4XVUC

Structure of get3 bound to the transmembrane domain of nyv1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNLYYYSIHWVRQAPGKGLEWVASISPYSSSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGRWYRRALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
total genus 43
structure length 222
sequence length 222
chains with identical sequence E, I, K
ec nomenclature
pdb deposition date 2015-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvuC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvuC01
3DIFA 3AAZB 1MCLA 4MJID 5LXGL 5C0RH 1YEDB 2VC2H 3SDCC 2NY6D 1ERNA 1Z5LB 2EDEA 2BJML 3QIBC 4BQCA 4DJMA 2DM7A 1Q72L 4N9GB 5GXBB 5HYEA 3EHBC 1RUAL 3S96A 4L4TD 4R4BA 4S11A 1LK3H 3QDGE 5D7LD 4TUOA 4JN1H 2J8UB 5L8LB 4YAQB 3FQUB 2XICA 5I75C 3Q1SH 2X4QB 3Q1SL 2J2ZA 4PV9A 1I8LC 3VXMA 3ARGA 5C0BD 5SWQA 4G8GB 5T3XD 3KPRD 2VLKB 4KROC 2YXFA 4N0RA 2NR6C 2HJLB 5JNYB 2SEBB 3PXJA 5F93C 4XXCA 1IEAA 4UOJA 2HT4C 2LE9A 3BKCH 3M1BA 4X7FC 4HZAA 4X4XB 1LEKA 3U7AA 1WFOA 4HIJB 4GKSA 2YS4A 3ARUA 2MQ3A 1YEIH 4QHLB 2XKSA 2HT4D 1H3XA 1R3LB 1RZGB 4K3EL 4P2QA 1KT2B 3MACH 4ELMA 2VR5A 5DD5H 3QIUB 4MLSA 4Q9RH 2ID5A 4Q9RL 3BPCB 4XWGL 1FGNH 4IJ3B 4G6JH 2C1PB 2QSVA 4U1MA 4HZLA 3IDJA 4LAQH 4UOW0 5HYQA 4LAQL 1NLBH 3O2VH 3HC3H 4H1LH 3T2NH 5EIIA 3HC3L 3ARFC 2VWEE 1DUYB 5KSAC 3DXAA 4PTUB 3KVQA 2XZCL 5L88L 5DJ0B 1LEIB 3MV9D 2VH5L 3X3GH 4JM2B 3V5DB 3ARFD 3TO4D 4NWTH 3P30H 5C0IB 2EKSB 3P30L 2DWDB 1DCLA 2OQJA 4Q58C 2HMID 4OLZL 3DARA 5HDBE 3DUUA 1JUFB 2Z8RA 3DSNA 5TFSH 5ICYA 4YXHL 1ULVA 4PGBB 4JKPH 4ODVH 5J3HC 2A6KB 1DANT 4JKPL 2YK1L 1YN6A 2H8PA 3VXSB 3MLVH 1T2QL 3IDMB 4UQ2B 1XMWA 4UV4H 1TPXB 2HKFH 1U8NA 1SMAA 2VZ3A 3UZQA 2C7UB 2FATH 2IQAA 2FATL 5K9KB 4Z95L 3LMJH 4FQQB 3BIAX 1PSKL 2FSEB 4DZBB 3RWGA 5I1GL 3M17A 2VJXA 4JVWA 2J8UE 4LSRH 4XPAH 3V4UH 3KLHC 4X7EC 1EDQA 4G8GE 3ZDXF 1DBKH 3OJ2C 4NZDA 1DBKL 4KQ4H 1IEBB 1KLFA 2VLKE 5DK0B 5HYJA 2I5YH 3KLHD 4R97C 2DJSA 3FB6B 3ULSB 1OTSC 1QLEL 2L4OA 1FYTA 1E6JL 2VL4A 3QUZB 2I24N 2CLRA 4HG4J 4J4PC 4Y1AA 5A40E 3ILQC 3CDCA 1MRFH 3S3SA 1F6AB 2R0KL 2WIIB 4JFZH 5IB4B 2AXGB 4JFZL 3CSPA 3INUL 1MREL 1HHIA 2HG5B 2R0LL 4J4PD 4NYLA 4PV9B 4HJGA 4G8EB 2RR3A 4NO2B 1MI5B 4U3XA 1CFTA 1B2WH 4R90H 4FFYH 5I19L 4FFYL 2DM4A 5DD6B 4M6NL 3G9AB 1LVEA 3DURA 4ZS7L 2AQ2A 2WINA 3S7GA 3C8DA 3MV11 3F62A 2WBKA 4NCC2 2G60H 3D9AH 4GS7C 2G60L 1XEDA 3ZMRA 1OOAA 4R8WL 2AI0L 2GJ6B 3CK0L 3FMGH 4W6XB 5GIRB 3FMGL 5D1QB 4PG9A 2MOVA 4KRNA 4JQVC 1G9MH 2AABH 5A16B 1F02I 1ZTXL 2BNUA 4BH7A 3VFTB 1I3UA 2C3HA 4KHTL 3D2UD 2VXQL 3CFJA 4L8CB 1BD2D 1N8ZA 2Z8VC 4OLUH 2XN9A 4PJEB 1XF4A 2EEBA 3BW9B 1NFDA 3I6LE 2G5BB 3L9RA 4JFQB 4L3EA 1FNEA 1E4JA 3VXSE 1YQVH 5C0JA 3GMNA 3QCVL 4PJAB 2A74A 3GBMH 4QGTA 3GBML 4K8RH 1DQJA 3DVGA 3T4YA 1KG0B 5L7XL 3F5WA 5D1XB 4HX1B 2ADFL 5C2BL 1GCFA 1S9WB 2D31A 1CS6A 1DTUA 4M7KH 4YHIB 3DHJA 4LCWD 4PB9H 1T6VN 2C5DC 4F9PA 3RWCA 4XI5C 4X7TA 3EOAA 3S4SB 2EE9A 3S37H 1MFEH 3S98A 1BZQK 1A6VL 3WJLA 3MNWA 1ZLUH 5C6WH 2OZ4A 3FQNA 4JLRA 3WDHA 2VQTA 4APQC 1A3RL 3M8OH 3RNQA 1OQOA 1RU9L 3M8OL 3LKSB 2BDNL 3GMPB 5C0DB 1T7YA 4KZEL 1A2YA 1TJHL 3V79C 3BWUC 3O3AA 5D93B 3VWKB 5F1IA 1TETH 2F5AH 1JF1B 4XNQB 3SKMB 2DAVA 3GJFK 2DLEA 5E9DB 1OP5K 3TZVC 1MI5E 2ARJB 1BJ1H 1CGXA 3LHPH 4K23L 4OCYH 3RWHA 1S7SA 5HGDB 3C6LA 4NQCB 1MHEA 4AQOA 3D0LA 4TNVK 4WW2B 1UA6L 1RZKL 4HPYH 5T1LD 4QNPF 7CGTA 2ZPKL 1BOGA 2GJ6E 5DEFB 3C60B 5C0AD 5IWLA 1HHIB 1IZKA 3QI9D 4N0FB 4K8RC 3GSNH 4K7PH 4Y16B 5KVGH 1OAZH 4NJ9L 3VG0L 2ADIA 1EAPA 1OAZL 3QUYC 5EBWA 3VD5A 4NRZA 1JZ5A 5IV2A 4KZDH 2FJFB 1I7TB 2JJSC 2AJVL 2MHAB 4HIXL 4PJEE 3SQOH 1A7NH 1IFHH 1TCRA 1UB6A 2HFFA 4FNLL 2VLJD 1AIFA 4QRRA 2NY2C 4Y5YA 1SBSL 4GRWH 5F1OB 4PJAE 3H9SB 1F4WH 2PTTB 5DJYB 5HYFA 2GHWB 4ZFGH 4PG9B 4UT7H 3QEGH 1QUNA 5EC1A 2NY2D 4YE4L 2V2XB 3QEGL 5AG9A 2A9NH 4Z18A 2BNUB 4GRWF 4J23A 4IRSA 4YHPB 2G2RB 1J1OH 5F6IB 1OAYH 1OAYL 2VE6A 4Q0XL 4ZG1A 1YC7A 5BXFA 1MLBA 2NZ9D 1PW3A 3L9RB 1II4E 4L3EB 1S7TB 4NQED 2ED9A 1OPGH 4NNPH 4Q9QH 1OPGL 1RIUH 1XR9B 4FQ2L 2BSSB 1DQJB 1FAIH 1E28A 5D7IB 1DR9A 1SVZA 4OIBA 4TULL 4Y5VA 3LKQA 4J2XA 3F5WB 1NCDH 1T20A 4NQDA 3CVHH 4I18A 2VLMD 5BO1H 2HT3D 3U6RB 4LSUH 2OXHA 4CVZB 5JPMA 4Y7MA 1DEEA 5I2IB 4HH9A 3K0WA 1A1MB 5F1NA 3MRMA 3HKFA 4OCWH 4WY7L 3MYJA 1S9VA 1W8OA 5E9DE 4LHUD 5F9DC 5J06A 3CSYA 4H88H 3EOAB 5C0FA 3R8QA 2YXMA 3QDJA 4EN3C 2BFVH 4NQCE 1DQLH 5BQ7B 2PF6A 2Q8BL 2AXJA 4HF5H 4BZ1H 3V4VL 5GSVA 4N8CL 3ELAT 2GITA 1J8HA 3MJ9L 2J5LB 5KJRH 3SKNA 4L4VB 3OX8A 2DD8L 3W2DL 3FO1B 1JHKH 2VYRE 4EIZC 2UWEF 3S35L 3ARRA 5IUSA 1WFNA 3X11B 1D9KD 4IHOA 2I07A 2OLDA 4KK8C 3R8BB 3BGFC 2IAND 4QRQB 5IMOB 1OTTC 1NC4B 3OAUL 1I1AD 2EDWA 2KH2B 3AREC 1MVUA 1MHEB 4GJTB 5CSGA 1NH6A 3D0LB 4Y19D 4PJ8C 2P7TA 5CGMA 1W0VB 4ZNEE 3KJ6H 3IVKA 3QFDA 4P5KA 2HJFA 4GAGH 1OTTD 3H9SE 3KNBA 5I15H 3RJDA 4JGMA 4YDIL 1D6EB 1JNHB 1PD6A 4C59B 4PJ8D 4PJDF 3ECBA 5HVHC 4KK5C 4LVOB 3GKZA 1WICA 4Z7WF 4Q6IC 4F7TB 4XPTH 1DBAL 5LVEA 4KK5D 2DIAA 4RAVA 3BRDA 1GOHA 4HKXB 5JW3H 1UB6B 2HFFB 3LKRA 4L3EE 3VGDA 4KDWA 5CWSB 2IFFH 2YA2A 1H3PH 4LNVA 4YUEH 3V52H 1H3PL 4JO3H 4YUEL 1B0RB 