5DJ0B

Fc heterodimer design 11.2 y349s/k370y + e357d/s364q
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj0B01
4K3EL 5GJSL 3RY6A 3SCMA 4CKVX 5HYSA 3LVEA 1FLRH 2IALB 1R3IL 4RMTA 1N3NB 5DWUH 2R4RL 4MNGA 4NNPH 4OZGE 3KPSB 2FBOJ 4Y8DC 1N5YL 2DLFH 5GRXG 4JN2B 1W0WB 5DJAB 2X4QB 1W2KT 5C09A 1HH6A 1ZSDA 1WICA 5EC1B 4PJ5A 3T3PE 4XI5D 1HXMB 1EFXA 1HINL 4DK3A 4RISH 4WFHE 5INCA 2L7JA 3BE1H 1YYLH 5JORB 2OR9L 4AT6A 1B0RA 1TZHA 5CMAA 3KYNB 1I7RB 5D2NA 3QUZA 1FNSL 4NQDB 4F33A 5DLMH 3REWB 3PWPE 4IJ3C 1U3HA 1L9NA 5CD3A 4POZD 1CGXA 1W72H 5GGUA 4G8GD 5IWLA 4P9ML 2IFFL 5DJDB 4QHKI 3R0MA 3ZTJG 4KK5C 5D7JD 1OP3K 1SQ2N 2CXKA 2VC2L 1BFOA 3VI4E 2UY7A 3A6BL 4JO4L 4X9BA 5C2UB 4DN3H 1TJIH 3HFMH 1NCCL 1ZAGA 3C5ZA 5FCSH 4G6JL 2DN7A 2FJGB 2GEEA 3GSQA 3TLRA 5EOTB 4JCMA 3D0VA 4ZS7H 1MHPL 4OM0L 5JO5A 4ZOBA 3DUUB 5ELIA 1OWRM 3O6MH 2I9TA 2A6DA 4NPYA 1EIBA 2CRYA 5F7DB 4KI5C 1AHWC 3OX8B 2CD0A 1QPXA 3S37X 4R9HA 1QR4A 4KTEH 4E42B 1XGUA 2DBJA 1RZKL 5JPMA 1BBJA 4H8WL 4R6UA 3JUZA 1CIDA 1G0DA 3EHBC 2VDRL 2PTUA 3MR9A 2R69L 1HXYB 1NGZA 3NA9H 4WFGD 1BZ9A 5C6PB 2I07A 2VLKA 5J13C 2IJ0C 3OXSB 1EO8H 2PO6A 1EVTC 4U6YA 3RX8A 2C4XA 2O26U 2VZVA 4LFHD 1DQDL 4KXZH 4O02L 3FFDB 4N0YL 2GJ6E 3MOAL 4LCUA 4U1IA 5I19L 1IARB 3WNMA 4HUWA 1T0PB 1CXEA 1IGTA 3G6JF 3D39B 1WSST 4MD0B 4E5XA 1VEPA 4ERSL 3W5MA 4L4VA 1IGJB 1KNOA 4N0FB 3QG6A 2Y36L 4YDKL 4K23H 4XBGA 4XPAH 1CL7H 4PRIE 4XNZB 1MFBL 4WFEE 2YD7A 3UXFA 3LOWA 2H2PD 5I8EA 1AGFA 1G1YA 3HC3L 2OR8A 1XGRA 2BSTB 1CICC 3MBEC 2YD4A 3WXWH 5HVHB 4PRDB 4AJ0A 2E7LA 1X5YA 3HS0A 1BGXH 5EOCJ 5E5UB 1HSAA 2BXYA 5KSBE 5GGQH 2CXGA 4H1LB 1MFNA 3MLZH 5D7JB 2WZPD 5C0IA 4K7PY 5DS8B 3QA3B 4P2RA 4YDLB 2PYEE 2BOCA 4LPTA 4ZUSA 2FCBA 1T1YB 2AJ3B 3I9GL 5TDOB 2LABA 5EU7C 3QQ4A 4LEXH 2VL5B 3CH8A 2DWEB 4XP6L 1T0NB 2Z31A 3HG1A 3QDJD 5DK2B 2A6KA 5JDSA 4QRRD 2X40A 3TYGL 4BH7B 4PJCB 3UTPD 2FYYB 1I1AB 3U7YL 2MHAB 5MI0C 4HIHB 1VKXB 4OV5A 3RPIB 4HDIA 5DEFB 5FO7A 4HEME 5ADPL 1RPQA 2DYPA 2V7HA 4GS7C 3DXAA 1NMCB 4QT5B 1F13A 5TF1H 3MRMA 1DFBL 5JHLH 2GUOB 2QKIA 5DEGA 4UV7H 5F7EL 4FG6C 3PHOA 3NAAL 5HDOA 3OKMA 3KYOB 2A9MH 2CK0L 3BZEA 4E9LA 2H32A 3VXQB 3ARUA 1EZVY 5ADOH 4NDMB 4KRPB 3OKNA 2R0WH 3BO8A 1F4YL 3IFPB 3STZA 3HLAB 2EXYC 4NZTH 3C60D 3G6JE 3ISWA 4KC3B 3PQYD 5CJBA 3FL7A 5F7YC 3EDJA 1JGVH 5CAYB 2YRPA 3FCTA 3IDNB 4HS8H 4EUPG 5ID0B 5L2KB 5MEPB 1LE9A 4OIIH 4QXTA 3HI5L 1I3UA 3H9SE 3N85H 1BOGA 1KENH 3MLUH 4JM2C 1XF5B 3WJJC 2FRGP 3UC0L 2J6EL 5HI4D 4LAJH 4Y16B 4HPOL 5I1KH 4DGYL 4WTZA 2Q3AA 1S7TB 1XR9B 4PG2C 1ZHBA 1M6OB 1GHFH 2FEEL 2HH0L 1T04A 5IMOA 3C8DA 3HNVH 2IBBA 3S7GA 1NGYB 4QGTA 5DJXA 4YGAB 2GSIB 3WL9A 3ULUF 1PBYA 2X44D 4LCWD 5ICYA 2YD3A 5GZNC 2VDLH 1AIFB 3PV7A 1PJ9A 1MWAL 3HKFA 1VADA 1G7QB 2ATPB 3LEYL 3V4PL 4F8TA 3QIBB 1JNHB 3MYJB 3TPUA 2ZUVA 3RWHB 3VGGA 1K4CA 1J1XL 3RNQA 2VLMD 3DYPA 2R1XB 3N1GC 2OLDA 5K33A 4G8IB 1IC5L 4MCZA 4UT6L 4R4BA 3WEXB 4HUKB 4FFVD 1YEJL 2X4UA 4OLEA 2ZUQC 4OZIB 5DMGD 1UH2A 1GGUA 4FQ2H 1A22B 4NO5B 3F7VB 4M4PA 5IB1A 5E08H 3X12A 4I3RH 3D2UA 5E7BA 3UP1A 3AMLA 4XPGL 2WMPA 5IESL 1MAJA 1F97A 4U0RC 4Z7QF 4I1NB 3QQ3A 1MVFA 4W4OC 2B5IB 3LHPH 3G9VA 1Y18A 1R3JA 2J8UB 3QDGE 4PRBA 4PYHA 3WFCL 3UPRB 2PETA 3UTSA 3DO3A 5ILTL 2FB4L 2W60B 3TIDB 3MUGA 4UILL 1I8IB 3DVGA 3C60B 3BMVA 4AG4L 4PV9A 2IPTH 1I9JL 4QCIA 1EDQA 4DGVL 2HTLC 2YD2A 2XZQH 2D7MA 4LHUD 4I18C 3KPRD 4LIQE 3S96A 2A6IB 1MJUL 4JFEB 3WDHA 5E4IA 2O5XL 3REVB 4NN5C 3MTRA 1CDJA 3HHRB 2RIKA 4LSPH 5DK0B 5L6YL 4OLXH 3DX8A 1RIHH 5ITFB 4BK5A 2H8PB 1QPPA 1B90A 5LXGH 3VD9A 4W81A 2DICA 4WTWA 1DUYA 4XPBL 3VXNB 3VWJD 4WHDA 4XI5C 3ROOA 5BVPH 5I73C 3NIGF 5T5NG 3VCLB 3P9LA 1NLBL 3BWUC 4HXBH 3LS4L 3RUGE 1NGQL 4M6OL 3BP6A 3V0AC 5B38G 2WIIA 4GQ9H 5ID1B 4WHYG 5I8KL 3HE6D 3ULUE 2J88H 4LCWB 12E8L 4LVNC 4POZC 3V52H 4BH8A 5B8CB 1A3QA 1KB5B 4JLRA 3D25B 1OAQL 1G7LB 1RVFL 4R4NC 1TZGL 1CBVL 3OKOA 1C5CH 1ZWIB 4FFYH 1GZQA 4ZPVB 3SBWA 4DFIA 4RQQA 4LQFH 1OB1A 1G6VK 4P3DB 3EYFB 4ZXBB 4V1DE 2V9TA 4XXDA 1F2XK 1N8ZB 2NY7H 4UU9B 5HJ3A 4LCCB 4XWOD 3WIFA 3O3DA 3LV3B 3FRUA 3ZKMC 2VLJB 3GDBA 3CFKB 5DUPH 5DJCB 4Z7QE 4M7LH 2HWZL 4KMTL 4XAWL 4TVPE 1T0MB 1YEEL 4OTXH 4DUWA 1Q94A 3FTGA 1RZJH 2AK4A 1G7HA 4ZNEA 3MRJA 4ELMF 5F9AC 2ZNWA 1U8QB 2XKNA 3QO1A 2A2QT 1ZEAH 5CEXB 5J9PA 4PB0H 1EHNA 3MSPA 1LWRA 2AJVH 4LKXA 4U3XA 3OXRA 1JWUA 4Y5XB 1QEWB 2PXYC 3JBG7 2I60L 5T1MA 3MRRA 3ARGD 1KN4H 2BHYA 3O4LD 5ESAA 1SHMA 2V5TA 3VXUD 4CW1B 3DGGB 3LS5H 1K3ZA 2MPAH 4XVJH 1P4IH 3GJFK 3M17A 4HCRL 5I9QC 2A6JB 1OP3H 3VWJB 2V5RA 2WK2A 4A6YA 1T03H 1ZHKA 3NIGE 3TV3L 3NFSL 2ARJQ 4LLMA 5I8OH 5LGJA 2H2PC 2AABL 4HH9A 1GAFL 3ARDB 2NNAA 3IJSB 3L3HB 2D31A 5DHYB 4WU5A 4P5TD 2IGFH 1K85A 1RQ5A 1Q0YH 1QKZH 5FYKL 1Z3GL 4GLRH 3CXHJ 4P4KA 4YAQA 4FQCH 3IVKA 3Q1SL 2APTA 3OSKA 4CN1A 1Q72H 1T66C 2EEDA 1X9QA 1Z5LB 3CD4A 3QPXH 3LDBB 3QI9A 2MCPL 3ALWA 4LDLB 3BIKA 4JFHE 3U0PB 3ZKXB 5IR1A 3ILPA 4NOBA 1S9VB 1U2HA 1HE7A 2C3GA 4XPTL 5FYJL 1MI5E 3RFZC 2EE2A 3IB4A 4YHYC 3SDDC 5DT1L 4P46D 1X5LA 3OPZH 5DD5H 4H26B 4ETQA 3ULUC 1FL3B 1E6OH 1NANI 1WBZB 3MLWL 4J12A 