5DJ0B

Fc heterodimer design 11.2 y349s/k370y + e357d/s364q
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 34
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj0B01
1Q1JH 5DJXB 3JVGC 1AXIB 3WJLA 3B9EA 4YXHL 4DZBB 5JHLH 5CZXD 5LCVL 4PJAB 4MAYC 3GSNL 1WT5A 1BM3H 5E6IA 3FO0L 1FNSH 4EVNA 3QT2A 3VDCA 2NY3B 5MHSD 2YRPA 3TNNA 3T09A 3S6CA 1EGJA 1DN2A 3RKDC 1UACL 4CADB 2WAHA 4K2UH 4AK1A 1X6LA 2LTQC 4K71B 3QWRA 2PTTB 5EA0L 4PJ9C 1F4WL 1A1NA 1U92B 4J12A 3T2OA 4DN3L 2DKSA 1OAZL 5ESAB 2M26A 4OLEA 4KJQD 2AW2A 2UV3A 2F54B 3GMNA 3PWLB 4H1LA 1KENL 3DUHA 2OP4L 5L6YH 3O6FA 1ZHLB 2IFFH 4RNRA 1VSCA 1FE8H 3WS3A 4LSRH 3JV4B 5ICXB 2EXWD 5T5FH 2R2HA 2VWEE 4HUMB 1F13A 3WD5L 4HMDA 2BMKB 1UGNA 1F4XH 3EZ8A 4XVTL 1A4JB 4QHMB 5F1IB 5DLMH 1UH3A 3OX8A 2ESVB 1MHCB 1MHHB 5IOPA 4JFEE 3GRWA 2GAZA 4YHNB 1MAMH 4FQLL 3MA7A 4M1CD 1CL7I 5E56A 3ARDC 4FN0A 2YD7A 5INCB 3V4PH 4MA3B 2WMPA 4DOHE 2VLRD 4KH2A 5CCKL 5DTFA 1JRHI 2BHUA 3STZA 4OZHF 3DIFA 3MRFB 4XP5L 1L0QA 2B1AH 1UM4L 4TSBH 5F96L 2B4CH 1S7SA 2XPGA 4MNGA 4R6UA 3DGGA 3WL9B 1QFUL 3MREB 4FQCL 4JE4B 4E0RB 3DURA 3E2HC 4HKXA 4U7SA 5F8RC 4HXBL 1FL5A 3FN3A 5L8LB 1PX4A 1QSZA 3IJYB 4HIJB 1LDPL 3RWFA 2H2SD 5MHSE 4FTVD 3G5YA 2VB5A 1VEPA 3HZYA 2C26A 3G6JF 4DGIL 4QRPB 1ADQH 3ZDYE 1E6JH 5HTSA 1OHQA 2FEEL 4WIQA 1S7RB 2RJMA 3BPCA 2Q6WA 3TBSB 1JZ2A 4LSVH 3MLXH 3P4OA 2ICWB 4M7KL 3QWOB 5FA3B 3TESA 3WO4B 2XQBL 1RU9H 3GUTA 1BWWA 3AS3A 4HMEA 4OZIF 3NFPB 4Y5YC 3AAZA 5C0FA 1IKFH 4NQUA 3VH8B 2G75B 2VZUA 1FAKT 3EOAB 4ZO6A 3UJTL 3W0WA 3S5LG 4ZTOL 1FBIH 4GMTL 3HAEA 4ONFL 3KPNA 4PJBF 5CLWA 2X4UA 3HCVA 3JWOL 2H9GA 2OZ4L 3PL6A 1JPSL 1YZZA 4X7DC 2UVFA 1WZ1L 4WUKL 2P8LB 1T0PB 3QP3A 3MODH 3TA3B 3RWEB 5JDSA 4L3CA 4XZUA 3CFKA 2VDLH 3GSXA 1JP5A 5F9OL 5GXBB 3OKOA 5KSUB 1A1MA 2EC9U 2Z35B 2ZSVB 4QRSB 4YEEA 5HGAA 5C0ND 3G9AB 3K8LA 4OTXL 2VLRE 4XNZB 2DD8L 4MNQE 2DMKA 4TPRL 3IDGA 3QI9D 1NGQH 2EH7H 4X4ME 1ADQL 1BJMA 5TPWL 4MNHB 1BFSA 4HIHA 2P5WE 5CINL 5ERWB 1MPAH 3PV7A 5EBMB 1UH2A 3BUTA 4I18B 3KYMB 1MFDH 2ICES 2O5YH 3F12B 3TBTA 3AVEA 5IV2A 2XZZA 2YUWA 1OVZA 4DKFH 4K8RL 1GCFA 2JCCE 2E8YA 4WI3A 3WD5H 2F9BT 3UO1L 5I1GL 5I1DA 4DAGL 1KYOJ 4XNYH 5AZ2H 3LN9A 1S7QB 4YJZL 2HLAA 2FHFA 3U46A 3SEPA 4J6RL 4AG4H 5IHUL 3TF7C 3EYUL 4X7SL 3RTQA 2NY7H 5IEHB 2P8LA 2XY2A 4LPYA 5ADPH 3B2UD 3WFHB 3C09B 4J3WA 4MNGB 3Q1SH 2F54A 2VDNH 3SKMB 1VGKB 2ZZUT 4PG9B 3DVGA 4EXKA 4Y0GA 4IOIB 5GSRA 2W9EL 5IJVB 2DAVA 3C87A 4MJ4A 1A02N 4PRDA 4NUGH 2Z9TA 1TVHA 1Y6NR 5IFJA 2BVOA 4P9HL 2A77L 4UNVA 5C0GB 1KXVC 1J1PH 1J87A 5DC4B 4WWKB 2O93L 1I75A 2QSVA 4P4RB 4MHHI 4FXKB 2J7LA 5CP3H 4OCRL 1OAKL 5D96C 5EU7E 1UM6L 4LEXH 1AGBB 2A74A 5ID0B 3RU8H 2DQTL 5JORB 3OAYH 3STZB 1AO7B 1NGZA 3WHXB 3ARDA 5BOPA 1V05A 2ENYA 4GUPA 3QHZH 4KUCD 4KKBC 5GJTL 1B6UA 3EO1B 1HXMA 1RY7B 1AI1L 4H0GA 4MAYD 5CSZB 2HT2D 1IEBB 3REVB 4ELME 2R1WB 4N0FB 3KYKL 4HIJA 4TUKH 4F9LA 4XPTL 5MENA 3BH9A 4NHCL 1RJCA 4WY7H 3INUL 1GGYA 2A6IB 1S7XB 3X3FH 3IDIB 4F2MB 3I9GH 1A9BB 5C86A 4HKZB 3BPCB 3QWQB 4N9GA 1T5WA 4QRUA 4LNVA 1CFBA 5T1LA 1TMCB 2R69L 2NR6D 2C7UA 2XV6B 3AM8C 3OV6A 1R3LB 5E94B 4YX2L 1E4XL 4FABL 1CDJA 4OZHB 3F5WA 5GZOC 3RNQA 4G8GD 4KHXL 1HINH 4UQ3A 3UDWA 1EXUA 3QDGB 1BVLA 2EDNA 1YYML 4OT1H 3C6LD 1J1OL 4D8PB 1CGVA 3NACH 4YK4B 2OJZH 5GGRB 6FABL 3DMMD 5IHLB 3H9YA 3QEGL 4XXCA 4P4KC 1RVFL 2Z31D 4AIZA 1AH1A 1EUTA 1MRFL 3BVNA 4LDOB 1Q94B 3U4BL 5FCUH 2Z8VC 4IJ3C 2AEQH 3IU4H 2F54D 1QSVA 2R0ZL 1P4LB 8CGTA 1CFQB 1XR9B 3IFLH 4K8RH 5CMAA 5J13B 7FABL 3GI8H 3CNKA 3LVEA 1CG9A 5E99L 1NCWH 3HI5L 4HS6B 1KT2A 1LO2H 1M7IA 1YECL 3V0VB 4LVNC 3V6BR 5I1JH 1YEEL 3DUUA 2OX5A 4F9PC 3RTQB 3V0WH 3U0TB 3H0TB 3FN0H 3UZEA 2HN7A 3MGOB 1LP9B 1NDMB 3CZFB 3SJVB 3IDIA 3MMEA 4Y7MA 4F3FB 3FZUD 4NZUH 4YXKH 2A9NL 2AXGA 1EFXD 2FX8H 5F7KC 1ZANH 3FOMB 3HS0A 5DHYA 3WCYA 5JR1L 4S0TD 1A7RH 3KXFD 4K8RD 5LG1A 1FYTE 3HI1B 4U05A 2FATH 2ZOLB 1DL7H 3RWJA 3DVNA 1Z5LA 4LLMA 3LS5H 4D0DA 1MHEB 2OR8A 3RUGB 1NGPH 4NQDE 4HBQA 3EYSL 3DMMA 5K59F 5J13C 4KZDH 4YDIL 1EERB 3TWCL 4QRPA 5I18L 5DA0B 1GZQA 1XF4B 3HI6H 5HI3D 4JFFB 4GUPB 3D85B 1TZHA 1FO0A 4I5BA 3SO3C 4JFXB 2F53B 3KYOB 1A7OH 4PJCB 1FPTL 5TDNA 2DBLH 5EU3A 1A7NL 4UU9B 3UTQB 1A2YA 3BRGC 3P30H 3BRFA 5EWIH 4MD4B 4OZIE 4FZEL 4HUXB 5D7JA 1LP9A 1NDMA 4LSSL 2ZNXA 4LMQE 4P2RD 4JG0L 4D0CB 5CBAB 1CLYL 1NLBH 3HAEB 3O2VL 4I3RH 2QQNL 3MCLL 4L3CB 4NKMB 1U58A 1IC4H 2FYYA 4AENB 3KXFE 1AXSB 5BO1L 1A7PH 2VDKH 1KCVH 1SBBA 4LF3B 3IYLW 3TZVB 2BX5A 1TETL 1HSBA 1Q9OA 4YHKH 2DLGA 1PZ5A 2B1AL 1HINL 2YRZA 3ZE2E 5CD5D 1Z3GH 1UG9A 2Z92B 3QO1B 5EORL 3M17A 4UNTA 3ZTJH 1WJ3A 4YBQD 5E8DH 3RWDA 1AP2B 4BSJA 1N5YL 1MIEL 5E2WL 3U0WL 1EHNA 1CK0L 4I18A 1F2XK 5F3HA 3L1OH 4HCRH 1A1NB 1B0RB 3IF1A 1INDH 3RX7A 4X6EB 2CD0A 5HSFA 4F2MA 2VDPL 5D1ZC 4HUVA 1U8OB 2XRAL 2NY4D 3U83A 2PCPA 3C6SB 1KLUA 4BH8B 3MLWL 5E8NB 4RZCA 4RA0C 2I24N 3GO1H 1HQRB 4U1SB 1CD1B 1T2JA 3BGMB 4W70A 1ORSB 2EIBA 5GS2H 3H3KA 4NQXA 3O41B 1OP9A 5B38A 5A16B 2IPTH 2VR9A 3HAEH 2JK5B 4RIRA 3RBGA 1EO8L 5HYQB 4DW2H 3RZCA 1YMME 5IBTL 2HRLA 5EN2B 4TTDD 3U36A 5SWQB 4MXVE 