3GJFK

Rational development of high-affinity t-cell receptor-like antibodies
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
QSELTQPRSVSGSPGQSVTISCTGTSRDVGGYNYVSWYQQHPGKAPKLIIHDVIERSSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCWSFAGSYYVFGTGTDVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGNTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Rational development of high-affinity T-cell receptor-like antibodies
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2009-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gjfK01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gjfK02
1YJDC 1EV2E 2XXCB 3VXUB 4JHWL 5IQ9B 4YDVA 4OFIA 2WAHA 1VPOH 4CL7A 1S5HB 2HH0H 3BKCL 2BOCA 4HMCA 3QCUH 1T3FA 2DQEH 4M3KB 2P8LB 4XP1L 3VD5A 3M17B 4Z0BH 3LIZH 4L3ED 3RTQD 1F00I 4TVPD 1IKFL 4HCRL 4XHJD 5GJTL 5KSAA 1W0YT 2W9LA 5LGKA 1YY8B 3G5YB 3HUJF 4R90L 4GQ9L 5EZOH 3HKFA 2P44B 3DYPA 4PRAB 2Q1EA 2ICEB 4NQEE 3QUXB 5JDSB 3TJHD 3ARBD 4HBCL 3L3GA 3DXAE 3SJVD 4HF5L 4ZUUA 3R8QA 3EKCA 3NMEA 4TUOA 4F9LA 4GS7B 2LU4A 1J5OL 3KYMB 1V7NL 5E8NA 1MWAB 3FB7A 5E9DD 2CMRL 2IAMC 3SQOL 4OZFA 4LNVA 2WP3O 2BSED 1ED3A 3KYKH 5F9WB 1XH3B 3C5SA 4S1RH 5DD6A 4G7YL 2MFNA 3GJFB 5C0FA 3P40A 3BKML 5FYLD 1M7DA 4JFQB 1ZLSH 2JJTC 4XP9L 4HUUA 43C9B 2IANA 3VI4E 4K23L 4FXGA 1JYXA 1QLFB 2FBOJ 4LU5H 4FQHB 4QNPE 3D25A 4Y2DB 3VD7A 4JFDE 5EU4A 4B53A 4DGIH 1BX2B 3CFKA 4RFOL 1LO2H 1LP9B 4G43B 1NGYA 3GBML 4RFNC 5MEQA 4LRNL 1NJ9A 1R6VA 4HX1A 1Q94B 2IPUK 4IRSC 4OCSH 1SBSH 2VL5A 1EFXD 5HYSB 5CP3A 1JRHH 4QGTA 4TUKL 4KPHH 3SCMA 5F7UA 5FAAA 1I3VA 3EFFA 5D93C 2E9IA 3ULUD 3T8XA 3WBDA 4PJ8C 1CXIA 4JZJB 3GSRB 2FEEL 3GMRB 3WNLA 1YEEH 3O6FC 4LLVB 5BS0A 5TDOB 5FV2A 3GSVA 3RPIA 1A64A 4ZNEE 2WLYA 4FZEL 3BZDA 3VFMA 2A6DA 4BZ2H 3EOAA 2DM4A 4JFFE 3NOIA 4F7PB 1HH9A 1QQDA 3MLUL 5EA0H 2ED8A 3RWGA 1JI2A 3F7YA 3EBAA 4DKAA 1YPZA 1Q9LA 1HWHB 1X5ZA 4JFEE 2CK0L 2YMXH 3IDYC 3KAAA 5JR1L 4RGNE 4PTUB 1FBIH 5TDNB 3UROR 5I1AB 2VXQH 3LMJH 1LE5A 1H5BB 3AREA 3S88L 2FX8L 4JO4H 1MIMH 1OP5K 1XR9A 3W5MA 4G9FE 1Y6MR 4G6KL 3QUZD 3O9WB 5DUML 3M1BA 4DOHB 4KKLC 1BD2E 1BIIB 3EHBC 4IMKA 4E41A 4LRIC 5GSRA 3T2OA 5ISZB 3QDJE 5CGMA 4D0DB 4M9PA 3F62A 4DQOH 4Z7WF 1SBBA 3UXFA 3T0EC 2ZUUA 4ZUVA 1HI6B 1OB1B 1FG2B 1RZJL 1G9MC 3BGMB 4X6CB 1IAIM 3WUWA 2NY2B 1G7QB 2P46B 5HYJB 3RA7L 1JWUA 1U8IA 1R3IH 4OIAA 5B4MC 2XZQH 3QUMA 3QULA 4J3OC 1WAAA 2YBRA 3MV8A 4Y5YC 4P5TD 2YOCA 1E27B 5DTFA 1B0GB 1NEZA 2PYEE 2BC4B 1T20A 2F5BH 4PJ5A 1DQQB 3TZVD 1BJMA 1U3HC 2BRQA 2H3NA 4WU5B 5J12C 4RSVA 1I4FB 3TP4A 5F3HA 1FFOB 1MREL 2XG5A 4KTYA 1YQVH 2NTFB 5KANG 1GCFA 1P4LB 3MV9D 5EU6E 5SX5H 3AY4C 4RZCA 4Z18A 1FO0A 3O2DA 3ZDXE 4EI5B 4MNGA 1C08A 4N90E 2NXYD 1T5WB 1L6ZA 3PWJB 1BF8A 15C8H 1Z3GL 1J0IA 4JPIB 4OI8A 4Y1AB 5EFIB 3I3DA 4LQ1A 1W0VA 1CXHA 4PRDB 1XIWD 2D0HA 2VDQL 3PL6A 4PIRF 5HI5D 2ED7A 5CBEA 2GK0A 4JG0L 5A2IH 3O11B 3TYFB 1RUQH 4K9EH 4HS8L 3VXSD 3QEHA 3V0WH 2X4TB 2EYRA 5FO8B 3UTTD 2C1OA 2WWMC 5GS0H 1ZVSA 1MSPA 1PEZA 3H9ZA 1GZQB 4LBEB 3WKMH 1KN2H 4M7LH 3JV6A 4NUGH 4Y5VB 4RBPH 2IBZY 5GGVY 3RWCB 3UBXI 5I30H 2XIDA 3ZE2F 4W6YB 2IH1A 4PB9H 1KULA 2Q86B 3HLAB 4Z7VA 4B5EA 5IM7B 3JZ7A 1FVCB 2R0LL 1DBJL 1AHWC 5J6GA 3PGDB 4PV9B 4CRPA 4GT7A 4Q6IB 4TNWK 2FWOB 4J3SA 2DLIA 3TCXA 3ZHKA 2ZNXA 4WO4A 5L7XH 2B8OT 2MMXA 3QXUA 3RIFF 1P69B 2X4PB 2AV1B 4NZDA 3TIDA 5DMKB 5HDQL 1YNKH 1MCIA 5J56B 2GTZB 2R0KL 4F3FB 1IGJA 5ESQA 5EH1A 3WS6C 4GBXA 5E5RB 4PJ8D 1N59A 4XAKE 2NLJA 4N9GB 1UM5L 3NA9H 4JM2C 4O5LL 5IK3A 3E0GA 4PJAE 1Z9MA 5BXFA 4FS0A 5C0JB 1L7IH 3HCVB 4R3SA 1MRDL 3SDXA 1BOYA 2R8SL 3B2VL 5T1LB 2BHUA 1TTFA 3TPUA 2ZSWB 4HIIB 4PREB 2UVFA 3HC4H 5T1DH 1U3ZA 3NAAL 2W91A 4NZUL 4UNVA 1RAMA 5IW3A 4D8PB 3IAPA 4PGEB 3VFNB 3ZHDA 4UV7L 2DD8L 4MD0B 3X12B 4M61B 4ZOBA 2GSGB 4M7KL 4XNQB 5CEYA 1QSFE 4P2OA 3RDTA 4QHKI 4RWYL 3C60B 1JPGB 4PR5B 3WNOA 4ONOA 2FH8A 4F8TA 4NO2B 1CZ8L 1X7QB 3HPJB 5TH2A 4PRPB 4FQJL 2EKSB 4RIRA 4EN3C 3HG1E 5KS9B 3O2WL 5ICXA 1DQLH 5KAQF 4KKLD 4F7TB 4CMHC 3EHBD 3BMVA 3N1FC 3IF1A 3QPQC 4JLRA 2W0FB 1MY5A 2XN9D 4P4RA 1JHLL 2OP4H 5K33A 1YEHL 3C8HA 4HIEA 1QYGH 4Z5RA 1MF2L 3M8OL 3DX7B 4HWNA 3K74B 2JK5A 4JKPH 5ITFA 4JY4A 2CDGB 5ESVB 3T0ED 5CEZD 2R2BB 1I1FA 2G9HA 4XH2A 1BAFH 3MFFA 2JJWA 1LDPL 1A1OA 5IIEB 3GDBA 1CVRA 2UWEF 5D1ZA 1NDGB 5B4MD 1UWXH 1OGAD 4PY8J 4OZ4B 2Y7QB 1S3KH 4WW1A 2VE6A 4OSUH 4UT7L 4YHZH 2B5IB 4YHIA 2MKWA 3T0BA 3NN8A 3F5WB 4HJGB 4PUBL 2Y6SD 5J9PB 5DD1H 5DJ8A 2Z4QA 1RJZA 3L7EB 3IXTB 2OR8A 1ZHLB 4XPGL 3MGOA 5DJDB 1T0MB 4X7CC 1CU4H 3ARVA 3CZFB 3E6FB 3FO2A 4LK4A 4NQXA 3S35H 4MMZC 1UH4A 4G9DA 1U8MB 3STZA 1QRNA 3BPLB 3UBXB 1U3YA 5T3XL 3TCLA 1F3DJ 2B4CC 5CSGA 5DJYB 1Q9OB 2NY5H 4PGDA 4HWBH 5D7LE 2WNGA 1VB9A 3NFNB 3SDAA 3UJTH 4NN5B 3VFUB 2WUBL 2KKQA 5D2LA 2XTJD 2ARJQ 5CJ8A 3UJIH 2GFBB 3WL9B 5GGQH 1RURH 4K8RC 3QQ3B 3TO4D 2AXJA 5HI3C 2DQDH 3T3ME 2NPLX 3GIVB 2Z8WC 4HXAL 5SWZE 3T0XA 5SWSB 5C0RL 3DXAD 3QXWA 4LVHC 1F4AA 5DRWB 4NQDA 5K9QI 1QRKA 3EFDH 2DMKA 4O2CA 1CT8B 2WBJD 1CGWA 1OT2A 1I9EA 4MQXD 3A67H 2GT9B 2VIRB 4CN6A 1AKJB 1NEUA 4IOSD 4HAFA 3HRZA 4Z7UB 1UC6A 1T21A 4OFPA 1J0HA 1RULL 