3GZKA 3KPSA 5D7IE 1C5DB 4RFEA 4C56A 1BX2A 2A6JB 1G7QA 1X44A 5E1AB 1EMTL 1KELH 1KELL 2DJUA 1FZMA 4IRSB 3IU3A 4WWKB 5ECJE 3T0DA 3G5XB 4QYOB 5LWYH 1GRWA 3U48A 2IALA 5LWYL 4UDUA 2Z91A 5JOFB 4M5YH 4XCNA 3QXAA 4R4FL 2MMXA 3WSQH 3C8KB 1G6RH 3OAYK 3MRIA 5DQ9A 5IBLC 3JWOH 1EHXA 1P1ZB 4WW1A 1DQDL 4NM8H 4RRPA 1V5JA 1VDGA 4X4YB 1DFBH 1HKLH 4MHHI 3LKPB 1LO5A 1PY4A 5IBLD 1E28B 1P4IH 2QHRH 4P4KC 2ZSWB 2R15A 4Y5VB 3GJEB 2R0WH 2MQ0A 5H94A 3VRLE 4QHKI 1S7WB 1LQSR 3LEXA 1I1YB 3AC0A 1Y18B 3CFCL 1M1SA 5CAYB 3CIQA 5I8EA 1UWXK 4TSCL 2B4CH 4L4VE 2B4CL 3UTTD 1DEEB 4AT6B 1LDSA 3MRQA 1ND0A 4JZJB 5F1NB 1A9EB 1BZ7B 3E8UH 4DKAA 5FUOH 4QOKB 4IBLT 5FUOL 4F33A 1YY8B 3MJ8B 4JFEB 3NTCH 5E8NA 3P9MA 5LQBL 1MCHA 1T7VA 1YZZA 3SHSA 3BZFA 1FFPB 3O3DA 1HYSC 2WAHA 5E1HB 4WI4A 5ESVA 3VFSB 4YGVA 5D72H 3NCCB 2FWOB 4CW1A 5ADPL 1HYSD 4P5TC 1FIEA 2DQGL 2QEJA 3FO2B 3HZYB 4PR5A 2VDMH 2BSED 2YN3A 4JDZA 1AD9B 3QP3A 4EI5C 3UTSB 3MROA 2H32B 2ZG2A 4P5TD 5ETUB 4MWFA 3OPZL 5KTEL 4YGAB 4QT5A 4EI5D 1LO0H 3P0VH 5EZIH 5EZIL 1IC5H 4KV5E 1YYLH 1IC5L 5CEZL 3JWOC 3CXHJ 1JMXA 4WEBL 3CZJA 1URLA 2EECA 2GSIB 5I16A 2ZUXA 2J12B 4XRCA 4X4ME 4RWYL 2AW2A 4AK1A 5IMMA 4WUKH 4POUB 1Z9OA 1MWAB 2X89D 5ESAA 2DKUA 1CR9H 1QPXA 5D96B 2QSTA 1YEKL 2Y5TB 5GS1B 4JRYB 1EEZA 4UQ3A 1CLZL 3T3ME 2NNAB 2VDNH 3MRCA 3LPGA 2R0ZL 3D0VA 4RSVA 5TQ0H 2JJTA 3CC5B 4L4TA 1ZT1B 3IDXH 5D7LA 3IDXL 3WUWA 3U82B 2ICWJ 1KN2H 1KN2L 2DQDL 1Q8MA 4RFEB 3F12B 2FH6A 1AKJA 5CGYD 2Q7YA 3KHOA 3RWEA 4RDQG 4X6CB 3KPRA 4J3XA 3VXOA 4UDUB 5DS8B 2OM5A 1FVDA 3TF7C 4DN4L 5D2LB 3PWNA 2FYYA 2W59A 3MRIB 5B4MC 1BREA 3FT3B 4PYGA 1LEGA 5GGTA 3B9KC 4QOKE 1ODAA 1T1XB 1I1CA 4MNGA 1B4JH 5J9PB 5CBAB 2B5IB 3VXRA 3MRKB 4JFEE 4PLOB 4AH2A 5I8CB 4POZD 2DLIA 4JQIL 4P59L 2RB8A 4HK0B 1QOKA 2DTSA 4HJ0D 4FXKB 5I0DA 4PJ5A 1CD0A 2NXYC 3UYRH 4BFEA 1RZ8B 3BAEL 5GGSB 5INDA 1XR8B 2NXYD 2X1OA 1HI6B 5HHNB 3DI2B 3B5HA 3HE7D 3ZL4L 3ROOA 4BUHA 3UTSE 1JV5B 4P2OB 2DWEA 1S9YA 2VQ1B 4NO0B 2AJUL 1LD9A 3TO4A 2HH0H 1Q0XL 1ZWIA 5GJSH 5FOBA 2N7AA 3OKNB 2D7TL 4BK4A 3A67L 5ESVB 4U7SA 2DQFA 3OKMA 4BQBA 1C1EL 4AENB 4XCCH 3SQBA 5J6GB 3GSVB 5FM5O 3EJJX 4PR5B 1NEZG 3OL2A 4OIIH 4XX1G 2IMNA 1QYGL 2B1HH 1IKNA 4C58B 2RGSA 4JRYE 4AG4H 4D9RE 3NA9L 1BGXH 4WFHD 4XNXL 4F15B 1DN0B 3UPRA 3MLSH 1YEEL 3MLSL 5CP3A 2VZTA 3DX9A 4LLWB 1M7XA 3RA7L 3ZE2F 4XRCB 4YK4C 3JUZA 5IVZA 5ACZA 4LSTH 4N5EC 4LSTL 2PYEA 5CUSH 4LQFH 3ARDB 4GUPB 2ZCLH 1L6ZA 5I1KL 2ZCLL 4I9WD 5DRXA 1W8NA 5DHYA 1JYWA 4X6CE 4BSJA 4YPGB 2JJVA 3IYLW 3VXUD 1JZ6A 5HHOD 3FZUC 4NZRL 2CGRH 2P8MA 5F96H 5D2LE 1FO0H 2X4NA 3MRCB 3L5WA 3MV8A 1W72H 4DGYL 4KFZC 1U8PA 3J7HA 1UGNA 4HUUA 3S5LA 4HFWA 4IIQB 2IJ0C 2QTEA 1ZLSL 4ODHH 4ODHL 5E2UL 4H1LA 3S36L 5JQ6H 3FT4A 5E70A 4NNXB 3D18A 3E0GA 1NUGA 3RWEB 4PGZA 3D3VD 1T0PB 3M07A 3QUMB 3VXOB 3O9WA 3DTXA 4PFEA 4WV1C 3TGXA 4I4WA 4LASH 2AGJH 1WWCA 4E0RA 1HNGA 1JFQH 2IBBA 3SKUD 1ROWA 2IH1B 1NL0H 2F74B 3VXRB 1EBPA 4MDJA 3FFDB 3M45A 1UQSB 5F7LB 4EUPH 1Q94B 3PHOA 1M7IA 4PV8A 3BPNC 4LARH 5EH1A 1EFQA 4LPWA 5KSUA 3DPBA 4JKLA 1BD2A 2Q6WB 1JF6A 1QLFA 4DKFH 4PBWD 4HUKB 1U3ZA 4YWGL 4FG6C 4NQVA 3FFCB 1K5NB 1JNNL 4M6OH 4M6OL 4AEEA 1S9YB 4R96A 1P7QD 4M1GH 3KYNA 3AUVA 2YMXL 3O6FC 4PJFA 3WS6C 2HWZL 5KANG 3ZT5A 1IM3B 3TWCH 4RGMB 2NW3B 5GGQH 1I9JH 4WHTA 5GGQL 1U36A 4Y4HC 5EUKB 4KMTH 5DMKB 4KMTL 2VNCA 3O6FD 2X1WL 5L0QC 3PL6C 2R1YA 3REVA 4BQ8A 1IT9H 4WTWA 1IT9L 4LCWA 3NGBB 1H3UA 1CK0L 3WO4B 4HWEH 3PL6D 4M5ZH 4M5ZL 3H9HA 2PO6B 5SV3A 5SWSB 5ERWB 2CLVA 3TO2B 3RFZC 5IM7A 2YUXA 3MX0A 4PREB 1KXVC 3WN5A 3MRBA 1I8KA 1P6FA 1PZUB 2HVJB 4UU9A 2FR4B 3B3IB 4JFYA 3D69A 3O3BB 4U3HA 5EOQH 5I74C 4U1JA 2P4AB 1J05A 3CVIH 2YBRB 2DLFL 4CU8A 1DP0A 2AV7B 5D1ZD 5C3LD 4GG8B 5DRNB 1NBZA 4IMKA 1HCFX 1A7OH 1F3RB 1IGCH 2PYEB 4GLRI 3EW3B 1U92B 3O6KL 1GGIL 2H2PD 5JA8B 5GISH 1HH6B 1T1YA 1N2RB 3B2UD 3RDTC 1XIWC 1IKFL 2DQIH 2XT1B 4IOIB 2QQLH 3O4LD 3T04D 1CN4A 1F4HA 3ARXA 3BWAA 4X5LA 4LOUC 4Z77A 1AGBA 5I1DA 4HUUB 1QD0A 3VXRE 2QKIB 3G04A 4E5XA 3QEUA 4LIQL 2HJKA 1A47A 1MJJB 3QI9A 2FHBA 4GMSH 4LOUD 2V7NA 4TQEL 3RY6C 4FTVB 2EDFA 1AHWA 3W81A 3HN3A 2KDGA 3BT2L 4ISVA 2F5BH 2KBGA 4KKCD 5I1HH 3QIWC 4FP8H 1IJ9A 1RURL 4ZDHB 2DBJA 4DGVL 2BCKA 3PWPD 1IAIH 3FFCE 4X9IA 3FRUB 1A1NA 1QVOB 1INDL 1ETZB 3QIWD 3C08L 4YBHA 3RGVC 2AKRB 2RCSH 4HWZB 4KPHL 4MDJB 1I9IH 2YPLB 3BGMB 4IRJB 4I5BB 1PG7W 3DROA 4LCCC 1BLNA 2C9AA 4Y2DC 5F9OH 1I1FB 5DJ8A 5F9JA 1T1ZB 1TQBB 1T3FB 3O3EA 4XH2A 5LGJA 3HZKA 2MKLC 4WCYL 3CCHB 3QULA 1J0HA 4Y2DD 4WJ5A 5ADOH 5GS3A 5F70A 5DJDB 5SWSE 1VESA 1CD8A 2F8VA 4BH8A 1R3IH 2BHZA 1QQDB 3BE1H 4FQHB 4OGXL 1O7SA 5E2VH 3ZYJA 1TVDA 2Y06H 4MA1C 5ANMB 3DMMB 5E6ID 3GSUA 2ITDB 1LO3L 4N8VA 1ZA3B 2PYEE 1CD9B 4LHUA 3GMQA 3ZSTA 1J0KA 3MFGB 4HXBL 1VACB 3CSGA 3RWIB 5DMIH 5E7FA 4OLWH 3DECA 3IDIA 3KPMA 1FSKB 4O2FA 1SY6L 3MRBB 4UBDC 3SKOA 5INCB 5I18L 3FB8B 2DKMA 3U0PB 3WFEH 5J1AA 4LLQB 4U6YB 5EC2A 5DD3H 3QDAA 3SO3B 4PRBA 3GSXA 1KFAH 1KFAL 4LF3A 4NKOB 5I30H 4UV7H 2GFBA 1OSZB 5F7WC 1BZ9B 1R0AL 4FTVE 4RIRA 8CGTA 1D9KA 1H3TA 4BKLB 1FCGA 3X12A 2IANA 1O0VA 1XGUB 4ZTPH 2FEDC 3QHFH 3JBG7 2OX5A 1AGEB 1NDMB 