3HI1A 1YEFL 4UIKH 4Z7OE 4MDIA 1LE5A 3MOAH 2XWTA 3DURB 1PY9A 1XF2A 1ZGLM 2RCSL 1MHEA 4EOWH 3UJIH 1JRHH 1OB1B 3QUYC 4S2SA 4IM8A 3HC4H 1TVHB 4JZJA 3VE0A 1T20A 3G08B 3QHFL 1NCBH 5DD5L 3FT4A 5DJDB 3B5HA 4AG4L 3ULVL 2QADD 2H6PA 5I1KH 3QPXH 3P4NB 5TGBA 1W72A 3BP4A 2XY1A 3BIKB 1IGTA 4H8WL 2AXGB 1P7KA 1WFTA 1QO3A 5FM5M 2CDGB 4PRPE 1NL0L 4PREB 4GQ9H 4G6AC 3RWIB 1SY6L 5IHBA 1N59B 1NFDF 1F02I 3ZDZF 4RISH 3ZYJA 2LTQB 2MKLC 1G7LA 2ZPKL 1TZIB 5HGDB 1HKLL 4PTTA 2NR6C 4HKJB 3UYOD 4FXLA 4BQCA 3MJGX 3LPGA 1OD9A 2JCCB 2W9DL 1N3NA 3O2VH 2FIRT 2A6IA 4NFDA 4ODXB 4LU5H 3EYQD 3L5WA 4PJIE 5ISZB 2BNQD 4JFFD 1D6EB 2BVYA 4FG6C 2NY7L 3DMMC 3KXFA 4O4YH 5BV7C 4U1KB 4U7MA 4JO3H 4HH9B 4PR5B 2D0HA 1AGBA 2A74B 2FX7H 5C7XH 5EORH 1UWEL 3LS4L 3QNXA 5CD5C 4OLXL 3WNOA 2NX5A 5ITFB 4TRPH 5C08D 2AGJL 4K9EL 4ZUSB 3VXPA 5C0BA 2NLJA 3NAAH 1QSFE 1T6WA 1KLGB 3WDHA 4QTHA 3ZDXF 3BD4A 5FB8A 3S4SA 3P77A 2PW2A 3OXSA 4ODSL 3TN0D 4PPTA 3FQWA 1F3JA 4CJ1A 1BJ8A 2DI7A 4LFHD 3MV11 1JFQH 1CICB 2HRPH 2LVEA 2VLJE 4I0PB 4PJ5D 3BGMA 1Y6KR 4W4OA 1I8IB 4PJ8A 4ODVL 1KEGH 2QR0A 5F9WB 1LHZA 2WSKA 2X10A 4XCNB 4HWBL 4FHBD 1JTTA 2A1WL 4KK5C 5D7IA 1OM3L 1F4YH 3ARBC 3SE4C 3PDOB 1UEMA 1YDPB 4Z78A 4UB0L 2HYMA 2OSLB 4U1GB 2Q8BH 3MMEB 3GKWH 4P5TD 3MNVB 2VSDA 1J05B 2F53D 2B2XH 5E1HB 3RWGB 1QFWI 4KJPC 4M48L 4MYWB 4PD4K 2G60L 2YN3A 1FN4B 1CS6A 1H3PH 2BHZA 2D31B 5F88A 4Z7WF 3I84A 5IBLC 1YPZE 3DVIA 3Q48A 4C55A 4HLJA 4KWUA 3OF6D 4R97C 3BH8B 4XTRD 1UQSA 3I6KB 3RBSA 5BV7L 4FQ1L 3C60A 1R5IB 3JSSA 4FQHB 4RQQB 4K3DH 1RJZB 4MAUL 2ZUYA 1ZHKA 2UYLA 3MSPA 1FGVH 4WW2B 3OKNB 4JO1L 4HBCH 1T1ZB 5E9DE 3CLFL 1H3TA 3B4NA 4S1QL 2VXQH 2O5YL 1MFDL 4RBPH 2MCG1 4ZNCD 3TT1H 4CU7A 3QPQD 5GIRB 1T6VN 3G5ZB 3V95A 1D5IL 3S7GA 4U2YA 4K7PH 4BA8A 1BIHA 4C59B 3L6FA 5J6GA 3QUZC 3NN8B 2QR0B 3S3PA 4WWKC 2D0GA 3FOMA 3V52L 1E4XH 4L1HA 4LGSB 1IGIH 4W6WB 3S88L 4D0CA 1MCKA 4U7KA 4MLSA 2HT3C 4D9RD 4WCYH 3SDXF 2OQJA 3UAJC 3TA3C 3FFCD 3PF2A 1WLHA 1HHHA 2JB5H 4MZ2A 4R90L 2XNAB 4LKXB 4LCUA 5GZND 1Z5LB 5I75C 3BGFC 5TGBB 2PYEE 5F6IB 2YN5A 2VQ1A 1JI2A 1QVOB 3UCRA 1FDLL 4JFZH 1LP9E 3BIBX 4RNRB 3D69A 4V1DA 2A9MH 2XICA 2J4WL 4S0SD 5DMIH 5C07D 2KZ1B 3LQAC 2Z31B 1OGAD 3TYFB 4KY1H 3U7AA 2H26A 3EYVB 4LPTA 1UQSB 4BELD 1S8DA 4XP9H 4K3DL 1JNLL 2X40A 5E9DD 5EUOB 1TJGH 3HG1E 5HGDA 1FZJB 4IJ3B 1SJEA 1FZKA 3FONA 3HC3L 4Y1AE 3DXAA 3OJDB 4HKJA 1P7QA 4X83A 3U4AA 2EYTB 4LARL 3FQWB 4NM8H 5KSBF 1EDQA 5SX5K 4WUUA 4F57H 1SBSL 3EDDA 4MQ7A 4F58H 1T4KB 1G7MB 3PWJB 3W11C 1TVBA 1ZEAH 4AJ0A 3JBG7 4P23B 1XT5A 4ZPTA 2X4SA 4HWUA 4RGMB 5D2NC 2ZJSH 4WHYG 5TQ2H 1CYGA 3BN3B 1IZJA 5CUSH 3O41A 4XP4H 5B38B 4ZFOA 4HH9A 4NO0D 4LCIH 3KYKH 4P4KB 5IBUG 4JGJA 4OIIH 5CJBA 2Y25A 3A67H 4KKAC 3CVHL 3LKOA 1CLCA 3GI8L 4Z0BL 5JLZA 4I4WA 1DFBL 4DZ8A 4KRNA 4O02L 3AY4A 1B4JL 3MRRA 1WEJH 1NCCL 1FDLH 5LGHH 4Y4FA 3WFBH 1MHCA 2VIRB 1EUUA 3BI9X 2OJEB 3D3VE 5F9AC 3MXVH 1MWAL 1Z9SA 1NC4D 1K6QH 4JY4B 5CJ8A 1ZANL 1RZ7L 4O5LH 5I76A 4UV4L 5GS0L 3DOSA 4FQJL 3F62A 5FEBA 1D5BB 1QFHA 1CDIA 4H5SB 1KPUB 2A38A 2Q20A 4NQSB 4PJ8C 2MOVA 4E41A 5INCA 3VW3H 2BSTB 1C16A 5I2IB 3IFNL 3V4VL 3ZKND 3DROB 3BGAA 3H42H 2GI7A 1G7MA 3HTLX 3C2AL 3PP4H 5MP6L 4Q9BA 4XNUH 4X4XB 1JZ5A 4N1CA 3L6FB 1HKFA 5IMMA 4EI6B 2O26U 4OM1L 3FOLA 1I1CA 4JKMA 4P2QD 1T5WB 5L0QC 3OB0H 1J5OL 5D1XB 5EU5B 5DJYA 3BUYA 4POZC 1PKQE 2KKQA 1BZ9B 3QQ9D 3LIZL 2D7OA 2BNRA 1OAQH 2YBRA 2J8UE 3T77A 3UX9B 2R1YB 3V5HB 1H5BA 1XF3A 4LCUB 3ARFB 4O02H 4QF1B 1ZT7B 5BVPH 5I8KL 3KNBA 3OKYA 1J1OH 3TZVD 3PP3K 4X9GA 1AXTL 3V5KB 1QVOA 4KHTL 2R9HD 1W0WA 4JKWA 3T65B 1QLRA 3VXQA 3IVKA 3QDME 4GQ9L 4DQOH 1P2CA 2GUOB 2JELL 1T1XB 3QIBB 1OCWH 1BVZA 3RGHA 5HHPA 2Q7NA 2WWKT 4JFPB 3RIFK 3QUZA 4WV1A 2HWZL 5IROA 4KMQA 1FFNB 32C2A 5D1XC 1ACZA 4ZO7A 4KK5D 3VXRA 1R3IH 1AGDB 4MD5A 4PYGA 2YPKA 4WW2F 3VJ6A 4LASL 4P2CG 3TIDB 5I1AA 4LCWE 1I9JH 5JA8B 4HFUH 2X1OA 1N6UA 4MNHA 2OL3L 5D7IB 1X5LA 2DWDA 4HXAL 5IGXH 3SQOL 3ILQD 1TNMA 3WUWG 3QI9A 1FVEB 4G7YL 4BFIA 1Q0XL 3RWJB 3MLSH 4JRWA 3CLEL 2ADFH 1L0YA 4NNPL 1ETZB 3LOWA 4R96A 1REIA 5DC9B 2FCBA 2CLRA 2VDKL 3MNVA 4M3JA 1YMHB 4GRLB 4ZFZB 1UCBL 1FV1B 4UAOB 1TZHB 3PWVB 3V7AG 4BQBA 2PN5A 3QIWD 4L8DB 2A6KA 5DD1H 3KAAA 2R2CA 4G6ML 1PJ9A 3VXSE 2PW2B 3OXSB 2DQJH 4JHWH 3WS3B 1SEBB 4PV8A 5DD3L 25C8L 1OP3H 5IKCA 5EU6E 3QQ3B 5EC1A 1FNAA 3OG6B 2HLAB 2QSTA 3PHQA 3V6FB 1I8KB 1A7BA 1FFPA 3NFNA 4R8WH 5F1NB 5C0CA 3HNVH 3S37L 4GSDH 3MLUL 1QFUH 4MJ5A 5FA4B 2CKBA 3OR6B 5CBAA 4O2FA 4N1EA 1R5VB 4NWTL 1GPOH 5GRJL 1C5DA 5DJ6A 4WFED 1MI5E 1A9BA 3NN8A 2PUQT 3VFPA 1UYWH 3ULUH 1CF8H 2GTWA 4YPGB 3GMOA 4U31A 3N1MC 1EA9C 2C7UB 2G60H 1FGNL 4WTXA 5I1KL 4HHAB 2ZG2A 3MYJA 4NPYB 3C6LB 4G9FD 1WISA 1FFRA 3LS5L 5TJWK 3FO0H 2LVCA 4PBWD 4X98A 3IJYA 4BZYA 2XN9B 3VWKB 4FQQA 3UZQA 1KNOB 4P5MA 3QIUC 3ZT6A 2VXSL 3MXWL 3Q5YA 2FJFA 1JTOA 3WFDH 1HCVA 4N8PA 1U8IA 4HJJL 1N0XH 3SDAB 1RD6A 2JKXA 4JREC 2R9HC 2A9NH 5IEKA 3MV8E 1T83A 1AE6H 4Q9QH 1G0XA 1JPGA 3VFOA 5L7XH 4PY8I 5DFVD 1FZKB 1HQRA 4X80L 5DURB 1RURH 1DLHA 3NIDF 4F9LC 2IANB 2BNRB 1QKZH 3MGTB 1NFKA 3WKNA 1K85A 2VLKB 