1LO2L

Retro-diels-alderase catalytic antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQVSIFCTSSQTIVHTNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVETEDLGIYYCFQGSHFPLAFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords If kappa light chain
publication title A structural basis for the activity of retro-Diels-Alder catalytic antibodies: evidence for a catalytic aromatic residue.
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 219
sequence length 219
chains with identical sequence X
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lo2L01
1RJZB 2YD6A 5EOQL 1OW0A 4HUWB 4O2FB 4JO4H 3MLXH 3MRCA 4J7RA 4JPWH 4NJAH 4LGRB 3RL1B 1FNHA 1LNUA 2E27L 1U8OA 3CX2A 4UI2A 3IVKA 1RUAL 5IQ7L 2H3NB 1K2DB 3FQNA 1G6RL 5L8LB 5ADOH 4LCWA 5DJ6B 3T2PA 1WV7T 4N9GA 4PRPE 2RR3A 2YZ8A 5DRZB 4PJXF 5L6YH 4JG0L 4GMTH 4Y4HC 1KBGL 4RFEA 4G9FB 3X3FH 1DLFL 1MHPL 5I16B 3O3BA 4ODTH 5FB8B 1N6UA 3S35L 2VXTH 1MHCB 1EVUA 1KENH 3QI9D 4JRXE 1FG2B 1F58L 3I02A 4UV7L 4ZFFB 5CEZL 1LK3H 1P7QB 4IRJB 3WHXA 1HE7A 1VEOA 4ZFGH 5I8OH 4NC2B 4UQ2A 3TO2A 1B4RA 5FEBA 4ZD3H 2HWZH 3ULVH 3R06A 4PJ9B 1P53A 5K9QI 3TNNA 2PYFB 4MNHB 4MHHI 4EUPA 3MRKB 1OY3B 1KLFA 3QG6A 3V4PH 5CJOH 5HGHB 5C0AB 3ARQA 4XPGH 3ARPA 2OM5A 3RKDC 3VFSA 3BAEH 2Y6SD 1UJ3A 1ZOXA 3DUSA 1JTOA 4PRNB 5MEOB 2WQ8A 3EYUH 4U1KA 5DEFA 3NA4A 1T80A 4MQTB 3B3IB 2V7HA 4OCWH 4IIQB 4IDJL 5SWSB 4M02A 5E95B 1MIMH 3D3VE 5JUEH 4OCYL 2GTWA 4LEXH 4OIAA 5D7LE 1IAIM 1SEBA 1QBBA 1O0VA 4M5YH 3P73A 5E4EB 4PRAA 5JORB 3CFIC 3P9MB 4WW2A 5EO0A 4BKLB 3GMPB 4NGHL 3VG9C 4PJHF 5H2BB 4I4WA 3T3PF 2B2XH 1Y0LB 5KSAB 3LAFA 1TTFA 5GS0D 5KSBE 2YPLB 1R3LA 4ZOEA 1OD7A 2NX5A 3VGBA 1AHWA 1YC8A 4KTDH 3QXTA 4RGND 1M71A 4NC1E 1T0NA 5HYQB 4HS8H 2L7UA 1TZHB 1RZFH 3DVNB 1B2WH 2ZKHL 3WCYA 1CD1B 4XXCA 5C08A 4HG4K 1DE4B 5DQ9A 4NKMB 4K9EL 2L7JA 2IG2H 1AGDA 4XI5C 5C0CE 4YNYA 4G6FB 4UDTB 4FMKA 4XPAH 4XB8A 3IXTA 1IGYB 5HYSB 4MJ5B 4AEIL 3PHQA 2QQQA 4HJJH 2IBZY 3ZTNL 2R0ZL 1S7UA 4FS0A 1K6QH 1A9BB 4P23C 2AJXH 4C54A 5B22A 5LCVL 3MJ6A 2GT9B 3UZQA 2R9HD 4Z7QE 4H26A 3B9AA 2AKRA 3MV9A 1T1WA 3OWEA 2O5ZL 2DBJA 2X9WA 3O9WB 1D5IH 3DETD 5EC1B 2VDNL 1YY9C 4D0BA 2AJ3B 5BZDA 3CGTA 3IDYB 1DBJH 1U8MA 4N0YH 1CDGA 2AJUH 4M7LH 4AENA 1QRNA 3WJJC 2QR0B 4N8VB 4E42B 3GIZH 2VSCA 1BF2A 4QRRE 4PJEA 1CVSC 2EDNA 2V2TB 4PJ7E 3QZWA 4CNIA 1Z6JT 4QRSB 2AXJA 1FO0L 4UILH 1FORH 1IAOA 1DUYB 3EYQC 4LSRL 5L2KA 4M1CC 5D1ZD 3ARBC 4LHUD 3C60D 2PETA 3K2UH 3TN0D 4MJ2A 1AGBA 2Y06H 3IDYC 1IE5A 1TQBB 3LMJH 4KXZH 3WS3A 4POZD 1XGPB 2UY7A 1ZEAH 2VZUA 3U36A 3V6ZA 1JPFA 1QNZH 5K59E 5IIEB 3S3JA 4PJ8D 1UC6A 4FFVC 4G42A 2WUCH 3QXDB 2A9MH 4XNQB 4C56E 4G9DA 4P2QD 4PJCE 2UUDH 4RAHA 1H3GA 4FQ1L 2R23A 3KDMA 5DQJA 3T0EE 5JPMA 3C8KB 4PRDB 1MI5A 3K74B 3IGAA 3BUYA 1GC1H 2KKQA 4JDVB 3CNKA 1LE5B 2BSTA 3HNSL 3PE9A 1Z5LB 4JO1H 1FPTH 3O2VH 1QFOA 3OHXB 1HYRC 2YWZA 1HHJA 3W0WA 4KI5C 3ZYZA 4WTWA 3IKCA 2XZCH 1UCBH 1D3CA 4I77L 2P45B 3S36L 1V7ML 3RWGB 5DD5L 4UNUA 1E4XI 4P59L 1C16A 5DMGD 3FFCE 4I0PA 4LASL 3MLVL 4FZEH 2W60B 2ZG2A 4HUVA 2PF6A 3TYFA 3OG6B 4S11A 5HHMB 3T0BA 4UU9A 3LN5A 3ULSB 3TBVA 2JJTC 2O5YL 4L5FH 4Y19A 5ID0B 2J8UA 5HY9A 1ORSA 2VLRA 2R4SH 4YDKH 5D7KD 5BW7C 5GGVL 4D9QD 1ZT7A 4TNWK 3QUYC 4Q6IA 3ZHLA 1VADA 3B2VL 5ISZA 1CK0H 3G5VB 3KLSA 3VCLB 2PXYD 1AD0A 2D7TL 3VFVA 3H9ZA 43C9A 4I2XA 4Q9QH 3D0LA 3F5WB 3GMMB 3ARWA 1N8ZA 2G2RB 1FDLH 3E3QC 3QULB 2Q8BL 3NIDF 1NBYA 3ZDZE 4PJ5A 3OKKB 1KB5L 3INUH 3CC5B 1NUFA 3JTSA 4OFIA 3A67L 5HVHC 1JK8B 4LSQH 4J1UB 4LIQL 4KK8D 4XVSL 2WSKA 2BRQA 4PJIE 1CFQA 5IOPB 3QRFM 2YN5A 2X05A 3S7GA 3FO1A 1VKXA 1T3FB 1NCDL 2FH6A 1KB9K 1KNOB 3KJ6L 4H20H 4ODHH 4LHUG 1VFUA 3FAXA 4CVXB 3S34H 3VXUA 2Q8AL 5HSFA 1OGAE 4JHWH 2QSTA 1DFBH 1IT9H 4QOKB 3VFMB 1LEIB 3KYNA 3CDCA 4F7MB 4QXGL 4Y89A 2R2EB 3KLAB 3LH2L 2FBOJ 1PKQA 3FQXB 3EBAA 3O6FB 5AZ2L 2DB8A 4AK1A 4GXVH 3GM0A 3VWJD 1T7VA 3H9SB 3WKML 3TIDB 4DZBB 5F1NB 1CT8A 1Q8MA 3E8UL 3BH9B 5E8DL 5IKCB 1GHFL 4P48A 5FAAA 4F9PC 1XF5B 1UWGH 1S8DA 4MA3B 4CU7A 3WJLA 1FG9C 1NFKA 4LLVB 4ODWA 3QQNA 4WHDA 5F9JA 5C9JB 3O0RL 5M7QA 4MXWH 5HGDA 2NY6D 4J8RB 3PDOB 3BPCB 1U8LA 1NANH 1ZVSB 2VYRE 3QIUB 4KTEL 5DEZA 5GRWA 2DQGL 3DX6B 1X5LA 3FMGH 5MP6H 3HRZB 3MRPA 1KULA 2BX5A 5CD5D 4QYOA 4XHQA 4PGBA 3TNMB 4DQOL 3LKPA 4MD4A 4RX4A 4BFGA 1GOHA 5A2FA 5ICYA 1I7RA 1H3XA 3AM8A 4JJHA 5HGAB 5GGTA 3PWPD 1ZLWK 2YK1L 3HB3D 3MRIA 3ZZ1A 4AG4H 2WWMC 2DI8A 2IGFL 3D48R 1A4KB 1KG0A 1PSKH 1G9NC 4FQJH 3TBSB 4ZQKB 5ALCL 2LABA 2XT1B 3UDWC 1LQSR 3LKQA 4OZFB 3SCMC 1I3GL 3HE7B 2VC2H 2EDBA 3RY5A 1LD9B 2CDEB 5IFHL 1RJLA 5GSRA 1IMHC 2X89A 4NWUH 4PLNC 1OAKL 3SDXE 1Z0MA 3DRTB 1BFTA 4NRYB 3QEQE 1H5BA 5GJSL 2RB8A 1U3HB 2XACC 4U4BA 3RNQA 2CK0L 4K7FB 4B5EA 5C8JA 3NPSB 1RJZA 4NNPL 4FQCL 4HUWA 4N8CL 5EBLB 5C2UB 4MJ6A 3RL1A 2VWEE 3S8WA 4DCQA 5IW1B 3X11A 2H3NA 4NZTH 4ELME 5C09B 1GGYA 5EULV 3PWUA 5I6XB 1X5YA 5HPMB 4YXLL 2NX5D 5TE7H 3NABL 5F70A 3SE4C 1EH9A 5DJ6A 2AEPH 3U9PH 1MOEA 5L8KB 3LB6C 2MCG1 3SGJC 1U3HC 2XTJD 3F8UB 2OJEA 1GPOL 4W6YB 1XCTA 5I16A 5D71H 3HNVL 5C08D 2HYMA 2NQCA 1U93B 5FB8A 1MHCA 4DVBB 1L0YA 5DJZB 1FG2A 4LGPB 