1BVLB 4NNPL 1BWWA 4ZYKB 2P8MB 3I2CL 3CAFA 2ZUUA 4M6MH 4P57B 5SWSD 4YXLH 4FQ1H 1S7UB 2PW2A 5C07A 5LGKA 3VXSA 1EV2E 1NBZA 4G9FB 4JDTL 5CSGA 1CFQA 3U79A 2VDMH 3IF1A 2AV1B 3DURB 5C1MB 1YUHB 3QNXA 5JLZB 1Q9OA 4QF1A 1GXEA 3M07A 4ELME 4B0MM 3U46B 3RDTC 3ZDXF 1I7UB 1MREL 2A83A 2CLVA 3KJ6L 4PJGB 4A6YH 3CZFA 3HA0A 4YDVA 1WCBB 5C9JB 1CR9H 3W11D 5MEOA 4HKJA 3C09B 1IAOB 3O11B 1KTDA 2NW3B 1WIPA 3D3VB 5JZ7D 3K2UH 5HGHB 3A6CH 2HVKA 2ORBH 3GK8H 2ITCB 2E9JA 3WBDA 2YPLD 1H0DA 4DN3L 2XTJE 3BQUC 2CDGB 4D0BA 4KJPC 2NX5A 3V6FA 4JO3H 3ZYOA 4KKCC 3MRDB 5KN5B 1UCBH 3RWIA 1MIMH 4P5TB 3B9KA 1NCWL 4HW6A 5E0QA 2D03L 1GYAA 3C6LB 2ADFL 3L3DA 4MCYA 2NXYD 3BYYA 3RZWA 1J9CT 1JFQH 1KT2A 1NDMB 4WI8A 3ZKND 5D9SB 5K9QG 4ZSOE 3DSNA 3WN5A 2CIIB 4N8VG 2NTSP 5C0BD 2Z4QA 3U0TB 5C7XL 4HS6A 4UI2A 1GL4B 4PRPD 1MRCL 2YD5A 4UUJB 3U36A 1U6AH 5FGSA 1YECH 5D72L 2IC2A 3IKKA 4ODVH 4OGXL 1H5BB 3RPKA 3NA9L 3I02A 5FIEA 3VFRB 4Z7WA 4ZQKA 3DARA 5J1AB 2X4OB 4P46B 3P73B 3B6SB 2CK2A 2WUCL 2Q8BL 3OG4B 4G7VL 1SEQH 3ZYZA 4QHUB 4XB8A 2EDEA 2P4AB 1HK6A 3WD5L 2AKRA 5J12C 4EI5D 1AFVL 1CXLA 1XCTA 1IEAB 1IBGH 2MOVA 4IS6A 2ESVE 2VQ1A 3T65A 1QD0A 5TPWL 2X41A 4DTGH 5FUZH 1NUFA 1E4XL 5KVDL 1ND0B 1QSFE 5T3ZL 4G6KH 2XZAH 4XCNB 3SDCA 3UYOD 4MJIA 2IQAB 2BNRD 3L1OL 3ARED 2DMBA 5J6HA 1DDHA 4U49A 2CDFB 5I1DB 5L8JB 2DL2A 5FO8B 3CFBA 2GCYB 3ZDXE 3IAPA 4J2XA 2KH2B 5FB8A 4HLJA 5JHDB 4H0GA 3DROA 4LKCA 3G5XB 4JY6B 4PJHA 3ZE2E 5A1AA 2DWDB 3MA9H 4JQIL 5IK3B 3N1QC 5TFSL 1A7PH 1VPOL 5CEZE 4U1SB 1N0LA 4M8QB 5CBAB 3S4SB 4J1UA 1CU4L 4JFFD 3B2VH 4EIZC 3WFEL 4LNRA 4XBPB 3NTCL 5FOBA 5F89B 4LEXL 4XVUD 4DQOH 3QDMB 4UQ2A 3DMMA 5BW7C 1M71A 2Z0BA 3EFDL 5I74C 2NXYB 5I1CL 3BKMH 3LIZL 3PIQB 3WHE0 4KZEL 1A4KA 5FDWA 3G5YB 2QHRH 2HA1A 3QEGL 5E9DE 1JGEA 2HG5B 3WFBL 4JG0H 3TT3H 2AGJL 1F4XL 1J8HA 3HE6C 3LEVH 4HT1L 4OZFA 4ZG1A 3BPLC 1OCWH 5CZKA 5F70A 2VXVH 3SO5A 1BOYA 3GGWB 3LSOA 4Y5VA 3H2WA 5EZLB 4XNQA 3GSXB 4C56D 4PJDA 3O8XA 4R7NA 1BM3L 2APFA 3QUXD 4WUUE 3VG0L 4E41A 4L3EA 3O2DL 4KXZI 3C2AL 4JQVC 2BVEA 3NACH 4MX7A 1ZGLB 4O2EB 2CJUH 4PJIB 1J05B 4FS0A 5C3TA 1SJXA 2E6PA 5DYOB 1R0AL 3IJYA 1OAZL 3MRQB 4E0RA 1QA9B 2I9LA 4XWOC 3TN0D 3IDYC 1FFPA 3C5JB 1CL7I 4LGPB 5JIPA 3WNNA 3N85L 1RJYA 4PGCA 4L9DA 3MLUL 3P11L 1QBLH 2ADJA 5AWNL 4OLZL 3AC0A 4PP1C 4UNUA 1B6DA 4PTUA 1OTTD 3BD3A 4PRHB 3E8UH 4GAYA 4JFYA 3C2SA 5FYLD 5DVOA 1IAIM 2NXZB 2X6MA 3QXTA 1IAKB 3TO4D 4FQHA 3UTTE 1IMHC 4NNYB 5LKNA 4XMLH 2Q76B 3QFJA 5C0AD 1ZT4B 3SE8L 1I8LC 3K7UA 2R9HC 3KS0J 4NZUH 4JFFB 3ARGC 2XWJA 4L8DB 1MJJA 2H26A 3VD3A 3GI9L 3WIHA 3CUPA 4Z0BH 1Z0NA 5MENE 4HUVA 3SJVA 3OR6A 2BDNL 4OZFH 4M7JH 1FDLL 1UZ6E 1WF5A 4R26H 3C5SB 3KPLB 2HLFD 3IDUA 5BZWB 4PBVC 1FP5A 2P7TB 3PP4L 4L1DA 5CEZH 1LK2A 1T80A 1ZMYA 3FOLB 4GRLD 4Y2OA 1NUGA 5F3HB 1D5ZB 3LB6D 1QSEE 2EDXA 3Q5OA 4RFNC 4X6DF 5DHVA 2G2RA 3U4EB 4O51B 3NMEA 1KIQA 3ARQA 5F72S 3GHEH 3QXDB 4JZJC 2V2TB 3GMRA 2J1KA 2P44B 3VGAC 4GAFB 4NQEE 3V5KB 1OF2B 5EIIB 3FB6B 4OD2B 4PGJA 2VERN 4ZTOL 3VXRE 1OAUL 1VB9A 4Y1AE 1RHHA 4EQ3A 1TCRA 35C8L 3OAYK 5DMKA 3C6SB 3LKPA 1UWGL 3EGSB 3FJTA 3T0EE 4MJ5A 2WQ8A 5IF0B 3B8SA 4I2XB 4JFDB 3X17A 5J0BA 3KLHD 3FB8A 3ZZ1A 1T3FA 3C08H 4HKZA 3O41A 2OXHA 1KJMB 2C3VB 3LN9A 2VISB 1UXWA 3A67H 1MCIA 1YEHH 5HYJB 2FO4B 3T08A 3SY0B 3B5HA 4G80B 4RGND 3MLSH 4HUUA 2E8YA 1LD9B 4LMQE 4X99B 5ANMB 2FH8A 3VXME 1LMKA 2AJZA 3RI5K 2PCPB 3BPOB 4EKXA 1NFDA 4YHPA 5GIRA 4FXKB 1CFTA 4EVNB 5F6HJ 1INEH 1WFTA 3WIHH 4Y2DD 3X11A 4I4WB 3DX7A 4M48L 3G6AB 5DD3H 1WZKA 1H15A 4WFFD 4O2CB 4ZPTB 4KTDL 1E4KA 3H0TB 5C0AB 2AI0H 5IUSA 2YEZA 1IT9L 1NCBH 3ARFD 2EE6A 4NGHL 3W11C 3AU1B 4KK8D 3U4AA 2ZKHL 3BAEL 4KY1H 1CFNA 3MX0A 3RU8L 2XWBB 3T4YA 4EEEA 1KPRB 3QR2A 1KLUB 4IHOA 1JV5A 3GIVB 4N68A 1XGPB 1MOEA 1EX0A 2NY6D 5BQ7A 4FQIH 4Z5RA 4TSAL 4GRLB 2VZSA 3ET9F 3LKSB 1NUNB 1MCBA 4YQXL 1DEEA 4L9LB 4WW2F 1GOFA 3ZKNC 2VXUH 5MHSD 4X8JA 4J8RB 1I85C 1HILA 3DO7A 5DUPL 2D0FA 3FFCE 4QRPA 4ALAL 1U8LA 2Z8VC 1JZ2A 1AD9A 4P2OB 4L8BA 4Y5YA 4NKIH 5L8KB 1MFCL 1RULH 4DKFH 5JQ6H 4G42B 4Y4HD 3E0GA 5D7LE 2E3VA 2OJEA 4NBZB 3B2UC 1NC4D 4WVRA 5H2BB 5LCVH 2W07A 5A3ID 2GITA 5IHZB 2DTML 3WLBA 4Y4FB 4LSTH 4GRWF 1ZEAL 1A1NA 4LF3B 5KS9F 2AJVL 1BZ7B 2I5YH 2JK5B 4EI5C 4P9HH 3RZCC 4CGTA 1CGUA 1T2QH 2AK1H 1JHTB 3KGRA 1DZBA 4GBXA 1HHKA 2MQCA 2RGSA 1U2CA 4XAKD 5L0QB 4PY8J 4X6CA 2Q3ZA 1X6NA 4ZUUA 3GSWA 4N5UA 5D7IA 1G9NH 5AD0A 2MPAL 5CWSB 4XVJL 1MHHA 1YEGH 5IFAL 4YHOH 3AREC 3RVUD 3RBGA 5C8JA 2VH5L 5JUEL 4G7YH 2EDTA 2V9RA 1C7SA 4LIQL 4PLOB 4K3JH 1MJ8H 4X6EA 3T0BA 4KJWD 5D8JH 5CFHA 3LQAH 4IMKC 3JTTA 4FQCL 4UIKL 4QTHA 5BRZA 2O5ZH 1C08A 3EZ8A 5I0DA 3ARFB 3L9RA 2JJWA 1NGXA 3QIWA 5FOJA 3LKQA 3PGCA 3BN9D 2DQJH 1KYOK 4BSWA 1RURL 4RNRB 2X89A 3HN3A 4XCCH 4PRNB 2APXA 1D6VH 1FV1A 4IOFD 1H3VA 4JDVB 1MNUH 2OI9C 4NO0D 4MNQD 4JPVH 1FYTA 3GBNH 4EXPX 3THML 5IJVA 2NY6B 3ULUL 1I3RA 1FAIH 3QIUC 5DD5L 4JGJA 3BWAA 3HE7B 3GNMH 5E24E 3AAZB 1ADQA 4OI8A 4MAYA 2DDQH 1NBQA 2BSRB 3BKYL 4WI5A 4XCYA 4N5EC 5IROC 2N4IA 4Q74A 5JR1H 5J6GA 1B9ZA 5BS0A 4HSQA 4D8PB 1UJ3C 3MRCA 3SDXF 4J6RL 