1NCTA

Titin module m5, n-terminally extended, nmr
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
SKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muscle protein
molecule keywords TITIN
publication title When a module is also a domain: the role of the N terminus in the stability and the dynamics of immunoglobulin domains from titin.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 98
sequence length 98
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nctA00
2A0LC 1VEOA 1F2QA 4R7DB 1OAZH 5I17B 4ORGA 4QNPF 3RWHA 2EZ0D 3ZLQC 2A6KB 1Q0XH 2NY3D 2WIMA 2R2EB 3DUUA 3L3HB 1AC0A 5TQ0H 1OM3H 1KEGL 1SY6L 4U6YA 5D7IE 1WZMA 4ODUA 5EBWB 4PLKC 1WK0A 3SJVB 4P2YA 4DGIH 1XGYL 4DKFH 5CD5C 5DMKB 1P7QA 2DQEH 3T0EE 3CFDB 1FNFA 4M6ML 1FZJA 4X7TA 3RWJA 1L0QA 2X05A 2VLME 4S2SA 4NZUL 4BKLA 5ACMA 1PG7H 1UM4L 4HIEA 3W9DA 1MFBH 4PYHA 3ECBA 4XI5D 3S4SG 5C07A 3ARGA 1ZHNB 2RGSA 5HI4C 2VDRH 1WJ3A 1YC8A 2KKQA 4XVJL 1KCLA 3FMGH 5DEFA 1EA9C 1AQDA 1DJSA 3EFDH 2IADB 4MWFB 5D6DA 3SJVD 5B3JE 4NO3B 3OF6A 1IGJA 2YPLE 4GFTB 4RIRA 5ICXB 1K8IA 1H8SA 4UAOB 4MNHA 3CC5A 1OT1A 3MRLB 5J1AA 5EBLB 4Q9CA 4XHQA 4JVPA 5HHPB 4E41B 5HDOA 1W2KT 3I75A 3MR9A 3CLFL 5LVEA 2BSRA 5K9OA 1F4XH 4P5KB 5J9PB 2AXJA 1OT2A 1P84J 4AQ1B 5D72L 2DQUL 3I2CL 3KR3H 3DVGB 3QNYB 3FB7A 15C8H 4HW6A 3RVXC 3SKJL 2HKFL 4XP1L 4Q9QH 5D8JH 4JFDA 1IT9H 4NNXA 4QXWA 3W11C 3UO1H 1IC4L 5EBGA 4E9LA 4Z7VF 1UG9A 1DDHA 4XGZB 4JM2C 2H2PC 1HOCA 5DK0B 2OJEB 1IZJA 5E2UH 1E28A 1PD6A 2QKIB 3RPIB 1JWUA 1WIPA 3F62A 1FL6B 4UOJA 4GLRI 1RZ8B 4J4PD 4KKCD 1R5WA 1CDJA 1ZLSH 1WAAA 4KTDH 1D5IL 1MHPL 2OBGA 4QHNA 2HH0L 3QIUD 3MYZA 3LVEA 5DQDH 5JW5B 1YMMD 1ZHBB 1KXVC 5LQBL 1TJHH 1B2WL 4OZGE 3R1GH 3GJFK 4FFZH 4K94L 1UJ3B 4O2FA 5A16B 3L6FB 5ITBL 1A02N 2F9BT 2R2EA 3TZVC 3L3HA 3GSUB 1FPTL 1CGYA 1JGDB 2OLDA 4YZFF 1N5AA 2VXUH 1I1CA 3REWA 2WLYA 5DHYB 2CLRA 1A0QH 1AD9B 3CFDA 4PFEA 4QXTA 3MROA 1ORQB 4UIMA 1HQ4A 4HS8L 2ATPA 3SKNB 4ZD3H 3MNZB 5E08H 1KLGA 3MRHB 1T0NB 1UFUA 4PJAB 2A6JA 4ZPTB 2Y6SD 2ZUQB 1KXTB 3L7EB 4FQQA 4O9HL 1U8PB 3BKYL 4ODHH 5HHXL 3DURB 5IROA 2ZKHH 3VFNB 5JQHC 4QHKI 2R23A 2A9MH 1S8DB 4YXHL 1HH9B 5I8EA 5FOBB 3JWDC 1MUJB 1NMAL 2V17L 4LSTH 1J0JA 1YA5A 4Z6AT 3NZHH 3GB7B 3LS5L 4WFHD 5I8OL 3G6JF 4NO3A 2ZCLL 3JWDH 3N1GC 5CILH 3EYQC 4ZUTB 4ONFL 1ZV5A 2RB8A 3H9SB 3JUZA 1QUNA 2EEDA 2F5AL 1FHGA 1X5XA 5D9SA 3U7AA 1DEDA 3AXLA 1S9WB 3U0PB 2QQKH 4R4FL 1XMWA 4WI8A 3ZE1E 3TYGH 4KV5F 1N7MH 4K9EL 4DWHA 2I25N 3O3UN 2NYYC 3DVGA 3QNYA 1QYGH 3ZTNH 4BUHA 4R8WH 4CGTA 4O5LH 2D3VA 2Q86A 5HDQH 1OCWH 3L7FB 4OFPA 1AGDB 3REVB 4XNQB 1TITA 5TE6L 5IMMA 2Z35B 5I30L 2DQFB 4UAOC 1B0RB 1JN6B 1ZANH 2VDML 4OM0H 2I9LA 2QADB 2DQCL 2ZUXA 1NFDB 4J4PC 3OL2A 3RFZC 3MA9L 2GK0A 3I02B 1OTTD 3RWIA 3H9SD 3CIQA 1KN4H 3WSQH 1NAML 5C92A 4DTGH 3TVMA 3E6HB 3EYSH 3FFCA 3VXSA 3FQRA 4OCSH 2VWEC 2C9AA 1KG0A 4S1SH 1MCCA 5KZCB 2F8XC 4M7ZC 2Q87A 2VQTA 3GSNL 3DIFB 5HJ3B 1NC4D 4PG9A 4D9QD 2B0SL 5J57B 1A6PA 3O6LH 1UKSA 1GGTA 1NC2D 1VGEH 3FQXB 4NZRL 5FYJE 5IBLC 4F7EA 3ZHKA 2AVGA 1MFDL 3L3KB 4QHKJ 2DLEA 4R2GD 5DMJB 1CF8H 1FLRH 2I07A 5H94A 3RU8H 2R56L 3O0RL 1AD9A 2DWEA 1CGSH 1ORQA 2HRPH 1RJLA 4QHMB 4CKVX 4HUXA 2Y6SC 4N5ED 5HPOA 3TJEL 2VZUA 4HG4J 2NLJB 1LP9F 5GGSA 1I3UA 3PWJA 5AWNH 5EPMA 4LK4A 1UJ3C 4KWUA 4WTZA 4Z5RA 1JGVH 3ZTJH 4GG6A 2XZAH 4JAMB 3GJEB 3WHE0 4TPRH 4JFED 4QLRA 4GBXB 2UWEB 4O4YL 3RAJL 3SQBA 3C5SA 1FNAA 4U1IB 1SQ2N 4PS4H 4TSBH 3OPZH 4I77L 3EOBA 2NZIA 3VU2A 4KKLD 4BM7A 3V4VL 5BRZE 2ZUQC 5HSFA 2FB4H 4OZFH 4P4RA 1T5XA 4M02A 3U0PA 3SCMB 4NO0B 5I76A 5DD3L 2IFFL 3V4UL 4WTZG 8FABB 3ILQD 2D9QB 1K5NB 1HDMA 2UZYB 2D7QA 2VL5A 5DSCB 4GMSH 4K7PH 2Q6WB 4O2CA 3MUZ1 7FABH 1L7IH 3AM8C 5F7KC 1LEGA 1UEYA 1X4XA 4KRPB 1H3TA 5JPMA 2VMFA 1OTTC 2DQFA 4NKDA 5FECB 5E6IA 4OCXH 1JPFA 4TVSa 1KEML 2GKIA 1NFDA 4S0TD 4KQ3H 4CUCA 3I02A 2GFBB 5TF0A 4Z7WF 2CLVB 4FQ1L 4Z7UB 3UTZB 2NNAB 3D2UA 3E6HA 4KZDL 2FO1A 2W0FA 4NO0D 1FL5A 1P6AB 2EKJA 5LCVH 3RHWK 1OAYH 2W9LA 4QHLB 3HMXL 1G1CA 3NTCH 4C54A 1I7RA 1CFQB 2YN5A 5KSBB 5HJ3A 3LMJL 2KH2B 1U8JB 3RUGA 4L8BA 2QADC 4KRPD 1BZ7B 1PJ9A 1CI5A 4N5EC 3Q1SL 4CMMB 4TNVK 4OIIH 3VGBA 4BELD 1F02I 2A73A 4LLYB 4PJCB 1RIHL 2KUTA 1YYLL 1FRGL 1QSED 4JB9H 1PZ5B 4NQDD 1T1XA 3DSNA 4JR9L 2IBZY 1DFBH 5DRNA 3RIFF 3U4BL 3V6BR 4WHYH 4XXCA 1NCAL 2YSSA 2Z92A 4MA7H 1G1YA 3DX9B 1Y18B 1OAKL 3R0NA 1W0WB 2M26A 4XNUL 5JUEH 5MEQB 2PW2B 2O5YH 3DYOA 5CS7A 1A5FL 3ARTA 5FOJA 2CKBL 3TESA 3MRCA 4NQEA 4FQXD 1WWCA 1QKZL 3WFDH 4KU1A 3T2QA 2UWEA 1GZPB 1S7SB 2VLRE 3I9GH 2JJSA 3FQTB 3Q5TA 1R6VA 3UTSB 5F1IA 3MLRH 4WUKL 4L3ED 1AR1D 3TN0D 1D5XA 1MF2H 1VPOH 1RJZB 3L3DB 2XQYK 1CLYL 5H37H 4UOW1 3DVFA 4S1DD 1ONQA 3ILQC 5C2BH 3SDDA 5DD0L 1EHNA 3D39B 4C56E 4O02L 2VDNH 5DC9B 2OL3H 2NY0B 4OZHF 2JELL 1O0VA 4FQIH 4J3TA 1NCWH 2NY6D 5L2KA 1T0PB 5DA4A 4Z7QE 3P4NB 3GMLA 4N9GB 3V52H 4H8WL 5CBAB 5T1KD 2BNQD 3MV11 4GBXC 2Q6WA 3VXRE 4EI5D 4MVBD 2OMBA 4LCUB 2F53A 1KENL 4QYOB 1AR2A 5T1DH 3DMMB 1I3RB 4WFFD 4LLVB 2ADFH 2AJ3B 3Q6FA 2EDBA 2YBRA 3KXFE 4OZIB 3SCMC 3L3IB 4N0FA 3VXPB 3GRWA 4OQTL 4TUKH 4HG4K 5E56A 1YEGH 4WW2A 