2X4SB 3PJSB 1IKNC 2BNQE 3FQTB 3U46B 3MOAL 4M00A 2G75B 1G7HB 1IJ9A 1MAKA 1MEXH 1Q1JH 3FO1A 1CICB 1MFDH 2FZ3B 4POZC 5IVXA 4JN1L 3VI3F 3WLWC 3OSKA 2P5EE 4X5LA 3AU1A 4RMVA 2KUTA 5HBBA 3ZDZE 2XFXA 4ZUTB 4ODHH 5DFVD 1J1PL 1QBAA 4NRZA 1UA6H 5H94B 4XCYA 2PO6A 3MJ6A 4MA7H 1FFRA 2ED9A 3NPZB 1JWSA 3GHBH 3C9NB 2IG2L 2B1HL 2R1XA 4WUUA 1WIUA 4WRLA 3PHSA 1QBMH 1FNEA 4M6OL 2W60B 4M6NH 1CK0L 4V1DD 5I8OL 4UIKL 2K1MA 5FYKE 3ULVF 2J88L 3I6GA 4IJ3C 1HNFA 4G8EB 1R24A 2GY7B 1GGCL 4HUWB 4NHCH 1DUZA 4ZD3H 2PCPA 5JQ6L 2QKIA 4JPVL 3H9SB 2SEBB 3V79C 2NW2B 2XYCA 5B39A 1IGTA 2AJZB 4FQ1L 5DQDH 5FKAB 4HC1L 3EOYG 4OTXL 5GJSL 5GS1A 2VDPL 2D9QB 1OTUD 4UV4H 5EUOF 4LGPB 5FUCC 1BBDH 5T3ZL 4P4KC 1CDGA 1MLCA 3IDUA 1OT1A 1KJ2L 1WZ1L 3ET9F 2LVEA 1I8MB 4JFFD 2NY4D 4P2RA 4K2UH 4I2XB 3D18B 3ULVL 4KUCD 1CFTA 2R4SL 3QPQD 4Z8FL 5J1AB 1KLGB 1W72L 1BVLB 4RGND 2Y36H 4C56A 2XT1B 3RUGB 2W0PA 3HZKB 7FABH 1TJGL 5SX5K 5FA3B 4FQXA 2CXGA 1MOEA 4ZUWA 2H2SC 4NRYB 3C6LB 3FN0H 4I3GA 4K3DL 1A02N 2F19L 2VOTA 1A6TA 2ZUQB 4MD5B 5LCVH 3LKNA 1U95B 3G6AB 4RX4D 4J4PA 4XHQA 4MSWB 3U36B 1BD2D 5KVEH 2OJZL 1VFMA 4BH8A 4NNYB 3RWIB 4XP4L 3VH8B 4LKCB 4GG6E 4FXKB 1X5AA 2Y4SA 4K3HA 1J1OL 1XCQA 3GSUB 1KYOK 5JZ7C 4MJ5A 1WSST 4OCRL 3JV5A 3PNWA 4HGWA 2CKBL 3GBNL 5DRXA 3MLTB 1XFPA 5I1EL 2XRAL 1CE6B 3MUGB 2XOTA 4PD4K 1CF8L 3G9AB 4WY7H 3RY5A 3MUJA 3MBED 5IB2A 4NDMA 2FJFB 2IC2A 4GAJH 4MNQB 4JZOB 4JPKL 5IMLB 4B41A 4QRUA 5A2FA 4R0LB 1F58L 2FLBT 1ZVHA 3NZHH 4Q58C 5KTEL 3FB5B 4JEGB 2PYED 1J05B 1CQYA 1NFDE 3X14A 4S11A 3Q6FB 25C8L 1I1AB 3GB7A 1GZPB 3BIBX 1NBYA 3B5GA 3SKOA 2HTKD 5JW4M 1MI5A 3IRPX 2CUHA 4LSDA 2X2YA 5FCUL 1PKQE 2VDRL 2YPLA 3BVNA 4LARL 4PY7A 3CDFA 2VLJD 3QUYB 3OG6B 1C5BH 2W9EH 1AJ7H 5D7KE 4KK9C 1JIBA 1NSNL 4LL9A 3WFCH 5JXEC 3V0VB 1YNLH 3P30H 1TMCB 4X6EB 1CL7H 1V7MH 4QRTA 2Y06H 4RMTA 1AGDA 3O3AA 3VFTB 4DGVH 1KENH 2J8HA 1MFBH 5IMMB 1WZLA 32C2B 5CBAA 4OFVA 3CDYA 1IT9L 3H42H 2W92A 5D9SB 3FB7B 5GGSY 1SVCP 3BPOB 4POZD 4ALAL 3C5SB 5C09A 5CGTA 4TPRL 1A6UH 5D6CB 3DTXA 5EZLA 1JNLL 4PRIE 2IALB 4EBQH 4WWID 5BRZA 1P9MA 4YHOH 3ARDA 2V2TA 4YHLH 4KRNA 4HPOL 5D71H 4EQ2A 4AIZA 3D25B 3QIUA 1Y18A 4U1KA 3EDDA 5EU4B 4QYOA 4UI2A 4MA1B 5ELIA 1RUKL 4YDJB 1I75A 4O9HL 4HIXL 3SDDA 1CWVA 4WFGD 4S2SB 1QO3B 5FXCH 1KCUL 2QTEA 3DHMA 1LK3H 2R0ZH 3PWPD 4HX1B 5F1IA 2D7OA 1BGXH 5BVPL 2JJVA 3LHPL 4L3EA 4LCCB 3RTQA 2WLZA 4GH7B 3IETA 5T33H 3REVB 3MFGB 4DTGL 3AM8A 4CUCA 3W39B 4GXVH 3MA9L 3NFPB 2KBGA 5D96B 5J0BA 5TF1H 3OKNA 4ZS7L 1ZVYA 4NC1E 1A8JH 3PHQA 1MPAH 3L3IA 1U93A 1UWXK 1BFTA 5JHDD 1AFVH 3QUKA 4Y19E 3IS0X 4YXLL 1EO8L 3MRNB 2YEZB 1MJ8L 1E6JL 3SJVA 3LPFA 5HVGB 3DROB 4QT5B 1NCAL 1T1YA 4IIQA 5CZVL 4S1QH 2CKNA 1UACH 1K6QL 4I5BA 4D3CH 1GGUA 1X5HA 3FB8A 3LD8C 3BUYB 4R26H 5IMKA 3VFMB 4YNYA 3VGGA 2AJSL 3E1F1 4K94C 3B6SB 3L9RA 4FG6C 1WF5A 5I74B 3W0WB 1PFCA 3KVQA 3SGJC 1N5AA 3K8MA 3HG1D 3KDMB 4MB5A 2UZIL 3ESUF 5IHLB 5EC1A 5C0AE 3ZYZA 1LEKB 3OKEB 2ESVE 4KMLB 4PJEA 4ZNCD 3U7YH 1T1XB 1FC2D 5L2JA 2QHRL 2FIKA 4WEBL 3SOBH 4P9MH 2YN5A 4APQB 4GW5B 4N5UA 1B4JL 3VGAB 4D9LH 4X7DC 4KHTL 5JUEL 1C7TA 3ZKND 3NCYP 2FEDD 1MELA 2YD2A 4Q9RL 5E8DL 5GSRB 4HG4K 3T2QA 5FV1L 1EFXA 2MQ3A 4Y4FC 4NGHH 2WSKA 1TTGA 2Q8BH 1LO3L 2EEAA 1IBGH 2AJYL 5I18L 1WBZB 1QFHA 3BZEB 1YPZF 2OYPA 2FR4A 3ARGC 5BW7C 3S5LB 2VDKL 3FQUB 3LRSB 3QDME 4FQIL 3ZTNL 1A7OH 4Q74A 4K3GA 4PLOB 4MNHA 2WQ8A 3RZCC 2J8UB 3CH8A 1FZJB 1GHFL 4NQCB 2DQIL 2YK1L 1N0LA 3MRFB 3C6SB 3D39D 3FQNB 3MJ7A 1R0AH 1I7UB 3RGVB 1OPGL 2DYPA 2H3NB 1KTLA 4NO5B 3UP1A 4QCIA 3LKQB 1G0YR 3NCBB 4KQ3H 2HVJB 4NKIH 1X5YA 2EIZA 4M02A 4QRRB 5D7LD 1P4BL 1FNGA 1I85C 3RL2A 1QLRA 2R69H 5K9JL 4XNXH 2IPKB 1F3DH 1QBLL 4E9LA 3I6KA 1VFAA 4YO0B 5ALBH 2EICA 1N6VA 3MNZB 1Q9KA 2GJ6B 4P49A 4M93B 4UBDC 3A0OA 3DSFH 3K46A 1OTTC 5SWZD 3MUHL 4LKXA 1MHCA 5HYFA 1E4WL 5GHWL 1U41A 3KPLB 1WAAF 4LCWD 3PQYD 1I1RA 3UTOA 4ZAKB 1JYVA 4L4VE 4JDVB 1UWEH 4L3AA 2E6JA 1LNUB 1A4KB 1N8ZB 4WI9A 1D7FA 4M4PA 2LFGA 3BQUA 1CXLA 2R2EB 4P2QB 5JIKA 1CG9B 2X4NB 2X4OA 2BNQD 1ZHBB 2G60L 1UKTA 4U3CA 4Y4KB 4PJCB 3V7AE 1NGPH 3MLSL 5EO9A 1BHGA 2OI9B 4JFZL 5EBMB 1XCTB 3UTZA 3OGCB 4AG4L 1AO7D 5FB8A 4M43L 3GI9H 3BRDA 5KAQG 2QSCL 2P5ED 1S5IH 2BSSA 3D48R 2IH3A 4DN4L 3VDBA 3CK0L 1EO7A 5C08B 1Y6KR 4P5TA 3QUML 1QACA 2VH5L 4I3SH 1G9EA 2DIJA 5DFWH 2GI7A 3TZVA 2WIIB 2X10A 4L8SB 3UCRA 1IAMA 5AZEH 3KR3L 3BPCA 4ORGA 5FYKD 1T22B 2OSLA 1AD0B 3MV9A 5FUOH 3B83A 4Z0XB 4FFVC 2AJVL 4HDIA 5IJVA 3HNTH 3KPSE 4R96A 1GC1H 1FO0L 3O2DL 4OCYL 5ICZA 3I02A 4G8IB 3BAEH 4KXZI 3P4LA 4R8WL 3SDXB 1QSEA 2ZSVB 4Z7VF 3TPUB 4XI5D 4AMKL 2CXKA 4XNMB 1H3PL 3C08L 3OHXB 1KIRB 4P3CH 5E5UB 1HNGA 3TWCH 4FG6D 1WWAX 2UUDH 5D7JC 2XKUA 1UB5A 2OM5A 4HS3B 5IFHL 3UTTA 1T1ZB 1OAXL 3QI9D 1HXMA 12E8H 3HAEA 4YZFE 4H1LA 5IR1B 5C0DA 3DX8A 2YHGA 4KDTC 1JZ8A 3CXDL 1F4XH 3TT3H 3QIBC 4OGYH 2YA2A 3GO1L 1NC4D 1QFOA 1QD0A 3ULSB 3CH1A 4KK5D 4UT9H 5DVMA 3LB6D 1MVUB 3LEYL 4HAGA 3VMOA 2V2WA 5BV7C 5T1KB 2HJLB 3RWHA 1T7XA 3DMMC 3WMSA 4NKOA 3IF1B 4JLRB 4PGCA 1LDSA 4HIEB 5EU5A 5C7XL 2PETA 2ILLA 4N8VA 4UUJB 4LAJH 5E4EC 1FVEA 4JY4B 3THML 1ADQH 2Q7NA 3FOMB 2G9HB 4ZYKB 2GYSA 3ARGD 