3GJFK

Rational development of high-affinity t-cell receptor-like antibodies
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
QSELTQPRSVSGSPGQSVTISCTGTSRDVGGYNYVSWYQQHPGKAPKLIIHDVIERSSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCWSFAGSYYVFGTGTDVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGNTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Rational development of high-affinity T-cell receptor-like antibodies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2009-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gjfK01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gjfK02
2N7BA 4X6CA 5HD8C 3PDOB 3RP1A 3AY4A 1JGEA 3ILPA 4OCXH 1GH7A 5SWZD 2YD3A 3S36L 4ZDHA 3UYOD 4PJDF 3HRPA 3ARDB 1CL7L 5F7KC 3NABL 4LQ1A 2J8UE 2D7NA 4U2ZA 4QHLB 4Y7MA 1DBBL 3O41B 4K2UL 3QCTL 1LNUB 3W0WA 3PQYB 1FL3A 1JNHB 1X9QA 1AJ7L 2V2TA 4HPOL 1NH6A 5C2UB 4POYA 5BMFH 2BVQA 1C08A 2E9BA 1AD9A 2DD8L 1MCFA 5BJTA 3O2WH 1OF2A 1J0JA 1RQ5A 4IIQB 3FRPA 5JHDA 4P46C 1X7QA 4KROB 1RJYA 3JZ7A 5I8KH 3L3HA 3CCHA 1MCWM 2V17L 2VUYA 3SDYH 5ESAA 2VLJB 1CI5A 3UJIH 1A6UH 4GBXC 2PYFB 2EDXA 2UVFA 1WAAF 4DVRL 1T5XA 5T3ZL 1EIBA 5D6CB 5DD6B 4R0LC 2GQHA 3FT3A 1KXVC 5MEPA 3PGCB 3MFGB 3H9SE 4U0QB 4P2QA 1XCTB 2IALB 4OIIL 4ODSL 1DANU 4HJ0C 2CKNA 5JPNA 3QIBD 3FO1B 4BFIB 5H94B 3EFFB 3BKMH 4PRHB 3L95B 1LO0L 4JCMA 4OZHA 3SJVA 4NQEE 1OTTC 1V8HA 1UB5B 4XPTL 4DW2L 4E41E 4Q9QH 3ZLQC 1EUUA 5JPMB 2WNGA 1EVUA 4QOKB 4HFUH 4Y4HD 4F57H 5GGRY 3LB6D 1L7TL 3BKJH 1AHWC 5DS8B 3RWIB 4AT6A 5DJAB 1NUNB 3FCTB 4LSSH 1RIHL 3QWQB 3O11B 5FA3A 3OJMB 3QI9B 3O45A 4FQXC 5FK9B 3GK8L 3HC4L 1MHHB 1S7WB 3UCRA 1AKJA 1HILA 2F53A 3KPLA 1A1MA 4MJ6A 1CLOL 3MACL 5D71H 3FQTB 4PJIF 4X7TB 5DJZB 3OZ9H 4J4PC 1CD1B 1T5WA 3MV7E 1BFSA 1CZ8H 1NMBL 3N85H 2NW2A 4U1KA 5EIQA 3QUZC 3BDYL 5TE7H 3HB3D 5A2JH 1EEYB 5E8PA 1JTTA 4PLNC 3MR9A 1KJ2H 3OKMB 4MQXC 3QDJE 2VTFA 1LILA 1MHCB 4X9GA 3REVB 4OT1H 1ZLSH 4DQOL 3VGDA 1O7VA 1BIIB 3L3OB 3S37L 2W9EL 1U93A 1XCQA 2HLFC 3D18A 4U6HB 1RJLA 3BKCL 2WP3O 1W72B 3VCLA 1B4JL 5MI0B 4BK4A 5DK0A 4HC1H 1F11A 3QUMA 2LU7A 3RVWD 3RA7H 2J88H 4HF5L 1G0XA 3L5WB 2Q76B 3L7EB 3IJSB 4PJGE 4E0RB 1S78D 1QSEA 3RY6A 1ZEAH 2IF7A 2CIKB 4XT1C 5HD8D 4N90D 4X6CE 3T2NH 4ODTH 5HHME 3K46A 5LG1A 4K8RL 2IPKB 5KVGH 4OF5A 5GRYA 1EO8L 4QF1B 4G9DB 3ZKXC 3N06B 1IZKA 