4KDTA 1MCKA 4PTUA 4IRJA 4U33A 3FKUS 2GW5A 1HHGA 4JCMA 1K8DB 4HF5L 4I0CC 5JA8B 3VD9A 2CMRL 2R15A 2GYSA 4XNUL 5KVDH 1A1NA 3CLFL 2PYFA 5C0JB 4MNHA 1W0WB 4KDVA 4XNXL 1ZVHA 4JGJA 4WCYH 4XTRC 1J10A 2FX9H 5J9PB 3MV9D 3UTTB 2NY0C 5HGHA 2QV2A 5C0AA 2ED8A 1S7XB 2ZCLH 4G43B 1G0XA 1EV2E 4K7PY 2NY3D 1MFNA 4Y2DA 3OKDB 3RGVC 4MA1C 3JUZA 4LBEB 4X5XB 2P48B 4LSPH 2IANB 1U36A 3WFEH 2XKSA 4TNVK 1G7LB 1G6RB 3BKYH 4YDIH 4FQIH 3QUZA 1SBSL 1P2CB 5FHBL 2LU3A 4JO2L 5IBTH 2XG5A 2BCKB 2CRZA 2VLKB 2DOCA 4BZ1H 2FYYA 1KCVH 1MUJB 5JORA 3JV4A 2P42B 2IH3A 3H9HA 3P9MA 4PLJD 5L2KD 4V1DE 1KTDA 4BKLA 4DVRH 4AQOA 1Z9LA 1Y0LA 4N1HB 5KSAA 2F58H 4JM4L 1JCKA 3DROA 5SX4I 2BHUA 2QTEA 2YPLA 1AQKH 1U3YA 3JTTB 1XGTB 4DN3H 4IRZL 1BOGB 5D2LF 4D0CB 2P4AB 4FNLH 5HYQA 3F7VA 4LOUC 4H88L 2Z4QB 4ZUTA 3DVNA 4IS6B 4WI2A 3P9LB 1MI5D 3QO1B 5E1AA 1QFPA 1OAXH 4YDJB 5E2UH 2XWTB 5DWUL 1I3VA 4JGMA 5KSVB 1LILA 4B41A 4KRNA 1T66C 5GRZA 3SE8H 2R4RH 1C12B 2MMXA 5KAQG 2HH0H 4PJGE 5C92A 4OF5A 3W0WD 2BDNL 1HK6A 3VXME 4AIXA 4KWUA 2Z0BA 1GAFL 1N2RB 2GT9A 1QSFB 3OJ2C 1OCWL 5C07A 3RHWK 2CO6B 4PRHE 2FL5A 1RURL 3PJSB 1BZ9B 3I6LE 4PB9H 2ADFH 3O9WA 2BSSB 2W9DH 5DYOB 1D5BB 3K8MA 3L95B 4LLDB 5EC1A 5TDPA 2E7MA 3LPWA 2D9QB 3GSOB 5IB3B 5E6YA 2AJ3A 1CE6B 3GFUA 4BQBA 4Y19D 5IK3A 4S1SH 1RHHB 4Y16A 3UJTL 1G84A 1SY6A 1J8HB 1OM3L 3BN9D 4ORZC 4LARL 5IM7B 1T89A 4CRPA 1ZHBB 1S78C 3QT2A 2R8SL 3PUCA 3S9DB 4YX2L 4YBLB 3PF2A 2GFBB 5CUSL 3UPAA 1KELH 1L6XA 4NCC2 2YUWA 5IJVB 1YMHA 1A6AA 1DUYA 2DLIA 1SJHA 1FLRL 1EEZA 2Z35A 4F57L 3T08A 4PJAE 1M1SA 1AR1C 1Q0XH 3WL9B 3DIFB 1VERA 4X6CE 1NGYB 5BV7C 1XGPA 2G60L 1JFQH 4AZ8A 3HPLB 2ZSVB 5DSCB 5IIEA 2DQJL 4XPTH 3VGGA 1FFPB 1I8KA 3V6OA 4NFCA 5BMFH 1U9KA 3S37X 5IR1B 3MMEA 1ED3B 4EI5B 3C8KA 5IEKA 4WW1B 3KPLA 4R6UA 3HMWL 3OBAA 3T65A 2ADJA 3EO9H 1NGPL 2P44B 3EIFA 4JDVA 3EYFB 4HWEH 3P3YA 1LE5A 1Z5LA 1F4AA 4NJ9H 5I76A 1NPUA 3NIFE 3FQUA 4U1GB 1E4XH 2X5PA 4NIKB 2AJSL 3RWCB 3MRMA 3SEPA 1EO7A 4JFHD 1FZKA 1KPVB 2QBWA 1WZ1H 1U3JA 4IOIB 4O58L 1AXTH 1FO0B 5E8OB 3REWB 3QUMH 1CICB 2W60A 3JVGA 4PRBA 1CLYH 3JWOC 5ICXB 4WHTB 3NH7L 3GNML 4GKSA 5IQ9B 1WCBB 3MRJB 4G6KL 3EDKA 5ID0A 4JB9H 4U1GC 2BSRB 2EDOA 2LQRA 3F58H 1OAUH 1XGQB 2BC4A 5HDQL 4XMPH 2VZ3A 4RX4D 3G5VA 2PYEB 4R4FH 2OMNA 3UAJD 1KCRH 4E5XB 3GMMA 4MCYA 6CGTA 4RGNE 2JKXA 4N1CA 3QULA 1IGIL 4PUBL 4OTXH 1ZGLM 2EKJA 3OKKA 1LWRA 1I1AA 3CC5A 4GRLA 4KUCF 4WTXA 4L3EB 2R2HB 4WJ5B 1JYWA 2CPCA 4NYLB 4E0RB 2VDKH 1T3FA 4GKNB 3MLSH 1UVQB 1JF1B 3ZE0E 5J4MA 5CWSB 2X89D 4KK5D 5J57B 1UJ3C 3D39B 4YHZH 2NY1D 4CVXA 2G5BB 2BVEA 1R3IH 1BFVL 4K2UH 4HGMA 4Y4HD 3W39A 4XVUD 2VO5A 4WWKB 3VFMA 1HIML 4M1GL 5FFLA 1LEIA 1M7XA 1BGXL 4LP4A 1F3RB 4Q2ZA 4F7MA 2OI9B 4OUUB 3N1GC 4NQCB 5HHPB 2DQHH 3MLWH 3RFZC 5GRXG 4KI5F 1CZ8H 1NCBL 3SDDA 1D9KA 5TF1L 2YN3A 3OZ9L 3QBTB 3HC3H 2FR4A 5C2BH 4WW2C 5IKCA 1MCOL 3W2DL 4JFXA 1IQDB 1ZA6B 5EUOE 1XF5A 4DEPB 2C3WA 4MA3A 1TETH 2VXSL 5E08L 3VG0H 5C9JA 2C4XA 4NCDA 4G9FD 3MODL 1JHKH 4TTDD 1T03H 1KB5B 1TVHB 4J8RA 2AQ1A 3BPCA 4NSKB 3L3IA 3QIUA 4JG1L 1OSPL 2L4OA 1DQJB 4PGCB 4L1DA 1P7QD 3TCLB 4IRJD 2VN7A 3FZUD 3MGOB 1W8NA 1IKFH 3N1FC 3LEVH 3PDGA 3TNMA 5DUPH 3RAJL 3ROOB 3ZYIA 1WFOA 4PJ9D 2X09A 3SDCA 1UM6L 3BXNB 4LCIL 2GIYA 3BZEB 1AGFB 5HGAA 1JL8A 5EBWA 2OR9H 1A7RL 4P2QE 3OKEA 7FABH 5D7JA 4MNQB 5EFIB 3TBSA 4ZQKA 3UJJL 5L88H 5T33L 5JMRA 3HE7A 4PJXE 2J6EL 4KK6D 1DBKL 4WI4A 1A14H 2PR4L 1CFNA 4M62L 5HDBF 2XZAH 3LQAH 4HAFA 4NN7B 5SWSD 5J6HB 4XXDB 4KK9C 4QRUB 1YEEH 3AMKA 3KXFB 3DRTA 4GS7C 3CSGA 2A6KB 4HCRL 4YHKH 1NBZA 4K7FA 1ZHNA 3CVHH 4PJFE 1F2XK 2EEBA 2NYYD 4KJWC 5IHZB 5J89A 4OLXH 3REVA 3S4SA 1LO2H 3MA7B 1YEKH 4EDWL 1KYOJ 3B9KB 4XI5D 5DO2D 2R2BA 4AEEA 1FV1B 1BWWA 2FEEI 2ZCHL 5KSAD 3IJHB 4NZUH 1MIEH 1V7NL 5FM5O 3WFBH 4Y0GA 2YPLD 1B0GB 2CKBH 2OL3L 4XNYH 5HPMA 4JPVL 3ORJA 3LDBC 5DQDH 2ENYA 5D7KE 5JLZB 4N8PA 5DT1H 1EMTL 4JLRB 3FO9B 2DLTA 3UBXB 4NFBA 4IDLA 1UM5H 1BD2A 1YUHA 2P5EB 4TVPD 1BECA 1U93A 3F7YB 4X9BA 4NJAL 2D0GA 4DVBA 4U7KA 3AREA 4L4VA 5DJZA 4YJZL 2VQUA 4G6FD 1P84J 4HC1H 3LIZH 2F8XC 1JGLH 4HXBL 4DGVH 1K8DA 2BXZA 1EAPA 2N1KA 4RGOH 4HS6A 4XMKL 5ESVA 4PJHE 2C1OB 3T3PE 4WFHD 4G3YH 4RGMC 5C0JA 1ZS8B 1RK0A 1NCTA 3ESVF 1W0WA 3Q3GA 3DPBA 5EO1A 4AQ1B 4LSSH 3O9WD 3O2WL 1KENL 3QUXC 4FFZL 4DK6A 4FQ2H 3QFDB 6FABH 1Q0YL 4LBEA 1T20A 1J86A 4KRLB 5FF6A 4EN3B 4Z8FL 2HKHL 3CFKA 3FFDB 1G7LA 4KUCD 1MCRA 3HE6A 3TPKA 3UYRL 4OB5L 2XPGB 5DK2A 2HVJA 3W82A 2VDMH 1IC7H 3HNTH 4Z95L 2VXUH 1QFUL 3RI5F 2VLKA 3S5LG 2VR4A 1KCKA 5GRVK 4XRCA 3NAAH 4F33B 1A7PL 4G6AC 1ND0A 1MUJA 1X5JA 4YHMH 5F7MC 5FGCE 3BZFA 4J2XA 1F5WA 4HV8B 5JW3H 4U3CA 5I1IH 1KC5H 4YR6A 4OLZL 4JE4B 5FO9B 2BMKA 2NNAB 1Z3GH 3DSFH 5DD6B 5K9OA 5LWYL 4MVBC 1XGTA 4KI5D 4PREB 1CN4A 4XBEL 2R29L 1FNGB 2G9HB 4D0CA 4OKVA 1K4DB 4U6XB 2Z4QA 5E8NA 3NCJH 1F42A 5FUZL 1RZJH 1C08A 5DLML 4XPFH 2AJYH 4U1JB 4ZOCA 3NTCH 3A6OA 1DQQA 2XWTA 4KAQH 1P7KB 1NC4B 3CUPB 3B9DA 5KSVA 5GSVB 3PWPE 2B4CC 3IJSA 2B2XL 1OTTD 3C5ZB 2EYSA 5D5MB 5ERWB 4HKZB 4MB5A 2OK0L 4NNYB 4JDTH 1G7IA 5HI4C 2A77L 1YDPB 1I85A 5SX5K 1DBML 1CDCA 2VQTA 5D6DA 2X4QB 5E4IA 2DLFH 4FQHA 3Q6FB 