2BOBB 3OAUH 2NNAA 1KYOJ 1RZFL 2VR9A 3D39D 4DGVH 1P1ZB 2IALA 1UQSB 3S9DB 3ULVF 2MTPA 1D6VH 2ADIB 3BN3B 4WTXA 3KPSA 3T3PE 1QO3B 4KRPC 5JW3L 4U3CA 3P4MB 5H2BA 1MAKA 4D3CH 1QRNA 1C5DB 3WIFA 5IW6B 5JOPD 1I9IH 3BDBA 5TPWH 1B4RA 1ZLWK 4OAWA 1RAMA 3MJ8B 2OTUA 3NGBB 2CGRH 2VDPL 5HGHA 5MP6H 4NWTL 1PKQB 2P5WA 12E8L 2OR8A 5EUKB 4PJGF 1N0LA 1N8ZA 4LLYA 1QVOA 2OJZL 4PJCA 4G3YL 4I3SL 3WS3B 5F9JB 3AMKA 5J56B 5T5FL 3UEZA 3L5XH 3O2WH 1CS6A 1NGWA 3RX5A 4Z78A 3GJFH 3VJ6B 3V8CA 3EAKA 1S7RB 3IDNA 3QXDB 4HEPG 4HK0B 3WNKA 3N9GH 4HIHB 1NANH 5D1QD 1MCKA 5FA4B 3LEVH 5DK3A 3BDYL 3VFOA 3CH8A 4WV1A 1KFAL 5K59E 3T2NH 4YNYA 4RFEA 3ULSB 3HE6B 4NQEE 4HGKC 5KOMC 2PW2A 3EDJA 5DJ6A 1FGVH 5E00A 4Z18A 2XZQH 1NLBH 3JV4A 4QXUL 2E7LC 4Y2DA 3UPRB 5ETUB 1NKOA 4K2UH 1AR1C 1OSPH 2DBJA 4NUJB 2FX7H 4NYLA 2W9DL 1GSMA 5CZXD 3FL7A 4HPOH 3HC0A 3FQTA 4PV8A 3AAZB 5EWIL 5IP4A 4QOKA 5BVJB 4HGWA 5SWQA 3LQAC 4P2RD 3L3DA 4ZAKA 2VNCA 4KK9D 4RDQF 3WJJC 3BH8B 3SKMB 3HZYA 1RZKC 3ZKND 3B9KB 3LQAH 4OLUH 4PLNC 4XCNB 2MNUA 4P2QA 2V7NA 1BFOA 2F53E 1WGOA 2KZWA 4P48A 5FGCB 3AROA 4J23A 5FO8B 1NBYB 4JZOA 2EYRB 4H26B 5GGVY 4NKMB 3NFNA 2HJLA 4NT6B 4P3CL 1BGXH 4JFFD 4LLVA 1U8LB 1VADB 4L4TE 4OZIA 3HNVL 3L3IA 5EFIA 3ESUF 4XPGL 3O11A 4NKOB 1EEYA 5E8EB 2NY0C 4X98A 5AZ2L 2LVCA 3FQNA 5F71A 4AYFA 3HKFA 5CEYB 5FKAB 2P45B 1UQSA 3NA9H 4G7YL 2AEPL 2R0LL 1S7VB 4MAUH 3VRIB 5IHZB 4YHIB 1R0AL 5DUBB 5TJWK 1A6UH 3DMMC 3GI8L 2PTTB 2AK1H 3S35L 3EYUH 4KK5C 1CR9H 3BKCH 4ZO8A 1BFTA 4P4KD 4ZFFA 1QBBA 1RSFA 4HFWB 3L5HA 4RMWA 2DLFL 5HHOB 1E6OL 4LLDA 1RZ7H 1DP0A 1TVBA 2DDQL 4FQHA 2BC4B 3WS3A 5JA9A 5DD6B 1BD2E 3VJ6A 1ZAGA 1SEBB 3MNVA 3CNKA 2YUZA 5E4IA 1KJVB 2Y5TB 1FVDA 5GPRA 5KSUA 3QXTA 2IH1A 4UT6H 2B1AH 4ZTOL 3UJTL 1ZLVK 1FVEA 3T8XB 1KLUB 3NGBC 5CZXC 5ESVB 3FT4B 3OKNB 1FO0A 2FBOJ 1R3LA 2H2SD 3UPRA 2I5YH 5AAMA 5KVEH 3FOLA 2B2XL 1KCUH 4HWBH 2V5TA 2EDHA 3QFDB 5E1AA 3LSOB 2B4CC 4MA1B 1ORSB 5KW9L 4JPIB 4XP6L 5DYOB 4XP4H 1X7QA 2HKHL 1YEDB 3S37H 1UC6A 1XF2A 1WQVT 5EU6B 5LG1A 3VFMB 3ZKNC 4L3CB 4N0UB 1MI5A 2B4CH 2MQ3A 1KYOK 5EOCL 3VXNA 3TA3B 3C08L 1AIFB 2F19L 4NM8H 1SHMA 5IMKA 3HE6C 3TH4T 5CCKL 3GSQA 3MRMA 3MV7B 1BBDL 1QSVA 2PETA 1CICD 1DE4A 2EC9T 3MRJA 3RGHA 1NUDA 3U82B 1QR1B 3V6FA 1NBYA 5CIPB 3WFHA 4I3GA 1S5IH 4PRPB 1YUHA 4H26A 1E4WH 4N8PA 5M95B 4PIRF 5KS9F 1YN7B 3AS3A 5EZJB 4ELME 5DHVA 4U1HB 1G0XA 4Y4HD 5E95B 3MCLL 4QEGA 1TTUA 4E42B 2G60H 3B9KC 3A6OA 2DIAA 1TZHB 2WV3A 3OJ2C 4XAWL 3MX0A 5E8EA 5LJYH 3U1SH 5DDHB 3AB0B 3TYFB 4G7VL 3TA3D 1IAII 1JWSB 4S1QH 2ORBH 2OYPA 5D2LA 3BIKB 4BZ2L 1S7TA 4OFYA 5CJQH 3UZVB 5FKAA 3U7YH 5GGSY 3DLQR 4GKNA 1MCOL 1CWVA 3BZFB 2EDXA 5C08B 1J8KA 5B38B 5EO1A 2CR6A 1WFNA 3C09B 5DUBA 1HSAA 3CXHJ 5MHSD 2DQGL 4IOIB 4TRPL 4UDUA 4GW4B 3OAZK 4QRSA 4MGXA 1J05A 3QUML 4XAKD 3G6AB 1UZ8B 1X5YA 4X4XB 3QPXL 3BRGC 1MJ8H 1W72A 1MAMH 4FQCL 1BIHA 5BZWA 4OCMC 5DD6A 4DFIA 4JO4L 3DRQA 1TQCB 5IMOB 4RQQA 4JFZL 3S34L 4X6BA 2DWDB 4HF5H 3HUJA 4NBXB 4KK6C 5C08D 1H8OA 2ED7A 3RNKB 3BP6B 4LLMB 3X13A 3ULVL 3B9AA 1ZHKB 5CBEB 5JW4M 4X6CF 2EDEA 4G9FA 3LSOA 1YDPA 1AHWB 4NCC1 1YEDA 5C70A 2LTQB 5EU6A 4XWGL 3DSFH 1MFAH 4F9PA 3WHXB 1I1AB 3PP3K 1QFWI 3IDYB 5I18H 1JF1A 2R29H 4G80A 2RFXA 2Z91A 1MLBB 2D31B 4L8CA 4MXWH 3KNBA 3MV7A 5KVGL 5CMAB 4MNQB 4TNWK 5CKGA 4NBZB 1YEKH 3GHEH 4F8TA 2B1HH 3KPQA 3MOAH 2BSTA 3AY4A 2HVKA 1CFTA 3HNTL 4PJXB 4MA1C 4YHMH 1CFSA 1AD0B 2ZUUA 4P57B 3OR6B 4TULL 2QL1A 2VLKB 4WWKD 1T2QL 5FO7A 3SPVB 5KVFH 5GRXG 1MQKL 4PJEF 5HXMA 3FO0H 4AH2B 3F58L 3TA3C 2BRRH 1JV5A 5C0AE 4PBWD 3QI9B 5J6GB 2GJ6B 5JOFB 5I71B 3TNMA 3QWQB 1C1EH 3GMMB 1JGUH 1CLOH 4EDXA 3IU4L 2AQ1A 3BIKA 3UZQA 2BDNL 5DJ0A 3T0EB 5E99L 3LKPA 4CRPA 4LSPL 3KLSA 1ETZA 1U0QA 1UWGL 4K3EH 2YN3A 1IAKA 1BPVA 3QEQA 3QWOA 4NFBA 3B9VA 3D85B 5CP3A 1CQKA 3NIGF 2R9HC 1AE6L 5CIPH 3TJHD 2CJUL 2OK0H 1NEZB 5AG8A 4YQXL 5F3BB 5IB1B 3W2DH 4Q9RH 3OR7A 2VLKD 1MCRA 1RURL 1A1OB 4MDJA 2BVTA 1OPGH 4ZUUA 3SBWC 3AB0C 1NMCB 1OY3B 4XWOD 1Q38A 1A1NA 1R3JB 3VWJB 4PGEA 2GSGA 4OZ4A 3BISA 3S96A 5EU3A 4YHPB 5DJDA 2EYTA 4JKKA 2NXYB 3HUJE 3LEYL 3SKOA 1BOGB 1YY8A 5DMGD 2JJWA 3BRDA 4R7NA 3C09C 1ZLWH 4P46D 4GKOA 3T0ED 1CGWA 4P5MA 4M6NL 4JFHD 1VACB 2GUOB 1T7XA 2VLMD 1UB6B 3GMOB 2BJML 4Y4FB 5EB9A 2FX8H 1IEAA 1EGJH 2YC1B 3EYFA 1QSFD 3U6RB 1YNKH 2R1XA 3H3PL 4JPWL 1UZ6E 2ZWLT 1A4JB 4Z7VE 2EYSB 1AHWA 3GMQA 3QDGD 4MAYA 5GSRA 1TQCC 4ZDHB 3U48A 2Z0BA 1FNEB 3HZKB 1MHHA 1Z9LA 3DUHA 2NXYD 3TEUA 1LEIB 1QZ1A 1I1AA 5L7XH 3PL6D 1FG9C 2YPLD 1MREL 2Z93A 4HH9B 1JGLH 1XF5A 2M1KA 4DZBB 3PP4L 4HD9A 2E7HA 1V7ML 2HG5B 3GSXA 3IS1X 4P9ML 1FFPB 3PGFL 2FX9H 4Y8AA 3FAWA 1U93A 3IDUA 2VDKH 4GRMB 1EHAA 5I1AA 4UT7H 3SPVA 1EFXB 2LTQC 5HHNA 3S35X 3RWEA 2EDLA 1A1MB 4Y0GA 1MWAB 4WCYH 1JGEB 1TZIB 4MJ6B 5D7KE 4OZGB 4MMXC 3JVGA 4OCNC 1IGMH 4U1SB 3IDYC 5L88L 3PWUB 2QQQA 1LO4L 4G8GD 5KSAA 1SYVA 5LBSL 4P3WA 1AXTL 4PRHB 3RDTA 5E2TL 1WEJH 1QEWB 4AIZB 4F37F 3FO9B 3QP3A 2YEZA 3TJHC 2GT9A 3EJYD 3DX6B 2R0KH 1JYNA 1GC1C 3QEGH 1A7OL 1ITBB 2PN5A 5DJ8B 1I8KA 5HYQB 3O2DA 1HHGB 4YHKH 2P8MA 3QFJB 3VW3L 4QF1A 3MXVH 3KDMB 4HBQA 1FZMB 1HINL 3QI9C 5DJAB 3BP4A 3G6JE 