4GAJL 3SKUD 4KGLA 3REWA 3SKJH 5L2KB 4G6KH 3N0PB 4WENB 4FTVD 1GAFH 3TC9A 1ES0A 43CAB 4FQ2L 4OCSL 2FO4B 4S1QH 3DTXA 1QFUL 4I18C 3P0VH 3O3EB 35C8L 4H8WL 4YAQA 5DRWB 1X5LA 1N59B 4L1HA 5JHDE 3DNKA 5I6XC 1CICA 4RAVB 3SKOA 5IB5B 5I1LA 2ADGB 4JO3H 1LEKA 5ICYA 3EW3B 2CRZA 4LSDA 5BXFA 1A47A 4GBXD 3SGEH 1FBIH 2WWKO 4R4FL 1I9IL 3BSZL 5KAQF 5AYQA 1NL0L 1IAIL 4HXBH 3SCMB 4LEXH 2HVKB 4HIHA 4NKIL 3SQOL 1RY7B 2WIMA 4MLIA 4R8WH 5JOFB 3CDGA 2Y7QA 4GRMA 3SDCC 2BY1A 4KRMB 1BZ9B 4Q6IA 5KVMC 4XCNA 4P2QE 4Q2ZA 4HJ0D 4PJ8B 4NM8H 9CGTA 3NCJH 2CPCA 4DGIL 1LDPL 3KPOA 1J1XL 1OTTD 4NJAL 4OZHE 3RI5K 4NNYB 4GRWB 1KCLA 3IXTB 3O3AA 1DN0B 4GG8B 4MAYB 4JM2C 4WI5A 4ZUUB 3V4UL 4HZLB 4WFED 3SE4A 4Y5XC 4ZOEA 4DKEL 4PV8B 1T03L 1GGUA 1A6TB 1EXUB 1IEAB 1YEHL 3H7BB 4M02A 1G7MA 3PWPA 4HQQH 4FQXD 4M5ZH 4OLXL 2CD0A 3HR5A 3EOAA 3NH7H 3HI1B 3EJZC 3DMMB 4AEIH 4OIBA 3LS5H 4J3OC 4NZJA 1UKTA 2F53E 2E3VA 4Z95L 5E8EB 3S98A 4QRQB 1AFVH 3ULVF 2NLJA 5I8OH 3UTQB 5AYUH 4J4PD 4OLZH 1YEIH 1QO3A 3DUHA 1RZIA 1F4WH 4S2SA 5ALCL 3MV8B 3ULUL 3ARRA 2W9DL 5E9DB 5E4EC 2BSED 3QUZD 1A3QA 1L7IH 3SGKA 1W0WA 1XF4B 1FYHB 4MQXD 3ZDYE 4XB7A 3FO2A 4LSRL 5HGHB 1UCBH 4I2XB 1MAML 5KVDH 3B8SA 1YEEH 5I8EA 2HLFD 4M4PA 1KIQB 1XMWA 1IJ9A 3NMEA 5EU6A 5C3TA 2HT3C 5BW7A 2MSPA 2LAGB 2Z91B 3LSOA 4HLZH 4Z0XB 5AD0B 4XBGB 1NCBL 2DKUA 5DQDL 4K55A 5FM5M 1WCBA 1QSEE 1P7QA 4G6JL 3TBTA 4LLMB 5D1QD 2R0KH 5I9QC 3HC0A 4YDVB 3UPCA 5GRJH 5F7EL 4WFFD 3BISA 4JFEE 3JVGC 4UT7L 2Z92B 4XNQB 3TT1L 5IR1A 3IYLW 4BH7B 4QKXB 2R8SH 1NJ9B 1OARL 3F6IA 5JQHC 1KF9B 2IQ9L 1MJ8L 1WEJL 1XGYH 2AV1B 3KXFB 2HJKA 4PB0L 1J0ZA 3SGJC 4X7SL 4G42A 2XV6B 5CEZD 4QCIB 4PGZA 1I85C 1BAFL 3LRSA 4TVSa 2EZ0C 4QTHA 3JWOC 4PB9L 3KPSE 3GJFA 1FVDB 3IJHA 2ZG2A 3QRFM 2VQUA 5E7FA 2C3XA 5BQ7B 2VOTA 3ARQA 1U8PA 4ZODA 1CGVA 1FO0A 2NY2C 4QXTA 1XF2B 2H1PL 4HJGA 5J13B 5F1OB 4QTIL 4PJBA 3R1GL 3HZMA 5C0CD 3PIQA 3GIVB 3SDCD 2AEIT 1YPZB 1INQA 3RX7A 2EE9A 4TOYH 3OKYA 3ARBD 2ZCLH 3L3GA 1INDH 1RULH 3ZDZF 3TLRA 2Z93B 3LIZL 5DUPL 5EUOA 5CEYB 2AV7B 5SWSD 3S34L 4WRLA 5IMKB 3ULSB 1XF5B 2D4FA 1IFHH 3BXNB 4JM2D 4Z0BH 1XGPA 1JNNH 2CUIA 3RWCA 2F8VA 1AQKL 5HHOE 1KB9K 1FVCA 1N6UA 3MLWH 4AG4L 4YHLH 2IQAA 2FH6A 4LNRA 4X5LA 3KYMA 3PWPE 3MLTB 3MV9B 2VXQH 3EJZD 4YXKH 3IFOB 3NCCB 4MA7H 1UZ8A 2UY6A 5HDOA 1IKFL 5CCKH 4R7NA 4JGJA 3RZCB 43C9B 3PWJA 2RQ8A 