1SEQL 3WIIL 1HEZA 2A74B 4ZPVB 1MFEL 1BZ9A 1GZPA 2HT2D 3BWAA 3D87B 3O4LB 1NAKH 1S7SB 5IBLD 5EA0H 1QPPA 3EOYG 1ZGLA 3G6AA 1I3UA 4NKDB 3GSOA 5IB3A 1E27B 5HHMD 4NQXB 1MFAL 3C5ZC 3RVXC 4KHTH 1XIWB 1CFVL 3G5ZA 1MRFH 3T0VA 5IHLB 2NY2C 3EYVA 3VI3F 5IM7A 3MGTA 1AQDB 4X4YA 1MH5B 3NCYS 3LEYL 4E41A 4PP1D 1KIQB 2BNQA 1OTUC 4QHKI 3A6CL 1A5FL 2LV4A 4Y8AA 3KS0H 2NX5E 4K8RC 1T5XB 1ZANH 2X1QA 1VFMA 5AYUH 4N8VG 2XTJE 1MCJA 3LN4B 3QIWC 4K3DH 1DBJL 3T2QA 4N0YL 4PRIA 5C08E 2EH8H 2AJUL 2Z31A 4O2CA 2J5LC 4K3JL 3BT2H 3CZJA 5EOCJ 3AM8C 4GRWB 4K7PX 3FB6B 5T3ZH 5D72L 5DSCA 2FSEA 1JP5A 3DMMA 4YGAB 4DKDC 1E4WH 4OJFL 1AR2A 1GZQB 1ACYL 4JM2A 3RPKA 1ED3A 5I1JH 2H26A 4EI5A 4WW1A 3T77B 1QBLH 2YXMA 4JFOB 5LQBL 4P4RA 5CP7A 3DGGB 2EDLA 3M1BB 3HZKB 4U6HB 3EYFA 4JKWA 1VGKB 4KY1H 4LVOC 4QOKD 2FEEL 3K2UL 1BQLH 2I26N 3FOMB 3MV9E 1A2YB 3LEXA 4RAVB 1L9MA 3EAKA 3RP1A 1TQCC 4KROC 1MCBA 3QEGH 4DAGH 3NIDE 4UUJB 5GRVL 2OTPA 3O6FD 5DA4A 1A7QH 1JZ5A 1KPVA 3H9SD 1HHIB 1R24A 2Q7YA 1F90H 4ORGB 3CMOL 4IOIA 1U8PB 3UYPA 1A6TB 1QVOB 3REWA 4HK3J 5E8OA 5ABDE 4KZDL 1GC1L 1WT5C 1CICA 3MREB 4X4ZA 2O5XH 5DEGA 2G75B 5HI5C 3H6JA 3DI3B 5ALBL 2E7BA 2QKIB 3G08A 2ESVB 3AXLB 2ARJA 5IQ9A 1WCBA 3MRJA 4HK3N 4OSUL 5IBUB 4LDEB 2WIIB 3QIUD 1EO5A 1WC7A 3MR9B 5I66B 5L2KE 2BSRA 2XNAB 3RTQC 1R3JA 3LSOA 1U8HB 4ZNEA 3QQ4B 5HD8D 1XGQA 1MCEA 1IGTB 3PWJB 1MCWW 3QHFH 5DC4B 1ZT1A 4UINL 4KKCD 4UT9H 1VESA 3FRPA 1A47A 5C0RH 3U9UB 1MI5E 4M9PA 4J3TA 5HHOB 4GXUM 2R2HA 4M00A 3HE7D 4NHUA 4OLYL 5I8CB 3SKNB 2DQDH 4KKAC 4G6ML 4MS8C 3Q0HA 1T2QL 4NYLA 1OQXA 4E0RA 3HFML 1P6AB 4GKNA 1IVLA 1UVQA 1JBJA 3HR5B 1XF3B 3SE9H 5CWSA 2ATPB 3PABB 5HYFA 2KL6A 4Y2DC 3W0WE 2MCPL 4P2RB 3DV4B 1U3HD 1E28B 4PGEB 1JNLL 1EO8L 4RFOH 3SGKA 4NN6B 1QLRA 3TBTB 4U1NA 4X7EC 5EZLA 4GG8A 5I1HL 2BNRA 2DRUA 5IHUL 2B20A 3NFSH 1A0QL 4UB0H 4J3UA 3MGAA 5TF0A 3VH8B 4OUUA 3M8OH 3LS5H 1DR9A 3ZE2F 3TH4T 5C09D 4Y19E 4N0UE 3GGWB 3MUGB 1TENA 3TJHD 3BPNB 5IEHA 1MFCL 2VLRE 4LRNH 2UWEA 1MFBH 5A43C 4OF7A 1JGUH 2CIIB 3MNWA 1K5NA 1X5KA 3VXNB 2GUOB 4JHWL 3WLWC 4CN6A 1RVFL 3MRFB 1AP2B 3MJ9H 4OZGB 1KB5A 1TVHA 1BBJB 3HN3A 2J4WH 3MRHB 4NSKA 1R0AL 1SYSB 3RVWD 1LO3H 2VDQL 4ONGL 4WHYH 4PGCA 3RWHA 4ODXB 4R97B 4GG6A 4Y4KC 2GITB 1RFDH 2WLYA 3EHBD 3MGOA 2EIZB 5C0DB 4X7TB 3G6DL 2CH8A 5E0QA 4WNQA 3K4DA 2EZ0C 1AFVH 1CR9H 3BZEA 2V9TA 1DBBL 5L7XL 4APQC 5IMKB 1MJUH 3MLYH 1E6OH 5DJDB 2NXYC 1A7NH 3UTTD 2PCPB 3THMH 1QSEB 4YO0B 1XGRA 3VD3A 1I1YB 3W81A 2EDWA 3LRHA 5EFIA 5TDNB 3QCVH 4EI6A 3EJZD 1IL1A 3GI8H 2IAND 4N9OB 5DMYA 3QPQC 1MWAH 5J6HA 2EDDA 5FYJL 2M1KA 4QHLB 1GRWA 1MVFA 4QRUA 5DHYA 4ODBD 1N6QL 2X40A 1J87A 4JFHE 3I50H 1IM9B 2VLKD 5IB2A 2A6KA 1HKLL 3MUHL 2PUQT 4Z5RB 5EPMA 1J18A 4ZDHB 1PG7L 5IVOA 1PSKL 2QQKH 3IJYB 1X4ZA 4FQJL 4MQ7B 4HKJB 4C4KO 4JN1L 2VXQL 2XXCB 5HI3C 3DHJA 1ZTXL 4N90E 1FV1A 5JXEA 5CEZD 4P9HL 3IJHA 3DYPA 4L8CB 4R9HA 3NA9H 1OP9A 3BGFB 1L7IH 3GMLB 4YH6A 4FQQB 5B3NA 3WSQL 2KH2B 5TE4L 4NWUL 2YPVH 1FIGH 4EIGB 2CLVB 3IF1B 1FZMA 4PP2B 4FABH 1KN4H 5JIKA 3H3BC 4DGIL 3FO9A 3QNZA 3U6RB 2GAZB 4WY7L 1H0DB 5C0GB 3F7RA 5TFSL 4NKIL 1PQZB 2P8MA 3EOTL 3KYKL 4L9LC 1UB5B 4H1LH 2AQ3A 4LLWB 3BEWB 2AABH 2DM7A 3PP3H 4ODSH 3UPCA 2ZCKH 4S1DD 4TSCH 4XT1C 1S78D 1F4YH 4JPKL 1NCCH 3CXHJ 5FUCC 3BYTA 4IJ3B 1QSFD 4R0LC 1RIHH 1TFHA 4U1LB 4A6YH 2NTFB 5JQ6L 1A9EA 4XBPA 2A0LC 4O2EA 5HGBB 4LQFH 5D2LE 4LCCB 3M17A 4GKOA 3DO7A 3FCTB 2F74B 1EVTC 1CTOA 1RULL 5IVXB 1AR1D 2AP2A 4Q6YA 4EN3A 2XPGA 1J8HD 3CMGA 2PTUA 2HLAA 4FXGA 2Y5EA 2FX9L 3RA7H 4F33A 1LEKB 3RY6A 4X6BB 5J3HC 1NDGA 4O9HH 2MQ3A 5CJQH 2F9BT 3IFOA 4R4BA 4X99B 3I9GL 3A6BL 4R26L 4EVNB 4F15B 3WFDL 2I07B 4YHIB 4HV8A 3KHOA 1HYSC 1U3ZA 1U8NB 4IHOA 5KTEH 4FQLH 5DJ0B 5FO9A 5HBBA 2JELH 1S7WA 4R7NA 4TOYL 4XB7A 3RPIB 1D5MB 3R4DA 1MSPA 4YDIL 5DD6A 3BP7B 2VJXA 3GSWA 2ICCA 5D7SL 4I18B 4PREA 2VOTA 1FNGA 2DTSA 1U2HA 4GBXC 4YFLF 3O3AA 5KVFL 3OPZL 3KPTA 4U6XA 2OSLB 2WWKO 4EI5D 4RSVA 3EZ8A 3VE0B 2EDEA 4R8WH 4U1JA 1ADQH 4GW1B 1AC6A 1QO3B 1I9IH 3VXQB 1LDPL 3IDGA 3QFJA 1NC4A 3BE1L 3GIVB 2HTKC 4JFZH 5ERWA 5D5MA 5C0AE 3RL2B 3H42H 2IQ9H 4AMKH 4M43L 1YDPA 5I8KL 3EYOA 3TO4B 4M8QA 5F7FA 4I18C 3C5JB 2FB4H 3OKNB 3TBYA 2X4QA 7CGTA 2WLZA 1MHHB 2YD7A 5SWSE 1N5YL 4ZPVA 1HHKB 3BD5A 1S7SA 3GSVA 4S0TD 5ENWB 1JPGB 5EZOH 5BS0A 1CICD 5F7UA 2SEBB 1LK2B 4NQXA 5C0IA 2EIEA 2WZPD 4M48L 5I1GH 5DS8A 5J0BA 2HH0L 1PY9A 1HH9B 4ETQB 1XIWA 3ULVC 1OB1B 5BVPH 5IP4A 3UTSB 1TJGL 1AQDA 3P0VH 4X83A 5DMJB 1OAYL 1L6ZA 4Y1AB 3D85B 1KIQA 1FBIL 1YQVL 5GXBB 2CD0A 2EXWC 3IRPX 2YPLE 1EZVX 2PYED 1Q72H 4Z18A 1KCLA 2EH7H 1QG3A 3WNKA 4K7PH 2AXGB 3L6FB 4XP5H 4HAGA 5HTSA 1EHXA 3OGOE 1B0RB 2CLRB 1W72L 5SV4A 4MQXC 3LN4A 4LCYB 1UQSA 5IFAH 5TE6L 2OCFD 4LMQE 4WEMB 2DM3A 5CHNA 3SDCC 4B50A 4L3ED 3S3PA 1OTSC 2NXZB 1QR4A 4MA7L 5L8JB 4YDVB 3V4VL 5I1CH 5JHDA 3CU7A 1WWAX 3SOBL 5J1SC 4K3GA 4U6VH 1CXFA 2BY1A 1URLA 1FCCA 5F9WB 3U4BH 2VZTA 5KJRL 3D39D 3QG7H 1HXMA 4RA3A 4JFOA 3EFFB 4WFHE 4CAGA 3GKWL 3M1BA 1I8MB 3HZKA 1B9ZA 2EDRA 4U6HA 4YC2B 1INEL 1M05A 1R3KB 5I1KH 5DD1L 3OGCA 5F1SA 3QNXB 4WWKD 2LU7A 3VMOA 3V5DB 4OQTL 1F00I 3FOMA 3JWNC 3RKPA 1A2YA 