5F1KC 5I71C 3FFDB 3MBEB 5DMGC 2YD9A 4XVTL 5DEZA 1R3JA 1S9YA 5BMFL 4PG2A 4B0MM 4RMUA 4WI3A 1MFEH 3T0EC 5D71L 2VLJE 4I8DA 4U7KA 1FG2A 5F9AC 3GNMH 2D7TH 3DXAE 2VXVH 3VXME 3NAAL 1UYWH 4D9RD 1YEIL 1XF1A 2VAAA 4B7IA 2HT3D 3WL9B 4HUVB 4NZTH 4DZ8A 1CVSC 5GRJL 1S7XB 4LCIH 3U4AA 5C07D 3ARGD 4FFVD 4F7TB 2CRMA 5K9QG 3QDME 4XNXH 1NMCC 5HGAB 3OX8A 3VWJC 1ZK9A 4NC1E 1IE5A 5IKCA 1Q0YH 1J86A 4JDZB 2EIZB 1AGFA 2NXYC 2EYSA 3R8QA 3UPCA 3I3BA 4HEME 3MBED 1I75A 1T3FA 2P5EA 3OF6D 4M8VA 1U95B 4OCYL 3OG6B 3UJJL 5I9QB 1ZLVH 1H5BB 3B9EA 5DK2A 3TO4B 4YXLL 3WIIL 1LEIA 3WNLA 4DUWA 3PWPE 1J0IA 4LSRL 3U0TA 1M05B 4Y4FC 2C3VA 3M17B 3NA4A 2V7HB 3WE6A 2ZUVA 2PXYA 5JNYB 1UCBL 4YBLB 4JO2H 3T09A 5MENA 1XGQA 2VR4A 4BQCA 1OAXL 5F21B 2ZJSH 3ARDA 4HV8B 1EJ6A 3VA2C 3NZ8B 1TJIH 3TCLA 2OR9L 3CFEB 4WEMB 5FB8B 2VITA 4HT1L 4M3JA 2R0WH 3WFCH 1MHEA 2X42A 1JTPA 2ESVA 1QFHA 3PWUA 4J6RH 3IDJB 3VMNA 4P5TA 5ALBH 3EJYC 5D7LA 1I1RA 1UM6L 3TO4D 4HH8A 1BVLB 4LLAA 3B3IA 3MRRB 4PRHA 1LP9E 1ZTXL 3BE1L 4YXKH 3RP1A 5IEHB 4IRZL 2YKLL 2X4QA 1OB1B 1QR4A 3KPNA 2R1WA 1DL7L 1N3NB 4BFGA 1AQKH 5DRXB 5ALCH 4XB8A 4BK5A 3VGEA 1ADQA 1WBYA 4DOHE 1WWWX 3JUYA 4DCQB 5HYQA 1V3KA 2AABH 4KQ4H 4HUWB 2GHWB 3S97C 1KGCE 4YE4H 1QLRB 4AM0B 1MWAH 1OQXA 1UA6H 2B39A 3SGDI 4M5ZL 5CGYC 4D0CA 4X7SH 3TIEB 1QFOA 1JZ2A 2CUHA 4WHTB 2FEEL 1J1PH 3H9HA 4HIJB 4LSQL 4WI2A 1F2XK 5L0QC 3IB4A 3BPCB 2HT3C 4MZ2A 4LNRB 4J3WA 4MDIB 3OAZH 3GO1H 3MV8E 4NNYB 3EBAA 3T0VA 2ZCKL 4PRIA 4HUVA 4LF3A 2XRAH 4QT5B 4LU5H 1SYSA 1PLGH 3I6GB 4R90L 3JWOC 3VH8B 2E5EA 3MBEC 2P5EE 3JXAA 1JFQL 5F96H 4YFEA 3OTTA 3JWOH 4WENB 1TJGL 4OFDA 1RJYB 2BY1A 3BVNB 1AP2B 2C1PB 3KWWB 4B41A 3QPQC 3RZWA 1PQZA 3PDGA 1RMFL 1PG7W 3LKRB 3VGHA 2AXFB 1J8HB 4RGNE 4Z7WE 4UU9A 3VWKB 1R5VA 1U8OA 4WFGE 5B8CA 5FGRA 4EN3B 1HNGA 4OCWH 5DC0A 4JY5L 1A7QL 1JIBA 1VSCA 2F54E 2UUDK 4Q2ZA 1ZA6B 3I6KA 3MLXH 2NY2B 3BGMB 5BRZD 1WCBA 1QHOA 5GZNC 1C5BL 2GW5A 4NFCA 5EOQL 3ARWA 1HHKA 2XFXA 5A2KH 5CEZL 4B53A 4JLRA 3PP3H 3QIBB 4Z7OF 4HV8A 2XWTA 1OAZL 1KJ2A 4H1LA 4CW1A 1VERA 3MFGB 4GAYA 3RI5K 4NQTA 1LNUA 2XA3A 4QKXB 4PP2A 1Z2KA 1Q0XL 2DS4A 1H5BC 3TO4C 5TQ0L 1EXUA 4OLYH 4X80H 3U9PH 1F3RB 1OM3L 4GS7B 1WTLA 1KB5B 5I2IB 2WBJA 4HZLB 4N0RA 4DGIL 4DKFL 5I15H 5IK3B 4PJDA 3OJVC 2DQEL 4EQ3A 4EN3D 4M6OH 3TVMD 3VXSD 4YBLC 1JZ8A 3D0VB 3EO9H 5HYJA 2ATKA 1AGCB 2VAJA 4UI2A 2IPUK 1PG7L 1F42A 5C0JA 3UBXA 1JK8B 3FB5A 1QQDA 2RJMA 1MFBL 1B0WA 1FQ9C 1CGVA 2P1YA 3SE8L 4HKJB 4XZUA 3VFVB 4F33B 1FNSH 4HUWA 4PJBF 3VFSB 5KOVC 4H1LG 4GRLA 2VDRL 3UTPE 2DQTH 4AM0A 2LAGB 5D2NA 3DX7A 3W9EA 2BCKB 4ZODA 4DN3H 5J1SC 4I0PA 3EFDL 4KVNH 1MJJB 1UXWB 1U8NB 3GI9H 2VLRB 4ENED 2R2BB 1CD1B 4ZPVA 4NNYA 2ICEB 5ITFA 3CSBA 1T1WA 1ZXQA 1G7IB 5LGJB 3JTTB 3O3BA 5E70A 1MCPH 3GK8H 1H3XA 3UBXG 4UT9H 3FKUS 2NW2A 3W39B 5EORH 5ID1A 4ODBD 1F4XL 1IGFH 4C56B 4K3JH 3VXOB 4JRXB 2AEQH 1IGCH 2J7LA 3QCUH 3KR3L 4I5BB 1JZ6A 4TOYH 2IF7A 4ZFOL 15C8L 4ERSH 2F74B 4RMTA 4Q9QL 5D8JL 1RJYA 4GUPA 3VXRB 2C1PA 1IT9L 1QACA 2NZ9D 4HKBB 1I1FB 3UO1L 3VE0A 1WFUA 5E2UL 1JTOA 1XIWA 3QBTB 3FTGB 4FG6C 2UV3A 5H35A 3ULVE 4KGJA 3PWNB 3DETC 3NFSH 3W82A 1ZLSL 1PVHA 4KTDL 4C56D 4J1UB 2OTPA 3LCYA 2BVQA 3BQUA 5INCB 3QIBA 5DQDL 1BHGA 5GRYA 3MZGB 5C0BA 1TJHL 1UH4A 1U42A 2RIKA 3R1GL 2WUCH 4JGJA 4GKZB 4Z0XB 4PJGE 1NPUA 3NCCB 3VWKC 1HI6A 1BZ9B 5E6ID 4NHUB 3VXRD 4EN3C 3FRUB 2VXUL 3RVWD 5I2IA 3OAYK 1OP3K 4IDLA 1A0QL 4PJ5B 5GIRB 3IFNH 4JPKH 3U2SA 2NY2C 4GRWB 3AREB 2N7AA 1U9KA 3KXFD 1GH7A 3ZYZA 1ZGLA 4ZD3L 3CK0H 1DEEA 5E08L 1MY5A 1T83A 2X4OB 3K4ZA 3UTTA 2ZSVB 3OXRB 4KHTH 3MGTA 4X5XA 1J87A 4DFHA 4UOW0 5F88A 1U58B 5C0NC 4Y89A 4ODHL 1L9NA 3BUYB 4LAQH 1X6LA 2ZKHL 5CAYB 4D0DA 1J5OH 3NCYS 2A9ML 4XRCB 4EVNA 3FN0H 1NUFA 4F7CA 1BQHB 3WNPA 3E1F1 4LSTL 4ENEC 1INQB 3NZHL 4D2NA 1FJ1A 3EGSB 4UZGA 4XPFL 4PTUA 4PY8I 3JWDL 5EU4B 2QQLH 5CILL 4J2XA 1JL8A 4LPXA 1NUNB 3FN3A 2DMKA 3SHSA 5C0CB 3BKMH 1K4CB 1YNTA 1RY7B 3NMEA 2J6EH 2QQKL 4G8IA 1N59A 3DHJA 4FMKA 2WAHA 3TYGL 1KPRB 2ZNXA 1N7ML 2JK5B 5JO5B 3HLAA 4MQ7B 1MCHA 1JHTA 2A74B 1S7UA 4YPGB 3G5VA 4JHWH 1QYGL 3NCMA 1S78D 1HH6A 3ZTNL 4R8WL 4NQED 4O5LL 4HAFA 3VA6A 5HHME 2NTFB 3SY0A 5HDQL 1JNJA 1OCWL 2NX5E 2EH8H 3L5WA 3ULUD 1P9MC 3TIDB 4BFBD 2FCBA 3DVIA 1ZANL 4OM0L 2VZ1A 3MCG1 2HTKD 4FXKA 3FQUB 3E6FB 4RSVA 2XOTA 5JMOC 4RMVA 4UUJB 1IZKA 4L4TB 1KN4L 3WSQL 4ZFZB 4NO5B 1XGTB 4DTGL 5GZOC 2EE3A 2NW3B 5BOPA 3EYSL 3GZKA 4LVHB 1QRKA 3DPBA 3CVHB 5L2KD 2HVJA 4KKAD 4LVOB 4OCSL 1BOYA 5IF0B 2N56A 4JQXC 5CP7B 1AO7E 1T5WB 4S1SL 2LE9A 5F1NA 4IMLA 5INCA 2F53D 3RVWC 4ODWA 3STZA 1T2XA 4P0DA 4K07A 1MELA 1U8MA 3O6LL 1VGEL 2BVYA 3MRPA 5J6HA 1Q94B 4BZYA 2C4FT 1CF8L 1C7SA 1FLRL 2BK8A 4UMGA 4R3SA 3BEVA 1IBGH 3RU8L 4XBPA 3LEXB 1CGSL 1MH5A 2HRPL 1OOAA 5FV1L 3L3OA 4L4TD 1JHLH 3BIBX 1AH1A 3FT3B 3MJ6A 3WFEH 3WLWC 5F8RC 1BD2B 4PJHB 5CLTA 5AWNL 4WU5B 4IDJH 4UV4H 5C2UB 2SEBB 4U0RB 3EDDA 5DQ9B 1V5JA 5TGBA 5DO2C 2HFGH 2HLAB 4X6DA 1KTLB 1ZWIA 1JGVL 5F6IB 3GUTA 2XZAL 4XRCA 3LHPH 1A4KB 4NM4L 4TPRL 1SVCP 2VXTH 3HG1E 5TDOA 3BGAA 3RVTD 3TWCH 3AREC 1DVFA 4JEGB 2UYLB 1H8NA 3BZDA 4ODVH 3T4AA 2VQ1A 1I8MB 4TSBL 4PS4L 