4XVUC

Structure of get3 bound to the transmembrane domain of nyv1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNLYYYSIHWVRQAPGKGLEWVASISPYSSSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGRWYRRALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
total genus 43
structure length 222
sequence length 222
chains with identical sequence E, I, K
ec nomenclature
pdb deposition date 2015-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvuC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvuC01
2Z4QA 5D1QD 4WUUB 1DLHB 3DX7A 1H15A 2HTLD 4PREB 1ZS8A 3FFDA 1KPUB 4UINH 3BAEL 3MV9D 3QZWB 1ZVSB 1FJ1B 1DBML 4PJEE 5C8JA 1UVQB 5F7MC 2R2CA 3H0TB 3CMOL 3BSZH 3ILQC 1MREH 4WUUA 2PTUA 4P3DB 4PREA 1WSST 5FUZH 4ORGA 3RI5K 3IDYC 4FQXC 4F8TA 2FEDC 2NX5E 1YPZE 3H0TA 4XPHL 3GZKA 3HZYB 1CF8L 3B5TA 3HNTH 4HMCA 4PJDF 3FQWB 4UTBL 1LO0H 1TZHB 4EI5D 1SJHB 4PFEA 4Q2ZB 2D31B 2EIDA 1NUFA 3GEWB 2OBGA 4X6DA 4ELKA 1Q72H 2W60B 3HZYA 5C0RH 5LVEA 3QHZH 2O5ZL 5AD0B 5BRZA 2A9NL 3VA6A 1YN7A 4Y19E 5CJ5A 3LRGA 2NY1B 3WYRA 3VXPA 1LE9A 3U7YL 2W60A 3SEPA 4L4VE 5HYEA 5F9DC 2BMKA 2DWEB 2CGRH 3RA7H 4AYFA 4YFDB 4CNIA 3NA4A 3OB0H 5IHBA 4PRHE 2A6KB 3OKLB 3QA3B 2DQFA 4FNLH 4KK8C 2X9XA 2AJZB 4AIXA 2YD3A 1C5BL 3SDCD 4X6CE 1GHFH 4ZQKB 3K2MC 5I19L 4KQ4L 2FR4B 1U8NA 2ARWA 1J0KA 4X9BA 4EKXA 5CJOL 3REVB 3HRPA 1VFBB 3S3PA 1JBJA 1MFDH 5DD1L 1K8DB 4IJ3C 2AJZA 3J8F7 3RUGF 5JZ7C 4KRNA 1HIMH 2ADIB 4KXZI 4PTUA 1F11A 2X4UB 3OSKA 1NBZA 1I1FB 5CGYC 4PBVC 3HR6A 4XBEL 3TO4D 3W5MA 5I1EL 3UBXG 4O4YL 4FZEL 3HAEG 2YPVH 3UZQA 2ADIA 1IAMA 4MAYD 4PY8I 5SWSD 3OXSA 5JW4R 3OHXA 3H6JA 4YR6A 5EZLA 1YMMD 3AY4C 4R96A 1XZ0B 2NY5L 2ZKHL 1PYWB 1UKQA 4OFIA 3FT4B 1K2DB 3G6DH 4JQVA 4NM8L 1MH5B 3O9WA 1T22B 3OKNB 1EJOH 5CINL 1DEDA 1JK8A 3QJHA 1KIQB 4KU1A 3VXOB 1YMHA 1GSMA 2Q86B 1XZ0A 1XF3A 1NC4B 4V1DE 3P40A 3MXWH 2APTA 3FT4A 1K2DA 3MXVL 5KSBE 1T22A 3RP1A 2Z31B 3H9YA 1T3FB 3R4DA 4WI6A 3SCMD 5I6XC 2LVEA 4F7TA 4UDTA 3GMLB 5CEZH 1HHHB 3KLHC 1NC4A 5HHPB 3TN0C 5GSRB 3TPKA 5J1AB 4M6OL 3GSUA 4HS8H 4G6AD 4Z7VE 3A67H 5EORL 1S3KL 1HHHA 2I07B 2MMXA 3B8SA 4D0DB 2MQ3A 4MMXC 2VIRB 2ZUTA 1D5XA 2BSTB 4X4MA 4XP9L 4PRNB 3BZEA 4ZPVB 2BC4A 2P46B 4LPXA 1D5IL 2VIRA 3ZTJG 1VFOA 1CQYA 2IPTL 3ULUH 4PRNA 5EH1A 3H7BB 3VXTB 3CH1A 1E4XL 4KMQA 3VH8G 4L3CA 2WW8A 3DPBA 5D7IA 1VGEL 1MCLA 3VWKC 3K2UH 1GRWA 1CGYA 3VXTA 5CZXC 3F5WA 4KKLC 4JDTH 3ARRA 5BW7C 5HHXH 2EDOA 1DQML 4TVPE 2FL5B 1DBBL 5B3NA 4G5ZH 4S1SH 5ITBL 2EC8A 4PGJA 3GNMH 2PYED 5I1AB 4H0IA 5LQBL 4GQ9L 3HMXA 1PKQE 1KCUH 3B3IB 4GRMA 5BOZG 5JOPE 1X5LA 1LP9A 4ZFFA 2FL5A 5E2TL 4NKDB 3S4SA 1FO0H 1QQDB 1P4LA 1MRCH 3X12A 3P9LA 4RMUA 3FQRB 3PG2A 4F7CA 2E8ZA 3H42L 5I1AA 2BY3A 2QSVA 3O3DB 5TF0A 3B3IA 5L2KB 3MFGB 4Y8AA 1GGBL 1ZWIB 4WWKC 2HG5B 3OPZH 3BP7B 4ZUSB 1KC5L 3T4YB 1UENA 3VFGL 3UPCA 2VOTA 5I1LB 2BOCA 4UNTA 3C5ZA 4ENED 1YQVH 3O3DA 2D4DA 1HQRB 5L2KA 3C60D 4UBDC 1VPOL 1ZWIA 4GW4A 4MX7B 2HG5A 4ZUSA 1AC0A 5DEGB 3T4YA 4JAMB 5I1LA 5FOJA 3MRDA 3PL6C 3TV3L 3OZ9H 4UT7H 4PYHA 1KFAH 3NZ8A 2NY4D 3QCTH 4MX7A 5HGAB 5DEGA 1ZANL 2J6EL 1JHTB 4JAMA 3NIGF 1N5YH 5LGHL 1P4BH 4QNPF 5D7SL 5DJZB 3ZO0A 1T1YA 3KR3H 2Y06H 5EBWB 4HSQA 4GH7B 2KBGA 4I2XE 1JHTA 4JR9L 1NCUA 2BHYA 4V2BA 2NPLX 5DJZA 5EBWA 1WAAA 2BJMH 4XNMB 3QR2A 1T1XB 4HIXH 3K81A 3SDXB 1MI5E 3OAUH 4XMKL 2RQ8A 3R0NA 1RIVL 1MCFA 5ISZB 1CICC 3IU4L 4P23C 5KZCD 3PJSA 2A9MH 5DRXB 3RX8A 5KVFL 1QUNA 4JO2H 1J1PH 4Z18A 1FNEA 3O6FA 2XQYG 3K8MA 2BVOB 1F4XL 4QOKA 1PSKH 2RGSA 4C59B 3RDTD 4X5WB 3AM8A 4KJPC 4O2FA 4J7RA 5FGCE 5FKAB 3T0AA 4KTDH 4XNYH 5L0QB 3E6HB 5BS0B 1IARB 1F02I 1T7ZA 5FYJH 3BHBB 3SDAD 3ULSB 3EYQD 3VCLA 1CL7H 1XIWC 1U91B 5D7LA 2Y7QB 4JRXD 4X5WA 2P4AB 3X3GH 2GJ6D 3DXAB 5J6GB 2MOVA 4NJAL 4MQ7B 1ZGLP 3O6KH 4NQVB 5I1DA 1AGCB 4X5XB 5BS0A 5I8OL 5BMFL 1EHLH 3WIHL 1BGXL 2GFBB 3BHBA 3ABZA 1I9RH 3MV01 4OJFH 3T3ME 3MV11 1U91A 4ZPTB 2Y7QA 3VFMB 1RZFL 5TDNB 3DXAA 3KLDA 3RPKA 2WV3A 3TZVC 1DQTA 3NN8A 4NQVA 3U9PL 4X5XA 3UTZB 3ZE1F 3ZYZA 4PJ5E 5H35A 3MRNA 3QWQB 2EIZB 2X4OB 2YPKB 1JRHH 1LK2B 3EGSA 2GTZA 4KHTH 1NGQL 4L4JA 3T1FB 1HH6A 2DQEH 4XPTH 5FYKL 4ZNEE 3B9EA 1CXIA 1P5VA 3GBNH 4LU5L 1OM3L 4MA7H 2DS4A 3F12B 5B21A 4A2LA 2X4OA 3CDGB 1LK2A 5D2LB 2VUYA 3FB6B 3CFEB 5FDWA 2XZQL 4ELME 3ALWA 2CSPA 1NGZB 3GBML 1IC4L 2Z92A 1J0IA 5DVMA 5HHNB 3KPRE 2JJTA 3FONB 2YD9A 1IRAY 2FX8H 2X1OA 1T2QL 2VL5B 3CFEA 3G6JF 4JHWL 1AIFA 1XGYH 5F8RC 2APXA 1NAKL 4M7ZC 5T3ZL 4LLQB 1F90L 1BIIB 5L8JB 5DK2B 4JPVH 2DLFH 4YHZH 1KJVB 5C3LD 4LL9A 1JF6A 1G6RH 3RIAK 4TSBH 1KCSH 4TQEL 4DCQA 3D3VB 5J1SC 4QTHA 1R0AL 5DEZA 2YSSB 2MHAB 3P77B 4U7SA 5EBMB 4W81A 1YPZF 1NCBH 3WD5H 5ANMB 4FN0A 4QT5A 3BPNC 3FCTB 2HVKA 4YDVB 4ETQB 1MJ8H 4LLDB 1DBAH 4XCEA 2AJXL 1PGRB 3NBNA 1SVZA 5HYIA 5CGTA 3S5LB 4UQ3B 1LEGA 1Q38A 5E2WH 2QQNH 2MHAA 1UM4H 1U2CA 4K7PX 4YDKL 3D48R 1TVHB 3TT3H 4D9LH 1U3ZA 4GT7A 5E8EB 3C6SA 2ARJQ 2DKSA 3QUYB 3DX9A 4EOWH 4YDVA 3ARGA 3VXUD 5DMIL 5FM4A 4RGOH 1IQWL 4JQVC 4UQ3A 3O9WC 2BNQE 3SQBA 5K9KB 5I9QB 1TVHA 4QXGH 3DBXA 5E8EA 3ETBF 3QUYA 3O45A 1RZKH 2NR6D 4JDZB 4NCDA 4PJ8D 1AFVL 1MCNA 3LH2L 5ICYB 1MLBB 