1ORQB 4POUB 3LPWA 4PB9L 3A6CL 4HG4K 3LKSA 3ZMRA 1FZOA 4X4YA 3E1F1 4Y2DC 4A2LA 1N64L 4N0CD 4Z7VF 4ZTPL 4JPWL 3RGVC 2ZPKL 4WTWA 3Q6GH 3QFJB 2XZQH 5DHXB 2MCG1 4OZIA 4ODTH 3G6AB 2AXHA 3UBXG 1MLCA 4B50A 4XRCA 4BQ6A 4OM1L 5DC0A 2E9WA 4PRIB 4PJ5B 1IKFH 3QUYA 1G6RA 3CFJA 4H8WL 4M6AA 2EE9A 1SYVB 4NHUB 3WNNA 1GGUA 1A9EA 4J3UA 3OJ2C 4HCRH 3R8QA 2IPKB 1H9VA 4TSAH 1CL7I 3DETD 4L3EB 5DQ9A 3WYRA 1UJTA 5EBMB 3U30C 4LU5H 4XCYB 5DEGB 2XN9D 4JFEB 2ESVA 3TT1H 3TCLB 4U1NB 1DQJB 5KZCB 4D9LL 3MJGX 1NGYB 1NDMA 3BPNB 4X7EC 1ZT1A 1UEYA 5HSFA 1V7NL 2UUDH 1UA6H 1TJIL 5IGXL 5KS9E 3PGFH 1DTUA 2I07A 1R24A 1YYML 3MV8A 2DTMH 4NO2A 2W92A 3DVNA 1MSPA 1J11A 4JHBA 1S7UA 3NIDF 3GSVB 2P47B 2CKBL 2APTA 4Z7WE 5D7KE 4GQ9L 3TIEA 5F88B 1NGZB 1NC2D 1EFQA 3GMMA 5DD1H 2QSTA 3EYQC 2FYYB 3WUWA 4HDIA 3QO1A 2CIKA 2EDKA 5JTWA 1ODAA 5TDPB 2ZSWB 4U1GB 2WV3A 1H15B 1DDHB 2DQGH 4JFXA 1BFTA 4XPFH 5E8PA 2ZP0T 5DHYA 3GSOA 4WFHE 2FX9H 1XGUA 4CN1A 3MNVA 4TQEL 3VMNA 3BGFC 5ANMB 3UZQA 4MDIB 5EIIB 1OPGH 3I9GH 1FYTA 1BOGB 1G9EA 2DQUH 1CK0L 1WJ3A 3BX7C 3PGCB 2VDNL 3T4AA 1KFAH 1CL7H 4OF8A 4MAYA 4EIGB 2AJXH 1GGTA 5FO7B 2QV2A 2QR0A 4Y5XB 2R1WA 3OXSB 4XP5H 2PUQT 3ESVF 3V4PH 4KUZH 5DF0A 2BSED 2ICEB 3MRPB 1BEYL 3MXWL 1F11A 4MXWH 1JNJA 2X40A 4Z7QE 3PQYE 4XBPA 4R0LB 2Z4QA 5D96C 4U49A 1UYWL 3V52H 4E42B 3L3GA 2FX7H 4Q0XL 1NCBH 3RA7H 4IOSD 1NCNA 1J1XL 1J0JA 1AIFB 2CKBB 5I19L 4HIIA 3OKNA 1ZVYA 4R3SA 1R3KB 3RTQC 3GKZA 5F9WC 2XWBB 1F97A 2XA8L 3L95A 4XP9L 4XPBH 1EFXD 1B6UA 1EAPA 3QO0B 1EVUA 3V0WH 4K8RC 2PTTA 1I7ZB 4N0YH 3K74B 2QQNL 4TNWK 3QEHB 4OV5B 1BECA 2CO7B 4CAGA 3CJJA 1N0LA 2XRAL 3LQMA 4LRIC 3WNKA 1K8DA 2AJUL 4NBXB 5D5ME 4J1UA 1FFPA 5HHMB 3T8XB 1CN4A 4PJEF 4X8JA 3DGGA 2J4WL 1VACB 3SKOA 3ARGD 2Q87A 3IDXH 2BDNH 1TVBB 