3TLRA 4ZFZA 4Y0GA 1U8HB 3KPRE 1KB9J 2P7TA 4I0CC 3U9PL 4XCCH 4WGVB 2IGFH 3SGDI 3RZCD 2PTUA 5MERB 1R3KA 3ZT7A 3NFSL 3D0VA 5F1NA 5DLML 2V7NA 2J2ZA 4CNIA 2GJZA 3ZKMD 2Z4QB 1RJZB 1A4JB 3NBNA 4HKBB 5CSZB 5DI8B 3OB8A 5HHOE 5B38G 1JMZA 4M5YH 3EO9L 1FIEA 1G9NL 4G9DB 4LVNB 2DLEA 3IFOB 3AB0C 4I4WA 2YXFA 2WK2A 2JIXA 4MXVE 1I8IA 4LIQH 5B8CB 3OAYH 1HHIB 3EOTH 4R97B 3NACH 5HGHA 1N6QL 4PJDE 1TFHA 3HPLB 1JHTA 1HOCB 1UWGH 4IDLA 4JO1L 3RVVD 1EHNA 3SKMB 5KSBA 3H2WA 4EIGB 1ZEAH 4UBDD 1IZJA 3L3DA 3T65A 4NSKB 4X8JB 4QHNA 5HVHC 1OTTD 2D31B 4PJ7E 1T6VN 3O0RL 2N56A 4LF3B 5I1KL 2R29H 2MPAH 3BN9C 2EDWA 1EUTA 4KI1A 5DR5H 1S7TA 4GAYA 1J8HE 5I2IB 3IAGC 1HDMA 5JNYB 3TA3A 2AJUL 3OBAA 2XN9A 3CFCL 5CUSL 2VISB 4GG8A 5J11C 2BP3A 3JV4B 3HS0B 1KELH 5F6HJ 3LN4A 3QJHB 2EIBA 2A1WL 5ENWA 4OBRA 5HDBF 4KZDL 4AEHH 3HRZB 4HIJB 1HK6A 1OGAA 1EX0A 4FA8A 4HGKC 4Z7WE 2AEPL 3QEQE 2HLAA 3QHFH 4PRID 4NQUA 3U30C 4FNLH 3OV6A 5DDHB 4MZ2A 1BQHA 1K4DA 1F11A 1KCVH 4I18C 4JFOA 3Q5YA 4TUJA 5INCB 1G7LB 2YD7A 4U1HA 2RGSA 4MVBC 4XC1H 3DI2B 5D2LF 3VXQB 4NC2B 3UDWC 5DMIL 4TULL 1MCKA 2XFXB 1GIGH 2BVPB 3TNNA 5EO1A 4P23D 4L4JA 4I0PC 2Z91B 2AKRB 1Q38A 2Q7YA 2QQQA 3VXTA 35C8H 2PO6B 4GMSH 5D5ME 2EEBA 1WVZA 3OKDB 2HFGL 4NO0A 2O5ZH 1MAJA 1B2WH 5L2KB 4DUVA 4F15C 3ARYA 3NCFB 1FNEB 4OD1L 3D0LA 3P9MB 4QXTA 2RFXB 3V6FA 4L8BB 3I6GB 4U1MB 3TBSA 5KJRH 5JW3H 3HNSH 2ZPKH 1RZFH 1FAIL 1RIHL 4OLYL 2OQJA 4JZNA 4ZOEA 2J4WL 5D7JD 4NKDA 5DJZB 3V52H 3MLWH 5FUZH 5BMFH 4NQEA 1KCSH 4PJHA 2C3VA 5I1HH 4HUKB 4XXCC 5IVXF 5GS1B 3BMWA 5EBWA 3DXAA 4KRPB 1QVOA 1Z0MA 3ARXA 3PV7A 4X9BA 2WBJA 2RCSH 1A22B 1VKXB 3RAJL 5DHYA 3VXRB 3U79A 1OLLA 3FB6A 4C83A 3HMWH 4P9HH 3GUTB 2BHZA 4OM1L 4EDWL 3STBA 1SHMA 4YLQT 4WW2A 5DD0L 3FTGA 5I1IL 4JDZA 1CFTB 1LD9A 3DMMD 4MMXC 5IT2H 4DCQA 2BVYA 4FABH 4X7TB 1TZHA 2PR4L 5ERWB 1XGPA 1NLDL 3EOBB 1JF5A 4HUNB 3QHZH 4KI5C 1T04A 4LSVL 2F54E 1ZHKB 4LNRB 3QO0A 4JFDA 3OAUL 1LP9F 2C1PB 1NCCH 3GK8L 3QWOA 1U91B 4G7VH 3CLFL 1AQKH 3RVUC 1G7PB 3RY6A 1UXSA 4L29B 2EH7H 4X6FA 1MFCH 4Z9KB 4FQ2L 1D9KB 1VDGA 3I6LE 4TRPH 4PS4L 1KIQA 3CSPA 3B8SA 1UQSB 4WWKB 2VUYA 1WCBB 1C5DA 1NKRA 1AGFA 2PXYA 3QO1B 4I48A 5H35B 1JPSL 4XPBH 1A7NL 4MJ6B 3MV11 1JFQL 3BKYH 4LLDA 1NCBL 2N4IA 2BMKB 5DUBB 3DBXA 3PNWB 2A6JB 4G42B 3RWFA 1GGTA 4WEUD 2B1AH 4JRYE 1X5LA 5CZXD 1RJYB 5F8RC 4HKJA 1MHPH 3PG2A 5F9WC 3QDMD 4KDWA 1KLUB 3B8YA 5D8JH 3G5ZA 3KYNB 3PP4H 3QAZB 4QWWC 4R4ND 5F9DC 3TBVA 3LQAH 4WU7B 2W59A 3MRDB 3PWNA 1OWWA 4ZNEA 1BOGB 4B7IA 5MEPA 4OZIE 3GGWA 3EYVA 4QO1A 4XBGB 1VPOL 4D9RE 4JFFA 1MCNA 2ERJC 2HH0L 3BN9D 4Y2DC 1WBXA 4ODXA 3D2UA 4BKLA 5F8QC 4OZFG 2EIDA 4RAVA 3OXSB 3VG0H 3IDNB 3LIZL 4KMQA 4HV8B 1KPVB 4G8GD 4DW2H 1OY3B 2NX5E 1F6FB 3O4LB 1XF4A 1BJ8A 2P24A 1X6LA 3GFUA 5E4IA 1Z5LA 3T1WA 4OAWA 2FHFA 2Z8RA 4NBYB 5I8EB 5JOPE 4ONGL 4PRHD 4G9FA 1XR8A 4HHAB 1XGQA 4LSUL 1JTPA 1BZ7B 3O4OB 2E7LC 5IVNA 5F3BB 1RZJC 4OIIL 4RX4A 3KPNB 1IGCH 3I9GH 2APWA 1BD2A 4HK0B 1XMWA 2GCYA 5CBAB 5MENB 2LVCA 3MRQB 3L7FB 4RA3A 4JZJC 4H25B 3D85B 3DO7A 1TVHB 3QDJA 3KYKL 3LH2H 5JA8B 4FFWD 1UEYA 4IM8A 4JQIH 1JP5A 1ONQA 2VAAA 3BW9B 4I0PD 4O02H 1FL5A 1P7HL 4ELME 3GJEB 1CR9L 4LU5L 5ALCH 1OAZH 3MREA 4PLKC 1HHHA 1IGML 1I7TB 1V8HA 4LLQB 5TPWH 3PWLB 2PYEA 4BSJA 1R5WA 1F4YH 4DGIL 1I3GH 4JM4H 3MJ8B 3RFZC 4G5ZH 5C3TA 3LV3A 1H5BC 4LHUA 5CFHA 1EBPA 3MA7A 4ODUA 3OTTA 3TBWA 1F42A 4M1DH 3QXAA 5F1IB 4KQ4H 1G7IB 5GS2D 3U48A 2R23B 3LQMA 1CD8A 3DX6A 1SBSL 4CMMA 4H0IA 4WI4A 2LAAA 4OLWL 1FNFA 1KJ3H 4A6YH 1JRHL 3KXFE 5E70A 4EUPA 2O5XL 3OJ2C 3CSYB 1NDMA 3NIFF 1HEZA 3QCVL 3NCYS 1FLRL 5E1AA 4UILH 3ARBB 1BEYL 3I3BA 3MC0A 1NQBA 1T1YB 1BQLL 4IIQB 1YEEL 3DX9A 4QXUH 1IILE 2FD6L 1GYAA 4R4FH 3VRJA 5FUCE 2Z31B 5E9DB 1JPFA 3F6LA 3QQNA 5A2JH 5IMKB 4KKBC 2PW1A 1JUFA 2A38A 3IVKB 3HZYA 4C4KO 4BZ2L 1OTSC 3OAYK 2NYYD 1INDH 3TV3L 5L0QB 1ZHNA 2ZUVA 1G6RA 4LSRL 1S7SA 2XZCH 4RRPA 4MS8C 5J13C 1AGEB 4POYA 2YMXL 2OK0H 1KG0A 3QPXH 1A6WH 1IQWH 4KKCD 1R5VB 1FBIL 1NL0L 2MKLC 5HDLA 4JFYA 1DVFD 4C55A 4N0YL 4PJEB 1FZKA 1MIML 4JO4L 3CDGB 2FIKB 3EGSA 3PWVA 4YFEA 2EXYC 1YJDH 5CWSB 1FL3A 4I9WE 3WJLA 1NEZG 3PWPA 2CRIA 1J10A 1XF5B 3FO9A 5C0BE 2JB6A 3KLSA 1QR4A 1EFXB 3NABH 4KTDL 5L8LB 5DA0B 4LASH 4TVPL 4PJAA 3ES6A 4OKVA 4QWWD 4DQOL 5JHDA 2VLRD 5ESAA 1S7VA 4OQTA 3C09B 3TFKC 4JPWH 3NTCH 4NUJB 4GAGL 5EUOE 4Q6YA 3BHBA 5CD3A 3Q6GH 1CD1B 1IGFH 4NQTA 4J3TA 2EDLA 2HP4A 3UTQA 4M1CC 3FONA 3EZ8A 3X11B 4Z76B 4ONHB 2VLKE 4Q97A 4KUZL 1XGYH 3FT4B 2F5BL 2YRPA 4L3CA 1QSFA 1RZGA 4QCIB 3T2NH 2FL5B 4F37K 1E4XI 2EIZB 3C8KB 2UV3A 4CAGA 3OX8B 1FNGB 4OF6A 4YHPA 2IQ9H 4NWUH 5M95B 1QLRB 8FABA 1L4IA 1FYTB 4Z77B 1YQVL 4CU7A 4KGLA 4M5ZL 3B5TA 4OKDA 1T0NB 4JGMA 4NRXB 4QHMA 3HG1A 1Y0LB 3GRWH 5EOCH 3FT2A 3RVTD 3WSQL 1J8HD 2FBJH 3SDCD 1HKLL 1T1WB 2DWEA 2APBA 5CHNA 5T1MB 4GOSA 3PHOA 5TFSH 4UU9B 3DIFB 4XX1G 1QOKA 3BEWB 3QUZB 2CLVA 2WMPA 4PBVC 1J88A 4WIQA 4GSDH 1RUQL 2JCCE 5IROC 5E08L 4NO3A 4I3RH 4Z7QE 2IPUG 3GHEH 4UDUA 4PJGE 3PWUB 4WGWB 5FO7A 3BESR 3WKML 1KN2L 4M7LL 3JXAA 3KLHC 5EO9B 3OKMB 1VEPA 4X99A 1VADA 4PJFE 3UO1H 1JGEA 4PB9L 2ATPB 4ZQKA 5IHUL 1RZIB 3GSXA 4KTEH 1JCKA 2KPNA 