1X3DA 4JHBA 5FECA 5JOEA 4AENA 2VDML 4LGRB 4GUPA 1OVZA 4HHAA 5DD1L 1K8DA 1MH5A 3N0PB 4Y4HB 3V7AE 3AS2A 4BZ1H 3NFPB 2D7PA 2IANE 2N56A 2OQJA 3BKCH 3IYLW 3P4NA 4GRWE 1SBSL 5K93A 1NCNA 2FGWL 3W39B 5JXED 1AHWA 1OWWA 3UJIH 4HJJH 4LSSH 5IQ9A 3TF7C 4OLYH 4P3CL 4LEOB 2ORBL 4XBEL 3EOBB 5TGBA 2OL3L 4L3CB 1TMCB 3TN0C 5K9OA 4D9RD 4NHUB 1QR1A 3BW9B 4Z0XB 5J4MA 2VLRD 1IEBA 4J4PC 1CT8B 1QLEL 2F8XC 3DIFB 5DZLA 2QSQA 2R2HA 1YN6A 1QRNA 1QFWM 1VGEL 2W9EL 1OTTC 1PQZA 4NP4L 4JE4B 3NOIA 5JOPD 3QEQE 2I24N 5JW5A 4GLRI 3NCJH 1I1RA 3TO4C 4UDTB 1D5IH 1DBBL 2VDOH 1R5VA 2H1PL 1ADQH 1NAML 3VFSB 4EN3D 2B1AL 3JWDC 2BX5A 3IFOB 4UB0H 5FA3A 4KK6C 5DURD 5HDBE 5D2LA 4K8RL 4XPFH 3GI8L 1BVZA 4OAWB 1NFIB 5DD6B 2CLZB 1A6UH 1BEYH 1XH3B 3EYOB 4OKDA 1XEDA 2WINB 1UM6L 3MBEA 1A0QH 2APBA 1SYVA 1CQYA 3TZVB 4RGMB 5KTEL 4EDWL 4YFLI 2BY3A 4U3HA 1BQHA 2UVFA 2C7UA 1L6ZA 5BMFH 2HLFC 4XNXL 2B4CC 2AEQL 5HVGB 4YNYB 1F2QA 2J3SA 5F9WC 3W9EB 3O81A 4HGWB 5E95B 4QEGA 1PW3A 5C08E 3CVIH 3L3IB 3LRSB 1CE6B 3RHWF 2H6PA 1JTPA 3QAZB 3SDXE 4IMLA 1S8DB 4HQQL 1HHHA 1T5WB 2VABA 4MDJA 4JO2L 4QOKA 3FT2B 1IC1A 2Q1EA 1IL1B 4HH8A 1UB6A 2HFEB 3PWVA 4AEEA 3W0WD 4WW2C 4RX4D 2Q86A 3KLHC 3KPSE 4PD4K 1VFAB 2VJXA 2VDPH 3PGDB 5CGMA 3CU1A 3DX9B 3IDMA 3KHOA 1IKFL 1MY7A 4LLAA 5C71A 5DK3A 1D9KC 2A73B 4RGNC 4N8CH 4MMXC 1FLTX 4MD5B 4ZAKC 1DCLA 2LAGB 3VFTA 1CGSL 2VLRB 4UIMA 5DDHA 5EPMA 1FG2A 5SWQA 5EU3A 1F42A 3G04A 4Q9QH 3MFFB 3AY4C 3KG5A 4QXGH 2CKBB 4NQDE 4YBLB 5DVKA 1I3VA 43CAB 3UBXG 4Z7VA 2IBGA 4MB5A 4ZMAT 3PWJB 3P2TA 4Y2DC 1MLBA 1JI2A 3VMPA 3GB7B 3I3BA 4EI6B 1MCOH 1EHLL 2IALA 1LO4L 5E6ID 4UOJA 1N3NA 1X7QA 2PYFA 3P4OB 1J5OH 4PP2B 2QSCH 5GSVB 4QYOB 1GIGL 1NQBA 4NQXA 5I75C 5ESQB 3QRGL 5I18L 3K1DA 4PJ7B 1MY5A 4JM2A 1KIPA 1XF3A 1P7QD 3J7HA 1YEKH 3EKCA 1HXMA 5GRUH 3JXAA 1LE5B 3MCKA 1CFVL 1BP3B 1A9EA 3VI3F 3OAYH 2HT3C 2GY5A 1TZIA 4PG2A 2Q6WA 3ZE1F 5IW1B 4OIBA 2AJXH 2OZ4H 5D7SL 2R2EA 4RMRA 1U8MA 3ROLB 5ACZA 1XZ0B 5L7XH 1IZJA 1EMTH 1AH1A 4ZFOB 3VFMB 3CX5K 4Y19D 1TCMA 4I3SL 4OV6F 5EN2B 3RTQB 2R4SL 5EBMA 1QZ1A 4HAGA 4QHNA 1T1XA 1XCQB 3E2HB 1SM3L 4PLKD 1ZV5A 5IW3A 3RWCA 4HUMB 3U2SB 5IOPB 5FGBC 5T1KD 2QTEA 4GQPH 4OLUL 5LAXB 3ES6B 2A1WH 1QYGL 4NQSA 1KOAA 3D39E 2VUYA 3HNSH 2P47B 4N90D 3K4AA 4FFZL 2XNAB 4GKNB 4OZFG 2PYEA 5D7KE 3V0WH 2O5YH 1Z9SA 1CE1L 1P4BH 1WWBX 5ABDE 3BP5B 2Y1VA 2E7BA 1CN4A 1S7RA 2OTUB 5DXWA 3VFGL 5DFTA 3PJSB 4JKPH 4W4OA 5GS1B 4I9WE 5CSZA 3HB3C 3L3KB 1RUKL 1RZ7L 1E4WH 3PNWA 4M7JL 1MAMH 5HHMD 5J11B 4ISVB 4U6HA 1C12A 1MUJB 2J2ZA 4X4ME 4XH2A 3OXSA 4PG9A 4R2GD 3LPWA 5CEZL 5HHOB 3ARSA 1AE6H 3QUKA 3MJ7B 5C9KA 2FNBA 2W0FA 3FT4A 3BUYA 1RV6X 4YXKH 4KJWC 4OCWH 5E6IB 3PHSA 2HJLB 4I18A 4WWKD 5LGHH 3MV9E 3P9WB 4M7LT 1DANT 1IGJA 1OP5K 1TXKA 1U8PB 4M1CD 4JREB 4I77L 1VDGA 4TUKH 5ETUB 5F88B 4PR5A 2FR4B 4F58L 2B8OT 4X4YB 4PJCE 3PL6D 2FEDD 1FFNA 4NUGH 3VI3E 1FGNL 1Y6KR 3C08L 3ZE1E 3QCTL 4KK9D 3SPVB 3WV0A 4K55A 1MAKA 2NY2D 2UWEB 4S11A 1DBJH 2D4FA 4NQVB 4LLYA 5FM4A 2F15A 3NN8A 4NQCB 4N9GA 1BZQK 3B3IA 4NN7C 3H7BA 1FNFA 4G8GA 2F53D 1QVOA 5D7JA 5D71L 2J8UF 1A6ZA 3C87A 3FAXA 4KQ3H 4ONHB 1UCTA 3V7MA 2AJ3A 2GAZA 3L7FA 1INEL 1FZJB 1UYWL 2F5BH 1MJ7L 4X7TB 5E8EB 2IPUG 4NO2B 4QWWD 2GW5A 2CUIA 2CMRH 4HWNA 2DWEA 1JTOA 4ZS6D 5GGRB 3AS0A 5DK2A 1FCCA 4NM8H 3HAEB 5DD3L 3LD8C 1JI1A 4KKBC 4PJAB 4UT9H 4LLWB 4FQXD 3L3OB 5GGRY 2AI0L 4XVTH 1ETZB 1GGBH 5L2KE 4KROD 5JXEC 4W70A 3ZE0F 1UVQB 5ENWA 1MEXH 1JUFA 2YD6A 4MJ6A 3HC4H 1P1ZB 3K46A 5EUOF 1I9RH 1VA9A 2OSLB 3O6LH 32C2B 1FSKB 5FO9A 3SCMD 4QT5A 5IMLB 2Z9TA 4PJ9B 2M1KA 5T5FH 2WIMA 1IGYA 5AAWA 2XPGB 1CDIA 4YR6A 4R2GB 3TT1L 4W6YB 2ATKB 2KZWA 3KYOA 1H3TA 3QHFL 4HUNB 1NAKL 3FN0L 4P99A 4PJ5D 4OCYL 3CVHB 3BI9X 4WWKB 3IFPA 2VXUL 1TFHA 5HHXH 1X44A 4WV1C 2FX8H 4NHCL 3QZWA 4O5LL 5DSCA 1LILA 4NCDA 3O45A 1GVIA 5DQDH 4EN3C 1EBPA 1X5HA 4MDIB 1HHGB 2V5SA 5ID0A 1RULL 4DKFL 3WMSA 4KRNA 1N64H 1U95A 2UYLB 5C0EA 1TJGL 2D7QA 2X4PA 3OJMB 1DBAH 4HXAL 4K71C 1S7WA 3VRIA 4LSTL 1PY9A 2KBGA 1OARL 1ACYH 2NY2B 4PGBA 4HFUH 2ZUYA 3DYOA 4RMWA 1CLZH 2QQNL 5IVZB 2VB5A 3C5ZD 1GJIA 2DQEL 3HPLB 3CFEB 4JFXB 1QBMH 4XMPL 2AEPH 1W72B 5CGYC 1G9NL 1VESA 1NGWA 4ZUWA 2J8UE 1I1AC 5ITBH 4R0LB 3R8BB 4OJFH 4PB9H 1W8NA 4P4RA 2ATPA 3IETB 3RX7A 2E7HA 3MYJA 1KJ2A 1YEDB 3SKMB 2VN4A 2BC4A 1AR2A 1OQOA 3QDJA 3QUYD 4IM8A 1S3KL 4G6MH 4QRRA 1XGTB 3EDDA 1FH5H 5CUSH 1IQDB 1T21B 4NO3B 4KDTC 4FQXB 3HMXA 4P5MB 1AGDB 4OZIA 1BIHA 4JFEE 1ZGLM 4RFOL 1KJ3L 3FO9A 2EDNA 3PABB 5HY9B 1WWCA 2VLKD 1B4JL 2PO6D 2ERJB 4H5SB 3GJEB 2CRIA 2ZCHH 4DOHE 5HDLA 3IFLL 3P0VL 3SCMB 1RMFL 5HYSB 1OGAA 4YUEH 4MNGB 2E9BA 2Z92A 3CXDL 4G5ZH 3MXWL 4BK4A 1EO7A 2YWZA 4L4VD 2VZ3A 4O9HL 3UPRA 1HH6B 1CTNA 1LHZA 4PJ5B 1IM9D 5IVXF 3UYRL 1I8IA 1EFXB 1NMBH 3C60A 5INCB 3V95A 1VENA 3PQYA 4AT6B 1B0RB 1TZHB 5CMAB 4U4BA 5D2NB 3A0OA 4F33B 5B39A 4PJEA 2IPUK 1O7SA 5JNYB 3MREA 3RVVD 1U3HB 2DQTH 2XY1A 2BSSA 3PP3H 2X4RA 4GKSA 4R90H 2ARJA 1ZLVK 3EUUA 4NUJB 3CMGA 3FQXB 1BFOB 5DC4B 1KJ2H 4NQUA 5J3HC 5IW6B 2VLJE 1M7DB 3C5ZB 4EBQL 5GS0D 2H9GA 4ODTL 3GM0A 2YPKA 3GSQB 4KJYA 