1KYOJ 1S8DA 3RUGB 2B2XL 4LF3B 5CIPB 3ZTNL 1GGIH 4A6YL 3QJHB 5T3XD 3RDTC 1JRHH 4I0KA 4C57C 1CVRA 2ZJSH 1MCPH 2Z31C 5D1XA 4UB0H 1ADQA 3DV4B 5GZOD 3B6SA 1L0XA 4RMQA 1Z3GL 3T77B 4JKPH 1KB5B 2VIRA 1IC5H 1WBYA 1F90H 1MFDH 4XNMA 4NQSB 4D3CH 1S9VA 5SWZB 1YNTA 3ULUE 2R2HB 4YBQC 4KZEL 3V4VH 4XZUB 3KPPB 2HJFA 5E5MB 2I07A 4M6OH 1NFDB 4K7FA 3NCYS 4MAUL 4EDXB 3OKOA 4NJ9L 2HT3D 2VQ1A 4NQDA 5F1IA 5F1SA 1E4XL 4M7LL 4BQ8A 3FFDB 2FCBA 3NIFE 1QFOA 1ZVYA 1ED3B 5F6HJ 4GRWF 4LLWA 3CX5K 2C3GA 2W9LA 1JIBA 4NHUB 4A2LA 1GIGL 3O2VL 3T65A 1DN2A 2YMXL 2D31A 1PG7L 2MJWA 4NOFA 5HHVL 1RUKH 4GO6B 2VUOA 4YHNA 3VXRA 3ZZ1A 5CEXB 1GZQB 1S5IL 4YFLI 1J0YA 3VWJA 5BV7B 2JB6B 3KJ4C 5JIPA 1KV3A 4NFDA 1MI5D 5LXGL 1HOCB 3O4LD 3RWJB 2EKJA 4K3JH 3X17A 2DL9A 4XX1G 4YGAB 2GTZB 4OUOA 2KUTA 3EO1A 1F2XK 1G6RA 4S11A 3AMKA 3FQUA 1NFIA 4NQCA 2XG4A 1ONQA 3QYCA 3S36H 1CL7H 3NABH 3VXUD 1AGFB 5EC2B 3QUYD 3QIBB 5HPMB 5J12C 5HYJA 4LMQI 4QHMB 4HPOH 2CUMA 3P11L 4WUUD 4O00A 4O02L 2NY2D 3STZA 4JFPA 1R3LB 2HG5B 2G2RA 1BOGA 4D9RE 1OT1A 4PJBE 4HWZA 3CZFB 4YIQA 1U6AH 1FDLL 4MJIE 1G7PA 4XP6L 2XNAB 4KK6C 1AH1A 2NX5A 2V17H 3KYOB 3MROA 1MEXL 1YECL 3G6AA 4X8JA 2YD2A 4RFEB 1M71A 2GT9A 4L8SC 2EIZB 5DO2D 4DVRH 5T3ZH 2IADB 3NCBB 3GNML 5HYEA 4G8EB 5EUOE 4O4YH 1CLYL 3GSWA 5F7YC 3T0WA 3WNLA 2W60B 1TVDA 4OIIH 4ODSH 4ORGB 4LCCB 3WDJA 2ARJQ 4MCZA 3C5ZC 5EU7E 3TCLB 1F3DH 5I0DA 3HG1D 2FIKA 4GAGL 3HLAA 4QYOA 1IE5A 4XPTH 5IQ7H 4WEBL 3O8XA 1P9MA 3FO0L 2DQTL 1JPSL 2P8LA 4U05A 3RL1A 3UDWA 4YHMH 5KSBE 4Y89A 1XFPA 4NFCA 4XGZB 3LDBC 5GGVL 5C0NC 1L7TH 4KPHL 1Q0XL 2PCPA 1UH4A 1RIHH 3QDHA 1KTLB 3QH3A 4GJTB 2X9YA 5F70A 3BT2H 1M6OA 2Z31D 4CVXB 3GK8H 4J3XA 2IEPA 4JLRB 3HC4H 2VAAB 4HD9A 2V2XB 2AAVA 2R2EB 4YDKH 4H1LG 4K94C 1KCSL 1NBZB 2E7LC 1QBML 4BJLA 1CLOH 2EYTB 3MACH 2FO1A 1F5WA 3EDDA 4YBQD 3NZHH 1NMBH 4HV8B 1YPZF 3RVUC 1MY7A 3X11B 4HGWB 2YZ8A 4IJ3C 1YDPA 3BDYH 4P2YA 1RVFL 4JO2L 1GC1C 3PWVB 1AGCB 1N26A 4NQDE 4Y4KC 2XTLA 1K85A 2AJVL 4FTVB 3TIDA 5I0ZA 1OVZA 1A6ZB 4PJCB 4U1IA 2VLMD 5DK2A 5SWQB 1ITBB 1ZTXL 1E4KC 4WVRA 4DQOH 3VXNB 3OKDB 3KS0H 3QUMH 2W9EH 4JDTH 3S37H 3K4ZA 4X7DC 5BO1H 4TTGA 1QRNA 3QEHB 3BKCH 2O5ZL 1T83C 2KL6A 1RSFA 5C1MB 2H6PB 5DJXB 3VXRE 3NN8B 3ARYA 1U8KA 1LGVA 1NAKL 2VLRA 1HZHH 3UP1A 2E6QA 4LIQE 4E42A 4NKDB 3MCLL 4HF5H 3QEUA 3T3MF 1JYNA 4R97B 4MCYB 3ZDXF 1WFTA 3EO9L 