2BSSB 3BDYH 4MDIB 4XRCB 1A3RH 5JPMB 2E5EA 4P5TB 5I8CB 4AH2A 4YFDB 1H8NA 4NYLA 4JFPA 4N0FA 1QA9B 2ZKHH 3TZVB 5L7XL 1PZ5B 4KVNL 5DEFB 5TQ0H 4HKZB 1T66D 5D7LA 5IMOB 3HR5B 2VSCA 3CVHH 1BFSA 2DQUL 1G7JA 3BPCB 4ORGB 2X4UA 3X3GH 2VLLB 2GUOA 1ZA6B 5EU3A 2ZNWA 3NA9L 1H3TA 3PIQA 2OTUA 5A16B 1JGUL 4RMWA 4XP6L 1L7IL 2HG5A 3I02B 4KKBD 5DJAA 3GM0A 1HHGB 1UCTA 1XIWB 5SWZA 1OTSD 3AFLA 4PJIB 1T0PB 1T5XB 4HD9A 1L0XA 4LLMA 4C59B 1SM3L 5CSBA 1WIOA 3HC4L 4GFTB 1HSBB 3PQYA 3O3EB 2O5YH 1FVDB 5GGRA 1L9NA 3VXSB 3S36X 5IWLC 3VGHA 3SPVA 3IJHA 1HXMB 3L3OB 3HAEB 3VGBA 4O2FB 2BNQA 3ZL4H 2EC9U 5MEOB 3QNYA 3BD3A 1M6OB 2XZZA 4MZ3A 4P46A 4U2YA 3W2DH 1JHKL 2EXYD 3CFJB 3K80A 3CPLA 3CH1B 5DQJB 2P5EA 1JNNL 4OZHB 2F54D 2I60L 4UNUA 1FV1B 2V2WB 1DQLL 5DF0A 3GSWB 5TQ2L 1VENA 1KGCD 5F7KC 3RWHB 3WS3A 1FCGA 1S9KC 1SJHB 5HHME 3NGBC 1INQB 3RPKA 2EE9A 1RK0B 4QHUA 1UZ8B 4DK3A 5I16B 1FVEB 4EXKA 1RIVH 5JA9A 1OF2B 4EI6B 4PJ8B 2NW3B 3TVMC 3Q3GB 4YIQA 1H3UA 1ZT7B 4OSUL 2F53D 1U8JA 5TE4H 3UEZA 3ULVC 3QJFB 5DFTA 3RX5A 4MD4A 4RFEB 3GMLB 3QWRD 5DD1L 1IQDB 3EDKA 4Y4HC 3VA6A 1P2CB 1Q0YH 2CO7B 2DI7A 4FTVE 4UT6H 2V17H 1CU4L 5DWUL 3S35L 5IB5B 1CGSH 5D72H 2NY0C 3OB0H 3QI9A 2X7LA 2CO6B 1AE6H 2NCMA 4FFYH 3KG5A 3S3PA 4ZTPH 4OZGB 3RUGF 2OBGA 4K7PH 4IOIA 4KJYB 4JKMA 1TCMA 4X83A 3TIEB 1NC4A 4QRPB 3UJTL 2NX5D 4X5XA 5C2UB 4C57C 3DURB 3IXAB 5FDWB 4HLZH 1GAFH 1HDMB 3HA0A 5KVMC 5GGQL 4YR6B 5E56A 3NCJH 5DMYA 2XN9B 4MQ7B 2DQDL 2VC2H 3JUYA 3BI9X 4PFEA 3T09A 2ZZUT 3QFJE 1E4XL 1U8QA 2OJEB 4LSSL 7CGTA 5J6HA 4PG9A 3V6ZA 3EFDL 5T3XD 3G08B 3T0EB 1UB6A 3KLHD 2I9TB 1DANU 1L0QA 5ENWB 1IC7L 3UTPD 3FCTB 4GG6A 3H7BB 3MV7D 3KHOA 4IRZH 3F12B 2NNAA 3UTSD 3HRPA 3C2SA 4XPFL 1CVSC 4Y5YB 5KSBF 3ZDYE 3LEVH 1JPTH 1MEXL 2DQFB 3JV0A 4JFOB 3KPOA 4ETQA 1MFDL 5J12B 3OF6D 3BEVB 5EUKA 3SO3B 5DJ2B 2ZJSH 3D1MC 2XWBA 3V6BR 5B39G 4KH2A 4U05A 1RZ8A 1PYWA 4NM4L 4M7JH 1ZANH 1A3LL 5FYJE 3DHJA 1NFDA 4MGXA 4UINL 5DK0B 3RY4A 4NHUA 5HYSG 1ZGLB 1UA6L 1A9BA 1DUYB 5DZNA 3STLB 2B0SH 4MA7L 2XA8H 4ZSOE 4M62L 2QQNH 1FGVH 3ZKQD 4HGMA 2VDMH 1QBML 1IC5H 2W9DL 4M6NL 3KXFD 5EOTB 1U2HA 1DQML 4GKZA 2XTJB 4PP2A 4NHCL 1IMHC 3KPTA 2E9JA 1FORL 2ICWA 2MJWA 5F7EL 3TO4B 4GW1B 5DQDL 1BZ9A 3P11L 5K9OA 4PJHB 1KLFA 2BVQA 3U6RA 4HIHA 1PKOA 1LK2A 1QPXA 2PF6A 3QDGB 4S1SH 4UV4L 3PP3H 2DBLL 3NCCB 4F58L 5TGBB 2VR5A 2WBJB 1KB9K 4AT6A 3GBLA 4W4OA 1SYSA 3QRGH 5LQBH 1T7WA 5CEZL 2UYLB 3MNWB 3LRHA 3NPSB 3JWDH 4HT1L 5LAXA 4NNPH 3VFOB 4TOYH 4WW2B 3QIWD 3U0PB 1DCLA 1FZMA 5DD5H 1AHWB 5DJ0B 1UM6H 4PRIA 1JK8A 1QR1A 1S7UA 1VACB 5I19H 1DQDL 5IBLC 3V4VH 5H2BB 3LSOA 2Y36L 1UCBH 1UZ6E 4PJBE 4ZFGL 5F9OH 2AK4E 4U6XB 4HFWA 3WHXA 4X7FC 4U1SB 1YEJL 1T04B 5DHXB 1J0YA 5IW1B 3IGAB 4J8RA 5SX4I 5F7LB 5C0CE 2X40A 3CMOH 1HCFX 5KSAC 1UVQB 3QUYC 4P23A 4GO6B 4F7EA 3VGEA 1FFQA 3TVMD 3QZWB 2CSPA 2APXA 4I9WD 1YY9C 3FFCE 1AIFB 3IFLL 1UXSB 2E7HA 3WFHB 5LCVL 4JY6A 4X6FB 3QSKB 1K3IA 5KVEL 1MQ8A 3L5WA 1C5DB 2B20A 5E2WL 3ULVD 4U1GC 3CJJA 4I48B 4V1DB 2B2XL 4JG1L 2B4CH 2DQJL 2WIMA 4Y4HD 2Z93A 4GQPH 4F9LC 2MHAB 1U58B 3C5ZD 4Z78B 5GZND 5I1LA 3BZ4B 2HFEA 3BP5B 5IKCA 1YEKH 4TNVF 3WIIH 1IE5A 4WDIA 4Y19A 4XPTL 4WI5A 3VFWB 5JORB 4WY7L 3BP7A 4L1DA 1B3JA 3MYJB 4QNPF 5FHAL 3WFZA 4K8RH 3INUH 1UM4L 4GAJL 1ES0A 4H8WL 3MRRA 5MEPB 4YUEH 3B9AA 3NZHL 1A1MB 1YMME 3LN5A 1BIHA 4ZG1A 3TPKA 4LSQH 2FB4H 4ZUSB 2DICA 4U2ZA 4BFIA 3O6KL 2ITDA 4M6MH 2NY4B 4EN3B 4MA1C 4GLRH 2Q8AH 4RGMC 4RAVB 1FLTX 1U36A 1JL8A 2EYSA 3I50H 4WV1A 1GSMA 2OZ4A 1TLKA 1J0KA 5H37H 5DUPH 1C5BL 1AQDA 3CSGA 3OXRB 2OLDA 5C0AA 3DRTB 3F7RA 5IEKA 2VTFA 2Y9RT 4LCCC 2ESVA 3TNMA 1LEIB 4KJQC 3WFCL 3SGEH 2EIEA 1IFHH 4HUMB 5K9KB 2FX9L 1YNLL 1XGQB 3SCMC 2AJXH 5HHNB 3MQIA 4XTRD 1V7ML 2Y06L 3P9LA 3L5IA 4LCUB 5CKAA 1NC2A 4DGVL 2M2DA 1KENL 2AAVA 3WE6A 2GCYB 1A1NA 4NCDA 1J12A 4F7CA 1D6VL 3G6JE 1I9JL 3RVWC 5M7QA 5CCKH 2LV4A 1TENA 1W0WB 1XZ0B 5FO9B 1A6UL 4OGXH 1EUUA 1F13A 3VRIB 6FABH 1ONQB 3BD4A 3QDMA 3O81A 5DA4A 2CR6A 3MBEB 5FA4B 2VABA 1TJIH 4YHLL 2ZOKB 3FL7A 5D71L 2W38A 3UC0H 2D03H 3MREB 5I74C 1HHHB 2DQTH 3TN0D 4PYGA 1MFAH 2GW5A 3AXLA 3FQRA 1R5WB 3C87A 1ZLWH 2WINB 3LV3B 3AREC 3OJMB 5DK2A 5BZDA 1V05A 1M7IA 1WC7A 5DEGB 2LTQB 1D6EB 4APQC 1BF2A 4LOUC 5T33L 4D0BA 3D3VE 3BSZH 3MRCA 4GXVL 2VLJB 4NKQB 3WJJA 3MJGX 4LVHB 2AXHA 4LPYA 3V5DA 1JZ2A 3U9UA 4EUPB 1MPAL 3VXME 3GKWL 4IMKC 1NDMB 4L9LA 5CIPA 1E0OB 1AFVL 4HWZB 4NC0B 1AY1L 2QQKH 3KYOA 5D7IE 2QSVA 5JW4N 1NMCC 3QXDA 4QOKD 4L4VA 2R0WL 1Z2KA 4S1QL 5E6IA 2WP3T 4NJ9H 2X4RA 4D3CL 3VCLB 2BERA 1JPFB 4JQVC 1G84A 4HUVA 2P8PA 4ODBD 1I8LC 5C07E 3ECBA 2IAMA 4YFLI 5AEAA 3OB0K 4AYFA 2NY7L 1MY7A 2QEJA 5IW6B 2H1PH 3VXUE 1NPUA 4KY1H 4WFEE 3MLVH 5JW4R 1DLHB 1KTDA 4JR9H 3ZDXF 5DC4B 1JGDA 1FSKC 4X6DB 3IFPA 5JW5B 3P73A 2YR3A 4FQCH 2A77H 5EZIH 3T4AB 4KI5E 3GMPB 3RWEB 4P9ML 3PDOA 4PJ9A 2HJKA 1FL3B 1YEIH 4TQEH 3MROA 1A14H 3FQXB 2YRLA 1JNHA 4M93C 1F6AB 3PWPB 2DWDB 3G04B 3QHTC 4KGJA 2JB6B 1H3VA 3QEUB 3BH8A 3MRLA 4IRSA 3UYPA 5HJ3B 3S34H 5I17B 2DQCH 2VXVL 2Q8BL 1IBGL 1JZ3A 5K59E 3KPSA 5HGBB 5JHDB 2IAND 5DS8A 4DKEL 1H15A 2AJ3A 2V7HA 5F9JB 5I0ZA 3GMOA 4O4YH 4WCYH 1ZTXH 2VLME 1GGBH 