5DJ0B

Fc heterodimer design 11.2 y349s/k370y + e357d/s364q
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj0B01
1DN0B 4RAVB 4EUPA 3VFUB 3CFEB 4FFYL 1FAKT 1OF2A 4N0CC 2IBZY 4PBWD 3E8UH 3CH8A 3F7RA 3PV7A 4HWNA 1ZT7B 3DVGB 3MV8D 3EO0A 5GGUA 2WQRA 1IAMA 3BOVA 3SQBA 2MCPL 5ICXA 4PG9A 4RFOL 5JW4Q 4DN4H 2I07B 3IDGA 2C3VA 1Q94A 4KK8D 3HUJB 4KZEH 3GKZA 3PWPB 3KPTA 3GSNL 2DYPA 4OZ4B 3CH1B 3VXQA 1HHHA 3RGVC 4KJQD 2FB4L 4IMKC 2Q6WA 1MFAL 2PF6A 4AT6A 4AQ1B 2IQ9L 4PJ5D 4HHAA 4LBEB 3ETBF 2DM4A 2V6HA 1N5AB 1QA9A 2HFGL 4KRPC 4OZIB 1CQKA 1BLNB 1W72A 3IF1A 4HMCA 3WE6A 3KAAA 2EDDA 4LLUA 5CINH 5DJDA 2X7LA 2VR4A 1Q0YL 4IMLA 4X0KA 2NY0C 1GL4B 1G84A 3WD5L 2IANA 3S96B 5AZEL 1A1MA 3OAUL 2QL1A 1KTKE 3DX8A 1G7IB 4RISH 5EFIB 2AK4A 1P1ZB 2Z35A 3FAWA 3UZEA 1NCAH 5DWUH 1NCDL 3HMWH 1QRNB 1IMHC 2HTLC 4X7FC 3VFMA 5D7JB 5HJ3B 4LVNC 4JZJA 1A6UL 3GSWB 1XGTA 4XAKE 4PV9B 4P5MA 4ELMA 1QFHA 1PZUB 1AQDA 2AGJH 1P7QB 3ARVA 2X4OA 4K3EL 3LEXB 3MTRA 5BMFL 4Q0XH 5BO1H 5IQ7L 2LABA 5EWIL 43CAB 3O8XD 3TC9A 4XHQA 4HEME 4PR5A 4JAMA 3G5YA 3RWJB 2G60H 5HYEA 3AS3A 4JJ5B 5E70A 4JQIH 2R4RH 1WICA 1JN6A 3MR9A 5DD0L 3DO3A 1U8KA 4I18C 3WCYA 2GTZA 4OQTA 1LO3H 2A74B 2JK5A 1UZ8A 3MA9H 5DSCB 2YUWA 3GJEA 1W0YT 4NC0B 4CVUA 2XKNB 5BJTB 3L1OL 1LO0H 1WC7B 1LO4H 5C0BA 3E2HB 2ARJB 3V4PL 3SDXB 2BJML 1MJUH 3N50A 3KLAA 5EBLA 1GGTA 2V7NB 5EO1A 5L0QB 2GSGB 4WW1B 1YEEL 5BS0A 4YK4B 3A67H 5EBWA 5IMKA 2XN9A 2BNRB 4N9OB 5I1JH 43C9A 3VFVA 4IRJA 4HLZG 4Z5RB 3WBDA 4HF5H 4HUWA 2UVEA 4YNYA 4W6WB 2DIBA 1CZ8L 3VRJB 5ISZD 1KJ2A 1FNSH 1BM3L 1F4YH 5FKPA 1ZLVK 3ZKQD 3UTPE 3WIFB 3ILPA 2VSCA 3VWJB 1PG7L 2WP3T 4U1GC 2NCMA 1ZVYA 5D72H 2PR4H 3HZVB 3OKOA 1A2YA 1L0QA 5CJ5A 1GOFA 3MA7B 3IU4L 4K3JH 3IJSA 4JFZL 5MEQA 3EYVA 2GTWA 4OF8A 2A73A 4Y89A 3ES6B 5DMGD 3BGMA 2YBRB 4YHZH 1J86A 5BW7C 1A3LL 4WTWA 2XWBA 4XPAL 1NKRA 2AW2A 5MP6L 3P77A 4XAWL 3C2AH 3IAGC 2H9GB 3CC5A 4DOHE 4PB9H 2EIZA 4L4VB 3LIZL 2WBJC 1K8IB 1NC4A 4HIIB 1HH9A 4WU5A 3HI5L 3O4OC 4OFYD 4AEIL 3MGOA 4YHLH 4ZQKA 1N59B 4FFZL 1GOGA 1VPOH 1K2DA 3THML 3GMPA 3PG2A 1KULA 1CFVL 3UTOA 4F7TA 5IJVB 1N6QH 5D7IB 3HZKA 3L3GA 4EUPB 4O9HL 4XNYH 3K1KC 2VDRH 2NR6D 1OF2B 3RQ3A 4JE4B 1I1RA 3UCRA 4XVUC 1D5XA 3VGAB 1EHXA 4DK3A 4MXVE 4I2XA 5C09B 4PJEF 1CGYA 1JZ8A 3EO0B 5GGUB 1PFCA 1NGQH 5ICXB 2Q86A 4PG9B 3SDYH 1FYTA 1EVUA 2NY1C 1OOAA 3IDGB 2C3VB 1Q94B 1T21A 1DLFH 4BFBD 1QHPA 2DQCL 5B38A 5F3BA 2DYPB 3P30L 4JB9L 1AP2A 3RU8L 4AH2A 3FZUD 3VXQB 4JGJA 1HHHB 1NDGA 2Q6WB 3VMOA 3AY4C 4FFWC 4AT6B 2DQJH 4NZTL 1EEZB 2F54B 4HHAB 5DO2C 2R39A 3ARBA 4UT7H 1W72B 3IF1B 5CD5C 3G5ZA 3WE6B 4LLUB 5DJDB 3DX7A 2X7LB 4X0KB 4IMLB 4PD4K 2I24N 4P46A 4V2CB 4O5LL 5E08H 2IANB 3DXAA 1A1MB 3E1F1 5TE7L 4TNWK 3DX8B 4KKNA 5GGQL 3VFMB 4JZJB 4S1SL 2BFVL 1XGTB 3ZKSD 4P5MB 1R3HA 4ELMB 4G6KH 1AQDB 1WFTA 2WSKA 1JWMA 2GUOA 2X4OB 4M9OA 4K07A 3DROA 1AGEA 1U92A 3IB4A 3DTXA 4KGLA 3G04A 3QG7H 4I77H 5FM8A 1TETH 2X4TA 2GIYA 2P45B 3B2VH 2SEBB 1RZIA 5JXAL 4HIJA 2DQHL 3NZHL 4JAMB 3G5YB 4CUCA 4FQLH 2ZUWA 2Y36H 4HG4K 4WTZA 2HLFD 1IAII 1G1YA 2K7PA 1OQOA 3KVQA 4U7KA 3ARXA 1WISA 2AJVH 2AXHA 4PJ9D 1JN6B 5T5NF 1U8KB 5DA4A 1LQSR 2GTZB 5ICYA 1MFEH 5JUEL 3V7MA 2ZPKH 1UZ8B 4DEPC 3GJEB 3UZQA 3FB5A 1KC5H 4NQVB 1CFQA 3UTSD 4JY5L 4FQXD 3JV6A 2DBLH 5B4MD 1UC6A 5GISL 3BEWA 3KLAB 5EBLB 5EO1B 4YDIL 5BS0B 3DO7A 4ODTH 2VKWA 3TLRA 3RZCA 1EMTL 5EBWB 2Y06H 5T33L 2XN9B 3QO0A 1HQ4A 2X6MA 4OT1H 5J6HA 43C9B 3VFVB 4IRJB 1NLDH 3D85D 4HUWB 4HWZA 4R3SA 4HUMB 4YNYB 1RHFA 3RI5K 3N85H 1KJ2B 1N0XL 3SGKC 4FTVD 4X5LA 4JO4H 3BJ91 2X4RA 3SE9H 4Z7NF 3ARQA 3ILPB 3QUYA 3PGDA 1HDMA 2FEDC 3MXWL 5GGVL 5B3JE 1OW0A 3OKOB 1A2YB 4OF7A 2M1KA 4KVNH 3IJSB 4UAOB 1EA9C 5TFSH 5IEHB 5MEQB 5HVHC 3EYVB 4XTRC 2GTWB 2A73B 1D3CA 3BGMB 2YN5A 5H35A 1J87A 5L8KB 3TBYB 1MSPA 1TPXB 2IH1A 2XWBB 1J0IA 4P23C 4NZRH 1H0DA 1PKQE 3TIEA 1QACA 1P84J 2EIZB 1YEKH 4Z0BL 4JM2F 3W11D 1JPSL 2HT4C 1NC4B 3QDGE 4WGWB 3QB7C 3ZE0E 3RJQB 1HH9B 3U7YL 4WU5B 5IVNA 4BFEA 3MGOB 4ZQKB 5E1AA 1K2DB 1SEQH 4TVPH 1S5HB 3GMPB 4F7PA 1NBVH 4TNVK 2D7OA 3RTQA 1HHGA 3RBGA 2AJZA 5C0CA 1CDUA 3HZKB 4P2RA 3L3GB 1A3RL 4ZUVA 3WIHH 3VW3L 4JO1H 2Q20A 4P4KC 3D3VE 5ICZA 1D5XB 3ALWA 3BD4A 4I2XB 1A7PL 4WWKC 3BZ4A 5CP7A 1GPOH 2Q86B 3RX7A 1FYTB 1ZOXA 2D7PA 1T21B 4OCYL 4Z7OE 2JJSA 1DDHA 1XCQB 2B1AH 4IM8A 5F3BB 1ZAGA 1FE8L 5I71C 1AP2B 1IAIH 5EU3A 2COQA 1NGYA 3TF7C 2AP2A 1NGPL 1MCRA 2D4FA 3HNTH 4MQXC 3T0XA 1NDGB 1TCRA 1O7VA 2I25N 3P9LA 3ZTNL 3W39A 2VDQH 1LO5A 5L2KD 5ITBL 4OZHE 1IQWH 2C3HA 4BQ6A 3V4UL 1RFDL 1J1OH 2VDKL 3G5ZB 2DWDA 3HAEH 3DX7B 5GJTL 3MZGB 2VLRD 4P46B 2V9TA 1JYNA 4LSPL 5KN5A 3DXAB 1YC7A 1XF5A 2QEJA 2HFEA 3UTTA 3TCLA 5IWLC 3NOIA 4JM4H 2EE3A 4EI5D 4JVPA 4KDTA 5DVNA 2GK2A 1FBIH 3RWGA 2K9UA 3VE0A 5GHWH 4JGUA 4CVXA 3NGBB 3O9WD 2GUOB 2JELH 4NQUA 4GRWE 1HH6A 3B8YA 3DROB 2ZG2A 3DV4A 1AGEB 1U92B 5DGQA 5A40E 3DTXB 3G04B 2UYLB 4M1CD 1IE5A 2X4TB 2HJLA 4FFYH 4P5TA 1NGWB 4HIJB 4X9FA 2VXVL 2R69L 5EO9A 1BF8A 4R90L 3DUUA 3K46A 3MROA 1F00I 2Y5EA 2G9HA 3ARFD 2DM7A 2VDPH 2XG4A 2MCPH 1YQ2A 4RFOH 3G9VA 3C2SA 