4XVUC

Structure of get3 bound to the transmembrane domain of nyv1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFNLYYYSIHWVRQAPGKGLEWVASISPYSSSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGRWYRRALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
total genus 43
structure length 222
sequence length 222
chains with identical sequence E, I, K
ec nomenclature
pdb deposition date 2015-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvuC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvuC01
5JW4M 3FTGB 5CZVH 2ADJB 4HMDA 4NYLB 3GMRA 1NDMB 1D5BB 2AV7A 4KUZL 3CUPB 1QQDA 1S7TA 4DQOL 3QHFH 3GMOB 4YBQC 2H3NA 3LKPB 4FXGA 4UT6H 4ODHH 2DM2A 1YNKL 3HZVA 1JMXA 5C3TA 2A9MH 2JJUA 4JHZA 4NUGH 1YUHB 3RTQD 3QIBA 2YKLH 4RX4D 3PWVA 3DYOA 5I66B 3O2VL 5HHOE 3WCYA 3LKNA 5D71H 5EFIB 1TVDA 2AJ3A 2JJTA 3NIDF 1NUGA 3GHBL 3WN5C 1ADQL 5KVFH 4UI2A 4H25A 1NC4A 2R2HA 5FUZH 3MGOB 5L2KE 1NFKA 3L1OH 3ULUE 3LV3A 4LPVA 4OLEA 3P30H 3ZHKA 1G7IA 3R4DA 3OF6D 5DYOB 5C08D 3TV3H 3CXHJ 5CP7A 5E6IA 3O6LH 5EIQA 3FAXA 1T2QL 3I6KA 4PJIE 4BH8A 4JZNA 5IFJA 1NGQH 3BD3A 4OLUL 2VLLB 4K7FB 1JTTA 4HKJA 2ITCB 5AAWA 2CRMA 3H7BB 1B0GB 1SYVA 3EAKA 4ZXBA 3WE6A 5I1JL 4CGTA 5DR5L 1TTUA 1HYSD 1MCEA 4G8GE 5DUBA 5IMLA 1MRDH 3TESA 2ZUQB 1CF8L 4JKWA 2WBWB 4OZ4A 3C2SA 3UPRA 4KTEL 1KF9B 1CVRA 3QUMB 1BM3H 1JPSH 4OFPA 2YD3A 1EHLH 1ZT7B 1YNTA 5MP6H 3JZ7A 3SKOA 1I7RB 4HV8B 1WBZB 5J11B 1ZHKB 4XBGA 3S35X 5HYSA 3CSYB 5KAQF 3VH8B 2P45B 2PR4L 4OM0L 1EX0A 3OKDB 3DRTA 5BRZA 2OJEA 4R4FH 3QJHA 5A40E 4KQ4H 3P4MB 4JM2D 1YY9C 4HXAL 1L9NA 5DWUL 4JFZH 3ZT5A 3LEVL 3QDJD 5IMKA 3ZHDA 3KLDA 4XVSL 3GSNB 4WRLA 3U9UB 5KN5B 1KTLA 5EPMA 2BRRL 4DVBA 3BRGC 3RBGA 4O2FB 3GIVA 4DGIL 2JF1A 3IKCB 2IH1A 5GZNC 5CHNB 4OI9A 5LAXA 2JIXA 4FHBD 2IH3B 5DVNA 1ZEAH 2EEAA 5BS0A 3IDIB 4XCCL 1CVSC 3RWCB 4WV1A 2EH8H 4XBEH 3N1MC 4GAYA 3SQOL 4EBQL 4JRXA 3KYMA 4IOIB 4CMMB 4I0PD 2ZCKH 3O3AB 5C0AB 3KPQB 4L8SB 4MD4B 4MZ3A 4OFDA 1EHXA 3RI5F 5H35B 5F21B 2W92A 4QHUB 1OF2B 4YGVA 4YE4L 4R4ND 1P4BH 1RURH 4XPBH 1G7LB 5CCKL 5T5NG 5DK2A 3GMQA 3SGKA 1YY8B 3UYRH 1BX2A 2BSSA 5DHYB 5JPNB 2VITA 4R97C 4TUOB 3VFNB 1NCCL 3QUXA 4U1NB 1Y18B 4O51A 3B2UD 4P5TA 2YK1L 5ALBH 2WNGA 4Z0BH 3WHE1 3VRJB 1UVQB 4M7ZB 1ZHBB 1CBVH 3STLB 4Q9RL 5JW4N 3CFBB 3B2VL 5MEOB 3G08B 3RU8H 1NDGB 2RFXA 3TNMB 3I50H 4TVPH 2JK5A 3F5WB 1MRFL 1TNNA 4U1KB 3REWB 1GC1L 2NY0D 4UU9B 4KU1A 3TO4C 1U8IB 3TYGL 3D85B 4MA3A 3QUYA 4LKXA 4EUPH 4FG6C 1FBIL 4KHTL 3IXAB 1RUQL 2CLZB 2XOTA 1M6OB 2NY7L 3VFUB 5KANG 4WY7L 3ROLB 5ESAA 4AL8L 4JFFD 1KEMH 1F4YH 4ZTOL 5EN2B 1QR4A 5D7JB 5K59E 1TFHA 5J3HD 1JZ2A 2DD8H 2LVCA 1A4KB 3TBVA 1MH5A 4XCEA 3MRDB 5CLTA 2ATKB 3VFOA 3SJVD 3HA0A 4IRJD 1CDBA 1IKNA 4ZAKC 5DRWA 1ETZA 3VXUE 3IU4H 1QRNE 3HI5L 4LCWA 3MODL 4Y4HD 3U0WL 3SDDA 4F58H 2VXSH 1EHAA 5A2IH 3QEGH 5I15H 4WU5B 1MHEB 1DSFL 4G7VH 1ZE3C 2ZP0T 1MFAH 4PGBB 4HFUH 2VLKD 3VXRE 3IFNL 4BQ9A 4HUVA 3BWAB 4AEFA 5GISL 4JFED 5F96L 3RUGF 3L5XL 3TFKC 4P49A 4LGSB 5J7CC 4PS4L 4ORZC 3OQ3B 2Z31B 3D0LB 5I1DA 2A6KA 5IB5A 1XZ0A 5BMFL 1JGLH 4PRHA 1S7RB 1X7QA 1CFQA 2VZSA 1KIRA 3K80A 4GH7B 4QRRB 1PVHA 5TQ0H 3IDJB 2AVGA 4U1LB 5I73C 2XNAA 5I74B 4X7DC 5E08L 1AY1H 3QXTA 5EOTB 2X44D 3WFBH 1ZA6A 1AP2B 3LH2H 3K81A 4PRIE 3OXSB 5D1QD 3FL7A 3E6FB 1JK8B 3PV6A 1U93A 3RDTC 2A38A 5DJYB 2V2TB 2CO6B 4POZD 3ZE1F 4RFNC 4PLKD 1UA6L 5H37G 4NUJA 4Z6AT 3SE9H 1HEZA 3ZKXC 3ZE2F 1PX3A 3D39E 1FL3A 4OIAA 2YPKA 3IU4L 1KJVA 3KPRA 6FABH 5E5RB 5GSVA 4RMQA 3LS4L 4Y5YB 3HNTL 2EDTA 4FZEL 1QLRB 4ORGA 1I7ZB 1F3DH 2H2SD 1D5ZA 4P99A 2OR9H 4QCIA 5CILL 4ELKB 5J6HB 1JZ5A 4XCFL 5DMJB 3PQYA 4BFIA 1RUPL 3ZTJG 4S0SD 1J5OL 1JGUL 2QQLH 3RGVD 1I4FB 3JV4A 1I7TB 4LKCA 1MHHB 2BNQE 1K8IB 3BDYH 4M7KL 5TE4L 5KSVA 3ARDD 3ECBB 1CR9L 1YECH 3LN5A 2AKRB 2CXKA 4QRPE 3O3BA 4XBPA 4PJ5D 5TPWH 3CAFA 1FVDB 3UTTE 2HWZL 5EUOA 5DEGB 1F4WH 1XIWB 3MV9B 3SY0A 5HI4D 5I19H 1P2CA 4X6CB 1DLFL 4TRPL 5AZEL 2CDEA 4U31A 4KH2A 1QSFD 4UDUB 4H26A 2EC9U 3Q6FA 3NGBC 4NGHH 4UNTA 1F8TH 3OHXB 4ZUUA 5I8EB 4IEFB 4LCYA 4I5BB 4S2SA 1S7VA 4LPCA 5E95B 1AE6H 2V5YA 3IB4A 1XF5A 3HUJB 2MCPL 3MACL 1OQOA 3UDWC 4ZO9A 5GIRB 5KSUB 4WW1B 2VE6B 1MI5D 4LSPH 1J88A 3BEWA 1JN6A 5TDOB 3SCMB 3WIFA 1WISA 4YFLI 3OKYA 5FO9B 3SDCC 1S78D 5H2BA 3B5TA 1WBYB 1KJ2B 1VDGA 1U9KA 4JLRA 4X0KA 4DUVA 3SGJA 6FABL 1W0VA 4WI2A 4PJDA 5BVPH 3C9NB 4Y5VA 1DZBA 2HJKA 4C56A 1MLBA 2PYEE 4EI5B 2YUXA 3QI9B 2H2PC 2Z92B 5CJ5A 1DQQB 4YUEL 3O3EB 3ULVF 2R4RH 1L7IH 4Q2ZA 1IAIH 4OCXL 4P3DA 4GBXB 2ESVD 4ZDHA 4DAGL 4W4NA 1P84K 5I1CH 2BFVH 3EJJX 4TTGA 4A6YH 2GTZB 1C7TA 1FNSL 5HHMD 1IMHC 3FQRA 2LTQB 1KGCD 4GMSL 3C6LA 2JJWA 1U92B 2CDFB 2Z91A 2CD0A 3LKOA 2EXYD 2FZ3A 4K23H 3F6IA 4G42B 1BD2B 3O9WC 5IROC 4Z7VA 5GGSB 5C0FB 1Z6JT 1RZKH 4X7TB 1YEJL 3RWHB 4DKAA 2PTVA 4X9BA 2YSSB 1T0NA 2OYPA 3RHWK 4AIXA 4OZGA 5D2NB 4FP8L 3C87A 3ULVL 4K9EL 4HXBL 2AV1B 3CMOL 3S8WA 2X4TA 5E5MB 5KVGL 2QQKH 1NKRA 3IVKB 3OGCB 4KV5E 4CNIA 5D1ZB 5EORL 3TYFB 1UM6L 1ONQA 3VXNA 5DK0A 5CSGA 1K4CB 4RRPG 2M8XA 2I26N 3EYOA 3BT2L 1G7QB 5FYJL 1BFVL 4HJGB 3JUYA 5GS0H 1SJEA 4D9LH 3EIFA 4ZOEA 4BZ2H 2E7BA 5LKNA 2R56H 