1LK2A 1AI1L 5SX5K 4ONGL 5JO5B 2BXYA 2VR9A 1I1CA 4H0HB 2EDOA 1DANU 1JRHI 4OLVH 1DFBL 1MWAA 1U8PA 4KVCL 3DBXA 1NCCH 3S96B 3SHSA 3I2CH 5IHUH 4J3OC 1OLZA 4NUGL 1WAAA 4FRWA 4WDIB 1J5OL 3WV0A 1KCKA 4M1DH 1CFVH 2UZIH 5IMOB 4I3RH 5E08L 4RMWA 1QKZL 1JVKA 3H3PH 4JQIL 5HHPB 2AP2A 4YFDB 5D7KD 3MRDB 4X98B 1RUPL 5IEKA 3QIBD 2VQTA 3CDGA 4R90L 1HHIB 3B3IA 5MP6H 3RY6C 1GGIL 3OMZA 3H9ZA 1BPVA 3DROB 4ONFL 4G8IA 3AGVA 4P4RA 5HD8D 3V7AE 3IAGC 3O3EA 4MX7B 1F3JB 2FL5A 3AM8C 1BF8A 3MREB 2DWEA 3DECA 4OKVB 3V4VL 3PXHA 5MEQB 2DRUA 5CUSH 3QUKA 1VA9A 3FQTA 1OT2A 3DUSA 4Z5RA 2A9NL 3T2QA 3BDYL 3MV9B 3PL6D 1CDJA 1TCMA 1E6JL 5DHVB 4EOWH 1P2CA 2EKSB 2LVCA 1HNFA 3RTQB 3MLUH 4HXBH 3MRLB 1OARL 1XIWC 4KKNA 3TBVB 1L6XA 5F9WB 2VR5A 5SWSA 1FAIL 1T2QH 2CQVA 2V17H 1MCJA 1U36A 3D2UB 2NLJB 4HJJL 1I1AA 4IMKC 1QUNA 3EYUH 5J6HB 1SMAA 5T3ZE 5F70A 1T3FA 1JRHH 4P23A 4WV1C 4XNQA 5DRZA 4ZUTA 4PJXB 4FXGA 1QR1A 2I9LB 4RMRA 4KI1A 1K8IB 4IIQA 1FFQA 1KC5L 1KPVB 3K8LA 4HH8A 3VXUE 1NEZB 3V79C 3QRGL 2GK0A 2R39A 5DC4B 3B8YA 3O4OC 4UT6H 5T1MA 1E6OL 1IAMA 4PJ9C 4D0DA 5ADOL 5T3XE 4RMVA 5H35A 1IFHL 5EO9B 4OD2B 4CN6A 5C7XH 4BFIA 2HN7A 1R3JB 4XP4L 1CIDA 1IJ9A 3FN0L 4X5XA 4Z7VE 3Q3GB 2YUWA 3X14B 4K23L 1U8JA 1Q9LB 1NUDA 2A74B 4U1MA 1X5XA 3LEXB 3BH8B 2VLJD 5LGKA 3GB7A 3KPRA 3OGCA 2A6IA 5HHOE 1KTLB 3T0EB 3R1GL 5ENWA 1Q1JH 2K7PA 3CVHH 4YHNB 2OXHA 5EUOE 4XXCA 3KNBB 3LKNB 4L5FL 5E8OB 2CUHA 5IB4B 1YC7A 3NBNA 4LIQL 4ORGB 1MHPL 4OGXH 4DN3H 3G9VA 2F19H 4PG2C 3GRWA 2QTEA 4M9PA 1NLBH 3GSRA 2OR7A 3AAZB 4KMLB 4FTVA 3OX8B 3QG6A 4MA8H 1FL6A 4N90E 5T1DH 3I6KB 2CK2A 2HVJA 3EO9L 2A6DA 4U6XB 2P8PB 1SQ2N 3AY4A 1KN2H 3JWOC 4KI5C 3N1FC 3A0OA 3L3IA 1MIEH 4H0IA 4PG9B 2FR4A 3E6HB 2BC4B 3J7HA 5E2VH 4GXVH 4IRJC 4CMMA 2X4TA 2X4SB 1A1OB 