2FSEB 3AVEA 4K94L 4N1CA 1GOFA 1V3MA 1BQLL 4MNQA 5T3XL 2BNUA 1I1RA 5AWNL 5A40E 3FAXA 5HYJB 3MJ7A 2PXYD 2KUTA 2C7UA 1G7JB 3NCFB 3ESUF 5F7HA 1MLBA 4W4OA 4K23H 3GFUA 1FC2D 4FQ1L 4MJIE 1NMAH 1B4JH 3BKML 4HWUA 2XQBL 2EEDA 4P46B 5E5MB 4O4YH 3DUUB 2GSGB 4LRNL 1G9EA 3NABH 5GGVH 3RL2B 1F5WA 1IAIH 1QSFB 3RWJB 2WLYA 1X7QA 2A77L 5J89A 2ZSVB 2VXQL 3P4OB 3WSQL 5E5MA 4P46A 4NDMB 4MZ3A 3VDCA 4HUWB 5DI8A 3I02B 4AENB 4HQQH 5J1TC 3RL2A 1U8QA 2AV7B 3OR7B 2I27N 1MFBH 2OZ4H 3P4OA 4RMTA 2AXJA 5INCB 4DN4L 1MAKA 5I1HL 1BPVA 4NDMA 5H2BA 1RUKH 1PQZB 2XY2A 3I02A 2NY3D 4AENA 1KYOK 4LLUA 1R3JB 2C4FT 2LV4A 1KTRL 2AV7A 2ZG2A 3A6BH 3V7MA 3U82B 4I3SL 4XWGL 4G6AC 5ILTL 1U8OB 4OTXL 4KPHH 2P43B 1MAML 2PTTB 3T65B 1AGEA 5GGSB 1A1NB 1XAUA 1FYTD 5DR5H 2B1HH 5BV7L 4H88H 1RJZB 4QRQB 4WI8A 3RAJL 2DF3A 2FX9L 2YPLB 4YHMH 4MD4B 1IC7L 4P3CL 5DJXB 3T65A 1A64A 5GGSA 4DVBB 2PYFA 3QUXB 5DDHB 5HI3D 3EDEA 2YPLA 4MD4A 2V6HA 5DJXA 1S9XB 4XBPB 1CS6A 5FKPA 1S9YB 4P4KD 3HC4L 5ICZA 3C5ZC 3DI3B 4FXGA 3QUXA 4BQ8A 1MFCL 2VJXA 3VFSB 3TM6A 3SBWA 1EFXB 4PB9H 1HHJB 2B1AL 4JGJA 2IG2H 1H5BB 1RU9L 5KJRL 3LKSB 3TNNA 3D85D 1LVEA 3IJSA 2VXUL 3VFSA 2YZ1A 4K71C 1EFXA 1ZT4B 3FTGB 1HHJA 5EU6B 1JF1B 2HAZA 5F6HJ 1B0WA 3MNWB 2IANB 1V7NL 5FA3B 1NFDE 4XPBH 2HKFH 4PJIE 1JPSH 4P4RB 1CLZL 1ZT4A 3HRZB 3QEGL 4WDIB 3FTGA 5EU6A 1JF1A 2YUVA 1UYWL 2P5WD 5MEOB 3QDMA 3RVVC 2IANA 1DL7H 4OCWL 3QO0B 5F7EL 4JO4L 2QL1A 5FA3A 5TH2B 4D3CL 3WO4B 3THML 2YD4A 4AL8H 5ABDE 3TEUA 4CDGC 3PIQB 5MEOA 3BESR 1G9ML 2EXYD 2AGJL 2D7NA 1IKFL 3QO0A 1S78D 3RX7A 5FAAA 4UIMB 1WIPA 1BWMA 5KOMC 3O6FC 2VH5L 4XP5L 5GGQH 3PIQA 3O3BB 3HC3L 2V9RA 4NKOB 2X89D 4QHUA 3AM8C 3KXFE 3NAAL 4UIMA 5I15H 4X80H 4ZFOB 2IH3B 3PWVB 2AABL 4U4BA 3WNKA 3IF1B 5DJ0A 3K80A 1NH6A 2B39A 2HH0H 2QKIB 4R9HA 4HK0B 1MCQA 1VA9A 2ZUUA 3OF6A 3W11D 3HG1E 4QWWC 4XCCH 4ZFOA 1U36A 2IH3A 3ARVA 3KHQA 5CSGA 5DJ8B 3M8OH 2QKIA 3MUGB 3CU7A 3V4VL 3VFOB 2DQDH 1NJ9B 3V7AE 4BSVB 2BFVL 4L8CA 3LEVL 4MNHB 1CU4H 2IFFL 1RVFL 4RFOH 1YNLL 3TH4T 4MWFB 4S1DD 5D71L 3I3BA 4X6EB 4OZFB 3CVHB 2WANA 4OFVA 3MUGA 5KS9B 1MY7A 4U1GB 1NJ9A 3KPSB 5MI0B 3L3JA 4BSVA 4ZYKA 1NCCH 3P9WB 1A7QL 5E2JA 3EYSL 5EU5B 4X6EA 4OZFA 1AGBB 4YWGL 3KJ6L 4M7LH 3KPSA 1ZLUH 4LLYB 4PLOB 1WV7T 3EYUH 5ESQB 5KTEL 5E8DL 1DANU 2IC2A 4XVJL 2JJTC 3QUMH 1KIRB 4PLJD 3X17A 4ERSL 5C0NC 3DURB 2VDQL 3O3UN 3K74B 1ZT7A 1JPFB 5I8OH 4LLYA 2EYRB 1MLCB 2P8MB 3RWGB 3PHSA 3VFNB 2Z8SA 4XZUA 2BY2A 4WJ5B 2BSRA 3PQYE 4G9FE 2W92A 3H8NA 4YHKH 3O2VH 4NKMB 3HZVB 1NCDL 1IM3A 2P8MA 2HRLA 2K7QA 3VFNA 2X40A 4OQTH 7CGTA 3V4PH 4NWUH 5AUMB 3FB7B 3DYPA 5IB4B 4LPYA 2HT4D 3I9GL 2JK5B 4HC1L 4NKMA 3HZVA 5IBTH 3DMMB 2R0KL 5KW9H 1T80A 1IEAB 4JPWH 4LSQL 4OLXH 3D2UD 1RIUH 4BFIB 3MROA 1DFBL 3W0WE 5TE4H 2A6JB 5FM8A 3QFJB 5K9JH 3QH3B 4HEME 5DMYA 5IB4A 3HZKA 1MHCA 1QVOB 1O0VA 1SY6L 1CVRA 3ARGC 3MBXL 4NP4H 1J5OL 3HI6L 4BFIA 5ALBL 1N26A 3SJVE 2A6JA 2V7NA 1UWEL 4P5TD 1IGTA 3QH3A 1K4CB 4OBSA 1QVOA 2CXGA 2PW1A 3F7YA 3B2VL 2ZNXA 1MNUL 2FECI 2PTVA 1ZA3B 4JRYE 1ZT1B 1QFUL 5DMKB 1A6UH 2NY7H 3TWCL 5ECJE 2V2TB 1CD1B 5HHMB 2X2YA 3HAEA 4NHUB 1YA5A 3ALPA 5I9QC 4PV8A 2CDGB 4N0UB 3FFCE 4JFED 3D25B 1OP3H 3DVFA 1JYXA 3WLWD 2X1WL 3TBVA 1QG3A 1RMFL 4H1LH 4OFKA 5DMKA 1AXSA 2ZUQC 3GUTA 3ARXA 2V2TA 1ADQH 2XWBB 3K4ZA 4W4OC 3E3QE 5E00B 4RGNB 3N85L 2CDGA 3D39D 5DGRA 3D25A 5C7XL 5AZEH 5IT2L 5HHVH 1OQOA 5C9JB 4FA8A 4YPGA 4ZFGH 3BUYB 4Y5YC 4YH6A 3QQ4A 3ZYIA 1TZIB 4GMTL 2LAGB 5FV2A 1RAMA 2GTWA 5E00A 3WFDH 1QLRB 5IB3A 4LRIA 1JN6A 5J56B 2AVGA 4PJCA 5GRZA 3LIZL 1IGIH 4P46C 1C08B 2AK1H 4MJ6B 2BRQA 4A6YH 1FSKB 1OCWH 2BCKB 4HUMB 5C9JA 3MRRA 3MCLH 5DC4B 4YHIA 2G5BB 5FGSA 1XH3B 4HJ0D 3ZKND 2XTLA 15C8L 1G7MB 1QLRA 1GAFH 2EZ0D 4ODSL 1I1AB 1JNNL 4MJ6A 4D9QE 3VGFA 1CLCA 1NGPL 3U0WH 3JUYA 4BZ1L 1PDKA 3BQUB 3S98A 2ICEA 1KTLA 2ORBL 1QBLH 3MLVH 4JFDB 1QTYT 3MOBH 1KCKA 1K3IA 4QRUB 2XA8H 4NN7B 3BKCL 1I1AA 4TRPH 1NMBL 2UVFA 3EZ8A 1FH5L 4OI9A 3BQUA 4EI6B 2H3NA 1N6UA 4UT9H 4XH2A 3RNQA 3KJ4C 3WKNA 4WUUE 1NUNB 3Q6FB 4QRUA 5EUOA 3PP3H 4X8JB 5E6YA 4OD2A 1T04A 1UWGL 1PZ5B 3D0LB 1CXLA 4LCWD 3VH8A 3H2WA 4I48A 1PLGH 4ODHH 1BF8A 5ALCH 1CDIA 4X8JA 4OGZA 2EKSB 1J1XL 4MCYB 4URTB 1PZ5A 3QIBA 1YEHL 3BP6B 4K7PL 4HGWB 4PRPB 4JQIH 4PR5B 3OKDB 3O2DA 4HAGA 4OD3L 4JM2F 3GIZH 4HW6A 4P99A 5IJKA 4GRWF 1GGIH 2DBJA 4XRCB 4EZMA 3QUXC 4JEGB 4L1DA 2DKUA 4QXTB 3BP6A 4R4ND 3SBWC 1NGWB 4PRPA 5DLML 1JWMA 5EOQL 3BZFB 1JZ3A 5E24E 3HHRB 4XAKE 4HWNA 4E0RA 3UPAA 3C5SA 4IIQB 1CE1H 4OAWB 3F7VB 2DDQL 1WTGT 2OR9H 3DETC 4QXTA 1NGWA 3MLZL 4LSSL 3BZFA 1VEPA 2LQRA 4Z0BL 4I18B 4IIQA 1KBGH 3SDDA 1FPTL 4MXVE 3K0WA 4Y5XA 2VC2L 3EYOB 2F19H 4HWBL 1Q9WA 4KROD 3QG7H 5IVOA 3MMEA 5HI3C 4AIZB 3RPIB 4I18A 1ZEAL 2CR3A 2JLLA 2LTQB 2Q8AH 4NGHL 3EYFB 1KJ3H 3EYOA 4YHOH 1MHEA 2DQHH 2ATPB 1A3LL 4LSTH 2R29L 3V6ZA 2FJHB 4UAOC 1OSPL 4AIZA 4YJZL 2RBLA 3TYFB 3RPIA 4I0PD 1UJ3A 4GRLD 4PJ9B 3WO3B 2G75B 2N56A 3U36B 1MIMH 3DSFH 4LEXL 3RVUD 3EYFA 4MCZB 5GS2H 1P7QB 4BJLA 3U2SB 4RFNB 1GC1H 2F8XC 2C3WA 3NPSC 5DURD 5IR1B 2FJHA 2B4CC 5E4EB 3GKWL 3TYFA 5J9PB 5IOPA 5TQ2L 2PETA 1TDQA 5JHLH 3KPNB 5BZDB 3WL9B 