4O00A 2G2RB 3MRLB 2AJXH 1KJMB 3O2WL 3VD4A 1BQLH 2A0LC 2OTUA 3TBWB 4NQXB 1MCDA 1PLGH 3MGOA 1QLEH 2BVUA 1ZT7A 1MREH 5T5NG 3R06B 3ZE2F 1KN2L 4JQVC 3BHBB 3ULUE 1U42A 4HK3N 4MQ7B 4OCNC 1CR9L 3IT8D 4X5WA 2GT9A 3GSNA 3V5DB 4L8CA 1OW0A 1CFVL 1WSST 4M7JL 3QDGA 3MJ7B 4PJIA 3T0WA 4ZFOB 1JMZA 4UQ2A 3VD7A 1OB1A 4S2SB 3WLBB 5C1MB 1FHGA 2AJSL 3PGCA 3WEXA 4AEIH 3JXAA 5D2LE 1BQHB 1OP5K 1PQZB 5D6CA 1C1EL 1Y18B 2VXTL 3RGVC 2GEEA 1J8HA 2NY6D 4TSCL 2D4FA 5IG7B 5T1MB 3DXAB 4KKNA 1I7ZA 5ERWA 5GISL 5I1EL 1ZHBB 4EN3B 3VFOB 1N4XH 3GJFK 2C4FU 3DECA 5FYLL 1LQSR 5IV2B 5IMOA 4M7LL 3S35H 3KVQA 3RNKB 4P5KB 5ICZB 4Y19B 2V7NA 2FL5B 4PG2C 4Y4HA 1IFHL 3C5JB 2VXUH 3GK8H 4XAWL 5H2BA 4D0BB 4GKSA 1AKJA 4ETQB 3GI9H 1EAPB 2E7MA 5IFHL 1RZGB 4L9LC 1EIBA 3V6ZA 3D1MC 1X4ZA 4KQ3L 3RHWF 4WFGD 5IESL 3UTTD 2BRRL 4Q6IA 5C2BL 1PDKA 4BSWA 3D25A 1BGXL 4F15C 5BV7H 3T3ME 2D7PA 1ZVSA 3U46B 4OLZH 1BFOB 4CVZB 1ONQB 1I9RH 2KPNA 1QSFB 2KZWA 3R4DA 4I2XE 3PHSA 4NOBA 5EIIB 2A83A 5KOMC 1JZ3A 5KS9E 3LKPB 2IJ0C 4DZ8B 2Z91A 4JM4H 5FHBH 1NL0H 3QEUA 2L0DA 1T0NA 3OAZH 5I8OH 1IQWL 3VI4F 4PRPA 5DXWA 4PRNA 3T08A 1ITBB 4P2QA 5L8JB 2AERT 1S3KH 1SEBA 3JVGA 4PV8B 3ZE1F 1A47A 3DX8A 5F6IC 4PJ5A 1A3LH 4LCIL 4UB0H 1WT5C 5C0CB 5GJTH 5F3HB 1MFCH 5CJ5A 5EDXA 3T0VA 3VFWB 2VDMH 1A6UH 1I3GL 3G6DL 2QSCH 3AB0B 4CL7A 3CDGB 3S5LB 4JFZL 1FL6B 2BXYA 5IBTH 3VFPB 3VXQB 1EO7A 3IVKB 4XNMA 4E9LA 5BJTA 3L7EA 2EIZB 4C4KT 5KVGL 3NCMA 1WBZA 4GKSB 4ETQA 4PJ9A 4MQTB 2ADIA 1K8IB 4B53A 2CIKB 2OR7A 5D7JC 5IB5B 5EUOE 3PDOA 1LO3H 3QDJE 2H45A 4GW4B 3EYOB 4KY1L 4P23C 4TRPL 3ULSB 1NAMB 4LPUA 5J8OA 3GRWH 3QBTB 5EIIA 1FZMA 4G6FB 1G1YA 1BJ1J 1OAYH 4QHNB 4HZAA 3FB5A 3BJ91 1BZQK 1FVEA 2P8PA 3PP4L 4FZ8L 5FYLE 2VN7A 4LNRA 2VISA 5DRWB 4KJYA 1RHHA 1JWUB 3T04D 4PRNB 1YNKL 3U7WL 2YEZA 3O45B 4WCYL 5B39B 4NZJA 3ECBB 2XOTA 4I0KA 5JOPD 5CEXB 3QXDB 1W8NA 3O3DB 4KTEH 3QA3A 4L29B 3C8DA 2GHWB 2PNDA 1JNNH 1QHPA 1IC5H 2MCPH 2R0KH 3BP5B 2NY6C 3CCHA 1W72B 4L8DA 1MCPH 1T0MA 1S9VA 2OZ4H 4PLOB 5DTFB 1RVFH 3H8NA 3DV4B 1EFQA 3TO2A 5KVGH 1K4CA 4HULB 3L7EB 3RNKA 5ICZA 1WEJL 3OKMB 4Z95L 3LPFA 4D0BA 4ONGL 1G7PA 4N8CH 4OZGE 3DGGB 3MNZA 1WIPA 3BYTA 5ESAA 1ZSDA 1Z9LA 2ZG1A 4UQ2B 3RJQB 3BZFA 2EC9T 5DHVA 5J3HC 2ITCB 4HWBH 1Z9MA 3KJ6L 1JZ7A 1KIQA 5KSAC 1BQHA 3U7YH 2GTZA 1KBGL 1Y18A 4H0HB 4PGCA 2KQMA 3PGDA 5D7SH 5FYJD 2PO6D 4YNYB 1CT8A 5LAXA 3SY0A 5JPNA 4WO4C 1YC8A 2IEPA 3X14A 1DBBL 3RWCB 4GBXB 4IS6A 5J1TC 1UH4A 3R1GL 4KPHL 5HJ3A 5IMOB 4TULH 5CGMA 2IALA 2E6PA 1EEZB 5JHDE 2A1WH 2HT4C 3H9SE 4R4NC 5F1OB 2N4IA 5FM5O 4NKOA 2ICWJ 5T33H 1OAQL 1TVDA 3DX6A 5EC2A 4LVHB 3OGCB 4P57B 1JPGB 3ARXA 3P11L 4BJLA 1N0LA 4PRAA 1MQ8A 4A6YA 1CCZA 2NY1C 4DZBA 2HRPL 1VB9A 1FGNH 4LGPB 4PJAA 1PYWA 4GO6B 2G2RA 3MRLA 1FAIL 1T80A 4LVHC 4M6OL 3QDMD 4HS8H 2PR4L 4Y5VB 1MFAL 3IGAA 5JOEA 2YZ8A 4YQXL 4WI2A 1AR2A 3VW3L 3OXRA 1Z6JT 1OQXA 1MH5A 4J8RA 2EDBA 1LO2L 4M7ZB 1EGJL 3PGDB 1NMCC 4EI5D 4FA8A 1LVEA 4LBEB 4U1NB 4LNRB 3VXOB 3OWEA 1R5WA 4KRMB 4K8RC 1G84A 1P4IH 5D72H 3IDJA 3IETA 1D5IH 4CU8A 3MRCB 4MA8H 5JUEL 1C5BL 4H0IA 5C8JB 1IMHC 4G7VH 2B7DT 2VL5B 5CJQH 2OR9H 1NLDH 2I07B 3LKNB 3MV8D 4CMHB 4WI8A 4PRIB 4FQ1H 4N0CC 4JM2F 4ODTL 4Z7UE 2ADFL 4OGXL 3ZE1E 5D1QB 4LRNH 2IPKA 3TCXA 5I1DB 1MCQA 3OKKA 5FECA 4K7FB 1RZKC 1HKLH 2X1WL 2C3XA 4QRPE 5K9QI 1NAMA 4FFYL 1XGTA 1FZOA 3CFBA 5E2UH 2EDOA 1S9WA 4YDKL 5J06A 4NQDA 5IEHA 4QXUL 3O3AA 4MX7B 1F6AB 1GGBL 2VXVL 2DQIL 3MJ8A 5BQ7B 3BFOA 2W65B 4M03A 5GSRB 5I74B 3HI6L 5FK9A 3DO7A 1T7WA 3CVHH 4X6DF 1Q38A 1CD1A 3WKML 3W81A 3KYMA 4F37F 4WWID 1FP5A 3V6FA 4WI7A 4N0RA 1BFOA 4CVZA 2AJYH 3QXDA 1JGEB 1MNUH 4Q6IB 2NW2A 4PJBA 5I17B 1XAUA 3HZYB 1BBJA 1HWHB 3WO3B 3G6AA 3K3QA 3FHQA 5DEFB 4F58L 2NY0D 3EFDH 5I8EB 1D5XB 1U8JB 2YPVH 5LWYH 2NMSA 4G6JH 4M7LH 3S35X 4GH7B 1T2QH 4XPBH 1ZLUK 2F54E 2E27H 2D4DA 1UYWL 4PY8J 1J7VR 2X70A 4EN3A 1KPVB 5JIHA 2DQHL 1NBZA 3RI5K 5IMLA 1JPTL 4UOW1 2N1KA 3A6BH 4WW2A 2ITDA 5C6PB 3VXSA 1F4HA 1Y0LA 2V7NB 2H1PL 3BZDA 3FB8A 3VG9C 1P84K 2J8OA 2PXYC 3D18A 3W0WB 3WNLA 1PKOA 4QY8B 3VFWA 3P73A 2B0SL 1OF2A 4I3SH 4JFEB 2YD3A 3GMRB 3ARWA 1OT2A 2XQYG 5D2LB 1X5AA 3QUYD 2QSQA 2HVJA 3A0OA 3FT3A 4U2ZA 4ZPVB 1F00I 1KB9J 3CFEB 3IGAB 5TH2A 3RWIA 1PAMA 2P42B 4DGVL 4Y8DC 4N0YL 3O6KH 3EOBA 3RVVD 2I26N 4PJ9B 3TBSA 3MRKA 5IQ7H 2UUDH 1Q0XH 4AEIL 2HP4A 3MNWA 5JMOC 2X4PB 5M7QA 5JXAL 5A40E 1L6XA 1UCTA 2DTMH 1MCRA 5DVLA 5H37H 5C8JA 4Z18A 4ZS6C 4AEHH 4FQLH 4HZLA 5HHNA 5FO8A 4DEPC 3RY6A 1J0JA 2J8HA 5HDOA 4RFEA 2HFFB 3U79A 3MRMB 1NUFA 2PW1A 3VGBA 2HTLC 4RWYH 1F2QA 3CX2A 3LEXB 3GJEA 4LL9A 5FCSH 1CTNA 4QHKI 4Y5VA 4Z0XA 5ENWB 3WUWB 1B4RA 3C5SA 2E8ZA 1FZOB 2DTSA 4PYHA 3SE3C 3CLEH 2XN9E 3HC4L 1I9IH 5TE6L 3U6RA 3LN4B 2ARWA 4LVOB 2H32H 2VL4A 3ARBA 2BC4B 3K81A 4ODSH 4NNYA 1OARL 2Q8BL 3VXRE 4OZFG 4ACPA 3MRRB 2E6JA 3MYJB 3V7MA 1Z9OA 5F7WC 3TO4D 3T0EB 1HXYA 2VIRA 4FNLH 1P9MC 2OJEA 3FHAA 1JNJA 1EEUA 4HF5H 3UPRA 5I8KH 4XNXH 2LE9A 3NCBB 1RU9L 2GFBB 4U6HA 3RPKA 2FJFB 3H6JA 1JI1A 3ARGD 4JDVA 4Y4FC 4OCLC 1KIPB 2Y7QB 1VGEH 4HS6A 4MXWL 4H5SA 5JHLL 4JN1H 4RFNC 3LDBC 4XHQA 