2DQJH 4PJHF 4HW6A 1I1AA 3O6ML 4GXUM 5FYKE 3ARWA 3EYOA 4Y19A 2A73A 4OZGF 2FEDD 1JPSH 1EO8L 3O4OB 4ZUTA 1L0QA 2WBJA 3RPIA 5IB1B 2YPLE 1S7RB 3K81A 4UDTA 4J8RA 5J8OA 1AH1A 5A2IH 1W0WB 3C8HA 3CD4A 2NY1C 1D5BB 4F58H 3BP6A 4JRXB 4NN6B 1AGFA 3FQRA 1NBYA 2Z93A 3UC0L 4U1HB 5CIPH 5DQDH 1V3MA 2R29H 4PJ9A 1HSAB 5M94B 1CICB 2IBZY 1VFAB 3MA7B 1QRNA 4CKVX 1PYWA 3GBLA 4GKNB 3IXTA 5AZEL 3VFRB 1C5CH 4MGXA 1AGDA 3U4BH 2XWTA 2HLAA 5DT1H 2VAAA 4NOFA 4GOSA 2P48B 1DQML 4EQ2A 2ICCA 4XP5H 3TN0A 5ANME 3GFUA 1S8DA 3QJFB 4HJJH 4ALAL 5EDXA 5DJ8B 3HNVH 5F9JB 1HH9A 3TBTA 3OGOE 4XH2B 1VGKA 4Z0BH 4ODWA 3OV6A 4MD0A 3EGSB 1N4XH 4UT6L 2AJ3A 3O8XA 3T3PF 1N4XL 1KB5B 5DJ2A 3QJHA 2CMRH 2IPUG 4ELKB 1UCTA 3MJ9A 3VXTB 4BH8B 2GK2A 4S2SA 5GHWL 1BFOA 3HG1A 4LEOB 3V0WH 3FHAA 2GCYA 4ODUA 4JGUA 1WEJH 2ZG1A 4Q2ZB 1U93B 1FG9C 1G6VK 3WHE0 2PUQT 4ZFOL 2Y72A 4MVBC 3EAKA 3MREA 5C0EB 4LRIA 4RNRA 3THML 5DK2A 4DZ8B 3ME0A 3UTTA 4IDJL 4Y4KA 4HKBB 1FYHB 3KPPA 1A6AA 3VRJB 6FABH 2DI9A 3GMQB 5EUOF 4Z7WA 2D0GA 3HE6B 5TE6H 4QTIH 1OSPL 4WI9A 2ITCA 4DEPC 1IRAY 1I8IB 2QQNL 3VGHA 1RZFL 4F7EA 1YEHH 3E6FB 4WO4B 1YEHL 5JW4M 3TNNB 4BELD 2YD4A 4XPHL 3VWJA 5JZ7C 4DKEL 1FC2D 2E9WA 4FQXA 5I1CH 2F54A 2ENSA 3IDYB 5ELIA 4XCEB 5JPNB 3TVMC 4Y5XA 5L8KB 2WWKT 4GKOA 3TNMA 1N5AA 4EDWL 1D5IL 1A21A 3IF1A 4NUJB 4L9LC 1RJCA 2AJXL 2OR9H 5A2LH 1FC1A 3TVMD 5E4EB 1BJ8A 3TYFB 4JRXE 5T1KD 4NDMA 3GGWB 4LPXA 3U7YH 4E41A 2LTQB 5K9OA 5C3TA 1UM6L 2ICWI 1QSEA 5F71A 4P2YA 3FQTA 1QR1A 3SY0A 3K46A 1NMBH 1NMBL 3WCYA 3RPIB 3BFOA 3TH2T 4XVJL 3ZE0F 2YD9A 2X89A 5ILTL 3GSWA 4H8WL 1ZSDB 3DYOA 5JW5A 1LWRA 4I0KA 5IMLB 1MCWM 2Z93B 2CLZB 4J3OC 4JHBA 4LSDA 5IFAH 1KJ3L 1HHHB 4HUNB 4K7FA 1NGZB 1Q9LA 2DL2A 3PQYA 4FQPA 3PWVB 4PJ9B 2V2TA 4YO0B 1X4XA 5BW7C 2HFTA 1TNNA 3FQWB 2HLAB 4PBXA 2JB5L 4QHMB 3MA9L 1ZT7A 1INQA 2BSRA 5BVPL 1CVRA 2XKUA 1I85A 1RZIA 2E7LC 3QH3B 4NGHL 1SYVA 1HH9B 1XF1A 5FYJE 4JY6A 5DI8A 5F7MC 2Q87A 3NFSH 2L0DA 4FZ8H 4I0PC 3O8XB 5HHMD 4MJ5B 3KLAA 3NAAL 3V95A 4ZOEA 3T65A 9CGTA 5DUPL 4S2SB 3PNWB 1OLLA 3W9EB 5HYIA 1KBGH 5CD3B 3H42H 3IS0X 3RU8L 1QFWH 5CS7A 1T4KA 3MFFA 3GI8H 3IJSB 3VI4F 1HEZA 5TPWH 4FRWA 5JXEC 2FGWH 3JWDL 5DK2B 4RX4D 2FGWL 3HE7A 4JFFD 2A1WL 3QCUH 2DQEL 4HGWA 3F7YA 3SOBL 5JXED 4JY4B 4R3SA 2ITCB 4P23C 5E7BA 4WFFD 1GOGA 3HPJB 2W38A 2W9LA 2CJUL 2EYRB 4ODBD 3BUYA 4FQXB 2F54B 1FNSL 2D2OA 2IQ9L 3O2DH 4M1DH 1IARB 1FNGA 4YHNA 2AEPH 2Z31C 1BAFH 2VLRB 1XFPA 5FHBL 1RUQL 3ARBD 5E94B 3U30C 2FX8L 2D4DA 1OAQH 7FABH 3RVVC 5CZVH 3ZLQC 1ACYL 2Z31D 1JGLL 4O02H 4O02L 4ZXBC 5DC4B 3MRNA 2PW1B 2O26U 2Y4SA 3CFEA 5D71L 4ONFH 4ZSOA 5FYLE 1HK6A 1QSEB 4JG1L 3LSOA 4Y88A 4ZXBD 1CXEA 3GHBL 2ZWLT 2APWA 2E9IA 1K2DA 1EHAA 5IQ9A 4F7MA 3NCJL 1CDGA 2COQA 3FB5A 3TJHD 4FHBD 5MEOA 5E5MB 3N50A 3S8WA 1KCRH 4RAUA 3QXVA 2GKIA 4KHXH 3VFVB 3GBNL 2YSSA 1DDHB 1WCBB 1XGYL 2ZOKA 3QO0A 1CLYL 4OCRL 2AV1A 1FVEB 1RJZB 3EO9H 1V3LA 3EO9L 4NO5A 4PTTA 1XCQB 1I3GH 2X4OB 3UTZB 5LCVL 4JFOA 2EC9U 1A9BB 5FDYA 4V1DB 1ZT7B 1INQB 4P2RD 4F8QA 5CFHA 3D3VA 1GGCH 4G5ZL 3VFUA 3UDWC 2AAVA 5MERA 1RZIB 1EVTC 4MA7H 3ALWA 1J8KA 3BN9C 1INEL 3BVNB 3OJDB 1S7XA 4M93B 3KJ4B 4UNUA 3WHXA 1LE9A 5KG9B 2JJUA 3BQUB 4HWBH 4XP9L 3TYGH 4XHQA 35C8H 3G08A 1SVCP 4LCUB 1U2HA 3RL1B 2AJSL 1J87A 5D2NA 4XPBL 1AY1H 1T4KB 1AY1L 2VDKH 3JV5A 5E8DL 3FT2B 3RPKA 2F54E 3G9VA 1HEZB 3JVGC 2CIIA 3WFDH 1YNLH 1A4KB 3KPOB 4P3CL 5C08B 3WFDL 1KGCD 1T03H 2VLRE 1WFTA 3GJFH 2WIMA 1EVUA 2NYYC 2R1XA 3OAZK 3BKJH 3DX8A 5ICZA 2WWMC 1Z9SA 3DO7A 4MSWB 4QRSB 1A7QH 3VFGH 1A7QL 2NYYD 4F8TA 4MZ3A 5KS9B 2OL3B 5DVKA 3N1FC 1QSEE 5SV4A 4QTHB 3QDHA 3V7AG 1AC6A 1QFOA 1YMMD 1CQKA 3MGTA 1JRHH 3JTTA 3V6FA 5BRZB 3W0WD 4TNVF 2YD2A 3JTSA 3HCVA 2NX5A 5EBMB 3QWRD 2JIXD 3T8XB 4Z7NE 4JPKH 2B8OT 1S7VA 2FJGB 4GAYA 3O11A 2G75A 1RI8A 5JLZA 1TQCC 3MJGX 2WP3O 3MRNB 1HHJB 3EYFA 5HPMA 2P24B 5IG7A 1FL3B 1HNFA 4GW1B 3UEZA 3GMRB 3MNVB 4OV5B 1DBMH 4YEFA 1DBML 1IGMH 4TOYL 2X4UA 1K2DB 1FPTL 1G7MA 4NJAH 5MENB 5CEXA 4XPFH 5GRVK 5T1MA 5L2KB 4XPFL 2GI7A 4V1DE 4YDJB 3MRJB 5FO8A 2VB5A 4QRPA 5K9JL 3STBA 1LP9F 4PLNC 4JPIA 5IEHB 3O4LA 1Q9OB 2Q76A 2AK1H 1DSFL 4R2GD 5DD1L 4A6YB 1EFXD 3L3IB 5EN2A 3MLXH 4N0UB 5H37G 1TITA 1F8TL 2AV1B 1KTDA 5CBEA 2IAMB 1MUJA 1SEBA 2QADD 3G6DL 4LSQL 4HUVA 2P43B 4NZTL 4NKDB 3WIFA 3BYYA 1CFVL 1TZHA 3TBYA 43CAA 5BZDA 2VR4A 5J1SC 3N85L 5C08E 3MYZA 4NBYB 3G6JF 3L3JB 5C6TL 5DMJB 3VXNB 3PUCA 1CFNA 1U3HC 2FJHA 1WGOA 4YC2C 2VLLA 3RGHA 1XAUA 3P40A 3WHXB 2BC4B 5CEZE 5I76A 3TA3B 5AZ2L 3VD4A 4I48A 4FS0A 1EEYA 4KU1A 5FUZL 4XXDA 1NMAH 1U8JB 3G08B 5KS9E 1NMAL 4NQXA 4LVNB 3B2VL 3QWQB 1VFBA 2J8OA 5BRZE 1QSFD 1NJ9B 3JSSA 1UYWL 5DVLA 3VH8G 3Q5OA 3SE4A 4JM4L 1QBBA 3KYOA 4NQSB 4PGEA 4NM4H 4NM4L 5SX5K 3VA6A 4JZOA 3SDXF 4PJBF 3MRRB 1OTUC 4MS8D 4HAGA 4X80L 4IOFC 3VDBA 4S1QH 4OCLC 1Y6KR 1Z3GH 3CJJA 3R0MA 4LPYA 1R3HB 4YXKH 5JIIA 4KTEH 3B6SA 2EIZB 1OTUD 5FGBA 1QACA 1UH2A 3LEYL 4MXVE 4UZGA 1DQQA 1FAKT 5F44A 5E6IA 1U58A 4I13B 4PJXF 5D6CA 3HCVB 3L95A 3T0XA 5MENE 2F19H 5BCAA 1UVQB 2F19L 3MLZH 5L2KE 1TZGL 3CXDL 5FGCB 3MLZL 3SDDB 1DVFC 4GAYB 1QBMH 3MV7A 3OJMB 1T66C 3OKKB 4N0YL 4A2LA 1DVFD 