2AXHA 3U2SA 4NCC1 4F7EB 1AR1D 1R6VA 4U3HA 5DT1H 5IF0B 5IR1A 4EQ2A 3DARA 3FO2A 5E95B 1EDQA 5KSAB 1NKRA 5EIQA 1L6ZA 4BSJA 5J9PA 4NN6C 5DJYA 2XZCH 2UY6A 3KPNA 1A14L 3MGTB 4AEFA 1I3GH 1UYWH 3GI9H 3QO1B 4XNXL 4DKFH 4EVNB 1A7BA 1MQKL 5KSAA 2HMIC 3U30C 2AK4D 3DECA 3MYJB 1LILA 3T0VA 1X5KA 1NCAH 3PHQB 1GYAA 1KCLA 3BGMA 3CX5J 4ZUVB 3ES6B 3QO1A 3BW9B 5IIEB 1L4IA 3AS1A 4F80A 1B3JA 2GEEA 5KSVA 2WUBH 3MYJA 4QRRD 5FYLL 4R2GD 4XP5H 2O5XL 3UJTH 2XG4A 3KPQB 2DI9A 4BQ6A 3ES6A 1E6OH 5C70A 3BW9A 1TVBA 4L3ED 1QP1A 1QPXA 5IQ9B 1DDHB 4TVPH 1LEIB 5DMGC 2XYCA 3DROA 3BGFB 5D7IE 5C6PB 2I5YH 3NFNA 3KLSA 4WW2F 4D0CB 2R0WH 5I1CH 1IE5A 4QRSB 5IQ9A 4N5UA 1DDHA 1W72B 1F4AA 4JLRA 4X7CC 3W2DL 4JG1H 3REWB 3B6SB 1E4WL 2EE3A 1S7SB 1Q9OA 1OPGH 1MHHB 1WZ1L 2NMSA 2VMFA 2XTJB 3PWJA 3PWPD 3EDJA 1A7PL 5JQ6H 3L9RA 4S1DC 4U6HB 1PEWA 4K55A 1KELH 4R6UA 1ITCA 3REWA 4U6TA 3B6SA 4NQEB 3U83A 4N8CH 2VDKL 5IK3B 1P84J 5E6ZA 2CO7B 4G6JH 1DQJA 3C09B 2DBLH 2YS4A 4MNGB 1K5NA 3F7PC 4IRJB 1BOGB 1TZGH 1EBPA 3OAZK 2VZUA 3JTTA 2K7PA 3V4UL 1HSBB 5C0CA 4NQEA 3NH7L 5DUBB 3T77A 3C8DA 1AE6L 2X9WA 5IK3A 5GS0L 3VXMD 1UM6H 3B83A 5IFHH 5MEND 2J4WH 1VKXA 3WIIH 3VFVA 2FYYB 4HIJB 5A3ID 5BJTB 3U7WL 1WWBX 3RRQA 5D1QB 3ZHDA 3QEQD 3KPOA 1BOGA 2ERJB 1EMTL 2KZWA 3WLBA 2RCSH 3MV9B 2GCYB 3LEXB 3BT2L 1HSBA 3JVGA 1B9ZA 2OL3H 4UNUA 5CEZD 3FJTA 5C09D 4HUXA 5L2KE 1BD2A 1BQHB 2FYYA 4HIJA 5BJTA 3O6LH 4XVUC 3QI9A 1CFTA 3ZDYE 5CBEB 3VD7A 4P49A 5GSVA 1AC6A 2XNAB 4Z7NE 4YX2L 3DSNA 2IH1A 2NXZB 4FQPA 4H1LG 3STLB 1VHPA 5I8EB 1JZ4A 5CBEA 5D5MA 1MJ7H 4X7DC 1C1EL 1C12B 2XNAA 4CJ0A 4EI5B 4RWYH 2V17H 3CD4A 2VSDA 4JJ5B 4K9EL 4W6YB 2OJZL 4FG6D 3LQZB 3STLA 1KJMA 5D1XB 1DUZB 2OQJB 2VL4A 3MLUL 1F4WL 1UM5L 3U9UB 5DJAB 2HKHH 4NQDB 1C12A 4U1SA 5GRUL 4EI5A 3OKYA 4XNUL 1WAAE 3E8UH 4JJ5A 1D5ZA 4LRIC 3LQZA 1ZLUK 5D1XA 1DUZA 2GJZB 2OQJA 4HX1A 4W70A 5IEKB 5DJAA 1UADC 5L6YH 2NZIA 4XCYA 4NQDA 2AJ3B 3UTPD 1EBAA 5AZ2H 2G60H 1UC6A 4RX4D 2AJVL 2KDGA 4OGAD 3SDXE 4JY4B 5E6IA 2GJZA 5IEKA 3R1GL 1BECA 2F5BL 3SDCB 1IC5L 3IDXH 3MUHL 4TULH 5ISZE 5HVHC 1ACZA 1DCLA 3MODH 4MLSA 4Z7OF 4Z95L 4OV5A 1OTTD 2K1MA 5IBUB 4JY4A 4KI5D 5F21B 3AS2A 1V7MH 1IGCL 2VABA 5BO1H 1N7ML 3I84A 5IB2B 3I50H 5BS0E 3CFCL 4NO0B 2DQTL 4XP4L 4DFHA 2ZUWA 3HFML 3TO4B 1N3NB 5CD3B 5IP4A 4Z7UB 1OGAD 2OTUB 1I7TA 5IMLA 3DXAE 3OX8A 1CDCA 4MAYB 5SWSB 4C4KO 1JTTA 3NZHL 4NO0A 1J1OL 3LB6D 4B53A 1YMMB 2CDFA 3W5NA 3LKQB 3QIBC 2ZUSA 5EO1B 3V5HB 2OCFD 2VRAA 1HI6B 5DFWH 1A21A 4O2CB 2Z91A 4NNPH 3T8XB 3EDKA 4NQTA 4DKDC 5IJKC 5CS7A 4FQJH 3DVGB 4X7EC 3JUZA 5D72L 5CKGA 2VZSA 4F8QA 4Z7WB 1HI6A 4F15B 3SCMB 4KMTH 2IPUK 3T8XA 4FFWD 1BFVH 1N59B 1OAQL 1OP3K 2DM3A 1V3LA 4JFOB 3VWJB 4LSPH 1URLA 1JZ5A 4LFHG 1CR9H 5D2LE 4DGIL 5B4MC 1C16B 3FRUA 2VXTH 3O11A 4W6WB 2R8SL 1FIGH 1S7WB 2L0DA 4IIQC 1LO4H 4JFOA 5TPWH 1NEZB 3FN0L 3SDDC 3VWJA 2FB4L 5C08A 4Y5XC 2FH8A 5T1KA 3VGDA 2DTML 5IGXL 3DX8A 3RVTD 4XNZC 5DD5H 1DEEB 4HMEA 2DMCA 3EHBC 4BH7A 4ETYA 4EBQH 4ZODA 1NEZA 2FLRT 4TPRL 4KHXH 5EWIL 1YJDC 2RHEA 5D93B 1OP9A 2AJUL 1BZ9A 4G6FD 1JUFB 4GAGH 5CZVL 1T2XA 3D3VE 4X8XA 4OZ4B 1DEEA 1V05A 3E2HB 2GW5A 2Z93A 1UJ3C 1INDH 5T1LD 1KG0B 2VQUA 1NL0L 5ANME 4PRID 4X6DF 4O58L 1UACL 1YEEH 1KLFA 4YO0B 1WTLA 2EH8L 1U8HB 3VXSD 1OGTB 2UZXB 2F53A 1KENL 1R3IL 5FYLD 5E2VH 1HHGA 2Y6SD 2R4RH 4BSWA 4EIGB 2UUDH 2AERT 4LSSH 5LKNA 5DHVH 4KV5E 4NQXA 1BLNB 3G5YB 4Z0BH 2PYEB 1OGTA 1N8ZB 3QEHA 1MF2L 2FX7L 4P2QD 5I1IH 4XXCA 4BZ2H 3W82A 2NY2C 5GS1B 2OSLB 1I7UB 1ZVHA 1BLNA 3NACL 1KB5L 1TQCC 3EOBB 3P0YH 6FABH 25C8L 4DW2H 4R26L 4APQD 4ZAKB 8CGTA 1MCPL 3I6GA 1NMCC 4OGXL 5HSFA 3BEWB 1AKJB 5HYJE 1OSPH 1OAXH 3GI8L 2B2XL 1MEXH 4YE4H 2H45A 2KQNA 4KZEL 5MHSD 1Z3GH 3RTQA 3C60B 4IMLB 3EJZC 4ZAKA 5JORB 1HNFA 2X4SB 5TDOA 3B8YA 3FQTB 1AKJA 1WWCA 4CN1A 2GAZB 2Z8WC 5DUML 3T0BA 3GRWL 1G7LA 2HJFB 4U05A 4X9HA 1ZA6A 4ZOAA 3MYZA 3RGVD 3T09A 3C2AH 1QSFE 4U1NB 2X7LA 1CT8A 3C60A 4YAQB 2NY4B 5JORA 1GCFA 1NSNH 1F13A 2DQCL 5GS0D 3FQTA 1X3DA 1J87A 2F8VA 1FAIH 1EEZB 3IKCA 3PE9A 3F58L 4NUGH 2W59A 3GHEH 2HJFA 2WINA 1X5HA 3R8BB 5GJSH 3QXAB 2E6QA 3G5ZB 2HWZL 5C0EA 4OM1L 5I74C 3BGFC 2UWEB 4OZGB 3RWHB 3GMMB 3L7EA 3RZCD 2WMPA 1U92B 3MRKB 4OKVB 1MUJA 1QHOA 3QXAA 4LDEB 2RJMA 2J5LB 5E7FA 4LGRB 1CLOH 2IQAB 2UWEA 4M1CD 3IU3B 5KOVC 3RWHA 5E9DD 1F4YL 1SYSA 3T2QA 4QO1A 3BOVA 4U0RC 5DJCB 1CI5A 2QQLL 3MRKA 1JF5A 1WVZA 2FBOJ 2IFGA 2CH8A 3TGXA 1ZLSL 4HXBH 4CADA 1YEIL 2FD6L 1G6RA 2YPLE 4QGTA 4PRDB 5DJCA 3PGDB 1N64L 3CFKA 3Q5TA 1ZSDB 3SDAB 1I1YA 1S7XB 2D7MA 4N1EA 1G9NH 1P9MA 3DGGB 4JRXB 2GJ6B 2ATKA 1VCAA 3QI9C 2ED7A 3FO9A 1BFTA 3PGDA 1FLRH 4P2RD 3EFDH 4GUPA 2BVTA 4Z7QE 4X4ZA 1YY8B 1H9VA 3DGGA 5D7IF 4HIHA 4ODTL 2EDNA 2OMNA 1Y6NR 4JZNA 3WFHB 2VLRD 4TUKH 2MCPH 5EC2B 5D70H 2DYPA 2MPAH 3O41A 4OZHA 5ACZB 3K3QA 4MLIA 1YYMH 3UX9B 3D18A 3RVXD 4HBCL 3HPJA 5DVLA 4WTZG 1KCVH 5EU6E 3IDGA 4PJDA 1FNLA 2X70A 4PD4J 4BK4A 1T89A 3WFHA 4G6KH 1P1ZB 2IANE 4HCRH 3UPRA 4KDTC 2Z35A 5T1MB 1FN4A 1UH2A 3X3FH 5D1XC 1LP9F 4CN6A 2XV6B 5HYSB 2W07A 1CDHA 1P1ZA 4Y4KA 4ISVB 1MIEH 3OKEB 5T1MA 4M8QB 5JO5B 5TFSL 4G80B 2SEBA 5E6IC 5HYSA 2NY0D 3HLAB 