5E8NA 5HHQA 5D4QA 1ZS8A 3HMXH 5D70L 3VU2A 5JO5B 3IDIB 4M5ZL 4NPYB 1GGCH 1DL7H 1BJ1J 3HUJF 4I48B 1KCRL 2F54D 2NY5C 1JJUA 1U93A 3KDMA 4XP1H 3QUYB 1XGUB 1TQCC 4PLKC 4RRPA 5JPMB 1ZT7A 1Q9KA 1FPTH 4XNMB 4F7CA 3I3DA 3MR9B 1NGZB 1TJHH 4P3DA 1BZ9B 3RX5A 1A7OL 1JHKH 2I07B 2VLKB 1D5IL 3S35H 4JJ5B 2PO6B 5IEHA 4LCCA 4S1RL 1CI5A 1UACL 2DQUL 3KPPA 5GZOC 2XZZA 4U1IB 1BREA 2MTPA 4XPFL 3NPZB 4HUWB 5KJRL 4ODHH 1X4YA 4PUBH 4FABL 1C5BH 5F93C 5TE6H 4E5XB 5B3JF 4L4VB 3JVGA 4P23C 1KNOB 5DMYA 3QG6B 3F7YA 3S5LB 3T0VA 3TH2T 4XBGB 5IVXE 1U8QA 5E1AA 1AO7D 1MVUB 2DIAA 5EC2A 2LU4A 5CEXA 1KTLB 1T22A 1AGFB 1FJ1B 3GRWA 1XGRB 4LHUA 3KPRA 5JTWA 3TC9A 1AXIB 3HS0B 4JKKA 1HSAB 1WEJL 4M1CC 3WNLA 1DUZA 2Q87A 5BW7A 3DECA 1KB5H 3OKDA 2FEDC 5C0IB 4HBCH 3ULVF 4QXUH 5B8CC 1YEIH 2BOCB 4PY7A 4ODSL 3H7LA 4ZUSB 3BT2L 5DJ6A 1IC4H 3HE6A 1IEHA 2Z31B 3HG1B 4G9FE 5EORL 4EQ2A 2A6KB 5JDSB 4S1SL 2GK0B 5MP6H 1UM4H 3JV6A 4AMKH 4G3YH 3ARBD 1JWSA 3HCVA 1HI6A 5EWIH 1IGFL 3NFNA 4OV5B 3HUJE 1JPSH 1BQHG 3FHAA 4XC1H 3I84A 3FO0H 1NCTA 1S9VA 3VJ6A 2YMXH 5FF6A 4JQVA 3MXVH 5FO7B 5I6XB 2C3XA 1CG9A 2DYPB 2V7HB 3TM6A 4G43A 1RK0B 1IM3A 4ZS6C 3TVMC 3MRMB 3DTXA 3TBSA 2QKIB 3D3VE 3PHOB 1BVLA 3OKMB 1J0IA 4POUB 2CKNA 5EB9A 5C0RL 3BZEB 3RY5A 2H32B 4KROC 4P57A 1BD2D 4LRIC 5T33H 2VITA 3OKNB 3BO8B 1Z9OA 3MJ9L 3P0YH 4KMLB 3STZB 5DJ0A 4OFPA 1DBKL 4OGYH 4LVHB 1JZ3A 3DURA 2AEWA 3ECBB 1R3KA 3LQZA 3FCTB 3OZ9H 1IGML 4IRZH 4I0PC 3U46A 1LE9B 1JRHL 4QXTB 5GRVL 2OZ4L 2Y6SD 1A14L 4PJGA 1BOGB 1TETH 2XQYG 4NIKB 3KR3H 5I8CB 2LVEA 1A5FL 5D5MF 4OD3H 2Y4SA 4MB3A 4YH6A 1NCDL 4IIQC 3ARGA 3O11A 3O4LA 3SE3C 3OMZA 3VXUA 1MIEH 1ZHBB 4P2CG 1T04B 5IMOB 4NZJA 4HC1L 4Z7UF 3VFWA 1RK1A 4DCQA 5DJXB 3HR5A 4GKZA 4WUKH 5DJZA 4K7FA 3WL9B 4P2YA 2CDGA 3VRLE 3BXNA 1EVUA 1L4IA 3ULVE 5GJTL 1AP2B 5GXBB 1RU9L 3QDHA 2C1PA 1RUAL 1J0ZA 1K4CB 4I0CC 2MWCA 1IAIL 3DNKA 4JZJA 3PG2A 4R4BB 2MKLC 3LMJL 3B5TA 2O93L 1P6FA 5EZIL 2X4UB 4U31A 3U0TA 1MCPL 2YUXA 3KPOA 5FUOH 2J8OA 5IB1B 4D9LL 1E4XI 3ARZA 3SE9H 3KLDA 3X12B 3D2UB 5F9JB 5JHDE 3UROR 1RIUH 1FZMA 1KCSL 2DQGH 5T3XD 5J1AA 4Y4KD 4LLUB 2YUWA 1BLNA 3GSRA 4OQTA 3B6SA 2BJMH 2QR0A 3QQ3B 5GGTA 4OFIA 2NY3D 3O4OB 3CMOL 4HF5H 4UAOC 3RQ3A 1U3JA 5I1GH 2ZG3A 4Z18A 5J57B 1R3JB 4PRBB 4PD4J 4APQC 5EO9A 2QQLL 1BD2B 5SWSA 4AEIH 1YNLH 2A77H 4MQXD 1LO2L 2WV3A 3FQRB 2R29H 3DVGB 3KYAA 3QDME 4WTXA 4XMKL 1J0YA 1CGYA 4PV9B 5IFJB 5MERB 2EEAA 1NH6A 4QCIB 4JHWH 1XGYH 1KEGH 1RJZA 3V8OA 3S96B 3AMKA 1JN6B 1ZLUK 3SGKC 4CBPA 4NFDA 1TITA 1WWAX 2YC1A 3F8UB 1F45A 3DX8B 1QFOA 5B4MC 3N1MC 1J86A 1S5IH 1Y6NR 2RB8A 1DUYB 3IDXH 4B53A 2W59A 1F90L 3QT2A 3ROOB 3G5XA 4JY6A 5JA9A 3P9LB 5KVFH 1QSZA 4MAUH 4PJXF 3QG7H 5E1HB 4Q9RH 3BP6B 2EC9T 2WIIB 3S36H 4HIJB 2YPLA 3S4SA 1PKQE 4Z7UE 4LSQH 3SOBL 4KQ3L 4V2CB 3RVVC 1QSVA 3D87B 4BH8B 4PJIE 1TQBC 4JLRB 1IAMA 3VA6A 3QHZL 3BJ91 4YE4H 4ZO7A 4LQ1A 2DIJA 2F8OA 1JVKA 4RAVA 2XFXA 1J7VR 1SYSB 3OKOB 4PIRF 1I85A 5GRVK 1EEUA 5C0BA 5MENA 3HZKA 4FHBD 5GGTH 4RQQB 3HC4L 4PRPA 4ZFZA 3EBAA 4HKXA 3CX5J 1H3PL 4MA8L 4XXDB 4M6NL 4PRHE 1GH7A 5EZLA 5HJ3B 4KH2A 5IBLC 3FONA 3O3DB 3FRUB 4Y4KB 3K80A 4WDIA 2RAMA 1TPXB 4NKMA 2XQYK 4FNLH 4XRCA 3G08A 2X9XA 2NY3B 5C07D 3O6FD 2IEPA 4H1LG 1OLLA 3A6OA 4EI5A 4TULH 3L5XL 1KFAL 2VKXA 5SWZE 1NDGA 1Q94B 3FTGB 5DYOA 2JJSC 3WUZA 2AK4B 1G7HB 4CMHB 3MRQA 3MRJB 2YD8A 4KZDH 2ZG1A 4UTBH 4K9EC 2XKNB 3QO1B 4CJ1A 4X9IA 2ICCA 5C92A 4OD1H 3TH4T 5AYUL 5J9PB 1QTYT 2BNRA 4HK0A 4K7PL 4X9GA 3AREA 4LKXB 4QRUA 2KUTA 3MCG1 3HI1A 3OXRB 4YHZL 1JWUB 5FUCE 2LVCA 4DZ8A 3E6HA 5T1MB 4G8FA 5BZDA 1DBAL 3MRRB 4L5FH 1R6VA 3RL1A 3GHBL 1ZLVH 4IMKA 3M17B 3CFCL 1E27A 1MFAH 1FG9C 3GO1H 3VXMA 2X1XR 1FNGA 1IAKA 4WO4D 1ZHKB 5A2JH 2NX5D 4NNYA 4LLMB 5LGJB 3S34L 1BECA 2NNAB 4O4YL 4WU5B 3F12A 3QQNA 3EOTL 4PJXE 4RMSA 2HLAB 4JFFA 5ITBL 1MCFA 4OJFL 4KGLA 4P4KB 5E00A 1MFEH 5DA0B 4I2XE 1S9WA 3CJJA 4JFDE 4LFHG 3IVKB 2VXTH 2AXJA 2NLJA 4TSCL 3MJ8A 3QIUA 4UMGA 2DD8H 1JP5A 3TA3D 5BV7C 1JHLL 4XCFL 5HYJE 5DVNA 2HT4C 5CUSL 3QI9B 4OM1H 3UAJC 3QJHA 4RAHA 3SO3B 3BIKB 5IR1B 3ILPB 5ANME 1NBVH 5DR5H 4YC2B 1K2DB 5IROA 1N26A 5HVFB 4GH7B 4G9DA 3VWKC 5KVEL 8CGTA 4KPHL 3JTSA 2HVJA 5HI5D 2B20A 5AAMA 4ETQB 4MSWA 3MFGB 5DRNA 3ARBC 4TRPH 4C56A 5E2WL 3FB6A 4YHKL 3MGOA 1UZ8A 5DJYA 1QLRB 3QUXA 3H42H 3C6SA 4X6DA 4Z95L 3VGDA 2PW2B 5C07B 3MRIA 3VXSB 3O6FB 1LNUA 1NBZB 1TIUA 3IF1B 3RHWK 3QNXB 1Q9OB 4QF1B 2XG5A 1TDQA 1B0GA 3LZFH 4U1GB 5AUMA 4MLSA 3TN0A 2A83B 1I1YA 2CLVB 3KLSA 1IGIH 2YWYA 4Z7NE 3CZFB 4YDVB 4J4PA 5ALBH 5GGVH 5J7CC 1FBIL 4HS3A 5MEOB 2XXCB 4HKJB 4CRPA 1KTDB 4M93B 4OBRA 4R97B 4YLQT 5I1JH 1WWWX 2YN3A 2Q7YB 5H37H 1MQKL 2ZJSH 1U8NA 5CP7A 2OP4H 4BQBA 1H3WM 1H0DB 3G6AA 3TO4A 1CS6A 1L7TH 4D0BB 2Y6SC 2NX5B 3V6FB 1FRGH 3SKUD 3HRPA 2J7LA 4GXVL 1ZLSL 4GFTB 5C0AA 3ALXA 2VDNH 3B9KB 3M8OL 1WIUA 2PNDA 3L3DB 4MCYB 5F7UA 1DJSA 1KT2B 2FHFA 5MEQA 2NY5L 3MNZA 2DQCL 4X7EC 1N7ML 2PF6A 3WN5B 2F19H 5TDPA 2W91A 5F6IB 2Z4QB 3TA3B 2HRPH 1K9TA 1J8HD 2VXSL 4HS6B 3U36B 1XGPA 1EH9A 2DLIA 1B2WL 1K8IA 3T2NH 1Q9LA 2X1WL 3LKNB 5FKAA 1OOAA 2EE3A 