1MCPL 1OLZA 3GSNH 3SDAC 5ICYB 1L0XA 5F7FA 3MOBL 1ZANL 2XA8H 5JHDD 5HHOE 2LVEA 4F15C 1X5XA 4ZYKA 3FB5B 4HUXA 3QQNA 1M4KA 1VFBA 1MFAH 1XF3A 4Z7WE 4DQOL 1CFQB 2M26A 3H3PL 3PHOA 3JV6B 2GQHA 3BEWB 3HE6A 4NQDB 1K85A 5BZWA 3QHTC 3AROA 3DO7B 3RZCB 1AO7E 1N64L 2CK2A 1CGWA 4LAJH 4RDQG 1Q0YH 1P7QD 2LFGA 1ZVHA 3QO0B 2NW3A 3TH2T 5J6HB 1KEML 3QJHA 4Z6AT 5HHMD 5AZEH 2WANA 5SX5H 4HWZB 4R3SB 1RHHA 4NOFA 1TVBA 4IRSD 1TFHA 3D9AH 4HPYH 5MI0B 4AM0A 3D1MC 2DLEA 1NCDH 3LKOA 4M3JA 3PGDB 3FQRA 4W4NA 1FFOA 1HDMB 4I8DA 3SQOL 5EB9A 1KGCD 1KEGL 4NN6C 1KJMA 3Q2CA 4LSUH 5CGYD 3BEVA 1A6UH 3KPOA 5CD3A 2OL3A 1OAQL 3LKRA 3GSVA 4LP4A 1VFOA 1Y6NR 2VAAB 3H9HA 1CT8A 4PGDA 1J5OH 1GRWA 2X1WL 3LEVL 2YPLA 5IQ7H 5EC2A 1HYSD 1D9KA 5GPRA 5H35B 2C7UA 1K9TA 2IH1B 1U8IA 3B2UC 4GXVL 1H0DB 5EORH 3TIEB 4FZ8H 4W70A 4YBQD 4ZOAA 1WT5A 3PGFH 4FMKA 5EZLA 2YN3A 1K4DA 1CXIA 5DD0H 3IRZA 4NCDA 2WZPD 5E1AB 5KZCB 3NMEA 2VN7A 4F7PB 4GQ9L 4LSQH 4JFED 3TT1H 3MJGX 5C07D 5J6GA 1XF2A 1BD2D 1MAJA 4LFHD 3RTQB 3WIHA 2AJZB 1ES0A 4O2FA 3L1OH 1MVUA 3IKKA 1JF1A 4MZ3A 1T5XB 4PRBA 3V4PH 2BJMH 2DTMH 3DX9A 3L3DA 4ZUVB 3RKPA 4LSVL 4AIZA 4UOW1 2A6KA 2R1YA 4OCLC 3PDGA 1E6OL 1YNTA 5ICZB 1YEEH 4OLWL 4Z78B 5DD5H 3BZ4B 3ZDYE 5CP7B 4NFBA 3V5DA 4PRIE 2NXYB 1IKNC 3RWDA 3IRPX 2N56A 4LLDA 2E6JA 4IOFD 1DDHB 1JBJA 1BM3H 5EU3B 1NGYB 1PG7H 1CE1L 4ZOEA 4M1DL 5D1QD 3VD4A 1TCRB 3P9LB 3QHZH 4DN3L 3W39B 5IHUL 5ESQA 1LO5B 4G80A 1OGTA 1RK0A 2NX5D 2HH0L 2BC4A 3HAEA 4QHLA 4Z7VA 5AD0A 5IG7A 4HK0A 5FA3A 5K33A 1NMCC 4Z18A 2DWDB 4D3CL 1T0PB 3QPXL 2P44B 3MXVL 1RUAL 1A3LH 4TSCL 3WNMA 4XPAH 5C6PB 5MP6H 3N1PC 2Q8AL 3VXTA 4XAWH 5KN5B 3QSKB 2FECI 3AB0C 4RGMC 2UZXB 1XF5B 4L8BA 4RWYL 4E41D 1DVFD 5C3TA 1TJGL 2OR9L 1UJ3C 2HFEB 1JI1A 1PKOA 3LIZH 1NMBH 1L0YA 4X7TA 3UTTB 3TCLB 4YJZL 4OSUL 5ESVA 2G75A 3K0WA 3T2QA 4HJJL 4FFZH 1I1AA 4YHYB 4RQQB 4Y4KA 2FYYA 3O6LL 2ZNXA 4WVRA 4EN3D 3RWGB 4UDUA 4XBGA 3VE0B 4FZEL 4M7JH 3C09B 4CVXB 3P4LA 4DKAA 4KROD 4UBDD 1NUNB 5F9WB 5H37G 1HH6B 3DV4B 1YY9C 4MB4A 2BX5A 4Q6IC 5D6CA 4K7PY 4P5TB 1AD9A 1QFWL 2QHLA 1BIIA 5EO9B 5I1AA 3DUUB 4XXCA 3MROB 4S1DC 2G9HB 3WNNA 1H3WM 4P9MH 5D1XD 1M1SA 5FGBC 3CDFA 3GSNA 4MD5A 5F9AC 3PXHA 5FO7A 1HNFA 3VFTA 1WAAA 2DQCH 4OD1H 3ILQC 3EYFB 3P30H 3R1GL 4Y8AA 3B5GA 4GH7B 4NWTL 2AEQH 5F6IB 4ZYKB 4J3UA 4HUXB 2AK4D 1RIVL 1KELH 2HKHL 1B4JL 3PHOB 2HYMA 5FV1L 5J9PA 4PJ8A 3SDCC 3HE6B 1QKZL 3U46A 4OLVL 5BZWB 2FO1A 5GGTH 3RJDA 1A8JH 1FV1A 1NCTA 2ZNWA 2NY2B 4L8SC 2BVOA 3FT4B 2NW3B 4C56D 5KBNC 3QJHB 4O5LH 4XNMA 4PLKC 3K2UL 1F8TL 3VXSA 3F58L 4PJGA 1RHHB 5TE7H 1TVBB 1BZ7A 3T3PF 1U93A 1XF4A 2HKFL 4MAYA 4R4BA 3X14A 4AM0B 2A6DA 1F3DJ 3LKOB 3FQRB 1FFOB 1NSNL 5DRWA 1KJMB 3BEVB 1URLA 4S1SH 1A6VL 5CD3B 3KPOB 3LKRB 3GSVB 4I1NB 2GAZA 3H9HB 1CT8B 4PGDB 3NFSH 3LDBB 1HQRA 2XXCB 2YPLB 5EC2B 1D9KB 1A7RH 3QEQA 1Z0MA 4ONHA 5HYJD 3VU2A 1QR1B 2C7UB 5JXAH 2ED7A 1U8IB 3CXHJ 4U3CA 4Y1AA 4PRHD 1TDQA 3Q1SL 5C0BD 4H0GA 3CSBA 3T2NL 3I6LD 4TYUA 4CL7A 5FO8A 5EZLB 5IR1A 5DR5L 5D7SL 4ISVA 1K4DB 3HNVH 2BVPA 3FN3A 2H1PL 4LPCA 2XN9D 3EO1A 1KBGL 5C0DA 5JUEH 5IM7A 3MO1A 4IRJD 2R9HC 3NIFE 5J6GB 1XF2B 5IBLC 1CLOL 1AHWB 1ES0B 4JANA 1F6LL 4FQ1L 4O2FB 1F97A 1T04A 1YEJL 1MVUB 1JF1B 4YHKL 1LP9E 4PRBB 4GG6E 3DX9B 3L3DB 4JY5H 4JREC 3BPOC 4X6FA 4YDKL 1E27A 4WV1A 5GISH 1TCMA 4G42A 2A6KB 2R1YB 4YDIH 2Z8WC 4J8RA 5HHXL 2ATKA 1YNTB 4WJ5A 1KYOK 2F5AL 2FBJH 2CO7B 5T33H 5LGJA 1FCCA 4KQ4H 2YRLA 4QOKA 3V5DB 1TVHA 1OTSC 3RWDB 1B6UA 5AAWA 1T6VN 2WP3O 1XGPA 2CGRL 3I3EA 3VI4E 2FHBA 2OXHA 3EZ8A 1H5BC 1HNGA 1N0XH 4JFPA 4J6RH 2BHZA 2APTA 4LK4A 5GGVH 2XFXA 3S4SG 3I50L 3O6FA 5ESQB 4BQ8A 4G80B 1OGTB 3I75A 5JW3L 1RK0B 4CU6A 5DK3A 4M7LH 2BC4B 3HAEB 4QHLB 4QGTA 3H9ZA 4Z7VB 5AD0B 3KS0H 4ZNCD 5IG7B 4HK0B 5FA3B 4NSKA 5GGRA 3OJMB 4NM4L 3L5HA 2R0KH 4KK8C 3MV9B 5T3ZD 3BWUC 1CLYL 5FEBA 1BMGA 5HGDA 3PWJA 1N8ZA 3VXTB 4B7IA 3VCLA 3B43A 1NC2D 3IGAA 2ZUQC 4L8BB 4Z0BH 4LCYA 4X7TB 1JPSH 4DUWA 3O2WL 4KJQC 3VXRE 4JHWL 5ESVB 1JTPA 2G75B 3MOAL 1RUML 3H7BA 1I1AB 5JO5A 3VG9B 4Y4KB 4HDIA 4JFYA 2AQ1A 2FYYB 4ZFZA 4LLMA 4UDUB 5JW4N 4HQQL 4I3SH 4BSVA 4HJGA 1CGSL 1WFNA 4YHNA 2IC2A 3VFPB 4GAYA 5D6CB 1IKFL 1AD9B 4FNLL 1BIIB 5I1AB 1V8HA 1JGDA 2EDHA 3SKUD 5DJYA 2LU4A 4OF3A 1A7PH 3W0WE 1GGBL 3LPWA 3ARBD 3GSNB 4MD5B 5JIHA 4MLIA 4M48L 4MCZB 4V1DE 5FO7B 4PIRF 4E9LA 3VFTB 3S36X 1B3JA 6CGTA 2VH5H 1X5JA 2IEPA 3BD3A 5JMRA 4YXKL 4JO2L 5EO0A 3UPAA 5F8RC 1NGPH 1KG0A 3TV3L 3MRBB 5IGXL 3O8XC 3RNQA 1FGNL 4BH7A 5CBEA 2FGWL 5DHYA 3ZTNH 4RBPK 2J7LA 1MCEA 3F7QA 5J9PB 4PJ8B 1DSFL 3U46B 3S35X 1S7UA 5EU7E 3BKMH 3IKCB 4PJHA 4S2SA 1FV1B 4IDJL 3FAXA 4OD3L 4I0PD 2BVOB 4NUGH 1Q1JL 4XNMB 1UWEL 4LSPH 3VXSB 4KUCF 4PJGB 3BRDA 4Y88A 5J3HD 3WO4B 2IMNA 1BZ7B 5FYKH 3ROLA 3LRGA 4FMFA 3SDDB 2Q3AA 1U93B 1XF4B 1YEIL 4MAYB 4PPTA 4R4BB 3X14B 1MNUL 2A6DB 2D03L 9CGTA 5GIRA 1I9JL 1UYWL 4NQEE 4MA8H 5DRWB 1N4XL 1TQCC 3Q5YA 1VERA 3UMTA 2FX9L 3IDIA 1OGAE 2B5IB 2VB5A 4H5SB 4JFDD 4WRLA 2GAZB 4N8VG 1MCDA 5J1SC 1HQRB 2MKLC 5EUOE 3GZKA 4JG0L 5E2WH 2HT3D 4ONHB 1PJ9A 4U0RB 2HVKA 4Y16A 4MJIE 3MBEB 