3OPZL 3ZKMD 4F3FB 2IPKB 4P23A 1IKNC 3SGKC 2OZ4H 2FB4L 2FWOA 3OV6A 4PY7B 1NGYA 3U36A 1BD2D 2R15A 3T2OA 3KS0H 2JK5A 1E4JA 3O45B 4MQ7A 5GJSH 4OLXH 4AEHH 2CR3A 5A2IH 5CJBA 4Y2DD 4GMTH 5KS9E 5FUZH 4WGWB 3BP5B 3U9UA 1XF3A 4GMSL 4K7PL 7FABL 1L7IL 4LCCB 1BQHG 2HTKC 2DBLH 3ULUH 4TVPE 4WI5A 2XWJA 1VEPA 1RK0A 4OCXL 5SX4I 4YHNA 2EDWA 1EZVX 4KQ3L 2Q8BH 4ELMB 2VN4A 2Y06H 1M6OA 3LN5A 4MHHI 1VDGA 4W4OC 4HUNB 2QHLA 1ZT4A 4YBQD 3B9DA 1UH3A 3RJDA 1MVFA 3PHOB 3DECA 4LARH 5HHQA 1OF2A 5IM7B 3CUPA 1ES0A 3WCYA 1PG7X 5LCVL 1OAYL 5IW3A 3VXQB 4JKPH 3GMPA 3NTCL 1B6UA 1FYTE 1CFVH 1X5IA 1A3RH 4ZNEE 5ABDE 2A6DA 5DVMA 2UUDH 1CK0H 2E9WA 4XNMB 2WWKT 2VRAA 1GVIA 3WV0A 1E4XH 1A14H 4K3DH 3QB7C 3MUHL 4OKDA 1OW0A 3UYOD 1NAMB 4IJ3B 4OIBA 4OIIL 3PG2A 3E2HB 3C5ZB 3KYMA 1D9KB 1JNNH 3HE7B 4JFXB 5DFTA 5BS0E 4LVHC 1IAIM 2D7PA 4JB9L 1IVLA 3H9ZA 4FXGB 1N2RA 2ADJB 1DFBL 4LVOC 2W60A 2R4RH 3FT3A 1TETH 4XT1C 2R2CA 4MA7L 3CVHH 4N8VA 4LLQB 5HGDB 4MD4B 1X5LA 2X1XR 1N6QH 4RWHA 2QJDA 2VE6B 3QULA 43CAB 5JUEL 3FQWB 4MCYA 1DBKH 2O5YL 3OKKA 4HS6A 3IJSA 4BSVB 1SJVA 3NFPA 5E5RB 3CZFB 4XVSH 3ZKMC 3WFDL 5F6HI 35C8H 2M8XA 2A9NH 3NH7H 4LKXA 5ERWB 4JY4B 3I9GL 3O6MH 1NGXA 4KJYB 5ENWA 1T04B 5C0IB 3QAZB 2ARJA 1ZMYA 3QNZB 3MLRL 3G6DH 4C59B 3C5ZD 3K2UH 1MF2L 2F8VA 1VPOL 4EBQH 3VFUB 4K94C 5EC2A 4U0RC 4X4MA 1ACYH 4YK4B 5C2BL 3WN5A 5GRZA 3CH1B 4N8VG 2OSLA 4R4BB 2VDNL 2OL3L 2HWZH 3IDIA 3N1MC 3G5ZB 4FQIL 1T89C 2BMKA 1NCWL 4MNGB 4LSVH 2ITDB 4O58H 1CYGA 3V52L 1DSFH 5E9DE 1TCRA 5EUOF 4PJEE 5TH2A 2R8SH 5D70H 3MUGB 3QUYD 5T1DL 4O51A 1NGPH 1KCRH 5JDSB 5IB2B 4KDVA 1M7IA 4YBQC 3JTSA 2ADFL 3KPLB 2H9GB 1V8HA 2XY2A 2APBA 3WJLA 1QFWM 1U3ZA 4TUKL 5C0AB 1G9EA 4MA3B 2GJZB 1YEGL 1CD8A 3OAUL 5BXFB 2Y7QA 5D6CB 5FF6B 2Z8SA 5I19H 4DGVL 3RZCA 1BFSA 3NIGE 1V3LA 3W0WE 3RX8A 4KMTH 3HMWH 4F8QA 4QRRA 1D6VL 4LCCC 2YD3A 3O3DB 5C0FA 1VFBA 4WU7B 3QUZB 1JYVA 2ZG2A 2YD8A 2DRUA 5I1IH 4D3CL 3DBXB 4CNIB 3F6IA 1I9IL 5TPWL 5JZ7C 3EUUA 2CGRL 4JRYA 4XBGB 5MP6L 3OJDB 3QCTH 5F9DC 4L4VE 5T1MB 4K9EC 3QYCA 4ODTH 5LWYH 2OQJB 1FZOB 5F6HJ 3L5XL 3O2WL 5F7DA 3UAJD 3MRKA 4OUUB 4OFYD 5C0AD 4YDJA 4GXVH 1MCIA 3N9GL 3GSNA 3LEVL 2IQ9H 1BP3B 5SWZE 3I84A 3OAYH 1LK2B 4Y5YB 1OP3H 5JMRA 3T2NL 1VFAB 5TQ2H 5T3ZE 2D4FA 1FGVL 1J0ZA 2XWBB 2XZQL 3MRFB 1NLBL 2AP2A 3EHBD 4IJ3C 3OKDA 3Q48A 2MCG1 3E2HC 3C5ZC 1D9KC 4K2UL 3HE7C 1OSPL 2P8LA 2FX7L 3PNWB 1BIIA 4HPOL 4KJYA 1T04A 4X4ME 2PKDA 4UIKH 1SJXA 1GZQB 2OCFD 4Z7VB 1CN4A 2R2HB 1CBVH 2VIRB 1C12A 1LDSA 1E27B 5C09E 2IEPA 3LQAL 4OLUL 5H8DA 1SJHB 4M7KH 1FO0H 2CO6B 2I26N 2EE9A 3LY6A 3D0LA 4WUUA 3QUYC 1JJUA 5MERA 3V7MA 4PJ9A 4X6FA 3T65A 3CFIC 3IJYA 1WZ1H 3MFFA 2F15A 3QAZC 3V6OA 1EO5A 2B5IC 1XCTA 1DUYB 3T4YA 1HILA 1XGRA 4DKEH 1BGXL 3M8OH 2UVFA 3D18A 3QNXB 4KK8D 5IFAH 4XPAH 4ZYKB 5I8CA 3WDIA 1ZT1A 4YK4C 1AGBB 2EE6A 1JF6A 1OLZA 4QRRE 4ZUSB 3RPKA 2NCMA 2G9HA 4JFYB 1BFVH 1FE8H 3NA9L 3TNNB 1JVKA 4D8PA 4IRSB 4MAUL 3VFWB 3QUZA 2LU3A 4IS6A 2NR6D 1A6UL 1C08A 4BH7B 2AK1L 3PXJA 2YMXH 3EYUL 3U83A 1A6AA 3RIFK 2APTA 1CR9L 2DI9A 3BKCL 5DHVH 4ODSH 1DQQA 2YZ8A 1RZ7L 4M3KB 5I16A 5I1HH 5C9JB 1KIRA 5IG7A 4R97B 3P9MA 4ZUWA 5D7KD 3VFRA 3V5DA 4DUVA 1MPAH 4OUUA 3SGEI 5D5MA 3RTQB 2BOCA 3HMXA 2VLJB 3MRBA 4MQXD 2QR0A 4BFIB 3QEQD 4P2OA 2UY6A 5SWSA 3DXAB 3EHBC 3VXMB 4RAUA 4IRSD 3DRTA 4UT6L 2B1AL 5GGRA 3ILPA 2ZUSA 3QUXB 5ISZE 3QXWA 3LN9A 2XWBA 3NOIA 2XKSA 1LQSR 1RUQH 3M07A 5EZLB 1OHQA 2I5YL 4U7SA 1HXYA 3KYNA 3TFKC 5KVEL 1KCUL 4HWBL 3QDMB 4K7PX 4XHJD 4YGVB 4D94A 2MSPA 4LDLB 2IAMA 1BWWA 3KG5A 4H5SB 3V5KB 4XP4L 2JCCA 3EIFA 1GZQA 3S37L 1QBMH 2YUVA 4P3DB 3K4AA 4U6HB 4X99A 3PIQA 5D1ZB 1MRFH 4PRBA 3KJ6H 2B4CL 2EIDA 4Y5YC 4NM8L 2HLFD 4WUUE 2AGJH 3SN6N 4XNZC 4YX2H 3PWPB 4LVNB 4V1DA 1E4KA 4L29B 3BPNB 5DZNA 3DXAD 3VXMD 2CKBA 4G43A 3QUXD 2FBJH 4QRPA 3OB0K 5IEKB 1S5IL 2YD6A 3KYKH 1E4WL 5EU5B 3QT2A 3O9WB 1FVCB 3CFKB 3QDMD 3MLPA 4MAYD 4G6FD 5IVXA 1LDPH 1ZVYA 4R0LA 2G60L 5F97E 5D1ZD 3RKPA 1HCVA 4W6YB 3IDMA 2IWGA 5FK9A 1B0GB 3U1SL 4QWWD 1DANT 1MCDA 4S1QL 3B5GA 2ORBL 5CD3A 5CJQL 2NR6C 4DQOH 3U7YL 1LP9B 4X7DC 1PYWB 4X8JB 5KANG 1OQOA 3IDGB 2BSSA 3CX5J 1TFHA 1I9RH 1NBVH 1DTUA 4L9LA 4OKVB 2EXYC 3D6GA 3G5YA 3IXAB 1MHCA 3RL1B 4DOHB 4HWNA 2ICCA 2PW1B 3C8KA 2DJ4A 5B3JF 3FOMA 1P4IH 1JMXA 5ILTH 1MJ8L 3GMNB 1OAQH 4M5YH 5DTFA 5KSAD 3MPCA 1QLFA 1MAML 6FABH 3RDTD 2WIIA 1A6WH 4PGCB 2FEEI 4HKXB 2JJTC 1YMME 3FT2A 3S6CA 3EYOB 2EO1A 4IRSC 3IETB 4WW1B 3HR5A 1Q9LA 4HJJH 2C3GA 2HMIC 1JI1A 5CP3H 3X3FH 5B4MD 2VDOH 4NOFA 4HF5L 4MX7B 1P53A 1Q9KA 3L3JB 3MV8B 1M7XA 5E24E 5HGBA 5HYSB 1JZ5A 5DD5H 1ERNA 4G8FB 2QSCH 2E7MA 4I4WB 1X3DA 4PGDB 1YPZA 4Y19A 3BAEH 1U8QA 4R97C 4PJIA 2BVPB 5I1EH 1PBYA 3CFCH 4J3SA 4U6XB 5IT2H 2P48B 1KGCD 4H5SA 3HB3D 2AV1A 4RNRA 3IXTB 4J3OC 3RTQC 2HLFC 3D25A 1DR9A 1FZKA 3DSFL 5I66A 3S3SA 1MFAL 3FB8A 3G08B 5DUPH 4Z7WB 5BO1H 4QO1A 4RGNB 2MQCA 5I18L 2R29L 3QHZH 5CEXB 3QUXC 1P7KB 4MXWL 1ZKAA 4Z95H 4OV5A 2BFVH 3QUKB 2F54B 2FRGP 2PO6A 1ZT7A 3V7AG 32C2B 3O4LA 1YEKL 3GHEL 2B1HL 4Z7OE 4J12A 3F12B 3MOAL 3H3BC 3I6LD 5T1LA 5K9KB 3MC0A 3MCKB 4YHML 3S4SA 3CJJA 4JZJA 1XGPB 3SGJA 3O9WA 4FN0A 