2W1NA 4C4KT 2NY3D 5IROC 3SGEI 1T66D 4L8DA 4WTZG 2O5ZH 1RHHB 1T21B 4OGAD 4N0UE 3MCLL 2ARWA 2CKBB 5DFWH 4OFPA 3BJLA 4HBCL 2PW2A 1CGVA 5CHNB 4ZUWB 1OGAD 3WYRA 3CFBA 3RTQD 5CEXB 2IEPA 4NFBA 1J0IA 4XMLH 1HDMB 4XMLL 4LMQI 1ZXQA 5B22A 1M71A 3TCLB 3MRDA 2X7LB 4MA8H 1RFDL 1VKXB 4MA8L 4CNIB 5CMAB 3OAYH 5BV7C 2H1PH 1JK8A 1AQKL 3I84A 2A6IA 3MRFB 3RZWA 4OZ4A 4G43A 1WIOA 2D03H 1ZANH 2D03L 4X7SH 2GK0A 3A6CH 4X7SL 2E7CA 3TBSB 5J1TC 3QRGH 4G6FB 2UYLB 3QRGL 4WFED 1L7TH 3QG6A 3NOIA 4OF6A 1AO7A 3WIFB 1PEWA 5F7DA 1TZHB 4LLDA 1Q9KB 43CAB 1WC7A 2D3VA 2E27H 1JWMB 5IB2A 4CJ0A 3VD9A 4HV8A 3QQNA 3ZZ1A 4LSVH 4L29B 4L3CA 5E2TL 3BH9A 3OB0K 1ZGLB 4YBQD 3BSZH 1EXUB 3SDYH 1BMGA 4NN5B 5EZJA 1QLRA 4KRMB 1PQZA 4HUMB 5DQJB 2H45A 5DR5L 4OGYH 5HGHA 1GOFA 4I3RH 4UB0L 1R5IB 3PHQA 1E0OB 1KYOK 3PP3K 4G9DA 1RY7B 1QBAA 3GMLA 3NACH 1SY6A 4G7VH 4UIKH 5ALCH 4JKKA 1PLGL 5ALCL 3U46B 2MTPA 5FGCE 4LCYB 5D70L 2FLBT 5ABDE 3SCMC 4JFDA 3U4AA 2FX7H 2FX7L 3BIBX 5LAXB 1UZ8A 4PG2A 3P4NA 2WUBH 5HGAA 3SCMD 4D94A 3HAEH 4PJHA 4D8PA 2ICWA 5K59F 1CE1H 1G7IA 3AM8A 1JGUH 3ZDYF 1CE1L 3QEQB 3VDAA 5TDNA 3L3DB 4OZGA 4GXVL 1D7FA 4XVUC 2JCCB 4FFWD 4YIQA 3MGOB 2CPCA 4PJCF 4JY5L 3KGRA 5EB9A 5T3ZE 1FH5L 2FNBA 3LIZL 3STZA 2ZZUT 4AL8L 4ZPVB 4R7DA 4RGNC 4XVUD 5DD0L 2BNRD 4J3TA 5CCKH 5DHVA 3FAXA 3BMWA 3Q6FB 5CLWA 3N1PC 3QUXB 5J13C 3QAZB 4HH8A 1VADA 4RGND 3WE6B 2P1YA 3KLDA 4ZD3L 3S88H 1ED3A 1UZ6E 2X41A 3UP1A 3VRIA 4HWUA 5DJ6B 1CWVA 1D5MA 1A6UL 5DJXB 2IG2H 2PW2B 3ARSA 3HNSH 5CJOH 4MAYB 1ORSB 4Z76B 3LQAH 4DQOH 4QRTB 4PRDB 4DQOL 2CDFB 3MMEB 3W5MA 2H41A 2OI9C 1RJLA 4OUUA 1KXQE 1C08A 1M71B 5GPRA 3GMMB 4WUUB 5CSZB 1CF8H 3BEVB 4L9DA 4DVBA 4BSWA 4UT9L 1JK8B 3UBXG 2ATKB 4AM0B 4OZ4B 4G43B 1MLCB 5HGBA 1UM5L 1A6TA 3QQ4B 4EXKA 1T1WB 4QXUH 1GHFH 1GHFL 4U4BA 4JHWH 4XTRD 1I3RA 5IJKC 2ZSVB 3ARVA 3D25B 4XBEL 3WKML 1AO7B 3HAEG 5FXCH 3LZFL 5GGUA 5AD0A 1FZOB 1A3LL 2R2EA 5C6PB 4U1NA 1PG7X 4TPRH 4TPRL 4H20L 1NEUA 3CMGA 3KYMA 1LO4L 4GQPH 4YZFE 4L8SB 4OAWB 1AXSA 4Z7UB 3WNKA 4CADB 3BH9B 3FONB 2NTSP 3MBEC 4ZFOA 2R4SH 1MQKH 1JZ8A 1F11A 2JK5A 2V5TA 2F53A 4LNRB 4OT1H 4J3WA 2P5ED 4JPWH 3MBED 3QEQE 1YUHB 2ADJB 4G9FB 1ZS8A 5DMGC 4UILH 3LDBB 2JCCE 3UTPD 1NANH 1JVKA 1CG9A 1MPAL 4X99B 4P46B 2BVPB 2WANA 4YHKL 3PIQB 1X7QA 3CLFH 5GRXG 3CLFL 5DMGD 4L8BA 1JGDB 3EYVB 4MQSB 3LQAC 4F37K 3SDCB 4KY1H 3Q5TA 3QIBB 3U9UA 5EFIA 1UZ8B 4G3YL 5I71C 3P4NB 3GO1H 3BISA 3GO1L 2CUHA 5I8KH 4R0LC 5C0BB 2XG4A 3CUPA 4WI2A 5TDNB 3ZKXC 5I75B 3OZ9H 3NCYS 1CD1A 4WHYH 3LN5B 4LSPH 5CKAA 3IKKA 5JQHC 4JREC 5FV2A 4LSPL 5C07D 1TVHB 4FXGB 2XFXB 4JFFA 4KROB 4R7DB 4AIZA 4OLEA 4N1CA 1KENL 5KVDL 4WUUE 2CH8A 1F4AA 4KH2A 4J3UA 4DGIH 5A3ID 4Z7VA 4U6VH 2X4RB 4U6VL 4YXLH 3KDMB 1P4BH 3VGEA 2AERT 3NIDF 3RZCA 4TVSa 3HR5A 1NFIB 3T0EA 3CH1A 1NGWA 5FYKU 5DURD 2B0SH 5BJTB 5I0ZA 3ARBA 3QUKA 4NC0B 1AO7E 4PJ7A 3N9GH 2CIKB 5CINH 3HI1B 5CINL 3H9ZA 2M8XA 3MLWL 2NLJA 2NY4D 3ARFB 3VXQB 3DX6B 5KSAB 4FA8A 3NFNA 4Z7UE 2EIDA 4TVPE 1JL8A 1NAKH 1EEQA 3OXSA 1X5JA 3CDYA 5HDBF 4LLMA 4G7YL 4ORGA 2YWYA 2VDQL 4OI7A 1QP1A 2HKHL 4O5LL 2CSPA 2PXYA 1X5FA 2JB6A 3ULUE 4K3GA 3P0YL 1PVHA 4M3KB 1PKQA 3GDBA 2A2QT 4S1SH 4G9FE 3GSQB 3SDAC 4U1NB 2X9YA 5K93A 4OM1H 4JO2H 2IPKB 4JO2L 4X6DF 1H3WM 3SDAD 3KR3H 4U31A 5I73C 3HMXH 2R2HA 4YR6A 3DI3B 2J8UF 3IFOA 3O41B 1F11B 2QHLA 3SN6N 5F3BA 4GRMA 4HHAB 1A14H 1CE6B 3OKDB 1FNAA 5C0BE 1ZHNA 1F6FB 5T3XE 4JHAL 2VWEC 3LH2L 3ET9F 1F3DJ 3UJIL 3WIHL 5DF0A 1CXHA 2HFGL 2ZCHH 1N26A 1X7QB 2NPLX 4OTXL 1HWHB 3P4MA 4OLXH 4L8BB 3KPLA 5CD5D 4R97B 5DZOA 5FDWA 2R4RH 2BVOA 2Z35A 5KANI 3U9UB 4IEFB 1BECA 2CDGB 2ZUWA 1PKOA 3L3GA 4XAKE 3NABL 1AD0A 1DLFH 4JE4B 1HOCB 4X9HA 1KNOB 4FQ1H 2MFNA 1BPVA 3H6JA 4PRAA 5SWZA 2W9EL 4LCIH 5DVMA 5B38G 4JDTH 2P47B 4M1CC 4JDTL 2QR0B 5IBTH 3HR6A 3L6FA 5C0CB 4JM2F 5I1AA 3S6CA 4U1GC 4M1CD 2OXGA 3E6HA 3PDDA 4GS7B 1WV7T 3U0TA 2OTUA 2JJWA 1ZOXA 1FIGH 1BFVH 3D2UB 3NFPA 5C9JB 4NBZB 1MFAH 1KCLA 3RZCB 1YMMA 5ALBH 3OBAA 3FN9A 5BVJB 2N7BA 1K6QL 3NIGF 3UX9B 3MLUL 4KDTC 2AXFB 1RIHL 1U6AH 3HS0B 3QWRA 2R2BB 4G8GD 4XVSH 1F4YH 3RWDA 4XVSL 3QHZH 3QHZL 3V6OA 4JANA 2W91A 3WXVH 3WXVL 5TGBA 1P9MC 5EU5A 1UKTA 5J6HA 4HT1L 5L2JB 4PJGB 4E42A 5EO0B 1CZ8L 2BHUA 1A7BA 3HNTH 4M3JA 1EK3A 2PXYB 2C3XA 2G5RA 1KIUA 1MRDL 1UWGL 2CDEB 3RQ3A 5DK3A 4ZFZA 1OF2A 3QIUD 2VN4A 4N90D 1VPOH 4B0MM 1NUDA 4KJWC 1CDIA 1AI1H 3EIFA 1AI1L 5HYSB 1ES0A 3MUGA 1DL7H 2WQRA 4YR6B 1UCBL 4KJWD 5IW1A 1DE4B 4JM2D 4HUWB 4NQTA 4APQB 4CAGA 1H3GA 4M7ZC 5FYJU 1VEPA 2LU3A 5JHDB 3GJFA 1E6OH 3BUTA 3PP4H 2ZCKH 2V17H 3QCTH 3QCTL 2XA8L 4XP1H 4HSQA 2EZ0D 5FHAL 2FL5A 3UMTA 3L3OA 3TZVB 1BBDL 1KPRA 4JFPA 2MCPL 4YHOL 1J10A 3O45A 1FBIH 1NMCC 4P49A 1G7JA 3VXSD 5T1LB 1X5ZA 5C0CE 4GG6B 3WIIL 1MF2L 3CU7A 3ARTA 2XWBA 3SE9L 3OMZA 2QSCL 2BMKA 4M48L 1UWEH 1MCSA 5L8JB 5IIEB 2IH3B 2RFXB 2A77H 4PJEF 3RX8A 4LDEB 4QY8B 1OARL 5SWZB 3VMPA 2PNDA 3QUYB 2A83A 2Y07L 4U05A 5DTFB 4PJAF 2EE3A 2GTWB 1EGJL 2VDOH 1C5BH 5JO5A 2P5WA 4OFYA 3E6HB 4HAFA 5EOTA 2NY2B 2J6EA 2ICEB 1D6VH 1FFRA 2AJYL 5E6YA 3BMVA 4PJGE 4K94L 3WL9B 4XCFL 3NFPB 5E0QA 5ESQB 3ARGC 3P3YA 5JOEA 1NGQH 1P2CA 