2C5DC 4QRRA 2VXVH 3MACL 2W38A 4Y1AB 2GJ6A 4R90H 5E6IA 2DI8A 4U6TA 1ZLVH 2XZQH 5C6WH 2D9CA 3NACL 2XKSA 2XPGA 4LEXL 1JF5A 2NY4D 5FO8B 4OJFL 5IR1B 4ISVB 2BVPB 3RZCD 3GUTA 4ODXA 1I7ZA 1ZT4A 3EO1B 5E4IA 1EHAA 5C0DB 2HFFA 5DLML 2EDEA 3SE3C 5IM7B 3MO1B 1FGVL 5MEPA 5DMGC 1X6LA 4D0CA 2BVTA 4OQ1A 5K9OA 4YPJA 4JANB 1T04B 3D39A 1EZVY 1QD0A 3BPNB 3NH7L 3QUYD 1E27B 4WV1B 1OLLA 4YE4H 4UNVA 3T1FA 4X5WA 4G42B 4U7MA 4J8RB 2ATKB 4WJ5B 4PJ7A 5LGJB 1A6ZA 5KSAC 4QOKB 4EKXA 1YNKL 1TVHB 5GS2H 3EOAA 4JGMA 2M8XA 5I16A 1RIUH 1XGPB 4QLRA 2FJGA 3LQMA 2DKSA 2VXTL 4PJEE 1INQB 4JFPB 2XIDA 5HGGS 3SQOH 5DQ9A 4PV8A 2R23A 2NR6C 5KSUA 3I75B 3J8F7 2H45A 4PBVC 5F3HA 1UB5A 2JB6A 4HULB 3JV0A 4U33A 4NSKB 1FZJB 1A0QL 4QTIH 5GGRB 4FTVE 3RTQD 5C0CD 4KUCD 2AI0L 3SKOA 1BREA 4AL8L 5HGDB 3PWJB 3ZE2E 1N8ZB 3GGWA 1NFDA 5JXED 4P2RD 3I84A 3VCLB 2QJDA 4L1DA 2ITDA 3IGAB 2IFFH 3FZUC 1TQBB 5DQDL 4HWBL 4WI3A 3SJVA 4LCYB 4HAGA 5I8KL 2ADFL 2CUIA 3H7BB 4IOSD 4L3EA 3MLUL 3MLTA 5JO5B 5IESH 4HDIB 4GQ9H 4XNXL 4ZFZB 4LLMB 1PVHA 3D25A 2P5WE 1QFWM 4BSVB 4HJGB 4X7DC 1G6RL 4YHNB 4GAYB 3O0RH 3ZYZA 4LSVH 1KOAA 2DKMA 1RUQL 5DI8A 4KI5D 4JFFA 1JGDB 4CGTA 3I2CL 4OLWH 4N0FB 1YMHB 3LN5A 1F02I 5DJYB 4G9DA 5CLTA 3RGVA 2C1OA 4IMKA 4LGSB 3O81A 3HB3D 4APQB 1S9YA 3CK0L 4D9LL 5IT2L 5JDJA 2RIKA 4K7PX 12E8L 2X09A 3QNYA 4N8CH 5FDYA 2VYRE 1N26A 3S34L 3WFZA 5EO0B 4LP5A 1JGUH 5KJRH 5C2UB 5TDOA 1CE1H 1CN4A 1KG0B 4M1DH 5KVFL 2E8YA 4PRAA 3RNQB 4RA0C 4BH7B 4MD0A 5CBEB 3P11L 5DHYB 4O2EA 2E9BA 4OGAD 4LPVA 1MOEA 1A64A 1YY8A 4PRPB 1P4IL 1J88A 2W9LA 2HLFC 4XCYA 5HTSA 1S7UB 5DJ0A 4TN9A 4PJ9C 4WEMB 4D3CH 1EFXD 2AJXL 1YEFL 3PDOA 4RMWA 3VFOA 2E7MA 2J8UA 2Q8AH 5LXGH 1HINL 3ZT7A 1UG9A 2ZKHL 3BWAA 5L2KE 4RWYH 1NCUA 4B5EA 4LVHC 3ROLB 4P5TD 5FHBL 1IEAA 3X12B 4OSUH 5GIRB 2W60A 1BJ1J 4FQXC 4HJJH 2XY1A 5B4MC 3HPLA 1QQDA 5HGAA 1BOGA 2BZDA 3IDIB 3O6LH 4PP2A 1MY7A 2VLRE 4G9FD 3MPCA 5ELIA 2EDJA 4HXBL 2ZUYA 2ICES 4PJAA 4M4RA 4RGNB 4W6YB 3ZKXB 3T4YA 3G6JF 5L8LB 5DRZA 4JR9H 3SGEI 1CK0L 3ME0A 4I18A 5KW9L 1LGVA 2HVKB 4Y16B 3EOTL 1QFWH 3K8KA 1T0NA 4NN7C 2GJ6B 1YYLL 5E6IB 4P2OD 3VDCA 4DWHA 2XPGB 3CLEL 4QRSA 1YA5A 2FD6L 2BY1A 1UM6L 3GUTB 4JCMA 4ODXB 1I7ZB 1UA6L 1ZT4B 1T7VA 2AQ2A 5J7CC 3GK8H 3HFML 4PGCA 1ODAA 5MEPB 2F5BL 5I1IL 4D0CB 1WWCA 5K9OB 4KC3B 3GNMH 2VLJD 1NLBH 3RIAF 4B41A 1OWRM 3BZDA 1RIVH 3D39B 2HKHH 1B4JH 3BJLA 2XZCL 4LSSH 3CX2A 1WEJL 1QKZH 3MV7E 5SX4I 3T1FB 3TZVD 3W11C 4RZCA 4PJ7B 5I19L 2Y07L 4OBSA 3G6AA 3QXDB 1A6ZB 3I9GL 1GC1C 1JTOA 2VDLL 3H42L 3KYOA 1ND0A 5SWSD 3MLSL 3EOAB 3K2UH 3F58H 1D9KD 5I16B 4WU7A 4XNZC 4QXTA 2HT2D 2FJGB 2HKFH 4G8GE 4KKAD 3PHQA 1IILE 5ADPL 5HGBA 3OZ9H 4KKCD 2NPLX 1IFHL 4FXGA 5DQ9B 4EIZC 4PV8B 5BW7A 2R23B 2KUTA 3H8NA 4G8FB 2R0WH 1U3JA 1B90A 1MPAH 1A6VH 3QUKA 4POUB 1GAFL 5KS9A 2MPAL 3GB7A 4FQPA 5F3HB 1UB5B 2WBJA 4AEEA 3BDBA 3U4EA 5DC9B 3WDIA 4M6MH 2XICA 3U30C 5C9KA 5EU6D 3SKOB 1KGCE 5KVDL 3GGWB 1NFDB 3Q1SH 3T0AA 2J4WL 4LIQE 3EDKA 2CKNA 2ITDB 3KXFD 2BNQB 3VD3A 4O51A 3T2NH 5A1AA 5I66A 3SJVB 5I73C 1ZGLP 1QBLH 4EZMA 5DR5H 5D7SH 3DSFH 3MJ6A 2BP3A 2OJZL 2A9ML 2DQTL 4P4RA 4L3EB 5IFHL 1KBGH 2QTEA 3MLTB 2RR3A 4HEPG 5IVOA 2L7JA 1CLOH 1UH3A 1WFOA 4ODBD 4FQ1H 5C9JA 5ALBH 1YEJH 2E7BA 1X9QA 1KUMA 3AGVA 3OWEA 5E8EA 1GOHA 3P2TA 3TA3C 1IM9D 1FO0L 3MUHL 4KAQL 3KLHD 5DI8B 4RFEA 4JFFB 4YFEA 2BVQA 5HHXH 4DKEH 2F5AH 3LN5B 4I9WE 1NPUA 4G9DB 3RGVB 4L5FL 4ZXBD 4EI5C 2C1OB 3AY4A 2L7UA 2VTFA 4OCMC 5EBGA 2VABA 2L0DA 1S9YB 3VFGH 2FGZA 3MUGA 2CGRH 3QNYB 4LDLB 4KRPB 2KZ1B 3O9WC 4NKOA 3ZTJH 3KPSD 2FECL 5I8CB 2IPTL 4M1CC 3U4BL 2NY0B 4X83A 1ZHKA 2W9EL 4PRAB 1AI1L 3PABA 4MD0B 5DJ8B 4UNUA 4O2EB 4ODVL 5JW3H 2O5ZL 4OF5A 4X4ZA 5D96C 3ARFC 4MHHG 4XCCL 1TZGL 4ESKA 1FAIH 1RIHL 4DJMA 3PDOB 3TBTA 4FG6D 4LVNB 1CLYH 2J8UB 3RFZC 3BWAB 5E2JA 2NX5E 2DM3A 4FXLA 1N6UA 2F15A 4IIQC 4JHWH 5IOPA 1IEAB 1ADQL 3VXME 2W60B 3D2UA 1ETZA 3GHBL 3HPLB 1QQDB 1V3MA 4MNGE 1BOGB 3OKEA 5HGAB 3WUWA 3QEUA 4PP2B 1H8SA 2G5RA 5HDBF 2R2HA 4PJAB 4E41E 3T4YB 4EI6A 1CGSH 1YDPA 4PJXF 1EJOL 2ARJQ 4I18B 1YEDB 4IRSC 4FNLH 1T0NB 4EDWL 4PJBF 5ERWA 3CDCA 5LG1A 5E8DH 32C2A 2EDXA 2FIKA 3ARWA 1IGTA 3IU3A 4M6OL 4QRSB 3TVMD 5CGYC 4M43L 3O3UN 2YZ1A 3JVGC 5EOTA 1IC5L 5F7UA 3K74B 4YXKH 2XI9A 4IRZL 3ZZ1A 2DJSA 3VXSD 5C0IA 1Q0XL 1HYSC 2X10A 3TV3H 5IGXH 2F53D 1FGNH 3GBLA 2FGWH 3FONA 5DRXA 2WIMA 2X1XR 2V17L 4ONGL 4YBQC 4OM0H 3SGKA 3VGDA 4MD4A 3S35L 2Y1VA 4RZCB 4OI8A 4U1GB 3G6AB 3ZKMD 4NC1E 1L6XA 3KYOB 4FQJL 4RIRA 3FT3A 1MCKA 4WU7B 4JLRA 3QEQD 4NNXA 4QXTB 1BEYL 5F7WC 1WFUA 3L3IB 4HLJA 2D03H 2DMBA 3PHQB 3R0NA 5HGBB 1I9JH 3QDMA 1UYWH 3LKSA 4FXGB 5JORA 1S9XA 2XXMB 1GH7A 4JFXB 1QEWA 4P23A 5JIPA 4XC1H 1N4XH 1A7OL 1J10A 3OXRA 1FNAA 3QUKB 1LEGB 1KXVC 3Q48A 5KS9B 3GB7B 4GKSA 1HEZA 2WBJB 3NA4A 5T5NG 4F9PC 3QEGL 4NGHL 3U4EB 3O4OB 1WF5A 3QG6A 1CGVA 2XKUA 2J3SA 2WUBL 4WHDA 4IOFC 3WFCH 4YR6A 1SY6H 3MACH 1UWXK 4RWHA 4O51B 3KPRD 1FN4A 1VDGA 3MGTB 3NACH 1IBGL 1UWGH 5D1QC 4YXLL 5I66B 2CRMA 4LEXH 2VJXA 2EECA 3AXLA 1GSMA 3SDXF 4YZFF 2DS4A 5D2LF 1J05A 4P4RB 3BGAA 4P4KA 5B22A 