4Q9BA 4X83A 3LKSA 1QFWL 1F4WL 3I02B 4YHML 5HPMA 4Z7WB 4ZQKB 3BP4A 5DRWA 1U3YA 4EOWH 4J8RA 4XPHH 5DO2C 3D9AH 4Z77A 1DQLL 4KQ4H 5CLWA 2AKRB 1CGTA 2QADD 1S7QA 1XCTB 2DLTA 3LPGA 1DANU 2DJSA 4IS6B 2WQRA 4ODHL 1KXVC 2VQ1B 3EO9H 3T65B 1SJHB 1CFSA 5I71C 4YGVB 4XC3L 4WW2A 1CYGA 1MFDH 5LQBH 2X9YA 3SDCB 4N0CD 3HMWL 5J6HB 5ICXA 1DDHB 1LDPL 3KXFD 1A3LL 1PAMA 2FATL 3NIDF 2GY7B 3GBLA 2PUQT 2Z8WC 3CFBB 5FYLH 4CMMA 1UWXK 2HJFB 3BP7A 1OM3H 4ZAKA 5FB8B 4LPYA 3H8NA 5EZOL 1U8IA 1AXTL 1NGPL 4MQXC 4LKCB 2ICWA 3S37L 2F74B 1JMZA 1P84K 4XNUH 3JWDH 5KS9A 3AY4A 2NY0D 3QFJD 1Q9WB 1HEZA 5GRZA 5HI3D 4J1UB 4Y2DA 2DMKA 3V4UL 4Q9CA 1LO0L 4LNRB 4C57C 2E6QA 5FOBB 3HNTL 2B4CH 3DMMB 1M71B 3BSZH 5KW9L 1KULA 3ARFA 3H3KA 1YEFL 4PPTA 3LPFA 1BBDH 3IAQA 3ZHKA 2QQKH 4NJ9L 1A4KB 4GW1A 3B9VA 4NJAL 5FDWB 4QHLA 1JGEB 3P77B 3FO0L 3STBA 1S7VA 2HFGH 3BRFA 1J8HB 1G84A 4OUOA 4ZTPL 4J7RA 5F1OB 5D1ZC 1DQML 5BO1H 2W9DL 5CJQH 5FA4A 4D2NA 4XAKE 3LSOB 3G6DH 4Y5VB 4P2OC 3RGVC 4XNQB 2D7TH 4ZUVA 4KVNL 3AAZA 4PJDB 3O8XB 4CDHA 2EIZA 2DKUA 5C0CE 1OW0C 2XN9E 3PDGA 4FP8H 3FQUA 3LEXA 4E41B 3RJQB 2YA1A 3WSQL 5D93C 5T33L 2P5WD 4MX7B 2XRAL 2XKUA 1OT2A 2V2XA 3G5ZA 3IJYB 3MRLA 4E0RB 1CVSC 5FGBA 4IRJC 4Y4HA 2XA8H 3NZHL 5EFIA 1NC4A 3NFPA 4GAJL 4R8WL 4ZOCA 3VFPA 1FFPB 4YHLH 3ARRA 5C08A 1RJYB 4PGCB 3KXFB 2PW1A 3BUTA 1SY6L 2ADJB 3NIDE 1CXHA 1A2YA 3BISA 4OD3L 1U8OA 4OZHF 4PTUB 2IQ9H 1OY3B 4GAYB 5I1HH 3Q6GL 4JFYB 2WW8A 2OTWB 1L0YA 3DUHA 3EOBA 4JRYE 4FQHB 4FZEH 2YZ1A 3MLVH 3MV7E 5LVEA 2IADA 3MLXH 3ARTA 2NY0B 2ITDA 3QFJB 5E4EC 5TJWK 2GSGA 1WTLA 2XWJB 5CD5D 1MJJB 2H26B 1HQ4B 1C5DA 3CUPB 4O58L 4HUVB 3WO3B 3SJVB 3KPTA 3F5WB 3ZTNL 5SV4A 4KDWA 3LN4A 4WO4C 2MSPA 3CLEL 2OJZL 3ARXA 1V7ML 3UO1L 3HE7C 4P59L 1LK2B 4LSUL 3VFSA 3X3GL 3SE9L 3BPNB 4WHCA 1ZTXH 5DHVB 2G2RB 3QPQD 4JN1H 4NO0A 3VG9B 4MNQA 3QUMA 4UINL 1NFIA 1OAKH 3HPJB 2BNQD 1J0JA 3GMRB 3MCLH 2BJML 4QRPD 1DLFL 4X7SH 5HYFA 1GZPA 5GHWH 4JY4A 5F7MC 1RHHB 5DMKB 3LKPB 3MUY1 2X4SA 4MJ5B 4AQ1B 1BQSA 5T5NF 4BZ2L 4YXHL 3NCMA 1VACA 2P5WB 1HKLL 3FB8B 4L1HA 5I1LA 1T3FB 4HKZB 3S3SA 3O41B 3EAKA 5HI5C 4LSRH 4M62L 1UGNA 1F6LL 1JYNA 4UZGA 1UXWB 4NYLB 2E5EA 1KEGL 3NH7L 3HI6L 2WANA 5FYKD 2H45A 1E6JH 5D96C 1KACB 4HUUB 5J8OA 2YD1A 1BVKA 4JFQA 3TNNA 1PG7H 3C9NA 4PBWD 3IRPX 3MACL 2AJZB 3RIFF 3U30B 2HFEA 1Q8MA 4RFEA 1YMMD 4PGEA 2BVPB 3WKNA 4P2QE 5IT2H 4M8VA 1NFDB 1ZANL 3DHMA 3IU3A 1CFTB 5JXEA 4OZHE 5IQ7L 4PJ7E 5FYJD 4OLWH 1N6QL 4Y88A 3X11B 3MRGA 3DX7B 5GISH 2A73A 1DQJA 1H15B 4X5XA 4LSQL 1JCKA 4NRZA 3DJ9A 4MS8C 3UJTL 3U9PH 5J1TC 2B39A 1I1FB 2YEZB 2CQVA 4P3WA 2UWEF 1H8SA 1JWMA 43CAA 1TLKA 1YPZF 5ISZD 2ZCKL 3SDYL 2ZOLA 3T4YB 1YZZA 3PWJA 1ZHNA 3TPKA 4IHOB 5GRYA 1KN2L 4ZD3L 4XX1E 1JV5B 1BQLL 3BD5A 5I15L 1EUUA 3MLPA 1WAAF 4Q0XL 4EZMA 4NC2B 5BQ7B 4Z5RB 4NWUL 4EN3A 3ULVL 4YJZL 1VFBA 3T0WA 4KUZH 1J11A 5HHPA 2FZ3A 2VWEC 4OFVA 1DEEB 2A38A 4QY8A 4X8JB 4KHXH 5AZ2L 1HILB 4R7DB 2RBLA 3TBVA 4AK1A 4DKAA 1LE5A 1RFDL 1ZHLA 4QRPB 4XNYH 5BS0D 4TSBH 1U8LB 3I6LE 4L8BB 4Y5YB 4OZ4A 3MV9A 3CDGA 2OMNA 1HHIA 1QFHA 3GSOA 4BJLA 1WTGT 2EYTA 2OCFD 4GO6B 2OJEB 1I9IH 4K9EL 1YQVH 3S4SG 3WUWB 1U58B 2GITB 4ZFOA 3WLBB 5F7KC 2XZCH 1QFPA 2DI7A 2KKQA 4Z7OE 1A1NB 1NCAL 1ONQA 1AXSA 5EN2A 3WIIH 2E7CA 2QADC 2ED9A 1G6RA 2EDRA 4KI5D 1A3RH 5HHOE 1HHKB 1NEZA 1J88A 2J5LC 3E1F1 1JNLL 3MGAA 3GSWB 1G9ML 5D7IB 5AD0B 4QHMB 3B83A 3W0WA 3GUTA 4K94C 4RX4A 5LAXA 3VH8A 1MHHB 3EHBD 4KDTA 4ZO6A 3GO1L 4H88H 3RVXC 5E8OA 5HGBA 3OBAA 5E8DL 3LQMA 4M61B 3MLRH 4OCSH 3WXVL 4UTAL 2WLYA 2VDQL 4MYWB 1JGLH 3TFKC 4XHQA 2VKWA 4FTVE 2C4FT 4XWGH 4X6EB 5CJOH 4HIEA 4LDEB 5H8DA 5GGSA 4DW2L 3AM8C 3JTTB 2OBGA 4QTHB 5BRZB 1C08B 4MWFA 5GS1A 3L9RB 3HRZA 1NGXB 4S10A 3LKQB 3PGCB 3IU4H 2UWEE 5TQ0L 1JZ4A 4GSDH 4BSWB 4NQCE 1MUJA 4M7KL 1A64A 3D1MC 5T3ZD 1FV1B 4PJBA 5DR5L 5SX5K 5J1SC 3T2OA 3ZKQD 5E6IA 1CGVA 5IJVB 4LVOC 1CICD 1I3RB 3MBED 3OAUH 3CPLA 3OKEA 4M02A 1LK3L 3BWAB 1WBXA 1T7XA 4U1MA 1ZA3A 1PEZA 3CXHK 2RCSL 4U6VL 5E2VL 2UUDH 1FFQA 4IJ3B 4XCYB 3SHSA 3X3FH 4CADA 1P7QA 3T0AA 5E2TL 5JW4Q 1J1OL 4MZ3A 5J6GB 4PJAE 5BS0B 5DVLA 1ED3A 1JPTH 2VXQH 3MRCB 4W6WB 4WFHD 1G6RH 3CK0H 3L7EA 4AENB 4GUPB 4GG6B 1LEGB 1ZVSA 3QJFA 3T4AB 2R8SH 1K8DB 1MH5B 4NWTL 4CU6A 3O0RL 3QXAA 5LG1A 1EJOH 5H37G 1RUMH 1EEYA 3P4NB 3PWPD 4Y19A 1KEML 3OKYA 1OD7A 4CVWA 1UA6H 3M45A 4ZNCD 3V6OC 5GGVL 1AHWB 3TBYA 2JB5H 1CLOL 5IQ9B 4FN0A 1XIWD 2BVQB 3U7WH 3O6KH 5C0FA 5IMMA 3V6BR 5T1KA 5CILL 4NO2A 5TGBB 3JUYA 1UKQA 4Z8FL 4JPIA 1PSKH 3UDWC 5E94A 4Q7DA 1KC5L 4FG6D 1L7IL 2Z8SA 4CVUA 2B0SH 2R2HB 1A6VH 4NZRL 1MHEA 1YN6B 1QRNB 1R5IA 4RGOH 1GPOH 1UB5A 2AJSH 2EDBA 1AQKH 3DYMA 1PQZB 4PS4H 1UVQA 4OCXH 4OCRL 5JW5B 2X5PA 3MYZA 1YYML 1RZFH 1PFCA 3R06A 5LWYL 4MA7L 1JPST 1P1ZA 5EOCH 5EU5B 2GJJA 2OSLA 3KJ4C 1KPUA 4MLIA 1PEWA 4NBXB 1A6TA 1H3XA 1R5VB 1NSNL 3MLYH 5I16A 1CF8H 5DQJA 2A74A 5FK9A 5FA3B 2XPGA 4JDZA 1AY1L 4IRSC 2KL6A 5D2LB 4MXWL 3P30H 2YD9A 4F9PC 5FHAH 4M3KB 4M9OA 4PRAB 5EUOA 2PR4H 1P2CB 2QEJA 2GJ6D 1CICB 3MBEB 2FX9H 1SYVB 5F9OL 2R39A 5HGAA 3IAGC 2C7UB 4FQLL 3S97C 5E8PA 2LTQB 