2APWA 4LKXB 1T1YA 4XVTL 4FRWA 1ZA3B 4YBHA 4NQCD 2APVA 4UUJA 5E94A 4IRSB 3V8CA 1TIUA 3KLHD 4QTIL 4BSWB 3KYMB 4ORGA 2EECA 4K55A 4PPTA 4P5TC 1U8PA 4UTBH 1SVZA 1A6TA 1N4XL 1QVOA 4UT6L 5D2NA 3O8XB 4NWTH 1R3HA 3HPJA 2QL1A 3JXAA 1DQDL 2G75A 2OR7A 3CFEA 4GAYB 1FQ9C 1NGQL 4X98B 1MQ8A 5D5MF 4S1RH 2Q86A 4P4KB 3D9AH 3MR9A 5I66A 1MQKH 1Q94B 2YKLH 4NZRL 1U8HA 4HX1A 3QQ4A 3MCKB 3IDNA 1MHEB 3BDYL 2FHBA 1SMOA 4PGDB 2HT4C 4RCAA 4DKAA 3SQOL 2ATKB 3OJVC 1RMFL 4KI5E 1V3JA 2FLRT 2X9YA 2H2PD 4ZNCD 5ICZB 3BYYA 2VLMD 3V6OE 2ZPKH 2Q6WB 3ILPB 4KJWD 4RFNB 2VITB 4ZS7L 3N9GH 3DXAB 1NFDB 1BREA 3OJDB 5D7IB 4MNQD 3VA2C 1S7VA 4O5LH 3MNVA 5I8CA 2A2QT 2AGJH 1MFDL 2WV3A 3O81A 4JRWA 3SKNA 1A7OH 4HWBH 4OQ1A 3VFRB 3GJFH 1CDIA 3HR5A 1XF3A 4RA0C 2ATPA 3ET9F 2CRIA 4MB3A 3PABA 2D31A 4F58L 1FN4B 3KXFD 1MEXH 1ZHKB 4GSDH 2F5BL 1E28A 1KT2B 3MBEB 1QQDB 5GGUB 3P0YH 3TBTA 3P4OB 1ZKAA 4KUZL 1C1EL 3BP5B 1NLDL 3VXOB 2Y9RT 3B9KD 5CILH 4ZS6D 3E3QE 1R5WB 4G8FB 4GRWF 3VH8A 5C70A 3NIGF 5HHME 2FEDC 1HZHL 2VDKL 2UYLA 4PTTB 4K71B 1QEWA 3MUGA 1OAZL 5FUOH 4QXUH 4WHCA 1ULVA 4XC3H 4YHZL 4HZLA 4QCIB 2Q76B 5E6IC 2DAVA 1NGXB 4O02H 2XZQH 1H8NA 4ODVH 2CIIA 3VXNA 3GSRA 1YYLH 2GUOA 1PEWA 5HDBE 5T5NF 1F3DJ 1IFHL 2ORBL 1AP2A 2P5ED 4WEUD 3SPVB 5GZOD 4K23H 3BSZH 3WUWG 2ZOLB 3MLRL 2P49B 3CCHB 3O11B 2XRAH 1SYSA 2VDPL 1C5CH 4ODXA 3FOLB 2GITA 1JPTH 1TJIH 1QKZL 4ESKA 1FFQA 2EXYD 5C0DA 4K71C 3L3OB 1IKNA 5DVMA 2E9WA 3E6HA 4HWZA 5LAXB 2Q7NA 5AYQA 4YQXH 1IBGL 5IMKA 5DJDA 1RAMA 1CFBA 3TWCL 3ISWA 3P30H 2PCPA 1QSEA 2EO1A 1T7XA 4HUUA 1UXWA 1I85C 3MYZA 3P0GB 5JO5B 1QA9B 3QJHB 5D70H 3PGFL 3AY4A 5FCUH 2DTMH 4XP4H 3O3DB 4RWYH 4QOKE 4EN3D 3QCUL 3ZT6A 2FHFA 3ARFB 3C5SA 1KGCD 2XIDA 3LPFA 1S9VB 1LP9B 3GSXB 5DZLA 1EHLL 2MJWA 2HKFH 5E5UB 4BA8A 1YN7B 1IM9A 3H9SE 1B3JA 2WBJB 3FN9A 4YE4H 1ZAGA 2I60H 1HDMB 1GL4B 4UIKL 4L3CB 2ERJB 2NZIA 3I6KA 4HKXA 3GB7B 5C0NC 4NZDA 2LAAA 3MJ8B 4UTAH 2MQCA 3LD8B 5F7WC 1MAML 3WYRA 2CUHA 4S1QL 4ONFL 1FH5H 4FQQA 3CD4A 3PWNB 5IT2H 3IAGC 2WW8A 3P4NB 3IF1A 4PP2A 4DUVA 4JDZB 3RWEB 3IFPA 2WBJC 3HLAB 2Z31C 3U6RA 2GAZA 1FYTA 4PJDA 5C0GA 4E9LA 1T21A 5EORL 4OGXH 1MREL 2C4FU 1PQZA 3RNKB 3IETB 5CZXC 4JQVC 2ERJC 2Z92B 1NC4D 4YIQB 1UB5A 4LLWA 3C5ZD 2J6EA 1M7IA 3ALPA 3BEWA 4MJIB 3RVXD 4JM2C 4P46B 5C3LD 1GGUA 2XKNB 1NL0H 1TLKA 3WIFA 3UBXG 1HOCA 4X9GA 1G9MH 1DVFB 4UOW1 4X5WA 4L1HA 5D1QB 2VQ1A 2DI7A 1KJ3L 1HSAB 4HCRA 4LPWA 1Z9SA 1RK1B 1UM5L 2NTFA 4OT1H 3O4LD 4D2NA 5GS0H 4MSWA 4OZGF 1H15B 3X12B 5CINH 4LCCA 4GMSH 1NEZA 2R39A 4N68A 4OFYA 3FQRB 1UACH 4GQ9H 3SJVB 1GGIH 4M6ML 3RHWF 5IVXA 1J0KA 4P46C 1XIWD 4XCCL 4WO4C 1MNUL 4GOSA 1QYGL 2OL3A 1WBYB 1J1XH 1DVFC 1CQYA 4IBLT 1P1ZA 4OLEA 4ZUWB 4LSTH 4X6EB 1GJIA 1SHMA 3RWDB 2DWEB 3I85A 5F9AC 4L4JA 4OIIL 5C09E 3WDJA 3R1GL 1MCHA 1KTKE 1LEKA 3S88L 4OLUH 4KC3B 2B5IC 5I1DA 1B6UA 1T83A 4G80B 3O6ML 4X99A 3MTRA 2B1AH 4EVNA 2NLJA 4QLRA 2KUTA 2I07A 4YHIA 4Z7OF 1YYMH 4QRQB 2UV3A 4D3CL 1U8NA 1RJYA 5D8JH 3V6BR 4J4PC 5DJ0A 1JGEB 3F65A 4KJPD 4HMEA 4Z7UB 2H45A 4LLQB 4RIRB 3GBMH 3RPIA 4PRPA 2K9UA 4LCUB 4QXTB 3OAYK 1CG9A 1DBAH 4L4VE 5I74B 4JQXA 1Y6KR 3HNTL 3PNWB 4WV1A 3S98A 4MNGB 4KQ4L 3G5YB 3ROLB 1IC5L 4UZGA 2JE8A 5DD3L 2OSLA 3BGMB 3VE0A 3VI3E 1C5DA 1UM4H 1CTNA 3VXQA 3TA3A 1MRDL 5GJTL 3BEVB 3PV7A 2AXFB 4ZYKB 5SWZB 4XVJH 2E6JA 3JV6B 4EJ1C 3UTTE 5FOBB 1B4JH 4NHCL 4PB0H 1LE9A 4I9WD 1QLEH 1CIUA 4KZEH 3TO4A 4B53A 2OS7A 2HMIC 2IANE 3FQWB 4KMLB 2VDRH 2OP4H 1MHHA 3AAZA 3QIBB 4R2GB 4POYA 4R4ND 1HHKA 2ID5A 3KVQA 4KAQL 1JPGA 4LAJH 2SEBA 2HFGH 4ONHA 1LK2A 2QHLA 2VLKE 4KQ3L 3ZL4H 2W1NA 2ESVD 2MOVA 3C9NB 4I3RH 1T6WA 4PY7A 5D7LA 5KZCB 2R0LH 1HH9A 2BVQA 2QSCH 2J3SA 2ICWB 1N3NB 1YEJL 4UV4H 1FZJA 4W70A 5CEZE 1AKJA 1QZ1A 5T1DL 3U4AA 2ZJSH 5I75C 4N0FA 1WK0A 4XH2A 1NAKL 2IFFL 4GAGH 5CZKA 4OM1H 3L5XL 1Q9LB 2CLRA 3LCYA 3I75A 5C7XL 2C26A 3S3SA 5IVXF 1HWGB 4XP6L 4IMLB 3CPLB 3QDHA 5HHOD 4ZAKB 3CH1A 3RVVD 2XQYG 1NAML 4YDVA 2MPAL 2R1WA 3KLDA 1DL7H 1REIA 5BJTA 1XCQA 4RBPH 4XCFL 5DJCA 1S7RA 5DHVA 4WFFE 3BQUA 4P2RD 5IESH 5LGHH 3BKJH 1R3KA 1QSFE 3S37L 3V5DA 5IMLA 1VPOH 1OP3H 1A3LL 1FE8H 4Z76A 4QGYA 2H8PB 3ARGC 4F9LA 1CGVA 5F6HJ 3G04A 1AE6L 2R56H 4BSWA 3KYMA 12E8H 4BH8A 4EKXA 4YBQC 1NCWH 1J8HE 1RZKL 5JXEC 1BPVA 1T7ZA 5DUBA 1FFOB 2DKSA 2DQUH 3V95A 4CMMB 4D9RD 1JZ8A 4X98A 3BW9B 2JK5A 3BMWA 4DAGL 2R1XB 5JW4Q 4PV8B 1YEHL 1G6VK 1KEML 3EO1A 3QPQD 3MCKA 5FO7B 2AEQH 2APFA 1MHEA 5I18L 1EEYB 1DQLL 4WTZA 2IBGA 2I25N 3LS4H 4LNRB 2ATKA 1JN6A 4PLKC 2DDQH 2GEEA 1BAFL 5IBUG 3ZE2E 1S5IL 2E6PA 2Q6WA 3ILPA 1QSED 1NMCB 4P2CG 3JWOH 1NFDA 5FKPA 4BFEA 3OJDA 4C56A 4PJCA 1DP0A 4HIXL 1OF2B 3MJ7B 4L8SB 5A16B 4OFKA 2O61A 1YJDL 3IKKA 4UQ3B 4NO5B 1CLCA 1WEJL 3VFRA 4ZFOL 4LEOA 1X5XA 4AL8L 1TDQA 4OFVA 3QRGL 5EO9A 2P7TB 4XWOC 1IM9D 4UT9L 2Z8VC 4JZJB 4R7DB 1G0YR 3IYLW 1MF2H 2C1PB 1KT2A 1NMCC 1QQDA 3MBEA 5GGUA 1A7BA 5CCKL 2X4OB 2F53B 3P4OA 5JR1H 1SYVA 3C6SB 3QDMB 4OLWL 4CMHB 2DLEA 3FHQA 2DJ4A 3VXOA 2FIKB 3L5JA 4NO3B 4Y5XC 2A1WL 4EUPH 3FFCA 5J13C 4PFEA 1FC2D 2X4PB 2YD3A 4HJ0D 4ZXBA 3ZYJA 3E6FB 3CFDA 1A6UH 1Z2KA 2UZIH 1VEMA 4HLZG 1GOGA 1T04A 1J11A 2DJSA 1GSMA 