3MNVA 5ESQA 4Z7NF 3AU1B 3F65A 4JN1L 1S7XA 2APXA 3PNWA 3VMPA 3GKWL 5LAXA 4NQCE 4K8RH 3S96B 2DWEA 5LKNA 4L29B 1EO8H 1U92B 4PD4K 4X6DB 5INDA 1H0DA 1BLNA 3MGOA 3TBYB 4LEOA 3GSXB 2R9HC 4KKLC 5DC0A 4GAJH 4C55A 4Z7OE 1D6EA 4H0HB 1ZK9A 4G8FA 2RGSA 4NQXA 4NYLA 4P4RB 5K33A 3IXAA 3IDIA 1V3JA 4O51A 3L3JA 2UWEB 2OLDA 3HN3A 4OSUL 4P5TC 4G80A 1A3LL 1KACB 1K4DA 1EJOL 1NFDF 2NY3C 1QFUH 2ADFL 3MLXH 1T3FA 3BQUC 4LCYA 2F15A 35C8H 4H8WH 1MQKH 4Z7WB 2PTTA 5BZWA 3K8KA 4FQXB 2E5EA 1NGZB 3HRZA 5E5RB 1QLRA 1LDSA 4KK6D 1KCUL 4L5FL 4ZXBC 3RKPA 5MENB 4FFWC 3MFFA 2NX5E 4KTYA 4I1NB 3LEVH 1D5BA 1KPUA 2Y9RT 4R4FH 1I9IH 3BSZH 3GSVB 2VL5A 4FQJL 5EZJB 2YRPA 1IAIH 1YY9C 3ISWA 4HKZA 1HHKA 3HUJE 4CN1A 3VXTB 4RQQB 4ZUTA 2CDGA 3SQOH 3QIUC 1GZPA 3QUZB 5F9OH 1D5MB 5C0AD 3BN3B 3L7FB 3IFNL 5FKAB 3WNKA 2X9XA 2ZUYA 4S1DD 2SEBB 3J7HA 1UXWB 2YUZA 4U1MB 4XCFL 2EDKA 2MHAA 1LDPH 4JRYA 4F7CB 2JELL 2FJFA 3VWKA 4HS6A 2FECL 3CFBA 1TPXC 1YMMD 3KNBA 3DSNA 1IC4L 2AQ2A 3MNWA 4HUVB 3V4UH 1NDMB 2OTWB 1OPGL 4DKFL 3WFCL 1T03H 2A6KA 4HIXL 5C0ND 3MMEA 3BW9B 1YEHH 2W07A 4CL7A 2BNQA 1UEYA 3ARSA 2JK5A 1FLTX 3BDBA 4OLXH 5FOBB 4J8RB 2ZSVA 3CVHA 2BP3A 5D1QB 3BI9X 2YN5A 4CNIB 4Z95H 3UTSD 3B4NA 2DKSA 4X98B 4GMSH 4IM8A 4F58L 1U2CA 3QQNA 1HQRA 3T8XA 2XTJC 1NGQL 3ZE2E 4DUWA 3ULUH 3RVUD 4MVBC 2W9DH 4WWKC 4GT7A 4K7PX 4Y4KD 1CDHA 1DEEA 3IKKA 1IEBA 2C1PA 5JW3L 4LSRH 3A6OA 4U31A 3VW3L 3EYQD 3OMZA 3SO5A 4XMKL 1CQKA 5EN2B 5EO1A 1GOFA 5D5MB 4Y19A 3C5SA 2EYSA 3R06A 1FYTA 2IPUG 1XH3A 1K8IA 2G75B 4JZOA 4NN6C 3IKCB 1DANT 3MRNA 3R8BB 1GL4B 1QFWL 4Y16C 4YHPB 5DQDH 1UQSB 2XWJA 4R4NC 2FATL 1IM9D 4IHOA 2AJXH 3TF7C 4MX7A 1VKXB 3LOWA 5SV4A 3NBNA 3RVTC 2I27N 3K8LA 32C2A 2LTQB 1TZHB 4O2FA 1T7WA 1U3ZA 4UT7H 1CCZA 3TT1H 3H0TB 2R9HD 4KKLD 2EDYA 3OR7A 1LO3L 3ARBB 1C5DA 3GBNL 2F8XC 1U8OB 5DEGA 1OARH 4GXUM 2HLAB 2A38A 3ARFA 2IQ9H 1MJ8H 1WEJH 1MIML 1QUNA 4EUPH 1I1RA 4X7SH 4HPYL 4JHBA 5DHVA 4MDIB 2A6JA 1CDJA 4Y5XB 2XACC 3HZVA 1FCCA 4HWEL 1HHGA 2GK0B 3DIFA 1BAFH 2NZIA 1CDIA 1NKOA 3BP6A 1K3IA 3OG6B 4NKMB 5IW6B 1KSRA 2QQQA 1MPAL 4PB9H 3QFJA 3MLRL 4PRIA 4ZXBD 4NNXB 3C5JA 4FFWD 5IB1B 4U1LB 3N1GC 1S7SB 2Y72A 3QEGL 2FLRT 1F2QA 1D5ZA 1MCOL 3P2TA 2H1PH 4J3VA 1YY9D 3MA9L 4N68A 3VXPA 5HVFB 4QTIH 3LQAC 5CHNA 3R1GH 1JUFA 4G43B 1ORQB 3QIUD 3VFMB 2GSGB 5E4EB 3RY6C 5GGSY 4FXGB 1OGAA 2VJXA 4OZGA 