3MRBA 3DNKA 3MV11 4LNVA 3NIDE 3QJFA 3P9WB 5TDOB 4YDLC 5ITBH 3E6FB 4JREC 3RWDB 3FN3A 3V0AC 1QEWA 2EDBA 4LSTL 2R0ZH 4JM2C 5GPRA 5C6TH 3QG7L 5E2TH 2H26A 4JR9L 3P11H 1CG9A 4X80H 5A2JH 3O3DA 4KRNA 4WV1B 4JFPA 1S7QA 3MUGA 5T5FL 5CILH 4NFBA 5TH2B 3QXTA 4CVZA 3X3GL 1FH5L 4UV4L 4YHPB 4DEPC 3JWOL 4BFEA 3JV6A 3O6FD 5EO0B 5DUPL 3LKOA 4PJFB 4WUUE 2NX5B 3O4OB 4ZS7H 5AD0A 4DTGL 4OFYD 4PJ9B 4V2CB 5TE4H 2H2SC 4XCEA 3DJ9A 3RVUD 5BVPL 5C9KA 4YPGB 4D94A 4PGJA 5C0EB 5IB2A 3WHE0 2OL3A 3TLRA 1MAML 3IXTB 2EE2A 3O0RL 5C08A 2XV6B 3U36A 3BDBA 3QXDA 4KDTC 2AJ3A 3OZ9H 5D72H 4DK3A 2JJWA 2X9YA 4HZLA 1ZKAA 5IWLC 1XGRB 2UVFA 3MTRA 2X05A 5AUMB 3DO7B 5D2NE 5IQ9B 3VXUD 2M26A 2BFVL 3KXFA 3RPIA 4NNYA 1BQLL 5JW4M 1FZKA 2R69H 5DJXB 2AGJH 5CBAA 1FZJA 2ZOKB 3RZCD 5EU6E 5C0AA 5HYFA 3D69A 4WI7A 4P46A 3UZVB 3B6SA 4N0UE 4XH2B 2VL5B 5DUBA 3KPLB 3RRQA 5FEBA 1MF2H 5LJYH 3BIBX 4K7FA 2OK0L 2Q6WB 4Y4FC 3SY0B 1I3GH 4YZFE 4IOIA 3HHRB 4JPKL 1CF8H 3IDMA 4O51B 4PJAE 5E8DH 3T2NL 3C2SA 1YA5A 1U8KA 5D7SL 4PY8J 2MKWA 3K7UA 5HHOD 2CDGA 1IC5H 3QP3A 5TF1H 5DVKA 2DQTL 5I8EB 4IRJB 2CDFA 4YHML 2F53B 2J8HA 1Q0YL 2NY5H 3VDBA 3RWJB 5GGQL 3QUZA 4XNXH 3O3BB 2FATL 1WWWX 4JREB 3EFDH 5C09A 5IMLB 4J4PC 3ULUH 5DVLA 4RFEB 2C3HA 1A22B 1AE6H 3NTCH 5FUZH 4GFTB 5E99L 2FX8H 1PG7W 4HKZA 2RIKA 1G7PA 3F7VA 2HMIC 3BH9A 4N5EC 3QQ4A 1F5WA 2W60B 5LQBH 4L3CA 3OPZH 3MLSL 5FFLA 4ODUB 1UXSB 3R4DA 4L8SC 1NMBL 4M1GH 2Z8SA 4NZRH 1AR1D 1UM6H 2DWDB 3RJQB 3KLAA 1OVZA 3RUGA 3S37L 4G3YH 1GRWA 2VDKH 2W1NA 4YR6B 4KWUA 4M6NH 1Q9WA 2D0GA 4PPTA 2AV7B 5F1NA 3VXMB 5DJ6B 1FYTD 2R1YB 2BSSB 1I8LC 5JIPA 2C3WA 3QPXL 1LNUB 1ETZB 2X4PB 4OZHB 5BRZE 4NQVB 4AT6B 2PO6B 4HX1B 3CXDL 3VFSA 4MCZB 5B8CA 4YHOH 1QBMH 4KK8C 2Q8AL 4JFHE 1CFTB 3BO8B 4P2RE 2ZOLA 4PBXA 