3TJHD 5HYJE 5JA8B 5DLMH 4X4XA 1EUTA 3BIAX 4PRHE 5HVGB 1BPVA 2ZCHH 4QYOB 3SOBL 5C9JB 3I6LE 2NY1B 3OV6A 2E27H 3DYMA 3TBSA 3NH7H 5E8EB 1P4BH 1QR4A 4D8PA 1DVFC 4RFEB 3WXVL 2BVQB 1RU9L 1EUUA 3O6FD 1A7BA 4S1QL 4U1LB 3GRWL 2XTJD 4GBXD 3RIFF 4BZ2H 1YNKH 2VABB 3IDXL 5HXMA 2I9TA 3WL9A 4EN3C 4KH2A 3MUGB 2G5BA 4NKOB 3FQTA 4KROC 2DF3A 4UBDC 2GY7B 2VXTH 4WCYL 2WV3A 5INCA 1NDMA 3HC0A 1XR9B 1ZHKB 3IDMA 3PABB 3QUML 4NKMA 3VFRA 1OL0A 3BO8A 4P48A 1JWUA 2FCBA 3ULUH 5F96H 4GFTB 3S6CA 3ALXA 3DSNA 4Z77B 5D1XC 1CVSC 5IWLA 2FO4A 1CD9B 4ZO7A 5ECJE 2X4QA 3TBTB 1DBKL 5K9QG 4AL8H 3AUVA 3KPPA 1ZLSL 2YD2A 5EA0L 3HRPA 5DQDH 4MA3A 1HXYA 3ULVF 5CEZE 5DFWH 3FRPG 4ZNEA 2ADFH 2VDMH 5IOPB 3SCMD 1ETZB 5HDQH 5LVEA 1ERNA 3MLUH 5T3ZE 3WUWB 4XNXH 3QEUB 2VZVA 1BF2A 1X5FA 1DQMH 3W9DA 3BZEA 3L5JA 3T3PE 2R2HB 4NNYA 4EI6B 1PKQA 1HIML 2JCCF 3GSRA 3QIWD 4OFPA 4GLRI 3MNVA 2H2SD 4KI1A 1RUQH 3QDGA 3QJFA 5ERWB 4DEPB 4S1RL 5JR1H 3I2CH 1J7VR 2EE2A 3H9SA 3EYUL 32C2B 2FIKB 1IGTB 3GMQA 3IU3B 1OAUL 3DI2B 3QQ3A 3NIGF 5MERA 1Q38A 4MCYB 3RDTD 4G3YH 1OAZL 1UM4L 5EOTB 5BRZA 5FCSH 2MHAA 3S34H 3X13A 1MHEB 2MKWA 5C0IB 5T3XH 3C9NA 1AXTL 4JFOA 4YQXH 1RSFA 3D3VA 3GO1H 3V4VL 3MODL 1QBAA 5DRXB 3FONB 3P11H 2DN7A 3IXTA 1FVCA 5J0BA 5CMAA 3WXWL 1GC1L 1P4IH 1PG7W 1YJDC 4JRXA 4JFQA 1ROWA 4MD4B 2FRGP 1A7NH 3TCXA 1YEFH 4X6CF 4YFDB 3OB0H 1J1PL 4RIRB 3FT3B 1HINH 4IRJC 2LVCA 1JNNL 5E94A 4JLRB 4NNXB 5GJSL 3QQ4A 4BFIA 3EJYD 4QRRD 3RY5A 3LRHA 5FHBH 1VKXB 1W8NA 1B0RA 4MQSB 4OZHA 1U2CA 3KPLA 3QDMB 5DJ6A 1LHZA 5KAQF 5JORB 5CGMA 1S9XB 3FCTB 3MSPA 1QEWB 4P23B 2R1WA 1GVIA 4BSWB 3PV6B 4X5XA 3OXRB 5E9DE 1QSFA 3KYNA 4GKSB 1HEZB 3BRGC 4WUUD 1EEQA 5K59F 3GM8A 3RUGF 4AMKL 3AU1A 3PF2A 3QG6B 4GXUN 1ACYL 5FUCC 2E9WA 4YR6B 3D39D 3MRJA 1FN4B 4U1MB 3DGGA 3P73A 4LSTH 1WIOA 3X3FL 2GK0A 3CLEH 4OLYH 3AXLB 2FD6H 3OJDA 3VXUD 4P4KB 5AYUL 1IGIH 5HHPA 3VH8G 4UQ2A 4X6DE 1I7RA 1TTUA 1A14L 3HFMH 4QRQA 1WZKA 3KYAA 2IAMD 4OM1L 5KSBE 2IADA 3QDJD 1IKNA 3E0GA 5KSVA 1CTOA 3TBSB 1AQKL 2OR7A 2XZCH 5AEAA 1SHMA 5IIEA 2XZAL 2X1QA 4D8PB 3BIKA 1WEJH 3T04D 4YEFA 5I71B 4JRYE 4M5ZL 4OIBA 5I19H 1PLGL 3EUUA 2Y07H 1I8MA 3S97C 3CUPB 3S4SA 3B6SA 3LS4L 4PG2C 1WCQA 2VDLH 3H42H 2Z4QA 3CD4A 3MLSH 5HHOA 2I9TB 3WL9B 4PJFF 4NQCA 2G5BB 4Z7WA 3VWKD 5INCB 4DVRL 1NDMB 4HS6A 3HC0B 1IFHH 2R29L 4CAGA 1C5DA 2CLZA 2YD8A 3QFDA 3M45A 4NKMB 3KR3H 4JO3H 3BO8B 5LAXA 2OCFD 4N0YH 3TEUA 3TO4D 3VFRB 3QULA 1JWUB 2GHWB 1AO7A 2IPUK 2MPAH 4YDVA 1UJ3A 1I75A 4RX4D 1SM3L 4A6YH 3U2SA 3BQUD 2FO4B 2BVEA 3BPCA 3L9RA 3ARBC 1Z0NA 5SWZA 3FHAA 5FAAA 3L7EA 2X4QB 2VLKE 3L3HA 1EX0A 4KJWD 2QHRL 1J9CT 3CMOL 4HWBA 5KVDH 1A7QL 1JRHI 3KPPB 5C0AD 5KTEH 4X4YA 4KJYA 3FB7B 5GXBB 1AGDA 1HXYB 1J11A 1MWAL 2YD4A 5DJCA 4KTDH 4FFVD 2J8OA 1BFOA 4Q6IA 1JF6A 3RGVD 4TSBL 5IFHH 5DQJB 3PJSA 3UROR 4HIHA 1WCBA 1AGBA 2HG5A 4GKNB 4URTB 2DL2A 1G6RA 3BZEB 5FGBA 4NNYB 2W0LA 2MTPA 4I0PC 2Q3ZA 1EXUA 1PKQB 1CE6A 4HV8A 5TGBA 3GSRB 5IP4A 3S3PA 3MNVB 3O4LE 3IT8D 3QWOA 1RZJC 1RK1A 5J3HC 3SDAB 1P7KA 4KAQH 1BFTA 3QDGB 4LIQL 1Y6MR 2UWEE 3QJFB 3B8SA 3H9SB 4L5FH 5IB2A 4XPFL 3GMQB 3C6LD 1MRDL 3QQ3B 5MERB 1RUKL 2HTLD 3BKJL 4R97C 3SDCA 5BRZB 3S8WA 2V5SA 4X99A 2MHAB 3X13B 5D5MF 4O58L 4L8SA 2IPTH 1A6AA 2BHYA 3E6FA 4JFOB 1UVQA 2W9EH 3D3VB 3LB6C 2VR9A 4K2UL 4F8QA 3RZWA 2EEAA 2GY5A 4ODVH 3IXTB 3U0TA 1JMXA 3SGJC 1FVCB 5CMAB 4U05A 4H1LH 4JRXB 2AABH 4JFQB 1HCFX 1IQDA 2NY4C 4PLJD 3ESVF 4MS8D 5BCAA 4NN6B 2UUDK 2X4NA 3C6SA 2C3XA 1MCIA 3AC0A 3L5XH 1RQ5A 5GGRY 5E94B 4CDGC 2CO6B 4N8VA 3QQ4B 4BFIB 1EEUA 5I30L 2O5XL 3WHE1 5HYFA 4HH8A 4LNVA 1B0RB 1ADQH 1A1OA 4HH9A 4OZHB 3KPLB 5F7MC 5DJ6B 1A21A 3O11B 3GHBH 3U7WL 3QUYC 2R1WB 3EHBD 4X5XB 2X4UA 5DD3L 5FECA 1NMAL 1A47A 1QSFB 3KYNB 2GJZA 3GKWL 3TNNA 4RA3A 5B21A 3TPUA 3AU1B 3CMGA 2X44D 5C6TL 1J0KA 1U8JA 4MNQA 4MAUH 2JJWA 1F3RB 2F19L 3V6ZA 3MRJB 4G9FE 5I1CH 3DGGB 4LARL 3P73B 5I15L 5E95B 2YWYA 3BX7C 4Y4FD 2GK0B 5HVWA 5F7NC 2JE8A 3OJDB 4U1HA 1DQTA 1S5IL 5ACZA 3OB8A 1MHPL 5HHPB 4WHTA 1YC8A 3S36H 1J1XL 4HK3N 1I7RB 4UQ2B 4QRQB 4IDLA 4IRZH 4RRPG 1TTGA 1TZIA 3RTQC 1DQDL 1I3RA 5KSVB 5JXEC 5LJYH 2QQQA 3VFNA 1EGJL 5IIEB 4DUXA 4ONGH 5AWNH 1EHNA 1H5BA 1YEGH 3BIKB 4H0HB 2VWEE 3S35H 4ZO6A 1Q9WA 1I8MB 3QXAA 3KHOA 5FUOL 3S4SB 2GJJA 3RA7L 1WWBX 2WBJD 3B6SB 2VLJE 1RZKC 4FP8L 1S78C 4FQJH 3KJ6L 5HHOB 1EVTC 1MFNA 2DM2A 3CFDA 1G1CA 4NQCB 3MV8A 2Q7NA 1UACH 2ZWLT 4TQEH 2RCSL 4Z7WB 4MLSA 1I9EA 1BEYH 1MREH 1NMCB 2N7BA 1JZ7A 4DKDC 3CVIH 1U8HA 4ODWA 1LEIA 1C5DB 1JV5B 2PW2B 2CLZB 3QFDB 3NA9H 1A7OH 4P2CG 5LAXB 4KI5C 3QULB 4RGMB 3AB0B 1AO7B 1OSZA 5SWSE 4YDVB 5CHNA 3GDBA 1UJ3B 4I4WA 2W59A 3U2SB 2CR3A 2CSPA 3BPCB 4L9DA 3L9RB 3O2DL 2XTLA 4NNPH 3HB3C 5SWZB 4NHCL 3L7EB 4PJ5A 4JPKH 3L3HB 1LDSA 2WUBH 3NZ8B 5INDA 1IC4L 4U6HA 4NM8L 2C4FT 4FOMA 4KKBD 4X4YB 4KJYB 5ALCH 1AGDB 4YXLH 1JI2A 1FYHB 2WINB 1GIGH 4MXVF 5DJCB 2VZOA 1WSST 4FQ2H 5EG6C 5KVGH 1BFOB 4Q6IB 4OGAC 1JZ5A 5CZKA 1IM3A 5FHAL 5IBUG 3PJSB 4KDTC 4HIHB 5EU6E 1WCBB 5C71A 1AGBB 1KTDA 2HG5B 1BBDH 4XH2A 2E5EA 1V7NH 5IEKA 1FO0A 2FJFA 3SOBH 1EXUB 1EO8H 