5KVFL 1FVCA 5D1ZC 1INEH 2P5ED 4QRTA 4Q9BA 4X5WB 3FO0L 4PJFF 4RAVB 2BRRL 2J8UA 3SO5A 5DRZB 5FDYA 1YEEH 2C4FU 1U8HA 4QTHA 1C1EL 4LVNC 2PYEB 3BPNC 1JGUL 4AZ8A 1CLOL 4RGND 5B39B 5KJRH 1JHKH 2PXYD 5CZVH 2FZ3A 5D7SH 2W91A 3FO2A 2F54D 2P24B 4K3EL 4YR6A 4PJBE 1L6XA 1NDMA 4G6JH 4MB5A 4KJQD 4L8DB 1X4ZA 3RL1A 1KT2A 3CPLA 2OK0L 5FYKU 1TTFA 1T20A 3UTQA 3W2DL 3KPMA 4Q9RL 2VXSH 3HHRB 1NDGA 4PRDA 5KAQG 4JY6B 4F2MB 1OPGL 2ESVD 4C55A 5D7LD 1MCBA 5B4MC 1R3KB 4PRAA 1MCQA 5AD0A 3VCLA 4TSAH 3V7AE 4PJ8A 4ZOAA 1U3HA 3RWDB 4LMQI 4PB9H 1NCCH 1MJ7H 3OSKA 3DX8A 4Y5VB 1TDQA 3C60B 1LE9A 3BJLA 4OZHB 3ELAT 3O2DH 3QUMB 5IJKC 1JNHB 2FX8L 5ESAA 5FAAA 2APWA 4TNWF 1EGJL 4DK3A 3K81A 2FR4A 2VC2H 3PV6B 3MRGA 1YNKL 4WDIB 1NJ9B 5T5NG 2ZUWA 4J8RA 4WFEE 3BT2H 3UTPD 2BVOA 3NCJH 2BHYA 4M1CC 4HLJA 1DUZB 3RWGA 1S5HA 1WAAF 4LHJB 4KKBC 3RL2A 5D7JB 4G7YH 4PJ7A 5LKNA 4K71B 5ADPH 3VXUE 5L7XL 3HZVA 2XYCA 4AEEA 1CGXA 2PCPB 1EEZB 1JGLL 3MYJB 4PRID 4IIQA 5KN5B 3MOQA 2X1QA 3ESVF 4JO3H 5JR1H 4FQPA 4QTIH 1CIDA 4MB4A 5ACZB 1BQUA 2FX9L 3RY6C 4TUJA 1YJDC 2C1OB 2VDKL 3PWLB 3H9YA 3PJSA 3X14B 1MCJA 2HTLD 4L4JA 1IM9A 2K3TA 4UT7L 1WZKA 1YJDH 5IOPB 4UQ3B 3R8BB 4XMPH 4WCYL 3AS1A 1CE6A 4LKCA 4ZSOE 5KG9A 2HFFA 3KPPA 5IGXH 1IGML 4RGNC 4PJGB 3U30B 4HJ0D 3QDJB 2PYEA 1WEJL 3JBG7 3QEHA 4C83B 5I0DA 1VHPA 2VN7A 4H88H 2FSEA 4NFDA 1Q9WA 2R0KL 3QEGL 1OD7A 2V2XB 3SKUD 1RPQA 3AC0A 4YHKL 4EI6A 1FV1B 3O41B 1WBXB 4NJ9H 3MXVL 3LKQA 4LPUA 1P2CA 1AFVH 2GQHA 4MLIA 2CDEA 4RX4D 5AUMA 2F8OA 3F7QA 3GSWB 2J8HA 3CMOH 5DXWA 1MFEL 4XH2B 5JXEA 2C7UA 2FH8A 5IVOA 5HYJD 1JMZA 4R96A 3GNML 2D7TL 2VXVL 4L8SA 5GS3A 1UYWL 4WI9A 3ZSTA 1T4KB 5I6XB 2Q1EA 5JHDA 4I0KA 2W38A 4NZTL 4RZCB 4LCIL 4U3XA 5D96B 5FHBH 1NCDH 3WYRA 1I7UB 1WLHA 3NPZB 4GRLD 2DKSA 2LV4A 1QSEE 2YPKA 4NQDE 4XNXL 1IQDA 4YJZL 4LLUA 3PV6A 3HAEA 2XIDA 4CAGA 3AS0A 1HWGB 1Q0YL 3TLRA 3TP4A 4L1DA 2DJUA 4I0PD 4Z76B 3C6LB 1LE5B 5HHMB 1CDUA 4WJ5B 2X4PB 3F7YB 5A43C 3WUWB 5E7BA 2NX5B 3BO8B 1IM3B 1MCOH 2BRQA 2GAZA 4Y5VC 3K1KC 1KJ3H 2H6PB 1MLCB 2CD0A 2FL5B 3C60C 1K2DB 1IL1A 3GSOB 3SDXA 1K8DB 2XN9A 3BD4A 2AJYH 3HC3H 5HHVH 3QQ3A 4JO2L 4K55A 3D69B 3TBSA 4L3EE 3PWLA 1I7TB 3HAEG 1XR8A 2ZJSL 1AO7B 3GBNH 1W0VA 5K9JH 1TJIL 4IEFB 1JP5A 5D7JC 3KYOA 2R0WL 2VISA 4K71C 5HHMD 3WFCL 5M7QA 5FFLA 5D1XA 4J6RL 2NX5D 1WC7B 3QDJA 3G5XB 3NACH 5ALBL 1XIWD 5EOTB 1NFIB 3OB0H 3HPLB 1IC5H 3D3VA 1LK3H 3DGGB 1NFKA 3NVQA 4EOWH 3ULVC 4GG6F 3VFPB 4YXKL 3FN9A 3MMEA 1P4LB 5JPNB 3PGCB 1AQKL 5GHWH 4WFFE 3I3DA 4YHLH 4M61B 5ALCL 1JRHH 4KRLB 5GGRY 3BQUD 3SDAA 1A9BB 4M8QB 1KJ2H 4H1LH 3PWVA 2AABL 4KQ4L 5C0BD 3VI3F 2DM3A 2XKNA 3PV7A 4YE4L 3WLBA 5KSVA 3U30C 2H26B 2WK2A 1MWAL 1H15B 4MXQD 1UA6L 4KDTA 2O61A 4X9BA 4HXBH 4PV9A 4LCWA 2JB5H 4X7SL 2IGFH 2X4SA 3HG1B 2KL6A 1J1PL 1WCQA 5JHDE 1AXSB 1CL7L 1RULH 3GMRB 3QWRA 3R06B 5IB3B 3GO1L 1NCUA 2J5LB 1MJUH 5JOPE 1DCLA 2PTUA 5T33H 4FTVB 2GTZB 5C8JB 2XRAL 2WP3O 2X4NB 3GBLA 2IANE 4G8EA 4LU5L 5IQ7H 1KNOB 1PLGL 1TXKA 3MODH 2QHRH 5EIIB 1NFDF 1Y6KR 4MJIB 4GO6B 5IFJB 5F96L 1K6QH 3CDYA 4ACPA 4NOBA 3JWOL 4LEXH 4KI1A 1LO5B 3ARYA 1Q9OA 4APQB 3LH2H 3LKOB 2W65A 3WUWA 3F5WB 4AQOA 3HG1D 5DI8B 1P69B 5I6XC 1RZGB 3OKOB 1MLCA 2FL5A 5TDPB 4OCWL 1YC7A 2ICWJ 3G04B 3IF1A 5FYJU 2CXKA 3PGDA 3QH3A 4JDTH 2MCPH 5D96C 3RUGF 1IRAY 1E6JH 3MLXL 2J4WH 3D87B 4U1LA 2EXWC 4ZNCD 2FIKB 5FYLE 5LXGH 2O93L 3CSYA 4UNTA 3SDCB 1ZVSB 5ICYB 3EOTH 4P2RE 3C6LC 3TT1H 3IDXH 5IR1B 2YS4A 1GHFH 3IJHA 1RVFH 4LLWB 1FYTB 4NQCE 1ZHLB 3K46A 4OLYL 4X80L 4HHAA 3U9PL 1JPGA 1F11A 5FGBC 4GW5B 4JFPA 3WUWG 1KF9B 5DEGB 1HN1A 1G9NL 5EOTA 1SVZA 5I15L 2WW8A 4GW1A 4TVPD 4WY7H 4NCDA 1P5UA 3WS6C 3MOBH 4M6OL 4KROB 3HZMA 2BVUA 3EO9L 5BS0B 4O2EA 2DI7A 5GS1B 4ZOBA 3ZE2F 1G7PA 1WVZA 2UWEF 4MMZC 3ULUF 2Q7YB 3GIVA 4LPTA 1FNSL 3MV9A 3DO7A 1YY9C 2DQTL 3MLZH 4EXKA 2DLHA 1WISA 3BESR 4NGHH 2GCYB 3LAFA 4J3XA 4NPYB 2JIXB 4X6CB 4DN3L 3FB6B 3KPRA 1N64H 4HLZG 4KVNL 1Z3GH 1G7JA 4WO4B 1AXSA 3GI9L 5BW7A 3V0VA 2ED8A 3GHBH 3OXSB 3NN8B 2ZOKA 1M71B 4LIQE 4FP8H 5BS0D 4G6KH 3LKNB 1H3VA 4P9HH 1MCPL 2B7DT 3GK8L 4D0BB 3T0DA 4UT9L 5EORL 2X4NA 5GRWA 1A9EB 1IGFL 4NC2B 5EUOE 1HHIA 4K3JL 2AEQL 1IGCL 3MREB 3QCUL 3DV4A 4MJIA 4IRJB 4TOYL 5IFJA 1U8IB 2IQAA 1C8PA 4ERSL 2A77L 4WW2F 5E9DB 3T0AA 4APQA 1ZS8B 4CU6A 2GITB 4PJEB 4B50A 5BQ7A 2J5LC 2OTWB 3MJ7B 4Y1AA 3VD4A 3K8KA 9CGTA 4WO4D 5CSZB 4CVZB 4R9HA 5TDPA 1LD9B 5FKPB 4LQFH 1JWMA 3G04A 4TQEH 2H32B 3PABB 3MGOB 1XH3A 1D3CA 1HHJA 3NFSL 2JF1A 3SDCA 2DYPB 1ZVSA 3OKEA 3QG6B 1RUMH 1EAJA 3ET9F 5ICYA 4PJCF 3QRGH 5IR1A 5SV3A 2WUCL 4XCYB 3U4EB 4LLWA 3ARBA 1BX2A 1T21A 2JB6A 1FFQA 1UADC 4YFLI 4ZXBA 1JPTH 1V3MA 1K85A 1CDYA 5C7XH 5DQJA 3QEUB 1IAOB 2FNBA 2G5RA 3IFNL 4JPKL 4TVPH 4BSJA 1LEKB 4G6MH 5FGSA 4L4VB 5ESQA 4LRIC 1Y0LA 4OJFH 1XF4B 1I8IA 4V2CB 3CK0L 3LQZB 5TFSH 1URLA 4JJ5B 3TBYB 1H0DB 1NANI 4KHTL 1J12A 1OGAE 2Y23A 2QSQA 3FONB 3N06B 4X0KA 3O6FB 2DYPD 2VSDA 3BDXA 3JZ7A 3OQ3B 3W0WD 5DJYA 4RISH 5EC1A 1CVRA 4LAQL 2ITCA 4U0QB 1J5OL 4FZ8H 4FFYH 1DQTA 3FN0L 2DQHH 4Y88A 2YA0A 2GCYA 3CFBB 1KIUA 2JIXA 4FRWA 4G9DA 5LAXA 1UVQA 2XNAA 4PR5A 1RHHA 4KROC 3UC0H 1U92B 