2I27N 4CU6A 4MB3A 4GSDL 4OD1L 4WUUD 3FONA 4JDZA 1RJZA 4N0CC 1QVOA 3JZ7A 3GKWH 3SDXB 4IMLB 3N1QC 4U1IB 3TYGH 1RZKC 4CVUA 2XZAL 5DK0B 2Y5TB 3HZMB 3WFDH 3BZEA 3OWEA 4FS0A 4DN4H 1TQCC 1AGDB 2HP4A 3PWLB 2YKLL 1FV1B 1MHCA 3UJTH 4GG8A 3CZFA 3K1DA 5DEFB 2PXYD 4Y4FB 3BZFB 3GMLB 2N7BA 1GC1C 5EU3B 2J12B 3ROLA 2AI0H 2F15A 3CSPA 5D1XC 5MI0B 3QHTC 1EA9C 3DETC 1QACA 5JPNB 4EVNB 1P9MA 5BS0B 2QSCH 3ARVA 1JWSA 2CO6B 4HPYH 4F7MB 4P9HL 1RIVL 4PUBL 3DX6B 4OJFH 4XC1L 1X5AA 3VD7A 1RZKL 5C9JA 4X6FB 5LGHH 2EH8H 3WXWL 4NQXB 4JDVB 4PGBA 4I3GA 4AM0B 4CRPA 5KVGH 3SDYH 5JMOC 5EU5B 3BKJH 5JOFA 3MCG1 4A6YA 5I8KL 3S37X 4RIRB 3VRLE 1DQLL 4IBLT 1MJ7L 1M7IA 5L88L 1UVQB 4LVEA 3HG1A 5L7XL 3S34H 5K9QI 2GIYA 4DVBB 1FG2A 3BD4A 4UDUA 3BFOA 1HHGB 4XVTH 4J6RH 5CEZL 3MPCA 4MCYA 3MNZA 2VDPL 1YN7B 3N06B 3FMGH 4PP2A 3GJFB 3QUMH 2YZ1A 4OFPA 5KSUA 1W0WB 3TC9A 4QEGA 5GGTH 5EO1A 3SCMA 2SEBA 2XYCA 1OM3H 1TZHA 4EUPG 3PWUA 1RFDH 3WCYA 5CJXA 1TTUA 2IFFH 4AEIH 1LGVA 1D5IH 1HDMA 1YEGL 1CZ8L 1BF2A 3W39A 3KYMA 4HT1L 3VWJD 1CU4L 4JY5L 4QOKB 1B88A 1OAYH 1TFHA 2R0LH 4UNVA 4UT7H 3HKFA 4UU9B 3TBSB 1DQDH 4HIXH 2W9EH 2FZ3A 4WWKA 1C5DA 4HXAL 3QZWG 4PRDB 3C09B 4HV8B 4ODXB 5EUKB 4KJYA 2DKSA 3MCLL 3DUUB 3MRQB 4ZDHA 3LB6D 2DQCL 1NUGA 5BRZD 3RWIB 5CJ8A 2HKFH 5CCKH 5ISZE 4RZCB 4XWOD 5F7NC 4XZUB 3KPSA 1MOEA 4P23D 5DC9B 3S88H 2D7MA 1KCVH 4NP4L 2ARJB 4JFHD 4MD4B 3BKYH 4P2RD 3JTTA 3MOAL 4CVXA 3IB4A 3GBNL 1RZJC 5D1XB 1JNHA 3W82A 3C60B 2PYFA 1T4KA 4PJGA 3G6JF 4LBEB 3MLTB 4H26B 5JNYB 2FJFA 5DMJB 3W0WE 1VGKA 1P7HL 1MCOH 3PNWA 1K5NB 5D7LB 3DSFH 5IVXE 4YXLH 2I24N 2ZG3A 1EJOL 3C5SB 4JFYA 1JMZA 1NCAH 2GITB 1MFCH 1S9XA 2VXTH 1FL3A 1EZVX 4FQIL 1W72A 4FQQA 5CEXA 1JF1A 3MGTB 4WFGD 2RAMA 4XI5D 4P2QA 4NQCB 3ARGC 1KIUA 1XF4A 