4XNMA 8FABA 2CGRH 1YYLL 2X4RB 5I30L 1MELA 1DBKL 4Z7VF 5I9QB 5LXGH 3VD5A 3PL6C 4KK5D 4ELMB 3WFCL 1EEUA 1DBJH 3BZFB 5LQBH 3BKCH 4WHYH 3DIFB 4OZGF 4CVUA 4LLYA 4UOW0 1LO3H 3TT1H 1ZAGA 5HHQA 2J8UB 3MR9A 2VH5L 3BW9A 1AGFB 3THML 4ONHB 4LCIH 3BYYA 4OLVH 4L4TA 5D1ZD 1T66D 3NTCL 4GRLB 1B90A 3DO3A 3RZCA 2B4CC 1EEZB 2ADGB 2Z8RA 3WDIA 4XPTL 2A73B 1SMOA 4OD2A 4X8JB 5CD5C 1QKZH 3PGDA 2X70B 1NC2D 1RZKL 3MA7B 3TO2B 4LEOA 3FTGA 4NKDA 1IGTB 1XH3B 3BH9A 2UYLA 3V6ZB 2DLGA 1OWRM 5EOCJ 4K71C 4MCYB 4G6AC 3F7VB 3BP5B 1NDMA 1D5BA 5FM4A 1F6AB 1C12B 4BK5A 4FQ2H 1VKXB 5DZLA 4Q97A 3RAJH 5ICXA 3WFHB 5KS9F 4XNUL 5EO1B 1YUHA 2CMRH 3UJJL 4N1HB 1JE6A 4QF1B 3VXMD 5K9JL 5EFIA 2VXVL 3AB0B 2WAHA 1OGAD 1X5KA 2ZKHH 3B3IA 2ZSWB 3QIWB 3QIUC 3R06B 5GS2H 2XPGA 4FABL 2XG4A 5D7SL 5GS0L 4OBSA 5J06A 3SE8L 4XMPL 4LCCB 5DYOA 4LVOC 5I1AB 1AGBB 1KB5H 1B2WL 3NN8A 2ICWI 1ZT4B 1A6WH 3PUCA 4J2XA 3C60D 1CN4A 3T04D 1M7IA 2Q20A 3JWOH 5A1AA 1CZ8L 3AUVA 2YMXH 1JZ8A 4QRUB 5B21A 5I71B 3S37X 5L88L 2WP3T 2VDMH 4EXPX 3VXQA 4MLIA 4XAWL 1GPOH 1UQSB 2DIJA 2VLLA 1J7VR 4K7FA 1A4JB 3QPXL 1OGTA 3ZE0F 2ITCA 4OLXL 1EGJA 1B0GA 3STZB 1MQKH 3PGFL 2H26A 3P73B 3BWUC 5IK3A 1DEEB 1UJ3C 1VERA 2VJXA 5JW3L 3LRHA 3N0PB 3KLHC 3VI4E 4YHIB 5EO0B 3EYSH 3IGAA 1UH4A 2ZOLB 1PZUB 5CZXD 4KXZI 3HE7B 1I7RA 2PTUA 1ZHKA 5EU4A 1TENA 4JO3H 2LE9A 4ALAL 1CXEA 3VH8A 1DN2A 2XXMB 2CKBB 4JGMA 1JPFA 3L3GA 5JORB 4HCRH 1IGIH 4LPWA 5CIPB 1H3GA 3EOAB 3OKDA 1H3XA 4TVPE 5B4MC 2YA2A 4DWHA 1CFVL 1YMMD 5FO7B 3RNKA 1FJ1B 5HD8D 5I16B 3P4MA 3SGDI 3QCVL 2ICES 4O58L 5IOPA 4P4KC 3U7AA 1X5AA 4MGXA 1T1WB 3BKML 3OJ2C 1PD6A 4HWBH 3U9UA 3O0RL 3PWPE 4ZO8A 3N9GL 1KJMB 5JIKA 5GPRA 4O2FA 2NXZB 4HJJH 4NDMB 3IKCA 5D2LB 5CHNA 4OF8A 4DTGL 4NT6A 3K4ZA 2WLZA 3DTXB 5E8EA 1ZVSA 3SDXB 5I76B 5MERB 2HT4C 4UV4L 4KKBC 1U2CA 1NBYB 3RWCA 5DQJA 1JWSB 2KDGA 3BZ4B 5D4QA 5EU6B 5L0QC 3NAAH 2VXUH 3PWUA 1KYOJ 2B0SL 4OLWL 4CMMA 2VRAA 3O3AA 2MCG1 1VACA 2VLRA 2X1OA 4WFHD 5C0AA 2YEZB 3VJ6A 3KPQA 4MD4A 3SOBH 4M8QB 4WI9A 5EZLB 2NY5L 3GBLA 4M1DL 1WQVT 5DD0L 1OAKH 4X7SH 1CFNA 3WKML 4JQXC 3S34L 3MNVB 3BP4B 4XTRC 5GGUB 2DQEL 1G7LA 2VDLL 2BY1A 1EGJL 4RIRB 1MQKL 3VE0B 5T3ZD 3NZHL 5C0RH 2V9TA 3IJHB 4HX1B 2FX9L 4Y16D 5DHYA 3SO3B 4I2XB 4TUOA 5HHPA 1PQZA 2APBA 3VRLE 4U1NA 4I18B 5B8CB 3G5YA 4MNGA 5BVJB 4KMTL 4NKQB 3IETB 2IBGA 2O5YL 4XB8A 3BN3B 1UVQA 1S7XA 5DD3H 1ZHBA 3ARGB 1IM3A 4XPGH 5HI5D 1HCFX 5MEOA 2N4IA 2XN9B 4BQBA 3DX9B 1KCKA 2NY3C 4N9OB 3TNMA 4RFOH 3IRPX 3F5WA 3TVMD 4U1KA 2NZ9C 3REWA 1T1YB 4UU9A 1U8IA 1ZWIB 3D85A 2YBRB 2WBJD 1D5MB 4YDVB 4Y4KC 4OCRH 4PJFE 4R7NA 3VFTA 3IXAA 1ZKAA 4Q6YA 3HS0B 4ERSL 3VFUA 5E2TH 4QNPF 1TJIL 5I1EH 5D6CB 4Y4FD 4QTIH 3DVGA 1XGQB 3MRDA 3FB8A 1R5WA 1MCPL 4L29B 4XC1L 1OTSC 3FAWA 4HGMA 4OFYD 3TZVD 5D6DC 2GJ6A 3RGHA 4F33B 3ROOB 4HMEA 3OKNB 2F9BT 4IHOB 1KUMA 2YRZA 1B0WA 4WU5A 1M05B 1Q9LA 2EE9A 1FGNH 3PQYE 5ACMA 3ARFD 4OCNC 3MBEA 4PGBA 2XTJB 1X4YA 4JZJC 1IM9B 4P5KA 3V4PH 1EO7A 4MAUL 4PJ8B 5IQ7H 2A77H 1T83A 3UTPD 3B5HA 3QDGB 4L8DA 5C3LD 1ZGLB 2I27N 2PETA 2E6PA 1U8OB 5HHVH 4MWFA 2BHUA 3U4BH 4M93B 1FVEB 5SV3A 3VFRA 1MCIA 3MJ6A 2FEDC 1A6UL 3QEQB 2Z31A 2KH2B 2X41A 2OX5A 3R8BB 3VI3E 4OCSH 3DUHA 5DMIH 4NN5C 3GI8L 5EUOE 3TA3B 4F57H 1S7RA 4HUXB 2VTFA 5JHDB 4HZAA 3IDJA 1A2YB 4K94H 3RA7L 3AROA 5EOTA 4PYGA 5DHVB 2X1XR 1YC7A 1AP2A 2XY1A 4LDLB 5KJRL 2GITA 4TUKH 1K2DB 1KC5L 3OXSA 2EYSB 3W0WB 5FM5O 2HKFH 12E8H 1JK8A 3E6FA 5I6XC 1Y0LB 4OZFH 4JPWL 2Q7NA 3O2WH 3ARTA 1AGEA 2DLTA 4F7PA 2PO6D 4NQCB 5E8NB 5F8QC 3MRKA 4QHKI 1PJ9A 4OFIA 3T0EB 3RVWD 1AIFA 5CBEA 3OB0K 3JWDL 2CR6A 3JBG7 2MHAA 5IVZB 4PJDE 3U30C 4JN1L 3MUZ1 2HT2D 1KB9J 1QYGL 2H6PB 3WUWA 4X7CC 1HN1A 3PABA 1LDPH 4XPFH 1II4E 4ELKA 3IDGB 4LDEB 5F1SA 2CLRB 2AABL 4EVNB 3MCLL 5ESVB 1ODAA 3MRRB 2IBZX 3OAZH 4GS7C 1I4FA 4WGWB 1I7TA 1GGCL 4W4OA 4K2UL 4I4WA 1MHCB 4LSTH 5INCA 1AKJA 4GOSA 2BY0A 1IT9H 3BPOC 3W0WD 1QBML 4GW5B 2VL4A 2FO4B 5A2JH 4V2BA 3ECBA 2ZCLL 4ODUB 3WMSA 2AKRA 4R0LA 3D5OF 1R3HB 1T03H 2GFBB 4O9HH 5TQ2L 5DEGA 4MD0A 1XIWA 4KVCH 2DQIL 3MV8E 2J88H 3K7UA 4X6CA 2F54A 3KG5A 2WIMA 3VWKA 3C8HA 4UDUA 1S7QB 2Y9RT 3OHXA 1CLYL 1RHFA 4K3DL 3SDYL 3WYRA 1NCBH 5AUMB 4FFYH 1QA9A 5KSUA 5ITBL 3O6FD 4WW1A 2VE6A 5E94B 5DC4B 5TDOA 5HDBF 3SCMA 1QRND 1YEGH 1NCWL 3AREB 3QIBC 1PSKL 1X5FA 5FO9A 2ATPA 2IG2L 5CSZB 1KJ2A 1CYGA 4EZMA 1PEWA 4N8VB 3CFJB 2R15A 4XAKE 3WJLC 3C9NA 4DCQA 3PDOB 2J4WL 5E00B 4EI5A 4XPAH 3QI9A 3QO1B 5EOCL 1L6ZA 3G6AA 4PRDB 2Z92A 1AHWA 4BFEA 2BZDA 5HDQH 2EDHA 4JR9L 5ENWB 5FYLH 1GL4B 4GBXA 3PNWB 5E6IC 1HH6B 3QAZB 3BGAA 4X6CF 4WEBL 3MRFA 1KT2A 1MNUL 4P9HH 35C8H 3EJZD 4TNVF 5J9PB 4LSQH 4LSTL 2JELH 5KVDL 3TIDB 1QUNA 2CDFA 2IPKB 3HUJF 3WEXB 4G42A 4EKXA 3B9EA 4LK4A 2GQHA 1G7HA 5DSCB 4ZXBC 2J8HA 3R8QA 1KTDB 5DJXA 3Q1SH 3RWHA 5F7KC 3QG7H 2YSSA 1AO7B 3HE6D 2B8OT 4P3CH 3CC5B 4QT5B 1EJOH 3FFCA 2CK0H 2SEBB 3FN3A 4BZYA 4N0FA 3CU7A 4G6JH 4LP5A 5E5MA 3IVKA 1MEXL 1O7SA 5JW4R 2IBZY 1YPZB 5F7MC 1JGDA 2CSPA 4WFFE 5F8RC 4KZEL 3BSZH 1K4CA 3C5ZB 4UV7L 4KKAC 2Y25A 1G7QA 4HZLB 1NAKL 3UXFA 3ARBB 3D39D 2CIIB 1GC1C 2A83B 2A6DB 1SM3H 4IDJH 3TT3L 3U7WH 2X4RA 