5K9KB 1SEQH 4WHCA 3IDNB 1HHIB 3C60C 4U3XA 4GBXD 3O9WD 1NUNB 2FGWH 2Y9RT 1DEEB 3FB7B 4OM1H 5CEZE 1CQYA 4FZ8H 3DHMA 5HJ3B 1UCBH 1DLHB 2I60L 2ZUSA 4MB3A 1BJ1H 5BRZB 5FOBB 4J1UA 5DQDH 3BKMH 4YDVB 1G7QA 3B6SA 2UVEA 3ZYZA 2FZ3B 1C16B 2AABH 2EIDA 3MNZB 3WFEL 5M95B 5I1LA 2CUMA 5C0CE 5HHOD 2XYCA 4X4XA 1FNFA 2Z93A 4K3JL 1T7ZA 4JY5H 3FT3B 4EUPA 5DSCB 2RQ8A 3RVUC 2B5IB 5FYKD 1KPRA 3ARBB 4OZ4A 3TPUB 5I66B 3DYPA 4CVXA 2VUYA 4IRJA 5DJ2A 4X0KB 1URLA 1ZV5A 1RUMH 4JAMA 3HLAB 3BO8B 4X7TA 5DO2D 2X4RB 1HSBB 4NP4L 5IQ9A 3O6KL 4ODHL 4EDXB 4YBLC 4JG1L 2BY3A 2VH5H 3ARVA 3BGFB 5ALCL 1HOCB 2DYPD 3WHXA 1RIHL 5D1ZA 3OMZA 1ZHNA 3QHFH 1LNUB 4UBDD 2IALB 4FMKA 4JANA 2P5WA 3C9NA 4N0FA 1JF1A 1DZBA 3WO4C 3VFNB 3BP6A 1TJIL 2H2SC 5GPRA 1UJ3A 3WXWH 2DQTH 2XXMB 3O4OB 4DN3H 1T1XA 1IQWH 1I9JL 4XTRC 2FIKA 2PYFA 2XKSA 3KJ4B 4O2CA 43C9B 4QWWD 5D4QA 1NC2D 2FJHA 3GIZL 1BQSA 4RCAA 5IROC 3FT2A 5L2KD 3MRKB 2CLVB 1JE6A 5LQBL 4Q2ZB 2RBLA 4XHJD 3HC3H 3VFTA 1FSKC 2HAZA 3TPKA 1QZ1A 2V5TA 3NCEB 4LCYA 4TUOA 3A67L 2PYEA 3BP7A 3H9SB 2XZAH 3QO1A 5EPMA 2A6DA 1UEYA 3OF6A 4HIXL 4BZ2H 5HYFA 5K9QG 4P59H 4HG4K 2R4SH 4FG6D 2YC1B 4NNXB 4JHAH 1F45A 4R4BA 4Y16B 3VFRA 4EDWL 5L7XL 3FMGH 4XGZA 1EEQA 4O4YL 4MSWB 4EDXA 1D9KD 1R3JB 3BAEL 5F7NC 4P2QB 2V5MA 4JY6A 5ILTH 3THMH 2CK0L 3NFPA 5BZDA 2HG5A 5C0FB 2G9HA 3U7YL 3KPQA 4HXBH 2ITCA 4ZFFA 3MXWH 4C56B 1OPGH 1QSEA 3QCUL 5BS0B 1ND0B 3PDGA 1GRWA 1JYXA 3MLZL 5KS9B 4J4PC 2WIIB 1WCBB 4OLZL 1IGCL 4YHLH 4Z7VE 4OLUH 1UWXK 1D6VH 2X4QA 1HIMH 4DK3A 1D5XA 1U8JA 4CN1A 5INDA 5I1HH 3IDUA 5CILH 4KVCH 1HN1A 1SHMA 5JW5B 3C60D 3T3MF 3KPRE 3D85A 3GBNL 4O2CB 43C9A 4KKAD 5KVDH 2CH8A 1KGCE 1FO0H 3GI9L 3P40A 2F53A 4JO4L 4NQDB 3RI5F 4XNUL 4G5ZL 2QHRH 3SDDC 4Z5RB 1A1MB 1A6PA 2NNAB 1QSFD 3FRUB 2CMRH 4U1GC 1MJ8L 1U2CA 1PG7W 2HFEB 5CJOH 4XVTH 4PRPD 2D3VA 2XZQH 2YD2A 2YKLH 3UP1A 4TPRH 2NZIA 2J12B 4YWGL 5JIKA 2V9QA 4G7YH 1J8HD 1ZLSL 5C0BD 3DYMA 4UTAH 1NAKL 3ZT7A 4K3JH 1EK3A 4QOKB 3STLA 3BDBA 4PJXB 4JFEA 2UY7A 1J18A 5IK3A 3T0XA 4ZYKB 3AMKA 4OZIB 1JPSH 1YEDB 2ATKA 1JF5A 4U1KA 5DO2C 2X4OB 5ILTL 3N9GH 3VFSA 5JHDA 4PLNC 3MRBA 3SGDH 5DUPH 5ETUA 3MROB 5A3IC 4HWNA 4OCXL 4D3CH 3D87B 3TIEB 12E8H 1DVFC 2H1PH 4P3WA 2HA1A 1WWBX 4QF1A 3B8YA 4R2GB 4Y2DD 3U1SL 4X6DA 2VZ3A 3RVWC 2EEAA 3P4MA 4IDJH 4FOMA 2IWGA 1WITA 5FYKL 1ZHBA 1AHWC 4NQEA 5IOPB 1CVSC 2NY5C 5I1IL 2D0FA 1QBBA 4JB9H 5IGXL 5KTEH 3ALPA 5DK3A 3DUSB 1AY1H 1PD6A 4Z7NE 3MRMA 4PJGE 4K94H 1CXFA 2XKNA 2R39A 3O8XB 4PGJA 3UTOA 2BVOB 1QYGL 4PFEA 1U8HA 3BQUD 1OP3K 1DQDH 3S34L 4XVJH 1G6RB 3I02B 5D2NE 4C58B 3O4LD 3LMJH 3PDDA 4JGUA 1CQKA 4GKNB 3MV9A 3SE9L 2DKUA 1PY4A 4O9HH 4W81A 1B2WH 3UZVB 1JV5A 2WM0A 4NNYB 2RIKA 5IIEA 3QH3A 2EXYC 15C8L 2YA2A 2GJ6B 1RHFA 3T3PF 4Q9CA 2C3VA 3Q0HA 4FFZL 1NCTA 4ERSL 4DGVH 1LDPH 4GBXC 3BDYL 4GXUN 1MCWM 2IBGA 5E8NA 2MCPL 4U6HB 4U1SA 1EGJH 2FGZA 3BH9B 4QHMA 5F1IA 3SBWA 5DJDA 1NEUA 4KI5F 3MRQA 3C5SB 4Y19D 1I1FB 1IAOB 4JKPL 1LK2B 1R6VA 2QHLA 4ZODA 5A16A 3VXUE 1QFWH 2HMID 1NKRA 2OL3H 4Y4FD 3KPSA 1DLFH 2WW8A 1F3DH 1A7PL 5KSAB 5E4IA 1CR9H 3ET9F 4OCWL 3G6JA 1J05A 3CH8A 4X6FA 4HUKB 3B2VH 5EN2A 3RA7L 5E9DA 4OD2A 4OF5A 4LSPH 4ETYA 4B5EA 2UWEF 2V9RA 3ZLQC 4OI8A 5FO9A 5ABDE 3CFDB 1YUHA 2WUCH 5HHME 4OLYL 1G9EA 1KJVA 4NQED 4G43A 3FT4B 1EJOL 1OGAE 4LEXL 3DV6A 2BNUA 3W11D 5ETUB 3X12B 1KB5A 4E42B 3D2UA 1OARH 3GIVA 5IVZB 1RZKH 5C9JB 1KC5L 2H26B 4I48B 1AGEB 3EYVA 2J88H 1RMFL 4PJDA 1YQVL 3O3DA 1HYSC 4UAOC 3BSZH 2XG5A 3RUGE 1S5IH 4WHDA 3VRLF 3MRHA 1BX2A 2YUVA 5D5MF 3IAGC 3G5VA 4XX1G 1NGXB 3MV9D 2EIZA 2P45B 5FGBC 3IFPA 5J1AB 5EOQL 3CH1B 4PJHA 4UBDC 2R2BA 4LSQL 3MLXL 3PABB 1J5OH 1AE6L 5SWZA 4KI5D 3EJYC 4MGXA 1TZGH 1B90A 3KPMA 4DVBB 2MQ3A 1BAFL 1CD9B 2GSGB 2XA8L 5I73B 4QXGL 4XNYL 4NO3A 2C3HA 3HZKB 1YECH 1MEXL 3P0VH 5F6HJ 3FB5B 2V2TA 1X5KA 5T3ZL 1J0HA 4R7DB 5FDWB 3VGEA 2ZG3A 4L5FH 3KPOA 2MKWA 4P0DA 4G8GE 4YX2H 2V17L 1BLNB 1CF8L 1ZHLA 5A1AA 4X9FA 5D72L 3V9FA 2I60H 4HS8L 3CFCL 4EXPX 1VENA 4N0UB 3F7VB 1KYOK 8FABB 5E8PA 4FTVA 2GK0A 3LEYL 3KWWB 4CMMB 1A7QL 1J86A 4GLRH 3GMLB 1A21A 2ZSVA 4P57A 5INDB 1UXSB 5T5FL 1Q9KB 1U8NA 4OFYD 3E2HB 1UWGL 4HLZG 1KELL 4DCQA 4DWHA 1KN4L 3FB7A 4G8EB 5EU5A 2X41A 4U6TA 4HIHB 1BZ9A 3AUVA 4F8QA 3S37X 1SEQL 4HGWB 4ODUA 3OPZH 4M02A 2ZCHL 4WI4A 5J57B 4E0RA 5DJ0A 4QLRA 1F4YL 5T3ZD 2NY4C 1IKNC 2HFGL 3NTCH 1YEHH 4JY4A 5FYKU 2APVA 1I9IL 3MLSL 4WGWB 5JIIA 5IHZA 3TH4T 2DS4A 5I6XC 4YBLB 1JJUA 5EU4B 1G6VK 5HVHC 2R4RL 1QLEL 3CMGA 4GRWF 4Z7QE 4D2NA 3QXVA 3E6HA 1A7RL 1I7TB 1YY9D 4IHOB 5C9JA 3RDTC 4C57C 1QD0A 2LU4A 2JJTA 4AIZB 5C07A 1EZVY 1RZKL 3SPVA 4LQFL 3ILQC 1IJ9A 3GJEB 1ZLVK 3Q6GH 1AFVL 2JJUA 1NANI 4UT9H 2YD1A 5CSZA 1WBXA 2F8XC 2A77H 4M6NL 4Y8AA 3RL1A 1U3JA 2V5SA 1LE9B 5E8DL 2J1KA 3U0TA 3ARFA 4C56E 5SWQA 3L3JB 3GMNB 1MCSA 4P23A 5F97E 5JMRA 1GVIA 1Q8MA 3O2DL 1XF2B 4MD0A 4OKDA 1ZT1A 4U6VL 4TNVF 1NFDE 3IETB 1BBDL 4WW1B 1ZS8A 3DTXB 3VGDA 2OLDA 4GKNA 3VGFA 2IFGA 4JFQB 5C0RL 4LBEA 4U1NA 5F21B 3V0WL 3RX8A 2ZSWB 5HDQL 5EWIL 4PP1C 1MI5A 5GS1B 3MACL 1UFUA 4LLQB 1L7TH 1EBAA 1UVQB 1INQB 4RX4D 2OTWB 1QR1B 