3L1OH 5MEPA 3G6JA 3KPRD 4XPHH 1AP2B 1YECH 1M4KA 2CRYA 1J86A 1NC2B 3WFEH 4FQJH 4G8GA 4DZBB 1ND0A 3WHE1 1CDHA 1ZLVH 1NGPL 3S36H 4YDVB 1D5BA 3VFRA 1CI5A 4RBPH 1MHHB 1DUZB 3U82B 1UH4A 1U58B 3B2VL 4QY8A 2GJ6A 3O9WD 2C4FT 1HSBB 3SDAA 2QADD 2IADA 1XAUA 3HMWH 1OSZB 4Q6IA 3G5ZA 4ZTOL 4LRNL 3MJ7A 1X9QA 3SPVA 1CBVH 5C0CE 1VDGA 4DZ8B 4ACPA 2L0DA 2PETA 4FFWD 5IOPB 5DYOB 5CD5D 3NGBC 1RMFL 2YPVL 1KCUH 4YIQA 3D3VB 1NC4B 3MGOB 3P4MA 4U1KB 3U9UA 3THMH 3H3KA 4NJ9H 4R4FH 5AZ2H 5L8JB 3OG6B 5HD8C 1XF5A 4R97C 1CWVA 4LSVH 4YFLF 1RUKL 1EO8L 3GBML 4LNRB 3V5HA 1X6LA 3C5ZA 1DQTA 2V2TA 3FFCE 4OZ4A 1LDPH 1QLEH 3BRGC 2X9XA 1JN6B 3QBTB 5B39A 3HNTH 4R8WL 1FN4A 4PTUA 1I1YA 1XGPA 2BJML 2NY3D 2AV1A 4Y4KA 1KTDA 5FGCE 4ZPVA 1CDUA 4JM4H 4YNYA 4PBWD 3F7RA 3S7GA 1LK3L 4LASL 4CW1A 5I9QC 3HS0B 3VU2A 3IDNB 3PIQB 3WN5B 5IW6B 2OX5A 5CZKA 3A6BH 3W5MA 2D7OA 3IXAA 4FQHA 4DUXA 3WO3B 5C08D 3GMOB 4X6CE 1WIOA 3HZVB 3OJVC 3D5OF 4O4YL 1NSNL 4G7YH 1MEXL 3BP7B 4FNLH 1U8LB 5H37H 4EKXA 4DUVA 4QYOB 4RDQF 4ZFFA 3LN5B 3GSUB 1C5CH 4XMLL 3REVA 2AJYL 1F3DJ 1JTPA 5FDWA 3HAEA 1H5BA 4U0RB 3RHWK 1OGAA 1U8IA 2FD6H 4WENB 5I30L 1UZ8B 3BRFA 2YPLD 5K33A 4LHQB 2Y06H 2L7UA 2X4OB 4MXQD 4OB5H 1IKNC 1MRFH 2P4AB 1JCKA 2XZCL 2C4XA 2HJKB 2Y07H 5KS9B 1N2RB 2H1PH 3TWCH 1CVRA 1RZ7H 3ARXA 3MR9A 3L3KA 3S3PA 1TCRA 3WIIL 1SY6H 2A77H 3WE6A 1IC1A 4OM0H 3C5JB 1KXVC 4Z7WB 3ZSTA 4OZFB 1KTRL 3H9SA 5ID0B 5DD0H 3C08H 2GSGA 4O02L 5IHLB 1N5YL 4GRWH 4PJBE 4QXGH 4OF5A 4K3JH 1R5WA 5F44A 1WCBB 1KJVB 1QO3B 2LU4A 2P49B 4OF0A 3U7WH 5CZVH 3WFCH 1U3YA 3MLRH 5D71H 1DBJL 5HY9A 3MRMA 1CLOH 1INDL 2FLRT 4QNPF 1E27B 5C09D 5HPMA 1A64A 3N1MC 5I8CA 5EA0L 3OB0K 4AEHL 5IF0B 3CK0L 3KYKL 5MENE 4KHTL 5I1LB 1B0RB 3BRDA 4U6VH 3QWOB 2F74B 2GI7A 3F7PC 5DDHA 1OF2A 