4IOFD 4TSBH 2KPNA 3GJEB 3BX7C 4M7LL 2L7JA 4CN1A 4FMKA 2OI9C 1CXFA 4OF6A 1HKFA 3BZFA 4M43H 5DD1H 1MJUL 2P7TA 4WWKB 1KXTB 3DIFA 1NCAH 2GT9A 5EU5B 4ETYA 1CGVA 2ADFH 2HLAB 2X4QB 5FYLL 4MDJA 1NAMA 3HCVB 2EDYA 5CAYB 4ONHA 2FWOA 1CDIA 1J8HB 5GGQL 4JFDE 1U0QA 1MVFA 1U3JA 2B7DT 5IESL 4DN4H 5I18H 4HIEA 3B9KB 2ADGA 1K6QH 1IILE 2E27H 1P4LB 3MRQB 3RKDC 4X8JA 2W0LA 1I1RA 4PJBB 1G9MH 3V8OA 1I3VA 1CLOL 5KVEH 3TF7C 1UG9A 3MA7A 1TJGL 2EDRA 2BNRE 2DWDB 1G9NH 1IKFH 2KL6A 4TYUA 3RWFB 1L4IA 1Z9LA 4R3SB 2DYPD 1IGTA 1XH3A 5EBLB 3V6ZA 4PG9A 3V0VA 4Z5RB 4ODBD 3O81A 4V1DE 1PKQB 4J6RL 1MCKA 3IJSB 5DMGC 3QUXC 2DMCA 4ELMF 4O5LL 2D4DA 3CK0L 5LGHH 5D1XD 4P5TC 5HPOA 5IB4B 5EUKB 1VKXA 4Z95H 5DT1L 4B7IA 5CLWA 1AGCB 4DVRH 3WJJA 4OGYH 3WFHA 1RUMH 5JW4Q 5EO1A 4L5FL 1XF4B 2J8UF 5AG8A 3QNZB 1K5NB 3CDGB 4QF1A 2IAMD 4LLQB 2F19L 3NFNA 5FHBH 1FDLH 1IAMA 1K3ZA 4NO5A 5MEPB 4P57B 2ZSWA 4M02A 3OXRB 3R06A 1KTRL 1J8HD 5H8DA 5HHNB 1IFHH 3QUYC 4J3OC 2GK2A 4LGPB 3GRWH 3QFJE 5DC9B 4GXVL 4IJ3B 1MFBH 5I1AA 3MLSH 3PHOA 4WFGD 1ROWA 1EMTL 1ZT4A 5SWSE 3WD5L 3QO0B 4DN3H 5DLML 3FB6B 4LCUB 4HH9B 4RQQA 3L3KB 5EG6C 2NY6D 5LBSL 1CWVA 4QRUA 4LSUH 3MJ9H 3QZWG 4OQTH 3EZJB 1UZ8A 2X09A 3CX5K 1PLGH 4KROC 4S1RH 1UQSA 2VKXA 5CKAA 1MAKA 1NAML 2PXYA 2ENYA 2QADD 1A7NL 1IKNC 4IRSB 4J3TA 4KKCC 5DJ0B 2VDOH 3BGMA 4ZO7A 4QXUL 1U3HD 3QQ9C 3W9DB 3P73A 1V8HA 3H7LA 3SDDC 4D0DA 4OM1H 3WXWL 4YHIA 1S5HB 5E2WH 5EO0A 3X12B 4TSAL 4DUXA 4Y19D 5E4EB 3WFDH 2WUCH 4MNGE 1UH2A 3LKRB 4QOKB 3TIEB 3HE7A 2BVQB 2FD6L 3WFZA 3HAEH 2B1HH 2UY6A 3E8UL 1QLEH 1H3WM 2FJHB 3IXTB 3OR7B 5FUOL 1B4RA 2D7TH 5F9OH 4NZUH 5CIPA 3EOAA 3A6BH 4OD3H 2BXZA 4BYHA 1CTNA 4N68A 1VCAA 5I1IH 1FJ1A 4LOUD 5B38G 3QDMB 4G9DB 3BKYL 3BRFA 2R0ZL 3T4YA 1T1WA 1T89A 1YJDL 2C7UB 4AENA 1R3IL 1JNLL 4GQPH 1CD1B 2P24A 1I8MB 1MCWM 4XHJC 4XP1L 4O00A 5T3XH 3UPAA 5D7IE 4JREB 2UVFA 3DTXA 3KR3H 3BE1H 5BZDB 3SDXA 1G6RH 2H45A 2NY2C 3RWGA 3GK8H 5ERWA 1JTPA 4JHAL 1NBYA 1GJIA 1JWSA 3LMJL 4OI7A 5EU6A 4HMCA 4QOKD 2CUHA 5I1HH 2A0LC 5C6WH 4NCC1 4CU7A 3P2TA 5HGHA 4Y7MA 5E6YA 4M8QA 2XZZA 4KDTC 3FMGL 3ARRA 4HWUA 2DM4A 5GZOC 4RISH 3M17A 4WGVB 5JOFB 4BH7B 4DOHE 3MNVA 3BP4A 5GGUA 4RIRA 2V17L 3T65B 2UWEB 5F89B 3ZKMC 4JG1L 1NLDH 3VXSD 3U1SH 4EN3D 1FLRL 3UBXG 4I3SL 1I1YA 4U6YB 3QNYB 4B5EA 2DJSA 2DQCH 3L6FB 4I9WD 4I18A 3O2DA 3FFDB 5BVJA 4AH2B 1PY9A 3TBSB 3B6SB 3IETA 3IFOB 4NIKB 4GSDH 3SDXF 2YD1A 4K3EH 2R1YB 1M71B 1K9TA 3MC0A 3C2AL 4OGAD 5FYKL 3ARGA 4UTAH 4PD4K 3P0YL 3SKUD 1SY6H 3MCKB 1BQLH 3F62A 5C0EB 2XN9A 2A9NL 1CLCA 5BO1L 1WVZA 2W91A 4WWID 32C2A 5IFHL 1BLNB 3T2NH 5HYQA 1Q1JH 1GGBL 1ZWIA 4F2MB 1RSFA 4QHMB 4Y1AB 4HUUA 3WN5B 3GNML 4TSCL 3TP4A 2VLME 5IHZA 3HS0A 4IMLB 4PGEA 4K9EC 4P48A 1MFCL 4XNYH 4XH2B 3UEZA 1BQHG 1HDMB 2D2OA 3H42L 1P5VA 5E9DD 3WNPA 2VC2H 5MENE 1BAFL 2HFTA 4U6XA 4F8QA 1XGQA 4HGWA 1WSST 2GUOA 4P2QB 1LVEA 4RGMC 2RR3A 1R6VA 3ZZ1A 4MHHI 4U1GC 4L29A 2DLFH 2B5IC 4F33A 1OP5H 4HW6A 3E3QE 1X4ZA 5DRXB 3T0BA 4G6FB 4GQ9H 2X1QA 3ROOA 4OIIL 4JKLA 4HPYH 3R0MA 4IHOA 2V2WA 1OM3H 1FFPB 2NW3B 5T1MA 3FO9B 1I1AD 4RMVA 5T1LB 1M05A 3NIFF 3MRMB 1BVKA 1FQ9C 2OXGA 3P4NB 4RNRB 2OTUB 1RZJH 2EDLA 3ARQA 4YWGL 3SGJC 5TE6H 3P9WB 4Y5VC 1AFVH 3PHQB 4D3CL 1A64A 1IM9A 1U95B 4JQVA 3GHEH 3GSWB 3VD9A 1CI5A 4XWOC 1SEQL 3TH2T 1U8OA 3O2DL 2UZIL 4NRZB 1L9MA 1FVEA 2F58H 3WO4C 2VYRE 3H9ZA 3QEQA 3L7FB 4PJ9D 1YEIL 4HUKB 4MB3A 3QSKB 4CW1A 2P5WD 4HIJB 3FO1B 1RZFL 3HI6H 2NTSP 4P2QD 5KBNC 3QH3A 1JTOA 3TA3A 4M1CD 4TOYH 4JN2B 4HUXA 2Y06H 1WCQA 3RZWA 1FAIH 4MJIA 5JHDA 3LS5L 6CGTA 3UTQB 4BUHA 1A2YA 1DQJB 3T2NL 2F54E 5CEZL 1A9BA 1RZKC 2RJMA 3QEHA 4KI5E 3H3PL 3TO2A 2NX5B 4KZDH 4OB5H 3HMWL 5DJAB 1E6JL 3IDMB 5L7XL 1CU4L 1OW0A 1E4XL 3BIAX 2OM5A 4LAQH 1Y0LA 4NQDD 1RU9H 1IQDB 2BX5A 3I6GB 3AGVA 3S6CA 2GSGB 4ZPTB 3S5LA 1MIMH 3T0EA 2Q3ZA 1ZGLM 3K1DA 3GSXA 1MCDA 5IVZA 4CJ0A 2XA8H 4G9FB 1HINH 1I8IB 2H6PA 2CIKB 4X4ME 4Y2DB 4FQXC 5GS0C 3X14A 2F53E 4PJXB 1OB1B 3IDGA 5FYLE 4O2EB 2CLRA 1AXTH 2H8PB 3O4LA 2BOBB 2HRPH 5ESVA 4I3RL 3VFPB 2NLJB 3Q3GB 2NY1B 4R97B 5IMOB 3MRHB 2B2XH 1J86A 1F2XK 4XCNA 4HHAB 3S36L 1MHCA 1U8PA 1IGMH 3QRFM 5F1IB 43C9B 2HKHL 4GW5A 2FO4A 2A1WL 4EEEA 4IS6A 4KAQH 4B50A 4X9IA 1J0ZA 1F6FB 1L0XA 3BP6B 4Z7WB 2YZ1A 4M6OH 1QFHA 1ZSDB 4K7PH 2GFBA 4CDGC 3D3VD 1E4WL 3FQWA 2BSTB 3TO4B 1HILB 5ILTH 1RZGA 4NBZB 1KACB 3BPLC 1ITCA 1NEZB 1V7MH 3QRGL 5C09A 3PDDA 4X5WB 1V3KA 3KPSA 4UOW1 4PP1D 1NMBH 1UWGH 3K8KA 1DQLH 3H0TB 3F58H 2OJZH 4NC0B 3HNVH 5K9QG 3NFSL 5HI3D 3FCTA 4ZAKB 5JIIA 4FTVD 4PGJA 1IGYB 4R26L 4WTXA 3QULB 1EJ6A 2MQ0A 3QXAB 3MLYL 4G3YH 4KUCD 4N8VA 4AG4H 4PJAB 3PDOA 4GJTB 3EGSB 3QO1A 1ZV5A 4GG8A 4NQED 3V6OA 1CK0H 4PRDA 5E1HB 1MVUB 5ENWA 1LK2B 4JFHD 4D9RD 1RUAL 4MA8L 2BCKA 1HH6A 3SHSA 1LO0L 1LE5A 1XCTB 1VB9A 2G60L 4UUJB 4ODXA 4AIZB 1JWMB 1QBLL 3IS0X 4JKPL 3CMGA 3JV5A 1IAKB 2OTWB 4XVUD 5KSAD 3V79C 2NY5C 4K8RH 4IM8A 1OAXH 3TIDA 2MTPA 2IPKA 3V5HA 1A21A 2ZWLT 1MLCB 3WEXA 3QNXA 3TJHD 2YPLD 1KTDA 1QFWM 4FZ8L 1FFNB 5INDA 1TDQA 1K4DB 2R9HC 4JGUA 5C0CB 1WZ1L 1AO7A 1I85A 4FXKA 2Q76B 3LB6C 5I73B 4IMKA 4BELD 2YD9A 2WQRA 1R0AH 4JO1L 1RV6X 2C9AA 2YXFA 