1MCEA 2M2DA 5DJ6B 1MCCA 1YYLH 4PJAB 4N9GB 3OKEA 4JFHD 5ENWA 5FHAL 3RZWA 5EU4B 5KVEL 2VISB 2RAMA 5GZOD 5D6CB 4X4YB 3D5OF 4DAGL 5HYQB 5B38G 3ZSSA 3OKKA 3ZDYF 3MRQB 4LSUH 3HLAA 3BD4A 2IAMD 1CZ8H 3ULUC 2AJSH 3PWNB 4YC2C 2VISA 4NWTH 35C8L 2G9HB 5GRVL 3PDOA 3L5XL 4OLWH 5D6CA 5C0IA 2VLME 1TTUA 1ZGLM 3HUJB 4MA8L 1JGLL 1HEZA 3O3EB 4N0YL 4NSKB 2BY0A 3MRQA 3CFIC 5D2NA 2GT9B 4UB0H 5FHBH 2X05A 4HT1L 3B9KC 5DA0B 4X9FA 1T5WB 1CIUA 2ZSWB 2V9QA 4WUKL 2G9HA 2ARJB 3QUZD 4LGPB 5K9QG 4P2OB 2UZIL 4L1HA 4JM4L 2R4SL 3O3EA 5HDBE 2O93L 1FFNB 4NNYA 1M7IB 5I71C 4W4NA 1U8KA 2HYMA 3LVEA 4HKBB 2WBJA 3G5XA 3OG6B 3Q0HA 3L5IA 3JBG7 1UKSA 3MRFB 1WAAF 4P2OA 4KRMB 4LASH 3V5KA 4PJ8B 5C07B 1M7IA 3MNVA 3PGFH 5MP6L 1OTTC 5KS9E 3KPSE 1JGDB 4NBZB 5F9WB 4J1UB 1JI2A 1JHLH 1KLUA 1RUPL 3H9HB 5CFHA 1L9NA 4PJ8A 2PXYB 2GITB 2A1WH 5C07A 2E7BA 3LHPL 4NHCH 3UYRH 2DQTH 4M1GH 2NYYC 3MQIA 2ZUXA 3IJYB 4S1RL 1AD0B 4N8VG 3AUVA 1ORQA 2GITA 4N0RA 4RAVB 4L8BB 1WBXB 5ITFA 1I9JL 3HI5H 4AG4L 4NRYB 1ND0A 4KVCL 2A6DB 3TO2B 4PP1C 5AYUH 3RWEB 1AD0A 5GGSY 3TVMA 5D8JH 4PJHB 1M4KA 3WXWL 5IFAL 1HDMB 2WUCL 2ICES 1M7DB 5DQDH 5I1JH 3FO1B 2A6DA 3QWRD 3TO2A 5KVDH 4KK9D 2VDPH 4WFFE 5MEPB 1PX3A 4I13B 4WEBL 1G7IA 1JI1A 2NY3B 3U1SL 2AEWA 2OXHA 5IHZA 1J12A 1HDMA 1RFDL 4JPIB 1A1MB 1MCIA 1CFBA 3FO1A 3IETA 5CJQL 2B5IC 3QFJE 3PHOA 2Y36L 2CQVA 4EUPH 1W8NA 1CXEA 4QRTA 1QRKA 1LGVA 2AJYL 4MXWH 1A1MA 5HD8D 5I8KH 1QFWI 1JYNA 4J6RH 3VGHA 4XXCC 3C5JB 3KYOA 3QDJD 3PF2A 3UTQB 5C2BH 4YFLF 4I5BB 4BFBD 5F7WC 5HI5C 1NAML 2OJEB 1S9WB 5INDA 5J6HB 4KUZL 1Q0XH 2PKDA 3SQOH 2XPGB 5HHME 3RIFK 1UCBL 3GJFH 3UTQA 4JO3L 4LVEA 5F3BB 4I5BA 5JTWA 4N0UE 4ZXBA 5AG8A 1RK1B 3LS5L 1I8MB 1N4XL 4P4KB 1CE6B 1G84A 1N0XH 3NCJL 4KKAD 3RBSA 2LU7A 2R1YB 3U48A 3RTQC 4FABL 3VG0H 3I6KB 2HRPL 2DQUH 2H2PD 4RGNE 4ZAKC 5F6IB 1SBSL 1A3RH 4PJCE 3OAYK 1NFIB 4DN3L 5HTSA 2D2OA 1I8MA 2E9JA 2BRRH 3D85B 4B0MM 2CIKB 5SV3A 1RZIA 2YUXA 3B2UD 2EDLA 5TGBB 4U1HA 2R1YA 2HVJB 4C4KT 2XZZA 1GPOL 4JFFD 4V2CB 3HE6A 3C6LD 3KPPA 3VD9A 3OJDB 5DD6B 2IQ9H 4LOUC 4WI5A 4WFED 1HH9B 1WFOA 3TJEH 2EDHA 3V6BR 4C56B 2XRAL 1W0WB 4H5SB 3K4DA 3VXRD 2HVJA 4XC1H 1A6WL 2ITCA 5EU3B 3SE8L 5EFIB 2VZ3A 1CD0A 1DP0A 2P5WB 3LD8C 3OKOA 4B7LA 5DD6A 4LLVB 4LLWA 4APQC 1GL4B 2P5EB 5GGTL 2CO6B 4GKSB 4C56A 3CJJA 12E8H 5C0BA 1W0WA 2R56H 2YWZA 4JFDE 1T0MA 4AMKH 4H0HB 5C92A 5EU3A 3NIDE 3JWOL 1FCGA 3WCYA 5EFIA 4FQQB 5CCKL 1I7ZB 2ZOKA 2FZ3A 3QUMA 5LBSH 4TOYH 5GS3A 2P5EA 4PLKC 1GGCH 4GKSA 3KS0H 5JHDB 3V0WL 5IFJB 2J5LC 3NMEA 2XKNB 4FQQA 3RGVC 1I7ZA 1MJUH 3QPXL 4FZ8H 2D7PA 3WUWG 4BH8B 3IFLH 1JPTH 3CIQA 1WICA 4XMLL 3O0RL 1WIUA 2I24N 1KJ2L 3N1QC 4RFEB 5JHDA 3S88H 2UUDK 4U6XB 1RULL 1A1OB 1P9MC 1SYVB 4RQQB 1GVIA 3NCMA 1VERA 2FHBA 2YD1A 3IDUA 3LS4H 4PRPE 1OP5H 2Q7NA 3HNVH 3AMLA 2COQA 3CUPB 1A1OA 2NXYD 4WO4B 1TXKA 5C6TH 1CGSH 2DTSA 3OR6B 4OV6F 3MRHB 4HPOL 4OLVL 2DQGL 1GIGL 4ODXB 4G9DA 1DQQB 3GSRA 4G6ML 3MX0A 4PG9B 1TTGA 2DM2A 2FIKB 4IMKA 4WO4A 5SWZA 1I8KA 4JFPA 3QIUD 4DQOL 2JJWA 4YLQT 1TNNA 5B22A 1RZKC 4ODXA 5DVNA 1T89C 3BP5B 1MHPL 2QEJA 2WSKA 3LDBB 4JPKL 4KQ3H 2X4TB 4X7SL 1SHMA 3EOTL 5LCVL 1A7RH 4KAQL 5BVPH 5D7KE 2C3VA 3BO8B 1ZOXA 5DYOB 4H1LA 4Y4KC 5K33A 4Z8FL 1RJLB 5JPMB 2HFEA 9CGTA 3MLWH 3AXLA 4E41A 3VFUB 2F15A 3BO8A 1QNZL 4XXDB 5DYOA 4HV8A 1K6QH 4PP2B 1RJLA 3V7AG 5JPMA 3QAZB 4ODTH 3UBXB 2AQ2A 3RI5F 4Y19D 3VFUA 4XXDA 4TSAH 4MYWB 3PDGA 1EO8L 4KC3B 4PJEA 3FOLB 5DUPH 5IVXB 1WK0A 4FFYH 1NUGA 1AXTL 3UYPA 4HWZB 4Z0XA 4OF0A 5C86A 1CFQB 4HWEH 1D6VH 5D2NC 2AKRB 1YPZA 2RIKA 4FOMA 5IVXA 2QQQA 4K3JL 3IVKB 4HFWA 4ZUUA 5BCAA 1NPUA 1UT9A 3GMOA 4MXQD 4JHZA 2VXVL 3RX5A 3BIKA 5D4QA 1ES0B 4P5TB 1IT9L 2WBJC 4WWID 3V52L 1CBVL 4OFYA 2NY0C 3RNKA 4LIQL 3IVKA 4LFHD 2DN7A 2IGFL 4PYGA 4Q9RL 1YC7A 1A47A 2BSSB 2DAVA 3HI1B 1ACYH 1JWSB 1RJYB 4HJGB 3VFPB 3MR9A 3IT8D 4FQHA 4XPFL 3BN9D 5J8OA 5E94A 1R5IB 2OI9C 5JXAH 4E9LA 4O5LL 5F9WC 4UUJB 2CLRA 1RJYA 2YK1L 2ICWJ 4HJGA 3D39B 3VFPA 1PY4A 3V6FB 4HMDA 1ODAA 1U42A 5HDQH 4H20H 4D8PB 4HKXB 2VLKD 1Z2KA 4XVSL 4KZDH 3BFOA 2O61B 4X6CA 2MCG1 1EV2E 1NBVL 4HJJH 4GAJH 4OCLC 2AXGB 4PB0H 1ZV5A 5CSZB 1AHWB 5BV7B 1HKLH 3EDDA 1A7OL 3LKOA 3MBED 2FWOB 4ZUWB 4D8PA 4HKXA 3TVMC 2NW3A 2XTJE 4OGYH 3P4MA 4FXKA 4UIKL 1XGQB 3O6MH 3QEUA 5CSZA 2KPNA 1AHWA 4M6MH 4NQEE 2C4FU 2FWOA 2F58H 4AQOA 3MLYL 1Q9LB 4JN2B 1H3GA 4MNGE 3ZDZE 4WNQB 2D0HA 1XGQA 4MGXA 4MB5A 3CVIL 1ZLWK 4EUPG 5J13B 2HTKD 3QIWA 4HPYL 3UTTD 2E6JA 5F89A 1LDPL 3HZMB 4GJTB 4WNQA 1F3JB 1JGUH 4K8RH 1U8LB 5TE6L 1QO3B 3QG6A 1YC8A 3MV9E 3IS0X 3B9DA 1OAYL 4JREB 4LCWB 1BQUA 3NFSH 4NZRH 3ULVL 2CKBL 5D6DA 5J0BA 5KSBA 2H1PH 4ONFH 3QULB 1L7IL 3SKMB 5CLWA 1F3JA 4UQ2B 1QBML 2Q7YB 4HKJB 4KUCF 3CSGA 1IAKA 1OLLA 2VWEE 1PD6A 5TF1H 1JMXA 1J0ZA 2YRPA 1VFAB 1E27B 1FDLH 5LJYH 3GMQA 1CDJA 3QRGH 4ZXBC 1DUYA 2OK0L 4Z7VA 2ENYA 2C1OA 4NO2B 3P4LA 2Y4SA 2E6PA 1QHPA 3A6CH 4QTIH 3T0EC 1JV5A 3CX5K 1I4FB 1VFAA 4ZD3L 4NUJB 4QXUH 3WNNA 3WFEH 4Q6IC 5HY9B 5JOPD 4NPYB 1H8SA 1OT2A 3PP4H 2ED8A 3CU1A 3SO3C 1TJGH 3MV8D 3GM0A 4F37K 3AAZA 3BKJL 4N1HB 4NQDE 4H26B 5D7JA 2QHRH 3HE6C 4PS4H 5F6IC 5HY9A 3U7AA 1AY1L 