1IGFL 4G8FB 4XTRD 3HR5A 2X89D 3ECBA 4KV5E 1L0YA 3IJHB 5I9QB 3WLBB 5A2LH 5ESQB 3DV4A 1ZVSB 1A0QH 3E8UH 3PQYB 5CINL 4GW4B 3O6FC 1MCBA 2VH5H 4NO5B 1B2WL 1P4LA 3Q48A 3RL1B 4P5KB 4YGVB 4KRLB 4Q9BA 4GUPB 5I76B 3ZKND 1G9ML 3FFCD 5HVWA 3X12B 1IGML 3IDJB 5BV7H 4D9RE 1YMME 3LKRB 4JQVC 3RVUC 3GGWB 3ZKMD 2GHWB 4QTHB 3LAFA 5T5NG 5I0ZA 4I8DA 3TJHD 3P4NA 4B53A 5AAMA 5IBLC 1F8TH 1WC7A 2X09A 5ALCH 4FZ8L 2DD8H 4ELKA 3ULUF 2R1XB 1CE1L 2OCFD 4YUEL 3DIFB 2H9GA 1IC7L 4JLRA 1ADQH 1HXYB 1DJSA 2CLRB 2WWKO 5IJVA 2NYYC 1SJEB 1TETH 5HHQB 2UY6A 3ARWA 3LZFH 3NH7H 1A7NL 1BQSA 4GKOA 4RQQA 4WCYL 5D5MB 3WFHB 4B0MM 3ULVF 3BD3A 4OAWA 3MLWH 3RZCC 1RZIB 2Z35A 3M8OL 3VH8A 5MHSE 1MQKH 5FYLE 1RZGB 5IB5B 3MQIA 4AQ1B 3BI9X 1Q8MA 1JYVA 1LP9A 5KOVC 2A6JA 4RCAA 1Q38A 4HLZG 4Z76A 1JWMA 4BZ2H 5T3ZL 3MRGB 1YEIL 4GMTH 3MFFA 1JYNA 5L9DL 3O2DH 4MD0B 2W0KA 3NFSL 4NUJA 1DQQA 3JWDH 4BELD 4JRYA 1T1ZA 4QT5A 1C16A 4NBZB 4Q9QL 3CUPA 5SV3A 4NNXA 2CGRL 1VFMA 4ELMF 4LSUL 1N7ML 1JHTB 5T3XL 1ZS8A 1D6VL 1JP5A 4RAUA 2H8PA 3BD5A 3NA9H 4OLZL 5BCAA 3HG1D 1T89A 1SM3L 4S2SB 5F9OH 5FA4A 1IAOA 1R3IL 1QP1A 5IESH 4I3SH 4ZUVB 3U83A 5I1AB 2NY7H 3ARFB 1OP5H 3MODH 1AR1C 1ZANL 3VXTA 1MH5A 2DJ4A 5IT2H 3D25A 4ZFZB 2XKUA 5EU4A 4AQOA 5B38A 3TPUB 1CQKA 2YA2A 3EOAA 2R8SH 1JJUA 1YEKL 4XVSL 4JO1H 3O4LA 3WSQL 3U0WH 4L4TE 1QNZH 1KJ2A 3QDAA 5TQ2H 4N0RA 4IEFB 4UDTA 4N9GB 2MPAL 3KPMB 2AXGA 1EEYA 1ZXQA 2OXGA 3U0TA 3RIFF 2IALB 1DL7H 2VXQL 3ZDYE 3GO1H 5F9JB 4AEEA 1A6UL 3CPLA 1XGQB 2J8UF 1MCPL 3KS0J 3W9EA 2B4CL 3VD3A 1KF9B 5E24E 4Q97A 4K9EH 3ISWA 3OAYH 5F3HA 2XNAB 3UXFA 4WWKD 4GG6A 1UH3A 4HHAA 1OP3K 5MEOB 4DGIH 2VDML 1O0VA 4I77L 5B4MD 1RU9L 2P43B 6FABL 4LAQL 5ILTL 1YNTB 3PJSA 4Y4HD 2R23B 3U0PA 5HGHB 3KPSD 4WFEE 4JDTL 2ICWJ 2FJGB 5DMKA 