4HWEH 1OAXL 4QTIL 3ALPA 5EZJA 1CWVA 3JWOC 4DKEH 4D0CA 3PL6A 2WWMC 4RWYH 4FRWA 4RWHA 3QPQC 5EO0A 5F96L 5C2BL 2H6PB 4WFED 1MF2L 2P48B 4NQTA 2MQ3A 4S1QL 1A7QH 3UYPA 5I1AB 1T1WA 4R96A 1CZ8L 1ZVYA 3K81A 1FN4B 2VABB 4MDJB 1PDKA 4ONGH 4QOKB 1XMWA 3O9WD 1YNKL 1UB6B 4AEFA 4FMFA 4NBYB 3PWVB 3DRQB 5K59E 4X7CC 3CFEA 2F53A 4MNGE 2Q86B 3U4BL 4Z76A 3DBXA 5MI0B 4IBLT 4XP4L 4LASH 4ZO8A 4KAQL 5DMJB 1DBMH 2EC9U 4R0LA 5C09E 2PYED 4DGIL 3IDMB 3B9AA 2L7UA 4PJ5E 1FVDA 2MCG1 2Q20A 4GS7B 3WFZA 3TVMA 3VFTB 3WJLC 1WQVT 4UIMB 1V3MA 1XGTA 5EPMB 1HZHH 3U0WH 1IQDA 2DM7A 1FSKC 5EU3B 1DN0A 3E6FA 2QBWA 3U6RB 4FQXA 4P5MA 1WIOA 5D2NE 4DVRH 3G04B 2WAHA 2OX5A 4PJ9C 2DBLH 2BMKA 1JZ8A 4Z7VB 4LRIA 1ZOXA 4P48A 4XHJD 3QRFM 3KWWA 1JE6A 1MLBB 1YDPA 3CSGA 1M05A 3EYSL 5DGQA 3WKML 4ZFGL 2HTLD 1O5DT 2V9QA 1X7QB 2PYFB 3B9EA 1BAFH 1QNZH 5GRJL 1AGBA 5FCUL 3BIAX 4NQXB 4MHHI 2CUMA 2F5AH 3EOAA 1OHQA 2VOTA 2DS4A 4JM2B 1KIPB 2EDQA 1XF3B 3BKJL 1HYSD 1T5XA 5KAQG 4IIQA 3MCKB 1A9EB 1OSPH 2N7AA 1UXSA 3SE3A 3S35X 1AKJD 1TZIB 3FT3A 2V7NA 1HWHB 2Q6WB 4XCEA 4NKOA 1RUPL 4LOUC 2NYYC 4YX2H 2R2EB 2VAJA 1U8MB 2DRUA 4HKBA 4LSVH 5ACZB 3V79C 5JNYA 5IVXA 5KSBF 4HWBA 4U7SA 1KBGL 2A0LC 3H9SD 2R56L 5TE4L 4QLRA 5K9JH 4UOW1 5EBMB 2VLKE 4R4ND 4PJ8D 4NUJA 4QHNB 1T1XB 3FQXA 4M1DL 5IW6A 3WCYA 3RWCB 1M7DA 2P42B 3NABH 5I1HL 3V4VH 4FQJH 3SKJL 2ZUQB 1TTFA 4NQSB 2VIRA 3N9GH 4NC1C 2G60L 3VGFA 2PYEB 1RZ8A 2B2XH 2EIEA 3EZJB 3QCVL 5CJ5A 4YPGA 3IDIA 1F02I 2YPVH 3LH2H 4M4RA 1A7RH 3ZKMD 4I48A 1S7RB 4U0RB 3QUYA 1U3ZA 4HWUA 1UM5L 4BKLA 2GYSA 4XVSH 4F7EA 4D3CH 5CSZB 1HDMA 4XNMA 4F37F 5HBBA 5I1IH 2FX7H 4JO1H 4D94A 5KSUA 2DQDL 4JY5L 4M1GH 3PNWB 2OK0H 3UTQA 2VSDA 1C12B 3F6IA 4U6HB 1YNTA 4U1LB 5IBTH 5L9DH 4JJ5A 4XH2B 4PG9B 4KRLB 3ESVF 4KU1A 2LV4A 1G0YR 3QUKB 4M5YL 4CNIA 1Q0XL 2W0FB 4C4KO 3FT4B 3BUYB 1WZ1H 4TYUA 4PYGA 4P2RE 1C1EH 4KVCH 2PXYD 4I18B 5KSAC 4WU7B 4XP5L 3SE4C 3SGKA 4HMCA 4AIOA 4NN5B 1P84J 2CRZA 3LKOA 1I8MA 2AJYL 3QDGD 5GHWL 3S5LA 1J1PL 3QUZC 3HG1E 4HWBH 5EULV 3I50H 1IM9A 3H6JA 2AJUH 4PR5B 4YZFF 5I1EL 5I73B 1U3HC 1MVUA 1YA5A 2WM0A 3GSNA 5HYIA 2X1PA 2YS4A 1FFNB 4YDIL 2CPCA 1KTLA 1AKJB 1FJ1A 2P46B 1SBBA 2G5BA 2L4OA 3PGFH 3SQOH 3ULSB 3NVQA 4LLYB 1D5XA 3AGVA 3NN8B 4N9GB 2F58H 3B3IB 4H20L 3H7BB 3DXAE 2P24A 4LVNB 4G8GB 1N4XH 1T66D 4JKMA 4LRNH 1OP9A 2ICWI 1QVOB 3VMNA 4WY7L 5D1XC 1A6ZB 3TJEL 2YKLL 3OF6A 3B4NA 3L7FB 2GAZB 5EG6C 1A9BA 5IMKA 4JFOA 2XTLA 2WUBL 3SDDD 1KGCE 3QXWA 1DLHA 4JM4L 3L3GB 3MNWB 3ULUD 2GK0A 1HQRA 4ONFH 1FIGH 5KVGH 1IFHH 3UZQA 4NT6A 5CCKL 2F54A 1RIVH 5ENWB 1JUFB 1LO3H 1XIWC 4D0DA 4MJ6B 3L6FA 4UV4H 1EHXA 2R0ZL 3K4DA 5FO9B 1RK0A 5ECJE 3I6GA 4WEBL 3U1SL 1OGAD 2JJSA 4DZBA 3ZL4H 2HMID 2BXZA 2XOTA 2XT1B 1IGYB 4TPRH 2E27L 4V1DD 1HIML 1IE5A 3HZVA 4YR6B 4JFZL 3RDTD 4M43H 2QSTA 5AZEL 4OB5H 4F57H 2Q8AH 4OF3A 3GSNH 1XFPA 1PZUB 5IKCA 2PXYB 5A16A 3O2VH 1HOCA 2Y07H 3VW3H 5ALCL 4YWGL 2HKHL 3QZWB 4OI9A 5DSCB 1RUQL 3O45B 4KHTL 3ECBA 4MB4A 4TVPD 1MPAH 3GKWH 2CO6B 3DSFH 5A2LH 4AL8H 5I9QB 3MOBH 2E7LC 2YK1L 3BQUD 4HK3N 1AO7A 2EECA 3FRPA 4P0DA 4YZFE 4KJPD 4LNVA 1U95B 5C0EB 4KKCD 2X4PB 2AV7A 4XT1C 5I8CA 1S7WB 3VRIB 4F9LC 1SMOA 3R1GH 5JIHA 4PGBB 1EUTA 5JDJA 5GS0H 1WUNT 4Y8AA 5JIKA 3RUGF 3CFJA 3RKPA 4L4JA 4PJFF 1F6AA 1P7HL 4K94L 2VN7A 1U91B 1OPGL 4YFLF 1I7ZA 1QFUL 1NGWB 1JPGA 5D5MA 5HGGS 4ZUWB 1AP2A 5FGRA 1OLZA 1U8KB 3UTSE 4P4RB 4K8RD 4YHYB 1KJ2B 3SDDB 2CKBL 5EA0L 2IWGA 2X7LA 2BC4B 3QDJB 4X4ZA 5JXAL 3O9WC 4R4FH 5I6XC 4QRRB 1INDH 8FABA 3ELAT 3PHQA 1HN1A 3S88L 1PLGH 3ARBA 3MBXL 1MLCB 3SDAD 3V9FA 3FO9B 3S36X 2AQ3A 4HMEA 2OMBA 1LEIB 2H32H 5HDQH 3FQWB 5F9JA 4JFHD 3QCUH 4U2ZA 1MI5D 4LLUA 5DUMH 5JW3L 3MO1A 1WVZA 4HPYH 9CGTA 1BJMA 4JPKL 1IGCH 5D6CA 1OGAB 2DI8A 1NC2D 4LAQL 4LLDB 4JHAH 3O3EA 4KUCF 4HIXL 2Z92B 2YZ8A 1JTTA 4XX1G 3RDTB 1ERNA 1U8JA 5CINH 1KF9B 1OAYL 5H94B 4GAGL 1V7NL 3WYRA 1BD2A 2K1MA 4XHJC 4U1NA 2RR3A 2P49B 3GMLA 4OLVH 4GMSH 3OGOE 3FQRA 1F8TL 5C6TH 1KELL 3PQYB 3SEPA 2XQBL 5IFJA 5I17B 5MERA 5KANI 5IFHH 6FABH 4F2MA 1N0XH 4GG8B 5SWZA 1EGJL 1JN6A 4JG1H 2OL3B 5B39B 1FGVH 3BQUB 4PJEB 2ED7A 3MREB 2EO1A 4DAGL 5BV7H 1S9YA 2BSSB 4NM4L 4U2YA 2LU3A 2X4RB 1C16B 4GKSB 4RMVA 2ARJB 1HYSC 2PN5A 3RVWC 1U36A 4UT7H 3DV6A 2JJVA 1KCVH 3Q48A 3VA2C 3IDJA 4PJFE 2VDKH 4HIJA 2H9GB 3W2DL 2YPKB 4YK4C 4KJYB 5E8NB 3O6KL 5FM5O 4BA8A 5HHQB 2XTJD 4ODXA 1ZS8B 3OKKB 1K6QL 4HUXA 5CZVH 4MQTB 2AK4E 1PSKL 4ZNEE 1NLDH 5DD0L 4QKXB 4TQEH 4F3FA 4PJ8C 2BRRL 4PJXA 1CK0L 1AI1H 3KDMB 1U93B 3GIZH 1SYSA 3ZSTA 4XP9L 2C3WA 5TQ2H 5LBSL 4MGXA 3OGCA 1ZT7B 3T1FA 1AQKL 4GMTL 1Q9KB 5J12B 5FHBL 4F7CB 4G6AD 25C8L 2FECL 1E0OB 4RA0C 4JGUA 3BMWA 5IGXL 5IEHB 3OKLB 4U6XB 1O7VA 4K07A 2XWTB 4ODUA 4Y4KA 3KPPB 3R4DA 2V17L 2DJUA 5T1DL 1NC2B 2BFVL 4HFWA 2IG2L 3DVNA 4WCYL 4PP1D 1NPUA 4TOYH 4JZNA 1T7VA 3F7YB 1OL0A 2ESVD 1SMAA 1FORL 2P5EA 1FO0L 4JR9L 1ROWA 1RZJC 5FGCB 3JWOL 1FE8L 5E1AB 2EDJA 5EC2B 2DIBA 1QSFD 2D7NA 4K3DL 1CLYH 1T22B 1A1OA 4RWYL 4LHUB 2ADGA 3KPRB 3WNKA 2R9HD 3HAEG 3IFNL 5CSBA 1ULVA 5TE7L 1RJLA 3VFVA 4WENB 4Z7WF 1DVFD 1A7QL 4ELMB 