4NPYA 2FBJL 4PV9B 4WTWA 1T7YA 2Z0BA 3CSPA 4JZOA 4ZFZB 4Q9QL 5GZND 2A0LC 2PR4L 4XHJC 4KROB 4I3RL 1U8PB 2O5YH 4ZFZA 3RWCA 2R1XB 4NFBA 1MCWW 5J12C 4X98B 1M05B 2V2XA 1AP2B 1MPAH 5GRJL 4KKAC 4NKIL 3KLAB 1U8PA 4Y4HD 5F9OL 3WFCH 2R1XA 3VRIB 4JKPL 4GRLB 1PKQA 4X98A 4K3EH 1M05A 1AP2A 2E7CA 1EX0A 1T66D 4XC3L 1V8HA 4ZTOH 4DN3H 1FV1B 4HKZA 3B5GA 3KLAA 1JFQH 4IRSB 1OARH 4Z7UE 2UVEA 1U8MB 2H6PB 3VRIA 4DUVA 1KLGB 5SWSE 1A7NH 5EO0B 2FJFB 2WK2A 4AM0B 4IRSA 3PDDA 3LKPB 4PJCF 1F8TL 1U8MA 5T33H 2H6PA 5SX5K 3S37L 3BZ4A 4WV1A 2R23B 1KLGA 5JXEA 4MA1C 4YDIH 2FJFA 5IHUH 1HYSD 2D7OA 1XGRB 3PGCA 3QPQC 2P8LB 2ZUVA 3LKPA 2AK4B 4X9GA 2W9DL 4LSRL 3UBXI 1E28A 4P59L 3WKML 1F3DJ 4HK3N 4Z7WE 3GSVB 3L95B 4AEHL 3OXRB 3GJFK 1D9KA 2OL3A 2P8LA 2I26N 5IMMB 4IMKC 4WO4C 4OLYH 1UB6B 1L7TH 4QRRB 3R0MA 1CD9B 1ED3B 4R2GB 3OXRA 3WXVH 1NC2D 4LAQL 2EDQA 3TNMB 3ZTNL 4HIIB 4I2XA 1ETZB 1WLHA 3SKNB 1UA6L 4R7NA 3HS0B 4QRRA 4LHUD 4ZS6C 3ALXA 1FNSL 4DTGL 1EJ6A 2VQ1B 3AC0A 1UFUA 2ZPKH 1CD8A 4F57H 2VDLL 4GXUN 4OF3A 3SKNA 5AG9A 4KK6D 4HC1A 2YD5A 4P9HH 3GHBH 4JFZL 4Y16A 4TUOB 4Y2DD 5ADPL 2VAAB 2XN9B 3IXTB 3ARED 4Q58C 3FMGH 4M4PA 5B8CA 1DLFH 4QRPD 4DGVL 2QQKH 5CUSL 1Q8MA 3MGAA 3PWPB 5IB1B 1SY6A 4TUOA 1U6AH 3EAKA 2VAAA 2B8OT 3WHXB 2XN9A 2F5AH 4M7KH 2NY6C 2QSCH 2R9HD 4LPWA 2Y07L 2DQJH 3U4BL 3PWPA 3VGEA 1BMGA 1LO3L 1DE4B 2EYTA 4UMGA 1LEKA 2PYEE 4YZFE 4JKMA 3QRFM 3VXMB 4PGCB 2K3TA 4JN1H 3OTTA 5DS8B 4MQSB 1RD6A 1LK3H 3QEQB 5JW3H 1AQDB 5KVGL 3CZFA 1DVFA 3O4OC 3RHWK 4HLJA 5MERB 3IAQA 3VFTB 4YUEH 1EEQA 5B38A 5DF0A 6CGTA 4PGCA 5L7XH 4YDJB 5E08L 1X5IA 5C0JB 5GJTH 4XVTL 1FE8H 2OTPA 5T5FH 4AT6A 1FVDB 1TQBC 1EXUA 3T2NH 5LAXB 4ZNEA 1OP5K 3L3GB 5ADOL 1MVUB 1YEKL 4EDXB 2EH7L 4I77L 5DEFA 3VFTA 4ALAH 4XX1E 4YQXL 4YDJA 5GGUB 1FZJA 3F62A 4ELMA 1RURH 4POYA 1KOAA 3JWNC 3ARBD 4R0LC 1EGJL 5LAXA 1NCWH 2VDML 1MVUA 4N5EC 3DRTB 1FFRA 3QDGD 3KPRA 2XACC 2YD7A 4GSDH 1MAJA 3RIAF 4ZTPL 4FQLH 4YK4B 3IFNH 1XCQB 5DVKA 2HFGH 3S35X 3BPCA 2ITDA 1IM9A 4M02A 2VLJB 3DRTA 3NCBB 5F7FA 5DQ9B 4JO1L 5IJVB 5I1GL 5J11C 1LO2H 4I4WB 1A9EA 5C0DB 1AO7D 2UWEE 4OZGE 5FK9A 5EG6C 3BP4B 3ULVD 1DBKL 2VLJA 4UV4H 1WFUA 4NKQB 4ZOEA 3L5HA 1Q1JL 1T1WB 1NANI 1OAUL 2FGWH 4JFXA 4I4WA 5DVOA 1P4IL 1AHWC 3BEVB 1T03L 1IFHH 3T0WA 1A6AA 3SGDI 5C0DA 3A0OA 3LZFL 2VTFA 3BP4A 4M1DH 3FB8A 3MLRL 4NC0B 1BVLB 4BM7A 5BQ7A 3U79A 2KL6A 1MWAL 3QQ9D 1INEH 1MCOH 3ARYA 1JTOA 3BEVA 3BDYL 3MRCB 3O4LD 3QIWC 5ERWA 3ZKQD 2DRUA 4LBEB 4KRPD 5I76B 1HOCB 3ROLB 2EYSB 2BNQA 1BVLA 1IBGL 3TBTB 3MO1A 5I73B 3VXNB 5EPMB 4CRPA 4NZDA 3MRCA 5HHQA 1R24B 3RWDB 1OGAB 4LBEA 4LNVA 4JRXE 3UAJC 1NBVH 2GJ6E 1GC1C 2EYSA 2NTFB 4EIZC 4CMMB 2DLEA 1WUNT 3TBTA 3VXNA 5EPMA 4PG2A 3EOAB 1Z6JT 4JREC 1U3HA 1OGAA 2C1PA 5E8NB 1KIPB 4ODVL 4JY5H 4WTXA 5ESAA 5DHVA 3C08L 2JB5H 3Q1SL 4MJIA 3ILQD 3D69B 3FQXB 1UZ6E 1T0PB 1C5DB 1TETH 4NZTH 3EOAA 2J3SA 3PABB 4M6NL 4HWBA 4FQXD 3V8CA 3UJJH 1EHXA 4OCXL 2FEDD 2OP4L 4JM2A 1AQKL 2HTKC 3BH8A 2CJUL 4KTYA 4FQ2L 3D69A 3FQXA 4DKEL 3UROR 1C5DA 2DIAA 2GY5A 3O8XA 2HFFA 1S7QA 4XGZB 4UV7H 5D7JC 3L6FA 4E42B 1DQDL 3ECBB 5CP7A 3MJ9L 3O81A 3QNXA 3ZDZF 5TE6H 1QFWM 1G9MC 3MRMA 4D9RD 4YBLB 2W1NA 3VGAC 4LLMA 1IGMH 4LCIL 3ECBA 3INUL 3MRPA 5MEQA 4L5FH 3QDHA 5DQJB 1AGFA 3EFFB 1W2KT 3MV7D 3IKKA 4PJAE 4YXHL 5IWLA 2Q20A 3KYKH 3GB7A 5DC9B 4OCSH 4G6FB 3IDIB 2PW2B 2QR0A 4HXAH 5DQJA 5KN5B 1J8HB 5IVZB 4KK8D 4YPJA 2A74B 4OZFH 5I66B 3CVHH 5T1LB 1HSAA 2JCCB 2APVA 2QADC 4WW1B 5C0FB 3JWDL 3MA9H 4PRIB 1BJ1J 3BE1L 4J8RB 1MCWM 3VXSB 4R97B 1J8HA 1YNKH 2A74A 5I66A 3GM8A 1S7UB 4WW1A 5JZ7D 2BXYA 4Y8DC 5HJ3A 3S34H 4NNXB 4MJ5B 1SQ2N 5A1AA 1CFVH 4IRSC 3CXDL 1B6DA 5FDYA 3VD4A 1NBYA 4LPVA 4PGZA 5CJBA 3K4AA 2BVPB 4WV1C 2PUQT 5JXEC 1S7UA 1QA9A 1QEWB 4XCFL 4RNRB 1FP5A 1MRFH 4MJ5A 1XF1A 4K2UL 5GHWH 5C07E 1FL6B 4JQXA 3ISWA 3QNYB 4M62H 1XGUA 4P5MA 4ONGH 3MLSH 3KXFD 4Y4HC 4KTEL 2YOCA 1QEWA 1D9KC 4RNRA 1HQ4A 4NJ9H 4GW5B 3BISA 4X7TA 3UO1H 2Y5EA 3F6IA 3OG4B 4BFEA 1NFDA 4PJIA 3BPOC 5CD5C 2X4QA 4WY7L 5CWSB 4NT6B 4PRAB 3ULUF 4I8DA 3MJ8B 1BFOA 1DQLL 1E6JH 4GW5A 2RFXA 1KN4L 2ADJA 2YKLH 4Q7DA 2BNRB 2Y9RT 3KLHD 1B6UA 4MDIA 5DJ2B 3TN0D 5HHOA 3MJ8A 4OLZH 4OI8A 4YFEA 2OYPA 3LKRA 3MGOA 3NCYP 3U6RB 4KY1L 4DGYL 3DO3A 2W0FA 2BNRA 2WNGA 3D9AH 4O9HH 4Y16C 2OXGA 4WW2A 4YBQC 2YMXL 4QF1B 4HCRA 4MJ2A 3OGCB 2CLVA 5B8CC 4LVNC 1BX2B 5I30H 1BOYA 3QDAA 4GMSL 4NRZB 3RZCB 4F9LA 3U6RA 3M1BB 3RU8H 5DRWB 1F6AB 2VZTA 2WP3T 4RISL 4GKNA 2EKJA 3OGCA 2XA3A 5I1KL 1BX2A 2X4NA 5E9DB 1A6ZB 5HVGB 3HG1A 1QYGL 3VWKD 1F6AA 4HG4J 3RWIB 5CKAA 4DUXA 2BOBB 2X44D 1BAFH 5CZXD 4KKLD 5CSBA 1A6ZA 1QKZL 4L8SB 5BVJA 3TT1H 2VYRE 3MCG1 2R2HA 4WU7A 4G9FD 4ODUB 1DVFC 2CK0H 5FUOL 3RWIA 5JOFB 2HLFC 4JG0L 3P30H 4K3HA 4FFZL 3BDBA 4RDQF 1OQXA 4OD1L 4U1KA 4DZBA 4WFGD 4L8SA 4M93B 4JFZH 5F7DB 2ESVD 2AEPL 1GZQB 4P2RB 4ODUA 4HZLA 1FZOA 1RIHL 2R0LL 2D7TL 5IQ7H 3QHFH 1FVEB 2Y5TA 4G8GD 1IC1A 1GZQA 4FQCL 2N7AA 4M48H 4U1MB 4UT6H 1A4JB 4HDIB 5DSCA 8FABB 2P49B 5I8CB 4M61B 5LGJB 1GOHA 4FTVB 1FVEA 4G7VL 4MHHG 2AEIT 2HA1A 1G7PA 1DBJH 1BBDH 5C3TA 4U1MA 1A4JA 4M5YH 3CFJA 3PQYA 4JRYD 3UCRA 4C56E 4OCYH 5I8CA 