3ZE2E 1F3RB 3SGKC 1XF2A 2NMSA 3EYFA 3JUYA 2MQ0A 4M6OL 5TFSL 1Q9KA 3PV6A 1NBZB 4TUJB 1PGRB 3EFFA 2JIXA 2EDLA 2J8UA 3SGDI 2IH3A 2RR3A 1WZMA 4Z7VB 1T03L 1JV5A 3PDDA 5TGBA 1R5VB 1A3RL 4AG4L 2OI9B 4FA8A 5F7HA 3BPOC 2PXYC 2XA3A 4L8CA 1NAML 1CDBA 4FQ2H 5D2NC 3IFPA 3OXRB 4O5LL 5F97E 1QFOA 2OTWB 4OF3A 4BKLA 1A4JB 2HJFB 4PB9H 3QA3A 5HHOB 4JB9L 5FHAH 4X0KB 5E9DA 3ARDC 3MRNA 4FFVD 5FKPA 1UENA 5EUOB 4D0CB 1N64H 4WO4B 3QDME 1D5XB 1A4KA 3AXLA 2ZPKH 2H32B 5MHSD 1S7RA 5K9KB 3QFDB 1I7TA 3LMJH 3O6ML 1Z9SA 2EH7L 4OM1H 3U7YH 2YUZA 4MJ4A 3FOLA 4G8GD 5C0FA 4I13B 5E7BA 3KJ4C 2QLVB 4WHTB 3ARBA 2ID5A 3B43A 4H8WH 2X10A 4LOUD 4LLWB 1RULL 1VSCA 3ILPB 1T0PB 4MQ7B 1KPUB 2E7BA 1NANI 1XR8B 4HC1A 2GJ6D 1CVSC 3SDAD 3EHBC 2AK1L 3EJJX 4NCC2 1GCFA 3GJEA 3MRKA 4RX4A 1UWGL 2W59A 3P30L 2YEZA 2L4OA 3C6LB 3FT2A 4HIHA 2PYEE 5E2UL 3QWQB 3H9YA 1WITA 2HKHL 2ATKA 3SGDH 1V7NH 1X6NA 2BZDA 3NOIA 2CLVA 1TJIH 4KDWA 2ZNXA 3DX7A 1A1MB 1YYMH 2ADIA 4PJDF 4KTYA 4GQPH 4ZO9A 4ZUWA 4NQEE 4GMSL 1UCBL 3F12B 4QNPE 3S9DB 3LHPL 2VLKB 1KB9J 1WV7T 1IEAA 1OW0A 4JGMA 1CTNA 3VWJC 3AUVA 4GQ9H 4PR5A 3PGDA 4WUUB 4Y5VB 5GS0D 2E27L 1LO5B 5FECA 3QIUD 2W65B 3C5ZD 3HZKA 4BH8B 3TF7C 4NN7B 4E5XA 5J11C 4L1DA 2F58H 4QRQB 4RGND 2EYRA 2EDXA 2Q76B 3T3MF 5HGAA 5I66B 2ED7A 2OP4L 4MAUL 4F9LC 4K3EL 4PRHA 5I75B 2GAZB 4H1LB 5IHZA 4Y4KD 3TVMA 1HOCA 5GJSH 4TQEH 1OAQL 1FVCB 3BPOB 1I4FA 4P23C 1NAKH 2Z31A 4QHLA 3HE6A 1IEHA 1G7JB 4U7SA 1V3JA 1AD9A 4HD9A 4FZEL 1EGJL 4UUJA 5D2NB 2DKMA 2Y7QB 1MUJB 3NCEB 3IJSA 1CK0H 1YEFL 1NANH 2VDNH 5JW5B 1ZLUK 3REWA 1HQ4A 3ARDB 2IANA 1XMWA 5FKAA 3QDGE 1AY1L 3D39B 4HKBA 4RFNB 1L7IH 5EU6B 3JWNC 5DA4A 1G7QB 3MV7E 5A16A 4N0UB 2CXGA 1J1PL 4QRSA 3ULUE 43CAA 5GRJH 3BPCA 1UYWH 2ZUUA 4O2FB 4KK6C 2P5WA 2LAGB 4PJAB 