3ILPB 4MD4A 1JPGB 1CDCA 2GJZA 3VXMD 3TFKD 5LGKA 4R7NB 4XXCC 4EVNA 3ROLA 1G0XA 4NQEB 3OKEA 1GGYA 3MRHB 4FQIH 3ZYZA 4JANB 2OCFD 2VR9A 3R1GH 5HI3D 1PX3A 5D7SL 3F8UB 4Q9BA 5TGBB 5EORH 3QPXL 5IB5B 1TDQA 2WUCH 2WUCL 3RVXC 3LB6D 4P3DA 2HT2D 5F3HB 1J1PH 2XTLA 3K80A 2X4PA 5IHUL 3RVXD 1S5IL 3SGJA 5JHDE 4P2QD 3EDKA 2BVTA 3I6GB 3D85B 5DJZB 2VXTH 2PKDA 5I66B 1SM3L 3X13A 3MOAL 3ZTNL 3P11L 3F7VA 4NCC1 2I9TA 3OR6A 5GS0H 5E2JA 3WFHB 5GS0L 4UAOC 4WW2F 3DSFH 4Q9CA 3GSNB 5GGRA 1ZVHA 4PGDB 4EN3B 3T1WA 1UADC 1EBAA 5DEGA 1TTUA 4GG6E 5IHBA 4YBLC 4PJBA 5E2WL 1QSZA 3I9GH 4MQTB 3I9GL 4M61A 4ODXA 3WKNA 5MI0C 1CL7L 4UUJB 5KAQG 4LDLB 3IDNB 1FFOB 4QCIA 2EDDA 2M26A 3UJJH 1HSBA 2AK4B 1QEWB 5SWZE 4P9HC 2AVGA 5EULV 1SEQL 1QFUH 4X6EB 4PJXA 3MBXH 3O45B 4Y8DC 4HIEB 5HTSA 1N7ML 4TSBH 1U8MB 4OBRA 1G7JB 4YJZL 4U7KA 3LRHA 1BIIB 3MR9A 4RFNC 3AREB 4M43H 2EKJA 4XBGA 4PJ8B 3P4OA 5C8JB 3IFPB 4KAQH 1KPVA 5HDLA 1C12A 3NIFE 1H5BA 3FO9B 3BEWB 3AROA 3C6SA 1AFVL 4L1HA 1FZKA 1MNUH 4EDXB 4MQXC 5HVHB 1GC1L 1NFDF 4NC1C 3LEVL 4XBPA 1G7HB 4Q6IB 1YNTA 3NA4A 1GAFH 1UEMA 4HIHA 3E3QC 3LV3B 3V6ZA 3WFCH 3WFCL 1HHGB 4NQEE 5B21A 2H6PA 4LLUB 2NY7H 5C0GB 3BDYH 1TIUA 4CL7A 5D7IF 3RIFK 1BM3H 2P5WB 4XMKH 1SYSB 1DUZA 5E4IA 1FYTD 1GZPA 2OTWB 3MCKA 3C5ZA 1E27B 4Y1AD 1B9ZA 3LPWA 5IR1B 2VLME 3EJZC 2PETA 4QNPE 5EPMB 4PP2A 2W65A 5AWNH 1WAAE 5HVFB 3C60D 2OK0H 2EYSB 3QO1A 2OK0L 5GS0D 4G8IA 4NWUH 2OZ4H 1RULL 1H3VA 3I3BA 3EJZD 2UWEB 1W0YT 4EVNB 1OAXH 1NLDH 1NLDL 4R26L 2NXZC 1LNUB 2X4TA 3UJTH 3BD3A 3VRLF 3HRZB 4W4OA 1MELA 4MA3B 4J6RH 4NZUH 4HCRL 4O58H 4NZUL 4O58L 3U36A 4HKZA 5I17B 3ARZA 3H9SD 1KLGA 2UUDH 4P4KB 3QPQD 4F2MA 1A7PL 3WNOA 4L4JA 3H8NA 2EDBA 2A0LC 4PJDB 1RIVL 1VEOA 2LU4A 5JR1H 5DDHB 3MRGB 4GW4A 1U8KB 5F7EL 1RZJH 5KVEH 1I7ZB 2AK4E 5KVEL 2A0LD 3BP7B 1XZ0A 4KXZI 2DIBA 1XT5A 3OR6B 3K2UH 4HKJB 3K2UL 5GRUH 4L3ED 3IJYA 3LPFA 32C2A 4NSKB 3REWB 4OSUH 4HUXB 1Y6NR 4XNMA 4LP4A 4GQ9L 4PP1C 3ZKQD 1YN7B 5LKNA 4MD5A 1WF5A 1U8HB 3LKNA 3CFDB 3ULVC 3W82A 1FRGL 4PP1D 1EAJA 1JGVL 1M7DA 4F9PC 5IFJA 1T83A 2GJJA 4U0QB 4P5TB 3IDGA 5FM4A 5DUBA 1S9XA 5E99H 4ZTOH 4OM0H 3VMNA 1V7MH 2VDRH 4DVRL 3VI3E 3VFWB 1P4LB 4KV5F 3L3HA 3WJLC 1CL7I 4NRYA 3SBWA 1Q0YL 2XTJC 1OM3H 1LE5A 1V3JA 1OM3L 3HC4H 3OKYA 3MR9B 5GGVL 1WZMA 4D3CL 1YEGH 2P5WE 5IB3A 4HQQH 4XBGB 1F58L 2J5LC 1KYOJ 1U8OA 1KPVB 1G6RB 4MXQD 2XTJD 1C16A 1N59B 3CFKA 5JW4R 3RL2A 4MCYB 2W0FA 3HZMA 1NKRA 1YEJH 4KVCL 1EJ6A 1YEJL 3GIVA 2HLFD 1I9EA 1MHHB 1NGXB 1T2XA 4D0BA 4L4VD 3T3MF 4X9GA 3FHQA 5DRZA 3C6LC 1CGSH 4HLJA 5HDQL 1MHCA 2UWEE 5DRWA 2H3NA 4I0CC 5F88A 3TIEB 3C6LD 5H2BA 1NC4D 1RZJC 3LS5H 1T0MA 2HFEB 4LU5L 3MCKB 1C7SA 4MXWH 3CMOH 5IWLC 3CMOL 1SJHA 4LPTA 3VGBA 1JPTH 2VUYA 2D9CA 1JPTL 4LLAA 2Z8SA 2HVKA 4WNQB 3HUJB 2GT9A 2CRYA 1JI2A 4G8IB 1DLHB 4PJDE 1HILA 5B8CA 1R3JA 1KTKE 1REIA 1WITA 2W60B 1MJUL 4Y5YC 1U8IB 4S1RH 1RVFH 5EOCJ 1KTLB 2ZJSH 5E56A 4Y4FA 2ADGA 4KRPC 4XC3H 3B9KB 3L5XH 1KIQA 3TIDB 1M4KA 5TQ2L 2H32H 3BIKB 4IRSC 4QXTA 4OB5H 5HHVL 1B3JA 2NXYB 4F7PA 1AE6L 2DOCA 2N4IA 3VD7A 1BOYA 5HHPB 4GSDH 4IRSD 3KWWB 1FL6A 3MRPA 4PY7B 5KSVA 1F4XL 2OJEB 4O9HL 15C8L 3O2WH 5E08H 3O2WL 5EU4A 5E08L 3PABB 3WDJA 4LKCA 5K9QI 1MWAL 3SJVA 4O2CB 3LN4A 1N3NA 3EDDA 3DBXA 4XNMB 4XWOC 3QA3A 3QDGA 3KPQB 5F7NC 3H3PL 3T09A 5TE4L 2DDQH 1VGEL 3BGAA 2ATPB 4I18C 4MD5B 2DDQL 5C71A 4YHYC 4WU7A 3I50L 4XWOD 4CVWA 3OHXB 1UC6A 5HD8C 4NQDD 2PCPA 1X5AA 3X14B 1EJOL 4KMQA 1ZVSB 2E8YA 3I75B 4NT6B 1J1XL 1PFCA 3RI5K 1AC0A 1NEZB 3F58H 3JV6B 2EXWC 5EIQA 3F58L 2EH7H 2GTZA 2V9RA 4QOKD 3KS0J 1AP2B 3OAZH 2VKWA 3GNMH 4JFED 2BRRL 1H0DA 4JPVL 5I1LB 4EBQH 1CIDA 1LGVA 1QFWM 1AJ7L 5F89B 5MP6H 1TJGH 2LABA 5AUMA 3RL2B 4OZIB 1F90H 4X6CF 2W0FB 4I2XB 1NCWH 3P73B 1NCWL 3T4AA 3IJHB 4YK4B 4NNYB 2C3GA 1NBVH 3HUJE 5IJVA 4XNUH 1JN6B 1X5XA 5D2LF 4XNUL 3VXUB 3TT1H 1MJ7H 3AY4A 5B39B 1G9NL 3VMOA 1T0NA 3TBVA 3EJYD 4EI6A 5JDSA 1JYNA 1K8IB 5F88B 5IMKB 4QXWA 5DYOA 2JELH 4XAWH 5I1JL 3K8LA 4F7CB 1A6ZA 1NGPH 1IZJA 4X98B 2VITB 1YDPB 4PD4K 4H0HB 1RK0A 1LK2B 4OD2B 4ZPTA 5KN5A 4RWHA 4TUKL 1MFDH 3EYQC 5CSBA 5D96C 3TBWA 5DUML 1I7UA 2EICA 2EH8L 5EO9A 5T5FH 3VGFA 5GRVL 5KVFL 4OZFA 4ZAKA 4OFKA 1R3JB 1BQHB 3EYQD 2ZUQC 1EUUA 4K71C 1CLOL 2FIRT 4M02A 4WV1B 3AAZA 1MIMH 5KSBB 1UB5B 1YEDA 5EA0H 3QNZB 1GGBH 4JRYD 5ISZB 2YN5A 4D9RD 2ADGB 5BMFH 5BMFL 2I60L 3MO1B 1KJVB 1FE8L 4N9GA 2VDPH 4LLVB 1XF2B 5B3JE 1A0QL 2NQCA 3CPLB 4MYWB 4UINH 4QXTB 3WFBH 3OXRB 4TNWK 2J8UA 3BPNB 2C4XA 3MZTA 4YAQA 3FQUA 2FO4A 5HPOA 2X4QA 4HLZG 5MEPA 1U3JA 2YPKB 4G8GA 5JMOC 4U1LA 2QSQA 2VLKA 5KSVB 3Q5YA 5GRJL 4QKXB 4RRPG 3OKLB 1PY9A 2HJLA 5JNYA 4F9LA 2SEBA 4R6UA 1JZ4A 2VZSA 2C4FU 4WFHE 3SJVB 4XX1E 5BOZG 1HZHH 2O5YH 2YRZA 1HZHL 5IT2L 1CFQB 2DRUA 3O6FB 3QA3B 4HIJA 2P8PB 3WIHA 5T33L 1IC4L 4OFDA 4QHLA 5L6YH 3UPCA 4Y4HB 4P0DA 1R3LA 4WU7B 2H2SD 2A6DB 4OZIE 1KT2A 5L0QB 2YUZA 3PL6B 4I2XE 1KLUA 4FFZH 3QIUA 3SE3A 5DJAB 3VFMB 3BPCA 2V2WB 4G6AC 3C09C 2C1PA 4H5SB 2Z92B 3VXUE 4C57C 3VFNB 1DUYA 4KGLA 2XWJB 4PTUA 4P2OD 5HJ3B 4KKAD 1MFCH 5T5NG 1X3DA 5DJ0A 1KF9B 3QUML 2GUOB 5CP7B 1QFPA 5C0IA 3IXAB 2VXVL 2FEEL 2EKSA 5I74B 