1RIHH 2XQBL 2DICA 1G0YR 1YPZA 4LSSH 2JB5L 1DBBH 3RDTB 3C5ZA 4KRLB 5ISZB 2VOTA 4HKXB 1QFUL 1A6TA 2OL3B 1J1XH 2EDQA 3DI2B 4U6HB 2JJVA 1HZHL 4RFNB 2XWTB 5HGDA 3ARBA 5TE7H 2A83A 3WLWD 3TFKD 2ZJSH 3ZKXB 1T7WA 3UJTL 5TDNB 1INDH 1W72A 5D9SA 4JDTL 2Y5EA 3GJEA 1DBAH 4KKLC 4YXKL 1S7UA 3OV6A 2PYFA 2DQDL 5LCVH 4WWKA 2XRAL 5L8KB 2I60H 1PYWA 3PP4H 5EU5A 3ABZA 3RVUC 4ZQKA 3ZKQD 1VFAA 2X4QA 1BJ1H 1UT9A 5HYJD 3TBYA 4OBRA 1LEKB 4U2YA 1ZHLB 5JQ6H 1EEYB 4MNQB 5E7BA 1IBGH 1MCOL 2Y36L 5FCUL 2VL5B 1NCDH 2F5AH 1J10A 1YPZF 2P8PA 4XP5H 1KPRB 2CLVA 1EFXB 4JY6B 1DL7L 1IGJB 4N0UE 3RVXC 3CVHA 1JRHH 2Z35A 3WV0A 3WFEH 3MRQA 3WDHA 1OAYL 4LSVL 1YZZA 2G2RA 4XP4H 4PJBA 4P46B 2IEPA 4MA1C 3NCJH 1CL7L 2DWDA 3EW3B 4P2RB 2OK0L 4XNXL 4LEXH 4ZMAT 1VPOL 3AU1A 5EBLA 1NMCC 3BPNC 4Z5RA 4HEPG 4PV9B 1PKQA 4JHBA 2CJUH 1U42A 3MJ7A 1AD0A 1NGPH 3NCFB 5IB4A 2VABA 1TZGL 5HHXL 1ACYH 3M1BB 1JPST 3STBA 2YUWA 3RIFK 1CXKA 1XF4A 5C71A 2VXQL 3QNZA 3ZYZA 3BVNA 4GAJH 1WAAA 4KVNL 2GEEA 4JRYA 4P59L 3D6GA 5CP3A 5ADPL 2E7LA 3UAJC 4DW2H 5MEPA 4X6BB 3MROB 2IPTL 2PW1A 5T3XE 2XZQL 1NBZB 3UTSE 3SDCB 3EYVB 2QSVA 3KPLB 4YHKH 4TPRH 4JM2A 5FGCB 1W72L 4F80A 4H20L 3QDJA 2RBLA 2VNCA 5FM8A 5BV7H 4PJBF 3QO0A 3FB6A 3T3PF 1D9KA 1B6DA 2XKNA 2WWKO 2KZWA 5FO8A 1MAMH 1JPGB 4YK4B 4YZFE 1S9YB 5HBBA 1UM4H 3BD4A 3TBTB 3JWNC 1X9QA 3FQTB 4GRWB 3OPZH 3HG1B 3Q6GH 5GSRA 3JWDC 4IRSA 5DJ0A 3QUMH 2Z93A 1ZLSL 5JOEA 3W9DA 1XGPB 4ZNEA 1A7RH 1YDPA 1FE8L 2W9DL 2VR5A 4I0PA 5C07E 4LNRB 3O9WB 5D7LE 5JMOC 3CVHL 3JTTA 1RI8A 3RWIB 2QV2A 3CZFB 3IFPB 3X13B 4OZIE 4XGZB 1G7JA 3MBEC 3SDCD 1T21B 3MA9H 2DM3A 2FJHA 3IXTA 3OR7A 4G43B 1T83C 3WLBB 1S9VB 2EYRA 1FGVL 5EZOL 3O6ML 3GSNH 5MEQB 1IGCL 5KG9B 2GHWB 4NO3B 3RUGE 2Z31C 1SBSL 1KCUH 3QDMA 4ZG1A 4G9DA 4OD1H 5EC1A 2IANB 1FH5H 2XYCA 3MV7E 4QTHA 5BJTA 3MLZL 2L7UA 2C7UA 4APQC 4NRYA 2DJUA 1CD1A 3HZKA 2GCYA 4YHZL 1A1NA 3HG1D 3K2UH 2AXHA 2HG5B 1JF1B 5A2KH 3MCG1 3JV6B 5I74C 4MAYC 1KPVB 1LE9B 1P7HL 2Q8AH 5HHOB 5BZDA 4EOWL 4WUKH 1SEBB 3DJ9A 1I75A 3B8SA 3UC0H 1FAKT 4P5MA 4NNPH 5D70H 1RZIB 1WFOA 2EIBA 1TETL 5L2KB 3VCLB 1KBGH 4HKZA 3TBWB 3RVTC 1S7SA 1UXWB 1WICA 3A0OA 3SGEI 4ODTL 1PG7W 3KYKL 2HN7B 3MLRH 3TLRA 5JOFA 4JFDD 4PJIB 3OAZK 5D93C 4G8FB 3TN0D 3T65A 1GZQA 2BDNH 3OKLB 3RY4A 5HVHC 4YDKH 3E3QC 2PF6A 1S7WB 2P42B 2RIKA 5ICZA 5IW1A 2IAND 4U6YA 4Y4HA 3QNYA 1ORSB 5F72S 4MS8D 3ZYJA 1RMFL 3LQAL 3U0PA 1F4AA 1G6VK 5DD5L 4HIXL 1U3YA 1X44A 5AD0A 5HTSA 1F5WA 4AH2A 3TBSA 1MPAL 2NY4D 2H32H 2P5EA 1M71A 3GI9H 4GW4B 5AWNH 3S35L 3EDEA 4K71B 2YOCA 2MQ3A 3BAEL 3RIAF 3L5HA 2VLKA 3PL6D 5CUSL 4OCWL 3KPTA 5C0BE 5C0EA 2NNAB 4OLZH 3VFVB 3LN9A 4XWGL 4JFEA 4WUUE 4MJIE 3MYJA 5KTEH 3I75B 1BLNA 2R23A 1EO8H 1KCUL 1KFAL 1FN4A 2QR0B 1QSED 4R0LC 4F2MA 4QHMA 4Y1AA 1HXMB 3P4OA 3WN5A 1DFBL 2FHBA 2CDGA 4NN7C 3QIUB 4FFZL 3RWJB 1XIWC 2UWEF 1I8KB 4OF0A 4XH2A 5I8KH 5F7WC 1HDMA 3KNBB 2AJSH 2YRLA 3L3IB 4LVOB 2AJYH 4TTDC 3SQBA 3VWKC 3G5VB 1PY4A 3DSFL 4GUPB 1LO4H 1KENH 3W9EB 3BESR 4AK1A 5FGBA 3G04B 1REIA 5EC2B 5D1QA 5CFHA 2Q8BH 4G6AD 2GKIA 4GW1B 5IHBA 5GRVL 5DD6B 3SCMC 5KAQG 1TZIA 1FFPA 3D48R 1HI6B 4P2OD 5T1LA 1T0MB 4AEEA 3MRMA 4RNRA 3P4NA 3H9HB 2Y07L 4J4PD 5GGRY 3QP3A 1UJ3B 4EI5C 1ZLUH 4NBYB 3QI9C 5EA0H 2NZIA 1AR1C 3LKSA 1U95A 2R2CA 3I9GL 5DJZB 3S3JA 1AHWC 3TCLB 4JAMA 3QIUD 1B9ZA 4JVWA 4NOBA 5IBUB 4J3UA 3MLXL 1FHGA 3F8UB 2GTWB 3L7FA 3DXAD 4HIJA 1AI1L 3W82A 3ET9F 1ZK9A 5CBAB 7CGTA 3NPZB 2FL5A 4JN2A 2WIIB 1FSKC 1YQ2A 3UTQA 4P4KB 1UYWL 43CAB 3L5IA 3LZFL 1HK6A 4BZ1L 3ARDA 5C09E 4P4RB 5DJAA 3IDMA 4PJ5A 2DM7A 1IC5L 1RJLB 1T0PB 3NCMA 3J7HA 4HS3B 1IQDA 3I6GA 5HPMA 3KLHD 5IEHB 3MRGB 2D31B 1MWAB 1HQRA 2QL1A 5L0QB 3QHTC 2HMID 4NOFA 2GSGA 3W5MA 4I0CC 1T5WB 4M6AA 4X6EB 3L9RB 4M61B 4UILH 1HHGB 4W70A 3KJ6H 2WK2A 5F9AC 4U49A 2HVJA 5IFAH 1F45A 1FNLA 3UX9B 1I8IA 4ODWB 2YRPA 4Y2DA 1A3LH 3QQ3A 3B9DA 1BWWA 5IEKA 2BJMH 4ZSOA 3ISWA 3U7YL 1RZ7H 1OCWL 1MI5A 3HC4L 4PJXA 1OB1A 4DJMA 3QEUB 3VXUB 4L3EA 3ZKND 5GJSH 2H8PA 3U79A 3O8XD 2ZNWA 3GMMB 1RULL 4U0RB 3IT8D 4I0KA 5H94A 3VFPA 1FYTB 5D72H 2NLJA 3L7EA 3OJMB 4JCMA 5IMOA 3MRHA 1FO0B 4LQFL 1HHHB 4BFGA 1U8LA 2COQA 3QT2A 4HHAA 2IJ0C 4X80L 1A6VH 4L9LA 1J1OH 1ITBB 4N0YH 4Q9QL 5T5FL 2FLRT 3VXRB 3QXWA 2X4OB 1OARH 2DTSA 2HT4D 3VG9C 2ESVA 4KKBD 2BHZA 2BMKA 5A2LH 3BP6A 4Z7WA 5AYUH 1LO5A 2NY3B 3PGCA 3EO9H 4YR6B 4TQEL 4JQIH 3MRPB 4ZNCD 1EH9A 4CADB 3T0DA 2BSTA 2HFFB 3TO4A 1HILA 4PRPD 4UT7L 4ZOBA 1KCSL 1X5XA 1CD0A 1LNUB 3IDXH 4Y4KB 1O0VA 4S1QH 1S9WA 4PJXF 2NTFB 1QNZH 2YA0A 1U8NA 4OZHE 5I8CA 1YYML 4OGXL 4RGNE 3CSGA 3QHZL 4NZRL 2VKWA 1FYTD 3H0TA 1KJ2H 1FV1A 3DX6B 3X3GL 1WCBA 4ONFL 3N85H 1MCNA 3QG6B 5CJQL 3WJJC 3CVIL 4BSWB 4PRIB 4ZAKA 1KJ3H 1A1OB 3S3SA 1IGYA 1QPPA 4UILL 4KUCF 3AB0C 2FX8H 3QXAA 5SWZE 4HLZG 3WS6C 1NMAH 5LGKA 4Z7WF 1BOGB 3AMLA 3EGSA 4MLSA 4R4BB 1I3UA 1IAOB 1FC2D 4GMTL 3R1GL 3L3OA 1MVUA 2FYYA 2NZ9D 4P0DA 3LEYH 2EIDA 5TJWK 2DBLL 4N8PA 4L4VD 4JZJB 1E4XI 3T1FB 3CLFL 5C08E 5E2VL 5AG9A 5IR1A 1R3JB 2AJXH 2IQ9H 4UUJA 2WINB 1JWUB 3WIIH 2X4PA 4AIZA 1UCBL 1JWMA 2D0GA 2BHYA 2EDEA 1IAKA 1ES0A 2DTML 3MRNB 3EDJA 2WV3A 5TGBA 2P49B 5TDPB 