5KSVA 3MV8E 1NL0L 4F7PA 2FIKA 2BY2A 5I30H 1DUZB 1MELA 5EUKA 1U92A 1ZLWK 4U05A 1YMHA 3OKDB 5I74B 3V6ZA 3QFDA 2R0KL 5E2UL 3DUSB 4PY7B 2ZPKH 3MLTB 4LASL 3W82A 5IJKC 4TUOB 2R0LH 1JNNL 5DJ6B 3TWCH 2HLAA 5C0JA 3VXSE 4B41A 3HE6B 4GW4B 3FN9A 1KLFA 3SBWC 3UJJL 3BPLB 3PUCA 3JV6B 2FJHA 1JWSB 4MD4A 3RGVA 3HCVB 1YC7A 4ZODA 1HI6B 3H3PH 5E99H 3NFNB 5K9KB 5T3XH 1KCUL 4G8EA 3VJ6B 4RCAA 5FF6B 1F58L 5IV2A 1K2DA 2FHBA 4WI6A 5F7FA 3FOMB 4ZSOB 2B1HL 1CG9B 1HWGB 5EOQL 4G43B 1R3LA 4GXUN 4PJHF 5E9DD 4JB9H 1IM3B 5E6YA 5IM7A 3CVHL 3DTXB 1WFNA 1IZKA 4DEPC 3TBSB 2KDGA 2ZSVA 1FLRL 5DWUL 4OFDA 1PX3A 3RAJH 4LU5H 1G7JA 4OSUH 3IDYB 3KS0H 1QLRA 2DLFL 3GBMH 2VITB 1QLFA 4KMQA 2V6HA 3Q2CA 2G5RA 3O6FA 5DJ0B 4WUUD 2Y06H 3CIQA 1CQKA 2NY4C 1W0YT 5D1QC 4RISL 1R3KB 3LQZB 5L88H 3BE1L 1YYLL 2ESVB 3MODH 3WFDH 2HMIC 3FQNA 1MRFH 1NCUA 4FA8A 4ODBD 1CDCA 4BM7A 5DLML 4C4KT 4U33A 2OR7A 3TCLB 3RIFK 3ZE2F 1W72L 3ARGB 5JPNA 3O4LB 4PJDF 4J3VA 3QP3A 4Z7WE 3VXUB 1UH4A 4K3EH 2Q7YA 3DI3B 3VXPA 5GJSH 3GEWB 1R3IH 3VFWB 1HCVA 1RK1B 4DCQB 4MXVF 3HR5B 1TJIL 3KPMA 3HFML 4GKZB 4UBDC 4K7FB 5DJZB 4WO4A 3BXNB 1N5YH 5DTFA 3UTTD 2D7OA 5HYSG 1G0XA 2JE8A 3TEUA 2C1PB 4ZS7L 2C4FU 4RFNB 1HINH 2VR4A 2WWKO 3O6ML 4YC2C 4MJIE 1F3DJ 4JZJB 5JMOC 4KTEL 5MEND 3TA3A 3VGAB 2Y5TA 1EHAA 3LN5A 4YIQA 5HYEA 1FNSH 1GC1H 3KPOB 4JO1L 3LKNA 1WZLA 2OK0L 4J3WA 5GSRA 4P9MH 1FZMB 3B2UD 3P0GB 1IRAY 4K8RC 3MRKA 3OL2A 1BLNB 1EO8L 5IIEA 2GT9A 3GSRB 4PJHE 1VEMA 1QSED 2QR0B 2VC2H 1D6EB 3A6BH 1CD9B 3WE6A 4JO4H 4C54A 3T8XA 3QYCA 3RZCD 3V8CA 4G6JH 4NQED 3SDAC 5EO9B 1SJHA 5SWSB 3VXRD 4YGVA 1IVLA 4Y1AD 1XF2B 3S9DB 1IJ9A 2IH3A 1MHPH 1AGCA 4OM0H 3T0ED 4K23L 4XPAL 1CL7L 1RJZB 1KLGA 1LGVA 3E3QE 2OTPA 1YY8A 1RZKH 4H8WH 4AH2A 2BNUB 2YC1B 3WXWL 2HJFA 2VDRH 2R69H 1BGXL 3VXMD 3QO0A 5KG9B 1ZK9A 5GGQL 4HWZA 5J56B 2F74A 4MQ7A 4S0TD 4PJDE 3MLZL 1DQDH 1YY9D 3B9KC 4O02H 1Q9WA 2VL4A 4MJ4A 4N0YH 4HD9A 3MOAH 1LDSA 2FD6H 2YPLB 2NTFA 3CZJA 4NN6C 4E41E 4L3EE 4MXVE 1Q38A 4MXQD 3QB7C 2X10A 1X5XA 1REIA 4ERSH 1X4XA 1DP0A 3QIUD 1UZ6F 3CSBA 2Y36H 2H2SC 4YDKH 3V0VA 5EU6E 3S6CA 3BEWB 3WS6A 1FIGL 4RAVB 2XFXB 1MFBH 4TUJA 3K74B 4Z78A 3S5LG 3HC3H 4L3AA 4N5ED 4P49A 3P77A 5C0BB 5MENB 3HZKB 4RIRA 4U0QB 3V5HA 1H3GA 3K8MA 1RZGA 4PRPB 3DV4A 4ZFZB 4HKXB 2XTJC 3FO1A 2NZIA 3UPCA 3ILQC 5TF1L 5JHLL 2E9WA 3FONB 4UV7L 4TPRL 3TBWA 4WDIB 4OFKA 2R1YA 2MQ0A 4NKMB 4YPJA 4MVBC 2A9ML 3CU7A 4XRCB 1BIIA 2H3NA 2J6EA 3G08B 5DFVD 4FQQA 1JIBA 5ADOL 4EI5B 4G6AC 2DJ4A 2R0WL 3GMNA 3I9GH 3VW3L 5IHBA 3CSYA 4EUPA 4NZTL 1NDGB 2C5DC 3FFCD 4NQEB 4OCNC 4XP6H 1S78D 3ZKSD 4TNWF 3BH8A 1JGVL 4RA3A 3NBNA 4Y1AB 3SJVE 3GKWL 3TYGH 2VQUA 4S0SD 4HS8L 2N7BA 1CDGA 4J3OC 2IBZX 4LARH 2VTFA 2BNRB 4HK0B 3U7YH 5DZOA 3AREB 4OIIL 4QRUB 4DJMA 3CH1A 3HI1B 4H25A 2Y25A 4HV8B 1MWAA 4J4PD 4DZ8B 3KXFA 1KENL 3E6HB 4OF5A 4G8FB 5BZDB 4WI3A 2UV3A 2ID5A 1K5NB 3UTOA 5TDNB 4OBSA 5ADPH 2AXFA 4JGMA 4ZDHB 5I1KL 3R1GL 3RL1B 1L6XA 3AM8A 1E27B 1DFBH 2OTWA 3VXMB 1GHFL 1YJDH 3W9DA 1FNGB 1B3JA 3HNVL 5F7EH 3MNVB 2VO5A 4P2QA 5BVJA 5DFWH 2NY1C 2CK0H 4N0RA 4S1DD 1TENA 3F12B 4ESKA 1P5VA 4F7MA 2VDLL 3KYMA 4KK6D 4OZHA 1PG7X 3N1FC 3EO1A 1BMGA 3GJFA 1F4YH 3E3QC 5GGVY 5E00B 2OI9B 1DVFC 1S9WB 1HQ4A 4AZ8A 3C8HA 3JZ7A 3OHXA 2NLJB 3K2MC 4U3CA 3MJ8B 3QIUB 2D0GA 3F5WA 3KPQA 1LP9A 2DLHA 4R4FL 4JHZA 1INDL 1XGQA 3QJHB 3HI5H 2QL1A 1U0QA 4FQ2L 3RWEA 4X6CF 3NGBC 5DI8A 2ZUXA 1P4LA 1G7MA 3UC0H 2J6EH 5E08L 2APWA 4G9DB 4I3RL 3JTSB 2HVJB 2WBJD 3AS1A 1UJ3B 2P8LB 1NFDE 4DGYH 3HPJA 2APVA 4MSWB 1GCFA 4DKDC 2HH0H 1DE4A 4Y89A 1HSBA 5DRNB 3O3BB 3SGJC 1BWMA 2NCMA 4C56B 4JHAL 2DB8A 4L4TE 3EJYC 5BJTA 3LHPL 2I25N 3MGOB 4G6FD 1UZ8B 2GHWB 4WTZG 2HTKD 5DJYB 3QUXB 4I3GA 1CCZA 4X7DC 4X6DB 3MRIB 1LNUB 1MWAH 2P5WA 3V4PH 2D9QB 3V6OA 1BPVA 5T1LA 4AIZA 3X14A 3LKRB 2KPNA 1X5AA 1J1XH 4NYLA 2EDOA 2IPTL 5D6DA 4F8QA 5C0GA 2JTDA 4M6AA 5IFHL 2XZQL 3T0DA 1D9KD 1B0GB 4JVPA 1IC5H 5AUMB 4UT6H 3TN0B 1YEJH 1I1YB 4ZAKD 2IAMD 4I5BA 3UDWA 2CRMA 4LSPL 2IAND 4OLXL 1RIHL 2EE9A 2BVPA 2X05A 4HS3B 5LXGL 2BCKA 5HXMA 3P4MB 2JCCF 1UKSA 4N0UA 5ERWA 4XPGH 3GJFH 5B38A 5BVPL 5IESH 4JQXA 1U8NB 5CP7B 4HXBL 1AQDB 3TO4B 4GQ9L 2EDYA 4QRPE 2VZUA 3CLFH 3QXVA 3N50A 4DFHA 3WFCH 2J88L 4NZDA 1I1FA 3QNYB 5ILTH 3V52L 2FB4H 3ABZA 4UILH 3WO4C 4F9PA 5MEQB 3MNZB 4RBPK 4TQEL 5DHVH 4AG4H 4O2FB 1I9JH 4HJ0C 1CDYA 4DGVH 5CZXD 5TDPB 1C5CL 4F15C 2HJKA 3QEQD 4FFYL 1MJUH 5E2JA 4A2LA 1RZIA 2O5XH 2HT3D 1K8IB 4LQFL 1Q9LB 5L6YH 5FKAB 5F9WB 4YO0A 2X70A 4X6CE 5HPMB 1EERB 3S8WA 1YPZA 1S7SA 3BP4B 4XPBH 5D7IE 5DRWB 1PD6A 2NY7L 1URLA 4YHNA 5GS2D 1PKOA 1NLBH 1K4DA 4Z77B 2BNQA 4R7DA 3LS4H 1NGQH 1V8HA 4M6OH 1S7QB 2R1WA 1WAAA 4M7LL 4OKVA 3JV5A 4XXCA 1ORSA 5I8KH 2ZCLH 5EBGA 1CFSB 4HCRA 4OTXL 3EJZC 12E8H 4WW2B 1RZJL 4BZYA 2IPKA 2R2BA 3WUWA 4CN6A 5BRZE 4BFGA 2P8PA 7CGTA 1U58A 1RVFH 5C08D 5ICXB 1TZGH 1UEMA 1CBVH 5DC0A 4PB0L 4I8DA 2SEBB 1D9KB 5EU4A 4RGNB 1GGIH 5D2LF 4CMMB 3BP7B 3GKZA 4OGAC 4ZAKB 1KN4L 2JJTC 1L0XA 3WJLA 3IS1X 1FYTE 3LS5L 4NKDA 1U8IB 3FB7B 4QHMA 1YMMA 1P4IL 2ICWB 4GRWB 5I30L 3HB3D 3VFOA 1G9NC 