1QQDA 2BRQA 1MUJB 3Q1SL 3S88L 5D1ZB 2Q7NA 4JRYE 4JO4L 4X6BA 2BCKB 3LIZH 5DZNA 3W0WD 4YQXL 3S34H 1NEZA 3V6ZB 1MFEL 5MEOA 4JFDA 5D96C 1F4YL 1OB1B 2NR6C 1AQKH 2X40A 3FT4A 5KJRH 3E2HB 1N0XL 1U0QA 2Y5TA 4AG4H 4UDTB 5IBTL 2BNQE 2UWEF 5B39G 4Z76A 2HVJB 2P5EA 1SJVA 1SJXA 4JY5L 5ICZB 5DVKA 1SBSL 3JWDL 4C4KO 4ZFOA 4CW1B 3L3IA 1IKFH 1DCLA 3BVNA 4P23A 1CICC 1ADQH 5I9QB 1I1YA 2L7UA 1XIWA 2C3VA 3WIFA 4P2CG 4B53A 2B2XH 2XTJD 5F9JB 2X4NB 3ZTNH 3P9MA 4HIEA 4A6YH 4MVBD 5TE4H 1XGQA 4WWKD 1IARB 1ND0A 4WV1B 4ZFZB 3MO1A 3O4LB 3S4SA 4UZGA 3BKYH 2P42B 1Z3GH 2Z8RA 3U1SL 1AR1C 2GITB 2BSTA 1U3HC 2UV3A 4W6YB 3DBXB 4H26A 3GMMA 5B22A 4KZEH 1U8NB 2DJ4A 3SJVD 3VXUB 1Y6NR 3QUYB 5GGUB 1CDCA 4MAUH 1FYTE 2X89A 4IDJH 3VXSA 2X4UB 4JPVH 3RGVA 3CU1A 1E4XH 4M7LH 3ZL4L 4KK8C 4Y16D 3VU2A 3DROB 1FNGB 4GKZA 1D5XA 2CRYA 1AIFB 2E7MA 1ZWIA 1U58A 3O2VH 3CFKA 1IGML 1NLBL 1FV1A 2YMXH 4NDMB 1I4FB 1SJHB 2EDEA 2D2OA 3QPQC 5E1AB 4EBQL 1LEIA 3QUKB 4N0UB 3RVTD 3U9UA 5JMRA 1S5IH 3TGXA 3N50A 3E6FA 5DLMH 2YD6A 5LXGH 3OL2A 2BHZA 1IL1A 1UGNA 3WUWA 3D0LA 5JOPE 3DWTA 4PYHA 4YHOL 3GSUA 4PRDB 4GLRH 1NAML 3EYUL 3HC3L 1O7SA 1LD9B 3NIDE 2IBZX 4Y1AD 3SHSA 3ZKQD 4IS6A 1DDHA 3GIZL 1P84K 2CSPA 2GHWB 4NSKB 5IGXL 2QLVB 5H2BA 5I71C 3E3QE 4C83A 3HG1B 2JTDA 2H26A 4IMLA 3T0EC 4N0YL 1Z5LB 1N6VA 3QEQE 5IB3A 5GSVA 3P11H 4WGVB 4MQ7A 1EGJL 2XFXB 3VRIB 1C16A 3TO4A 4O02H 1TNNA 1S5HA 4LARL 2PF6A 3MRGB 1I3RB 2MKWA 1NDGB 5FUZH 4MD5A 1EMTL 4MZ3A 4PGBA 1I1AA 2VSDA 4PRPA 1FDLH 1S9WB 2CH8A 3BYYA 1PLGL 4GKSB 4XP6H 1EGJA 1KG0A 2Q86A 1T7YA 4OV6F 5I1IL 1OGAE 1FLRL 5KSVB 1R24B 2BMKB 3A0OA 1RK0A 3M8OL 4EDWL 4OZGE 4R6UA 2FWOA 1YECH 2A77L 5D4QA 2Q6WA 1BJ1H 1ZS8B 2HKFL 4N0FA 1H3GA 1S9YB 5KTEL 4PBXA 1DE4A 4ISVA 1LHZA 2HP4A 1R3KA 4LKCB 4NO5A 2MKLC 4PJ9B 3U30B 5DTFA 5C0BE 2V9RA 4HKBA 1CLYH 3T3PF 2VDNL 2EDNA 2NR6D 5JDSB 1CFVL 3FFCA 4H5SA 3U0TB 1MVFA 1J0KA 3SBWA 4BA8A 4KI5E 3DO7B 4I0PA 4TUJB 5D7IA 3MRLB 3OX8B 4GAGH 4Y5VB 2RR3A 5CSGA 1QOKA 2FR4A 2DMKA 4WEBH 3FO0H 1TZGL 1Z9MA 5CZXC 4L9LC 4QXGH 1JPSH 4BELD 2WSKA 5KZCB 4ZFFA 1HIML 1CICD 1SYVA 1AXIB 1PBYA 4HKJB 5EU3A 4UOW0 4U7MA 3G08A 3GMPA 3DURA 5GGVH 1VFBA 3TFKC 4KPHH 4PTUA 1Q0XH 3MRQB 4RBPK 4PJ7B 3C6SB 3SY0A 5K9KB 4M3JA 4PGEB 4TPRH 4WHYH 5IMMB 1KCSH 3QNZA 1AR1D 2NTFA 1F3DJ 1U3HD 4D8PB 1QBMH 3FTGB 4YZFE 4F7MB 1FC1A 3SOBL 4ZOCA 4MXWL 3DX6B 