1CE6B 4HV8B 5TGBB 4JPIB 4MWFA 4Q9RH 5IUSA 4YWGH 1P7KB 1G9MC 2OI9C 3WXVH 4QRTA 4P5TC 1RU9H 4JHAL 5GRVL 3ZHDA 5ITFA 4S1QH 2JIXD 5F7HA 4LAQL 3O8XA 3M17A 5I18L 2QQLL 2EDKA 3FO0L 3IDXH 2OBGA 2Z91A 3SDCB 3GSQA 4X80H 6FABL 1LP9A 2IPKA 4GG6A 4X99B 3HI6L 4WCYH 1ZKAA 3UTPD 1XMWA 2A77H 4L8SB 1YJDL 3P3YA 1A6AB 1O5DT 1IZJA 3E6FB 4J7RA 5DFTA 1UVQB 5GGVY 1F45A 4DZBA 4NUJA 3U0TB 4P2OC 2ED9A 4XP5L 3D2UD 4N0UE 2FATL 2DI9A 5DUBA 3FOLA 4ODHH 5T1KD 3P4OA 1U3HD 4ZOCA 1M05A 4Z7QF 1IQDB 2W0KA 3KPSE 3BP5A 4RMTA 1MCBA 1DBKH 2X4NB 1UH2A 2VWEC 5E4EC 2UV3A 4ZPTA 1ZLSH 1ADQA 1J8HD 2CIIA 1PEZA 4JZOA 5DUPL 4XMPL 4ZO8A 4KPHL 3MNWA 2B1HH 1A1OB 4HH9B 3EGSA 1IEBA 4JY6A 5GZOD 1DQLL 1KNOA 2P49B 5JHLL 2X4UB 3I85A 5FECB 3TZVC 3WDHA 3PP4L 4ONFL 2GJZB 3E6HA 2VAJA 1IJ9A 5CWSB 3TNNB 5LGHL 1S7WA 4QNPE 1RJCA 1CL7I 2CJUL 2OXGA 1HWGB 1XGYL 3TPUB 5L6YH 3LVEA 3FFCD 1D9KC 1U8JB 4XHJD 3TJEL 4MNQB 5B8CC 3VXRA 3SE3A 2QKIA 5FYLE 4MGXA 2HT2C 4S1RH 3PQYD 4M7ZC 4P2QE 4M7KL 3V6ZB 4KKAC 5JIKA 3GSXA 3B5HA 4KKCC 4BK4A 1A9BA 3EYUH 1XH3A 5GQBA 4JREB 3BPOB 1JMZA 2MQCA 5T3ZL 4GAJL 4K7PH 4U1HB 4Z8FL 3BMWA 5ACZB 4WHTB 4HFUH 5ANMA 4Y19B 2ICWA 2VC2H 4OFYA 5KSAA 1AXTH 1MFDH 2VMFA 1TZIB 3V4VH 3MODH 1K3ZA 1I3RB 4HKJA 1AKJD 5FGCB 3X17A 4Z7UE 4PD4J 3W0WA 1GC1H 4Q7DA 5HDOA 3ZLQC 1H5BB 1WZ1L 1IGFL 1OT2A 2HJFA 4NO0D 2PTVA 4OZGF 4D0DB 3JWDL 1T66D 3EZJB 1P84K 3QXAB 3EYQD 3TM6A 3EFFA 4OLXL 5LWYH 3FT2A 3KYKH 2A1WH 3KPQB 1J1PH 5C08E 5LGKA 5EIVA 3CFDB 3ET9F 1JNNH 3V0WL 3MV8B 3UBXB 4QHMA 1CVRA 1UCBL 4RSVA 1U8HB 4ODWB 3UTQA 1LEIB 5DC0A 1C5CL 1M7IA 3W82A 1KFAL 2NXZD 3P9WB 1T83A 3KLHC 1MIMH 3BAEL 1OSZB 2ZUQB 3ZKND 5CHNB 4ZMAT 5CJOL 2ZZUT 4I4WB 4M62L 4GS7C 4ZXBC 4HG4J 2OK0L 3UO1H 4AMKH 4PJ5B 1ACYH 3LKPA 2X89A 5INDB 5GS0C 2NZ9D 4U6HB 1CR9L 2A6JA 3WJLC 2AXFA 2B4CC 1ZS8A 1F5WA 1OGAA 3X3FH 4XCNA 3IDYC 3BVNA 5L7XH 3MUZ1 3HC4L 5ENWA 1IM3B 4DGVL 5AYUH 1E6JH 3HKFA 1B9ZA 1KTDB 1A14H 2EDLA 3WYRA 5FO9B 4XH2B 1RZJL 2YD3A 3D0LA 1KENL 3QNZA 4OM1H 5IEKB 2FJFB 4FG6C 1N7MH 1J18A 1GHFL 4L4TD 3ARSA 5HVFB 4MWFB 1AQKH 5A2FA 3V2AR 2OZ4L 3GRWA 2A6IA 1PX3A 4CRPA 3EYOA 4QRTB 4GKOA 5ITFB 5TJWK 4M5ZH 2XWTB 1PLGH 4X7EC 3JWOL 3O8XB 3M17B 2A38A 3MLRL 4NYLA 4PJXE 3HUJE 3F65A 4UNTA 5F71A 3V9FA 3PWPE 5D70L 3W2DH 4I0CC 2XV6B 2Z91B 2F9BT 1VFAA 3GSQB 2V5TA 4PJBE 4ZPVA 3FB8A 5HPMA 3SKJL 1AY1H 1LP9B 4H26A 1FNGB 3MV11 2IPKB 3QUMA 4GG6B 5ACMA 4PJ9A 4GMTL 4POZD 4NKIH 2R29H 1DBAL 4LPWA 2J5LC 2XTJE 1NANI 2R56L 1V3KA 4DZBB 4EBQH 4OCXL 1KLFA 5DUBB 3FOLB 1DTUA 3P4OB 4L29A 1M05B 3L5WA 1U2HA 1KSRA 3TVMC 3IJYA 3LN4A 4GRWF 3BP5B 4FQXA 1NFIA 1R5WA 3TFKD 2QHRH 1TQCB 5T1LD 3CMOH 4PJEA 7CGTA 1A7QH 1BX2A 4G5ZL 4ZPTB 2BRRL 2VITB 1KTRL 1OP3K 1GCFA 4JZOB 2IWGA 1MWAH 5GS1C 1QRNE 3MNWB 3HNSH 1JPTL 1IEBB 5IF0A 4OUUA 4JY6B 1F13A 5F1OB 1KNOB 7FABL 1P7HL 1BBJA 4FTVA 4HC1L 1T1ZA 1S3KH 3NAAH 3M8OL 3OHXA 1DE4A 4NHUA 1QLFB 3E6HB 5CILL 1N6VA 1S7WB 2BOCA 3ZKMC 5IMLA 4MNHA 5AZ2L 3VXRB 3D3VD 2QKIB 2D9QB 1FJ1A 3T4AA 2PUQT 3KPNA 2F8OA 4GRLA 3GSXB 4H88L 1A9BB 1XH3B 1V7ML 2HJKA 5BQ7A 3TNMA 1G7QA 15C8L 1RUKH 5A16A 3BKJH 3PL6A 3RVWD 5ID0A 1DUZA 4J4PD 4YUEL 4UIMA 2CUMA 1KIRA 5DA0B 5ANMB 3O6KL 2ICWB 4O58H 5KSAB 4K2UH 3SDXE 2W9DL 4YZFE 4HKJB 5D2LE 1BJ8A 4KHTL 4GRMA 2DMCA 1UWXH 4AYFA 4JPWH 4H20L 1RZKL 3MRPA 4LCUA 4WV1C 5EPMA 2HJFB 3RPKA 5I2IA 3ECBA 3MOQA 1E4KC 3P0VL 5JMOC 1I9IL 4Q58C 3GBMH 3EFFB 4ZD3L 3ISWA 4GW5A 1OPGL 3TJHC 1QLRB 4JDZA 3ARDD 4LVOC 4MJ2A 2FL5A 2H32H 5D1ZD 4DCQA 3IFLL 5I30H 1IEHA 5I9QC 4QHMB 1NAML 1CICD 3O3AA 5GZND 3CFCL 5JPMA 2F8VA 1I7TA 4JQXA 1M7IB 5I8OL 4ZDHB 3TH3T 1XAUA 3INUL 4KK5D 2R15A 1NMAH 1OSPL 3O6FC 3GKWH 4ZAKD 4XWGL 2XTJC 2YRZA 3DOSA 1L4IA 4GBXC 4PGZA 4ORGA 4TRPL 1KCUL 5L2KA 2XY2A 3LKPB 3QQ9D 3H2WA 4TUKL 2ATPA 5LQBL 2A6JB 3QH3A 3CX5K 4CVZA 2F19H 2AXFB 3DECA 4L4VE 4Y5XC 1ZS8B 4LARH 1QNZH 4P9HC 2VLRA 4WUUE 3HMXL 3P0YL 1T20A 4XCNB 4Y0GA 5D2NC 3TA3A 3BVNB 3NABH 4N68A 3QAZC 5ENWB 3WLBA 1S5IH 1MHPH 5DMYA 4LQFL 1J1XH 2I26N 4NWUL 3D0LB 3ULVE 2BERA 4EI5A 3QNZB 5D7IE 1G9ML 4KTEL 1M7XA 2A6IB 1DBBH 3EYOB 4UOW0 5C09E 3N9GL 3SCMC 3OX8B 4NN5C 4NYLB 2JCCE 5E2UH 2PXYD 3QDJE 1TVDA 3ROOA 5FCUH 3JV4A 5EU4A 5DMIL 3JUYA 3O2VL 2KBGA 5ESAA 1VFAB 3AM8C 3ARFA 1E4XL 4ZPVB 3F6IA 3FB8B 5HPMB 1BP3B 3QZWG 1P6AB 4H26B 3ARPA 3QUMB 3MMEA 4PJ9B 3QIWC 3E3QE 2H2SC 3NIGE 4X8XA 5D7LD 5DJZA 2F54E 1W72H 4R4FH 5JHDA 4UILL 1G9NL 2VXUL 4LVHB 4TUOA 2ZCKL 5IB4A 1IGJA 3FRPA 4IIQA 4L29B 5DVLA 3O2DH 3L5WB 3IJYB 3LN4B 4OFKA 4NHCH 5FF6A 4FQXB 1NFIB 2C4FU 1R5WB 2QSQA 1J0JA 2XRAL 3RDTC 3CVHL 4G8GA 1MWAA 1BX2B 3QRGL 4R7NA 2UVFA 1KCVL 1S7QA 3VG0L 3WFEL 2MMXA 4CMHC 2EH8L 1ZV5A 3CZFA 2EDQA 3QFJE 5EOCH 5IF0B 1UKSA 4OUUB 4IRSA 3T0ED 2AEWA 1JPST 5E1HB 1BBJB 1NAKL 3IFPA 4NN7B 4FTVB 1T1ZB 4UT6L 4UU9A 1FNEA 3OHXB 3UDWC 1DE4B 4NHUB 5C0AE 2V2WA 1OARL 2BOCB 3GSUA 1ZA3A 2CPCA 5IMLB 2FX7L 1ZGLM 5FIEA 3S37L 4PJCF 2ILLA 3ESUF 5A43C 3JVGA 3WS6A 2OP4L 5BVPH 5I6XC 1UXWA 1V5JA 3N1FC 3EJYC 2VNCA 1FJ1B 3T4AB 1ULVA 3IS0X 4HXAL 4HS3A 3SE8L 4LAQH 1NGXA 3RUGE 4PRID 2QQLH 2YOCA 1OQXA 3TWCL 2HJKB 