3QUMB 4ZNEE 3U1SH 3WLBB 4PJBA 4JZJC 1AD9A 1WICA 1YZZA 3WFHB 5EWIL 4RFOL 3AB0B 1FGNL 1S3KL 2A0LD 4MD5B 4WU7B 3SPVA 2PYEE 1PZUB 3QHZH 4OGZA 1VACB 4CMHC 5HVGB 2C3XA 3CCHA 1H3TA 2WP3T 1SM3H 3WXVH 1HQRB 1S7QB 4M3KB 3UEZA 3FOLA 2Y25A 4MYWB 4YZFF 2V7NB 1PG7W 1UCTA 2DIAA 4WGVB 2CGRL 2Y36L 4JO3L 4HXAH 4L3EE 1KEGH 4G8EA 4Z6AT 5BOZG 5I15L 3ARDA 3SGDI 5EZIH 4NDMA 3GRWL 1NGZB 3MJ9L 4GAJH 2XTLA 1WWBX 2QQNL 3D39E 1UA6H 1QA9A 4X7SL 1RZ7H 4ERSL 3L7EA 1QBMH 3U7YL 5EUKB 1WAAA 4OFYD 3O3DA 4QXWA 1QUNA 2VR9A 3FO0L 5EC2B 1OGAA 3ARFA 1TVBB 2J2ZA 4Y5YB 1IAKB 1S9VA 4L4TB 1LP9A 5GGQL 4OFPA 4G8GB 2DQCL 4CN1A 5IB4A 1RSFA 3N85H 2J7LA 4G8IA 1YN6B 4JREB 1U58B 1CU4L 2BRRL 1Q9KB 3ZSTA 3THML 5GISH 3CX5K 4Y4FB 1NFDF 1KFAL 1HDMA 2B7DT 5D7IF 3GHEL 1IGJA 2UWEE 3BPOB 1NBVH 5EU6B 1FSKB 5D93B 3HC4L 4D94A 1QTYT 2HTKD 5H37H 3PWLA 4CL7A 1JPSH 3PP4H 3ZKNC 4L8BB 4OV5A 4IMKA 5DMIH 2ITDB 3LOWA 3IDJA 2NW3B 4HH9B 4JZOA 3PWNA 4Q9RH 4LIQE 1XF2B 4RISH 1KYOK 3DUUB 4N1EA 5HJ3B 5TGBB 4JDZA 4C59B 2D9CA 4NOBA 2ADGB 4XCNA 1NJ9B 1WBZB 5FO8B 4FFWD 3RNKA 2VDLH 4U49A 3LZFH 4YIQA 1FSKC 5D93C 5I17B 3V52H 1CIDA 1EA9C 4P3CH 2VLME 3RWJB 1OPGL 1W0VB 2XKNA 4TUJA 5F96L 4B0MM 2VL4A 4WFED 2H2SC 2QHRH 3TO4D 3U79A 25C8H 3CIQA 3V6FB 3VXPB 2RQ8A 3MOBH 3T4YA 2IF7A 1RK1A 3QCTH 3H9YA 3KPPA 1FVEB 4OCRH 3X12A 4D0DB 1PY4A 2ZNXA 3KXFE 5DR5L 5E2WL 4RMQA 1JWSB 1CDHA 5GGVY 2OTWA 4G6JH 4M6NL 5FKAB 5E7FA 2GK0B 3UO1H 3QEQA 2CR6A 1IM3B 1W0YT 1WBYA 3V5HB 5BQ7B 3WFCL 4KVCL 3HAEA 3UTSD 3FQTB 1NCCL 4ZUWA 2E8YA 4X6EA 3RWDA 4Y1AD 4M8VA 2C3VB 4OLVH 3D85D 1Z9OA 4X8XA 3CVHB 1BM3H 2V17H 1JMXA 1J8KA 1NKOA 4LQFL 3WDHA 4G80A 4NRZA 2AQ2A 5H94B 3W5MA 2ICEA 4QRQA 2HP4A 5LGJB 1WAAF 1JGEA 4Z7UA 4RIRA 5GIRB 2P5EE 3LQAC 4U0RB 2NXZD 1T4KA 1LEGB 4QXTA 1LP9F 4D8PB 3UZEA 4HFUL 5C6TL 3C6LC 4M1DL 5F1IA 3SKOB 2VLJB 3BGMA 5EU4B 2MWCA 3DV6B 1F2QA 4Y5VC 2HFFA 4FHBD 4M7KL 2DQTH 1CYGA 2XQBL 2MKWA 4HULB 1X5ZA 3ILQC 5IF0B 5JXAL 2FJFB 4KJQD 4TQEH 2D7QA 5TDOA 2WBKA 1RIUL 1HILB 4FP8L 1JZ3A 3CXDH 4AH2B 4U0RC 3PWVA 1I3RA 1JRHI 4IRSD 5TQ2H 3BUTA 5A3ID 4NO2B 3FQWA 2VISB 3FT3B 4KVNL 3TVMC 2FZ3A 1RU9L 3VGHA 3VDBA 1R6VA 1KGCE 1VEPA 3TV3H 3QIBA 4YEFA 4I48B 4YDLB 5MI0B 3O8XD 2F8VA 2V5YA 3RU8H 1Q1JL 4HS3B 5JW5B 4LSVH 3OB0K 5IGXL 5D6CB 1K8IB 1LO0H 5SV3A 4HD9A 5HDLA 2BFVH 3V5KB 2JB5H 4P4KD 4P9ML 4QO1A 1HQ4B 4DOHB 2ICWA 3PL6A 3OKLB 2VIRB 4LU5L 5F3BB 4V1DA 2CKNA 5CBEB 5TQ0L 4FQPA 1EERB 1FVCB 1CFTB 3SE3A 3QAZB 2NPLX 1FC1A 2ADIA 3GJFA 1JGDA 5ADPL 1BVKB 3UX9B 5B3JF 1N5AA 4NM8L 2YD1A 5JW4R 1Q9LA 2DKUA 3DXAD 2ZNWA 4JRYB 5I0ZA 4IMLA 5CLWA 3CPLA 1U92B 1V8HA 5T1KA 4ZAKA 4Y88A 1XMWA 1EDQA 3UP1A 4NKOB 5DRXB 5LBSH 5D5ME 1AY1H 1H3WM 5I1EH 2EH7L 3EJYC 4DW2L 2VZ1A 3AY4C 2PO6C 4TVPL 2HTLC 4U1IB 4K8RH 5MERA 1G0DA 3SDAB 1OP5H 3MBED 3VXMA 1TCMA 4UT7L 4Z7UF 2GSIB 3O4LE 4XPBH 5E7BA 1FL5A 1IAIH 4LVHC 4PRHA 2YSSB 3VXRB 4MXQD 5GGTH 4MXVE 3HMXL 4W4NA 1Q9OB 2DBLL 3U4BL 1RZJC 5B39A 5MENB 2OJZL 1DN0B 1LO5B 3I6GA 4CVWA 4M3JA 1KCUH 4GH7B 1IEHA 3HKFA 3ZHKA 3PXHA 1FFOA 1G7QB 4HKBB 1W72A 4R90L 5I8EB 3O2DH 2AS5M 1CCZA 4GRMB 3BW9A 4FQXB 4JFPA 4OI7A 4NQTA 1NAMB 2ZUYA 3J8F7 1A3RL 1OSZA 4K3HA 3UTPD 5FO7A 2YD8A 3DVGA 1OAQL 3KYOB 4BZ2L 3V7AE 3LPGA 4PJAA 4GRWE 1I1FA 3H0TA 2ZZUT 5KSUA 3NIGE 1KLUA 4JN2B 1N0XH 5F8RC 3GSUA 4ZUSB 3QI9A 3WBDA 3WN5C 2QEJA 4PD4J 3EOAB 2FHCA 4NP4L 4Q58C 4OQTA 5CGYD 2FX8H 3KR3L 1BBDH 4XAWL 4UDUB 4FQXC 4TSAL 1ZSDB 3MJ7A 4L8SA 5A16A 4X4XA 5DDHB 1FIEA 2EICA 3UTOA 3LKSB 4UQ3A 4NO5A 3PHSA 2FJHB 4G7VH 3EFDH 3ARFD 4JKPH 3GSQB 1YNLH 1B6DA 1CGTA 1SJEA 3HHRB 3VMPA 4HIIA 2VZVA 4HPYL 4ALAL 3GMRB 4MWFA 3K4AA 2X4NB 4DUXA 1KIPA 2P7TA 5KN5B 5DC9B 1MJ7H 2WBJD 5HVFB 3WXWL 2AK1H 4FZ8H 2EEDA 3RI5K 1DSFL 2F53A 4O5LL 5CZXD 5D2NE 3B9EA 1NSNH 4U6YA 2HLFC 4YWGL 2ESVE 3ARTA 1T83C 5IW6A 1WJ3A 5E2TL 1J5OH 3R8QA 3VFWB 1YY8B 2J8HA 3WLBA 2YA2A 4X7CC 1U8KA 3U48A 4XMLL 4CGTA 4JPIB 2A9NL 2HRPH 4R3SB 3P0YL 1RUML 4MD5A 2L0DA 2AEWA 4MZ2A 4AEHH 1PYWB 1FFNB 2HJKA 1HQRA 4MDIA 2BNUB 3C8DA 3SGDH 3WNPA 5JOEA 4CW1B 4MJID 1X4YA 2FCBA 3EOBB 4P46D 2V7NA 1T22B 4JANA 3JWDH 4ZFOB 4F7TB 2Y23A 3MPCA 5ACZB 4MAUL 5FYJD 3BZ4B 3ECBB 5HHOE 3TA3C 2NZ9C 1DVFD 1WVZA 4BYHA 1ZWIA 2GK2A 5DK0B 1NEUA 3QA3B 4K94H 4WUKL 4EXKA 4O02L 5D1QD 1I75A 2BOBA 3ZKMD 3HCVB 1QFWI 3S35X 5CLTA 5FA3A 2F19H 1OLLA 3IFLH 4I1NB 3U4EA 2NY5H 1D5XB 4C57C 2FRGP 2DF3A 1U8QB 4P2RE 3UPRB 1DZBA 4NPYB 3JZ7A 5EUKA 5I1LB 3SJVD 3BRFA 1WITA 1YEGL 1ZT4B 5EC2A 2OTUA 4YEEA 2AJVL 1N59A 1TVBA 3O3EA 3OXSB 3VWKC 2EO9A 2EDJA 3V4UH 3HC0B 3I3EA 4ZPTA 4TSBH 4I13B 2D7MA 1YN6A 4HUXB 1I8LC 2WANA 1NCAH 4M6OH 3MFFB 1ZMYA 4ZSOB 2JJUA 3QWOB 3U0WL 2KZ1B 4G7YL 3D18B 5AZEH 2H1PH 1CE1H 4KPHH 4L8BA 4D9RE 4OZGE 3W9DB 2ITDA 4XAKD 2NW3A 4YGVB 5SWQB 4F7CB 1JWUA 43CAA 3EJJX 1XF2A 3DUUA 5HJ3A 5TGBA 3GO1H 5ESQA 2O93L 3IDIB 4YHYB 3CFBB 1J1PH 3MROB 4HQQH 5D1ZA 5I73B 1NMAL 4BSJA 1L9NA 4LHUA 3C60A 1G9NL 2HA1A 1SY6H 5FHAH 4DUWA 5E2VL 4MCZB 4JEGB 1ES0A 1EJ6A 5I71B 1VFOA 1IGML 4JY5L 4U1MB 3Q2CA 5SWZD 4M7ZB 5JPNA 4BH7B 3RWJA 4PJ8A 1A6VL 1QSEE 2OZ4L 3QQ3B 3STLA 1V5JA 3K81A 2YEZB 3IU4H 3ULUH 5CJ5A 3MLTB 3QUKB 4P2QA 5FYLL 