3RI5K 1X5JA 1D5IL 1EERB 1YN6A 4NQTA 3RWDB 2PXYC 4QXGH 2D7QA 5E8DH 3O4OC 1U8KA 3V4UH 1KG0A 2MOVA 4O4YL 1I3GH 4U6VL 1P7QB 1V5JA 3LRSA 2Q76A 4HK0A 4H8WH 4PJAF 4H88H 1RK1B 4YHLH 2X4SB 1OLLA 4QRPB 3HE7C 2J3SA 2XIDA 4WHDA 3UTTB 1DLHA 4Y2OA 1CDYA 3U0TB 4R8WH 3VXTB 4UINH 1LK3L 5SWQB 3EDFA 3H9SD 5I6XB 2HT3C 4MNHB 1DQDL 1NBVH 2WUBH 5ISZA 1JNNH 4HKXA 5JDSB 2XWTA 3HFMH 5C0DB 5TFSL 2AJUL 1IARB 1UACL 5TDNA 4LBEA 4YXHH 2J5LB 1ULVA 4E41D 1J0JA 3QDJE 4LRNL 4RAUB 1J1PH 3G5XB 5I2IA 2OSLB 3VXMA 2NXZC 5DO2C 1F02I 1N6QH 1IAIM 1ZHNA 4DK3A 1OGAA 5DRNB 2HA1A 1N5YH 4HBCL 1H3PL 5FV2A 1BHGA 1CGSH 5F7YC 5DS8B 4GS7B 1H5BA 4X99B 5I8OH 4MNQA 4JJHA 3BOVA 5DJCA 1J05A 4UT9H 4NP4L 3C60A 1RVFL 3HRZA 4ZNEE 3HNSL 5FKAB 4F9PA 1WFUA 1EFXA 4JY6A 4XVTH 3QJFA 3OKEB 5EWIL 1MFDL 1OTUC 4OJFL 3N1FC 3DROB 4U7KA 1YEEL 4IIQC 4P46A 4QLRA 3KGRA 4DKFH 1MF2L 2DLIA 2AK4D 3OR6B 5FV1L 3V52H 2R4SH 1T1ZB 3GKWH 3V6BR 3GMPB 1DQTA 4PV9A 1HHIB 3GIZH 1KLGB 4I18C 3PWLB 1CD8A 3VD4A 2F15A 2WW8A 1G7PB 3ARGC 1A1MB 2AV7B 4NJ9H 1QQDB 2IFGA 3UDWA 3I6LD 2H3NB 3DYPA 4FXGB 3MOAH 3MROA 4M5ZH 5B3JF 3HFML 5ESQA 4Z8FH 3QIBB 4OLYH 5BQ7B 2OR7A 4KRPC 1YMMA 1N7MH 2DKSA 1BQUA 4QRSA 1T1XB 25C8L 3TCXA 4NJAH 3MRJA 1LP9E 5FB8A 1HKLL 5JW5A 3S97C 3CGTA 1NC4B 4OTXL 2R2HB 1OP5K 3O41A 2AGJL 3LV3B 3D9AH 4KJYB 2DMBA 2Y5TA 4JFFE 1IC4L 3C8KA 1J0KA 5C7XL 4HF5H 3FQTA 3I6KB 4BH8B 5I8OL 3TPUB 3SJVE 5E1AB 2X10A 5IFJB 1XGPA 3VXPB 3B83A 2MPAL 2MWCA 5E2UH 4HT1L 4MCZB 4IRZL 5IROA 4HKJB 1DVFD 4U4BA 4EDWL 2CKBH 3WE6B 3RWIA 2DQFB 5DUBB 3IFPA 1FPTL 5IMLB 2ARJA 2IADB 7FABL 5IM7A 2VLJD 3OSKA 4XGZA 2KKQA 2XTJC 2X2YA 4DGVH 4OZ4B 1TCRA 2R39A 2YS4A 3MUHL 5T3ZH 3WBDA 4EDXA 1YNTB 1WIOA 4JQVC 5EOQH 1A22B 2VLKE 3SKOB 3WLBA 1JYWA 4Y16A 4JFEE 4HQQL 5HYSB 5KG9A 4ZFGH 4NO3A 1P5UA 4MVBC 3EOYG 5HGGS 1V7NL 3GZKA 3DRTB 5E6ID 2OJEB 1E28A 4GRWF 3QJHB 1NFDE 5H37H 5B39G 3AY4A 3TA3C 3DVIA 2BC4B 4HG4K 1ZLVH 1JPTL 2OR8A 5C70A 1BMGA 3AAZA 1W8OA 1NSNL 5DFTA 2FGWH 1LE9A 5HHOA 1CL7I 2BXYA 1KTLB 1SEBA 5EPMB 4DVBB 3RPKA 1H3VA 1EV2E 3GIVB 2E9JA 2WBJA 1RZIA 4S1SH 4ZXBD 5CEXA 4JFPA 1OW0C 4N1EA 5LAXB 2XI9A 3VCLA 3FQNB 3TBWA 2JIXB 4WENB 3BIBX 1V3MA 4Y0GA 1MHPL 4HPOL 5ADOL 1MIEH 3S37L 1W0WB 4ZD3H 4JPVL 5A3IC 3FO0H 4MQXD 4GAYB 5L2JA 3KYMB 1F58H 4P23D 4QO1A 2I25N 4LHQB 2UY7A 3MOBH 2OZ4A 4YHML 2AK1H 3DMMC 1A5FH 3HKFA 5CINL 3RX8A 1XEDA 3OKLA 1U8QB 4Y89A 1BIIB 1BEYL 2FHFA 3V0WH 1S7WA 5DJDB 1D6VL 4XNQB 3TZVA 4YGVB 1HYRC 1ORSA 1NJ9A 5BRZD 3BD5A 1P69B 1KXQE 2ZG2A 2HTKD 5DK2B 2BK8A 3FZUD 3INUH 2UZXB 4G8GA 4XP6H 2BSSB 4GW4A 5JXAH 2VITB 3NACH 5T1KD 1WEJH 2GY7B 3EOTH 1PEZA 3P0GB 4OSUL 3GB7B 3VFGH 3SKNA 1FORL 4P5TB 2AP2A 2NNAA 3ULUF 4U1HB 2LU3A 2JIXD 4AEHH 4NM8H 3IKKA 1JP5A 4NQVA 2QR0A 4YX2H 5BS0D 4J7RA 2BRQA 2R0KL 3ZL4H 3SKJH 1HXMA 4JRXD 4N1CA 4QY8A 3QYCA 4PJIF 1A3QA 1N0XH 5IVXE 2E9BA 3PWNA 1LO2L 1I8KA 3KNBA 4MA3B 3QUYB 2DDQH 1OTTC 4EUPB 4OIBA 3L3IA 1V05A 2AEQL 2E6QA 3PWPB 3SDAD 4FQCL 1N5AA 2OMBA 3VFWB 3SKMB 4GUPA 3F7PC 1QSFE 2EDBA 4Y8AA 3MJ8A 5TF1L 4R2GC 4PB9L 1DN0A 4GKSB 3ULUL 3LOWA 3UO1H 3ARXA 3I2CH 4ODSL 3G04A 3NA9L 3TBVB 3M8OL 1MH5B 4XCEB 4JFOA 4GW1A 4KROB 5DMGD 3QUXD 4PRNB 3CXDL 2Y7QA 4NBXB 4YDIH 2PO6A 1HI6A 1MI5E 1T22B 4P5TD 4C4KO 5J1TC 2CK2A 1ETZB 3OX8B 2BVYA 3IDYC 4BQ6A 4MDIA 2Q3AA 3V95A 2OZ4L 3H9HA 3SDDB 4CN4A 4YFLF 5DHXB 4LVHC 4S10A 3UROR 2DQTH 5JUEL 4PR5B 4UTBL 3BFOA 1IL1A 2IFFH 4MA7H 4NWUL 4LLUA 3ZDZE 1SYSA 3LN4B 5DVKA 3IDNA 3LRGA 2CRZA 2VDRH 4U3XA 4KTDL 1B88A 4P9MH 2ESVE 1IEBA 3EOTL 5CBAA 4JDVB 2DL9A 2XWJB 5D8JL 5DHVH 2IGFH 3SN6N 4RRPA 5HHME 5I1DB 2A6KB 4AEHL 1G9EA 1CGUA 3DUSA 1KGCE 4P4KA 5IB5B 1XZ0B 43CAA 1TTGA 1HHJB 3HUJE 4PRHB 4KROD 3P9LA 1JGVL 1OP9A 1CFQB 4P4RA 3HB3D 1I85C 4Q0XL 2XNAB 4IMKC 2VDKH 4LCWD 1RJLA 2R8SH 4PUBH 2RCSL 4HAFA 2X05A 1LEIA 1PGRB 4K55A 1A7OH 3OZ9H 1YQVH 1ZA6B 2XT1B 4PJFB 4FQIH 5IEHA 4W68A 5DURD 4RGNC 1U93B 4NPYA 1I9RL 4M61A 1JHKL 1HHGA 2D3VA 3C5ZC 1HSBB 4GKZA 3U4AA 4YO0B 1R3LA 5I1LB 2FBJL 4WU7A 4NUJB 4ODWA 3EYUH 1MRCH 4JQXA 1KCVH 3DBXB 1FL3B 1BBDL 4JJ5A 1KJVB 1WWAX 3QEUA 1QRNA 5GSVB 3RL2B 3VXUA 3QCTL 3GMMA 5KSBA 5C6TH 2JKXA 3LPWA 3WSQH 4LPTA 4ORGB 1WTGT 4HDIA 3F6LA 1FO0A 4PRHD 1IJ9A 1FNAA 5DQDH 1AXSA 2X1PA 1AQKH 3DRQA 3PQYB 4BFIB 2HH0L 2VDRL 1F4XL 3JV4B 2BP3A 2NY2D 4LKCB 4HC1A 2X4OA 4P9ML 4EI6B 4RZCB 3V7AG 1LEGB 3BO8B 2R29H 3A6CL 4FQLL 4PY7A 4XP9L 4LIQH 3TWCL 1UADC 1UEMA 4M48L 4YR6A 5CJBA 5K59F 3R0NA 5F88A 4N90D 2A0LD 1I1CA 1EZVX 1H8OA 5IV2B 2ZOKA 4PTTA 1OWWA 3O3BB 1LNUA 1N59B 4K7PX 4JVPA 4WDIB 5EUOB 5I1KL 2VDNL 3MFGB 1LMKA 3BJLA 1QFWH 3NVQA 1HYSC 1CG9A 3SY0B 3GSVA 3KPRD 2W9EL 4L1HA 3CCHA 1P2CB 1JFQH 4FNLH 1QPXA 1I9JL 1WZMA 3HE6A 3RPIB 2CDEB 1DBMH 3Q6FB 2E7HA 3DX6A 3RP1A 1T7VA 4D8PB 4ZUUB 4U1GB 4BSWA 4LCYB 1JMZA 4PRIA 4KGLA 1LQSR 4XRCA 2B5IB 1RAMA 1FNFA 1VGEH 3BEWB 3WIHA 3A67H 1CE1L 3WIFB 1HIML 4LASL 1OGAE 5F9JA 1IAOA 5H2BB 1A8JH 3G6DL 3D39A 4JM2C 4JLRB 1AJ7H 2ZPKL 2KZ1B 3MLUL 4NWTH 5KW9L 1TJHL 1VEMA 4PJDB 5GRYA 4M5YL 1MUJB 2HJKB 4Y5VB 1MLBB 2HFGL 1JHLL 1D9KC 2F74A 2BY2A 4AQOA 2WINA 3W11D 1KN4H 4M1GH 3ZDYF 3NCCB 4KJWD 4P3DB 3ULVD 4ZDHB 2AJVL 