5BQ7B 4Z9KB 3TNMB 2WNGA 1G7QB 1T2QH 2OSLA 5A16B 1DANU 3PL6B 5ID0B 2VOTA 1DUZB 3K7UA 5IW1B 1KN4L 1G0DA 4UIMB 2GKIA 4PYHA 4OGYL 1KIRB 4XNUL 4XVSL 2ZUTA 1YJDH 4KVCH 2Q76A 5BOZG 2GW5A 2WBKA 4QRPE 5MHSE 2RBLA 2X1PA 5T1DL 4GRMB 4XNZB 4XP5H 5C07A 5E2TH 1BD2A 4C83A 5KVMC 2ZJSL 1T03L 3MRPB 4LCUB 5BS0E 3UYOD 5EPMB 4P2YA 1FC2D 4WFFD 5I2IB 3ECBB 2XWJA 3V8OA 3VRIA 1MLCA 2H32A 4AEHL 4M1GL 4GW5B 4JDZB 4M6NH 1SBSL 4LHJB 1P4LA 2FL5B 4LU5H 1BQHG 2IAMC 4DCQB 1WVZA 1Q8MA 4XMPH 4KPHH 4U1JA 3RVTD 3O3AB 4F9PA 4CN4A 1I7TB 2ZG1A 1K6QL 4U6VH 4K3GA 4ZTPH 5TE4L 3WKNA 4DGYL 4PJFE 1E4WL 3TYFA 4KTYA 2VDOL 4ONFH 2FIRT 3NCYS 4LMQI 1HSBA 5D1QA 5GS0L 5I73B 3EYSL 3KHQA 5LGHH 1KPUA 2CJUH 5IVZA 4ORGB 1KCKA 2B4CL 5F9OH 5L2KB 2NX5A 3SN6N 3TJEH 4OF0A 3G5XA 3BDYL 1LMKA 3GMLA 2ATPB 3VMPA 3VXMA 3CFBA 3QH3B 4CVZB 4M7KH 3VWKC 4HUVA 3A6CL 2RAMA 1SYVA 2VLRB 1DCLA 3DYPA 1T20B 3QUZD 3TO4C 3FQNA 3TA3B 1FG2B 4PB0L 5T3ZH 1CLZL 4GAJH 4CJ0A 1DVFA 4E41A 5J57B 3CLFL 2CH8A 4Q6YA 2OTUB 3BQUC 3QISA 3VI4F 4DTGH 2HWZL 1AGFA 1HXMA 1MLBA 1EGJA 4I5BA 5D7KD 4EI5B 4NFDA 3NCEB 4KJWC 4XPTH 5FV2A 4EN3A 3C08L 4HWUA 3BKYL 4Y2DD 3VI3E 3O9WB 1EHLL 3MLVL 5FYLL 2R2BA 1WZ1H 1KPRA 4AIOA 4I2XE 4R7DA 1RD6A 4FFVC 2DBJA 1DFBL 1FYTE 1T80A 2CXGA 3MC0A 3ROOB 3NTCL 3JV4B 5EU4B 2F8XC 5ESAB 5D96B 3V0WH 3ARFB 4ZUUA 1U6AH 5D1XA 3QWRA 3QIBD 3MMEB 2DQGL 1FH5L 2YD1A 1UCBH 2CDFB 1OY3B 5F9DC 2BOBA 4GW1A 1KFAH 4LDEB 3JBG7 5DJZB 5IB1A 3OKYA 3BAEH 3O2DA 3BP4A 5JHDB 4YO0A 4TUOB 1V3JA 1LDPL 5AUMA 5CJOH 2FLRT 5IB4B 4M62H 1WBXA 2HVJA 4IIQB 3QCUL 2EKJA 5D5ME 3C6LC 4PS4H 5FF6B 2FSEA 2MQ0A 4HMDA 1QOKA 2CKBL 1MWAB 3AVEA 2WMPA 2YD9A 4KRLB 1AJ7L 5C2BH 1XGRA 4XMKL 1S7QB 1ITBB 2HFTA 4C56A 4ERSL 5HHMB 3B9DA 3U83A 3CZFB 1QBML 3HC4H 4IRSB 1MI5D 3MX0A 1XCTA 3NN8A 3IFPB 3MLWL 3P9MA 5K9JH 1INDL 2UY7A 3L95A 1FFRA 1MCWW 1RZJH 1PD6A 3QUXD 4PLJC 2V2WB 4MS8C 1KYOJ 1KB9K 2UUDH 3GSUB 1DEEA 1HHJA 1GHFH 3C8HA 3PWUB 4XPBL 3DMMD 2OZ4H 1UXWB 4PTUA 4KGJA 2RQ8A 4HS3B 5DHXB 4IBLT 4PP1D 2D0GA 1NGXB 5HYJA 3RY4A 1NUFA 3MLRH 3B9EA 4JY4A 3H0TA 4PRHA 3EHBC 1QBBA 1P69B 4IOIA 3BGFC 5L88L 5D70H 1FZKA 2OSLB 3EAKA 1DEDA 3FB6A 3SKJH 4IHOA 1VHPA 3FMGL 4GMTH 1F90L 5CP3A 1DBAH 5IMOB 3D48R 2R56H 4JFEB 4NQDE 2P7TA 5C07B 1BD2B 1YPZF 4C83B 3UXFA 1AE6H 4HAFA 5DZOA 4Y4FC 2Y25A 4U1IA 3UP1A 2XWJB 4Q2ZB 4LPXA 3VRIB 1MLCB 5EUOF 1BGXH 1U8LA 2H32B 4KUZL 4R96A 4G5ZH 1P4LB 2BRRH 4Y2OA 2A83A 4HD9A 1BFVH 3DWTA 4U1JB 3VXRD 3LRSB 4WI9A 4FQIH 5DJAA 1YNLL 5HYSG 4XP6H 1JPTH 1TIUA 5J56B 1OD7A 4ZOBA 3GJFK 3L3KA 1F4HA 4YHMH 7FABH 5E2VL 4HC1H 3TYFB 4N90D 4GO6B 3GM0A 5L8JB 4ZUWA 3M8OH 2LE9A 5D1QB 1J8HE 5I8EA 1S7XA 5CILH 5T5FL 2D7MA 1KPUB 1NFKA 4HWEL 5IVZB 5AZ2H 3M1BB 3RL2A 2NX5B 1ZGLA 2DD8L 3QWQB 5KSAD 4P9HL 3G5XB 1BQUA 3GMLB 4RRPA 2YMXH 3CFBB 3VA2C 4HUVB 2BSTA 3W0WD 3REWA 3O41A 2PCPA 4H88H 4XMLL 1T0MA 1J0ZA 4D0BA 1V7MH 1SYVB 2P8MA 4KMTL 4J3WA 4X4ME 5TPWL 3Q6FA 4V1DD 15C8H 3FQNB 1NC2A 4NBZB 4F33A 4BM7A 4E41B 1DVFB 3MLYL 3FFCE 2ESVD 1QVOA 1QO3A 2ZUXA 4EXPX 1B0GA 1N3NA 3BISA 5EH1A 3LQZA 3PQYE 5HI4D 2WQ8A 1AGFB 1HXMB 1MLBB 4I5BB 1VCAA 4PG2A 2W9DH 4EN3B 3LD8C 4KHTH 1KIUA 4KKBC 5C8JA 4Y4HD 2R2BB 4H20H 4KROB 1KPRB 3OAZK 5KAQG 4K94C 1IC1A 4FQQA 2QQKL 4R7DB 3MBXH 4PRDA 3P0VH 1MH5A 1OAXL 3U79A 1I9IH 4RCAA 5IFJA 3VGBA 4ZD3H 4QXUL 4EXKA 2Y7QA 1T7XA 1XFPA 2GYSA 5KS9F 3ZE2F 3TYGL 4ZUUB 5D1XB 3MRIA 2X89D 2VZ3A 3IFLH 4PRNA 1QA9B 2B0SL 2R2EA 1FP5A 4F9LA 1JL8A 1VADA 5IHZA 4NQED 4NT6A 4K8RD 3L3JA 2BSRA 4E0RA 4JN2A 5I8OH 2BOBB 4XP9H 4GW1B 1OGAD 5IB1B 4OZFG 1OSPH 3F7YA 3BP4B 1CBVH 3MYJA 1R0AL 4YO0B 4XZUA 4JN1L 1VB9A 4XWGH 2HVJB 4P49A 2AK4B 2Z35B 1KCUH 1N2RA 5J1AA 5SV4A 2FSEB 4MJID 4OIIL 4GSDH 4PUBH 3LQAC 3FN0H 3EFDL 5LQBH 1L9NA 3MCG1 4R4ND 4CJ1A 3QCTL 5TDNA 4I0PA 3UTTE 4LLAA 3CAFA 1XGRB 4TNWF 4Z7QE 4C56B 1G7LA 3DV6A 3HMXH 4OF6A 3P0YH 3OTTA 1HZHH 5D8JL 4WW2F 3QPQD 4MJ6A 1XCTB 3NN8B 1HKLL 3P9MB 4P5KA 3L95B 1U3HC 4PR5B 5D93C 2DL9A 1OAKL 1G9MH 1JHKL 2OZ4A 1DEEB 3FQUA 1MCNA 2IG2L 1SVZA 1MCQA 4KTEH 3MR9B 4KKLD 4JFDA 4PTUB 4UTBH 1OP9A 3WIIL 4MSWA 1X44A 1HHIA 2XQYK 3N9GH 2QR0A 2JK5B 4NO5A 4C4KT 1ZEAL 5HYJB 2YKLH 3RHWF 4WI7A 5GZOC 3H0TB 3F7VA 4PRHB 4F80A 1D7FA 5C0BB 3SGJA 4IOIB 1FL5A 4WGVB 3WHXA 5DMIH 1FZKB 3O2VH 4L4TE 4ODSH 1GGCL 1E4XH 2D2OA 2VLME 3FB6B 4IHOB 3ULVL 3VXNA 4J1UA 4ZFOL 3GI8L 5IMKB 4XHJC 3TBWA 2BDNL 2P7TB 1CFNA 2IGFL 4UILH 2VXUH 4EIGB 3C5ZD 3VGHA 2ZCKH 5M7QA 1VEOA 1ACZA 4XPGH 5MEND 5FKPB 1F58L 4HKBA 4MA7L 5AG8A 1U8LB 2AKRA 3DYOA 3CVHH 4O4YL 3QRGH 4XCFL 3T2OA 1MCOL 4QXGH 2VXQL 2R4SL 4OZGE 1Y0LA 1KCVH 3RI5F 2A83B 1JZ6A 4X6EA 3VG0H 4H0IA 3WFEH 5LCVL 5DJAB 4PFEA 4HC1A 4GRLD 2EH8H 2OL3H 1Q9OA 4KRNA 2W92A 3L3KB 4BKLA 1NAKH 1HOCA 2AAVA 1F4XL 3P77B 4BQ9A 4MQTB 4ZUWB 1T66C 4WI6A 3CC5B 1ZLUK 2P5WD 3PL6D 4R8WL 1S7XB 3EYQC 4HK3J 3UZVB 2FX7H 3RL2B 4WNQA 2OP4H 2D7NA 4M93C 4LCWD 4AENA 3SE8H 3EOBA 2BSTB 1UKQA 4P59L 5C0RH 4TVPE 3REWB 3O41B 2PCPB 3S5LG 1T0MB 4F7TB 4D0BB 1OT1A 2P8MB 2NXZC 5L2JA 5JXEA 3Q6FB 2XT1B 1NC2B 4OLEA 4F33B 2BNUA 3ZKNC 3HE7A 5DVOA 1QVOB 1I7UA 1QO3B 