2W0KA 5B21A 5IWLA 1CTNA 4N68A 2QQLL 5GS1C 1RZIB 3T1FA 5MHSE 4AIXA 2XPGB 2Q76B 4EEEA 4G42A 2Z31B 3NN8A 4L4VD 4XXDB 1LO3H 1MVUA 1YMHB 4RMRA 3BKML 4XAKE 4JM4H 3EOAA 3X12A 3IGAA 5HY9B 2V5RA 3V95A 2J6EL 3QQ4A 3HA0A 4KJWD 1QBLH 1WZLA 4Y16B 5F9OH 1YQ2A 3PHQA 3MRIA 5C09B 1D5BB 1S7QA 5C0GB 4OZIF 3MREA 5SWZD 4JHWL 4LFHG 1G84A 4AENA 3U46B 5FV2A 1I85C 4I18A 2P8PA 3RVVC 5T3ZD 3WKMH 4WO4C 1FNGB 2EH8L 3GKZA 2LQRA 2OTWA 1Z5LA 2BNRA 4EUPB 4OBSA 5EZOH 2Q8AH 5DFVC 3BSZH 5BJTA 2GK2A 4OBRA 5I73B 2OXGA 2YRLA 5GRVK 4IRJC 1SMAA 2F5BH 4ZFOB 4HX1B 4Y16D 3PQYB 3SE4C 1A6TA 2VLLA 1QLEH 1QFUH 4LCYA 5C71A 4J3VA 1JZ3A 1MCNA 4Q0XH 4XVUC 1T80A 1R3HB 5J06A 5FA3A 1G6VK 4WNQA 2AJXH 1PDKA 1H3WM 1OP5K 2XA8H 1IBGL 2DIJA 4BZ1H 4XX1G 4N8CH 1CTOA 4N1EA 1UACH 3EFFB 3V0WH 3HI1B 1G7HB 3BEWA 2H32H 3BP7A 1JHLL 3RZCD 1FAIH 3WFEL 3S36H 4E5XA 4RFOH 4QRRD 2XG5A 1H0DA 2X70B 5CZKA 3O8XD 4IDJL 4UV4L 2NY3B 5J3HC 2J3SA 1I4FA 4C58B 2HFGL 5F89B 4GAJH 2JTDA 1BLNA 2D0GA 4PRNB 3CXDH 5ISZB 3LHPL 1HWHB 2VXTL 3VFTA 4LPYA 1EX0A 4NQVA 1T1YA 3IFLH 3TWCL 4QCIA 4NC0B 3DUSA 1XCQA 3K80A 1AI1H 3OKLA 2IMMA 4ODVL 4I2XA 1S9XB 3E0GA 2Q76A 4ZUVB 5F93C 3TT3H 2AK4E 3KLHC 2OZ4L 1ITCA 4QHUA 3I85A 2JLLA 2OM5A 3O6FC 3TO2B 5KVDH 2FYYB 4MJ5B 4NKIH 5TDNA 4NQSA 3GDBA 1U41A 3FHQA 5E2VH 3RWCB 4X6EB 4I3RH 5GJSL 3T2PA 2RHEA 1EAPB 2CIIA 1GGCH 4OLXL 4AEHL 2VABA 4GMTL 5FUZL 2VDQH 5E5UB 1ZEAH 3S8WA 4MSWA 5T3ZH 1UB5B 2VSCA 1M7DB 5ISZD 2Q7NA 1V3JA 2DBLL 3ULUL 4XX1E 5D2LF 4QRQB 4NO2B 2AI0H 2MKWA 4JFHE 2Z31C 3B2VH 3EYVA 3BXNB 4MD0A 4PJFA 2Q8BL 1OVZA 4ZG1A 2Y06L 1QSFE 4Y16C 1OL0A 3SE8H 3GM0A 4JN2A 3QO0B 1BJ8A 1OWWA 4NQXB 3P9LA 4FHBD 1KPVA 5B3NA 4LARL 4NRXA 5CWSB 3QDGE 4HX1A 4WUUD 4JQVC 1LO0H 5K93A 4JKPL 4KC3B 4UQ2B 1CFVL 1A3RL 3IFOB 4ISVA 1CK0L 4W4NA 1A6VH 2G5BB 2V2TB 3H6JA 1E4XL 5E8OB 5IB4A 3GGWB 1A14L 2FIRT 3HUJF 4K3DL 4EUPH 3HI5H 1SJEB 4JM2A 3LIZH 4MA8H 3AU1B 5I73C 1JNNL 4CVWA 4AEIH 3OZ9H 5ANMA 2OP4H 4AT6A 5HPMA 3O8XC 3RA7H 4HKZB 2R4RL 1TETL 3QIUB 4JHBA 4OF5A 3MRNB 4PP1D 1VKXB 1YMMB 1L6ZA 3CVHL 4V2BA 1NL0H 4F7MB 1N6QL 3Q3GB 2YUWA 3H7BA 4M7ZB 2MHAB 2AS5M 1J11A 4G8GE 1QHPA 4RMQA 1UZ6F 1DBKL 3LRSA 4CVXA 2AXGB 4BJLA 4OLEA 4JREB 3TZVA 2GI7A 4A6YA 4FQ2H 3TBTB 3H0TB 4XVSL 1CLCA 4JZNA 35C8L 3NH7L 2A9NL 4X4YB 1IEBB 1DQJB 3O6ML 4WRLA 3G6DL 3CD4A 1UH2A 4C57C 3K2UL 1SBSH 3KLDA 4EBQL 1RI8A 2P49B 2VTFA 2EZ0C 1D5MB 3MZTA 2NY3C 4YDIH 3TO2A 1ACYL 3X11B 4P2OD 5E7FA 1DZBA 5SWSD 4R7DA 5I17A 1G7LB 4FABH 4R26H 2A6IB 2HWZL 2A6KA 1KTDB 4BH8B 4LSVL 2APFA 4O58L 5EBWA 2AKRB 3SJVA 1DSFL 5DMKA 4LQ1A 5FXCH 4PJFE 2R8SL 4D9RE 5D70L 2BERA 3CSPA 1NGPL 1KCRL 1V7NH 4XI5C 4OZFB 5ECJE 4C4KT 5C07E 4U1KB 5GGUB 1OWRM 2YPVH 3C5JB 5SV4A 5JLZB 3KPOB 2CDFB 1IARB 4CADB 4HWEH 3QO0A 4V1DD 3INUH 4NQXA 1ZHNA 4XP9H 5CHNB 1MCWW 5I19L 3Q2CA 2X1OA 2HP4A 5GGTA 1BAFH 4KMTL 3HMWL 3QJFB 4J7RA 4QRPD 2VZOA 2WMPA 3NABH 4D9LH 4KXZH 5I1IL 2Z4QB 4HCRA 4YC2B 4PJBB 2IADA 4MWFA 4XPFH 5IJVB 1AKJD 2L0DA 4YHOH 2DOCA 5DURB 5E5MB 1HEZB 4OTXH 5ICXA 2XG4A 5E8OA 3MRLA 2V6HA 4WTWA 3QCTL 2X1PA 1ND0B 5EBLA 3AU1A 4J4PA 5HHPA 4ODTL 3ZDXE 4E41A 5LWYL 4MJ4A 5EO0B 1WBZB 4F80A 3HRZB 1A22B 3LV3B 4P5KA 5J9PA 2QSTA 4JFDE 2CDGB 4GXVL 5HD8D 1FFOB 3L5JA 4OFKA 4M7JH 2IBBA 5CJOH 3V6ZB 2IQ9L 1NC4B 3KAAA 2X4UB 1NC2B 3T77B 5TQ2L 2GSIB 5CJXC 1HYSD 3ZKXB 3NIDF 4R2GB 3VGFA 2AXGA 2EE2A 1B88A 2IBGA 4XGZA 4K23H 1PY9A 1G7MB 5DURD 4K7FB 5DK0A 2OJEA 5B22A 2QKIA 4H25B 1BMGA 3RPIA 1HZHH 2X9WA 4KKCC 1FCCA 1WAAE 1DQJA 1FL6A 3LN4B 3O3AB 3BHBB 1Y6NR 4UIKL 1RZ8A 4U6VH 4GOSA 3QIUC 5GJTH 1CBVL 4PJXF 1D5MA 2FJFB 1N0XH 1J1XH 2QQNH 1G9MC 5JW5A 1ZHBA 5AZEH 3WNOA 4X5LA 2Z8RA 5KBNC 5GS2D 1F4YH 1UJ3A 5A16A 4M7KL 3L6FA 1KTDA 4WGVB 4I48B 4JREC 4JFEB 4FS0A 1TNMA 1FO0L 3GSUA 1G9MH 1JUFB 4HWZB 1JGDA 2FH6A 4PGJA 4U1NB 5DHYA 2XY1A 4W6XB 1WZ1L 5DLMH 2NXZD 1CZ8H 3TPUB 4DKEL 3M8OL 4U3HA 3SKNA 1CFNB 1IAMA 4IHOB 5CFHA 4XPAL 4OZFA 5IFAL 3MLYH 3MNZA 5E0QA 3MRHA 1BJMA 1JCKA 1T0NA 4PJAA 5A2JH 2N4IA 4NWUH 4WFED 4ZSOB 2NY4B 3ROLB 4ZPTA 1EO8H 1FORH 3CLEH 2OL3B 3L7EA 4DW2H 4CADA 1U8PA 1RK1B 5C0EB 1RV6X 3FRPA 2PO6D 3ZTJG 3DURA 3VFNA 1BFVL 3O4LD 3TCXA 3QQ9D 3VXUD 1Q72H 2LAAA 1FE8L 1S8DA 5FOBA 1HH9A 1G6RB 4LHUB 4NM4H 1MUJA 2HT4D 5T1LD 2JE8A 1UT9A 3H3KA 4YBHA 5J13B 1FNLA 3GB7A 3OKMB 3AM8A 2YMXL 4X7CC 4ZUTA 4E41E 4ODSL 1HCFX 1OARH 2AV7B 3H9SA 1IC7H 3MACH 4OZFG 4YDKH 2C3WA 1IQWH 5I1HL 5HD8C 1S9WA 1X5ZA 5DT1H 4HJGB 2RR3A 5IHBA 1F6AB 1B6DA 2NY4D 5EO0A 1MPAL 2G75B 1CFBA 3QG7H 3FRPG 3F7RA 4YC2C 1NC4A 3JV6B 1NC2A 3L7FA 1OP5H 4LHUD 1AGDA 4POZD 4XNQA 3REVA 2X89A 2Z35A 4NN6B 1B0RA 1JN6A 1RUQL 3VXSE 3FFCE 1G7MA 4K7FA 5F3HB 1QSEB 4NQDB 5E2WH 3P0GB 1U8KB 1PEWA 3O3AA 2CUIA 3GJFB 4PGBB 1QBML 1X6NA 3W81A 1MRFL 3KJ6L 2C3XA 3DVNB 2PF6A 3QHFH 5C6WH 1S9KC 3ZE0F 3NCYP 1JI2A 2AGJL 3DIFA 4G6AD 4YX2L 3ZKXC 4YIQB 4R2GC 5GS2H 3BZEB 1T7YA 3PHSA 4JFEA 3FQXA 4FQXB 4F58H 1RUAL 5ICZB 2FBJL 3L3KA 5DMIH 2PYFB 2DQIH 5DJCB 3QA3B 4BSWB 1A2YB 5E1HB 4L3EB 3KYKL 3TN0B 1HKLH 5DS8B 4QHMA 1QA9B 1LDPL 5GS0D 1C5CH 3KPTA 2NLJA 4JANB 3WIHH 4GG6E 1J0YA 3QQ9C 4PUBH 2NY6B 4UILH 5C0EA 5F8QC 2FJHB 4HPYH 