5ESVB 5LGJA 2EXWD 3QXUA 4FTVA 3PL6D 1PG7W 4U6VH 3HMXL 4DKAA 4JCLA 2P5WE 3ZHLA 1JGVL 1KULA 1ZHBB 1KN2H 5HGBB 4P9MH 2P5EE 2F74B 5D96C 4G3YH 3UDWA 1HNGA 1PG7H 3LPGA 4JDVB 4YHLL 2YA1A 4O02H 5IB5B 2V2WB 2L4OA 1KPRB 1JNLH 4D94A 1ZHBA 2CRIA 1FGNL 2KKQA 1FG9C 3BRDA 3TIDA 1TJHH 3DYOA 4QHMB 4P57B 3KWWB 1QFPA 7FABL 2VDOL 4JDVA 5JHDE 4MAUL 2IMMA 1AGDA 1HILB 1S9VA 1FIEA 2V2WA 2JELL 4LVOC 3QISA 5DXWA 1KPRA 4PJGB 2NLJB 5JIKA 4WI7A 2EE2A 2IAMB 1XR8B 4MMZC 5FYKE 4MA3B 4P57A 3KWWA 3ELAT 1CICD 4P23D 1X5AA 5C2UB 2W65A 1FNGB 3LMJL 4PJGA 1CG9B 5E03A 2XZAH 1Q9KB 1MRDL 2IAMA 2XWJB 4D9QD 3T04D 43C9A 4KJPD 5ID1B 3FFCA 3L1OH 2X41A 3QUZB 3X13A 4PG2C 3HNSL 4Y4FA 5D1ZA 3VE0A 3MOAL 5SWZE 1U3HC 1R3KB 1UH3A 1WWAX 4EUPA 2XWJA 3BVNB 1XIWD 3CPLB 5T3ZE 4OB5L 4LQFL 4LHQB 3ZKMC 1YEDB 4Q6YA 1D5BB 1CL7I 4ZNCD 3DVNB 1CGTA 3VG9B 3SE4C 4C57C 2W9EH 4F33B 5E2UL 3FHQA 1MELA 1QSEB 3W9EB 2WWMC 4XMPH 1R3KA 1SM3L 2UWEF 4JM2C 3ZT5A 1FBIH 4RIRA 1IGFL 3CFDB 4KJWC 1SEQH 2Y25A 4C83B 3TZVD 3DVNA 1MOEA 1QSEA 3O8XC 4YDLC 3GJFA 5EA0L 2FDBP 4YIQB 2CMRL 1P6AB 1OHQA 2R69H 1B90A 4WCYH 4E41E 1IBGH 4LHJB 4IOSD 2YUZA 5FA4B 1RZ7L 3U4AA 3RBGA 4GBXB 5BRZD 5DJDB 3C8KB 3MLTB 5T5NF 4YIQA 1QFWL 4FFVC 5L88H 1UCTA 2B0SL 1VB9A 3S35L 2DI8A 5DK0B 5L9DH 3A6OA 4YBLC 5HVWA 4GBXA 4XAKD 5IWLC 4PGEA 4F2MB 3MLTA 2BDNH 4U6YB 3WFZA 1DLHA 4IBLT 3QCUL 1PAMA 1NGXB 1RUML 5E5RB 5HGDB 32C2B 3DUSB 1KPUA 1KB5B 4OZFG 1HZHH 3QZWA 3MCKB 1ZVSA 1FJ1A 5J57B 5DK0A 5GISH 2YEZB 1UVQA 2WBKA 3DVIA 4UDUB 5IVXE 5T3XE 4OZHF 4X83A 4AH2B 4P3DA 5HGDA 3DUSA 2YD2A 5CBAB 4XP6H 5TQ0L 3OV6A 3MCKA 2GK0B 4J4PA 4UDUA 3B5HA 1QBBA 4PBWD 1KNOB 1U9KA 3SDYL 5LXGH 5CBAA 4S10A 1GXEA 1I1CA 1HHKB 1FZKB 3FQWA 3HC0B 1TZHA 1S5IH 1SJHA 4Q2ZA 3G08B 2D31A 3H9SD 3HMWH 1Q0YL 1W72H 1CLYH 3W39B 4GOSA 4WHDA 3GSXB 4XPGL 5AD0A 4LKCB 1EEYB 1LNUB 4KJQC 2P47B 3N9GH 3GO1L 4HF5L 3G08A 3EO0B 3RGHA 3O9WD 2V5RA 3MRIB 1MCSA 5C0AB 1G9NC 1JL8A 1NDMB 3FO0H 4YXLH 5T1DH 3F65A 4LKCA 2DWEA 2VDNH 3T2PA 4LGSB 1WEJL 5ETUB 2A6KA 3OKLA 3QA3A 5JOEA 3JWDH 4KH2A 3D39E 1G0YR 2CD0A 1MY5A 1T0NB 5C0AA 2YD6A 3C2SA 1M6OB 4ZQKA 4CU8A 2FR4A 3WN5B 3UJIL 5ETUA 1NC4D 2E27H 1F58L 4JFFB 5F96H 3REVA 4ACPA 1VFBA 4TUJB 1K8DA 1T0NA 2HN7B 4IDJH 1B88A 1S7VB 2KQMA 2R0ZH 2FRGP 1DZBA 3WN5A 3VXRB 2X4UA 4LMQI 3KPLB 1I1FA 4WW2C 2ADFH 3RY4A 1J0YA 2HN7A 4IRZH 2NW2B 2VZVA 5SX4H 4F9LC 1ZHLB 3BWAB 5EN2B 2I9LB 3VXRA 3DHJA 3DO7B 3Q3GB 5IHLB 1PYWA 1Z9SA 1CK0H 1LDSA 1MH5A 4LVHC 1XF2B 3OKNA 4P2CG 1RZJH 5I18H 3BX7C 4R90L 5EU7E 5IUSA 3VXOA 1KIQA 3KPTA 3P11L 2Q86A 1IEHA 2P45B 4LCWE 3BKYH 4OIIL 5EZOL 1I9IH 2XFXB 3SKOB 1UJTA 1MCHA 2Z31A 1T3FA 1CFNB 3ZKXB 4ZO9A 3TH3T 3TIEB 3GMLA 3TYGH 4HFUL 3CLFH 3IGAB 5HHPA 4K9EC 5GSRA 1RZGB 3QYCA 5J1AA 2ZCHH 5IESL 3SKOA 1FGVH 3D0VB 1JHKH 1AJ7H 1QLEH 3RL1B 2VDRL 3TIEA 1QPPA 2I07A 1OVZA 2NXYB 2AQ3A 4NO3B 4DVRL 4D0DA 2VKWA 3BJLA 4KKCC 5L8LB 5I0DA 1KTKE 2DD8H 2BSTA 3G6AB 4S1QL 3G6JB 4ZPVA 3S3SA 2EEBA 3H3KA 2A38A 1KGCD 3QIUB 3C5ZD 5B39B 5ACMA 3D1MC 5L2KD 3H7BA 4OKDA 4Y7MA 1NLBH 1LE5B 3ZYOA 4QKXB 5TJWK 1VFUA 3B9AA 4OF5A 4NC2B 4I9WE 1M1SA 2FEEL 3MRBB 2ID5A 2BX5A 1HXYB 3QUKB 1QFHA 3UDWC 2I60H 3Q48A 4OM0L 1AI1H 5JMOC 1RUQL 3CLEL 3MRBA 1FL5B 4R4FH 1PBYA 5GRWA 4NZUL 3WDIA 4DEPB 3RVVD 4NKDA 2D03L 4KK5D 3EO9L 1QQDA 3FQRA 3GK8H 1BM3L 3TA3B 1A0QL 5DD0H 4ZS7L 1FL5A 1FNHA 3HN3A 3TPUB 4OT1L 4X6FB 5DD3L 4N9OB 4CW1B 3BP7A 4KVNL 3O6FD 4OSUL 3BD3A 3TA3A 2JB6B 2EXWC 3PWLB 1HQRA 4QOKD 3KNBB 3T0XA 3I2CL 1WT5A 2ZJSH 1X4ZA 1YEFL 3FL7A 3LQAL 4G7YH 4XAWH 4Y4FC 5D1ZC 3PV7A 5JR1L 2ZCKH 3ZDXE 4YXKH 2AK4E 2JB6A 1A9BB 4NM4H 1ZTXL 1J05B 3PWLA 5D7LD 3E3QC 3KNBA 3F7QA 4XPAL 1YDPB 1CIDA 3GMNB 4QWWD 5HGAA 5BS0D 3ZE2F 3SGEH 3EUUA 1BP3B 1E4KA 1A9BA 4KJYB 1G7HB 3MC0A 4QRRE 3CK0H 3DXAD 3Q6GL 3IRPX 4O2EB 3GMNA 3SE9L 4M7JL 5I17B 2H26B 5E99H 3RQ3A 4R7DB 1VFMA 1YEGH 2L7JA 4PJBB 1G7HA 3MLXH 1YEJH 2B4CL 4J2XA 3QXDB 2VR9A 4XNMA 4U1LB 5EZIH 1T1XA 2PO6B 3SY0B 4O2EA 3SDXA 4FQIH 3OB8A 1BEYL 3HE7C 5I17A 2VLKB 1WITA 5ISZA 3SN6N 4PJBA 5DRXA 3SKJL 1OAZL 4WI4A 3QXDA 2PO6A 2XN9E 1I3RB 5K9OB 5EOCH 2HT2C 3SY0A 4EDWL 2BVOA 3MBEB 5CHNB 5ICXB 5KG9B 5FKAA 1NAMB 1X44A 1ZMYA 3LN4B 3PWPE 3E6HA 1A5FL 3ARPA 4NBXB 5C0ND 3O2WH 4J3TA 5K9OA 5CILL 3ULSA 2EE9A 5ICXA 5F97E 1KEMH 2AXFB 1MFEH 5J6GA 3LN4A 4H8WH 4MQ7A 2Q3AA 4CVXB 1C5CL 1AGCA 1KCRH 1A6VH 2GFBA 4WGWB 2DQIL 3WIFB 4YHPB 4Y5VB 3UTTB 3VXME 4ZPTA 3VFMA 5TDNA 1JIBA 2J88L 1OTUC 4HHAB 3QEQE 1QLFB 4PIRF 3UTZA 3KPMB 3SOBL 4F3FB 5FO7B 2H8PB 4AEIL 3CFBB 2EIZA 3LEYL 3FZUC 4JZJB 2YPKA 3UTTA 5F9JB 2IPKB 5TE7L 4IOIB 2D9QB 3KVQA 2Q8BL 3P3YA 3T1FA 2OTWB 3BAEH 4F3FA 2QBWA 5FO7A 1CDYA 1D6EB 2H8PA 1DBMH 3CFBA 3F12A 1IZKA 3CDGA 4JZJA 5CAYB 5DFVC 3ARGD 3CMOH 4F58L 2NY1C 1IL1B 3FB6A 4IOIA 5D2LA 2VXSL 3P9MB 1CXFA 4XP1L 1GGTA 1NGZA 2OTWA 4U1JB 2FJGB 4FP8L 5A16B 5HHNA 1XGTB 1XEDA 2VKXA 3FONA 3T0DA 2P42B 4XPHH 2ZWLT 3F6LA 1M71B 4PJEF 1WCBB 2VL5A 1S9KC 1ZHKB 1X4XA 1CF8H 4LLQA 3MV8B 4MNQD 1BIIA 5A16A 3VI4E 4UTBH 2VLJE 5GGTA 5DK2A 1KJVA 2ENSA 1RSFA 1WCBA 4JFYB 4E5XB 1I8LA 3UXFA 1ZHKA 5IVXF 1T2JA 5F1IB 4JE4B 2O5ZH 4JGMA 3D3VA 3WEXB 4G8IB 