2KQNA 3T0EC 2AP2A 5KS9B 2JCCE 4MJ2A 4BFEA 3KPSD 4M61A 5B3NA 1T03L 3WDJA 1R3HA 1HEZB 5I8OL 4WNQB 2BRQA 4Y2DB 1FFRA 2IGFL 4ODWA 2HWZH 4KMTH 1Q0YL 1QKZL 4XAWH 5SX4I 5BOPA 5BS0E 2VZ1A 1YEEH 4WRLA 3H9HA 3PWUB 5I75B 1EBAA 1Q72L 4F37K 5C0DA 4GW1B 1YY9C 5ISZA 3QPXL 4LDOB 4NQDD 4QHLB 3TO2B 2P45B 5HDBF 3X13B 5FKPB 1S7VB 3QEQB 2I60H 1INQA 4MXQC 4K3GA 2GKIA 3OPZL 5FA4B 3UTZA 4HCRH 4Y5YC 4ZUVB 1E6OL 2EIZB 2YBRB 1KPVA 1Z9LA 3TV3H 3NFSH 2VAAA 1JMXA 3FQUB 1PYWA 3LEXB 3U83A 1OSZA 2AABH 2WWKT 4OSUL 4M6ML 4JEGB 4YXLL 3L5IA 5EBLA 1UENA 4FQ1L 4GOSA 5DRXA 2V2XB 5FYKH 1O0VA 3G5ZB 4X0KB 1Z3GH 1QRNE 1II4E 2MJWA 4GG6A 3MRLB 1LEGA 3T4AA 2IBZY 4GBXC 3WFDL 5EFIB 2X09A 1NC4B 5KZCD 1J10A 3MUHL 4GW5B 3VFPB 1XT5A 5C08B 3TESA 2MCPH 5HGDA 5DFVC 3RWFA 4KKBD 2PW1B 4A6YL 3PV6B 4XPTH 3SDXB 5FYJH 1GOGA 1A2YB 4JRXE 1CR9L 1U8OB 1Z0MA 2B7DT 5D2LE 5DT1H 2AW2A 2YSSA 4JM2F 1S78C 2BVQA 1R5WA 2HN7A 3FAWA 3K2UL 3A6CL 3GK8L 1XR8A 3MLWH 5DVMA 4MQSB 1MCKA 3VXOB 2IADB 5A2FA 1YC8A 2ITDB 3I2CH 3D39D 3BGAA 2GSGB 4JO3L 4YHIB 3QIWC 1UCBL 3IXAA 3WS3A 1MIML 5D7KD 4HZAA 5I66B 5HHVH 4N8VA 1JPFA 1C5DB 4JDTH 4RAUA 5CS7A 5KSAA 3NA4A 4NRYA 1JFQL 3SE4A 5EU5A 3LN4B 2OYPA 4I9WD 1JK8B 5KOMC 5EU7E 4LLQA 4PLNC 1T20A 3PXHA 1MREH 4S1DC 3WHXA 3KJ6H 4QOKE 4X4XA 1GC1L 1U6AL 1YECL 4ODVL 2OXGA 4MAYC 4NO0B 4MNQB 3QUMB 3BHBB 4PRAA 4D9QE 1P2CA 4HEPG 1CICA 1ODAA 2C1OA 4FMKA 4WW1B 2MKWA 1GZPB 1SEQL 4OZGA 2IFGA 3HZMB 4JY4B 3MV9D 4NN7B 1D5MA 1IBGL 2FSEA 4M7ZC 4L8CB 2X4SB 1OTSC 4DTGL 1VACB 5D1XA 5FUZL 5I1LB 1NCWH 2EICA 3AB0C 4QO1A 4QRQA 5CGYD 4G6KL 4MNHA 2D03H 2WBJC 2HRLA 2HKFH 2XZAL 2ADFH 5F8RC 6CGTA 1I1AD 3T1WA 1A8JH 4Z7VE 5I1AA 1JF1B 5I76B 4JKLA 1BVKB 4JFQB 3TNNB 5KZCB 1FN4A 3C9NB 1OTUC 4Q6IC 3GMPA 5C7XH 2HTKC 2K7PA 1MRCH 3PWPA 1AC0A 4BSVA 3DRQA 3LD8B 5IB4A 4RFEB 4PGEB 2L0DA 1EAPB 5D72H 4OGXH 3IU3B 1XIWA 3Q3GA 4BYHA 3MA9L 3CSPA 2WUCH 1A7PL 3MRGB 2Q8BH 4BFBD 1WFOA 2DM4A 4G7VH 3ZHDA 2FD6L 3WD5H 1DQJB 4KRPD 4X5XB 3B2VL 1AFVH 4M03A 2IAMC 4NRZB 5TPWH 4DQOL 3U6RA 1E4XH 1F11A 5KVDH 1L0QA 5FFLA 5T3ZH 1JWMB 4X6FA 3L1OH 3BKML 5L2KD 3O2DA 2ZOLB 1ZHNB 4MA1C 2F9BT 4FXGB 2QHRL 4WV1B 2VSCA 2Z93A 3KYKH 2EO9A 1RJCA 2IH1B 3IDGA 4JG0L 4Y16D 3TT3L 4OCMC 2NW2B 3TBTB 1G7IA 1I8KB 1FNHA 3LEVL 4EN3B 1DEDA 1VFBB 4L29A 4XGZA 3CNKA 5DURB 5HHPB 1OCWL 1KG0A 2GFBB 2FZ3B 2VXVL 2LTQC 4QY8B 1HNFA 3RA7H 4YDJB 5F6HI 3WJJA 3D85A 4K71B 5TFSH 4JQIH 1VPOH 2GJ6A 4XTRC 2YRLA 4NFBA 4PJCF 5CZXC 3TBVB 4F9LA 2NQCA 1ZHLB 1CU4H 3PWLA 1ES0A 4OZ4B 3MV9B 1T83C 3MUJA 3NACL 3WFEH 5J3HD 5EO1A 3QIBD 2CJUL 3CDGB 3GSOB 1HHIB 3NTCH 2EYTB 1DTUA 2X4TA 4HAFA 1ACZA 3EFDH 5DUBA 4PRIA 5I1CH 4LARL 1ONQB 3LIZH 1AXSB 4L8SC 4KZEH 1G6RB 3QEGH 3WFBH 3R0NA 1NEZB 1QBLL 2AGJH 3BGFC 1F4XH 3O9WA 4HT1H 5CJXC 3U7AA 3W0WB 5KSBA 3E8UL 3STLB 3GUTB 3VH8B 1YJDL 5E8OB 5HGBB 1AD0A 3O2WH 3QULA 3CDYA 3NZ8B 1BM3H 4XMLL 2EH7H 3DWTA 3VG0H 3O2DH 3C2AH 2CUHA 3BDYH 5GZOD 4NZUL 4ELKA 4U7MA 4HIEB 3DVFA 3GSVA 5GGSB 1R0AH 4MWFB 5DQ9A 2BVOA 4Z0BL 1OAZH 4DN4H 3HRZB 4RBPH 3O3UN 5GGSY 3ZYJA 4P23D 4R26L 4JFED 5DRZB 4Y0GA 4U1LA 3P9MA 4G8GE 4PJBB 4HZLA 3P11H 1QO3A 4CN4A 5AWNH 4OLZH 3VDCA 1UKTA 4PY8I 3OKEB 4WU7A 3BPCA 3CPLB 1WBXB 3RJDA 4U1MB 1ZA3B 3GHEL 4MA3A 1CD1A 2AXHA 5EBWA 2R15A 4CADB 4RDQG 1P7QB 2C9AA 1BJ1H 5F1IA 4C55A 5IEKA 4IDLA 3SE8H 1ED3B 1D3CA 3K3QA 2EDDA 2YA0A 4OZIF 3MPCA 3G6JA 1AKJA 3L7EB 5CJ8A 3GI9H 3QJFB 1ZVSB 3VGEA 3A67L 2BDNH 1YEHL 4KKAC 1XF4A 3QXAB 3ULSA 5ICZA 3SGEH 1FDLH 1KCLA 3EOYG 3MLSL 3N06B 4GXUM 1EEYB 4Y19B 5CEYA 1A7BA 3H9SA 4DVBA 4WFGE 3PP4H 2EDLA 1A1MA 5I0ZA 4PJ8A 4ZXBD 2K7QA 2W38A 3TBYB 1IKNC 2ZUWA 4ZUTB 1U8HA 1KV3A 1TQCB 2JELH 1WBYA 1MCCA 5C0FB 5IMMB 2ED8A 2VLJD 5T1KB 2EDKA 3WIHL 4JPIB 3TVMD 1AGEA 5IBUG 3L3GA 3MNWA 5E94B 4ZTOH 1OAUH 3LCYA 5CIPA 1NJ9B 3CLFL 35C8H 1UWGH 1MHEB 1R5IB 3HC0B 3DX6A 4PJEF 2FHCA 1UB5B 2HT2D 1NCBL 4KY1L 4PREB 3R06B 4NOFA 2FJFB 4QRSA 1KPUB 2CH8A 1X6LA 4P23B 1A6TB 5HHMB 4QNPF 5I16B 5DQJB 2A74B 5FK9B 5CBEA 1N2RA 4I0PD 4JDZB 4FQIL 1BX2B 1G9EA 1T4KA 4DOHB 5EUOB 2PXYA 2BK8A 4XNZC 2ICES 4JZOA 3RWJA 5HGAB 2AQ1A 3ARDD 2NR6D 4QRTB 4M48H 2FEEI 5E8PB 2J4WH 3QDGA 5HVHC 1S5HB 3QDJE 4GRMB 4NKIL 5EZJB 1JGDB 4KTDH 1F5WA 2ZCLL 1LO5B 4QRRE 4D0CB 3PL6B 5JQ6L 3UTPE 1IT9H 4NGHH 5EO0B 7FABH 4OZIE 2ZKHH 3BAEH 4PTTA 5LCVL 2Y23A 1P7KA 5D7JC 5IJKA 1CXFA 1Q1JH 4YDLC 3RU8H 1T1WB 5F7WC 1JBJA 4R96B 4HGKC 1MHCA 3WLWD 2I5YL 2G75A 4P9HL 1Y6MR 1T2QL 2AK1L 1GGIL 2BZDA 5KBNC 4LCYA 4C59B 2XACC 1OGAE 3U9UB 5M95B 2F53B 4TSAH 5CIPH 3DBXB 4Z76B 1U91A 4WEUD 3R8QA 4YQXH 3IT8D 1YEGL 2EDFA 3JV0A 4YHOL 1U8KA 3K8KA 3ETBF 1FVDB 3RUGA 3SDDA 1KUMA 4PJFA 4G7YL 4ALAH 3TVMB 3PQYE 1BJ8A 1OD9A 4G9FD 1ITCA 1MJ8L 4K3JL 5IHLB 1MFCH 1FVEA 5D8JL 1ORQA 1NMCC 4BQCA 3LQAL 1DN0B 3E6FB 4LL9A 2O5ZL 1MLCA 2BMKB 4APQD 4KROB 2UZIH 1V3KA 1Y0LA 4PJEE 2DTMH 1LEIA 3KWWB 4GJTB 3IXTB 3FQWA 2DQJL 4X5WA 1YN7A 4PLJD 1YDPB 3BGMA 1M05B 2ENSA 3ESUF 5JQHC 4PGDA 4XCCL 4KRPC 1D6VL 3WUWG 5D1QA 1MNUL 4X98A 5DJ8A 4LLDA 4RMQA 4JPVL 3GBNL 4QNPE 4I0PB 3D3VD 4V1DA 1AGBB 2EDHA 3RDTA 1FAIL 2X42A