5F6IB 2O61B 1A7OL 1K8DB 3S4SA 4F2MB 5I75C 1CXEA 3L6FA 1P6AB 3FONB 3L5XH 4X98B 5BOPA 1RZ7H 3HI1A 3O2VH 3KPPA 3PXJA 1MCWW 2JB5L 4P57A 1RZGB 3R06B 4KQ3L 4MDJA 3CVHA 1YNTA 4P5KA 1G6RL 4WO4C 3HNVH 5AG9A 1P53A 3VFSB 3WFEL 5I66B 4XNUH 4PJAF 1XGTA 1RJLA 3BRGC 1MNUH 2CLZB 3BO8A 4X5WA 4XVTL 4ZPTA 3W9DA 1LP9E 1XGUB 1DVFA 1X5JA 4GBXC 3ZLQC 4MWFA 1S7WB 1U8NA 2P4AB 3RVWD 1M71A 4FOMA 2OR9H 4PBWD 1CE1H 4DAGL 3RIFK 1OCWH 1EEYA 1MUJB 4Q9CA 5SV4A 5F1SA 1OD9A 2QQLH 4FQLH 4HQQL 3L1OH 3RGHA 1SVZA 4EJ1C 4O2EA 1UWEL 4OLZH 1CD9B 4XMKH 2BY0A 1G9NC 2BCKA 3CC5A 3KPRA 4U6VH 4LRIA 2J7LA 1D5MA 5IBTL 3MRKB 1KCRH 2ADFH 4XP5L 2D9CA 2VLRA 3ZYIA 1NGPL 3P4MB 2K7QA 3LS4H 3N85H 1K5NA 1OSPH 5BJTA 2Z35A 4OQTL 3BWAA 4P2OC 3RDTC 3GI9L 4XWGH 5HHOA 1N26A 2VXTH 1S5IL 3JWNC 1OAUL 2EYTB 4PLJD 5GRYA 3VXPA 4AH2B 2YWYA 2FO4B 4LOUD 3LPGA 4RQQA 3D39B 3TBYB 3EO0B 3RL1B 2ITCB 2KQMA 4PJDA 3EYUH 1DBAL 4OCWL 2ZG1A 4JGJA 5AD0A 4E41D 1U3HA 2X05A 3U83A 3VD3A 3GSNH 3V6OE 1IC4H 3ROOB 4PJ7A 4K94H 3D69B 4XVUC 2OTUB 3MLXH 1P5UA 1J8HA 1U8PB 2C4XA 5KANI 4H88L 3HNTL 1D3CA 4DOHE 4DZBB 1GC1L 2KQNA 1WZKA 4CVUA 1ZK9A 3BAEL 3N0PB 5DJAB 3IB4A 5D1ZC 5E2UH 4QY8A 5KZCD 3CLEH 4KROC 5ISZE 1NGWA 2NXZD 3I75B 4M8VA 2DM3A 3H9HA 1MJUH 3IKCA 4LCWB 3PQYB 3TWCL 4PJ5D 4NZTL 2DRUA 2H41A 4X6CE 1YYMH 2VZOA 2EDYA 4GRWH 4N8VG 5HYJE 4Z7WA 12E8L 3QEQA 1JPST 1AH1A 1LO0L 2OTWA 5B8CC 1F4XL 3TT3L 5FEBA 3MNVB 2H6PA 2MWCA 5KVGH 1DE4B 4WNQB 1AO7B 4G6FD 4AK1A 4IHOB 4RMSA 2A9NH 2BNRB 1KSRA 4UT9L 4H0GA 5HI4C 1EO5A 3JTTA 4KK8D 5FK9A 2J6EH 3VE0B 3WLBA 5C0CD 4MHHI 3SDAC 3T3MF 2CD0A 1ORSA 1W2KT 1WTGT 3PL6D 3MODH 3VH8G 1MFEH 3HZMA 5GZOC 2ICWI 5D5MA 4JKKA 1GRWA 1JMXA 4KAQH 1VGEH 3HC0B 5DMJB 4QRSA 1BMGA 4Y1AE 1KB5A 3MGTB 3HE6D 4NNXA 5A40E 1DBKL 4XC3H 5GSVA 3IU3A 1NGXA 3NIFE 4MB4A 4XCCL 3Q5OA 4R4BB 4DVRH 4JM2A 1YN7B 1DQJA 4KKAC 3RNQA 3LD8B 4YDKH 4MD4B 4CVXB 2XXMB 1CXKA 3MTRA 4KU1A 1FDLH 4PGBA 1F90H 3MJ9H 3U0TA 4X6BA 5AZ2H 2LAGB 4I13B 4M5YL 1KT2A 4XNZC 4WO4D 5DRNB 4XPAH 3BT2L 1LO4H 2BVEA 4YGVA 1TZGH 1HN1A 3OR6A 2Y5TA 1TZIA 1S9XA 3EOTL 3O41B 2CGRH 2ICCA 4E42A 4U3XA 3UZQA 4CJ1A 1ZLWK 1KIPA 1A2YA 3EJYC 4HWEL 1ZEAL 3DGGB 2PO6C 1U6AH 2R29L 2MPAL 1EHAA 1EEUA 2BK8A 2F54A 1OD7A 4YBLB 3U0WH 4GRWB 4IS6A 2Q76B 3H0TA 1CXFA 3UYRL 5D1QD 5I1CL 5D70H 5FYJH 4U6HA 3D9AH 2DL9A 1D5BB 2AERT 1U8OA 1KJVB 3B9KA 1NAMH 1AGBA 4HSQA 1N3NB 5IHZA 1J0JA 1EGJH 4MYWB 3VA2C 4F37F 1KV3A 3FAWA 1M1SA 1IVLA 1U0QA 2H2PD 3ARGB 1C16A 1WFNA 4JRXB 5GS1C 4KRPC 4ONFH 3RDTD 4YBQC 1BFOA 1OSZA 5FYKL 1Z6JT 5HHPA 4ZFOA 2IWGA 4YDIH 4N0UB 3RZCB 2EXWC 1E28B 4JRYA 4HBQA 1S78C 3KPOB 2JJSA 4TSAL 4U1IA 1N64H 1SMOA 4XC1L 1E4KA 1JE6A 1PYWB 5IB4B 4Z7NE 3B3IB 5EIIA 4RA0C 1GIGL 4JRWA 4G80B 1BBJB 1CGXA 3O45A 1ZS8A 3LKPB 4H5SA 1F3JA 1DN2A 2AABH 2GTWB 4NHUB 2YSSA 4Q2ZB 3UPCA 4XVUD 3IJSB 4PRPE 4FQXC 2HVKA 5DQ9B 5CS7A 1UENA 5KS9E 2O5ZL 3DUSB 1B2WL 4XGZA 2CJUH 3PE9A 5D6DA 1AXSA 5I1DA 5D1ZD 3D3VD 1ZGLP 4E5XA 1GPOL 2A6IA 4KROD 3U4BH 4J4PC 2NX5A 4MAYD 1KJMB 1UJ3A 2FATH 3FMGH 3VXMD 1CDIA 5JW3L 1NANH 2ZPKL 4DJMA 1LEGA 2EO1A 3MLWL 5FUZL 5K9OB 5JPNA 5ICYB 3RWJA 1UYWH 5BV7H 4ZO7A 4HH9A 2I9LA 5IB1A 3U6RB 1AI1H 2ADIB 4LCYA 5IP4A 1YEDB 1QRND 2R56L 2LABA 2RCSL 2I07A 3MSPA 1I8KA 4NFDA 4HFUL 3BP6A 4OI7A 4FFZH 1FL6B 5LAXB 3HMWL 4P9HL 1PLGH 3IDIB 1QLEH 4LVEA 4HLJA 4HJ0D 1MCRA 4R2GD 1HSAA 3SDAD 4O51A 5IT2L 4X0KB 1NAMB 3CCHB 2BRRL 4P59H 4L4TB 2HN7B 1R3LB 3IT8D 4YPGB 5GGSA 4ELMA 1CFQA 3OF6A 3RWDA 3LPWA 1LQSR 1F5WA 3IDJB 5J3HD 4WFFE 4DKFH 2KL6A 3GZKA 4EVNA 3CXHJ 5KVDH 3SKUD 2A6KB 4NQDD 5DJXB 1AQKL 4AENA 4WFHE 1T2JA 3RX8A 5FHBH 4E0RB 1V3MA 3GKZA 1M05B 4M8QA 1AGCA 2FJGA 3UZEA 4EDXA 1IEAA 1YC8A 5TE7H 1LO5A 3GSQA 1SJEA 1UXWA 4LSTL 1MHHA 5EORH 1I7RA 4GUPA 5FF6A 3KXFA 4X8XA 4RDQF 1VGKA 3V5HA 4OJFL 2VITB 2YZ1A 5SWSE 5I1LB 4Q7DA 4Y8DC 4OLXH 2HFEB 5CMAB 5IKCB 5D7JB 2XPGB 5EIQA 2B1AL 1QFUH 2DLFH 1MHPL 4XT1C 1SY6H 5ID1B 4N8CH 4MA3A 3RRQA 4XWOD 4PRBA 1HYSC 2X4QB 4Z7UE 3VMPA 4PBXA 2RJMA 3PP4L 3JVGA 3VXNB 2R4RH 2NY1D 1BP3B 4P4KA 5KOVC 2IFFH 2WWKO 3TC9A 4JGUA 3QIUC 4J6RL 4MAUH 3IDXL 3OJVC 4WI6A 2V5RA 4WUUD 1YDPB 3DMMB 3ABZA 3D5OF 3VG0L 3SDDC 4M7LT 1JF1A 3H9YA 1IM9A 1KTRL 3TO2A 4DW2L 1S7QA 2JKXA 1YEGH 3ZTJH 3CU1A 1AQDB 5EIVA 4R7DA 3UPAA 2A73B 4XP1H 2CIIB 1HIML 5IEKB 5CZKA 3RTQC 3AM8C 4XHJC 2VL4A 5E00A 2YRZA 1IKFH 5GJTH 1ZT4A 1DDHB 4K7FB 4R90H 1IL1B 2HKHL 3QG7H 2EXWD 5C0BA 3H9SE 1A6PA 4PYHA 3ARBC 4P2RD 4ZFFA 3I3EA 1JWMA 4LHUG 5DO2D 5KN5A 4IIQC 3MXWH 1UGNA 4HBCH 1N4XH 3HN3A 3C5ZA 1IGYA 4Y5XA 2BOBA 3LEXA 3OR7B 5EO0B 4XZUA 1V7NH 3BWUC 3AB0B 1IAKB 4JQIL 2CMRH 3VFVA 3SQOH 5EUOA 3ZKSD 4O02L 5DZLA 2VABB 2XV6B 1I7ZB 4D9QE 4FQXD 2H9GA 4G7YH 5ALCL 1MHEA 1OAZL 2J3SA 2VDLL 4U1NB 4I2XE 5CEXB 3BKMH 3B2UD 2VLKA 4RNRA 1MJJA 2E8ZA 1U8KA 2AW2A 1F4YL 3FOLA 4J4PD 2F74B 4JM4L 2D7QA 2DS4A 3GNMH 3QDAA 4OCNC 3CFDA 4PTTA 4R7NB 4UB0H 3RUGE 1OAYH 4Y16D 3S35X 4NT6B 1HHKA 4KQ4L 1BLNB 5CLTA 1V5JA 4G8GB 1AD9B 1KJ3L 2OZ4L 3V5DB 5CJ5A 1C12B 2X1PA 4XMPH 1CLYL 1NLBH 1KACB 1TPXC 1MCQA 1RUAL 4L9LB 5EBLA 2EDBA 5DGRA 3KNBA 3T4YB 5TE6H 3MV01 4PRHB 4WJ5A 4ELKB 5ISZD 3FT3B 4TUKH 4UILL 4PP1D 