2DWDA 4OLVL 3RWJB 2XI9A 2EC9T 5GGTH 3DHMA 3BN3B 3WO3B 4KK9C 4L5FH 1RZ7H 1JUFA 3EO0B 1J5OH 3DUSB 3QQ9D 1OT1A 3WD5H 3HMWL 4EUPB 3NBNA 3U9PH 1T0NB 3U9PL 4PGBA 5HI5D 4KK9D 3U7WH 2A6KA 3RDTB 4PUBH 3VXSA 1MRCH 1XIWB 1MRCL 3IDMA 4UMGA 1ZAGA 1KCUH 4UQ2A 5DYOB 5KSBE 3LKOB 5ISZE 1MCOH 1MCOL 4BK5A 4XP6H 2C7UA 1FV1B 2I27N 5EU6B 5K9KA 2ESVA 2EEAA 2NZIA 4H25A 2NY0C 2XRAL 3GHEL 4I3SL 4OD1L 4FQQA 3WNLA 4DZBA 1G0YR 4YH6A 3L1OH 3G5VB 3V4PL 3U4EB 1T22B 1DEDA 2NY0D 1IVLA 1I7RB 1FZJB 1JTOA 3ARDD 3PWPB 4NHUA 3S37X 2NY6C 4DAGL 3FN0L 4YQXL 1KJMB 1IEBA 5DK0A 5LXGH 3QIWB 1OB1B 1ZHKA 2JJTC 1MHPL 4QGYA 4HFUL 3FB6A 3ULSA 4KJYA 3WUWG 4JFHE 2BJMH 5GS2H 1KSRA 3QUZA 5FUCC 1Q72H 3SJVE 4MZ2A 1RUAH 3FQXB 1BVLB 2EE2A 3RGVB 2NY5C 5FA4B 2R9HC 1F6AA 2WIIA 1KN4L 5IB4A 2AXGA 3MC0A 4FABL 5FCSH 4LCCB 2HG5A 2FO4B 1J0JA 3KYAA 3QEHB 5MEPB 1AKJD 4FZEL 3ARYA 1B0GB 4Y2DB 1RMFL 2R9HD 3V5KB 4G8EA 4NO2A 3P0GB 2ILLA 1MI5A 5CP3H 4U1LB 1MEXH 1MEXL 2Q8AL 5DD6A 3QYCA 1CU4H 2BNQB 2J88L 2NW2B 1CU4L 2HRLA 2WWKO 3Q6GL 4OZHB 1YJDL 1ONQA 2Q7NA 4OLYH 2E7BA 3QG7L 4OLYL 2IC2A 2GJ6A 3VXRD 4WRLA 4FQLL 5GIRA 2VDLL 2B20A 5D1QA 4G6ML 4K7PX 3LQMA 3BJ91 4K3EH 4MA1B 5A16A 3VFTA 4PJ5D 2WBWB 1KLUB 4XWGH 3D39B 4L8CA 3IETB 2XPGA 4PJEA 3LAFA 4YHML 3BW9A 2G5BA 3TO4C 4JFQA 3EUUA 3FFCD 1HXYA 4NCDA 2XZCH 5L88H 2HMIC 4PJAA 2VH5H 4WEMB 1RUKH 1ITBB 1RUKL 4U0RC 4JDVB 1Z2KA 2I25N 1KG0A 3IFLL 5EU6E 4GW5B 5FYKL 4HDIA 5D1XA 4HX1A 1FFNB 4OLZH 1EGJA 1S9WA 1I1RA 3GRWL 1BQUA 2D7NA 2FEEI 1FJ1B 5GS2D 4YHIA 4YXHH 1U41A 1IKNC 3MLRH 3PWPE 3MLRL 1IGTB 4HC1L 2YK1H 1T2QH 2PO6D 2DIJA 5SWSD 3S4SA 3HZVA 3TC9A 1KJ2L 1NSNL 4Z95H 2ESVB 2LAGB 4H25B 2OR8A 1CTOA 5EOCL 1G7LB 1PSKH 3LKSA 5J89A 3GMPA 5C0DA 4XP4L 5I1GH 1NUNB 4OQTL 3LY6A 3VWKA 2PYED 2A38A 1JF1A 4XNQA 3SKMA 2NY1B 4NHUB 5E9DA 1PX4A 2ARJA 4S0SD 2ORBL 4PJFF 2BNQE 2FIKB 1ZHKB 4GAJL 5HGDA 3S5LG 1IQDA 1QLEH 4NQCA 1E6JH 4KJYB 4OZHE 5F9WC 4RA3A 4PRIB 3NZHH 3H2WA 3NZHL 3MV8D 4H1LG 3ZT6A 4WW2A 1P5VA 1TZIB 1KPUB 1SJXA 2R0KH 1C8PA 5DEFA 1H15B 1CFSB 3INUH 3C60A 1MREH 2R0LH 1IGYB 1J9CT 4N0FA 3O9WC 1HIML 3E1F1 4E9LA 1N6QL 4FTVD 4Y16A 1AQDB 2O93L 1X5YA 1PZ5B 3D39E 4CJ1A 5I19H 5CJXA 5E00B 2WNGA 4M6NH 3O9WD 2FJFA 1I7TA 2MHAA 3BO8B 4ZS7H 2MPAL 1ONQB 5D6DA 1NCUA 4IRZL 4ZNEA 4R8WH 2AI0H 3H9SA 2PTTA 1NDGB 1VA9A 2PYFB 3CK0H 4KDVA 5DJYA 4YHLL 1BFSA 4RGOL 2APTA 4P4RB 2V2XA 3UZVB 4IRJD 1ZTXH 4NUGL 4KHTH 5ITBL 2VXQH 4YHPA 2G2RA 3GIZL 2XPGB 1FG2A 5IHLB 3KAAA 5FB8B 1ZLUK 1JE6A 2X10A 1V7NL 2FD6L 3FO0H 5MHSE 3T0AA 3FO0L 3ARQA 1S7TA 2K7PA 3RAJL 1HXYB 4DEPB 4P23A 3QCVH 4HPOL 1XR9A 1ZV5A 2FO1A 2NMSA 2BSSA 4ZUVB 4UNVA 4KUZL 5D7IA 5JIKA 5CIPB 2ESVE 5L7XH 1HCVA 4HDIB 2ADFH 4PB0L 1B90A 3SGDI 3DMMD 3TVMB 5C2BH 2VZOA 2HN7A 3U6RA 5T1KB 4QWWD 4ZOBA 1BBJB 3V2AR 4CVZA 5I2IA 4NQUA 1DBBL 4YDLC 1A1MA 1EV2E 1FHGA 4L9LB 3WN5C 1B88A 1A4JB 5HYSG 1AXTH 1AXTL 4LL9A 5FO9B 1A6VH 3HZVB 5C7XL 1WBZB 3V0VB 4DUWA 1YMHA 1QKZH 5BQ7A 3IU4H 1QKZL 4PRIE 3IU4L 1NCBH 1A3RH 1NCBL 4X6FB 1RU9H 4IMKC 1KB5L 2BDNH 4KZEH 2IF7A 2R39A 1TJHH 5HHQB 2YUVA 4L4VA 3K1DA 3FO1A 3DO3A 1G9EA 3X11A 4HCRA 1J88A 3TPUB 1G9MC 1R6VA 3G5ZB 3CLEL 3V8CA 4QRQA 2BSTB 3LS4H 4K23H 3LS4L 5IMOA 1IQDB 1NC4A 5FYJL 3EZJB 1W0VA 3PWLB 1UA6H 1RZKH 3QI9C 2ZPKH 3WNPA 2AP2A 2XOTA 5D7KD 2K7QA 1D6EA 1JNHA 1UEYA 1AHWC 4KI1A 4JHZA 2WW8A 2X9WA 3QXDB 5HHMB 5JXAH 4NJ9H 3VG0H 4F7TA 5JXAL 2K1MA 3UPAA 4V2CB 3H0TB 4JRXD 4ZNCD 5C0NC 3RNKB 2AJVH 4HIXH 5H35B 4I0PB 4HKXA 3S3JA 2DMBA 4FNLH 5EWIL 1NCNA 4UTBH 5C0ND 1SBSH 1CICD 3MRLB 4UTBL 2E5EA 5CWSA 1T5WB 4AY0A 4MX7B 1B0RA 4XHJD 1T04A 4X4MA 4XPGL 3BKML 3BRGC 2J4WL 1C5DA 4YE4H 2B2XL 2A6JA 5E1AA 2NZ9C 4WWKA 3G5XA 4QYOA 3DVFA 4BJLA 1FG2B 5JOFA 4Q0XH 1CI5A 2CR6A 3R0NA 3V5HB 3C8KA 1JI1A 2XKNB 1S5HB 4ZODA 1P1ZA 1JPFB 1YNKL 4P23B 1T6WA 4X4YA 3BZEB 3LKPA 4OF8A 4FQ2H 3CNKA 5GGRY 4J3SA 2XV6B 4TULH 2HT3C 4K3DH 2ZSWA 3GJEA 4K3DL 4YDVB 3TJEL 4JZNB 3MODL 4N8VG 3U0WH 5FYLH 2BOCB 4J1UB 2QLVB 4MDIB 3U0WL 5FYLL 1JYXA 4OBSA 4D0DB 2P8LA 1S7WA 4ERSL 4KQ3L 1I1YA 1Y18A 3BDBA 4LHUG 5EU7C 2Z31B 2HN7B 4B7LA 3U30B 4QHNB 1PG7H 3BZDA 3UROR 4AT6A 1PG7L 4WY7H 4JZJA 1A9EA 5JMRA 1BZ7A 4O2EA 4QOKA 2GIYA 3HE6D 1BWWA 1XH3B 1YY8A 3GM0A 4ZXBB 2RAMA 4S1DC 3MJ8A 3F65A 1CDJA 4JFEA 3S9DB 2Q8BH 1YMHB 4WO4D 5FK9B 3B5GA 4ZYKB 1FFPA 4JCLA 3V4VH 4D9LH 4S1DD 4D9LL 4N8CH 3VFSA 3MJ9H 5ENWB 1D9KC 2VZUA 2FWOA 4JR9L 2DD8H 2DQCH 3W2DH 2Y6SC 2DQCL 2AEWA 3FO2A 3HZYA 5FCUL 3S35H 5HHME 5EZLA 1XF5A 3SKJL 1I1AC 1AD9A 1NCTA 1KEGH 3UTSA 1KEGL 4RAHA 4C55A 2H32A 2Y6SD 4U6HB 5ETUA 4ZUSB 4MHHG 2XQYG 3OAUH 1NCCL 2WBJC 5CJQL 1CBVL 3ES6B 1KIRB 3QQ3B 1XGRB 1RK1B 3LQZB 2GSIA 2WBJD 3BPOC 4YDIH 5F97E 3ZE1E 1MFNA 5KOVC 1MWAA 2EEDA 4MB4A 1FVCA 3IDUA 1DBAH 3QNYB 2DI7A 2C1OB 4AIXA 4PJ9C 1MIEL 2Y5TA 5GS1A 2KZWA 5DJCB 4JRYA 2D0FA 2NNAA 4JN2B 5FYLD 4G80B 2C3WA 4PJ9D 2F58L 1CQYA 5D9SA 1HINL 4KTDL 4LGSB 4NHCL 2OTPA 1QRND 3CC5A 1ZT1A 1OAKL 2HYMA 1WZKA 3TN0C 1R5VB 3T08A 1T04B 3TM6A 1CVSC 3F12A 4C4KO 1DBJL 1EMTH 2VZVA 1U8LB 1GSMA 3TN0D 1WWWX 4X6CA 4W81A 2VISB 2ZNWA 3VH8A 5DS8A 1WVZA 4B5EA 4R4FH 1PDKA 2E7HA 5D2LA 3RX5A 3O8XD 4HD9A 