4LSVL 4UILL 2A9NH 1BQHG 2YSSA 2MKLC 4MQXC 2CUIA 1C7SA 3P77A 3UTPE 3WN5C 5EBMA 1KJ2B 1FAKT 4OLUL 1U8JB 4M43L 1QBAA 3VA2C 3U7YH 4E5XA 5ANMA 4XHQA 4ETQA 3FCTA 3N1FC 3WV0A 2CKNA 4LLDA 4M5ZL 4G8IA 1KEGL 2Q6WB 3QFDB 3S5LA 4P46D 2J8UB 3S8WA 5JDJA 1U8IB 4KI5E 2QHLA 1C5BH 3GIVB 4CN4A 1Z5LB 5I19H 2E8YA 3ARDB 4KQ4H 3WFBL 5K9KA 2J8UA 4Q0XL 5CJOH 3UTSB 2YA2A 1RQ5A 1FYHB 5DD1H 5A2KH 3WS3B 4JDZA 4PUBL 5DRNB 3OL2A 3GIVA 1OGAE 2A73B 3KYMB 5DTFB 5ELIA 2V5MA 4G8EB 3ARDA 5ICYA 3K1KC 2FSEA 4GXVL 3MLPA 3L5WB 3KDMB 5CJXA 4X6CF 2Z31C 4XBEH 3UTSA 1JMZA 5I1EH 2VQTA 5HYJA 4FZEH 3NGBB 3ARFB 3BYTA 5DRNA 1CDUA 1G7JA 4S11A 3G9VA 2A73A 3KYMA 1N5AB 3TFKC 4JFQB 2HJLB 3L5WA 2ZCLL 3J7HA 4UTAL 3P0GB 3F8UB 2AEQL 2NY5H 1NCTA 2ZKHH 1OOAA 1WC7B 5GPRA 2VE6B 3ARFA 4EXPX 3DUUA 2GSGA 4NM8H 4U2ZA 1N5AA 4JB9L 1QSFA 3RWJA 5IBUG 5CINH 1B2WL 1CTOA 1W0VB 2ZSVA 3S36L 3EIFA 3TJHC 5JDSB 3QCVL 4S0SD 1HINL 2EDXA 1EERB 2VE6A 3MACL 4HUWA 3HCVB 3MXVH 3BMVA 3QUXD 3R06B 1UB5B 3B9VA 4LP5A 3OR7A 5JDSA 1N6QL 2DIJA 5LG1A 3MRLB 5INCA 4JHAL 4MS8C 3EO1B 1PQZA 5FCUL 4TTGA 4RSVA 3HCVA 4M6OH 3V6OA 3NA9L 1R3JA 2DMBA 3DETD 5HPMB 4LHUB 5KSBF 5EORH 3T1WA 4LK4A 1OT1A 1S3KH 5EUKB 1YECL 2Z8RA 1U8OA 4XP9H 2E3VA 4YHYB 4Y2DB 1TLKA 2PTTA 3BIAX 4N0CC 1INQB 3AREB 1A1NA 4GS7B 2V5YA 4Z7VF 1J8HE 1WWWX 3P0VL 5EU6D 3FT2B 4LARL 4QRPB 5EUKA 3TBSB 1OAKL 1RJZA 4QRQA 1D5IH 3QDMD 3O2DL 4G43B 2IAND 5CZKA 2JCCE 2IPTH 4PRIE 1E4XH 2W0LA 1VGEH 3VXSE 2UZYB 3TBSA 3FT2A 4DVBA 1DTUA 5FYLE 5FIEA 5DDHA 3DRQB 2RB8A 4G43A 1DSFL 4MVBC 4RDQG 5IBLC 3GSNL 4XBGB 4U7MA 4MJ4A 5CEYB 1NEZG 1DQMH 1S9XA 4XBPA 3TA3C 1S9YA 4XCNB 4XI5C 1TJIL 1DBBH 5ITBH 4O51B 3H7LA 1H5BA 4XBGA 3LKSA 5CEYA 1CCZA 4RMRA 1D7FA 2V7HB 3WMSA 1YY9C 1H3PL 5LQBH 4GQ9H 2DL2A 4K8RC 3VW3L 5E2TH 2FATL 4O51A 3OF6D 3H42H 1YJDL 3MNWA 3CH8A 1E4KC 3UC0L 4KK5C 4HAFA 4P4RA 4OZIB 1KT2B 2HMID 1GGBH 1T1ZB 1FHGA 1KXVC 3HRZA 4WDIA 5HHOE 1KC5H 4DUWA 3WNMA 3VFGH 1J8KA 4R8WL 3QDGB 5TH2A 2BNRE 4K7PY 4KDWA 3OAZH 1VPOH 4B7IA 4AIOA 4KVNH 1TCMA 1I3VA 1XR9B 2AI0L 3TV3H 3FN9A 4POZC 1FRGL 5DO2C 3KPSD 1ZANH 3O3BA 3V2AR 1AO7B 2UYLB 2J6EH 4NKOA 2CKBB 5DMGD 1BF2A 1XR9A 4OCRL 5LGHH 3CDFA 5D7SH 2EDJA 1WJ3A 5L0QC 2OM5A 1I75A 3RY6A 1MFAL 4NC1E 3PWVA 4KUCD 3ILPB 3IF1A 5LWYL 5E9DE 4TNVF 4OLEA 4JR9H 4UINL 4HK0A 2G5RA 2Z8VC 4LPCA 4TNWF 4IM8A 4WFHE 3GKZA 1RK0B 2VERN 3BSZL 1MREL 1KTDB 4XMKH 3O4LB 1RIVH 4GRWB 5DJ8A 5FUZL 2EDRA 5TDPB 4KRPB 4XB7A 3IU4H 2UY7A 3VFOA 5KVFH 2M26A 2EC9U 4MNHA 1SMAA 1WISA 1RK0A 4DFIA 1F4XH 2CUHA 4MWFA 1LD9B 3CVHA 2X9YA 3HNTL 1Z9LA 3AB0B 4WFFD 5KS9A 4JGUA 1LO0L 1Y18B 4P2RE 2P8PB 5F1KC 3PUCA 4LMQE 1Q72L 4JZJC 2F9BT 5EU5A 5C0RL 1AGBA 1LD9A 3QHZL 4NJAH 5BMFH 1TCRB 3WIHH 4N90D 1BGXH 5ESQA 4XVUD 1VEOA 2ZG1A 2C9AA 3CSYB 3JZ7A 4EQ3A 1RZFH 3IDYB 1KIRA 4FQXB 4HEPG 3DURA 2CGRL 3RA7L 1H0DB 1JPFA 1RUAL 2GSIB 4FTVE 3U9PH 2EYRA 1MLCA 5T5NG 2HJKB 1IQDB 2DWDB 3RWGA 2DQIH 1IAOB 2EDYA 4FNLL 4WJ5A 43CAB 3T3MF 1NGQH 1UGNA 1H0DA 1GHFL 1I8LC 3MREB 5FYKH 5GIRB 3ARWA 4LU5H 1OM3H 2ICWB 5JIIA 1RY7B 1IAOA 2VITB 4WIQA 4HH8A 1MFDL 4ZOBA 4P48A 43CAA 5AUMA 3FB7A 2XZQH 3DHMA 2Y72A 2MFNA 2JK5A 3GBMH 1HIML 1IC4H 1I7RB 3JV5A 3X11B 3DMMA 3ZL4L 2DKMA 4L4TB 1IEAA 4NN5B 1P5UA 3LPWA 3JTSB 4JY6B 3MV7B 2IJ0C 3QFJA 1JPST 4JHWH 1T2QH 3IJHB 3E0GA 3AMKA 2YPVL 3QUYC 1NAKH 5T3ZH 1F90H 3WUWB 2ZUYA 3X11A 4ELMF 4L4TA 4PJGE 5ID0B 4HS6B 4P9HC 3RIFF 4OFDA 1GGYA 4GAFB 4MD5B 3GMPB 1IJ9A 1K4CA 2E7MA 3IJHA 2R2BB 3G6DL 4TQEH 2EDKA 1LWRA 1ZA3A 1R0AH 1EJOL 1ZT1A 1JNHB 3C9NB 1CD1A 3ARZA 1JYWA 4Y1AB 1I1AD 5EULV 4MD5A 4NHUA 3UMTA 3BQUD 3MXWL 2R2BA 4N0UA 5HYSG 3EJYC 4IOFC 1R3HB 5FF6B 2AJXH 3L3HB 3T08A 1JNHA 3I6LD 3C9NA 4YDKH 2JIXB 4Y1AA 5FM5O 3TBYB 2XWBA 3VI4F 5CEZL 1MCDA 5F44A 3AFLA 1R3HA 4HS8L 4RA3A 5FF6A 3VJ6B 1QSEE 3ARFC 5DMIH 4GFTB 1IQWH 3A67L 1IAIM 3BUYA 2C3XA 1TZIA 2JIXA 5FUCE 4G8FB 1G7QB 5A43C 3QIBD 1J10A 4XNQB 4CU7A 1C08A 1ZE3C 1K4DB 2IBZX 1AFVH 5K9QI 1UEYA 4TTDC 2BCKA 3LH2H 3AY4A 2MSPA 4R3SB 5J06A 2G5BA 4K94H 1G7QA 1XH3A 1BQLH 5T3XH 1AH1A 1SEBB 1G7MA 5AWNH 4PRPD 2OR7A 1ORSB 4XNQA 3ULUL 1PX4A 1JPGB 1K4DA 4OF7A 1QRNB 4Z76B 3V6OC 1ZK9A 3DV6B 2OS7A 3LCYA 3WS6A 2I25N 4FQ1H 4JFDA 3TN0B 1QACA 3K2UL 5B4MD 3BKMH 2XQBH 5A2IH 3ROOB 3ZHKA 4DJMA 2A83B 4IS6B 4LRNH 1JPGA 5E8OB 4JDTL 5HHXL 1IGJB 1QRNA 4Z76A 1WBZB 4EI6A 3SDDD 3KG5A 3DTXB 1T21B 2A77H 2JKXA 3Q6FA 2VXQH 3WSQH 4G5ZL 4S1SL 2A83A 3QNZB 1E4JA 3D0LA 3GNML 1FCCA 1ZAGA 1IGJA 4UOJA 1WBZA 3EHBD 4WI9A 4X4XB 2GYSA 1T21A 1KCUL 2YN3A 1BBJB 1EO7A 2EKSA 2VAJA 4DN4H 5I1HH 1FO0L 4MCYA 4MD0B 1MRCL 3QNZA 1K3ZA 4UU9B 4UOW1 2NZ9C 2NCMA 4HGWA 3RKDC 3VWKB 4PR5A 3OKDA 4HK3J 1KB9K 4I3SH 4XWGH 4XRCA 3OPZL 5ILTH 3ZTJH 4GLRH 4OTXH 1XCTB 1MAMH 1YQVL 4G9FB 1H5BC 5IMOB 5JIPA 3EDFA 5BV7H 4OAWA 3F7VA 3GSOB 3RAJH 3NIGE 3UEZA 4J3OC 2FX9H 4QNPE 4NQCB 1IC7H 1YNTB 4P3CH 2ESVB 5CGMA 1P2CB 3ARQA 3GSWB 3U46B 3OZ9L 1ZHNB 4UT7L 5C0AE 5EZJB 2NY2D 1KFAL 1FG2B 3QCTL 3GSOA 2DMKA 4YEFA 2ADGB 3B43A 5KSAD 2Q76B 4NQCA 1YNTA 1P4BL 5EIIB 4G8GB 3U46A 3KR3L 2Y06L 1ZHNA 3HC4H 4WWKB 4JANB 1FG2A 1MFCH 3WO4C 2ADGA 1Z9MA 4RRPA 1MWAB 1UWXH 2B1AH 