1DP0A 3ULUC 2F8XC 3WDIA 1RFDL 2JCCA 3LCYA 4QXUL 3TM6A 2X4RB 4P3DB 4I18B 4JQXA 3BKJH 4UAOB 3MLPA 3K4DA 3PDDA 3UJJL 2NY2D 1EEZB 5HYJD 2E6QA 3VXOB 1MI5D 4PJGA 5IV2B 4MNQE 2YPLD 2VB5A 2XZCL 4YWGH 2AK1H 4Y8AA 4PJFA 4FZEH 4MCZB 4I0PB 2UZYB 1MAMH 4DK6A 1MWAH 4B50A 2OK0L 4WTZG 1IQWL 3ALWA 2YD3A 5BZWB 3MLUH 3TN0A 4F15B 5CGYC 3O6LL 3GJFH 4OGAC 4DVBA 4JVUA 3OKLB 1GOFA 2X70B 1U9KA 3MR9A 3KPQA 4OIBA 4QHKJ 2AXFB 2C7UB 5JO5A 3WHE0 3S88H 5E7FA 1OARH 4MXWL 1ND0A 3IDGA 4JN2A 4Y1AD 4HUXA 4CW1A 5C09D 4KWUA 3HUJB 2D7MA 5J7CC 1ULVA 1HYSD 1OGTA 4G6KH 5FKPA 1PG7W 4TSBH 4YHNA 4CVZA 5LJYH 3FRUB 5ACMA 5JOFA 2HWZH 4PJIF 5BRZD 3SEPA 2PKDA 5LG1A 3ARDD 2E9WA 2V7HB 3BQUC 4JPWL 2XWJA 3NTCL 4L8DB 2P5WD 4N8PA 4BQCA 1EHLL 4OUUA 3Q6GL 3F7QA 4YAQB 4QF1B 4QOKA 4X80L 3FFDA 4ZODA 4Z95L 2VQUA 5FECA 5EZJA 1NCTA 1RZJH 3SDDD 1VEOA 2OCFD 3CSBA 4HEME 4OFDA 2MNUA 4KC3B 1T80A 2DQGH 3DETC 1S9VB 3GSNA 4P5TC 3A6BL 5DHVH 3DVGA 3L3KA 3LKOB 4P5KB 1A21A 3TZVC 4U1LA 5CP7B 1QNZL 2I24N 4MJ2A 1HHJB 1UT9A 5EOCL 3IDMA 3NIDF 3OJDA 1DVFB 2EKJA 4DZ8A 4GKNB 3L95A 1UH3A 3WFDH 4N0RA 3BXNA 5HYQB 1FQ9C 4KJWC 2CIKA 2YD6A 2Z92B 3PGCB 4OLUH 2YUWA 2NXYC 4MJID 5GGVL 5E5MA 5GIRB 1IEBB 2DTSA 1EEYB 4KRLB 1SEQH 5EC2A 3QA3A 2H26A 1Z3GH 2AI0L 4GSDL 1T7YA 5F89A 1XIWC 1DJSA 4NCC2 4HZLA 5HI5C 5AUMB 3GHEL 4YZFF 1VHPA 3EYOA 3CMGA 2ZOLA 1BREA 4Y4FA 1U8LB 3WD5H 2VLRB 1WK0A 1G7MA 4HS8H 4NQVB 1FN4A 4WI7A 3UO1L 2Z35B 2ERJB 5J1TC 5C1MB 4XNYH 2A0LD 4JFHE 2VQ1B 2BFVL 1H8OA 4KTEL 3RKDC 4FTVA 3V9FA 4KHXH 5HY9A 1CFNA 2A74A 3C60D 4JFXA 4ZDHA 3QISA 4JVPA 3IYLW 4EXPX 4XBPA 4F33A 3W0WE 1NBZA 4KMTL 2HLFC 4JJ5A 2CK2A 3OKKA 1FJ1B 2R0LH 3VWKD 1DBJH 5GS0D 5L8JB 1YUHA 4X7SH 1E4JA 1FFPA 4XCFL 4LEOB 3CVHL 3P4NA 3X3GL 4F80A 4ZXBD 3PV6A 3LKSB 5AYUH 4J3VA 2ZG2A 3PGFH 5HDQH 1EIBA 5KSUB 4FXLA 1CS6A 3MRBB 1J8HB 5E99H 3CFIC 3FKUS 5T5FH 1C8PA 3SDCB 4L8CA 5BQ7B 4UQ3B 1A9EB 1RUMH 5DHVB 4QY8B 1BVKA 1QEWA 3MJ9A 3QFDB 3IJYB 2N7BA 5F93C 5IOPA 4LFHG 2P43B 2O5YL 4MXVF 2DYPD 1MRDH 4RMUA 2R8SH 3B2VH 1ZT1A 1XAUA 5C0GA 1MLBA 4PJDF 2HFTA 3AMLA 4KDVA 1ZV5A 1QSZA 5CGYD 3HZVA 3U4EA 4OGAD 2R1WA 2J8UE 4PJ7F 3L5JA 4NQCE 3BIKA 2XZAL 3AS0A 3UMTA 3W2DL 2VERN 4M7ZB 3I2CL 4M7KH 2YD1A 5KG9B 4RWYH 1A0QL 1RK1A 4QRRE 5T5NF 4CADB 1A7PL 5B3JE 3V4PL 1CZ8H 2VDNH 3CFBA 3QNXA 2BVOA 2AXGA 1MCFA 3O2WH 4XXDA 3WIFB 4LLWA 4ZSOA 1EGJA 5CINH 2HT2D 4OLVL 1S9YA 3BQUD 2K7PA 2GJ6E 1RIVL 3ZZ1A 1FZOA 4JAMA 5FYJU 1VERA 1MF2H 3MRIB 5SWSD 3U2SA 3RU8L 1RVFL 4GJTB 2IADB 1LE9B 1DEEA 3IFNH 1K2DA 1S7RA 1JN6A 4KVCL 1LDPH 4NKMA 4WUKL 3DETD 3SO5A 4YEEA 2H8PA 4PGBB 4P2QE 5JHLL 2P8MA 3Q5TA 4UT6L 1P7KA 2Y6SC 3EJJX 4GW4B 1HH6B 4UTBL 5J13B 4PV8A 3UX9B 4PJCE 3F8UB 4PUBH 3AROA 3P0VL 3SO3C 1D5IH 1CGSL 1FFNB 1TZIB 5D72L 1HQ4A 5D5MF 3MO1B 4NPYB 1PY9A 2G2RB 3QNZA 3GI8H 1KEGL 4F7MB 4ZTPL 4K7PL 4KDTA 5C08E 3CAFA 3MCKB 1I3RB 5ANMB 4KJWD 4DGYH 4JANA 5MI0C 4PJBA 1NAKH 3QIBA 2AK4A 5E8EA 1NCUA 5T3XH 1QHPA 2AQ3A 3P0YH 3SDYH 3DRQA 2CUMA 4JM2F 4GRMB 2VO5A 4Y7MA 4ISVA 3S96A 5C0CA 1MCPL 1QSED 4X4YA 3A6CL 2YUXA 4P2YA 1KPRB 2FHCA 2BXZA 4GKSB 4WHYH 2VC2L 2XTJC 3FFCA 4JB9H 4AEIL 4JO2L 2WUBH 1KBGH 2XQBL 3TO4C 3HC3H 5CILL 3H9SD 1S8DA 1HILB 3O8XA 2ATKA 3RX7A 3SKNB 1C16B 4XMLH 1NBVL 4H8WC 3HE6A 4QXWA 3SDXE 5JIPA 4BSVA 5JLZA 2YC1B 1Z9LA 2P42B 1KB5L 2WBJC 3RKDD 2YPVH 3MRJB 1R3HA 4Q0XH 5JIIA 4MQXC 4K55A 3LS5L 4OBSA 3VWJA 2WUCL 2F53B 3LEVL 3NPSC 3BH9B 4MHHG 4IRJA 1JPTL 3FHQA 2HLFD 4PRNA 4WW2C 1B9ZA 5I8KL 3L3HA 3HMXA 4D9QD 2FYYB 3VJ6A 3R1GL 2P47B 2CPCA 2ZJSL 5GPRA 2Y07L 1TVBA 1YMMA 1ZANL 2MTPA 4X9IA 3GJFK 2C4FT 1EXUA 3JWOC 4JN1H 3BZFA 4X4XB 3RIAK 2XA8L 4UIMB 5DFVC 1FGVL 2ARJB 1DEDA 3C6LD 2XWTA 4RDQG 1J1PH 1DN0A 3RVXC 2BY3A 1I9RH 5E8PA 4CN1A 2PW2B 4NOBA 2ADGB 4LPWA 3MLRL 1A7RL 1INEH 4J1UA 4OI9A 2VZSA 1WFUA 1G0XA 1ERNA 2CR3A 2IG2H 3LKRA 5D1QA 1C1EH 1CK0H 3MMEB 5JW4Q 3F7VA 4UIKH 5JPNB 1IEHA 1Q9WA 2J88H 3OG4B 2ORBL 1GGCH 4W4NA 1ZA3B 4JPVH 2VZVA 3OKOA 4YXKH 1S9WB 4OZIF 5DSCA 2JIXD 5SWQB 4GRLA 2BSRA 3T77B 1NBQA 1I8KB 3U4AA 3QRGL 2MSPA 3G6JA 2AEWA 2UWEB 3BP6B 4HMDA 1OTUC 3MV7B 4OTXH 5LQBL 2D7PA 5INDB 3JWDL 5E94B 1NUNB 2VDPH 3OWEA 4NNPL 5KSVB 3UTSB 2C3WA 3MACL 5F7DB 5I9QC 5T3ZH 4ZFOL 1MFNA 3CDCA 3DUUA 5I19L 2NY4C 3ARTA 2NY3C 4L5FL 5F44A 3V4VL 1I1AD 2BSTB 2C5DC 1UCBL 3DV4A 4ODVH 3TA3D 3BE1H 1R3JB 3G5XB 1OP9A 2GSIA 3NZ8B 2W07A 4RGNC 4Z8FH 2NY6D 3UDWA 5D2NB 3QQ4A 2DJ4A 2D7TL 1RV6X 1FGNL 3QG6B 1TETH 1YECH 4AENB 3EDFA 3VFGL 2VXUH 2YPKA 2BNUA 4F9PA 1IEAB 4Z7OE 4W6XB 4G6JH 3D3VA 3QQ9C 2GAZB 2F19H 4GUPB 4MAYA 4XVJH 3QH3B 3V2AR 2CLRB 2X9XA 3VXMA 4ZO9A 3ARFD 1ORQA 1FP5A 2OJZH 5D7IA 4XP4H 1HYRC 3FQWA 4ELMF 3JTSA 3MRGB 1YN6B 2R1YB 1WUNT 4OCRH 2FLRT 3T1FB 3Q48A 4XCEB 5DRZB 4YC2C 3H6JA 5I1EH 3OPZH 1DSFL 5IG7A 1K8IA 2CDFA 3MBEC 1CF8H 4LSQL 2FB4L 4NO0D 3DVFA 3QIWB 4M6ML 3SY0A 4JPKH 4IMLB 1F58H 2HJFB 3VXUA 1WBYB 5IQ9A 1XGRB 3DVNB 2Q8AL 3V5KB 4GMTH 1FNAA 1DBBH 3TGXA 1S5HA 2WANA 3NGBB 4S1DD 4TTDD 3I50L 1JZ7A 4UMGA 2H32B 3BJLA 2HTKC 5DMGC 5DUPL 4GAFB 5B38B 5E8OB 4ZTOH 2LTQC 4NQED 5GRJH 3DNKA 2RIKA 2GHWB 2VDRH 3VFRA 3M17A 5L2KE 4K7PY 1IFHL 4PB0L 3V4UL 2PN5A 3TVMB 