5FUOH 3IGAB 2Z35B 3GMRB 3VMNA 1BBDH 3I02A 3G5XA 5E70A 1MIEH 4JO2H 3VXSE 2IAND 1OW0C 4R96A 3EYFA 4ACPA 4ENEC 1MWAB 4KK8D 1BP3B 3D39B 4OAWA 1MH5B 1ZTXH 4DCQA 1T20A 3ROLB 2D03L 1TVBA 3PGFH 1HCVA 1KXTB 1UM6L 2HYMA 4RMSA 2XWTA 3QPQD 5GXBB 3FRPG 4AK1A 2O5ZH 3ARGC 3MCKB 5ACLA 3JUYA 1XF1A 4FXKB 4ZQKA 2D7PA 2DM4A 1MELA 4P49A 4LCUB 1QSFB 3H7LA 1NAKH 1PX4A 2GW5A 3MCLH 1X5JA 4GOSA 2EIEA 4R4BA 1EO7A 3VRJB 4L8SB 4JFOA 5DC9B 5I16A 2FJHA 1A0QL 1P7KA 4XBEL 3FQXB 1P1ZB 3GKWH 2YSSB 1MFCL 3KS0J 4MQTB 3A6CL 4GSDL 1FJ1B 3LQZA 4M1CC 4PJDA 4L9DA 5JA9A 3L6FB 2W0FB 3T0ED 5EU6D 2V5MA 1YMMB 4XVTL 4ELKA 4ZNEA 1FG2B 4POZC 3MRRB 4OSUH 1A3LH 2FZ3A 1Z2KA 3Q6GL 1EJOH 1U9KA 2BVYA 2DLFH 1DQDL 3LDBB 4YHYB 1VGKB 1I8MA 2EXWC 5GS3A 3HI5L 3VFWB 4MS8C 5ESVA 4ZD3H 1SHMA 3EYVA 4L5FH 3MC0A 1N5AA 3B8YA 4XAKD 1DUYB 3V9FA 5DWUL 3RL2B 3VWJC 3UTSB 2GFBB 4YK4C 4XCEB 2K9UA 4FQJH 3SEPA 1KBGL 1WAAA 2VKXA 3JTTB 1R5WA 5EBMA 3VJ6B 2QQNL 3NZ8A 2XQYK 1A9EB 3N1PC 1EX0A 4NUJA 1KB9J 4K71C 3BESR 3IFNH 4Y4KB 5F3HB 1EEQA 1D3CA 3O4OB 3MZTA 3FO9A 3MQIA 4XCFH 5D7IE 3MRFA 4JQVA 4WTZG 2PTVA 2FX9L 4G7YH 4D9QD 1J8KA 4JE4B 5DK3A 3MJ8B 1ZANL 2YKLL 3E6HB 3I2CL 1IC4H 1JHLL 4S0TD 4D2NA 3EYOB 2X4SA 3GMQA 3TBWA 4HIXH 3AXLB 1RZ7L 1TMCB 1U8JA 4RNRB 2YPLA 1R6VA 1IM9B 1I1FA 5HDBE 2OM5A 4EZMA 2I5YL 3PV6B 2K3TA 4F58H 2VISB 3RGHA 2CK0L 5EO9A 5J4MA 3IDUA 1NGQH 4GUPB 5E8DL 3VI3F 4OD2B 1UH3A 4PJIA 1IQWL 3WKML 2M26A 2R2BA 5BVJA 1NBYA 1K2DA 4HK0A 4F7EA 1GHFL 2ZUXA 4JPKL 5JW3H 1YMHB 5GRWA 1Y6KR 3UC0L 4ENED 3VW3H 3WV0A 1L9MA 4MA1C 1I7UA 5M94B 3B9VA 4XMKH 1FAIL 3MBEA 2VLLB 5BS0A 3ARGD 5DT1L 1N64L 3O8XC 1P9MC 1SEBA 2PW1B 3WIHA 4NRYB 5CD3A 3UDWC 4TULH 1BHGA 1OAKL 3KG5A 2P5WA 1QFWH 4XBPB 3VXMB 2EKSB 3BEVA 2CQVA 2FATH 3DXAA 5BRZB 2ESVB 3K4DA 1BOYA 4JKLA 2VABB 1OSPL 4IOIB 4F7TA 1KN4L 3C6LA 1I3UA 3IVKB 5EOQL 3QIUB 4PJ7F 1P6AB 1S3KL 1QG3A 4JANA 5HY9A 4M1CD 5DHVH 1PKQE 1LO3H 3GBNH 4PJDE 4ZTOL 3HE7A 1SQ2N 3BMVA 4EI6B 5E6IC 2I9TB 5C0JB 1AE6L 3IFLL 1UA6L 1TETH 5DA0B 1MIMH 4POZD 1UM5L 2BNRD 4G6FB 2IWGA 5IOPA 3HAEH 4H25A 5GS1A 4HPYH 3HNVL 2A83A 4N8VB 1RZ8B 4HWEH 2EXWD 1F4HA 3P4OB 4P9ML 4XVJL 3U7WL 1MPAH 1BZQK 3D2UA 4EN3B 5ISZA 3MLRH 3MRIA 3QJFB 4PLOB 1I9RL 1CFSA 5B3JF 1FZOA 3TM6A 2NY4B 5H37H 3VWJD 2C3WA 1J5OL 1MCOH 5C0DB 5HHQB 3CSPA 1IQDA 2FX7L 1FFOB 1FNEA 3DV6A 4AJ0A 3MA9H 1CU4L 