4F9LC 4DQOL 5T1KB 2BNQB 4EI5B 4JAMA 1P7HL 3GJEA 1QSZA 3UPAA 3VI3E 1I9RL 1NBVL 3QJHB 4KKLC 5DJXB 4GBXA 1NCTA 1EZVY 5HDLA 5I1DB 2BNUB 1OSZB 4U1IA 1P4BH 3K0WA 4YUEH 4J3UA 1LVEA 2PUQT 1KXQE 2MQ0A 2NY4C 4WWID 5H37G 1CDBA 1P4IL 4OI9A 5E8PB 5ILTL 1OAQL 3DI2B 3L9RB 4KPHH 4M5YL 1YN6B 3SCMA 4NO0A 1YYMH 3U79A 3TC9A 6FABL 3CVIH 1X5GA 1RHFA 1B3JA 3IVKB 1A6WL 2CUMA 8FABA 2EDOA 4M7LH 1CL7I 1CT8B 1K5NA 4CU8A 4HJJL 5DSCA 5BOZG 5J13C 4LBEB 1CXEA 3X3FL 2VDOL 4K8RD 3RVUD 1G6RH 2H41A 1BVKB 4Y5XB 2ZG3A 1NFDE 5DD5L 1UWEL 2QSCL 4LEOB 5FECA 1QPPA 2IANB 2YD4A 1EVTC 3BAEL 5I1EL 3OHXB 2GFBA 1Q1JH 3CFCL 5IT2L 3P2TA 2CLVA 4Z77B 1CDIA 4Z7UA 3UTZA 5DMYA 5I1CH 1F97A 1FGNH 1FCGA 3TBVB 5ID0B 5EZIH 5JXED 2N7BA 5D1QB 4M03A 4ODXB 3RUGE 4N0CD 4NRYB 4QHLA 4HC1A 5DUPL 5BO1L 2WANA 3HCVB 5DVOA 3QHZL 5JHDD 1CFQA 2H3NB 5KSBA 4NN6C 3FCTB 1U8JA 4Z95L 1KCKA 3WEXB 1XEDA 2BFVL 1N4XH 1AJ7H 1BZ7A 3ARFB 3HC4H 3D9AH 3STLB 5BVPH 1PFCA 4OQ1A 3GSRB 3MNWB 2E7LA 2PYFA 5DJCA 4CMMA 4PJDF 4BSWA 2R1YB 1A2YA 2IAND 5GS0C 3BUTA 1KPUB 3MRQB 5DS8A 4P2RB 1PZ5A 1INEL 1QFPA 1HXMB 1CG9B 2X10A 3BD5A 3ZMRA 5GS0H 1A3QA 4ZS6D 4NQCB 1T1ZB 3WNNA 2HJFB 2BHZA 1YEEL 3DX9A 1Y18A 1VGKB 1NCBH 3WJJA 1X44A 5IHUH 1W0WA 4FNLH 4U1GB 3C2AH 3RGVD 1NUGA 5FDWB 3RNQB 3K8MA 3ZE2E 5MEQA 4FQXC 3IFPB 5KJRL 2FJHA 5F7FA 2Y5EA 1JHKL 2UWEE 5T1KA 4NSKB 5T3XD 5CZVL 3ULUE 5D7SL 4TUOB 3B6SB 4NRZB 1F3JB 3ARFD 3TN0C 4G6JL 4JFFB 3TPKA 1GL4B 1GZPA 1S7SA 5FYLD 2DF3A 2BNUA 4S1DC 2XICA 3P0VH 4Y4KB 1BEYH 1FH5H 5E8NB 3UTSA 2VXSL 1RJZA 4HXAH 5D1XD 5L2KE 4P2CG 2NY6C 3D39A 1VFOA 4NQCD 5DRWB 5FO9B 4EI5C 3UDWC 4YO0B 4GAFB 4K8RC 4MVBC 3RVUC 2CQVA 4TSAL 3P4NA 5F7UA 2QTEA 2W59A 3DV6B 4N9GA 4PB9L 1NCCL 4ETQB 5CBAA 4K8RH 1MJ7L 1BVKA 3VG9B 1OP9A 1S3KH 4LCUA 3SDAD 4QYOA 4P4KB 3O2DL 2AJUH 3DMMA 1I3RA 3L95B 4ONGH 2P42B 4Z7UE 3TH3T 1ZA3B 4WI4A 5EBMB 3TV3H 1O7SA 2VC2L 2AJ3A 4Y4KD 2K1MA 3MUJA 5EUOB 3ZSSA 3VXPA 4N0CC 1NBQA 4P59H 4U7MA 4M9PA 3BT2L 1EDQA 3KPSE 2BOBA 1RUKH 3NCJL 2C5DC 4LDOB 4POUB 4LNVA 3BW9B 4ODXA 1P1ZA 1W0YT 1QRNE 2XTJD 3QWRD 3GKWH 2CRIA 2ADIA 2E27H 3FZUD 5ADPL 3H42H 4Y5XC 1QO3A 3P4MA 3LQMA 5EO9B 1ZSDB 2P5WE 3QCVH 5A3ID 4JO3L 3WEXA 5JR1L 1C5DA 4QTIL 1BECA 5IW6A 4PJCE 3T0BA 1MCFA 3B43A 3MJ8A 2I27N 5IBUB 3BH9B 3BZ4B 1NSNH 1NEUA 3X17A 4F7PB 1PKQA 5EUKA 4ELKB 1FL3B 1OLLA 4H0IA 5CLWA 1YJDL 5F9JA 5D1QC 2A83B 4XPTH 4XMPL 1ACZA 3RGVC 7CGTA 5IGXL 1S7RA 3QXDA 4HK0A 1J1OH 4HIHA 5FA4A 5A40E 4PBVC 3C87A 3WBDA 1DN0B 3P73B 1A3LH 1CICB 3VXTB 3RNQA 3ULSA 3HE6A 4DGYH 3ARFC 4KRNA 5T3XH 5IV2B 4ZS7H 3DI3B 3BI9X 1WICA 2VKXA 3MLSH 4H88L 3BOVA 4X8XA 5IESH 1T22B 5ETUA 4QOKE 1DBAH 4NUJA 5FYLH 3EZ8A 4KK9C 5EA0H 1LGVA 4OGXH 1OGAB 1R24B 3AAZA 4Y4HB 5GSVB 4MLSA 5BVJA 5IB5B 4NJ9L 2V2WB 1OTUD 1XGUB 1AFVL 4KMQA 4P2QE 2YOCA 2ZPKH 4Q6IC 2E9BA 3BH8A 3SKMA 4U1GC 1P5VA 4HDIB 5I75B 3B9KA 2DAVA 2XKUA 3CMOL 4XCNA 3SE9H 5FO8A 4OF6A 2D7OA 2EYRA 5INDB 4Y4KC 4NKMA 4OZIE 4P4KA 4NT6A 5FHBL 4NZJA 1NCDL 3CCHB 4HUUB 1I8LC 1J9CT 1G7QB 5EBMA 2K7QA 3ZYJA 1F90H 1OGAD 2Q3ZA 3V2AR 4Z8FH 1HHHB 1U8LA 1VADA 4Z7NE 4NKOA 3KPRD 1NLDH 3FZUC 4KJPD 5L2JB 1R3IH 3ZKQD 4LSSH 5J7CC 5CEYA 1H3GA 4MD5B 4IMKC 2DTSA 2V9QA 5A3IC 3N1QC 1KJ3L 3SE3C 1IGYB 3VG9C 1S7VA 3VRIA 5IHZA 3ZL4H 4YHIA 1HSBB 4P4KC 4U1MB 5CSBA 2PTTA 3H8NA 5DJZB 3V5HB 1PX3A 1T7VA 4LIQH 2AJYL 4ZQKB 4K7PY 3HC3L 4XCEB 5HHVL 1I3GH 3KVQA 4HFWA 3BH9A 4OGAD 5HHOA 1WUNT 4YAQB 4ZFGH 1RUPH 2Q3AA 4GRWF 2VZ3A 4UDTB 3DROB 2BC4A 3GBNL 5K9JL 2HAZA 1OTSD 2AAVA 2FATH 4Y1AD 1KCSH 1LO2H 1SEBA 1J18A 4YDVB 4GAGH 2VKWA 1KJVA 3NACL 2Y5TA 5EN2B 3P73A 1IC5L 2H2SC 4X6DF 1LK3L 5F7MC 5FCUH 4EOWL 1XR9B 3DARA 3T8XA 4OLVH 5JIPA 1KLUA 3BMWA 5ESVA 3FT4A 3OKNA 1UCTA 4P49A 4WWKB 5GHWL 1UWXK 4KH2A 4YHLL 1XZ0B 1MI5E 1JRHL 4NUGH 3QFDA 1CD0A 2X9XA 5F7EH 1KJ2L 1ORSA 4JPIA 4DVBB 5DYOA 3RWFB 3ARBD 5IQ9B 3VFMA 4L3CA 4N0UA 4N1CA 2KZ1B 3W5NA 4ZXBD 3TA3A 4AK1A 1AIFA 1CICC 4HXBL 2FLBT 2JB5L 3M1BB 2IGFL 3KYAA 3MA7B 4LSDA 1RULL 3C8DA 3QXAB 1QR1A 1MJUL 3C6SB 5CIPA 1A6ZB 2XQYG 3CU1A 3QIWB 43C9B 3CDGB 4PRPA 5T33L 2GY7B 1I7ZB 2AK4B 4Y4HC 1YN7A 4HIIB 5IQ7L 3MODL 5I1JH 5EZJA 1TENA 5J11B 2QHRL 4U1HA 5AEAA 3GM8A 4CVUA 4WHCA 3ZT7A 4PB0H 3GSVB 5D2LE 3HPJB 2HJKB 4E42A 2P7TB 5I75C 1K6QL 1TZHA 1FN4B 3TGXA 5HYFA 4LEXL 3V4PH 5D7IB 3ES6B 3SBWA 5DDHA 3CFJB 3TYFA 1TVHB 1JWSA 2QSVA 3LH2L 4P46B 3OGCB 1OGTB 3BZFA 5C08A 3EJJX 5B38A 3BN9D 4PPTA 2VUOA 3ALPA 1PZUB 4W68A 5HHOE 4JDTL 2MCPL 1E6JL 4IOIA 1EGJA 2J4WL 3QIWD 4GW4A 5TF1H 1QSFB 2AK4D 2HFEB 4FFWD 4ESKA 5LXGL 3G6AA 1UZ8A 5HGGS 1CDHA 1OTSC 4X4XA 4MS8D 3QDGB 3EOTL 2AJSH 3TT1L 3IDXL 3DROA 1CXFA 1GHFL 1X5HA 4RAHA 5E94B 1RVFL 5IW1B 3F6LA 2D2OA 5IMOA 3PL6B 2YPLB 1E4XI 2ILLA 2DWDA 5B38G 4WY7L 3RNKA 3MOBL 3BP6A 5J12B 4G9FE 4MQTB 1C16B 4LLMA 3PDOB 5EU6E 3O3EB 4N0UE 1ZHKA 5CBEA 3OG4B 4ZOCA 25C8H 4EJ1C 2WZPD 2O5XH 3MLZL 4G8GB 3EDKA 3B2UD 3MV7E 3KS0J 4YGAB 4NGHL 4XBEH 3RKDD 3WHXA 4U31A 3F7VB 1MRDL 1KC5L 1T0MB 1NGQH 4PTTB 1MLBA 2D31A 1N64L 5E6ZA 2HT2D 1Z3GL 3QDAA 1GXEA 1A21A 4PRPE 1INDH 4R4ND 5CMAA 4MNQA 1AGEB 3L3GB 4KY1L 4QXGH 2K9UA 3GHBL 4WWKC 3S4SB 3C6SA 4FP8L 4G6KL 