4Z7OE 3NFNA 3T0XA 1H3PH 1VSCA 2Y1VA 3KNBB 1RV6X 1DANU 1CF8H 3QNYB 3VXPA 1EJOL 1I7UA 4YHYC 3EUUA 4PJXA 3QIBD 4R2GD 4HBCH 1FVEA 1BLNA 1IAMA 4D0DA 1XZ0B 3RIFK 3FB8A 5FKAA 4WEBH 2IAMB 4I3SH 3CXHK 3NZ8B 3HI5L 5GGRB 5KZCD 5BXFA 4URTB 2X4SA 1DN2A 2VAJA 5M94B 1IM3A 1I7TB 1MWAB 1TZIA 5BQ7A 1E4KC 5C9KA 3LRSB 2LTQC 5ID1B 4BK4A 2EYTB 3WIHL 1INQB 3WS6A 3BO8A 4NQUA 3O45A 5D96B 3L9RB 4D9LH 5F7YC 5H94A 1MVUB 3LHPL 2PTTB 5CD3B 1U95B 4B7LA 5I1AB 5LGJA 2IAMC 3SBWA 3TLRA 1GGIL 1RIVH 2COQA 4U1HB 1UYWL 4J6RL 1D6VH 5GIRA 1IARB 1UWEL 3AS0A 4ZAKD 1I9JH 2PXYA 3MOAL 3F62A 4PR5A 3JUYA 1JPST 1CBVL 3OAZK 1QHOA 2H9GB 4YBQD 5KVEL 1F8TL 2MSPA 3DV6A 3T0EC 2NY4C 3DRQA 4NCC1 4XBGB 4MMZC 4ZG1A 5IF0A 4G5ZH 5TPWL 2GQHA 4PJHA 3O6LH 3SKJH 1IGFH 4FG6D 5ITBL 1FVDB 3GM8A 2I5YL 4OGAC 2A6IA 1T0MA 1F4XL 2GY5A 1MJJA 2IPTH 4L29B 3D2UB 1PLGH 2I24N 2XA8L 4P5MB 4AH2A 4Q9BA 1DBAL 3BJ91 1OOAA 1OL0A 1TVDA 2DQEH 3FN0H 1UJTA 5IVXE 2VISA 4GUPB 2YA0A 2GJ6B 5K9QG 4A6YB 1E6JH 4BFBD 3BFOA 5T1LB 4Z7WB 4I48A 4PLKD 1NMBL 4BQCA 3EYSH 2X4TB 2BVUA 5T5FH 2FD6H 1BQHB 1UXSB 5D6CA 1FP5A 2YMXH 2X6MA 1X5AA 3VWJA 1KF9B 4HMDA 4KMTH 1FNSL 2YUVA 5INDB 3RVUD 1I7ZB 1FNEA 3QQ9C 2IBBA 1AJ7L 3OKLA 3QPXH 1YEFL 2DQIH 3QB7C 4GLRH 1FVCA 1CFTA 4QTHB 2FJGB 1QFWL 5FXCH 2FH8A 3CSYB 4L8DB 2BZDA 4PGZA 3TP4A 3TZVC 5IHBA 1WTGT 4FFYH 2Z91B 4I3RL 1EGJL 1NLBH 4LPXA 5GHWH 3QH3B 5ACMA 4OZHB 3MXWH 3GHBL 4CU6A 3KPSB 1IC4L 1U92A 3ARDC 3GJEB 3OTTA 3EGSB 5E00A 4NKOA 5DRXA 5EU3B 1KXQE 3VFGH 1C7TA 3U46B 1NC2D 2E7LA 1CI5A 2HG5B 1NCUA 3PWPA 2FGWH 2QADB 1WIUA 4KFZC 2X1PA 2J88H 1S5HB 3S5LB 2WIMA 15C8H 3SDAA 3VG9B 3ZMRA 1CGXA 1QSVA 4TRPL 4DKFL 3MV01 2CK2A 2CXGA 2F53D 4BUGA 3QDMD 4PG9B 3IFNH 5HHNB 1RUKL 5E8PA 1E0OB 1U6AH 4HT1H 2E5EA 2RCSH 3VA6A 4DN4L 1YECH 5ETUB 3PIQA 4F7EB 2QADC 3QEUB 1P4BH 3OG4B 3DURB 1LO5A 3K3QA 4X9FA 4WU5B 5IESL 3OR6B 3TT1L 4Y1AE 1P4IL 2BOCB 4IMKC 1G7QA 4HKBA 3ESUF 4R96B 5I8EA 3LQMA 3GI9L 4XC1L 4CUCA 1JNNL 3MRBA 2H6PA 1MJ8H 1VPOL 3IDXL 4Z9KB 3JV0A 3CFCL 5BV7L 2X70B 1CFSB 1EXUA 1RZ8B 2YWYA 4P23B 2BVPB 2BY3A 1NAMA 4NQVB 2AV1B 5F7HA 4LVEA 2HJFA 5ILTL 3OAUL 3KGRA 2JIXB 2G5RA 3SDXB 3C08H 4P57B 4JN2A 4YFLI 1FGVH 4YXHL 2AI0H 4ZUSA 4X80L 4HDIB 2DQUL 2ZUQB 3LKOB 2IPKB 2LAGB 2V2WB 5F3HB 5BOPA 5I9QC 1FAIH 3TF7C 1A1MA 1MCPH 1G7HB 1CL7L 1VFBB 1ZSDA 5B8CA 4JHZA 1HN1A 5DDHA 3B8SA 1GGCH 5FGBC 3LKSA 4AT6A 2QQLH 3KPNA 2FJHA 3VI4F 1WIPA 4HUKB 4TVSa 4JFEB 2HJLA 1GVIA 4L4TD 1XGUA 4OCXL 4G8GD 4NN5C 4XP1L 4DTGH 4RWHA 1G7JB 4LF3A 4YZFE 1JYXA 1GIGL 1FNLA 4LAQL 5KN5A 3BKMH 5CZVH 5KW9H 2B1HL 2ZUQC 3FB7B 3UBXI 1CGYA 3JWOL 1QLFB 3ARBB 2HFEA 4Y4FD 5IJKC 2IALB 5AWNH 1RPQA 4ZMAT 3MACL 2V5RA 5EU6D 1S9YB 4UBDC 2R0KH 5E5RB 2VDOH 4LSUL 5F88B 3U83A 1C5BH 3PXJA 4NNXB 4MAYC 2ED7A 5EOQH 2B0SL 2EIBA 4P2OC 3VFWA 2E27H 2JTDA 3HG1B 1S9XA 1UWXH 4QHUB 1RUAH 5IQ7H 4R3SA 5DUML 3BIAX 3D6GA 1F4WL 1KIRA 1G6RH 3T1FB 1ZVYA 1PYWA 2AV7B 5GRUH 5CSBA 5DI8B 4IOFC 4P2YA 3BVNA 3VFUB 2FBJL 5BRZB 4CW1A 2C5DC 1U2CA 3MO1B 4GO6B 3DXAE 4XX1G 1NFDE 5CEXB 4JG0H 3RZCB 1KBGH 5D7IE 4QHNB 1DLFH 1MHPH 5ECJE 4Z77B 4ZFOA 5ACZA 5HHQA 3S35H 3ECBA 2KZWA 4MLSA 4W4OA 2NW2A 3GK8L 3UJIL 3QA3A 5INCB 1F58H 4HJGB 4LPCA 4UV7H 5CEZH 1CD8A 5IMOB 3Q6GL 3HCVA 3BHBB 1WBXB 5EOTB 4JQIL 1HI6B 1D5XA 3UPRA 1U8QA 4NPYA 3QXAA 3ZDYF 3QUYB 4RMVA 3VFTB 3RZCC 3U30C 5KAQF 3NACL 2E9BA 1LHZA 5D9SB 3GSNA 3ZTJH 3HC0A 5EG6C 5IB1A 1J05B 3QJFB 4X6DB 5DRWB 1HXYB 5DD0L 2APBA 2W59A 3G6JB 3MLUL 5EU7E 5CJBA 3RBSA 4IDJH 1VDGA 2FO4A 4RZCB 4N0UA 5I2IB 5IV2B 3PL6C 2A38A 3ILQD 4ZODA 5HVHB 1ZLUK 4EBQL 2XYCA 4OCYH 4PJBE 2A6JA 5I30L 1O5DT 1ONQB 2CDGA 4XWGL 5SWQA 4M61A 3C2AL 4NGHH 1ZLVH 3ZKSD 4HUNB 3IDIA 3GRWA 4Q0XL 2VLJD 4YHLL 3MA9L 1XAUA 3RGHA 2CIKB 2J8OA 4RDQF 5H35B 2P8LB 3L3KA 1KJ2L 5DMIL 3VXSB 5CEYA 5GS2H 2YEZA 4XPHL 2ZKHH 4UNVA 3QUKA 2HVKB 4P5KB 3QDJB 1WAAE 4K9EH 3EDEA 4JFFB 3VFOB 1TTGA 1MAJA 5F9OL 4OF0A 5L9DL 5LG1A 4TUOB 4AEIH 1LP9E 1OT2A 2BP3A 1GXEA 4OCSL 2VDLL 3B43A 3ZTNH 3VFNB 2R0ZH 1ETZB 1B0WA 5LCVH 1NQBA 1OARL 5FV1L 5GGRA 4JHBA 3SQBA 1JWMB 3NVQA 4RAUB 2O5ZH 4V2BA 1IEAA 3B6SA 3LRSA 2VDNH 5DVLA 2EYTA 3L3HA 1NBQA 1CLZH 1L7TH 4JY6B 1X5GA 5T1MA 3H3PL 4M7JL 5GS1C 1HINL 3L9RA 4EZMA 1MVUA 4P3WA 3FTGA 4OGYL 3SCMB 5JHLL 5I1AA 3BH8A 2F5AL 1MLCB 4OCMC 3RDTB 5HPOA 4PGJA 4JRYD 4J23A 4NUGL 3TPUB 4GFTB 3IXAB 1UB6B 1QR1A 1M6OA 4LLMA 3HI6L 3QI9C 4LSRH 5F89B 8FABB 4O4YL 3F6LA 3LKRB 4MJIE 5J7CC 2A73B 5KG9B 3LKNA 4LRIA 4A2MA 3PV6B 1JGVL 1N7ML 4S0SD 5FYJU 5FYJE 3VGEA 4ETYA 5KS9B 2BY2A 5CSGA 4NQEB 4XBGA 3MRQA 3SDAD 3K80A 4UAOC 1K9TA 2XQYK 2MTPA 5CMAB 3RDTC 3MV8B 4FQ1H 4HZAA 5E5MB 5B3JE 1S7TA 3O2DA 1K85A 3VXRD 2Y6SC 5D2LA 5LVEA 3SJVE 4K3EL 4EXPX 1TMCB 2GJ6A 3HNSH 3D25B 3VW3L 3AU1A 5MEND 3DX9B 4Z7QF 4Y4HA 5T1LA 3TYGL 3PHOB 4JVUA 4O2FA 3U7WL 1KIUA 3V0WL 4I77H 5E1HB 4WFGD 5K33A 4FQXD 1V7MH 3S36H 5DD5H 1K2DA 5JMOC 3HA0A 3ARRA 4P59H 1G9MC 1U8IB 4LASH 3MLVH 4ODUB 4FTVB 4IM8A 5B21A 2ZUWA 1V3MA 3T3MF 1K4CB 4Z7UE 2ZOKB 3QO0B 2KPNA 5A1AA 2O5YH 5DRZA 4QTHA 4XAKE 2NY0B 4G9FA 5GS0C 3MRNB 4LLYB 3O41B 5F6HI 5BZWB 5GGVH 5FYKH 5D1XB 2YS4A 2Z91A 4RGNC 3RGVB 4MA1B 