1UB6A 3MC0A 2R2EA 5MERB 5E8PB 3UBXG 1Q0YH 3L5IA 4R0LA 2X7LB 4F7CA 2A6JA 4LIQH 1YEJH 1RFDL 4BUGA 1RAMA 2A0LD 4DVRH 3FB8B 2WLYA 5DD0L 3C09C 1YPZB 3HG1B 2BDNL 5IW1A 3KPLA 3B9AA 5I15H 3X13B 1MFCL 2HVJB 5LGKA 2Q76B 4AMKH 5HHQA 5C3TA 4L4VE 3GSUA 1YNTB 3RU8L 1XGPA 1BLNA 3GIZH 2LV4A 3LEVL 4RMRA 1FG2A 2YS4A 1DBBH 2HFEA 4OGYH 2AVGA 2P8MA 3TN0C 3VFVA 3RKPA 3VWJB 3LDBB 1E6OL 5I19H 2NW2B 4PJBB 2R23A 1IAMA 2RHEA 2ZOLA 5DT1L 1KULA 4YDJB 3PE9A 2FBOJ 2GITA 4ZS7L 3GMLA 4F8TA 1MIMH 5TE6H 3M1BB 3SDDB 1YUHB 2FNBA 1QBAA 4XWGL 1G7JB 3ARBD 4XWOC 4ZUUB 1T03L 4KROC 4J2XA 3TJEL 3QULA 5FHAL 4G3YL 2AJ3A 3OR6A 5JQ6H 1KPVA 4TSBL 1C5CL 3CZFA 5JDSB 1GGBH 1ES0A 4WW2C 4POYA 5CBEB 3WSQH 2HKHH 1UM6H 3CSGA 4IMKA 3WJJC 2YA0A 1V8HA 3EJZC 2HH0H 2JIXA 2PXYA 5T3XL 3F58H 4R4FH 4UMGA 1U8QA 4JY5L 1KACB 5BVJB 1TFHA 1CD0A 3SCMD 5E9DB 3EOTL 1CI5A 3MBXL 5JPMA 4YQXH 2X44D 5F8QC 1KJ2L 4WFGE 1KSRA 3KPPA 4Z7VB 1U58B 2FYYB 3TIDA 1SJHB 1SY6H 3ESVF 4N5EC 5EZJA 2GSIB 3KYNB 4OCSL 4XGZB 1MLBB 3WFBL 2P8MB 3HUJE 5GHWL 4HCRA 5DJZA 2VC2L 5KSAD 2CKBH 4TYUA 3CX5J 2XWJB 1YEIH 4HIIB 1W8OA 4M1CC 4PS4L 1CDBA 3LD8C 1LO0H 1IC7H 2LABA 1DUYA 3QUZD 5FV2A 3D9AH 4NJAH 3ZKMD 4I48A 4U49A 5TDOB 1ND0A 3JV6B 4XWGH 4LU5L 1N8ZA 2QV2A 2R0WH 3L3IB 4YXLL 3MV9B 3MJ9H 2VJXA 1FVCA 1R5WB 3MRHB 3TBWA 4LP4A 5GJSH 1Q9LA 5ANMA 4KXZI 2YMXH 5EBLA 1T89A 1YEFH 2EE9A 2AK4D 4F7CB 1OAZH 3ARQA 2W9LA 1RUKH 3ARFC 5TFSH 3OBAA 2AI0H 5D7JD 1NH6A 1QBMH 2Y06H 3KPLB 1RZJC 3ARZA 4U1MA 4XT1C 3U1SH 1S7TA 4JFQA 5B3JF 4LLYA 1DJSA 2XZAL 3GSOA 4ELMA 4LP5A 3CUPA 3QR2A 1CFTB 3HR6A 1JL8A 4WUUE 1KPRB 5C71A 2DD8H 5DJXA 5EH1A 2APWA 1FORL 5IFAH 4U1HB 3H7BA 4HWEL 2Z0BA 7CGTA 1KB5L 1UVQA 3TBVA 4Z7WB 4TUJA 3LD8B 1PQZA 3NPSB 2X4RA 1C7SA 4XBGA 1OAKH 1NGZB 3LN5A 4ZOAA 4P5TB 3LV3A 3RIAK 5DYOA 1MCOL 4DKEH 35C8L 1PKQB 4KAQL 4G6AD 3BPOB 4JDVB 4WEBL 4Q6YA 1NDGA 2WUCL 1ZLSH 3G08A 1T20B 1BQHG 2IMNA 4GG6F 1FRGH 2X2YA 5K9KA 4ZSOA 5EU6D 4DW2L 2GK0B 2NX5E 1SVZA 1EEYB 4ZUSA 3V6ZB 5KAQG 4Q58C 2IF7A 3BYYA 3P4NA 5B4MC 5JDJA 1GC1C 2BERA 5FO7A 2YWZA 5DRNB 4M6AA 3VXMD 5IVXA 4QRUB 2DLEA 1O7VA 4PREA 4ERSH 1C08B 4KVCL 4LSVL 5GRXG 3G5XA 1M4KA 4DCQB 2ESVE 5KVDL 5C0DA 4LHJB 1CZ8L 3AU1B 1FGVL 1KIUA 4RAUB 4CUCA 1EFXB 2BSSA 2EDEA 4PTTB 3TNNB 2CXKA 5IR1B 4MJIE 2QQKH 4N0UE 1VFBB 2V6HA 2JCCA 4U6XA 4JAMB 2GSIA 3KYNA 3GRWL 4PTUA 4M93C 3DRQA 4L8SB 4P46B 5IIEB 2VISB 3EDEA 2FHBA 4P5TA 3GSNB 2H6PB 4WUKH 4JVWA 4XXDB 2DKMA 1XFPA 4C4KO 2ORBH 1MFNA 4WW1A 1NDGB 4H25B 3SPVB 2DICA 1IGFH 1NMAH 1K2DB 1ZA6A 2NY0C 4K07A 4JVPA 1N6QL 4OTXH 3SKUD 4ZNEA 1HQ4A 3IDMB 5DJAA 5L2JA 1R5IA 4FQHA 1U3HD 5H35B 3ARDD 3BEWA 4KI1A 2WV3A 5H8DA 2JIXD 3B9VA 4X6EA 2ZUQB 2NY1D 3QFJA 4M1GL 4Y5VC 4D9QD 3GGWB 5C6TH 4ZXBA 1I1AB 4YEFA 1BWMA 4Z77B 4J3UA 2HTKC 1EO5A 2FB4L 3E6FA 5EPMB 2WANA 3SJVD 2AV1A 4L4TA 4M7ZC 3I9GL 3SDCD 4PRDB 5KBNC 5A43C 3L3OA 3U2SB 3VXME 4ENEC 2YD6A 1UA6H 4WO4A 2DI8A 3UBXI 5D70L 4MSWA 3B9KB 3Q6GL 2X89D 4RGNE 3TBYA 1JPFB 5JXED 4RDQF 4LMQI 1IZKA 3RWFB 2HG5B 3BZ4A 3EDKA 5GS2D 3TVMC 2CXGA 5DK2A 1QSFA 3EYSH 4LCWB 1LEIA 1KOAA 1ZWIB 4P9HC 4D9RE 5JW3L 2ATKB 3RWEA 2NQCA 2E3VA 2EYSA 4LCCC 4MA8L 2L7UA 5JUEH 5E8EB 1IAKB 4YDJA 1FIGH 3TFKD 2JCCF 4G7VL 3FO2A 4JRXB 4D9QE 3UTPD 4PJEB 4HPYH 2ED7A 4MJ6B 3GJFH 2Z31A 3QAZB 2R56L 3BN9C 1GYAA 3C60B 4JKKA 3VD3A 1FFNA 3WS6C 2ESVD 3FJTA 3QUMB 3AAZB 5D8JL 5I15L 2HT3D 3G5VB 1U8LB 4AEFA 3HRZB 4PY7A 1IEHA 3OB0K 3QFJB 1F5WA 2AGJH 4K9EH 4RAHA 3UTZB 1YDPA 1P1ZB 4NT6A 4WNQB 5DMYA 2NY4B 4X7EC 2HT2C 4PJAE 3KLDA 4JVUA 1ONQA 3BKCL 1ES0B 2QQLH 2Q76A 3VG0H 4F7MB 5FOBA 5BRZA 1I1AC 3NIDE 5T1LB 1MWAH 2P5EE 3TBYB 3W2DH 1IM9A 4NNPH 4XPHH 4FP8H 1ETZA 3N1FC 4R96B 2ZUTA 4HH8A 1TENA 3H9SD 1KTDA 4RGND 2YPLD 3S3JA 1EEYA 1U8PA 3IDYB 3MPCA 3ZZ1A 3GHEH 3OKNA 3U48A 3LQMA 4E5XB 5IVXB 1RMFH 2W0KA 4WUUD 1Q94A 1ZT1B 1G0DA 2I07A 2PKDA 1W0YT 5I9QC 3LSOA 2EICA 4LSTH 3O9WB 1HOCA 2ARJA 1RK0B 2FO4A 5F7LB 1VERA 4KU1A 5IT2H 4K23L 1AHWA 1I1FA 1IAOA 5HYIA 4MB5A 1KPUA 3V0VA 4R26L 4LSQH 3ARGB 3CPLA 3HZVB 4MCYB 4OSUL 1M7DB 1SYSB 5I73C 1L4IA 2EEDA 2JELH 1RZJL 2M2DA 3QIUD 4QHUA 3MJ9A 4OI9A 1C7TA 3H9HA 2H3NA 2NXZB 1KG0A 4O51B 5IMMB 4JG1H 5HHXL 4YHPB 2M8XA 1QQDB 3MLTA 2DF3A 3GHBH 4XXDA 1UA6L 5I8OL 3MCKA 2ZCHH 4XCNA 4BKLB 1MCNA 3QH3B 1G6RA 3I02A 3R8BB 4NFBA 1T66C 2HJFA 3VE0B 4S1SH 5JA9A 5MI0B 4LEOA 4TVPE 3MZTA 4LLYB 4KQ3H 4H1LG 1VHPA 2LFGA 2GTZB 4TUJB 3IFOB 4FQPA 1YEEH 1BGXH 1G7HA 1I4FB 4GW1B 3QA3B 2DJ4A 1MF2L 1EJOH 4WI5A 3LQZB 2JB5L 2BDNH 5J7CC 4OZGA 3BP4B 4CN6A 3RWCA 2CDGA 1M6OB 4U6VH 1RUKL 2FEDD 2OK0H 3MLPA 5ID0A 3LN5B 1B88A 2VLLB 5HGBA 2QKIB 2EDRA 2P7TA 4H20H 5HI4C 2IMMA 2R15A 4UT7L 4YGAB 2VDNL 1E28A 3QQ9C 2ZCKL 5ECJE 4PY7B 4NQVA 1BOYA 4GSDL 5JNYA 4PJIF 1ZSDB 3SE8L 4FRWA 5ICYA 1M7DA 4B41A 2MHAA 1S7TB 3VMNA 4ODXA 4MXQC 1KIQB 4IBLT 5DZNA 4G6MH 4ZPVA 3W9DA 4EDWH 1JN6B 1OAYL 4A2MA 2DJSA 1MWAA 4O5LL 2E5EA 4HMCA 4M00A 3MLVH 4UTBH 1H0DA 1H3VA 5ALBH 3K4AA 4LHUB 1X4YA 2VLRB 1ORQA 3MO1B 5FUCC 4G8FB 3QDGD 5BMFH 2AJUH 3D0LB 5FYKH 3C8HA 4OFPA 2OM5A 4QOKA 1MREL 3QIBD 2Z31C 3ZTNH 1XEDA 4LPWA 