3O4LA 4XNUH 5EZIL 3JWNC 1B0GB 1MQKL 1N3NB 1QYGH 4XVSH 2O5YL 1CXKA 4TNVF 3D18A 1U3YA 4X7CC 3G6DL 3B4NA 2NZ9C 5T1DH 4FQCL 1KXTB 5C8JB 1J0HA 5EUKA 2DQUL 1OAYH 1DBML 1IT9L 1S9VA 5B38B 3DVNA 3NVQA 1K8DA 4FQQB 4AH2B 2PYFA 5FYJD 4PRDB 4JZNA 1MH5B 3DRTA 4AEHH 4UT9L 1NAMA 4WTZG 1SBSH 2Y7QB 1RUPL 5K93A 3TN0C 2E7LC 3V6OE 3NCYP 1VA9A 3MRIB 3ARBB 4XP4H 2R2EB 4BUHA 5IHZB 4NP4L 5E56A 4NT6B 3L3JB 2BSRB 3QEHA 5SV3A 4E0RB 1K6QH 4JN2B 2XZZA 2RJMA 5IVXA 5TE4H 2JTDA 5A2KH 4DGYH 4YHOL 4L3CA 1IGCL 2CK0L 3F7YB 3PXJA 4LCIL 3MYJB 3TA3D 4XZUB 5GGSA 5H94A 2FLBT 4JDTH 3Q3GA 1K5NA 1Z9SA 1GXEA 1N2RB 2B4CH 3MV9E 5J1AB 4WO4A 1EAPA 5DC4B 1N5YL 3BDYH 1Y6KR 3HMXA 3W9EA 3Q6GL 3WV0A 4S10A 1R3HB 4M4PA 2Q7YA 4POZC 3A6CH 1EFXA 4I0PB 4Z95L 3NCJL 1JWMB 1G7LB 3DV6B 4Y7MA 4PJDA 4JKMA 1CLZH 2Y9RT 4MJ6B 5CKGA 1RZIB 4P5KB 3ARUA 4RFNB 4OI7A 4JM2D 1D5MA 4HCRL 4YXHL 4HPOL 1WIPA 1N0LA 4HX1A 2B39A 3TFKC 5B39A 3FQUB 3C08H 4G9FA 3RVVD 3BKYH 1FFPA 4R97B 4GKZA 4JFDB 1FRGL 3MV7D 3MLVH 1OP3H 2GEEA 4CU7A 4MSWB 3K8MA 1HHIB 1NBZA 2QR0B 4NO5B 4OD2A 3A6BL 3VRLE 1MRFL 4EVNA 3EIFA 4JFHE 4M02A 3ZHLA 2Y4SA 4FRWA 1CIUA 4HW6A 3F7VB 2FB4H 3D87B 4P2OA 1FL5B 3WHXB 1KF9B 2IQ9H 1MRCL 2NY5L 1JGVL 1MF2L 4NRYA 4WEUD 2HFGH 4G8GD 5JOFA 1UKTA 5C0EA 2NY4B 3VXNB 4J1UB 3E8UL 4CW1A 1U3ZA 1SQ2N 3OSKA 5CBAA 3RX5A 1HQ4B 2J2ZA 3TBWB 1KIQA 3WD5H 2XACC 3RX8A 4MQ7A 3OAUH 3QHFL 1LDPH 1ONQA 2VLJA 3K81A 1CXEA 1DUYA 3CVHA 3QCUH 1RAMA 4H8WC 1OM3L 2X4RB 4HKBB 1Z6JT 3QUYB 1I1FA 3RVWC 2AKRB 3BH9A 4J4PC 1OP5K 3TZVA 2FEEL 5D7LE 1S9KC 1F2QA 2J6EL 3U0WL 1Y0LB 5CZVL 4X6EB 1X3DA 4HIXL 5I1KL 4K3EH 3QI9D 5BMFH 3ZDZE 5SWSA 4ERSH 1IGML 5F88A 5EWIH 1Q9OB 1P6FA 3V6OC 1QBMH 2EC9U 2OR8A 5B8CA 5H8DA 4BKLB 2CLRA 3IFNL 1HOCB 1INDH 1FIGL 1CXFA 1FVEA 5HY9A 4UIKL 3VXPA 2NY6D 5I1DA 2YD6A 1Q9LA 3HR6A 5JLZA 1HKFA 3ARDC 3AAZA 1X5ZA 3NFNA 5D1ZC 5GS3A 3T0EE 4AENB 2OYPA 3PIQA 5DEFA 5K9KA 4U7SA 1CICC 4I9WD 3EOBB 3GFUA 5GZNC 1D6EA 4W4OC 1HHGB 5C0CB 5EU6A 2VISA 5L2JB 1PGRB 4KK5C 4P2RB 5L88H 3KXFA 4Q0XL 5IFAL 2KZWA 2BNUB 4ZAKC 1I7UB 4NZUL 3D18B 2G60L 4K94L 1AFVL 3QQ9C 5EDXA 2DLHA 4UV7L 1FFQA 5EU5A 3G6JA 4JQIL 1C12A 5EUKB 1S9VB 1CZ8H 5GRJL 1UXSA 3DVNB 4QHKJ 5JQ6L 2EDOA 1K8DB 2PYFB 4UTAL 2WWKT 3LPFA 1IM9A 3DRTB 3MA9L 4ZFGL 4KUZH 4TSAL 1NAMB 1T7ZA 3IU4H 3VA6A 1LO0L 3PWNA 1HHKA 1LO4L 4UDTA 4RMVA 2WK2A 4JFZH 1MJUL 4C58B 4ZXBA 5DD6A 1U8MA 2OX5A 3VXMD 2N7AA 4PY8I 4WFFE 1K4CA 4N0UA 3QEHB 4I0KA 4QT5A 5IVXB 3H3BC 2I5YL 2OLDA 2DAVA 3KPSA 5E2VH 4L3CB 3WJLA 1S8DA 4LF3A 3LQAL 2FH6A 5GGSB 5H94B 2JKXA 3Q3GB 4HF5L 1K5NB 2VZUA 1GYAA 1CF8L 4HWEH 5BZDA 3KGRA 2PXYC 3MZTA 4QTHA 1CG9A 1EAPB 1F4YL 3HI5H 2DD8H 4OCRL 4P9HH 4AEIH 4K3DL 3MLXL 4KK6D 3THMH 4D9RD 2AXGA 1YN7A 2PR4L 4OB5L 2DI7A 3W9EB 2Q7YB 1EFXB 1CFVH 4K3JL 1WBYA 4KMTH 5DXWA 5F7LB 5TPWH 4PJDB 3NPZB 4R2GD 1K3IA 1I8KA 4O9HH 2HJLB 2AQ3A 2OI9B 3TO2A 2X9WA 4YHZL 1UQSA 3KWWA 3SKMA 1D5MB 5JA9A 4XX1E 5FOBA 4HX1B 4DGIL 2B20A 3EW3B 3QWRD 4WFEE 1B2WL 5B39B 4P2QA 4G9FB 1FFPB 4GKZB 2AJUL 2EKSA 3QZWA 3OBAA 4YHLL 1NBZB 4JB9H 2H6PA 1HSAA 4OD2B 3RU8H 4EVNB 3QXVA 3ULUF 4WI2A 4UV4L 5D7KE 3KYMA 3T0EC 4NOBA 4PJCE 4QXUH 4MA1C 1VFBB 4P2OB 1XF3B 1N6QL 1R24A 4NZTH 5I74C 3CCHA 3D5OF 5I75C 4NRYB 1A9EA 2VDRL 5JOFB 5C0EB 3AMKA 4W6XB 3TVMA 4CW1B 4H25A 5F7KC 5CBAB 4UI2A 2VLLA 5E4EB 3MNZA 4PRPE 5IHBA 3IETA 5CIPA 3SDYL 1CDHA 1R0AH 4MQ7B 1I1YA 4JN1H 5DJXA 5GS1A 2F53A 2VLJB 1DUYB 3CVHB 3HCVA 4IJ3C 2CKBA 1U8OA 5GGQH 4OIIH 3BH9B 5FM5M 3TZVB 3RVUD 2BFVH 2ZUUA 1CTNA 3EBAA 2OL3B 1OCWL 4FHBD 3MQIA 3HLAA 4RMUA 1KCSL 2VN4A 5CJBA 4RGOL 5SWSB 3RWIA 3STZA 5F88B 4UT7L 3ZT5A 5B8CB 4TTDD 2CLRB 2NQCA 1FVEB 2DQHH 3NZHH 2CIKA 4M7ZB 3VXPB 5HY9B 5I1DB 2APFA 1Q9LB 1OAKH 3G08A 1JHKH 1YN6A 5JLZB 4AZ8A 3SBWC 5DK0A 3HAEG 3OKDA 1B88A 4I3GA 1DN2A 3ZSTA 2GI7A 3AAZB 3NFNB 3OKKA 2GJ6E 2ZSWA 1MI5E 3OB0K 3KDMA 3PIQB 5DEFB 2Z8RA 5K9KB 3RVTC 4J2XA 2H41A 2WW8A 1D6EB 1JUFA 3DLQR 5EU6B 2VISB 5F21B 3GHEL 1PAMA 2D31A 3KXFB 1EH9A 1I8LC 1FL6A 2EIEA 3KPRA 1GGCH 4BSJA 4AIZB 4HLZH 3B2VL 2DLTA 2E3VA 3VGEA 1E4KA 4E5XA 3ZYIA 4J23A 1JYXA 4YPGA 1EMTH 3GI8H 4FQLL 4KDVA 1G7PA 8FABA 4NJ9L 4LLDB 5EU5B 3G6JB 1BQHA 2AJVL 1C12B 2IGFH 4JVUA 4PJXA 1UXSB 3N1QC 3PWPA 2ZOKA 3FOMA 2KKQA 3QUZC 4MA7H 4PJBA 3D6GA 4ALAL 1IM9B 2ZPKL 2XA3A 3VMNA 3MXWH 4PREA 1TITA 1L6ZA 4O4YH 1MCOH 2Y5TA 3PWNB 1GGUA 1HHKB 2VXQH 4UDTB 4GS7B 4GBXA 5CEZD 4ZS7L 4ZXBB 2DBLL 4LBEA 5DD6B 1U8MB 5LCVH 5I1GL 4XVJL 1K4CB 3CSYA 2W65A 4QT5B 2CXKA 4ODTL 5F8QC 4Y2DC 2Y06L 3KPSB 3W81A 1CDJA 2P5ED 3UYPA 3MLZL 1S8DB 4OT1L 4Y5XA 4LF3B 4NJAL 3I3BA 4X6DF 4R8WH 3S96A 5BZDB 3BDXA 5D2NA 3IDYB 5KSBF 4QTHB 1CG9B 3U7YH 3O3BA 3DI3B 3SE9L 1QRNA 2BNQE 3HTLX 2AXGB 3EJJX 1YN7B 1LK2A 3QIBC 1H8OA 4N90E 4XBGB 4P59H 3JUZA 2EDNA 4Q9CA 1ZA6A 3V95A 1FLRL 1WBYB 4G6FD 3DVFA 2HTKD 4U1KA 1I8KB 3UC0L 1A3RH 2VZTA 2P8LA 1TJIL 3VW3H 5EOCJ 4ORZC 1X4XA 1KTLA 3MRFA 3TO2B 1UQSB 3KWWB 4U2ZA 5EZIH 2Y23A 3SCMA 3SKMB 4NZRL 1PEWA 2O5YH 2P42B 3BW9A 5FOBB 2IBBA 2J1KA 3G6DH 5KG9A 2DB8A 3AM8A 5DTFA 4JFFE 4OCYH 2DQUH 2EKSB 1G0YR 3QZWB 4LLWA 