1F4HA 2B4CL 3B2VH 5EIIB 3LQZB 4ZFFA 1LO0L 1P7QA 3QH3A 2IADB 3MLZL 2D7TH 2JB5L 5T3ZD 3DBXB 4MMXC 5BVJB 4FA8A 3GJEA 4DK3A 1FRGL 4PJ9A 3EGSA 1BIHA 5EU3A 3KS0J 1KOAA 3BRDA 2Q8BH 2HG5A 3MRKA 1XFPA 1KB5H 2M8XA 3T4AB 3TBWB 1JHTB 1OGTB 2DWDB 3A67H 1J1OL 3X3GL 3B2UD 4LIQH 4XVSH 3MRLB 3S5LA 4ZTOL 5D1XC 5H8DA 4HWUA 5HHXL 4PRNA 5MEOA 1NCDH 1WFTA 2BVOB 4UOW0 1YEDB 3KJ6H 3B3IA 1T7WA 1VA9A 1VGEL 4PG9A 4IIQA 5SWSA 1S9KC 3DETC 3AVEA 2Q8AH 1AO7B 3CZFB 1E4JA 5ETUA 1MCNA 4Z7NF 5I1EL 3QXWA 2NZ9D 3QEUA 3OL2A 3NCCB 3DURA 3BI9X 4HGWB 5FDWB 3LH2H 3E1F1 3OR6A 5EU5B 5AZ2H 3X17A 2BOCA 1UFUA 1XGYL 3GMPA 4R96A 3WKMH 2A6DB 5H2BA 3K0WA 3E8UH 5AUMB 5E8DH 3IU3B 2XN9B 1GHFH 4J3OC 1IAIL 3CLEL 2X70A 2EDYA 4JZNB 35C8L 1CFSA 1RZ8A 3OX8B 2HN7B 1D5ZB 2WINB 3C60C 3O0RH 4WGWB 4JJ5B 1JUFB 1KCSL 3TN0C 4F3FB 4TUKL 1TZHA 5DGRA 4POZC 2P5WB 1CD1A 4Z7WF 4KTEH 2JIXA 5IFJB 4XP9L 1DE4A 2DQGH 4P57A 4NKMA 3LKOA 2V2WA 1JNHB 4ZUUB 2FX7L 4UDTA 4PJFB 4DQOH 1IGYA 5HYSA 5F7EL 4MJ5A 2RAMA 1G7HA 1H8SA 3QR2A 3WFZA 3MV11 3WJJA 4OD1L 4NO0B 2BJML 3SHSA 1A9BA 2V2XB 2YK1H 3DX8B 3HMXA 4NQSB 1HKFA 5KOMC 3HZMB 3M07A 3AC0A 3P9WB 3MJGX 1T6VN 5ALCH 4L3AA 4KKLC 1G7JA 3KWWB 1A4JB 1I3GH 5IROA 1N0XL 4DGYL 2F54B 1HCVA 4LPTA 1LO4L 2CDFB 3ARBA 5IFHH 2OX5A 1C8PA 3NGBB 4OZHF 5EZJB 3LV3B 5BV7B 1OAKH 4P99A 2HFTA 4NBZB 1S9YA 5DMGC 2QR0A 2D03L 4KHXL 4N8VA 4E42A 5GJSH 1MRCL 2CK0H 1AI1L 3WV0A 2V2TA 3WD5L 4Z0BL 5CBAB 4NNPH 3RRQA 5B38B 4FQCH 4N8CH 2C4FT 4HPOL 4J12A 2YC1B 4QRSA 1QRKA 3EDDA 2DJUA 4RDQG 4LVNC 2Q1EA 3V0AC 1ZK9A 5GGSB 3VD5A 2CJUL 3HUJB 2R69L 4JR9L 2MKLC 3NGBC 1CD9B 3T1FA 4YXLH 3MXVL 32C2B 3K8LA 3NABH 5DI8A 3AS1A 5BRZA 3VFUA 3W11C 3QXDA 4H0HB 1GPOH 4I5BB 4XNQA 4Z77A 3HNVH 4S10A 3MRCB 3DECA 4PRDA 4NT6B 1QFWM 2BVYA 5INCA 4HJGA 1KV3A 4KK8C 3IVKB 5HHVL 4HF5H 2ZUXA 2F15A 2WUBL 2JJTA 1JF6A 4L9DA 1UEMA 2CMRH 4LCWB 5EOTA 3CK0L 4XNUH 5F7LB 3CLFH 4N5UA 3H7LA 3OHXA 3CVIL 2IAMD 3VD4A 1N64L 3QUYA 4XNXH 4N9GB 4LPYA 5BCAA 2F53E 3QDME 1OW0C 1RUQL 4YHNB 1WQVT 3RWGA 2X1XR 3U82B 3TT3L 3QJFA 4EOWL 2EDHA 1HXYA 3SDXF 1EIBA 3WHXB 3BESR 4KGJA 3VWJC 4UQ2B 1JE6A 5E99L 1ODAA 1CQKA 3ULSA 4CVZB 3R06B 5I2IA 5IV2A 1SBSH 1CLOL 4TULL 3T2NL 4EUPB 4OGAD 3MV7B 3VU2A 5J8OA 1ONQA 1F6LL 1CGSL 2NY6C 3VCLA 4MZ3A 2LU4A 3TJEL 1UJ3B 3DUSB 2IBZX 3F5WA 1A6WL 4H25B 5DEFB 4U1KB 2G2RA 2DD8L 5CD5C 4JM4H 2V7HB 4JHAH 1WISA 1MPAL 3K46A 2QSQA 5J1TC 2CIKA 1ZLWH 3UYOD 3B5HA 4IRZH 1JK8A 4J1UA 3HB3C 4H88H 4Z7VB 5IOPA 3VXSA 3D2UD 2R0WL 1WZLA 4P5KA 1KNOA 4WW2B 4QHMB 5ANMB 3QQ9D 4F9PA 3QWRD 5JIPA 3SKMB 3VFOA 2ICES 2GJ6D 3HRPA 2IPUG 4XGZB 4WHYG 5T1LD 4TUOA 4QOKA 1AGCB 4L4TE 4G8GE 4GRWH 3ZDXF 2BDNH 3MCG1 2R2EA 3KLAA 1A02N 1T0NB 1GAFH 3FQXA 1WWCA 3O6FA 1OCWH 5BO1L 3WUWB 2GI7A 3H9SA 3TIDA 4DZBA 5F1NA 1RURH 3BH9A 1YEIL 3P4LA 4RRPG 2ZSWB 1XEDA 1ZLSL 3IXTB 4JY6A 4LLVA 1FNAA 3PHQB 2W9EL 3UJTH 3P11L 4DKEL 4F37F 3RKDD 5JNYB 5I19L 1OM3H 4LARH 3PDOA 4YHOL 1AHWC 1X5IA 1ZVSA 1G1CA 2DMCA 4WEBL 3SCMA 5KVMC 2UY6A 3DX6A 4QRPB 1BEYL 1TJHL 3HRZA 3RQ3A 1KJ2B 2XTJC 4WIQA 2OZ4A 3TC9A 4YX2H 5HGGS 1RUPH 3KPSD 1T1WB 3TPUA 5CUSH 3IXAA 4XXCC 5FM8A 3ZT7A 3RX7A 2KDGA 1F6AB 3TIEB 5F89A 2NTSP 8FABA 4GS7B 1FLRH 4X6DF 4F57H 5KG9A 5KBNC 2QADD 4ZTPL 3G6JF 1U8MB 1D6EB 1A4KA 4AENB 1QRNB 4JVPA 2G60H 3H8NA 4NQEA 5KVGL 2DQJH 3MCLL 4LHJB 3MZGB 4PJEB 3BKCL 1IGCL 4OZFA 3GBNL 3QZWB 5CMAA 5GRJL 5DJXB 3MV8A 1LD9A 2CDEA 3CX5J 3HMWH 1IAOB 5JW4N 3Q1SH 1NGPH 2NY3C 3LDBB 2YRZA 3SE4A 4YUEL 4NRYA 3WIHA 4H1LG 3D25A 1U3HA 3O6KL 3WS3B 3DX9A 1JHLL 3U36B 3PHOA 3QP3A 3V6ZB 3DYMA 1JPFB 2AJSH 4B7IA 5EBLA 2FATH 4G5ZL 4G42B 3CJJA 4H8WL 1IGFL 4G9DB 3BD4A 5IW1A 1I9RL 2R23B 2VH5H 2JJWA 5DQJB 5JPMB 4OIBA 4O58H 3IGAB 5C09A 3BUYB 1U8IA 4JGUA 4ODUA 4P23D 4CN4A 5T3XL 4D9QE 4PG2A 1P5UA 4RGMB 2NR6C 1K4CA 3NH7H 4PLOB 3GNMH 1E6JL 2ZOKA 3I2CL 3QO0A 1BQHG 4G6KH 1UG9A 1J0IA 3MRNA 4V2CB 2JIXD 4JO4L 3MLXL 1HHJB 4JPWL 3D0VB 3NCYP 3QUXB 5BZWA 4YFDB 3IKCB 1QSZA 1GOFA 1YY9D 1J9CT 3RGVA 2VLJE 3MNZB 3LQZA 5HDQH 4WENB 2IADA 2Z8SA 1I8IB 5ADOL 4J3SA 5BVJA 4I0PB 3PGCB 3G9VA 4HUVB 3TYFB 1IGIH 4PUBH 4UU9B 4JFED 3LN5B 2W0LA 5L6YL 1WIOA 4HMCA 4GMTL 1A21A 3T4AA 3X3FL 4KH2A 2J8UB 5J9PA 1JHTA 4ODTL 3R8BB 3UTTA 1ORSB 2DWDA 1S7XA 2VLRB 4G43A 2VXTL 5F21B 1ZT7B 3EYQD 3MRLA 4M1CD 2EDTA 3OKDA 4X5XA 3ARBD 5ISZB 1LK3L 2IANA 2X4RB 2BVOA 5I8OL 4ZFGL 3VFVB 1JIBA 43C9B 2DKMA 4I2XB 1G6RA 4ZD3L 2HWZL 2YRPA 4I0PC 3ULVL 3KJ4B 1P2CA 1UKQA 4FFVD 1BF8A 1BFVH 3CZFA 2VRAA 4EDXB 4NM4H 4LLUB 4PJ5B 2BCKA 2DS4A 2W0KA 1HIMH 4M1GH 2C3HA 3JTSB 1BGXH 3V4PL 5CJOL 5SX4H 4DOHE 4XPGL 4HGWA 5FDWA 5KS9F 3BN9C 3BAEL 3VI4E 3HG1D 4Q6IC 3V79C 1CFQB 2CUIA 1PVHA 2DQFB 4TYUA 3C09C 1VKXB 1YC7A 3EYUL 1MCWM 1NCBH 1EGJA 4U3XA 5AUMA 5TF1H 3OZ9H 1DDHB 4PV9B 4OCWL 5GQBA 4ELKB 3CFJB 4WWID 3TH3T 4ZO7A 3BZDA 3VXUB 1MIML 3JTTA 3KJ4C 5JUEL 5BRZD 3OX8A 4RMTA 2VXSH 3S6CA 5JTWA 5E08H 1BOGA 1CGUA 2WBWB 4LEXL 4BFIB 3VGAC 4KTYA 3RZCD 2WINA 1IZJA 3MODH 4JJ5A 1JUFA 4F3FA 3KYNB 4M5YL 3V7MA 1EHAA 4IS6A 3P9LA 1JV5B 3QO1A 2ARJQ 1X9QA 2JCCB 4YDJA 5IFJA 1PKQB 4JG1H 1OSPH 5MEPB 5C6PB 1P7HL 1JNHA 4ZUUA 1CT8B 5HYIA 3RAJH 1C12A 