5AAWA 2DYPA 4ZYKA 3UPAA 4ZSOB 3M45A 4WRLA 1TIUA 2OP4H 4OZIA 4M48H 1MFEH 4XCFH 3UTTB 4P2RA 2DBJA 4MZ3A 5EO0A 3QNYB 3PWVA 4PJFE 4Z7VF 1DBJL 4FTVB 1KCRH 3C6SA 4MXVF 2MSPA 2Y06L 1SM3H 4RZCB 5J12B 4TSAL 1V3LA 1N2RB 4DTGH 3BPNB 2E9BA 4I0CC 3M8OL 4MB4A 4TUKL 2XG4A 4U6YB 4APQA 3IFPB 3O6ML 3U6RB 1S9WB 1OAUL 3B5TA 4OSUH 5ANME 1BEYH 4G8EA 4P9MH 3W5NA 5D7KE 3V6OE 3O8XD 1A9EB 2V2TB 4XP5H 4DQOL 4KQ4H 4ZAKB 4K55A 4HD9A 1VA9A 5E5MB 3RFZC 3TVMD 3MR9A 5D93B 3CDCA 4OKVA 5DGQA 2HFGH 1FO0L 3GMMB 2F8VA 1GGIH 4N8VA 4KK9C 4NJ9L 5E7BA 2Z4QB 1QBLH 1JPFA 3ORJA 2QJDA 3I75B 3N1QC 4K3GA 4JFPA 3QDGE 4CMMA 1JYNA 4NO0A 5I8EA 4R7NB 5L9DH 5FV1L 4G6KH 1V3MA 2DQEL 3LKSB 2DQFA 4M7JH 1ZAGA 5CS7A 5D1QD 5CD3A 4CKVX 1N59A 2F8OA 4UV4H 5GS0H 5J6GB 5LGJA 1NLDL 3GGWA 1BHGA 4ZTPH 2JE8A 5MEOB 3KPRA 3KYOA 3K4ZA 4IRJC 1UZ6F 1LE9A 1OTSD 3UMTA 4TNWF 2ITDB 3UEZA 3HFMH 5T33L 3NACL 2RB8A 4JFYB 3QUMA 4QY8A 3B9KA 3MBXH 4GW1A 1LK2A 2D7NA 3OL2A 3P0VL 4F37K 1NPUA 2CGRH 3GB7A 5JZ7D 1DN0A 5FXCH 4YE4L 5F7EL 1CGSH 3M07A 1WVZA 2CR3A 3HS0B 1AR1C 1SJVA 1MRCL 2BFVL 3GMMA 4OIAA 4XP4L 4YUEL 4LRIC 3IDNA 2DLTA 3Q6FB 2Q1EA 5L8KB 3UBXB 1WFOA 2BSSB 5A2IH 5KZCD 1X5GA 1M71B 3JWOC 4GS7C 3WNMA 2NY5H 2PTVA 5HYQA 4IMLA 1DFBH 5GGVH 3WEXB 2AK1L 3LB6D 1DQTA 3QDMA 1IGYA 2BCKA 4JPIA 4YPJA 4LARH 4WUUB 2MHAB 4X8XA 1EAJA 3E0GA 5I1LB 1F3JB 4AMKL 1TJHH 2W0LA 3QEQA 3MA9H 1DQJB 4ONGH 3O0RL 2ZCLL 1I7ZB 3T3PE 1KXQE 1DR9A 3LRGA 2ZNWA 4XVUD 1WBXB 5E5UB 4EI5A 1BREA 3FQXB 1TCMA 2PCPB 1RUQL 5DK0B 4KTDL 3SN6N 3VI3F 5FGBA 3BKYH 2R8SL 5KOVC 5CZVH 5DHVB 1WFNA 4EUPG 4Y4HB 4QTIH 1FFOB 3OX8B 2W38A 4WTZG 3NA9L 5D7SL 4R8WL 4M1GH 3MOQA 2CGRL 4B0MM 3SJVE 4N90D 3BHBA 4NM4H 1OOAA 3OKEB 5IB3A 3O6FC 3RWHA 4Y5YB 4H26A 2IAMC 2YSSA 2QTEA 4J4PA 4WI6A 1S7SB 4OUOA 3D39B 1IC7L 3QIUA 3VD5A 3LRSA 2XTJE 4M5YH 2DQDL 1DVFD 1QRNA 5MEND 4NO3B 3LKQA 1CGTA 4X6CA 5EU7C 3U9UB 2IANA 3MGTA 1WCBA 3OGCA 3QDJD 1X5XA 4HS3A 4PJ7F 1NLBL 4I3RL 2O61A 5FDWA 3PWPA 1DQJA 1QFOA 1A8JH 5D1QC 4APQC 1EMTL 1ADQA 5IMKB 3OR7B 1RUQH 2EDTA 3VFGL 2X1XR 1TETH 3BKYL 2R8SH 1S9YB 4JRXE 4LKCA 4AZ8A 3SKNB 4NNXA 4FFVD 5HI5D 4YGVA 1G9MH 1NGWB 4JDZB 4DK6A 5GGQH 5JO5B 4HJ0C 1CDCA 4NBZB 1K8IA 3SOBL 1A1OA 4LFHG 2JB6A 1BOGA 2VLJB 2ZUXA 1VPOH 2KBGA 3I75A 1MIML 3ZDXE 1S78D 3DX9B 4EUPH 3PL6B 1P1ZA 4NT6B 1NCBL 4C56A 1YYLH 4KK8C 1FZMB 1KIPA 1MLBA 4MNQA 2YZ1A 1YY8B 2XT1B 3D0VA 4MDIB 4YUEH 5BW7C 4BUHA 5TFSL 3KS0J 3D69B 3K80A 3DSFH 1XMWA 3MLYH 3V2AR 4Z5RA 1G7JA 4ZUUA 4DUVA 3CSPA 3WIHH 1LEKB 2H8PA 3BEWB 3WFCL 3DRTA 3EGSB 2K7QA 2R4RH 5EBMA 4XMLH 4PG2A 4X8JB 4Z77A 4IRSB 2P49B 4GG6A 1MY5A 1H5BC 2W65A 3B9KC 4X9BA 5AAMA 2H9GB 5EUOF 2PXYB 2JJVA 5HD8D 5E99H 1SJHA 2HJKA 5FF6B 3TP4A 5H37G 5GGSY 4XPGH 1ULVA 1WGOA 3K2UH 4RQQA 5IVXF 2CUIA 1V7MH 4E41E 1QFWM 1BF2A 1AC0A 5HGAB 5E70A 4F7PB 2UZIL 3HG1D 4LRIA 5EUKB 5T5NF 5M94B 5CSGA 3CXDH 1ORQB 3NGBB 4KKLC 5EZJB 4Y4KD 3QEQD 2A6DB 3EUUA 1YMHA 4GRLA 2H32B 4IOFD 2AKRB 3TYGH 5ADOL 1CBVH 2AEPL 5DJZB 3QG6B 2IAMD 1WV7T 3SO5A 3W39A 1R3KB 4WV1C 3LRSB 3FFCA 4P99A 5DF0A 3KR3H 4LCWD 5DUBA 5FCUL 3PL6C 5B38G 5J6HB 3MJ7A 4PJIB 2YPLB 3GM8A 5CGTA 3UTTA 5CEYB 3VCLA 4H8WC 5EBGA 1X5HA 1MVFA 1GGCH 5D7KD 1U3HA 5HYSA 1WC7A 1B0GB 1AD9B 4ZG1A 4POZD 2ZSWA 3RKDD 1T7VA 5D8JH 2IG2L 1KIRA 5GS1A 4LSDA 5IG7A 4GG8A 3TNMA 4R0LC 1UB5B 2Q6WB 5DD5H 4PP2A 5J9PA 3FOLB 1MJ7H 4DUXA 4XB7A 2XTJD 2HJKB 2P7TB 2EH8L 3GUTB 2NTFB 1U3YA 2VERN 4R0LB 1EFXA 4S10A 1U91B 1RZGA 1MCOH 4DKEL 3CGTA 2NYYD 1HNFA 1T21B 2GJ6A 1BIIA 4OGYL 4QGYA 2Y36L 5BV7B 3LKQB 3HG1A 1OAXH 2HT4D 4U1HA 1FJ1B 4ZUVA 2IH3A 1S78C 5C0GA 1NGPL 5FGCE 2W92A 3PWPB 4JR9L 3F6LA 3I6GB 1GZQB 1XF4A 1OP5H 2Q8AH 3WIIH 1ACYL 5D9SB 2ORBL 4JM2C 5DS8A 4GRMA 2J8UF 4PJDB 2VDQH 5DGRA 5GRWA 3HMXL 3LKOB 1EEZA 3KPSB 3GKZA 2XWBB 4D8PA 3D0LA 5HPOA 2EDHA 5MEOA 5F89A 3HPJA 1YNLL 5I16B 4YHZH 3LS4H 2BRRH 5C2BH 2VLJA 3GM0A 3J8F7 3I3BA 5BVPL 2IGFH 1S7WA 2VDRH 4JHZA 5T3ZE 3MLUH 4OV5A 2DL9A 4V1DE 4Z8FL 5A2KH 3OB8A 2VC2H 5SWZD 1CFQA 3PWJA 5SX4H 4JHBA 5DQ9A 3ARPA 3FQXA 4M4RA 4BYHA 4OGXH 4OCSH 1EJ6A 3ES6B 1KUMA 1DQMH 2AJVH 5CGYD 2BSTA 5KVFH 3ULSA 4P4KA 4XVUC 2PO6A 2F74A 4O58L 1OTTC 1NC2A 1CLYH 1JNHB 4NWTH 2W59A 2CKNA 3K46A 4RAVA 1KJ2H 2BZDA 3SKMA 5E8EA 4AQ1B 3DVGB 2GQHA 4OQTL 4P46D 4YHML 1KLUB 2Y1VA 2P24B 2CIIA 5DD3H 3CU1A 3BAEH 3GBNH 4HGKC 3R1GH 3CH1A 4PJHB 1XCQB 1XR8A 5GS3A 2F5AH 3SGEH 2XFXB 2OL3A 4UT7H 5F89B 5L88L 3IDXL 2ED8A 3MCG1 4N5ED 3TNMB 4KZEL 4OJFH 1P7QB 5TDPB 3S8WA 3ETBF 5HHMB 2EE3A 3EAKA 1KB5H 1OW0C 3P9MA 1FVCB 1FFOA 1RZFH 4NDMB 3EHBD 2X4NA 4RRPA 2WIMA 2AKRA 3GEWB 1F8TL 4XXCC 1ITCA 2C4XA 5DUBB 2J6EA 3KPRB 5CEZD 1FLRH 5EG6C 3SKJH 4G9FB 3LY6A 1JCKA 4NOFA 4LHUA 2PETA 1M7XA 4XPAH 4HWZA 3UC0L 3F7QA 2JJTC 3GHBL 4DJMA 3UJTH 4JFYA 2CRYA 5EBWA 4MHHG 4Y16C 2CJUH 4ZTOH 1WFUA 3UROR 3F7VA 4K7PX 3SDAA 3IJSB 5CIPA 5I17A 3FFDB 2VOTA 1INEL 1FL6A 3PJSA 4JKLA 4QOKE 3S35L 2DIBA 4XNMB 1OLLA 2DWDB 3MJ6A 5KANG 4P2YA 3GIVB 1YNKH 1WBZB 3IXTA 3IDXH 4XC3L 4L4VD 5BQ7A 2E7LC 3PQYE 3EW3B 5IB5A 1F11A 1MCJA 3SOBH 1IARB 1ODAA 3QUXD 4JQXA 1ZTXH 2E9WA 4M7LT 