4UBDD 3QXVA 3MRNA 3WO4B 3U6RB 5DTFA 1WC7B 3KLAB 1YN7A 4HC1L 1KNOA 2O5XL 2VZ3A 4LP4A 3UTOA 2BNQA 3V5DA 4LQ1A 2CRIA 1U41A 2DQJH 5LWYL 1TXKA 3BMWA 4I0PC 4Z7OE 3ZSTA 3LQAC 1N64H 5FYJD 2VDQL 3KXFD 4GKNB 1RK1A 4YPGB 2X4SA 2XXCB 2VXTH 1T0NB 1FCGA 5ICYA 2AERT 3U0TA 3VXTA 5GQBA 1QFWL 4YNYA 2FJGB 3MV8B 1IC7H 2X89A 3MXWL 2DYPA 3OKOB 4C56D 3ARWA 3CX5J 1A7QL 3QFDA 5F7EH 2Z8SA 5C0DA 4HWZB 3UJIL 4QWWD 5DK0B 3B2UC 1YMME 2FX7H 2I9LA 5D1XA 3EYOB 3IFLH 3GMNA 4KJPC 4L4JA 5J8OA 4ODVL 1EZVY 2OSLA 2KQNA 4FQXB 4XI5C 3WIHL 4G6KL 4Z76B 5DRNA 3K3QA 1MJ8H 4K7PY 3C6LD 3PXJA 1F90H 2FB4L 4M7JL 4S1DD 2PNDA 5DZNA 5DS8A 3OB0H 2PYEA 4K8RD 4EQ2A 5CWSB 4I1NB 4J3WA 1DCLA 1CICA 4LLYB 1G84A 1Q72H 1RJZB 2FEEL 3VGBA 5HHQB 5FKAA 1FRGL 3MR9B 4XX1E 15C8L 3OAUH 1DANU 1A14H 3P11L 3U83A 2YZ8A 3BW9B 3OKEA 1BVLB 4WFHE 4NZDA 4J3SA 1P4IL 2I5YL 3DROA 3VMNA 4K3JL 1H0DA 1MCHA 3HMXH 3PIQB 3ORJA 1I9IL 5T3ZE 1T1ZA 4Y4HC 2O5ZH 2WZPD 3V4VH 4XXDA 2LV4A 4JY5H 1KELL 3T8XA 4NZTH 1KLGA 4OAWA 5F70A 1YEFL 5EDXA 3BPLB 4AEIL 1WBXA 4LEOB 5K9OA 1EIBA 4NKDB 5ABDE 4Y19A 3BH9B 2UYLB 2W59A 1G7PA 1F3DJ 1A1MA 1L7TL 4M62H 5D2LE 5JLZB 3KLSA 4Q9CA 2D7PA 5CKGA 1IGFH 1S5IH 3ZTNH 4WCYH 1INEL 5ICXB 2QHRL 1CGWA 1NLBH 3EFFA 1BQSA 2C26A 5SWZD 3MZTA 5BQ7A 4JM4L 5D5MA 4JO2L 5L6YL 1T1XA 2ZG1A 3B3IB 3ZKSD 4YXLH 3WJLA 4L4TD 4NKMA 4QHLB 2XPGB 5FUCE 1OSPH 1OPGH 4YDLC 4KJYA 3VWJA 1WFNA 3RZCD 4RBPH 3GBML 3NN8B 5IBTL 3BN9D 2XG5A 4GAGL 2XY2A 2EXWD 1M7IB 3FB5B 2GI7A 4G6MH 4PD4J 4ZS7H 3DX8A 4I2XE 3OJDB 3FN0L 1ZLUK 1SJVA 3KHQA 3TPUA 5E1AA 3U9PL 4AYFA 5FGBC 4LLMA 3VW3H 1BZQK 5D1QC 3VXQB 3VXPA 5EZJA 4ZTPH 4MCZA 4LHUB 1DUZA 4UIKL 1OGTB 3GSOB 4KV5F 3D25B 3F65A 2QQQA 5MHSD 4POZC 4NO2B 2LFGA 2H26B 4PLKC 2DQFA 4XHQA 5IK3B 2IADA 4M6ML 3FO2A 1NL0L 4NNXA 3IGAB 4X6DE 3E1F1 4I77L 4Z7UE 4X7FC 3U48A 2J6EH 5EU4B 1WIPA 3SBWA 5D96C 2BNRB 2H2SC 3RY6C 3DURA 3UTPE 1GAFH 5CZVL 5JQHC 1JBJA 4D2NA 5FECA 1JPFB 3L3GB 4V1DB 1H3TA 3AC0A 1UWEH 3QHFL 5SX4I 1F42A 1S5IL 3RNKB 2BC4A 3JTSA 4UT6L 4ODHL 4X83A 4OCMC 5GGRB 1EDQA 2D03H 2W38A 2A9ML 1HOCA 5IOPB 4NUGL 3GM0A 2YKLL 1BPVA 5D71L 1L0QA 5BZWA 3GBNH 2ITDB 2C1OB 3ARDC 5KVFL 3BZDA 1Q9KA 5FUZL 1XMWA 4NT6B 3L1OL 3FQNA 5E8EB 1ZVSB 1OAQH 3P30L 5F1NB 3QFJB 3LB6D 4CAGA 5DQJB 1W0WA 3TV3L 5HI4C 1V3LA 1QVOA 3E6HB 2ZUWA 3O6LL 3T3ME 3PWUB 4X5XA 5E9DA 2AXFB 1JV5A 3D2UB 1VACB 1T3FB 2VLRB 4LFHG 3VJ6B 1U8QA 5JHLH 1F11A 1BIIA 1C5CH 4EIGB 1NGQL 3BZEB 5DJDA 1CFNB 4Y2DC 4XNQA 4NHCH 4W81A 4X98A 4LLVB 1ZMYA 4MA1B 1VHPA 5C0IB 3M07A 3FT4A 2JB6A 2W0FB 1MRDL 1C16A 1I1AA 2DQGH 2VDPH 1T2JA 1NMCB 3BPNB 4AMKH 2NY1C 1BM3L 1JPSL 1PQZB 5HHPB 1EHLL 3GB7A 1MFEH 3G5YB 4LSRH 4MNGB 5MP6L 4KKLD 4TNVK 4JG0H 4L9LC 4RA3A 2WM0A 1N8ZA 3L5JA 4U1HA 3AVEA 1PG7H 1S7XB 2ICCA 2A6IA 4PJHE 1IM3B 4WJ5A 3W0WE 1BJ8A 5FYKU 5EH1A 3KDMA 1QFOA 4PJ9A 1AXIB 4R4FL 4A2MA 4Y88A 4KQ4L 1J18A 2EYTB 4PTUA 4JFZL 4WI3A 5K33A 2AS5M 5C0AD 3QQ4B 1UH3A 4EUPA 2EXYC 4R7NB 3PWPA 3VFTB 1BZ9B 4XC3H 3VFWA 3BKJH 4HKBA 3SKMA 3L3HA 4HUNB 3RJDA 5D7IB 4GKSA 5KANI 3LIZH 1ZEAL 3DVGB 3VI4F 4MJ6B 1FL5A 4WW2A 3FB8B 1R5WB 2EH8L 1A3RH 4XBEL 2Y6SD 2N7AA 4PRNA 4BSVB 1T22A 4RMRA 3OX8A 2ZCKL 2GJ6B 1GSMA 5KSBE 4NKIH 5JIPA 1YEHH 1HH9B 1U6AH 1W8NA 4PR5A 4HWNA 4XMKH 1JYVA 4DOHB 1Q9LB 2P44B 4ZFFA 1P4BL 4K3GA 1RURL 4XPBL 4HWEH 4F9LA 3LN4A 1OHQA 1OSZB 4D0CA 3ALWA 2XKSA 3MNZB 3MBEB 3UYRL 4FFWD 3K2MC 2VDPL 4JFXB 3D85D 4WIQA 3WNKA 4P5KB 2ARWA 4D9QD 2VZVA 4L8DB 4LIQE 2E3VA 4JDVA 4WEUD 4MWFB 3TNNA 4J8RB 1BP3B 2XWJA 4N0CC 5E6ZA 5ALCH 1RIUH 3VFRB 5ALBL 5JA8B 5D7JD 4Z0BL 4N5UA 2VISB 1CBVL 1TQCC 2X9XA 2R1XA 3K8MA 4XX1G 4WW2F 1HHJA 3IU3B 1HWHB 4APQB 5HXMA 3RU8L 3I50L 4TVPL 2EKJA 1T66C 4S11A 5FFLA 2QSCH 4MAYB 2GJ6D 1A02N 1GCFA 4NO0B 5FHAH 4PJFA 2GITB 1NANI 1Q0YH 2XZCH 2CPCA 1KEML 4OZFB 5IB3A 1F4YL 1XAUA 1HSBA 4CVWA 1AGEB 4F7PB 2DD8L 4YO0A 5MENB 3HLAB 1CLZH 5I1LA 4KDTA 3MRKB 4WO4B 2EDOA 3C5JA 3VRLF 4LU5H 1WITA 4O2CA 1AIFB 3DBXA 3WS3B 5CBEB 5D93B 1OT1A 3RL2A 2MHAB 2Z31D 5HVHB 1SVZA 4F58L 1RQ5A 2VXSL 5C0ND 3WUWB 4CU8A 2CKNA 3I84A 3RBSA 2FATH 3PABB 3QEGL 5I15L 3BXNB 4PGZA 4BK4A 1XGUB 4G7VL 4QRRD 2D9QB 2EE6A 1MFAL 3ARYA 3ARZA 4HFUL 5ANME 1U91A 1UB6A 4DZ8B 1H5BC 3EYFA 4O02H 4W6XB 4PJFF 4EI6A 4RZCA 1LEGA 3BO8A 4I4WB 4YAQA 3BHBB 1AKJB 3GO1H 3P4LA 3C60C 4OQ1A 5INCB 2VZ1A 1YMHB 4F9PC 4LPYA 4X4XA 3MBXH 3RVTD 3IS1X 3IYLW 2APWA 3UZQA 5IV2A 5KSAA 3W81A 4R0LB 1Q94A 3P0VH 4QKXB 3GM8A 4P46C 1JGLL 4I48B 1N59A 4WDIA 4ENEC 1BGXH 4NN7B 1G7MB 5EZIH 4MD0B 1MREH 5TQ0L 4KQ3H 4J1UB 1AY1L 4KFZC 1F3JB 2F54B 3RPIA 3VWKB 3WFBL 3QA3B 3LH2L 2G75B 3W2DH 4D8PA 5FOBB 4OF7A 4NM4H 2V5SA 5KZCB 1GIGH 1AH1A 5T1DH 1QA9B 2C4FT 3OB8A 4OKVA 4CDHA 3DWTA 4BQ8A 3SE9L 3CFCH 4YDJA 4U05A 5J13B 2R0LH 2ATPB 1BF2A 1UXSB 4KK6D 4LARH 1K3IA 1J8HE 1RJCA 2JLLA 5IGXH 4DCQB 1MUJA 3VI3F 2AJZB 5SX4H 3BPCA 3G6AB 3B9VA 4YH6A 5EUOF 3CDYA 3B8YA 4WFGE 4FQJH 1AHWB 2F53B 4YK4C 2OR9L 4N8CH 1KEGH 1R24A 4GT7A 1U8JA 4OCYH 2GK0A 5J12C 1KLUB 1XIWD 3MV9D 3MRLA 1DQMH 3MRFB 1KT2B 3U6RA 3AXLA 1WC7A 2QQLL 3KLAA 1ZA3A 2IALB 3MXVH 4JPIB 2LAGB 2QHLA 3L5WA 1SJHB 3MBXL 1FSKB 3BDYL 2MKLC 4PLJD 4OT1H 