2NY2B 2ZUUA 1UM6H 4LCIH 1S8DB 5F9DC 1OLZA 3QUYD 4ODWB 5F9JB 4KTDL 3DX8A 3BISA 4MGXA 1A7RH 4PD4K 4HS8L 4NQSA 1N2RA 3HZMA 2JLLA 1QSFA 3WO4C 1RZFL 1B2WL 5T33H 3UJJH 2DM4A 2VNCA 3PJSA 3MSPA 3VXRE 1ZV5A 4ZOAA 4C58B 1Z9MA 2BSSA 5DYOA 1D5BA 3L95A 1KJMB 4LLDA 2IG2L 2J6EH 1DBKH 1HHHB 4QYOB 2CDFA 1G7PB 2PR4H 4PGBB 3QIWB 4XPAL 1CE6A 3BIKB 3LKPB 4M62H 2X2YA 5ICYB 5EZJA 1ITBB 3OF6A 5DVOA 1I7RB 2J5LB 1NANI 1RHHA 4HJJL 1J8HA 1GGCL 3WJLC 3U7AA 1K6QL 4HCRH 1ZHBA 2AJXL 4HEME 4WFGE 1KG0B 1U8JB 5CBAA 2ZUVA 2H32B 2V9QA 4TPRH 2GFBA 4EDWH 3LKQB 2MHAB 3DLQR 4CVUA 1D5IL 1I4FB 5CZVL 5IJVA 1FCGA 3N1MC 1RHFA 1QD0A 5GGSA 2ZCHH 4LVOB 1KTLB 1V7NH 1X5FA 1RJLB 5GSRB 2OL3H 3FN3A 4YK4B 3WL9A 3DIFA 4JPVH 4M7LL 5M95B 1NGYA 1TQCB 4KROB 5IWLA 3UAJC 3HPLA 3GIZL 2ZSVA 1H5BB 4LRIC 1EMTH 3RNQB 5C8JB 3VXSD 5CIPB 4I5BA 1FFPA 3N0PB 5T3ZE 2N56A 5IR1A 3QDJD 4MJ6B 1FL3B 2HT3C 4JFFD 4NT6A 4UILL 1FORL 4DCQB 3X11B 1XH3B 3ZT5A 1BVZA 3OV6A 4HXBH 3PWUB 2Y06L 4YK4C 3LMJL 3VDAA 4XMKH 4KK5C 4WDIB 4POUB 1ZEAL 5GRUL 2NY1C 1QNZL 3RWCA 5C0EB 1H5BC 3RTQB 2FLBT 2OJEB 2WUCL 1XCTB 2A9ML 4XVUC 4NZJA 5F1KC 4YXKH 2WP3O 4YHNA 4IOSD 3RIFF 4NBYB 3O2WH 4FFZH 1FO0A 1Q0YH 4JVWA 2Q87A 2DICA 4PTUB 4X7FC 4U05A 2I27N 2WWMD 1HHGB 1BX2B 4Z8FH 2HKHH 5ICXA 4JO1L 4WHTA 3K8KA 1FPTL 3O2VL 2EIDA 4PJFF 3UYRH 4CVZA 4OB5H 2R2CA 1A1NB 2X4UB 5L0QB 3SCMD 2M2DA 3TFKC 4Z95H 1QFUH 3RDTD 3FONB 3MV7A 2XZCL 3B5GA 1UCBL 4TTDC 1A7PH 5FYLD 2GHWB 3L3JB 2PYEA 3KPOB 4Y2DB 4FZEL 4E5XA 4H25A 4KDTC 4OLZH 3FO2B 3V8OA 4IRJC 3PDDA 5C6WH 3FZUC 4OBRA 4WRLA 4JAMB 2XI9A 1SMAA 4L5FL 5LWYH 3QUZB 2I9LB 1ORQB 2I9TB 4NQED 1UH4A 4PJ9C 5L0QC 4L3EA 2R4SL 2R29H 4XBEH 4YDKL 4WJ5A 1UH3A 3MV8D 4Z7VA 1GGBH 3TGXA 5FGSA 2FYYB 5FUZH 5F72S 5DLMH 1CK0L 3JV4B 1JF1A 2IH3B 3H9HB 1DQTA 1U0QA 4QHMA 1A1OB 5ANMA 2ICWI 4Q9QL 3D39A 1KTDB 1PJ9A 2YXFA 3SKMA 2G5BA 2EC9T 3LB6D 1FDLL 4KK6C 1MY7A 4XGZA 5ESAB 3DROB 3HUJF 2OK0H 4IIQC 1AGCA 4RMSA 4WWKA 3INUL 2A77H 2EDFA 3QUZC 5B39G 4QEGA 1DBMH 1PAMA 3S96B 5I0DA 4LSQL 4WI8A 3F7VB 5HHPA 4NQCA 5FIEA 5HVWA 1SEQH 4Y4KB 2X42A 4ZUTB 3WIIH 4ZSOE 3WUWA 5E1AB 2NYYC 3JWDC 1MFEH 5E4EC 5C0FB 5DHVH 4H20L 4ODHL 4FTVD 2ZSWA 4K94C 1IQDA 1ZA6A 3S34L 5DO2C 2XOTA 4APQB 1MFAH 4XTRD 5KSAC 2NXYB 1DFBL 1IT9L 3MC0A 1CFVH 2NY0D 3DWTA 5JNYA 1JVKA 2NY5C 5K9KB 3Q5OA 5D1XD 3RGVD 3LEYH 1DQJA 1JI1A 2VN4A 4QRPA 5C07B 4GXVL 4JKLA 1KJ2A 4XCYB 3TCLA 1CWVA 4CBPA 2FL5B 3A6CH 1A5FH 1V3LA 3ROOA 3B4NA 5TDPB 1F6AA 3TIEA 5LXGH 3BXNA 1UWGL 1AGFA 1A3QA 4YFEA 3UTZB 1CLZL 1L7TL 5IK3B 2XG4A 3H7BB 5GPRA 1D6EA 2EDXA 4K3JH 4MXWL 4Y16B 2M26A 4MNQA 5D72H 5TJWK 1K3ZA 3T3ME 5JQHC 4KKBC 4PYHA 5EIQA 3FMGL 5MP6L 4TTGA 4OJFH 5DJXA 1ACYH 1KLGB 5LQBH 1YMHB 5IROC 1A6AB 3O9WC 4XXDA 3WE6B 4M5ZH 1AO7D 1EX0A 1SJHB 3KXFA 1EEZB 2Z35B 5FECB 5E03A 4CJ1A 4LOUD 4AG4L 3GZKA 4MA8H 4Y16C 4JY4B 5IHZA 1N6VA 1NUDA 5E70A 5KANG 1T89C 3MA7A 1DUZB 4L9LB 3B9KA 2VC2L 1T66D 4Q97A 1I8KB 4BM7A 3T8XB 3MMEB 2XN9D 4Z7VF 2BVTA 3CMOH 5IEKB 2CUMA 3ULUC 3KPLB 1B0GA 3T65B 4KZDH 2ADJB 4WW2F 3E0GA 3WHE1 4EIZC 3ARSA 5D4QA 2BHYA 5JLZA 2DYPB 5ALBH 4JLRA 4R0LB 3UBXA 2A83B 5I76B 1TQBC 4OSUH 3FQUB 2R1YB 2P5WD 4KKLD 5FM4A 2P5EA 3MRMB 3OB8A 3F7YA 1WUNT 3D0VA 3QUXA 1FZKB 4Z7NE 1WF5A 3MNZA 3V6OC 1IC1A 2C9AA 2X1WL 4NZTL 2P46B 1I8IA 3PGCA 5TE7L 4NO0D 2E7HA 2C1OA 4PRBB 4UINH 2AEPL 3U9PL 4NBXB 2XZZA 1ZS8A 1OTTC 4GKSB 5JIHA 5SX5H 8CGTA 5D71L 3P77B 3CU1A 2AW2A 4OLYH 4I3GA 2F54D 5FYKL 1G7MB 4G6MH 3QFDA 4PYGA 2GJ6E 3DVFA 1T2QH 1PEZA 2BC4B 5GGRY 5K9JH 4F8QA 3HFMH 2X4RA 5HYJB 4Z7WE 3RVTC 3OF6D 1IZKA 3FFDA 2HT2C 3ARUA 5IBLC 2MCPH 4MCYB 3QISA 2VAAB 5KVDL 3ALWA 3JVGC 3W11D 1OT1A 4O51B 4EDXA 4LLUA 4GBXB 4WCYL 1JNLH 5DZOA 1EO8H 1I1AB 4JFYB 5I1HH 5IHUH 2ZG1A 1A0QH 4GRLB 2ZCLL 2UVEA 3VRIB 4N0RA 2VL5B 4PJEF 2DQFA 4LSPL 4PP1C 4TN9A 3WFEL 4G9FE 2ARWA 1DDHA 4PV9A 2NNAA 4ELKA 4AYFA 1MFCH 3CFJA 3BKYL 4FQIL 4LGSB 3VXTB 3EO0B 5IBTL 3W39B 4BFIA 2XY1A 5MHSD 2G9HA 4OZHE 1RVFH 3AUVA 3KPSE 4BZ1L 1KXTB 1K4DA 1I1AC 1F3JB 4Q2ZB 1KCVL 4GRLC 1JV5A 1R0AH 2JCCA 1W8OA 5MEPA 1P7KA 2VDQH 4ONGH 5DA0B 3CUPA 5GSVA 4DVRL 3SDDB 4UIMB 3G6DH 1D9KB 3MUY1 3C5ZA 2FR4B 2F58L 4HKZA 4LCWD 4JFXB 2Z8RA 4NNYA 5C3TA 1AQKL 1DBBH 5L7XH 4DN3L 3VFPB 3AS3A 4FNLL 3Q6FA 3ZO0A 1AH1A 5E56A 1OAXL 2A74A 3L3IB 3O4LA 5E2UL 1HCFX 1LMKA 3O6FC 1KJMA 4GKZB 1HHHA 4NKDA 3SE8L 1G7PA 1E27A 3SDDC 3QIWA 1D9KC 2JJVA 3BIKA 2R4RL 5DZNA 5FYJH 1RZIB 3SDCB 1N6QH 2EEAA 3DI2B 5EBWB 2D4DA 3MV7D 1MH5A 1HKLH 3UC0H 3OKEB 4LNVA 1BJ1H 5D7JB 1PG7H 1U8JA 1KACB 3QYCA 2H32A 2Y72A 4JN1H 2J8UF 2VXQH 3QIUC 2MHAA 4PB9L 2ADFL 1I4FA 1ZTXH 2W9DL 1T5XA 4RNRB 1OVZA 1CFNB 4P9HH 1PX4A 5DURB 1Q38A 5HD8C 1KTLA 3T0DA 3WSQH 2OMBA 5TE4H 4S1SL 4TVPE 3HAEH 1DANT 5B38G 3FB6A 5C71A 1I9EA 1NBZB 4DGIH 4KKCC 2V5SA 1ZHNB 3NN8B 3T2OA 2J12B 5CIPA 4WY7H 5D7JC 3NCBB 3REVB 3EDFA 4NKIH 5TFSH 3S4SB 2LVEA 1G9EA 1GZQA 1Z0NA 3EOTH 1KELL 3KYKH 4OI9A 4P5TB 1FL3A 3T77A 2R2BB 3HE7C 1WT5A 3OJMB 3DGGA 1XH3A 2W0FB 4JFEE 1VGKA 3LN9A 1EUTA 1Q0XL 5LKNA 3KHQA 4RAVA 4WDIA 1JFQL 3WMSA 4JPKH 5C0EA 4XPTL 3RTQA 1T2XA 1QFHA 1HHIA 1YUHB 1BD2B 3NPSC 5JQ6H 3KG5A 5BMFL 1XF4B 1DTU