3WFDL 2XTJB 2BFVL 1DFBH 4Y4FB 1WAAE 4WWKB 3WYRA 2WWMC 4UI2A 5IVZA 3DX8B 2FYYA 5MEQB 4RRPA 2ZPKL 4AENA 3JV4A 1JJUA 2CKBA 3S88H 3Q1SH 1U91B 1FNHA 4KVCL 3PDOA 5GS0C 4KQ4H 3TT3L 1MY5A 2AVGA 5F6HI 5HYJD 3V4PL 1OAQL 1F3JB 2X10A 3KPRD 2B7DT 3FL7A 4L4VD 4YH6A 3ARDA 1F4YH 1AI1L 1R3HB 4QHLA 1N0XH 5JXAH 3O41A 3PP4H 1LNUA 5IBTH 2QTEA 4LHUD 3PQYA 1JNHA 4Y16B 1UACL 1K6QH 3RPIB 4JY5H 1SBSH 3JWDH 1ACYH 5TE6H 4HDIA 1OLZA 1P4LB 4HUXB 4IIQA 1KCKA 5DJ0B 2HT4C 4KQ3L 2ZCHL 2XN9E 4PJIE 3AS1A 1LE9B 2EC8A 3GSRB 5EOCL 2VLJA 4S1RL 1PYWB 3U1SH 4PJHF 2PYFA 4HAGA 1N4XL 4P59H 3MUHL 4C56D 5D6CA 3F5WB 2GY7B 2OS7A 1UWXH 5DD6A 4Y1AB 5E4IA 4L8DB 4WO4D 5BS0E 1KIPA 3O8XD 3PGCA 2HT2C 1XCTA 2IALA 1HKLL 3LKOB 5HGAB 5F7FA 3FO1A 4BFIA 5H94A 3EFFA 4LCWD 3MOBH 4M4RA 4PV9B 1OAZL 4PRHA 3L95A 5IMLB 1E28B 3ZL4H 2P5WE 1UB5A 4LVOC 4M93C 1LK3L 5I76B 1IGMH 1OP5K 2JKXA 5HYSB 5JPMA 4QOKA 4EBQH 3BH8B 2FSEB 1FCGA 3QNXB 1QLFB 3RWIA 5DS8A 5DJAA 4MNGB 3FCTA 1C5BL 5DSCB 1OTSC 3JV6B 3O11A 1GOHA 3QI9A 5FK9A 1EBPA 1QEWB 3LN4B 1MHHA 5E6ID 4R7DB 5EA0L 1S7WA 4YHOH 3X12B 3QDGE 3RAJL 4WHDA 5GRXG 3QHFH 3EYUH 3FQTA 3HC3H 4X7TA 5DJZA 1CD1A 5J6HB 3PL6B 3GIZH 3JTSB 1EEYA 1QRND 5C0GB 3OKMA 5ISZE 5I2IB 1FNAA 4M48L 4U6TA 1V5JA 3U0WL 3Q5YA 1EGJH 1MHCA 3REVA 4KJPD 1BEYL 1BIIA 3L3OA 1NCAL 2VLRD 4K07A 4LARH 1DLFH 4U6HA 1KCVL 5GRUL 2DOCA 3ZE0E 2AJUL 2EDHA 4M6AA 4QXUH 3NCEB 1W72A 3PXHA 4YBHA 5CZKA 1PLGH 2VE6B 1S9KC 5IEKB 2B1AL 2WWMD 5I1IH 1FLRH 5DMIL 3CFEB 3M8OH 4EDWH 3L5WA 2Q76A 3L7EA 3IJSA 4E0RA 1C8PA 2A77H 1U3HB 2HKFH 5EC1B 4HUNB 5KTEH 3STLB 1NUFA 2CIKA 5DVMA 5GQBA 1IGIL 5IVXB 4M7LT 1BQHB 1B90A 2GJJA 2PUQT 3OAUL 3AM8C 1FE8L 1RUAH 2IPKA 3TN0B 2NXZC 1CXLA 3ARFC 3LN5B 2VDNH 4G9DA 3IDMB 2ZUQC 2L0DA 3ABZA 3TYGL 1R3IH 1CFVH 4LQFL 2IANB 5FAAA 5ADPL 3M1BB 5L2KA 1UM4L 4HWBA 3ORJA 1KC5L 43CAA 2FO4A 4JB9H 1HIMH 1BJ1J 4Z7QE 5HGBB 3ZSTA 3O3EA 1VADB 2HT4D 4K3GA 5DRWA 1N59A 1GGCL 4OCRL 1KEGL 2R1YB 4MNQD 3BO8B 3MTRA 4RAVA 4KVNH 4U3XA 1FL6B 5IB5A 2ADGA 1N8ZB 5ACMA 3MODL 4RGOH 4EKXA 2VLJE 4PRAB 3WXVL 4UNUA 1IGFL 2QSCL 1ZT1A 5JTWA 2GSIB 3SCMA 4M8VA 2AI0L 2HVKA 1G7IB 5EU5B 3W5MA 3HNTL 5EBGA 4LRIA 4X4XB 3SOBH 4GG6B 5JOFA 5JO5B 5I71B 1BZ9A 3ZKNC 4QRTB 4OCNC 3NTCL 4PJ8A 3T0EB 3ILQC 1TTUA 2ZKHL 5D7LA 5CSZB 4I0CC 4PRHE 5CJOL 4KI5C 1A6AB 2XKNB 4NNYA 4QRRD 1YEFL 5ID0B 1FNLA 3TJHC 