2CUIA 4RFEB 1YECL 1G7HB 4GKNA 4YPGA 5C9JB 4M6NH 5DJXB 5TPWL 3VG0H 3SCMD 1MCCA 1FP5A 4Y19E 4KPHH 1PFCA 4F37F 2OL3H 2NW2A 1F4WL 3FFCB 1ZLVK 1FIGH 4JY4A 4PJDF 3DO7B 2FJGA 3VXOB 3MV8A 1S9XB 4N0FB 5I19L 3OKOA 3VU2A 4Y16C 4EI5D 1I9EA 3QI9D 3LSOA 1AR1D 4OCLC 5F93C 4NGHL 4HWZA 1JGDB 1F8TL 1N4XH 5L9DH 1I3RA 4KY1H 3QPQC 4GBXD 4NQSB 1AE6L 5D5ME 2VQ1B 3BQUB 1CDUA 3AY4C 4CVZA 4OF3A 3V7MA 5AZ2H 2PTTA 5HI5C 3MLVH 1T7XA 1S8DB 4LSPL 4HIIB 1JL8A 4FQXA 1CD9B 5DUMH 4Z76A 5GHWH 3TVMC 5J56B 2R1WA 3UBXA 4UZGA 1BD2D 3VD7A 2FECL 4FQQA 2IQAA 3N50A 5BVPL 3BDBA 2WBJC 3LHPH 5CWSA 3ULUC 5FUCC 2P7TB 2HJLA 4JB9H 5F3BB 4XMLH 1T7ZA 2GT9B 1RJZA 3NA4A 3O6KH 4UB0H 2R4RL 1L7IL 4QOKE 5KOVC 2Q7YB 1IAIL 2QKIA 4M03A 5IMMA 4R90H 2ZG3A 3FFCD 1NAMB 4MDJB 5DMKB 3WXVH 1VA9A 1FNEB 2FGZA 4Y4FC 1BVLA 5CZKA 5I1CL 2BFVL 4PIRF 2FWOB 3VG9B 2EZ0D 4FQPA 4PJ7A 1VFOA 2NR6D 1J0HA 1Q0XH 4A6YL 1MJ7H 2LU4A 4ZYKA 3IJYA 2XZAH 2EO1A 4HIEB 3PIQA 2HFEA 4LVEA 4NRXB 1NGZB 3TZVC 4K23L 3X3FH 1GOFA 1J8KA 2OP4H 3VXSE 4GG6E 1Z3GH 4RMUA 3TC9A 1TIUA 3DHMA 1IEAB 2R2EA 3LPGA 4M4PA 4QXTA 4I9WE 2VZTA 4ONGH 1I7UB 4PG9B 3V0VB 1FVCA 1UKQA 2HVKA 4YEEA 4J23A 3ARFC 5JLZA 3IRZA 2QQKL 4LFHD 4PJEA 5CJOH 3RWEA 4FQ1H 1Q8MA 5IT2H 5GGSY 4FFVC 1UM5H 4WNQB 4YQXH 2BSRA 3NABH 1U8MB 3NFNB 4GLRI 4X5LA 1EXUB 3K46A 4NO5B 4DGYH 1X5ZA 5SX5H 3CH8A 4QHLA 3G6JA 3AS2A 3UPCA 1OD9A 2ZUXA 4D9LL 4GRLD 2MKWA 4BZ2L 2R56L 4U6TA 5CD3A 2CGRL 3OKKB 5C2BH 4G5ZH 3PHOB 5LXGL 5A2FA 5GRJH 5E9DE 1YNLH 4ESKA 4LLWA 3FB5A 4RQQB 3KJ4C 4HULB 1DBJL 3K4DA 5LJYH 5LQBL 4N8VG 3OJDA 3BKCL 3AMKA 4LDOB 1WF5A 1LO3L 1UZ8B 3TT1L 4NQUA 4PLNC 3CPLA 4PB0H 2PXYB 4RGOH 4LHUA 2PO6C 3GSOA 4YHOH 2X7LB 3D25A 4LCIL 3O4OB 4OLVL 3BGMB 3H8NA 2ZCHH 4NO2A 3ESUF 4OF5A 1JZ4A 2DB8A 4D0DB 2WP3O 4JFDA 2DQUH 1S3KH 2DQHH 2Z9TA 3QUZB 1WGOA 5F6IC 2HT2C 2KUTA 1QKZL 3QIWD 3HAEB 5LG1A 1KIPB 1RUKH 2BNRA 3MRCA 3S88H 2HTLC 2FEEI 4HCRA 4NSKB 4V1DA 4OV5A 4KDWA 5DF0A 3TJEH 3CIQA 2P5WE 2E7CA 4FQ2L 4P2QE 3RAJL 5GGRA 4ZUTA 3QXDB 2CMRL 2YC1A 3T4YB 4M9PA 4HWBA 1RPQA 4AENB 2XKUA 2ITDA 2P24B 2C1OA 1JCKA 2ZKHL 4TULH 5CGYD 4JO4H 3BDXA 3OGOE 4MJ5B 3UTSB 2FH6A 5DFVD 4ZPVB 2V2XA 5ACZB 3RWGB 5ERWB 5DEFB 5F1NA 5HGAB 1KPUA 3QFJA 5AEAA 4PRAB 1KB5L 4NQDE 3E6HA 5SWSA 1A6WL 1WWWX 3JWOL 2AXFA 4JGJA 3HE7D 2B4CH 1TCMA 2YMXL 2VN4A 3D2UA 1T3FA 2UUDH 5HGHB 4MXWH 3ZYOA 5FYKD 2VDML 4BSJA 4JZOB 4GAFB 3BZEA 2HT3D 1GPOL 5J6GA 3M17B 3MO1B 4U1IA 2WMPA 4LLVA 3MRIA 4IIQB 1WTLA 5C0IA 3U2SB 2W0FA 4U0RC 3DOSA 1JGEA 1I1YB 1H8SA 5D7LB 1UWXH 3D69A 4KHXH 4J4PA 2F5BH 3EYSL 3TPKA 4FOMA 2N7BA 2NXZD 4OZIB 2G5RA 5DI8B 4YGAB 1BBJB 5GRUH 4JO3L 4HUWA 4G7YH 4JDZA 1EUTA 5JR1H 1CGTA 2R2BA 4HCRL 1IGIL 1BF8A 4FQHA 1DEDA 5EU6D 1E4JA 1GVIA 3DXAA 1KN2H 32C2B 4EQ3A 5JZ7C 5K93A 5GJTH 2M26A 4JHWH 2EYTA 5C2UB 5HYQB 3RKPA 4KRPB 1EEQA 2DN7A 1YC8A 3QQ4A 3MV7B 3D3VE 3DX7B 1BJMA 4HWBL 2V5TA 4HUUB 4UMGA 1RIVH 3LY6A 3H3KA 4M3KB 1BZ9A 5IHZB 4PGEB 4WTZA 1BOYA 2LQRA 4HJJL 1XF3B 3MLWH 1NGWA 1E6OH 5IW6A 3TH4T 4HEME 5D7IA 3Q5OA 3PV7A 3HE6C 4U6XB 4HGWB 2GUOB 4MJ6A 5GGTH 5DVMA 3T2OA 3NAAL 3W39B 2VXUL 4BSVA 1VEOA 3C08H 1C1EH 2VAJA 2B1AH 1BWMA 3T77B 4YFEA 5DUPH 2I9TA 3ARPA 4FTVE 5GS1B 3ARGD 1HH9A 4PPTA 3SOBL 4RWHA 3WNOA 2V2WB 1OAKL 4X7SL 5T1MB 1OOAA 3CLEH 1HNFA 2XN9D 1BVKB 3WO3B 2DMKA 5JDJA 1OSZA 4MXQD 3VRIB 4NQEE 2XACC 2YPVH 4JPKH 3MNZA 2N56A 5C0RL 5CEZD 1XGRB 1LD9B 4JFXA 5K9KA 4IOFC 5GGVH 4JFHE 2J1KA 4D9RE 4LVNC 3DUUB 2F8OA 3MQIA 3H2WA 4J8RA 3DV4A 5D7IF 4BFBD 1WZLA 3EFDH 3NH7H 1A0QH 3BEVA 3N06B 1C5BH 2VISA 4CW1B 2R0WH 5DD3L 4XPGL 4NC1E 3IU3A 4APQA 3QH3B 4X9FA 4RFOL 5E99H 4JFYA 4WUUB 4MJIB 2YPLE 4ISVB 1MWAH 4MAYA 1A9BB 3FOLA 5TH2B 3QEHB 4NO0A 4GO6B 4OCRL 4PRPA 1I1FA 1GGYA 3EKCA 5HYIA 2CUMA 4DFHA 3S96B 5E2TL 4OZFA 3NCYS 5I1EL 1OVZA 2XTJD 2J2ZA 2JCCA 3JSSA 4QTIL 5MENA 3HLAA 1IM9D 4U33A 4F15C 5IUSA 4N5ED 4PJ8D 1JZ3A 2CR3A 1NUDA 4AT6B 4WO4A 5JOPD 3S5LB 4C57C 3UTZA 3QDGD 1XGYH 5D1XC 3WS3A 2J5LC 4HH8A 1R3KB 4RWYH 3VFSA 2B1AL 4H0GA 3DMMB 4MXVE 1FO0H 3GSXB 3QEQD 2XTLA 4M7LT 4MVBD 4L3CA 3L3DA 2IAMC 4LNVA 3VGEA 3X14B 3TA3D 3BXNA 1X5HA 1KXVC 3O4LB 1XGUA 1FGNL 5JHDD 1DE4A 5D7KD 1T80A 3PXHA 1RJYA 4DZ8A 2E9IA 4WI6A 3HC3H 3V4PL 5IQ7L 1AGDA 3GSQA 1BFTA 2A77L 4XCNB 5HYJE 1CICC 4B53A 1U8PB 3BHBA 2VERN 3EO0B 4PGDB 1YMHA 5HHVL 2NY6C 3U4BL 1B4JH 2DBJA 4Q6IA 1A9EA 1UEYA 4IS6B 1EPFA 4MJ2A 4NQCD 3U36B 4OCSL 1IRAY 5A3ID 1CE6B 4I48A 5DMIL 2QADC 4XPHH 4F57L 5C0JB 1G7MA 5I1GH 3T0ED 1FCCA 4UQ3A 1YEDA 3RQ3A 3UMTA 3FQWB 1Z0MA 4K94L 1RZGB 4J1UA 3ILQC 1F3JA 3FB7B 1XR8B 1ZANH 2F8VA 3QA3A 2G75A 5C09B 2V5RA 1C8PA 3QBTB 2FJFA 4TUKL 5FOBA 3KPSB 2AEPH 1VESA 4R2GB 2HKFL 12E8L 2R69H 3K74B 1GGIH 3O3DA 4G8EB 4LF3B 1NFIA 3O2WL 5IBLC 4HS8H 1P6FA 2J8OA 3H9SA 1B6UA 4KXZH 1ZS8B 4PV8B 1FFQA 1D5XA 4RBPK 3CD4A 3GJFH 2EH7H 4XVJH 3FCTB 1Y6KR 4G8IA 4CUCA 4QXWA 3EOBA 3GSRA 3IDYB 3ILPA 1UXSA 3PDGA 1OAZH 5ID0B 4LVHB 2C3WA 2D4FA 4I8DA 1OAUH 2AJZA 2NYYD 3DVFA 3LPFA 4X4MA 4GG8B 4E41A 3SGDH 4WVRA 1LDPL 2F53A 4XPFL 4ZUVA 3VWJC 5DMYA 5L8JB 1WZKA 2P1YA 3G5ZA 1RK0A 2BVUA 1KLUA 4R6UA 5IKCA 2BCKB 1GH7A 1IQWH 4KI5F 1LE5B 1TVBB 