4FMKA 3GSRB 2EO1A 3FT3A 1WTGT 5T1DL 1DQDH 1T1XA 2V7HB 4DUVA 1YY9C 1V3KA 5J9PA 3D6GA 5CBAA 2O5XL 3MRKA 3W0WB 5I8CA 3LRGA 2WMPA 4EOWL 1WWAX 3HG1D 4LRIC 4HK0A 2JIXB 5IHZB 1YY9D 4FXKA 4Y4KC 4AZ8A 2P8LB 3DGGB 3PDOB 1D5ZB 3TV3L 3CFCH 2OJZL 1RZ8A 5GGSA 4TSCH 4X9BA 1MCDA 4KK6D 4Y4KD 4HXAH 1XR8A 1HI6A 4HXAL 5HHNA 4GMTL 4Z7QE 5B3NA 1SBBA 1EHNA 1JV5A 4O2EB 4P2OA 3VWJC 1QO3B 3QWOB 1TQCB 2VQ1A 4KKNA 4NO0A 4FQXC 5FIEA 5LQBH 1N0XH 2UVEA 1WT5A 2GYSA 1N0XL 5JUEL 2FZ3B 4WTZA 3VWJD 3OKNA 4Y5XC 4Y89A 5CJBA 4FQXD 1Y0LB 5J11C 2F54D 4JG0L 2DL9A 4GKZB 1BFTA 5TE7L 4AENA 5ADPH 4MAUL 2DQGH 5DFVC 5J6GA 1G84A 1KEML 3GSVA 5EZLB 1XF5B 5ICXB 1EFXB 1IBGL 4ONGL 3B9DA 5DFVD 1MCFA 3CH8A 4PD4J 3MJ6A 1G7PB 3OPZH 5KTEH 4E41D 1U91B 4PRNB 2RQ8A 3GB7B 4LLYB 1DN0A 1QSED 3DV6B 2FBJH 5CEZH 1ZEAL 2FBJL 1IGJB 2FBOJ 4WEBH 4LLWA 3S97C 2IBGA 4RWYH 3N06B 1KGCE 3QT2A 3V6BR 1IAKB 3ARDA 1BQSA 4GUPA 2W9DL 4K55A 3FOMB 2OL3L 4XB8A 1FVCB 2LVEA 3WS3A 1YEKH 2RJMA 1I4FA 4YPGA 3BHBB 3NCBB 3PE9A 1U3HB 5A2JH 1JWUB 1FLRL 4YC2B 1CLZH 1RHFA 2FHFA 2B4CC 2R0ZH 3PQYD 3WLWD 4KWUA 5D9SB 1IGIH 5CGYC 1IGIL 4IIQA 1QSFB 3W0WE 2DQDH 1I85C 4GH7B 5IKCB 1JWSA 5IP4A 3V7AE 4NNXA 1T7ZA 2OP4L 3QUMA 5JDJA 3VH8B 1DJSA 3MJ7A 1ZT4B 3EFFB 4DN4H 1LP9B 5D7JA 3IFNL 3EOTL 4MXVF 4POZC 4BSVA 5BZWB 5IEKB 4CVXB 3BQUD 2IH1A 4QHUB 4HJ0C 2F74A 4FN0A 3R06B 3FFDA 4JQIH 4M4RA 4P59H 4POYA 1UQSA 3GSOB 1Q94A 3T0VA 3EOBB 2AS5M 2EXYC 1ZA6B 5F21B 1H8SA 4A6YL 3HE7C 4AEFA 4WHDA 3BAEH 2Q6WA 2EXYD 5BS0B 4B53A 4X6BB 1J7VR 4R4ND 1DVFB 3BKYL 3G6JB 3ZL4H 2J8HA 3FFCA 3MCG1 1K5NA 5CEZD 2EDJA 2P46B 3PG2A 3PJSB 4QXGL 1NQBA 4HMCA 3F6IA 8FABB 2AJUH 3BD4A 4PRHB 1Q0XH 1OGAB 3K1KC 3B9VA 1IM3A 4WI5A 2NW3A 2D7TH 5GRYA 4CN4A 3A67H 5EUKA 3RIFF 5DMKA 2VABB 1J11A 1QRKA 3AU1B 1C1EH 5I9QC 1GIGL 4XMPL 2B1AL 1NFKA 1QBLL 3BPLC 4HS3B 3ALXA 2PO6A 2CXKA 1QYGH 5SWSA 5ERWA 3TO2A 2P45B 3SDXB 5BV7B 2VKXA 3IRZA 3WLBB 4PREA 1JGEA 4JQXA 3NA9H 1OD7A 2WV3A 1RUPL 4XNXH 2HVJA 2FR4A 3B3IA 5FF6A 3CX5K 3O3BA 1YEEH 4GLRH 1OT2A 2YBRA 2AV7A 3RA7H 4W6YB 2PN5A 3HPLB 4GG8A 1QSFE 3RKDC 1JTTA 1F45A 4WFGD 1OW0A 5DRNA 4U7MA 4CDHA 5EBGA 5MEND 3FCTB 5L2KD 2E9BA 4M8QB 5B39G 5I1KH 1IE5A 4MJ6B 3CU1A 5E8OB 1QFHA 3RKDD 3WS3B 1U92A 1ADQL 3U1SH 4UOW1 1EZVX 3MXWL 4KC3B 2LV4A 3U1SL 1HH6A 1N2RA 3A6BL 4UTAL 1I4FB 4NZRH 3VFPA 2DQUH 1LP9E 1XCTB 4Z8FL 2APVA 2DQUL 4IOIA 2Q86B 4IMLB 4DGYH 5AEAA 1KUMA 1TFHA 2GSGB 4ODSL 1MCRA 2IAMD 3X17A 2QKIA 1ZLSH 3BP4B 5H8DA 5E2UH 4JCMA 3S36H 1MJJA 4ODTL 3FB7B 1JWSB 3OR7B 3LD8C 1GZQB 2AJZA 4FTVA 1S7UB 5IQ7L 2X70B 1FN4B 1BQHG 1LO2L 2CKBH 1U8QB 2CKBL 3MJ7B 5BS0E 4JFXA 5T3ZH 4ZDHA 3G6JE 5D7JB 3SCMB 5T3ZL 1NC2A 4BSVB 1CDUA 2HRPL 3FRUA 2J3SA 1QVOA 1ETZA 4JAMB 5D2NC 4TTDD 3TA3D 1UKSA 3GRWA 1UH3A 2AKRA 4JO1L 4HWZA 5EO1A 3TH4T 3MLPA 3MUZ1 3DX7B 3GUTB 4PRHE 2YPLA 3V0AC 4V2BA 1OGAE 2DQHL 2DYPB 3BGMA 4I5BA 4IRJA 4HC1A 4CVUA 4LGRB 2BNRB 4J3VA 4CN6A 1I1FA 2YKLL 1T1ZA 1T3FA 1KJ2A 4I8DA 1R24B 4RGNB 1J12A 3CCHA 4JKMA 1P5UA 1UZ6F 4YWGH 3HI6L 1JNNH 3MUHL 2R56L 5DJDA 3CDGB 5I8OL 1JNLL 3SDXE 2YD1A 2BHYA 2LFGA 2YMXH 4OQTA 4GT7A 4K2UL 3W39B 2DS4A 1QQDA 2HWZH 4FQHA 4URTB 5C09B 3ZTJH 2GQHA 5ANMA 4AQ1B 3DMMA 3IGAB 3RP1A 3S34L 4EZMA 1VHPA 1PAMA 2ITDA 2NX5D 2VL5A 2OI9B 1CK0H 1ZA3A 1CXKA 1X6NA 1VACA 4NO3B 3RWIA 4GBXA 1EA9C 3G6AB 1HQ4B 4X0KB 3UBXB 1JGEB 5D1ZC 5INCA 4LFHG 5FF6B 3FB8A 3U0PA 5MEQB 4LGPB 2DLFH 1ZMYA 4LLQA 4U6YA 4GAFB 4QRUB 1K8DA 3Q3GB 2GEEA 4YZFF 4X9FA 5FECB 2H2PC 4PJCB 5T3ZD 3B2UC 4NKOA 4LFHD 1Q1JL 3HAEB 2MNUA 4Q7DA 4RISL 4EUPG 1OSZA 1BZ9A 2GAZB 3G5YB 2DQTL 3T2PA 3O6KH 4BKLA 1GGIH 3SEPA 1F3JA 1XGUA 4QRPD 1OLZA 1IKFH 1AGEA 1NDMA 1WLHA 3VFPB 2CK0L 1C7TA 4WDIB 1JZ2A 2DLGA 2P5EB 3MBEB 1OD9A 3IKCB 2JCCF 5IVXB 4X83A 1XGPA 4G6FD 5CEYB 1Z0NA 1UG9A 5IB1A 4LIQH 2CO7B 2HA1A 1S7QA 4YLQT 4Z78B 1S7RA 1B6DA 3RKPA 4KKCC 4NOBA 4TQEH 1MSPA 2AJZB 2BNRE 1W0WA 5J57B 2BVUA 1ZLWH 25C8L 3ZTJG 1D5BA 4JJ5B 2BERA 4JRXA 4M7LL 3BT2H 1NAML 4RGNE 1AXIB 3MLYL 4U1HA 4JFXB 1RURH 1Y6MR 4DGVH 5ITFB 1LHZA 5I1IL 1NC2B 4K9EL 1HSAA 1R3KB 3NH7L 1CICA 3T77A 3QR2A 1INDH 1VFAA 3MA7A 5I71B 4LKXB 5DSCA 3C08H 3KXFB 3RI5F 4GKNA 4KPHH 5EO1B 3EYSL 3VFRA 5DXWA 4R0LB 2KQMA 1BF8A 5C07B 1L7IL 3ZKXB 5C09E 3SE4C 3NVQA 2E7MA 2WLYA 4ONHB 3QJFA 1T5XA 5DWUH 3TCXA 4P9ML 5DWUL 2YPVL 3P77B 1KJ2B 1A5FL 4WCYH 1CYGA 2Z9TA 3EGSA 4U2ZA 2Q1EA 1N6VA 1KB5A 3ETBF 2GW5A 4HMEA 1A7RL 4ELKA 3AS1A 3VXTA 1JJUA 3C9NA 5FGBC 3BYTA 1RV6X 1N64H 2BRQA 1N64L 4M9PA 4PGJA 4OGXH 5E6IC 3PWUB 1BJ1J 3PGCB 4LEOA 4TVPL 2IPUK 4Q2ZA 1U93A 3QEQD 4P57B 5JW4Q 3MLTB 2YHGA 5C0EA 4DZ8A 3DUHA 1LO3H 4Z7UF 1JF5A 4PJCE 2VL5B 4HKBA 1UXSB 3ULUL 3OGCB 3VRJA 1P9MA 1A8JH 4HXBH 4A2MA 3HE6A 3MV7D 5HBBA 3CZFA 4GBXB 1S3KL 1I8IA 3ULUF 3H7LA 4HS8L 3E6FA 1SY6H 4WO4A 3TNNA 2P5EE 3HC0A 5I18H 5C86A 1F2QA 3RUGB 1EUTA 4IM8A 5IVXE 3BOVA 1K8DB 1QHPA 4XCEA 5JPNA 2W0LA 3OSKA 3SO5A 4K3HA 4MAYD 1XGQA 3SGKA 3LRSB 5DO2D 1IM9B 1R0AH 4G6KL 1MCQA 4NUJA 5T3XL 3HRPA 3TYFA 3I02B 1F3JB 4WUUD 1IEHA 4FQJL 3GGWA 4PGCB 3RY4A 3O6MH 3KYKL 1IC7L 2R69L 1M6OB 1FDLH 1FDLL 4H0GA 5DHVH 1EO8H 1XGPB 3KXFE 2H9GA 1FNLA 4ENED 