1IT9H 1LEKA 1FE8H 2ESVE 3QIWA 2H6PB 1HSAB 4TVPL 4K7FA 4X98A 2J5LB 1NBVL 4NZJA 3KYMB 4UT9H 1AD0A 1SMAA 2HRPL 2YA0A 5TF1L 2X40A 1R24B 5ITBH 2I9LA 5CKAA 1YUHA 2XOTA 3QDHA 3CCHB 3SDXA 5HI3D 3QUXC 2Z8VC 1AR1D 5D2LA 1A9EB 1S7TA 1XIWA 1YEHL 3V4UH 5I1EL 3TVMB 1RFDH 4H25B 2VDKH 1SJXA 3RDTA 1A4KA 1C5BL 2VLLB 3DMMC 2QQNL 2OS7A 5GJTH 4H8WL 3QRFM 3BPLC 1VESA 5E9DD 1D5ZA 1W2KT 4YH6A 4YHOH 2CK0H 4LCIH 3HS0A 3IETB 5CIPB 1WBZA 5DJXB 2R1XA 4PP1C 5GS1B 2F53B 5EZOL 1UEYA 5A3IC 2QBWA 3HCVB 1CFTA 2CKBB 1U8OB 3CSGA 1MCCA 5FYKE 1IAIL 3C60C 1WJ3A 3VWJA 2AV1A 4TPRL 1F11A 4KWUA 5LKNA 1YPZE 3Q6GH 3UDWA 2UWEF 1BVLA 1U8QA 2AJYL 3HLAB 4MVBD 4M5YL 4W68A 4O2CA 3RWIB 3STZB 3QEQB 3LB6D 2R69H 2CIKB 4WUKL 3VFWA 4HCRH 2LU7A 4HPOH 3G08B 1YN6B 5DK0B 1TENA 3QIUD 3OKDB 4C4KO 4R26L 1MCPH 2GT9A 3OKKB 1FRGH 5FXCH 3LMJL 4WUUA 2ZSVA 3KDMB 4JRYD 5DDHA 3MOBH 1ZANH 3A6BH 1MRFH 1Z5LA 4ETYA 1JUFB 1X5HA 3GJFH 1CD1A 1GZQA 2D31B 2OM5A 2CRYA 4WTXA 4DQOH 3H3PH 1FL6B 4ZFOA 3KPRB 4X6FB 5HBBA 1JGVH 1MF2H 1RJYA 4D9QE 1LD9A 1LILA 1TLKA 2X41A 4E5XB 5DGRA 4YPGB 1N64H 4AEFA 4KJPD 4OLZL 4IS6A 3VXUA 5C09A 5EULV 1G7PB 2P47B 2DIJA 2VDPL 8FABB 1KEMH 3T2PA 4LVOB 1T1YA 1S7SA 2XNAA 3AS2A 1BQHB 3GIZL 4JHZA 2IAMA 2JCCA 4XX1G 4PJXB 3QHFH 5I9QB 4JKWA 4L8CA 1CFBA 3QDJA 4J3XA 5HHQA 5HYSA 4GJTB 5IJKC 2ZOKB 3FOMB 1LO2L 1OM3H 3T0VA 4NCC2 2VLKD 4PJBB 2XA8L 5EBMA 4PREB 2DQDL 3GBNL 1KEGH 4YBHA 2XFXB 4MYWB 2Y5TB 3O6FB 4CKVX 5ABDE 2PO6A 1QFWI 1OAQH 2J6EH 3HZMA 1J0YA 1ED3A 2XTJB 3U0WH 5TDPA 4GBXB 5HI4C 2A9NL 3A6OA 2VRAA 5CZVH 5I1KH 1EEZA 2F54A 4HIXH 4N1HB 3WHE0 3LEVH 4X9GA 4XI5D 1IGMH 4YDLC 2NLJA 1BWMA 5MENE 3CSYB 2W65B 1EDQA 1WUNT 3VFSA 5HYQA 4Y4HC 5KS9E 3IFNH 3T65A 5EU7C 1FIGH 3OAZH 1T83C 4GXVH 4UIKH 3VWKA 4Y5XB 4WFHD 5E5UB 3HE7D 1H15A 3D9AL 5CJXC 3TO4A 5D2NB 3O4LD 4HPYL 2QLVB 4WHYG 3O3BB 3QAZB 3PWVA 4RX4A 4M8QA 3BQUA 1S78D 4JFYB 3QFJA 1IL1A 4LSUL 1LK2B 4X6CA 5DURB 2ZP0T 3QDAA 5ACLA 4K8RC 2DMKA 1ZA6B 4G8EA 4QKXB 1J5OL 1ZSDA 2FNBA 4U1KB 1JNLL 5C0AA 5IFAH 5IKCA 2P8LB 1KTLB 3L7FA 3MRFB 4OFVA 3ZE1F 2SEBA 4LCWE 1E6OH 3SCMB 4NN5B 2YPVL 3BW9B 4NZUH 1T4KA 4LGRB 5EORL 4FZ8L 3HA0A 4K94H 1AFVH 5KG9B 4UV7H 3PGFL 3K4DA 5DTFB 3RUGA 1SJEA 2ENYA 4R4NC 1LEKB 4LLWB 5GRJH 5JQ6H 2XG5A 5F1SA 3QIWB 4PYGA 4UTAH 3RY6C 4LSQL 4QHUA 4K7FB 3O6ML 4X98B 1LE9A 2RHEA 3TT1L 4ZFGH 3QPQC 4TSAH 2NYYD 1AD0B 4OZFA 1FZMA 3B83A 4DN3H 5IHUH 4WO4D 3LEYL 3OGCA 4NQVA 2I9LB 2HH0H 1YUHB 2DTML 4AG4L 4QRPA 1S7TB 2EXWD 1SJVA 5D2LB 5TF0A 1XIWB 25C8L 3C6LA 3LZFL 2H2PD 4PJHB 2X05A 4S2SB 2FR4A 1QG3A 3BHBA 5FYJE 3RDTB 1A4KB 3QPXH 4KKLC 3MXVH 1RUAH 5DD5L 2DLIA 2I5YH 4TSCH 1D5ZB 5J11C 1XGQA 3HS0B 4CNIA 1AH1A 1WBZB 2W91A 3LQAH 2R1XB 4LCCC 1CF8H 1TJGH 2OR9H 1CFTB 4CMHB 2WWMD 3LKQA 1F2XK 1BJ1H 4OCRH 2AV1B 4K3DH 3MLXH 1CWVA 1F11B 1TMCB 4OB5H 2B8OT 3QHZL 4FZEH 3GI9L 1BVLB 1Z9OA 1U8QB 5EIQA 4PJFA 5IEHA 3V6FA 2XQYG 4O2CB 5I6XB 4EQ2A 4HCRA 1RZ7L 3C5ZC 2W0FA 4QRRB 3TBYA 4OGZA 3OR7A 4NPYA 1BOYA 5BV7C 1LVEA 1QSVA 1UZ6F 3VFWB 4WY7L 5D71L 4I48A 4DGIH 3IDUA 1B2WH 2X9YA 3ARGD 1NMBL 5A2IH 1S7RA 2GT9B 2R0ZL 2AJUH 1G7MA 1MVFA 4WUUB 2JLLA 2ZSVB 1LE5A 3GJFA 2HFFB 5DDHB 5E99L 4N9GA 3R1GH 1S5HA 1Z5LB 3S3JA 4GRLC 4O02L 4UV4H 4NWTH 4M7JL 2UZYB 5M95B 1CD1B 2EEDA 1GZQB 4FQHA 1NCBL 3FO1A 4ZFOB 2I60L 4ENED 1ZLUH 3PL6C 1RJYB 4GOSA 4X5WB 1LD9B 4OLVH 2NW2A 4Y4FA 4M03A 1M6OA 4GG8A 4BK5A 1RURL 4U49A 4IS6B 3VXUB 1AGCA 1YMME 5C0ND 4P9ML 1I3UA 1T1YB 1S7SB 2XNAB 1F8TH 2IAMB 1WWAX 2JCCB 2W0PA 4L8CB 1BQLL 3QDJB 5HHQB 5HYSB 3QNXA 2NY7L 3SO5A 1XCQA 4WW2C 4OD1L 2MJWA 4QNPF 5GRYA 1NSNH 2J6EA 5EBMB 2AEQL 3HN3A 5KSUB 1KELL 2WLYA 5DUML 2PO6B 1OCWH 3HZMB 1QSZA 1ED3B 5TDPB 1KCSH 2JB6B 3QDME 1UB6A 4RGOH 2NLJB 3T08A 5GGTL 3UJIL 5D5MA 2B2XL 3VFSB 4JQXC 5HYQB 4OCNC 3T65B 3VWKB 2D4DA 3S5LA 3V6BR 1GGIL 1H15B 2LV4A 1AXSA 3TO4B 3SE4C 2VSDA 4NO2A 2BHUA 3D0VA 3PWVB 5ID1A 5J8OA 2H1PH 4Z7UF 4M8QB 3RWHA 3BQUB 1HYRC 3IYLW 3QFJB 1IL1B 4X6CB 2JJUA 5IBTL 2J12B 3D25B 4G8EB 2DQEL 3F7PC 3GHEH 4YHKH 3NFSL 1X5LA 1ZSDB 5C0AB 4G6JL 4G6AD 5IKCB 2UYLA 4YDKH 4ZSOE 2APWA 1A7RL 2NY3D 3L7FB 3GMOA 2YC1A 1NGWA 4NQSA 3CFJA 4B0MM 1A02N 5HD8D 1T4KB 3RHWK 3H3KA 2Z93A 1EFQA 4NJ9H 2WWKO 3UPCA 4J12A 3RUGB 1SJEB 1MJJA 3ZYJA 3HNVL 5GS0D 1DQJA 4C54A 2YS4A 2YSSA 4QHUB 1LE9B 5HHVL 5TDOB 4ALAH 3F12A 1ZHBA 5HGHA 4XRCA 4OZFB 1FZMB 3I50H 1FZOA 1BAFL 3OGCB 2JIXA 1YY8B 4JM2C 5F7EL 3N0PB 4TUJA 5DZNA 4ZS7H 3BN3B 4QRPB 5E03A 5CSZA 4XCYB 3C6LB 4NQDA 2MQ3A 5I1GH 4JVWA 5DJ0B 4XVJH 2FR4B 4PJIF 4NM4H 3RVVC 3BHBB 3V0AC 3VFOB 1FNLA 2FBJL 2CMRL 1BZ9A 3VD7A 1CXHA 4KQ4L 1XGQB 3MLZH 4CNIB 3C5JA 4G6ML 1BWWA 1IAIM 4NJAH 4M00A 3O2WH 4YHIA 3LKQB 1F4WL 5H37H 5DEZA 3MOAH 1RUMH 4J6RL 4PGBA 5FYLD 5T1KA 5SWQA 1U3HA 4P2QD 2BXYA 1V05A 2YR3A 4HQQH 3BE1L 4ZNEE 4PJFB 4M7LL 2QADD 5FOJA 3V6FB 1FLRH 2UZIL 2VAAA 5DRZB 5IHLB 3UC0H 1J8HA 2VE6A 3HUJF 1KCLA 4HMEA 1TJIH 3F8UB 2R0KL 2X9XA 2W0FB 1IKFH 3LSOA 3OR7B 4NPYB 1XR8A 4D9RE 2YA1A 4N5ED 3FQXA 3FKUS 4I48B 1GGBH 2E9IA 4QWWD 2V2TA 1OP5H 3BGFB 4M48H 4HZAA 1S7RB 3B9KD 5JOPE 3WS6C 1G7MB 3O3EA