4PJXA 4ORGB 3RWHB 4P9HL 1AD0A 3DUUB 4P57A 3OR6A 2VLKA 2A0LD 4U6YB 4ODUB 2ADGB 4AH2A 1P7QB 4DAGH 3QI9A 5J6GA 2GJ6A 5JOFA 1FZJB 2YZ1A 4PLKD 3RWJB 5D7IA 3GMMA 4S2SB 1IGTB 4ZO7A 1WF5A 3QEQE 1WT5C 4BKLB 4RGMB 3SQOH 4HIEB 3T0EA 1EV2E 3MXWH 2ZZUT 3W9DB 3AVEA 3QIWC 5L0QB 3ECBB 1F3DJ 4FFWC 3U7WH 4LQFL 3D85A 3STBA 4ETYA 5C07B 3ARGB 1CQYA 4TQEL 1IGIH 4AEFA 4DN4H 4M7LT 5J11C 1NEZA 4N90E 5F3BA 4XWOC 5IB1A 4U2ZA 4OLZH 5DEFB 2KDGA 1A1OA 1EEUA 3LS4H 5HI4D 1AQDB 1RUML 3QISA 1IFHH 3QRGL 3MGAA 1IGJB 3VWJA 1CXHA 4RIRB 1P7QD 4P46C 4YHPA 1K8IB 4MNHB 3G9AB 1PSKH 5CGMA 1BOGA 5FYKE 5JTWA 5DVLA 4JO1H 5J1AB 3VRJB 2D03H 4HBCH 1JPTL 5C7XL 3I75B 3IRPX 3MR9B 4AG4H 2BSRB 4JVWA 1VACA 2GUOA 4TVPL 5K9OB 4Q7DA 4G6ML 2XZCH 1BF2A 2IFGA 1UB6A 2E3VA 3GMOA 4Y4FA 2X41A 1BZQK 4HQQH 4Y7MA 3FB7B 4OJFL 2NTSP 1NEZG 3RQ3A 5TFSL 3PDOA 2VXQH 2YC1A 3U6RA 3K2MC 3O3EA 4JFDB 2A2QT 4NNXB 3NIDE 4XTRD 4BQBA 1A4JA 5JW4Q 2DB8A 2WBKA 4Q58C 1DDHB 3S88H 4ZDHA 3PL6C 1HOCB 4RISL 1FNEA 5L9DH 3HZKA 5TE7H 3W11D 2X4TB 4FZ8L 4FFYL 1E28B 4U6TA 2DN7A 4MNQE 1JWUB 2DQHL 1W8OA 4JM2D 4PTTA 4HH9A 4XC3H 5CJ8A 3UC0L 4OIAA 4DZBA 2X9YA 5J12C 4PJXE 2HG5A 1R5WB 5DUMH 1FFPA 1X5JA 1LO3L 2AQ3A 4JM4L 3WXVH 4GRMA 5JORB 4M1DH 4O2FB 4JFDD 1EFXA 3A0OA 2VH5H 2GJ6E 1A1MA 1QBLL 1MWAA 5F9OL 1N5AB 1JGEA 1TZIA 3REWB 4MJ6A 4B7LA 2CLRB 2ADGA 4OZGA 4NP4H 4YWGH 4U1SA 3G9VA 3TZVD 4NN7C 4QXTB 3MROB 4UIMB 3WKML 1HQ4B 2ERJB 2FGZA 3F65A 1IGTA 2ATPB 3R4DA 1KLGB 4JKLA 1QEWA 3VG0H 4AIZA 4HFUH 3FO9A 2A6JB 5EZOL 3LOWA 2Q8AL 3ABZA 3DX6A 4FQQB 3BSZL 2VOTA 3NIFF 4JHAH 5DJ8A 1HHGA 2R23B 3QFJA 2DIBA 5I8EB 3S5LB 1GAFH 3A6BH 4H20H 3KDMA 1FZMA 2F5BL 1B90A 4MJ2A 5DJAA 1YEFH 3FFDA 3MBEA 1QLEL 1QFUL 4RGMC 5DGQA 4Q0XL 1HE7A 2V5YA 4XPHH 5D5MF 1CL7H 2VUYA 3EYQD 5D9SB 4XB7A 3VRJA 3AXLB 3SDYH 3ARGC 1QP1A 2H45A 1U3YA 4FFVC 2AJXL 5LGHH 2XA8L 4BZ1L 1LMKA 4OF8A 5BRZB 4N8CL 3WL9A 1K3IA 1UACL 3I6LE 3V0WL 1Z9MA 1S7XA 3RIAK 4XTRC 3IU3B 4F7TA 1FAIL 5D6DC 2Q86B 3S36L 5HGAA 2ARWA 4RFOL 5IHLB 2NYYD 2I9TB 5IMMB 4JDZA 2EIZA 2JCCF 2WBWB 2I9LB 1U95A 1WFOA 4GAJL 2COQA 2X4TA 2GK0B 3RWIB 3CXDL 1H5BA 3TO4A 3IKCB 4TSCH 3TVMB 3IFLL 3VXSB 3FFCB 1M05A 4EXPX 3M17A 1UWXH 4E41D 5MENE 3FQRB 2V7HA 1AI1L 5J8OA 2IPTH 3EOYG 3ZE0E 1KG0B 5JNYA 3B8SA 3TT3L 5JW4R 1CE1H 2Z8VC 4JKWA 4OT1H 4PG9B 5KVDL 5JORA 4NKIL 2ESVE 4XP5H 3NZ8A 4F7EB 5E2VL 5IVXF 3CFEA 5FB8A 5D7LE 4NCC2 4I3RL 1T2JA 1G9NC 5KTEH 1GGCL 1UM5H 4PRHE 2RAMA 2I07B 5H94B 4A6YH 5IBLD 2VDQL 1U2HA 2DWEB 1ZEAL 3IDJA 5T3ZL 1RJLB 1G9NH 3MSPA 4HUXB 4FZEH 4OB5H 1BVLA 3PUCA 4OD2B 2AI0L 3MRRA 1TMCB 3FFCD 5GGSB 3B2VL 5IEHA 3D5OF 4H0GA 1OB1A 3PWJB 3Q5YA 3QFJE 5EPMB 1N3NA 4Z5RB 5DRXA 1AY1H 4DJMA 4DCQA 1WITA 3MJ9A 4UINH 1ZLUK 4GG6B 5GGVH 3S5LA 1QLRA 4L9DA 2CK0H 1LO0L 5J1TC 4GQ9H 2ERJC 3IT8D 3ROOB 3C5SB 2GJJA 3TIEA 3EOBB 4WHTA 5K33A 4HIJA 3PF2A 4PRIE 1A6VL 3EZJB 3BPCA 4P4RB 4LNRA 1T5XB 4MDIA 5IVNA 1EIBA 3OWEA 1F4WH 5I76B 3HI5L 4QY8B 5IROC 4MA8L 3LIZL 5BRZA 4AEIL 3OZ9L 4JQIH 1T6WA 4QT5A 2OP4L 4LRNH 1HDMB 3P0YH 3IU3A 2VL5B 4XMLH 3I6GA 3RA7L 1FBIH 2R4SH 1YPZF 3VH8A 5GGTH 2QV2A 4O2CB 3S5LG 4PJIF 2EC9U 4BFEA 2EICA 1LEGB 3UJIH 1NL0L 5JPMB 2DL9A 2I9TA 2A77H 5IFHH 4HCRH 1TVDA 4NKDB 3BVNA 1AP2A 5E6IB 3KWWA 1JPFB 5ADOH 4YEFA 3CDCA 3LKRA 4F57H 2AXFA 1J8HA 5FHAH 5F70A 3VWKA 3IKCA 3Q0HA 4FQ2L 2VZTA 4EN3A 1MCSA 3D2UB 3KXFB 2W0FB 1FL5B 1CXKA 1RIVH 1ZA6A 2HYMA 1FDLH 3BGMA 5I0ZA 1BQLH 4MZ3A 5IUSA 1X4YA 1SBSL 2X4RB 1GRWA 5F9WB 1I7RB 3VH8G 4YDIL 4JFOB 3RUGB 3ZHLA 4LSUH 4L8BB 5EIQA 1YECH 4ZO9A 4FABL 4R26L 5KAQF 2X89D 4PJDE 2J8UF 2Z9TA 3O6KH 2QADD 2A73B 3TVMC 3I50H 1KB5A 3P11H 5KVMC 5HYJE 4HZLA 2FEDD 3MLVH 1T1XB 5IK3A 5DRNB 4OD2A 1YQVH 2YSSB 3D2UD 3D0VA 2Z92B 4S10A 1V7NL 1P84K 1AGCA 3BPLB 2J6EA 1JK8A 4TTGA 2YPVL 5KZCD 5D2NE 4HKJA 4I1NB 4UV7H 2AXHA 4HWEL 3VFVA 4F33A 4N5UA 2RQ8A 3LKSB 3INUL 3A67H 3VFSA 4XP9L 1Y6MR 3JV5A 3MRCB 3NPSB 4NQEB 5T5NF 2W0PA 1BAFL 3ZZ1A 3VRLF 2BCKA 5L6YH 1MY7A 3NABL 3ROOA 5F1IB 3WFBH 4URTB 4D9LL 3OMZA 3UZEA 1D5XB 1MJJA 1UXWA 1U8NA 1PAMA 4YHOL 4BK4A 4OTXL 1P9MA 2VLRA 1ONQB 5BV7B 2R2BA 3SDDB 1CD1A 2ICEA 1HKFA 3ZDYF 4QY8A 5LGJA 1G7IA 1F8TH 3JTTA 3PE9A 2IC2A 4HZAA 4Z9KB 4OCRH 3BKJH 3W39A 5L2KB 2X5PA 8CGTA 3GMLB 4C56A 1HQRB 4LGRB 1GCFA 3P4LA 3VXOA 4JRXA 1NKRA 2UY7A 4I5BA 2NZ9C 5E03A 4M7JL 1L0YA 2F53B 5CJOL 4OSUH 2F74A 1J8HE 4JQXA 2DICA 4GBXD 3VXRA 2FDBP 3ARRA 4HKBA 1I1FA 3Q6FB 5K9QI 2YBRB 1GIGH 4PJ7F 1D6EB 4N0FB 1PGRB 4K23L 1GOGA 4WW2B 3FTGA 3SDDD 1HZHL 3KXFA 4EDWH 3B5HA 3SCMD 1UGNA 1KIPB 2IALB 1CD9B 1RIUH 3PWNA 2LABA 2Y4SA 4U6VL 2CSPA 2EH7H 3KPSB 3VI4F 5GJTL 5C0BE 1EPFA 2X4RA 2AJVH 5H2BB 3VMPA 4J1UA 4JFOA 1QRNB 5E6IC 3EDEA 1N0XL 3WIFB 3WMSA 1J1XL 2QQNL 2E6JA 4ZO6A 1RD6A 2DQJH 1N5YH 5AZEL 4OAWB 1TQBB 2CLZB 1F4YL 2OTUB 2FEDC 3MO1B 4GKZA 4Z0XA 4HGMA 5HGHB 2P5WB 1BZ9A 1G9ML 4NHUA 1N8ZB 5JW4N 4OF7A 3FRUA 1QVOB 3TH2T 4PJ5A 5DLML 5GIRA 1NGWB 4M62H 1CZ8L 3UTTE 4Z78B 3AREA 3IDNB 1CCZA 4DVRL 2OZ4A 5F9WC 3MLYL 3VFOB 4WV1B 2X4OA 1IKNA 4YNYB 2ZSVA 4NWUL 4RFEB 2CPCA 3KPSD 3SGKA 1EO8L 3OXRA 1FORL 3CLEL 3ETBF 5E00B 5DJ6B 2CKNA 4DW2L 1U58A 5AYQA 1RJCA