1GHFH 2AQ1A 1A6VL 1X5JA 3BVNB 3IF1B 4PP1D 2VWEC 4UT6H 2GJZA 1A5FH 1AIFA 4LAJH 3TN0B 5FO9B 4HUWA 2FLRT 2YC1A 3MQIA 4NKIL 5F71A 5D2LA 2R2BB 1MUJB 1UXWA 3HUJF 4AM0B 4GS7B 4NYLA 3MR9B 5E1AB 3IU4L 1K5NB 2O5XH 1E4KC 3ECBA 2YBRB 1D5ZA 1ZLUH 4LQ1A 3ZKXC 1OWRM 3MGAA 4HX1A 1YYMH 1F4XL 4U1JB 2UZXB 5IR1A 1BQLL 2BXZA 2IBBA 2IADA 5DMGC 1P6AB 5GS0C 3VXOA 1Y6MR 1T03H 2WUBH 1SYVA 2BVTA 3T65A 1LEKA 1W72H 1FORH 3ZKXB 4U4BA 3QCTH 3C2SA 2F19L 4I0PA 3MODL 4KGJA 1HHIA 1KFAH 2AP2A 4P5KA 5E00A 4Y19A 2OL3B 4TQEH 2GUOA 5CJXC 1PX3A 3K2UL 1MFEL 4QO1A 2E27L 2H3NB 3MXVL 5TF1H 3X3GL 5I75B 1VADB 2VAAA 3OKKB 3C5JA 5FECB 4L8SC 4HS3B 2XTLA 1RIVL 1PFCA 4P2OA 4YO0A 4BZ1H 3CK0L 1CGYA 4XCEA 3H9HB 3L95A 3LN4A 3C5ZB 5T1DL 2ZCLH 4P4KD 1H9VA 2O5ZH 1MI5B 3VXUB 3MLVL 5DMJB 4RGOL 1E4JA 2BJMH 1C5BH 1MRDH 3TVMA 4EZMA 5IQ9B 1U95B 1H8OA 1UB6B 4XP6L 4OLVL 1C8PA 3UPRB 2QKIA 4NKOB 4N0UA 3P4MB 5TDPA 4OFKA 4FQQB 3QO0B 3PGFH 1NEZB 4U1LB 1MSPA 2WZPD 3WJJA 1WICA 5C0IA 1MJ7L 2NYYC 3ROLA 2P5WB 2XQYK 3QEQB 2VLLA 5HGBB 1PG7X 2GT9B 4M3KB 1LO4L 3OAUH 5CP3A 2APBA 5HPMB 1CE1H 3WS6A 2KQNA 3NZHL 1I3RA 1NFDB 5AD0B 1OGAB 3GMQB 4GRWB 3IAPA 3JV5A 4WU5A 1P7KB 1XIWC 2CMRL 4RMQA 1CXHA 1FAIH 5ALCH 1A22B 2BC4A 1NCNA 1LILA 1WWAX 4MJ6A 3LKRA 3BKCH 3NZ8A 5FGRA 2OQJB 1AD0B 3VXSB 4HG4J 3C08H 2I9TB 5C92A 1J8HE 4XC1H 3H7LA 5D71L 5B8CA 1KJMA 4FZEH 1XGUA 6FABH 4I3SL 2YXMA 1IC5L 4GXVL 4JZJC 3BW9B 1OF2B 5DSCA 4EUPB 4ZQKA 1OSPL 4NYLB 2DRUA 4HUVB 4J3OC 2APTA 3NFSL 3TO4A 2IC2A 2YSSB 3GMOB 4PB9H 5LJYH 2MNUA 4JJ5A 2YEZB 4NPYA 4ESKA 3C6LA 4MD0B 1B9ZA 3I6GA 1BF8A 4KJYB 4Q9QL 2UZIH 1CTOA 4YR6B 4QWWC 4P46C 1IVLA 4H20L 1YC7A 2DIAA 4L29A 1GOFA 4UNUA 2EKJA 2BVQB 5KG9B 4JFDD 4JPWL 3HB3C 2YR3A 5C0IB 4G80A 4NHCH 4DN4L 3HR5A 4CMHC 4OAWB 1NJ9A 1S9VB 4NM4L 4NUJA 4AL8L 1XF5B 3PWNA 4YAQB 5CIPH 3QFDB 4RSVA 3BE1L 4Q9RH 4PV9A 3QG6A 3P2TA 1GL4B 4MA7L 1G9MC 1TPXB 2YHGA 5JW5A 3DV4A 3PHOA 3K7UA 1CDUA 3DSFL 2AK4E 4PG9A 2N7AA 3GSNH 1CVRA 3MRNB 2Y72A 1QKZL 4UTBL 1D9KC 2YOCA 1F97A 5DUPL 1JBJA 1ZHKB 4P9HH 3I6LD 2MJWA 4QCIB 1ZE3C 1E4KA 5TQ0L 3RGVD 3ILPB 2MQ0A 3MUGB 3NCCB 2OS7A 4LCYB 5JOPE 2CRZA 5D7LB 4XCYA 1N5AB 1IAIM 2FDBP 4HGMA 5FUZH 3FQTB 1JF6A 2K1MA 5I8CB 3QDJB 2FX8L 1X4XA 3BWAB 2EDDA 3Q6FA 2VAJA 1N6VA 2CIKA 3GSQB 1IGJA 3RVTC 1F4AA 4FMFA 2R23B 5LXGL 2PYFB 3RY4A 5GGQL 4WHYH 3JV0A 5I1JL 1UJ3C 4E41B 5KG9A 3FQNB 3IAQA 1QSEB 1XCQA 1XR8B 4R7NA 3HKFA 4OAWA 5JXAH 2AXJA 3FT2B 5F9JB 1E4WH 3TYGL 1NUDA 2UZYB 1MCEA 4FQ2L 5J1AA 2R0ZH 3GDBA 3V4UH 2UY6A 1T66D 4QGTA 3BUYB 4WU7A 3RUGF 2OCFD 2HVKA 3G5XB 3B5GA 4HKZA 3TLRA 3P9WB 4JCLA 1MCHA 3QNXB 4J23A 1FPTH 3WLWD 2RR3A 3O2DH 4XPGL 1F11B 1JPST 1MH5B 4J8RB 3VXPB 1P5UA 2QBWA 3G9VA 2X05A 5BVJA 1R3JA 2D03H 3LV3B 4KUCF 3EOYG 4HUWB 4X6CE 3AREA 3WN5B 3KPNB 1FYHB 4OLUL 2G9HB 2W9DH 5BZWA 3WNKA 3V6OA 4M8QB 2MMXA 4XMLL 1PBYA 2D7TL 4R26H 4WGVB 3M1BA 4ZPTB 3BO8A 4RFOL 1JGVH 4IEFB 5TE4L 5L6YL 3NGBC 3WN5C 2EKSA 4X7FC 1A7OL 4KJWD 1A4KA 1T5XB 1KC5H 2IBZY 4N90E 3T1FA 4U0RB 3SHSA 2PTUA 1T2QL 4XPBL 2DLIA 3U4EB 1P4LA 5JR1H 2BVQA 5E6YA 4KTDH 3TJHD 1CICD 4PJ5B 3TC9A 3VA6A 2IPTL 3TCLA 3MRIB 1HHGB 1KCSL 1DBJH 1WAAE 3UC0H 2AS5M 4JFDE 4XBPA 3GBMH 5C0DB 2D2OA 4U1IB 3I3DA 3SY0B 3NAAL 4RAVB 2G5BA 4JR9H 4NRZB 5FHAH 1UJ3B 1Q9LB 3WIIL 1R3IL 6CGTA 4Y1AA 4YLQT 1XCTA 4M61B 1QRND 3L3DA 1FNLA 2VDPH 5CHNB 5C0AB 1G0YR 5D6DA 1IEAB 2WINB 3O6LL 5C0JB 2E6QA 5FK9B 4U1MB 1VACA 2WWKO 4MNGE 3WHE0 1BIIB 4DKAA 5HVFB 3C5ZA 5TE7L 1N5YH 4M8VA 5ISZD 3U0PB 2F5AL 3T0EC 3RWHB 4JKPH 1T22A 3IB4A 5HHOB 5KSVA 4Y89A 5JLZB 5TDOA 4KJQC 1I7TA 5C0NC 1W72L 1HDMB 4LHUG 4YNYA 1AQKL 2FBJL 4WFFD 3TV3H 1HZHL 5ADOH 4MA1C 2PXYD 3MLRL 1J9CT 2QHRL 3QRGL 4KC3B 5DYOB 2VH5L 1WIUA 2UUDK 2P5WD 3O45A 4OFVA 5LXGH 1RZIA 5CJOL 1FCCA 4X4MA 2Z8RA 2GY7B 3KPQB 5DQDL 2O61B 1HHHB 4ZTPL 3P3YA 2ZP0T 1R5VA 2VR4A 4ZUWB 1C5DB 5DJ6B 5E24E 1B2WL 2W07A 4NO0B 3BPNC 5F9WC 3TT3H 4CVWA 4ELMB 3QXUA 1P9MA 5T3ZH 1XZ0B 3MLZH 2VDOH 4Z7UB 2DQEH 1U8MB 4AENA 1WBYB 1BFVH 5IVOA 1INEH 5DJCA 1BFTA 1G7PB 4XNXL 4XP6H 2AV7B 3REVA 3REWB 5JW4R 4R4ND 4K94L 2NXYD 3HNSL 1MCBA 1CDHA 1CIDA 3JWDH 5IBLD 4XC3H 4TULL 4OM0H 5BXFB 4OZFH 3A6OA 4IDJL 3MA9L 5KN5A 5DI8A 3W5MA 2N7BA 2X4PA 2H2PD 4RFOH 1BM3L 3MOAL 1JGDA 4MVBC 3AXLA 1KTRL 4PRBB 1AY1L 3QI9B 1LK3L 1ZXQA 2OI9C 3MRBB 2Q86B 3AGVA 1HEZA 2FJHB 4FQXD 3VCLB 1P4BH 2EDJA 5T1KD 4IRSD 1ZA6B 4A6YL 5K33A 4HV8A 2X9WA 4GG8B 4X8JA 1F58L 3TA3D 2R0WL 4YXLH 5F7UA 1J1PL 5A2LH 2C1OB 3NFSH 4M8QA 4P3CL 4PB9L 4PV9B 1JZ4A 1HCFX 5FF6A 3SDYL 2AEQL 3VJ6B 3N85H 1E6JL 3DRQB 2VXUL 2NCMA 3LH2L 5KJRL 2EKSB 1UM4H 1S9XA 1CZ8H 3S36X 5ESVA 4N5UA 1Q0YL 4WO4B 1R3KA 2Z8WC 4HWZB 1I8KA 1Y0LB 2GSGA 3OJ2C 4NZTL 5BXFA 1DQQA 5IM7B 3FO9A 1N5AA 4MCZB 3VMPA 3S98A 3KJ4C 4H25A 2WIIA 4PJHF 4KHXH 4J3SA 3WJLC 3MACH 3FN0L 3IS1X 1UWGH 4R7DA 1EMTH 4X9HA 4HSQA 3OKDA 4Z76A 1LO4H 1IGJB 2GK2A 2AQ2A 4NO2B 4Z8FH 5CEYA 4PIRF 3QFDA 2FD6H 1P84J 3T8XA 4M5ZH 2J6EL 3BKJH 4N8VG 1RZ7H 4PRHE 1AKJB 2ICEB 4M4PA 1YNLH 5FYJH 1NBZB 5D1QA 3PHOB 3L9RB 3QI9C 4ZFGL 1K3IA 3B6SB 1YMMD 1S9KC 3OJMB 2NXZD 3DMMB 3UTSA 1N7ML 