2Q76A 4JFFE 2ATPA 1RU9H 5KJRH 2JCCF 2PF6A 3EJZD 3R8QA 2VZOA 4KDVA 4WWKA 4HIXL 1OB1B 2VXUH 4PJ9A 3VDAA 2G75A 3OAUL 3U36A 3AS0A 4MCZA 3VXRE 3DIFB 1P7QA 4NFCA 3EBAA 2A9ML 5F7NC 4JO2L 1J1PL 1V7NH 4RAHA 2E7LA 3V5DB 4U7KA 1PSKL 4NOBA 1CLZH 5BZDA 3QEGH 3RY6C 3WL9A 4F7EA 4KTDL 2QV2A 5IF0A 4XNYL 5F7EH 4OCWH 2X1QA 4JO4H 5FYJL 4LAJH 1A02N 4D3CH 5AAWA 1CL7L 1NFDF 3THMH 1JZ8A 4PJIF 3X3GL 3MGTA 1F45A 3O6KL 3FOMB 3RVWC 4EVNA 1G9MH 1EHLL 2AGJH 1IKFH 1I9RL 4BFGA 1BZQK 5FB8B 4OJFL 4CVZB 2ICWI 4I3GA 2AV1B 4LPUA 2V5TA 2VH5H 1CICB 4P23B 3PHQA 1NFKA 4NRXB 4ZUVA 3HC3H 4Q74A 2EIBA 1A4KB 5IIEA 4YNYB 5C0CD 2EDWA 3NAAH 4NQED 4U1GC 5MI0C 1J0HA 5FB8A 1JRHL 1BZ7B 1EAJA 2Z4QB 2AABH 1U0QA 1EAPB 3KPQA 4KHTL 3CXHJ 3WNOA 4Z77B 3FFDB 2DQEL 2IBZY 4XPTL 1T4KB 4YNYA 3GBNL 4MA7L 1XIWB 5C8JB 1LEIA 1PW3A 4LCUB 3MTRA 3SE3A 1BD2D 1BZ7A 1EAPA 4OIBA 2M1KA 2FHFA 3QI9D 5LWYH 4D0CA 4Z77A 1TPXB 3OKMB 4ORGB 4QRSA 4EN3B 1T4KA 1ZXQA 3V4VH 5M7QA 1W72A 1XIWA 2BFVH 3LEVH 2FCBA 4LCUA 2IFFH 1RVFH 2FX8L 4GKZB 1YNLH 4RWHA 3TZVB 2BK8A 5D71H 2XWTB 1S7SA 5CMAB 2Q1EA 1C7TA 1XGYL 4RMVA 1S8DB 1MHHA 3OKMA 2N7BA 4EN3A 3HPLB 1MCRA 2D0GA 2CR6A 4JPVL 2DLFL 4YHZL 4U6HA 4OFPA 3ZT6A 4X6DB 4ELKB 5DFTA 4GKZA 1A7QH 1G6RL 2NXZD 3TZVA 3EYSH 4TSBL 1KCSL 2XWTA 5CMAA 2IADB 1S8DA 5BRZB 4YWGH 3KJ6H 4MNGA 3HPLA 1TENA 4ZDHB 4IRJA 1YN7B 2AS5M 5KTEH 3DMMC 5E8DH 1BIHA 3VXPB 4BYHA 1LE9B 3WD5L 1NCBL 5DUBA 4XVJH 3HKFA 5D1XD 2IADA 2BMKB 4ERSH 1MJ8L 1BWWA 1DBAL 2VDQH 4CNIB 4NQDD 5D1QA 2BVYA 5E2WL 1NDGB 2QQNL 1EA9C 2XG5A 1UM4L 2AAVA 3G5VB 4ZDHA 3S96B 5EC1B 3TT3L 2DQFB 3MV9A 2GCYA 3LEXA 4NN5C 5DC0A 5E8PB 1F00I 4D9LL 2IPUG 5E6ID 4M7ZB 4EOWL 2FIRT 1RHHB 5BOPA 1BQHA 5JW4M 4RGOL 1RUAH 1NCDH 1U8NB 1NDGA 3G5VA 3S96A 5EC1A 2IMNA 3DLQR 3CAFA 5E8PA 4QXGL 1ONQB 4IHOB 1RZKL 3BGAA 1RHHA 2DOCA 3I9GH 1H3VA 4HC1H 5I8EA 3ULUD 4PTUB 1F11B 2R0KH 1NBZB 4F37F 4LSQH 1DFBH 1ONQA 3BPNB 4ZUTB 1X5GA 4IHOA 5HGGS 5HBBA 4F7MB 3MZGB 3H9SB 4RGNC 1CGVA 4WHCA 3B9KD 1SY6H 3OXSB 3ZL4H 4K23L 3MBXH 3OHXB 1J5OH 4NO0D 3HI6H 2XT1B 1X5FA 3U9UA 5ALBH 3K46A 4YR6B 5EZLB 1NMAL 1B4JL 3Q5OA 4R96B 5JIHA 1T7WA 4ZUTA 1UWEH 4F7MA 3H9SA 3O9WB 3NABL 3B2VH 5GGVL 1MNUH 1IAIL 1QFUH 3FB5B 1FSKC 3TWCH 1JK8B 3QJHB 1MCKA 1YMHB 2AJ3A 5ACLA 3IS1X 4PJBE 1XF3B 2VO5A 1HXMB 5F71A 4HQQL 3ZLQC 4I0KA 1A2YB 2Y1VA 3IFOB 1I1AC 2H2SC 1RMFH 2VLKE 3SDCA 3FB5A 1MFBL 2OZ4L 3BQUC 4F7TB 4UDTB 4PJGF 3WS6C 1RUKL 3N85H 1HXMA 3GSUB 5C7XH 4NN7C 5IT2H 1A2YA 3IFOA 2YRLA 2NYYD 3A6BL 3QP3A 4GMTH 5HVFB 5IB2A 3VWJD 5HI4C 1S7RB 5C08D 1U3JA 3LIZH 1D5XB 1ROWA 3TO4A 1N3NA 4KPHL 5T1KD 3BZEB 2BC4B 2BERA 4Z7UA 5CD3A 2OTUA 4LF3B 4PP1D 5DR5L 3QQNA 4MAYA 5B3JE 2B1HL 5SWSA 2CRMA 4H88L 15C8H 1S7RA 4OCNC 4YHML 4CU6A 1YMMA 3QXVA 4ODSH 1JNNH 2FGZA 1NGPH 3UTTE 3CH1B 4TSCL 4BZ1H 3LKQA 4L3CB 4MB4A 4LF3A 1U3YA 5D7IB 5EO1A 3V5HA 2ORBH 5F1NB 3OAYH 4O2CA 4LNRB 2WLZA 2Y23A 5E1AB 4POUB 3BKCH 3ZT7A 1DR9A 3DVGA 1OL0A 5F72S 1NMBH 2YBRB 3V9FA 3F5WB 3VD5A 1FH5H 3BI9X 3FT3B 2YN5A 2F53D 5J3HC 4Z7WA 5F1NA 3PWUB 1Z0NA 2XICA 4LNRA 4QCIB 5AYQA 3SCMA 1K85A 4PB9L 5E1AA 1N59A 1UWGH 2YBRA 2IG2L 4PJFB 3FT3A 3BIBX 1C16A 3PWUA 4GRMB 1ZVYA 1LP9B 4ZFFB 4QCIA 3S4SB 5HI5D 4I18C 1J1XH 3WHE1 1P4LB 1S7WA 3X12B 3P9LB 4U1IB 4WI2A 2R2EB 1YEHH 4F7CB 4K7PH 4PJFA 2X4PB 3MUJA 4LPTA 4XPBL 2HKFL 1JPSL 3V79C 4OD3H 5FYJD 3MV8E 4U1IA 2R2EA 2LTQC 4N68A 2X4PA 3FRPA 2BOCB 1DL7L 3C5ZB 3NFPB 3RTQD 5DLMH 1JUFA 5EOQH 4ZAKD 5FO8B 3KGRA 4GW4B 4AL8L 2DDQH 4OZ4A 1T7XA 2OLDA 4PJ9C 1AKJD 1QD0A 2BVQB 4QHNB 3MLZH 1KG0A 4RFNC 3MRDB 3NFPA 1MQ8A 4K71B 4YO0A 3VFWB 1U8HA 3NZ8B 5FO8A 5E4EC 2E7LC 1FPTH 3PXJA 5GGQL 4ONHB 2VC2H 4LOUD 2BVQA 2ZG3A 1IILE 2J8UE 4HWBH 1BREA 2G2RB 3MA7B 4QHNA 3RHWF 1T1YB 2ICCA 3G5YA 3VFWA 5KSAC 1VEMA 2PYEA 4X80L 5I15L 1N8ZA 2DB8A 1NCNA 1ZEAH 4NGHH 4ONHA 2HH0L 4MXVF 2G2RA 3MA7A 1A3LH 4HUVB 2R29H 3UTSE 5GS1A 4XTRC 2OSLA 3L3OB 1I7UA 1WQVT 1UXSB 4XCCL 3EOBA 2ZP0T 2C5DC 4LEXH 3EYVB 4WVRA 3M8OL 4PLKD 5CLTA 4HUVA 3PJSB 2DQDL 4PJ7B 3BEWA 3L3OA 1OWRM 1FNEB 3O6FB 1UXSA 3GKWH 2DJ4A 5TQ2H 1CU4L 4RFOL 1X5JA 4QOKB 2DL9A 1REIA 3EZJB 1EUUA 3EYVA 3IFPB 4IMLA 4O2FB 4MQTB 2X4SA 4PJ7A 2GAZA 4QHKI 2J1KA 1NCCL 3VCLB 5D7LB 4U1NA 1OTSC 2BZDA 5AEAA 4D2NA 1A14H 2CK2A 2EO1A 3IFPA 3SE3C 3V0AC 1WCQA 5IMKB 4YAQA 1U93B 2VB5A 5I1DB 4HS3B 4M7LL 4XNXH 1RHFA 1MQKH 2VN4A 2LAAA 1EEZA 3EYUL 3W9DB 3V6OE 4X5LA 3CC5B 1GJIA 3QUML 3G5ZA 5IMKA 5DZNA 1U93A 3VRLE 4JJHA 3NN8B 5C6WH 4HS3A 1BJ8A 4OZGA 4P0DA 3GMMA 1TPXC 5H35B 3W9DA 2WWKO 4EN3C 2DI7A 3MRNB 5KZCB 2XTJC 1U92A 5FYLH 2DYPD 4OKVA 5IKCB 3EGSB 4PGDB 3CC5A 2O5XH 3JV6B 2GTZB 1UWXK 4XWOC 3RY5A 4YHKL 3O2VL 2IQAA 1HH6B 5DZOA 3D87B 3IU3A 3RDTB 3FQUB 3C09C 3JWDC 4OQTL 3V4PL 4NWUL 5IKCA 4IRJC 4KI1A 4PGDA 3JV6A 4FMKA 2XXCB 5FDWB 2QLVB 3JVGC 1R5WB 1A8JH 5F1OB 4QRPE 2Z92B 4RMWA 5IBTL 3RDTA 3FQUA 5KW9L 1K8IB 4Y4KD 4JKLA 4LIQE 3GSQB 4JPWL 4OLXL 4PRDA 1RIUL 5D1QC 2HTLC 3W2DH 5TE4L 2ERJC 5K9JL 1ZSDA 3SDAA 1E4WH 1AIFB 1S7XA 1R5WA 1WZ1H 4JRXA 2GJ6A 3LKNB 4NP4L 1K8IA 4CBPA 3GSQA 2WIMA 1A7PH 4C54A 3MJ6A 1Z9OA 2VDKH 1FNFA 2VWEC 4DCQB 1YY8A 1P7KB 3O3AB 4QTHB 2MQCA 3LKNA