4IOSD 4PS4L 1XGTB 4HBQA 5C07E 1CXIA 4NRXB 4PJIA 1S7QB 5LBSH 5LBSL 1AO7D 4JB9L 4ZS6D 1ZSDA 4WHCA 5IMLA 3VXPB 3VJ6B 4M6MH 4DW2L 1YYML 4M6ML 3UC0H 4D2NA 2CLZA 5D5MB 1HHHA 3C5SB 2C26A 1NGZA 1KCSL 1JHLL 2I9LB 1AGCB 3RVWD 3PWVA 1MJ8L 4YO0A 3T77B 3H7BB 4DTGL 5JORA 5DSCB 4Z6AT 5AZEH 3TEUA 4XCYB 2FX9L 3WEXB 3LDBC 3ULUD 3FQWA 1MAJA 1DQMH 4RMQA 1N5YL 4QHMA 4F3FA 4Z7OF 4WGWB 1H9VA 3FRPA 3RVUD 1KIPB 3JV0A 4G9FD 4HIIB 1T5XB 4ALAH 3C2SA 3PF2A 5B38B 3JWNC 4G42B 3QH3A 5C0RL 4ZO9A 2VC2L 4P46D 1I75A 4JVPA 3NCEB 4O4YH 4UT6H 4PG2C 4O4YL 4MJ5A 4X6DB 4OF0A 4U1GB 4DCQB 3DWTA 4JFDD 3SDCD 1EIBA 2Z8WC 1LK3L 3NPSC 3QIBD 3C9NB 3AM8C 4HS6A 4U6XB 1Q9WB 4JN1L 3MXVH 3PNWA 5GHWH 5DEZA 3MXVL 3EHBD 3ZHLA 4HEPG 3W9EA 2VTFA 1K9TA 4PLJC 5CD3A 3W11C 5FGRA 4MNHB 3RUGE 2VOTA 3IJSA 1K4CB 4RBPH 3BZ4B 3THMH 4PLJD 2YD8A 3EDJA 4IDJH 3W11D 4LQ1A 4OI8A 4KROD 3BKCL 5E8PB 2NR6D 3OKOB 5E95B 1OSPH 3L7FB 4JY4A 4PRPB 3CZFB 1YEIL 2QQNH 1RZFH 4NPYB 3HPJA 4O51B 3CAFA 1M05A 4XAKD 4XPHH 2EYRA 3HC0B 3NZ8B 4DKEH 3MACL 5DD5L 3WJJA 1UH4A 1XF3B 1ACZA 1FGNL 2BY0A 3NIDE 4G6JL 4Z5RB 4AJ0A 1NLBL 1QNZH 3O2VL 1XGQB 3T2NL 1QNZL 2VLRA 4X7DC 4EDWH 5FKPB 5E94A 1D5IH 1L6XA 1CGWA 2AJXH 2CXGA 2H26B 3X3GL 1TTGA 5FA3B 1JMZA 3CFIC 5KSAD 5D5ME 4NWTL 5TH2B 2PW1A 1AR2A 1UM6H 3JV4B 1SJEB 4M7ZB 3VG9C 4MNQA 4KJPC 2H9GB 4JEGB 3STLB 4M4PA 4D9QE 4ESKA 2Y9RT 1MY7A 3I2CH 5GSRB 5TFSL 3AB0B 3I2CL 2Y7QA 3BH8B 4XVJH 1RJYB 2AXHA 4PJIB 5ILTH 4NBXB 2VSDA 3K3QA 4ODVL 4H8WH 4KJPD 3UTQB 2V5MA 1OL0A 1IL1B 3GI9H 3MLVL 3QNXB 3GI9L 5E5MA 3HTLX 4UV4L 1TXKA 2L7JA 4Z7VF 1KJ3H 5HSFA 1NMCB 1QA9B 2HKFL 3VFVA 5J3HD 1DDHA 1R5WA 1WCBA 1IILE 3LMJL 3PV6B 4B50A 4X6DE 5JORB 1FVEA 1TVBB 2A9MH 5EU3B 2A9ML 2F53D 1RJZA 4LSRL 4XPAL 3V4UL 1XCQA 5HY9A 2X4OA 3UTZA 4PJ7F 2JB5H 3MA9H 3K7UA 1A9BA 4F3FB 4U49A 4V1DA 4KQ4L 3DIFB 5BVPH 2I5YL 4NGHH 2FGZA 4PJGF 3BVNA 3OJDA 2C4FT 5GGVY 3S96B 3NAAH 4R4BB 4M7JH 5KG9A 1MRFL 1OTSD 3BQUA 4M7JL 4TUOB 5DUPH 4PRPE 5CZXC 4HS6B 3ZHDA 3ILQD 4LCUA 3RL1A 3RU8H 3VXMB 2F8XC 3ARGB 5SWQB 4H26A 1KV3A 3HLAA 1WISA 5CZXD 3FT2A 1B2WL 4N90E 4R90L 3T2OA 1A4KA 3JWDH 3KPOA 5C08A 1IEAB 3L5IA 2A1WH 2ZP0T 2DQEH 5JTWA 3D9AL 3M1BB 5KVMC 3SOBH 1LEKB 5C0CD 5CILH 5CILL 4GKSB 4H8WC 4MSWA 3RZCC 4QRSA 1G9ML 5TDOA 2AABL 2CJUH 4P2QB 3ESUF 5KS9A 1M05B 2OL3A 3T0EC 4ELMB 3PHSA 4ZFFA 4QTHA 1EX0A 3ARBC 3RZCD 1F00I 1FNSH 2IQ9H 3B5TA 2IADA 4HZLB 3IDJB 4U1MB 5BRZA 5HYQB 4OLUL 2BY1A 5EIIB 3T0ED 5FHBH 3NIGE 4PJIE 1RUQH 5EBMA 3T8XA 2FX8H 3DXAB 3ZKNC 2FJGA 2V5RA 4GG6F 1YQVL 4BQ6A 5GRZA 1ACYH 3OF6A 5DMYA 1BWMA 1JGLH 4M7LT 4UAOB 4K8RL 2X5PA 4NFDA 3ZKND 2OQJB 1HHJA 3K8KA 5D71H 2PXYC 2P24A 4JG1H 4YBLB 1FL3A 4GW1A 3AVEA 3DUUB 4MNQB 3GMRA 3MNVA 3TJHC 4OV5A 3GHBH 2E9JA 4ORZC 2PXYD 2YD5A 3O6LH 5MI0B 1MCJA 3DVNA 3O6LL 4M7KL 2Y7QB 3TT3H 5ICYB 1FQ9C 3K2MC 3MQIA 4PB9L 3TT3L 1IAMA 3NCJH 5MENA 5L2KA 1YN6B 2H8PB 4YDJA 1IMHC 3MRJA 3S37L 1MFEL 4U33A 3U2SA 4XI5D 1U8NB 1NUFA 3GBNH 2IQAB 1FCCA 4LPUA 3NIFF 5IEHA 2YR3A 3JWDC 1R5WB 1Q9OA 4LHJB 4DN3H 4RFNB 4DN3L 4A6YA 1XGYH 3L3IA 3RWGB 1CLYH 3M17B 4N0UA 4OCRH 2IAMA 4APQD 3SPVA 1KTRL 2HP4A 5HY9B 2ENYA 1I8MA 1TETL 2F5AL 5JHDD 3VXME 5LCVH 4NKDA 5F7HA 4G5ZH 2I26N 5HYJB 4B41A 3LHPL 4OCYL 4LAJH 4NFCA 3TZVD 1OQXA 1INEH 1FYTB 3L3JA 3VXNA 1VENA 2WK2A 4Z9KB 2CLRB 1VERA 4OCNC 4Y1AB 2BC4A 4HPYL 1WAAF 3B43A 1UENA 3QISA 3TA3A 4XP9H 4OF5A 3F7RA 2CRZA 4NYLB 1CDYA 4P2QE 5D8JH 1U8JA 2AJSH 4HJGB 3GSNL 2ZUUA 5D8JL 4K7PL 4H26B 4XPBH 4ELME 1T7WA 5KVGL 3HLAB 5E8DH 1CFTB 2YA0A 3WXWH 3WXWL 4K8RD 2VZ1A 4P3CH 4KZDL 5SWZD 2ZNXA 3DURB 3SQOL 1A7NL 1IFHL 1NJ9A 2WINB 3QUYD 5F1SA 1OP5H 3TP4A 4NQSA 3DXAE 5GGSY 5IOPA 2NXZB 2PR4H 5IBUG 1OHQA 2PR4L 3MRRA 1F4WL 2CR3A 3DRTA 2G9HA 2FH8A 1WZLA 4ZFGL 5E24E 4UT7L 1ZE3C 2A9NL 4NP4H 5TDOB 4BH7B 1I3VA 1R3HA 4NP4L 2X05A 2EIZA 3IT8D 4ZFFB 1ADQA 3CFJB 1GYAA 4MNQE 1N8ZB 1J1OL 3B4NA 4HEME 2IADB 3V6OC 2XN9B 1XF4B 1NFDB 1UVQA 3SDDA 1FNEB 3SGEH 4FOMA 5C0JB 3GMNB 4NNPL 2A74B 4Q9QL 1RIUL 1IGFH 3CX5J 1LMKA 1IGFL 2XZAH 3OKKA 2XZAL 3QB7C 1FAIL 3DVGB 3T4YB 1NCDL 1DN2A 3DVIA 1RHHA 3CVHL 1T21A 5BO1L 3VI3F 2CKBA 2KPNA 3N1MC 4LSUL 4EXPX 3UTOA 4TOYH 2D31B 5CHNA 3DVNB 1FPTH 2J6EH 4ZUWA 2J6EL 4OCWL 3RWCB 3QFJA 4X7TB 3D85D 1HDMA 2YUWA 3TCLA 4H88L 5HYJE 4NC1E 1P7KA 4PPTA 4R2GC 4OKDA 2X7LA 5K9JH 1VKXA 3U2SB 3E3QE 3MNWB 2BFVL 4CNIA 5CMAA 1FYTE 1DQLL 3FQNB 4JLRB 2QL1A 2XTJB 4HF5L 3MRFA 1DSFH 2QADC 3RNQB 5DD1H 4BZ1L 4Y1AE 4EN3D 4BFIA 1A2YB 4H0IA 4XB7A 1F8TH 3TBSA 5KJRL 2UYLA 3O3AB 3G6DH 3SPVB 4LSQH 5F1IB 2JF1A 1JHKL 1I8MB 4NZTH 4BA8A 1CFVH 4BUGA 2RIKA 3DJ9A 1Q9KA 2AK4D 3RWHB 5JOPE 1S7SB 3N85H 1JWMA 1JZ7A 1YPZA 3C6LB 4QLRA 5C6TH 3O0RH 4KK8D 3O0RL 2BXYA 2DJ4A 4L29A 4G8FA 1E4KA 1ZGLA 3KJ6L 4RMWA 5GJTH 1EXUA 1BOGB 5F7KC 4GAGL 5GJTL 3ARED 5AZ2H 5I15L 5FEBA 3DYPA 3RJQB 4YPJA 5DQJA 5FUZH 1MCWW 2ADIB 4XPTL 1EAPB 1R5IA 4WIQA 3B2VH 5EBWB 4NRZB 4LHQB 5IV2B 2XN9E 1CXFA 1TCRB 1UYWH 1NFDE 4MS8C 2IWGA 4JM4H 5JW3L 1AIFB 4QRRB 3U46A 4LCYA 4Y5YB 5IOPB 3MUY1 1P69B 2IFFL 3QBTB 4KRPB 4X80H 3V52L 3DRTB 4JO3L 5LAXA 2P5WD 2G9HB 4OFYD 4RZCA 2BX5A 5EC1B 5EG6C 3A0OA 2VSCA 3LEYH