3MRQB 3T0AA 1NMBH 2HJFB 4IRJB 3MBEA 4QT5B 1QFPA 4LLUB 3GSWA 5FUZL 1VGEL 1MNUL 1UM5H 2VTFA 2Z91B 1I1YA 2BRQA 4MLIA 2ZKHH 3IFOA 1MCFA 2AV7A 5EZIL 3KPTA 3OR7A 3DI2B 4GKZA 2FWOB 1NMCB 5EU3B 2P44B 4V1DD 3DJ9A 4FABH 1OT1A 3O4LA 3KXFB 1QOKA 3QDJA 4KK9D 2VDQL 4NZDA 5KS9F 3IXAB 1I3UA 4NN5C 1FYTB 5ACLA 5D9SA 5FKPA 3HMXH 1DDHB 2VSCA 3D5OF 5B8CB 3VXRB 4X98B 1P7QD 2GKIA 2VLMD 5DFWH 3VXTB 1JF1B 4ZO8A 1F6FB 3BW9A 1CL7H 2XWBA 3TJHC 1AKJD 1DUZB 3CZJA 5GGUB 1S7VA 1LNUA 1RZFL 1VFMA 3HPJB 4NQVB 3B2UC 3ZKNC 1NCUA 1Q9KA 3LIZH 5C3LD 4JO3L 4LAQH 4M62L 1GOGA 1A6WH 3T1FB 4NP4H 3Q1SL 1RPQA 2VKXA 1OD7A 2CKBL 1VADA 3MX0A 1OTSC 3VDAA 5CJQL 4IRSC 1MJ8H 4Z0XB 1L7IL 3LHPL 2IH1B 4APQD 2EE6A 3ES6A 2Y5TA 5AZ2L 4G8IA 1L6ZA 1UWXH 3WDIA 3ARGA 3CPLB 1IM9B 1K9TA 4K3EL 5BRZE 5J1SC 2Q3ZA 4OLYH 1IBGL 4YE4H 1CE1L 3VFUA 1NCDL 2DOCA 1OGTA 4FQ2H 4F33A 5JXEA 1IM3B 4ELMF 4ALAL 1LWRA 3S88H 4I0PD 5DMIL 1CLZL 3TVMB 1KTKE 3QQ3A 1T83C 3ZHDA 4L8BB 5F1KC 4NC1C 1HXYB 3NPSC 5ACZB 2HKHL 4C83A 3D9AL 2IPUK 4NJAL 4NRYB 4YC2B 4EIZC 4FQIH 1XGRB 2ADJA 4JO2L 3QO0A 2X09A 3CCHB 4Z76B 3RRQA 3H2WA 5DVOA 1JTPA 3K1DA 1F6LL 2VABA 1H3XA 3MRIA 3KPOB 2IGFL 2VDRL 1MEXH 4PLKC 1KF9B 1K4CB 4O2EB 5EULV 4GKOA 3MRGB 3DO3A 2O5ZL 1R3HB 3FO1B 2NY0B 2I5YL 3CVIH 1MCIA 1XH3B 3QULB 4KMTH 2ICEA 5GRYA 1KGCD 2EDXA 4HAFA 5DD1L 5DR5L 3D39D 4QHUB 3F7PC 4BH7A 1K6QL 1TZGL 3L3JA 4G6FD 4HKBB 5CHNA 4Y4KA 2APXA 4XPAL 4C54A 1MQKH 2DQGH 2HKFH 4HBCL 1IEAA 2WINA 4PJXA 4NSKB 3MV7A 1PW3A 2XNAA 3DPBA 1CDYA 4XWOD 3GSUB 4GAJH 1UJTA 3FFDA 4KROD 5SWSD 3VRJB 2A9ML 4Y2DC 3SBWC 2VLKA 2PYED 3HC0B 1YEJL 3HE7B 4QYOB 4HWBA 4GW4A 1NQBA 5CUSL 2AI0L 3RVXC 4N1HB 3QQNA 2A2QT 5E08H 2P5EB 2PYEB 4WVRA 5CP7B 1FG9C 3RJDA 4JM2A 5FUOL 4P2QE 5C2UB 4XCCL 4HK0B 3SKOA 3R8QA 5SV3A 4KV5F 4OQTA 1XGYH 1WWWX 5K59E 3C8KA 4J3TA 4ODTH 3W9EA 1DQML 1HHKB 2AJVL 2IBZX 4NC2B 4X5XB 4HV8B 1LO0L 5CEXA 4ZFFB 1P69B 1FC2D 4YIQA 1S5HB 3SE8H 2GJZB 1KJ3H 3HZKA 1MHPH 5MP6H 3BZ4B 1QSEE 4UQ3B 1WK0A 2YUZA 3O3BA 5IW6B 3MV7B 5FB8B 2X4QB 3FQUB 1CXIA 3UTPE 2ESVA 1IM3A 3B3IB 2C9AA 3V4UL 1CU4H 4O58H 1AGFB 3CC5B 3IDJB 5GSVB 4HK3J 1ZOXA 2AQ3A 5MEQB 2ED9A 3LPWA 2FX7L 5DI8B 2FHCA 1SMOA 2NZ9D 5ITBH 4M6OH 5ACMA 1X5ZA 4MMXC 1HSAB 2ZUUA 3HE6C 4LLAA 3CSYB 2WBKA 2Y6SC 3BKML 4R4FL 5IB4B 3WL9A 3NCYS 4JEGB 4N68A 4UINL 4NQDD 2OSLA 5L0QB 1TPXC 5JHDD 4MCZA 1D5BA 3HMWL 1I85C 1I3GH 3QEHB 3DUUB 1HDMA 3IKCA 2AEIT 5DLML 2BOBB 4IS6B 3QEUB 2WBJD 1AO7A 1T1YA 2ATPB 3NVQA 1TQCB 3MV8A 4XRCB 1J88A 5BOZG 1S9YA 4X6FB 3SQOH 4KUZH 2B5IC 1FH5L 3P4OB 3LKRB 3TIEA 1JUFA 1C08A 4ZFOL 5KSAA 5EOCJ 5I19L 3HNSH 4JFDA 1JZ6A 5F6HI 3AU1A 3T77B 3SKJL 4HJGB 3CFDA 5BW7A 4OLWL 1BBJB 5GGTA 1X5IA 3LZFH 2DWEB 4BSVB 4GKZB 2HWZH 2VABB 2BNRD 1L0XA 1VFBA 5CAYB 5ESQB 1I1YB 1YNTA 4X6DE 1G7IB 4U1LA 5MI0C 4PB0L 3ARTA 3GBLA 1YYLL 1NBVL 5DEGA 5LAXB 4NGHH 3RPIA 2WWMC 2FH8A 1BPVA 2MWCA 1RULL 3DETD 3LEYH 1YJDC 4GLRI 1IQDB 3VXRD 1UENA 1OTTD 3BSZL 1OCWL 4V2CB 2V2WB 4Y5XC 1JWSA 4ODHH 4QHKJ 3AC0A 4I9WE 1OTUC 4NN6C 1ZA3B 4D9LH 4IMLB 3QIWC 4PGEB 3ZMRA 4F7EB 2XN9D 5FM4A 3OGOE 3VWKD 3QDMB 4YGVB 2G5BB 4NKIH 3IKCB 5C09E 1HH9A 4G6KL 1AQKH 2FBJH 1RJLA 5JOFB 1NAKH 4Y1AB 2YD8A 1GHFL 5FYLD 4L1DA 1W0VB 4LHUD 2K3TA 1A5FL 4LLUA 4AIXA 3IS0X 5B39A 3CFJB 1VEMA 5I6XB 1FNHA 2JJSC 4OF8A 4OV6F 3H3PH 4HC1L 1XGUB 4N0YH 4K7PL 5E94A 2DM3A 3W2DL 2J5LC 2FEDC 4KVNH 1MJJB 3FFCE 5D96B 1NCAH 4R90H 3KHOA 1PKQA 5EA0H 5FYJU 1V7NH 4G8IB 5EU6A 1M71A 4U0RC 2B0SH 3TO2B 3KPPB 4Z7VA 5B3JE 4GOSA 1U3HC 5F1SA 4KDTC 3RPIB 4F9PA 1KTLA 4X4YB 1AO7D 4DGYL 1NANH 3SDCB 3SKOB 5GS1C 3TV3L 4A2LA 4UZGA 4LPXA 5FO7B 2Y6SD 1I3VA 4KDWA 4Z9KB 4OZGF 4D9LL 2BVPA 3SGJC 1FLRL 1L7IH 3LHPH 3O4OC 3GNML 1AD9A 1SQ2N 4ENED 5IKCB 4I0PC 4QXGH 3K8KA 5F9JA 3F7YA 3PHQB 4KV5E 1UACH 3EFFB 4I9WD 2RFXB 1YA5A 3R0NA 1WZKA 2BNQA 5E2JA 4JZOA 3TJEH 2JF1A 5HYJB 2VXSH 3BEVA 4G8GB 3RL2B 3WIHA 3O0RH 3STBA 3X12A 1UM5L 4G9DA 4JPKL 4HJJH 1H15A 3ILPA 2FJGA 2K7PA 4PJFB 3JWDC 5FFLA 5E2VL 5DJ0B 1HSAA 5I8CA 3IU3A 5D7LD 1DSFL 5I71B 2RAMA 2VAAB 4I18C 1XF1A 3BMWA 3V79C 1UKTA 4UDUB 3CUPB 4RMVA 4XCYB 4XB8A 3P73B 4P5TC 2XN9A 5GRJH 3VWKA 1LO5B 3BRDA 2OXHA 2J8UB 2VE6B 1CFSA 2BNQE 1RZ8B 5HDQH 5GGVY 3V0AC 4WENB 3EO9L 5J12C 3AXLB 4Q9RL 2ATPA 4S1RL 2WWMD 5CCKH 3J7HA 4NRXB 2CPCA 3QXTA 1PSKH 5CBEA 1DEDA 1E27A 1JHLL 2GY5A 3AB0C 1HYSD 1M05A 3FO2B 4JRXA 1LD9A 3VA2C 1N2RA 2NXYB 3M17B 2Z8SA 5TDNB 4LOUD 1I1AD 5CWSA 4ZXBC 5E7FA 3RDTD 2ICCA 5EB9A 3QUXA 4HT1L 5CP7A 4GAGH 5K93A 2W0FB 2EYRB 4MD4A 5I1EH 1BX2B 3FN9A 3BEVB 4G8GA 4LPVA 1T1WA 1A1OB 4X0KA 1A9EA 2EDWA 5E5MA 3K4DA 1MF2H 1P2CB 2PO6C 1B6DA 4HK0A 4JGMA 4QRQA 3TT3L 5B8CC 4PJ8D 2VL5A 1OSPH 3L5WB 4PJGB 1S9XB 5F72S 4WDIA 4TNWK 3TZVA 4F7MA 4NQCD 2IPKB 1G1CA 4OD2B 5GQBA 4NC0B 4WI9A 1U3ZA 2WBJA 4BQ6A 4QTIL 4EN3C 4CADA 4TOYL 1GC1L 4NZTH 3WLBA 5I1CH 1KT2B 4POUB 3GSRB 1II4E 1DBAH 4LLQA 4V2BA 4Y5XA 4PTUB 3FRPG 5JQ6L 1XIWD 4BFEA 1DE4A 4NBYB 1RZJH 1NCCH 3EHBC 3SJVA 1L9MA 2EDYA 1RJLB 3U36B 3D3VD 1PEZA 3P4LA 2MPAH 2V5RA 4AL8H 3H3BC 3U82B 1IAII 5T3XH 1RZIB 1A3LL 1P5VA 3DBXA 1AGEA 1EPFA