4Q0XH 3Q0HA 1J1XH 2JB6B 2A83A 4I0CC 5B21A 5I19H 3VXQA 35C8L 1A8JH 4HIEA 3DVFA 5CGYD 3FB7A 1BGXL 3LV3B 4NN5C 2EDHA 2V7HA 2XA8H 5DJYA 5IK3A 4C58B 3QDMD 3GFUA 4XXCC 1N5AB 3LQAH 5I1KL 4XXDA 1JPGB 4LLVA 1P7QB 3GMRB 5HYEA 4FQ1L 2QQNH 3H9SD 5MERB 1KT2B 4NOBA 3LD8B 2BSTB 2QKIA 4YDKL 1OAZL 3U9PL 1KB5L 2XRAH 2LU7A 3O9WC 4NKIH 3LY6A 3MBEB 2ED8A 4NNPL 3TEUA 1NUNB 5DD6B 1PZUB 3O3AB 3AY4C 3SKMB 2CUMA 1AC0A 1JK8A 4F15C 4GW1B 1GZPA 4FFWC 5F6IC 3LN9A 5CD5C 4G43A 3VWJB 2H2PC 3NA4A 2E7CA 2HFEB 1XFPA 1QPPA 3GDBA 4ONGH 4DGYL 4H88L 3V4UL 1YEHH 4ZO6A 4WUKL 1DQML 4BSWB 4QHMA 1DFBH 3GIZL 2ZCKL 2PYED 5HGBA 5J11B 1WFNA 2HTKD 2GSIA 4NUGH 4JKMA 2DIAA 3KYOA 2VSCA 4ZNEE 2FSEA 4UIKL 3WL9B 1ZLWH 1Y18A 4JJ5B 4CADA 5E08H 4NQED 3FO1A 12E8L 3MCKB 4C83A 5DQDL 1TDQA 2DAVA 4M6MH 4NPYB 3NFNB 5HHNB 3PWPA 3RWHA 1RUPH 1LEIA 1N6QH 1UZ6F 4HWBL 1EMTL 4R90H 2NY3C 4GRWF 1GGIH 1ED3B 4O2CA 3ZYJA 3VXPB 1BQHB 5F1IA 1W0VA 3MMEB 4HAGA 1Z0NA 5M7QA 2WINA 3UTPE 5HDQL 5J1SC 4TPRL 1YZZA 2VDRL 2OZ4A 4NKDA 4X6EB 5DJ8A 3LEYL 3BIKA 4RNRA 2C3XA 1QR4A 3GSXA 4JHWH 2V5YA 4PRNA 5D9SA 3V4VH 4EDXB 1X5KA 1CFNB 5KANI 2E3VA 2A9NH 3EZJB 3M45A 4HWZA 3BDYH 1BVKB 1N26A 2LTQB 4K7PX 1E6JH 4P3CL 4YDIL 3E0GA 3WIHA 4ETQA 5J57B 3RVXD 1OARH 1FAIH 4NN5B 1YJDC 2BOCB 2CUIA 4HJJH 3I3EA 1HQRB 4UINL 4TNVF 4JKWA 5D70L 3TV3H 1VKXB 2DS4A 1K4DB 4MJIA 5KSBF 3MJ8B 4XPGL 4MXQC 4X7TA 4WTZA 4F37F 1KC5H 5IBUG 2XPGB 1B90A 1X4YA 5DFVC 5AG8A 4M03A 3ES6B 1ZA3A 2JJTA 3VFVA 4DJMA 5JDSB 1KBGL 3HMXH 3HLAA 2VSDA 4GKZB 3ZT5A 3MRFA 5DI8B 4PRBB 4F57H 4POYA 1RZFH 3L7FA 5ADOH 3DYOA 3QZWB 3VFOA 4F15B 1WBXA 2H45A 1I3VA 4XP4H 1WWAX 3DHMA 1BX2B 3ULVD 3JV4B 1I3RA 4NGHH 4CGTA 4YXHL 3WXVL 1JGVH 4K23H 4I48B 3WNOA 2G2RB 1MCFA 2IEPA 1QSEA 4U1LA 2XKNA 4JZOB 3WUWG