5ADOH 1KJ2B 1YY8A 3G5YA 3TH2T 3MLYH 4LIQE 3O3BB 2PYFB 3DOSA 4YE4H 3TJEH 4LHJB 4BQ8A 5LGHL 4PRAA 1NKOA 2ICEA 2K9UA 1QHOA 1IM3B 3P4OA 5HHVL 4NJAL 3QUXA 5JDSA 9CGTA 5EPMB 4Y4HB 4U1JB 5CCKL 1W72B 2Y5EA 1IGYB 3P77B 1T83A 2GITA 1EAPB 4OGXL 1DBMH 1IT9H 3KYMA 2QADC 1MWAA 3VXRE 2NY0B 2PUQT 4ALAH 4JFHD 2FSEB 4JFDD 1XH3A 4TPRH 2IBBA 2F58H 1MIEL 3UC0L 2DQTL 3GJFA 1JNLH 1T7VA 1B0RA 3NH7L 2DQHL 2OL3A 4JFQA 3RVXD 3K1KC 3FOLB 4NQSB 5HHQB 1NFKA 2EDEA 5DJCA 1QLFA 1JJUA 4HPOH 4OT1L 4FQHA 1UKQA 2A2QT 1TVDA 2J1KA 2PXYD 4Y2DA 3P9WB 3UYOD 1K9TA 5C92A 4MXQD 3GMMB 3SE8L 1RUKH 3WNMA 1BX2A 4O9HH 2CKBB 4HIXH 3BSZL 4HKXB 4BQBA 4LVOB 5KW9L 3EYFB 3WJLC 3V7AG 1LP9A 5I1GL 2QR0B 3B9DA 4G43A 2XNAB 5I1JL 2N1KA 1Q94A 2A9MH 3LHPH 2A83B 4DTGH 4ZOCA 5HYSA 4OD3L 4CN4A 1J1XH 4G8FB 5FGSA 2E7LA 3ZYOA 4NJ9L 3O3DB 1XF3A 4QHLB 5F6IC 1BM3L 2NY3D 3D2UD 4YXLH 5GGTH 4NZJA 3T2PA 2ZUYA 2HYMA 3GSRA 1ACZA 2P48B 3GMRA 4JFED 1ACYL 5TDOA 4KY1L 2IMMA 2I5YH 3MLVL 5F1OB 4YQXL 3RGVD 4JR9L 1KC5L 2AJSH 4ENED 1WIPA 3HR6A 1T4KB 4G9FD 3GMNB 4QRQB 4FQCL 2A77L 3QQ9D 2EC9T 3S4SG 3UPRB 2GEEA 4JKWA 2X9YA 4PTUA 5TDNA 5LBSL 5I1AA 2VJXA 3O4LE 1D5XB 2HT3D 4Y16A 2JCCF 3V6OA 5ACZB 1H5BA 1A6VL 5ETUB 1MQKL 3IDGB 4Z7QF 3QDJD 2D2OA 2YKLH 2DDQL 2VKWA 4PJGF 2DJUA 3ZKNC 2DQCL 2HTLD 2C3HA 3O9WA 4RBPK 1HXYB 2FEDC 4KHTH 4ZOAA 5JUEH 1I1YB 4ZAKD 3ROLB 1XF2B 1P7QB 4PJFF 4Q9QH 4Q9RH 3VW3L 1D5ZB 4UOJA 5ISZA 1OM3H 5MENE 1ZTXL 4FQQB 5IFJA 1GGBL 1LO3H 5CP3H 1QG3A 4YDVB 4D0DA 3H7LA 5I18H 5EWIL 4QOKB 4J3XA 5FECB 4C4KT 4Y4KD 4OV5A 1HI6A 2BOCB 4LLUA 1OB1A 1FG2A 4X6CA 3BGMA 3L5XL 5GISL 4J2XA 4LHUD 5DYOA 1T3FB 4NOFA 1RZ7L 1G7QA 5HYJA 2VDKH 3LY6A 5GRXG 5DMGD 3ZTNH 3W9EA 1B90A 1CFSA 1GHFH 1RZKL 3UAJC 5KSAB 5EU6D 1VSCA 4DUWA 2YK1H 1E27A 3BD5A 1B0GA 3MLZL 1TJHL 2BC4A 4N90D 1OPGH 3EW3B 1DQQA 4WU5A 2EDFA 1BQSA 5IJKA 1I4FA 5F7NC 1P4BH 1F4WL 1FFOA 3S36L 4U1GB 4JKLA 3L3GB 2NTFA 4ZUUB 5K9JH 4TUOB 4M03A 1QBLH 3I85A 4JY5L 3TEUA 5F96H 4YPJA 4EI5A 5E8NB 2AQ1A 3KPMA 1OCWL 1T5WA 2E6PA 1K85A 4OZFB 2H26B 4AY0A 2QQLL 4JPIA 3L1OL 2QADD 4Y1AA 5EFIA 2ZCLH 1ED3B 4OLZL 3K3QA 4XMKL 5DD6B 2XI9A 3EYOB 4AL8L 1F6LL 1E4WH 2YD5A 5C0FB 4U6VL 3ARRA 1M7DB 2N7AA 4HUUB 2IANB 3AS2A 3TYFA 4FXGB 1B6DA 1EEQA 2X4TA 5E9DE 5FO8A 1OSPL 1DANT 2P5WA 4HWUA 2MQ0A 1GZQA 1CDCA 4XWGL 1X44A 3TYGH 2VXTL 5T5NG 3S37X 4Y5VA 4ZDHB 3CFKB 3MLSH 4RGMB 4P46C 1PX4A 3RWCA 1AC6A 5FYLE 1CLOH 1G1CA 4AG4H 4JJ5B 3MCLH 3HLAA 4ODSH 1NGYB 5MEQB 1NJ9B 5IM7A 2QSCH 3HE7D 3EYUL 2EDXA 2IMNA 1FVCA 1I3UA 4DN4H 4ODTH 3CK0H 2VL5B 4XAKD 3QUMH 5C9JA 3GSNL 3PGDA 1FFPB 4PV9A 4TTGA 4Q6IA 2FWOA 4GRWF 4PJEE 3SCMB 3SN6N 1PD6A 2X42A 1CGUA 3EFFB 3SE9H 1N5YL 2X4PA 2AV1A 5DMKA 1J9CT 1TQCB 3T8XB 3MLXL 3SGKC 4IDJH 4F3FA 1DZBA 4WVRA 2WBWB 1SYVA 2E9BA 2AVGA 1JI1A 3KR3H 1NCWL 2HAZA 4HLZG 4N9GA 5C0NC 3CLEL 2M1KA 4MJIA 1GXEA 5BS0B 2BDNH 5J1SC 5FIEA 3GSVB 1P84J 2E27L 2PTTA 3RPIB 1MJUL 5C0JA 3SE4A 1FO0H 3HCVA 4CU6A 2A6DB 1WEJH 4R8WH 3EOAB 3ULUE 4XI5C 1HH9B 1QSFD 5DT1L 1QQDB 1YYML 5T1LA 5CJQL 4ZMAT 3RWGB 3F7YB 1H3PH 1YPZB 4PREA 1Q9LB 1QFWI 2W0KA 5ITBH 1GGYA 4HXBH 3QI9C 3VFNA 4DKDC 4MD0A 1LE5B 3X12A 3QZWG 3AREB 4M61A 1UG9A 2NQCA 3JBG7 2GSGA 4XNQA 4XCNA 3E2HC 1FC1A 3C60A 1XR9B 3CXDH 4YBHA 4YDLB 4RGOL 2KDGA 4NO2A 3GO1H 4KK5C 1X7QA 3HPJA 5D1XD 3LB6C 1FYTE 3G6DL 3MODL 3M1BB 4YBLC 1MFEL 4PRPA 4KRMB 3LEYH 3VWKA 5KS9A 4E41B 4OB5L 1II4E 3MGAA 1GGIH 2FJHA 2F5AL 3TH3T 2W0FA 1FZOB 5FM4A 4ZXBA 4I8DA 5C7XH 4CKVX 1KF9B 2GIYA 3DX7A 1NMCB 4ZUVB 4NM8H 3ZDYF 1KCKA 1EJ6A 4YHKL 3THMH 1H3XA 5ESVA 3WUWB 5F1KC 4K3JH 2R2BA 3FZUC 1JWUB 1U8IB 1WT5A 3QUMB 3N9GL 5KZCB 3QULB 5IIEA 1XT5A 1YYLL 1NDGA 2YBRB 3MV8B 3DUHA 1RIUH 1FDLL 2H8PB 2Y7QA 4OZ4A 1F90L 3FO0L 3MJ9L 5DTFB 1CGVA 1NEZB 5AZ2L 2HRLA 1T20B 3UAJD 2BVUA 3NFSH 4PJ5B 1Z9OA 4XPAL 4YH6A 5HYEA 2CH8A 3ZKMC 1LO4L 3F5WA 5F3HB 1TZGL 2IBGA 5IWLA 1NMAL 1FSKB 3U7WH 3L7EA 3IXTA 3S8WA 1ZHLA 2C3GA 1EBAA 1CQKA 3EO9H 1T0MA 2E8YA 1DQTA 3CZFA 1G9NH 3E6FA 3REWA 5HXMA 3G5VA 1MCOH 4RZCB 4HJJL 1U8MA 3VG9B 1FO0B 4MNGB 1C08B 1U6AL 1KNOA 4G6FB 4KJPD 3UBXA 4RAUA 3RVVC 5F97E 3U82B 3X3FH 3S96B 1W0VB 5DJYA 1Q9OA 3OL2A 5EOQL 2OXHA 2VRAA 3NFNA 3PL6B 5FYJL 3O0RH 2WM0A 2GK0B 5CBEB 5I1KH 3VFUA 2V9QA 5E2TH 5GRZA 5F7FA 3QEHB 2GFBA 3WL9A 5MHSE 2EYRB 1OP5H 2C1OB 2ZUWA 1EGJL 1ZVSB 3QQ3A 2ATKB 1V3LA 1KYOJ 1Q72H 3CFCH 3GIVA 3JV6B 4ONFL 5JLZB 5CD5D 2QLVB 5CUSH 5I75B 5SWSA 4RAHA 4PJIE 5DRWA 4W4OC 2IH1B 1CT8A 1U42A 4P46D 4UTAH 4Z7VB 4PD4J 1OW0A 3VXSE 4R9HA 4PJBF 1UZ6F 2GT9A 4KZDH 1AKJA 2QL1A 4Z7UA 5J6GB 1N64L 4X4ME 1VA9A 2AEPH 2L7UA 5D4QA 2X4SA 3PJSA 4LFHD 3FQTA 4WO4B 3MXVH 1A7BA 2G75A 1G7HA 3TIDB 1KXVC 1CICA 2FZ3A 2JELH 3CX5J 2AABL 1IGJB 3BZFB 5ESQB 2HT4D 4OZHE 4GBXB 5DMIH 4TULH 4P23C 1N59B 4TSCH 4NWTH 2NLJB 3QB7C 4KFZC 5EN2A 1EZVY 3RQ3A 5IK3B 3V8OA 2ZCHL 3N1PC 5C0ND 2EO9A 5BXFB 2EE2A 4R3SB 3NIDE 2IJ0C 3SKJL 3E3QC 5H37G 3VRLE 3KHQA 3C9NA 3QEGL 4OD1H 4NC1C 3ZE1E 2W60A 3ISWA 4LCIH 1V3KA 5F88A 2EDQA 5BV7L 4G8EA 4HUWA 3CZJA 4ZPVA 1RIHH 3H9SA 3GSOA 2J4WH 2SEBA 3CUPA 2NW2A 4LEXH 3NCEB 2AJZA 5FKAA 2IBZX 1C5CH 5CEYB 2YWZA 4HWBA 4P2OB 3RDTB 1PLGL 5I71C 5TH2B 