2H1PH 4PJ7E 4ODXB 2IALA 3QWOB 3HC3L 4JPIA 4PJGE 4H0HB 3IDUA 1IT9L 1SJHA 3KPSD 3V5HB 2ZUSA 2YN3A 3QNXB 1S9KC 4Q9BA 4RFEA 4BUGA 5E5UB 3PF2A 4KUZH 3T0XA 5C9JA 1QRKA 4DQOH 5INDB 1JVKA 3ARED 4KK8D 1T03L 4L8BB 1YNKH 4FXKB 2OQJA 4O9HL 4KVCL 4LLAA 3DO7A 3VXOA 2J88L 1S9XA 3O2VH 3RIAK 4C55A 5F7DB 4PJEE 5FK9B 5FGCE 3SBWC 5IIEA 3GHBH 1UC6A 1ADQH 4QHNA 2V7NA 4OZHB 1EO5A 4LRIC 4RGNB 3NPSC 1QLFB 4PBXA 4NQSA 2VQ1A 2X4NB 1NCBL 1A6TB 1EBAA 3BQUA 4FFYL 5HGDB 1WUNT 3EJYD 1GGTA 1S8DA 3G6JE 4HIIA 5ELIA 2BNUA 2PW2A 1YEGL 3HG1E 1T2QH 1W72B 5D9SB 1VEPA 4R7DB 4U7MA 4YHPB 3RTQB 5F9WB 5SV4A 4OLUH 5T33H 4XPAL 1S7UB 2PYFB 5F3BA 3KPMA 1PYWB 3FRPA 1AO7D 3KWWB 5DR5H 5GXBB 4ZQKB 5HDQL 1VFAB 2Q7YA 5EBGA 3RNQB 3TBYB 5DMKA 1CF8H 1E4KC 5LVEA 1FNEA 3A6OA 4ETQA 4KTEH 5C08B 4P9HL 1JNHB 4DFIA 1JZ7A 35C8L 2P8PB 4ZFOL 2CLVB 4HG4J 4LSQL 4XNZC 1UZ6E 2JELL 4HSQA 4NRXA 3C5ZD 1X6NA 1NGZA 3CVHB 2Z35B 3NIGE 2P8MA 2G2RB 4F7CB 2IANE 2PR4H 3ARBD 4OM0H 3O11B 1IEAA 4TNWF 3Q1SL 1I1AC 3PWJB 1DVFA 3QG7L 1I7UA 1AC6A 3AU1B 4HXAH 4P3CL 5DWUH 3T4AB 3LEVH 1EJOL 4MX7A 1NBQA 2EDNA 2VLJA 4XVSH 3U82B 2Z4QA 2CK0L 3BH8B 2ZUTA 2VWEE 3MJ7B 1AD0B 4G6JL 2EE2A 3X11B 2VABB 2BRRH 3RJQB 2CO7B 4NFCA 1SQ2N 4WWKD 4DGIH 1CGXA 3BVNB 4WNQA 3BSZL 2VAAA 2NCMA 2B20A 1NEZG 4JRYB 3KS0H 4POUB 1U8MA 4PJ9C 1EXUA 3HZMA 3WS6A 4XCCH 2PW1B 3AS0A 1QSEE 4EJ1C 4PGCA 1X5LA 4MQ7B 3SQOH 4EBQH 3BGFC 5MI0C 1SM3L 4M1CC 4IDJL 4JM2B 3U7WL 4X8XA 3GRWA 4ZFZA 3OKKA 3DETC 2PKDA 3B9KD 3QDJB 4TSBL 5BV7B 2BVOA 3IAGC 1D9KB 2XKNB 5T33L 5FO8B 2M1KA 3LKQA 4YE4H 4M43L 5DD1L 3MJ9A 4UDTB 4OQTA 1NCAL 5CCKH 4QRTB 2ADFL 4XB7A 4HJ0D 4WW2C 5J57B 3ES6A 5GSRB 2QSTA 2X7LA 2Z93B 1NCCH 1YDPB 4OUUA 2RQ8A 2YK1H 4P23A 4I0PB 1N6VA 4DN4L 5I18L 4JRYD 4N0UA 1K6QL 2E27L 3QUZA 1TNMA 3JTTB 4Q9RH 1FFOA 3BUYB 5ETUB 4F9LC 1G9ML 2C3HA 2FECI 3ALXA 3HAEA 3UYPA 3B2VH 5KVEL 1G7JB 1KIPA 1G9NL 1IKFL 1M7DB 2ZNXA 1MRFH 1GC1H 4GRMB 4NSKA 3MREA 3TYGH 2EYRB 1IAII 2GJZB 2Z0BA 4ZUWA 3CU1A 5LGHL 5T1KA 3DXAE 4Z7QF 1FBIH 4KHTH 1D9KD 4UAOC 4Z95L 1RUQH 3V9FA 4DVRL 4OGYL 1RUML 2NY7H 4WY7H 3B4NA 3QXDA 5EC1B 4AL8H 3G9VA 4QTHB 1J12A 5BJTB 4ZTOH 1QO3A 3CZJA 2WWMD 4L1DA 2FNBA 3WHXB 4NRYB 3ESVF 5FHBL 3HZKB 1FDLL 2GCYB 1A1NB 1Q38A 4NFDA 4IRSD 5DEZA 4XXCA 4MJ5A 2GY5A 3UTSA 2QSQA 3OG6B 4ZPVA 1G6RA 1TVHA 5ACZA 2A74B 4PP2B 1IFHL 5IG7A 2NY0B 5DEFA 3HI5H 5HGAA 4H1LB 3GRWL 3MODH 3U0WH 3T09A 4P5MB 1MFBL 2GAZA 3MLSL 4PRAA 1LP9B 3FRUB 2BSED 3SE4A 4DN3L 2AXGA 4MSWA 4HKZB 3SDAA 1CFSA 1S7SB 1P53A 4LSUL 3UYOD 3FN9A 3EDKA 3MJ9L 1DSFH 4JFFB 4OQTL 5FEBA 4JZOA 3PJSA 1PLGL 4L8CB 4PP1C 4S1RL 3MO1A 3VGFA 1XF2B 3IFNH 5JNYB 5GISH 2I07B 3ULSA 3DHJA 5F96H 2YN5A 3L5XH 3SJVB 2VDOL 1GZQB 4IIQA 4IRJB 5HI3C 3U2SA 4PS4H 3AFLA 3QDMD 1DJSA 4OM1L 5ICZB 5IW1B 5C07A 4Y4HB 1XFPA 5D7LA 5E2WL 4F7EA 3U0PB 3D87B 4KJPD 3UBXI 3WFDL 3NMEA 3ZLQC 2WUCL 5AD0B 5BMFH 2Y4SA 4OZIA 4XI5D 3MGAA 2B1HL 5DI8A 1BBJA 2H32B 2P5EB 1QLEL 2ICEA 5J1AA 1SY6A 5E08H 5E03A 1MCBA 1O5DT 2YUZA 4Z7NE 2VLKB 2D7TL 5F9OL 4NZUL 3A6BL 4OD3L 1TPXC 3EZ8A 4JFEB 1PG7X 5I1IL 1BJ1J 2FH8A 3MYJB 4YZFF 2AQ2A 2BY3A 2H9GB 3RUGA 5A16B 5FKPA 2R23B 3F7QA 5FDYA 4BKLB 1FN4B 4XVUC 4CKVX 5KSAC 1FZJB 4HLZH 3MV7A 1JF6A 1UJTA 2EC9T 4NC1C 3DX7A 1QEWB 3P4OB 1NFDB 4PRPE 2CDGB 3TJHC 1UA6H 5I17B 1XF3A 5T3XL 2DWEB 3QISA 3QWRA 5FOJA 4YDLB 4AM0B 1A7PH 3KR3L 2JCCE 3BE1L 1G6RL 2X9WA 3GK8L 2EE3A 3MUGA 3LS4H 2DF3A 5HY9A 1TZHB 3HNTH 1TQBB 1FYTE 4FZEH 4OZIF 3W39A 3L3JA 5I1HL 3T77A 1T04B 5CILH 3VFMB 1Z5LA 4C58B 2P5ED 5D1QB 2C3VB 3L95A 4XCFH 3S4SB 2GYSA 5GS1A 1RUPH 4UQ2A 3C8DA 3DVNB 1J5OH 1TZIB 1JGUH 4RISL 4YBQD 5CJXA 2C5DC 3WLWC 1UGNA 3VRIA 1NLDL 3HPLB 5DGRA 1XGRA 1ED3A 4M7KH 3U1SL 1LD9A 5E7FA 1AQDA 3KAAA 5TE4H 4ZS6C 4Y1AD 3LKSB 1CR9H 1H3UA 2DQCL 4L4VE 3DUUA 5BW7A 4JAMB 2V7HA 5D96B 1CT8B 2HWZH 1OT2A 3U46B 4ZOAA 4GSDL 3ZDYE 4K3EL 1P1ZA 3DGGA 1BFOA 4UTAL 5HYEA 3V5KB 3ARUA 1MJJB 5DGQA 1SY6L 1QG3A 5AZEH 1DLFH 4TRPH 4Z0XB 3RGVB 1BQLL 2FL5B 1FZOB 5C0BA 1ACZA 4KDVA 4WUUA 4ISVA 4WI4A 1DUYB 3MGTA 1Q1JL 4G80B 5TH2A 4G6FD 2MCPH 3ARDB 3MACH 5EU3B 5T1LD 5DJ8B 2PN5A 4PJ5B 5IVXB 5I75B 4XNYL 3S96A 5DFWH 1HHKB 1A7PL 2XWBB 4YC2C 3V0AC 2VC2L 5HPMB 3H9SE 4FXLA 4V2CB 3ZYIA 1HQRB 2WANA 1OP3H 4AT6A 1QR1A 5IB1A 1Q9WB 1QSFB 1JHTA 1R3KA 3DMMA 4YUEH 2DLFL 2HVJB 1JI1A 4OCXH 5BOPA 5IB2B 4DAGH 4GQ9L 3QQ3B 4HPYL 4E41E 5IEKB 5F7UA 4ZSOB 3BISA 1OM3L 1MI5B 1Z9SA 1N3NA 1YY9D 4L3EB 1FNSH 1RZJL 4JANB 1H8NA 3TEUA 5TE6L 5H94B 3NZ8A 3LD8C 4GMSH 2AEWA 1AFVL 2L4OA 3I3EA 3L7EB 2V6HA 1XF1A 1U8LB 2NX5D 3GHEL 3EO0A 4L9LB 3ZT6A 4PGDA 3Q5YA 5GZND 1YEJH 2DL2A 2JJSA 3ZDXE 3BJ91 2F58L 4NN6C 1PDKA 1RHHB 4FP8H 1G0DA 2ESVB 2VZUA 3ULVH 4K9EH 2BMKB 3HI6L 4HXBH 2UVEA 3BP7A 3CMOH 3U36A 2BVTA 5JXEA 5KVGH 1CE6A 1LO5B 2PUQT 3PGCB 3NFPA 4TOYL 5C0JA 5EIIA 5F97E 2Y06L 5GRZA 4PJCE 5EORH 5HHMB 1FAIL 1UM6H 5HJ3A 3D0VA 2AK4E 4AY0A 3BT2H 3FB7A 4G9FD 5DDHA 1XR8A 4Y2DD 1S9WB 3P9MB 5FYJH 4KZDL 3KXFA 4OB5L 1BFVH 1U8NB 5I8CB 5SX5K 2D9CA 4L3ED 4LAQL 1QHPA 4G8EA 4LF3A 2OLDA 1RU9L 1YYLH 5I30H 1DBKH 1FV1B 2NY1D 1A6AB 1WCBB 3SE3A 2FDBP 1ZS8A 4PV8A 4F7MA 3I6LE 2E6JA 3WFCH 1QSZA