5JMRA 3I84A 4TNVK 4RIRB 5EULV 4OM1H 1J18A 5ICXB 4EDWH 1I8MA 4BFGA 5C6TH 3HMXL 4I2XA 3D18A 4KXZH 4I77H 4P4RB 4HPYH 4DKFL 4OZGE 4RISH 2HKFH 3KJ6L 4Z5RB 1PG7X 2JK5B 1L0YA 1KLGA 3CU7A 5J1AA 5ITFB 1BVLA 1QFWL 4QRPE 1FNSL 5FHBL 3RUGA 1I1FB 4LSVH 1CGTA 2OMBA 4XH2B 3OAUH 3MFFB 5GGUA 5FA3A 1EHXA 1A1OB 2FIRT 3FZUD 3MRPA 2EH8L 3G6JF 5D1ZB 5TE7L 1KXTB 3C6LA 3CLFH 4NRYA 5C3LD 4KROB 5FGBA 2XN9E 5EORL 4WW1B 2VE6B 2X5PA 4MD5A 1FRGH 1U95A 3VXMB 3G6AA 3OZ9H 2FHBA 4PS4H 1BFVH 4YHIB 2D4FA 3NN8B 4MSWA 2V2XA 1REIA 4OLXL 3T0EE 5DJ8B 3FN3A 4NNYA 3RWIA 3MGOB 3VH8A 4LAQH 4LKCA 4FXKA 3HI5H 3HTLX 4BZ1L 1A7NH 4N8CL 3FO2B 4NQXB 1JFQH 3OAZH 2R15A 5CZXC 3STZB 1QRNB 1FH5H 2R4RL 2FGWL 3MLTA 3MUY1 5B21A 5IG7B 3TCLB 1CE6A 3MUGA 4PJXF 1AXIB 2IFFL 4R4NC 4AIXA 1IZKA 4PGDB 2FJFA 4MNQA 4OCXL 4JZOA 4MLIA 4R0LA 4R2GB 3SDAB 3FB5A 2BY1A 5D7KD 1J05A 3AS1A 5L88H 5D2LB 1F2XK 2W65A 3Q6FA 1I1AA 1GZPA 3SGDH 1JF6A 1YEGL 1N7MH 4NN6C 3U7AA 3VFRB 5D7IF 3WJJC 1BJ1J 3DGCR 4NQDB 3QUYA 4O2CB 4P99A 4L9LC 4URTB 2XTJE 5D7SH 3QG7L 4HG4J 4ONGH 2KZWA 5GGTA 3IRZA 1T21B 3V0VA 2EC8A 3P4OB 4LSUH 4PJHE 1EK3A 4X6EA 1PBYA 3MXWL 1TNMA 3H3PH 2W0LA 1P5VA 4OIIH 5ADPL 5E6IC 1N4XL 4BFBD 3VFTA 3QDGE 3ARFA 1N0XH 4XNZB 2GITB 3FO1B 4UAOC 5IMMA 32C2A 4XVSH 5IVXB 5D9SA 2Z31D 3AU1B 4HMEA 1JRHI 1HWGB 3S3JA 3V95A 1FG9C 3BIAX 5DJ6A 4POUB 3WN5A 4FFWC 4B0MM 1L6XA 3R0MA 5GRVK 2MOVA 5D6CA 2NY1B 1KFAL 4KI5F 1B0RB 4NRZB 1MRFH 2IALA 2OL3B 4MCYA 2VNCA 4XCYB 1WWCA 5IESH 5DJCB 3GNML 1RI8A 1JWSB 1CR9H 4WUUB 2R1XB 4UB0L 1OAYL 1IGMH 3QCTH 3DECA 1T89A 1R24B 4PJ9C 1DUZB 4YDJA 2PCPB 2QKIB 1WV7T 5K59F 2CDEA 4F8QA 5B39B 4S2SA 1IGTB 1QO3A 5HGDA 4Y19D 4K7PX 4XMPL 4OCMC 1NLBL 3HB3D 1I9IL 4LCCA 5TE6L 3REVA 3W39A 5I76A 3ZYJA 3NFPA 4OLWH 4V1DE 5AWNL 3K2UH 1MLCB 2O5XH 3RKPA 4M1GL 2F9BT 1OAKH 3F6IA 5I73C 1FHGA 3QCVH 1XF3B 3RIAF 4KK6D 4XAWL 4P2RB 3BKJL 5C0IA 1FLRH 5BVJA 1VFBA 1X4XA 1FNHA 1BEYH 2DI8A 3MRNA 2YEZA 3WXVL 1BQLH 3DROA 4QT5A 5GRUL 2FD6H 3PF2A 4U6TA 4YWGL 4C56B 2AK1L 2C26A 3IKKA 1L9MA 3BUYA 2NYYC 1MAML 4K3EH 5E0QA 5C0AD 1MWAL 1JVKA 4FQXB 2ESVD 3TV3H 3QT2A 4ZUWB 1OAQH 4LSRH 3ALPA 2AS5M 5CJXA 3B6SA 5J8OA 3W0WA 1A6TB 4KKCC 1CFVL 3LKNB 4DFIA 1FYTD 2OL3L 1NC2D 1S7XA 1DVFC 2GJJA 1NL0H 3KDMA 4BH8B 2ZWLT 3DV6A 3KJ4C 3LN9A 1DL7L 4F57L 4Y16B 4K71C 1LMKA 4NBZB 4NP4L 1LEKA 3OKEA 4N0YH 1OARL 1XCQB 3WFBH 3HFML 1ZLUH 2J5LC 1GL4B 1T1XA 4MJ5B 4APQA 4GW5A 1GOHA 4HGWB 3S37H 5DRXB 1DLFH 4TSBL 4HEPG 2ICES 2HWZL 2Q3ZA 5FDYA 5C70A 3DARA 5IB2B 4NDMB 4KTDH 5IFJB 4QRUB 2QBWA 5DEZA 4TVPH 4U31A 1W8NA 1WBZA 3X14B 3BZEA 4RCAA 5HGAA 1DFBH 3GB7B 4OV5B 4JREC 4LLUB 3DSNA 1NBYB 2Q3AA 4Y88A 4GAGH 1KN4H 4X9FA 5DYOB 3QCUL 3SKOB 2DQEL 3S5LA 3LRSA 1MI5B 3FQUA 4JQVA 2DQGL 2Y1VA 4JDTH 3W9EB 2B7DT 4Z0BL 1I8LA 1CFSB 2YPLB 4JFEA 3BVNB 4PY7B 2J8UA 3ILQC 1FZJA 4FZ8H 4NQCA 4WHTA 3MRFA 4LP4A 3C6SA 1MCJA 3FQNA 1I7UA 4KUZH 3RGVA 4Z6AT 1NGZA 4NO5A 5EZOL 3LKQA 2HVJA 4QRRA 1PZUB 1RY7B 2H45A 4QRTB 5IBUG 3WFDL 1AGDB 3O3AB 5FYLH 2YA1A 4M5ZH 3RVTC 2IPKA 4OLUL 2VLJE 4JHAH 4L4VD 5E6ID 3WSQH 4YO0A 3SDCC 5C9KA 3KPMB 4OGZA 5MHSD 3MNZA 2UUDK 2YD4A 1SEQL 1HKLH 2GJ6A 4X6CF 2IAMD 2Q6WA 5C09B 4S1RL 4W81A 3H8NA 4FHBD 3DTXB 5EZLB 3ARUA 4RMQA 2DTMH 3KPLA 1GVIA 1ZLSL 1YMHA 4G6AC 3WD5L 4ZAKA 5BRZB 3ARDB 4JDVA 5E08H 2V2TB 1LNUA 4AIZB 1A4KA 3B43A 1N8ZA 4QLRA 3FRPG 3VMNA 2R2EA 1Y18B 2P5WB 3QIUB 4U1KB 1MCSA 4XNYL 4P2QA 5FGRA 3B5HA 1CG9A 2X4NA 4QYOB 4KHXL 1ZHBA 4Y4KA 4PJCA 1NMBH 3SDDB 4PJ9D 1LO2L 1XCTA 5EBMA 4YXHH 1YEFH 3ULUH 4M7ZC 3OGCA 4R6UA 5IHUH 4X6DE 4L3EB 3RTQB 4OCSL 3IETB 1BZQK 5C9JB 5C08A 5EU6A 4X7SL 4IRSD 4MB3A 3OKNB 3SHSA 5FOBA 4KPHL 3PHQB 3L3IB 1U93B 2WIIA 4CJ0A 3KPSD 1EVTC 4KVNH 4L8SA 1QFWM 1T66C 5AYUL 3QUKB 3PGFL 4WFGE 3K81A 5CKGA 5E99L 5T5FL 3PWPE 1SYVB 2XY2A 4G3YH 2DQUH 3WDJA 3SJVB 1RUML 1AXTH 1T22A 1AD0A 2HRPH 4MJIB 5HPMA 4I5BB 4Z0XA 2PTTB 1GH7A 1JGUH 3O6FD 5C0EA 3FB8B 4XP6H 5JXAH 4YNYB 3OAZK 5JHDE 2XA3A 4G8IA 5ECJE 2ZSVA 4ERSH 3NA4A 5EA0L 3L9RB 4XNMA 4LGSB 1SM3H 3OHXA 1KIRA 2VDOH 4FP8H 4ZO6A 4BQ6A 2J12B 3CFEA 3GIZH 4J3UA 1N5AB 3NCMA 3F65A 1QFPA 4HS3A 2VXQL 1T1ZA 2RBLA 5EC1B 3LMJL 1IC1A 4I1NB 3DYMA 2MCPH 1TIUA 5IR1A 1CDYA 4XCNB 4YEFA 5L2JB 5E1HB 1GJIA 4OFYA 2VDNL 1JHKH 4QRPD 1U2CA 3ULSA 3ILPA 3HE7A 1JNNH 1MVUA 2I60H 3VWKB 1OVZA 1TPXB 1SJXA 5TQ2H 5CINL 5DK3A 5DZOA 5T1KA 2HJLA 2FJHB 3KPRD 3N1GC 1CTOA 4ZXBB 4WTZA 3X17A 2E3VA 3B9KC 1ITBB 3ELAT 1CCZA 2X89D 1TQBB 4UUJA 3JWDC 2FR4B 3IFNL 2QJDA 1B0WA 4G6MH 3FOMA 2X09A 4ZYKA 5HHOD 1R3IL 4D2NA 1A7QH 1PSKH 2XZQL 4MNHB 1U8HA 1NCDH 4Z7NF 3MJ7B 3ILQD 5MERA 4OCLC 2DYPB 2JJSC 1KTLB 3TT1H 1E4KC 2LQRA 1D5IL 1U3HD 2APTA 1A4JA 4HKBA 1BPVA 4U0RB 5CSZA 5KS9F 5DI8A 3RL2B 3TESA 3WO4C 3GI8L 1NUFA 2DM2A 3REWB 5DWUH 2EEDA 1WJ3A 3G5VB 3IFOA 3ZO0A 3I6KB 4OLEA 1VFAB 4DGYL 5B8CA 3D39E 3CIQA 3VFPA 1HHIA 1KNOB 1NAKL 4MQTB 1Q9KB 4RAUB 2COQA 3P0YL 3HPLA 15C8L 3SDYL 3HAEH 5D6DC 4H1LH 1HOCA 4ORZC 3SKMA 2FO1A 1A6ZA 4LKXB 1MHCB 4NSKA 4X8JA 2DB8A 1UJ3C 5D1XA 2D31A 3BGAA 4LF3A 5C2BH 4JB9L 4K9EL 1KTKE 1KBGL 3HC3L 3V0WL 2OR7A 4G6AD 5I2IA 2DJSA 5JNYA 3RI5F 3BQUB 3T3PE 5GS0L 1BJ1H 2X4OB 4CBPA