2D03H 3IXTA 4YUEL 4KHTL 4U6VL 4MB4A 3RZWA 1DN0A 1UM6H 4GG8A 4MAYA 5I1CL 4ZUUA 4HZLA 2F5BL 2HJLB 4L8CB 4NFBA 4PV8A 1A6TA 2IFFH 4M62L 3V7AE 5JW4R 3ZE1F 2VR9A 4P23C 4PGDB 1EXUA 1IEAA 3H7BA 1OTSD 2X1PA 1XIWC 1CBVH 1IAKB 1OWWA 3HI1A 3BUYB 1MJUH 3DMMA 4ODHL 5LVEA 1D9KC 2GYSA 1A0QH 5E8EA 4TSCL 4QRQA 2GY5A 4XBEH 1HDMA 3UTQA 2BXYA 4P4KB 1J05A 3VD3A 1MFCH 2QHLA 3MV8A 3A6CH 4GSDH 5E9DA 5EIVA 1MFAL 2MFNA 4TVPE 3SGEI 5L88H 1E0OB 1HH9B 1OQXA 3WN5B 3N1QC 1IAOB 1T0NB 1XF4A 2K1MA 4I9WE 4M9OA 3WFHB 2EDBA 4Y19D 1QLEH 2WW8A 1FNSH 4L9LB 1EDQA 4XVTH 5HGHA 1OP3H 3GEWB 2UZYB 3Q6GH 4I3RL 4I2XA 5L9DL 2VN7A 5K59F 3P77B 1EUTA 1DQDH 1FG9C 3VG9C 1KIQA 3WLBB 2D0HA 3KLAB 2Z91A 4LNVA 4Z0XA 5TDOB 5AD0A 5FO9B 4XBGA 3F58L 5IBLC 1RZKC 3K1DA 4LLMA 5CGTA 4CKVX 4YDVA 5J0BA 1YYMH 3ZDZE 3MRCB 2NXZD 2QQNH 3IETB 4XNQA 2DQFB 4BH7A 1NJ9A 3KHOA 5L2KE 5HJ3B 4ORZC 2FX9H 2AV1A 7FABL 1ZANH 2E7HA 3KXFA 3I2CH 2HMIC 3QFJD 4Q97A 2DQIL 2RFXB 3ARGB 4PRID 1YEKL 4QCIA 1Z6JT 4FZ8L 4LCIL 3VDCA 3DYPA 3N1FC 1RZ7H 3OAYK 3ECBB 1FVDA 2I25N 1ETZB 3UPRB 1NC4B 2WBWB 2BNUB 5BQ7A 3VXQB 1M7IB 4DAGL 1CD9B 1XF2A 3K1KC 4RIRB 2I5YH 2XA8L 3UTTD 3QQ4B 4O5LL 5IB2B 1EHLL 4LP4A 5CJ8A 3TH4T 5E8DH 3GIVA 1ZLVH 1T7VA 5FGCB 1IQWH 3WKMH 3ZKND 1YPZA 3ARTA 4URTB 4JFDD 2CRMA 3ILQD 1F6FB 3E0GA 1GHFH 4NWUL 1LP9E 5IVXF 5HI5C 5MHSE 4JPKH 5D7LE 3UC0H 3WIHH 3DYOA 5CINL 2AEQL 1MAKA 2BNRB 3U7YL 2Z93A 4PBWD 1WGOA 5FYJE 5CEYA 3TJHD 2AV7A 4GRWE 5I17B 2DIBA 2J12B 5IMKA 1FAIH 3ULSA 1XF5A 2P5ED 3BXNA 4M7ZC 3DOSA 5DT1H 1N64H 3X3FL 5C6WH 2J8OA 3OJ2C 3G04B 1U8QB 4UOW1 4TN9A 5EO0A 1EPFA 1XIWD 1A7BA 3MLTA 2DL2A 3MV9A 5JORB 4JAMB 3TPKA 3IFOA 1D9KD 4YK4B 4G9FD 4QWWC 1OSPH 1KN4H 4Z7UE 3AB0B 4M61B 4HUMB 43C9A 3RZCA 4L4TD 1C7SA 5EOQH 5J89A 3RUGA 5GSRB 4LF3A 5GJSL 1AY1L 5CIPA 3QJHA 4K71B 3QO1B 3WD5L 5E9DE 4OQTL 4ZTOH 3DV4A 4QNPF 3B3IB 2H8PB 1OAXL 3T77A 1AE6H 3IFLH 1UA6H 25C8L 3IRZA 4RISH 4LU5H 5CJXA 4NQSA 5SWZA 1UM5H 3HI6L 4GKOA 4GG6F 3KPRB 2BZDA 2R2HA 4L4VB 1T04B 4XZUA 2AS5M 3HNVH 1PDKA 3KPPA 1DLHB 5E5MA 1RZJC 3BRFA 2AJSL 1WQVT 5D2LE 4XVJH 2B0SL 4P9MH 3U7WH 3OAZH 1NFDA 4YX2L 4Z5RB 2V5SA 4LHUB 4EDXA 3FFDA 1QNZL 2OBGA 3QXDB 1ED3A 3QCVL 4KMQA 3AS3A 1CXIA 1I9RH 1IKNA 3EOTH 1KJMB 5IBLD 4NHUA 3NOIA 4R9HA 2BY0A 2HKHL 5DFTA 5EWIL 1J5OH 1TQBC 2AJ3B 1F8TL 2YBRB 2FX7H 1JZ2A 4DZBB 5H35B 2CKBH 1CU4H 3KDMB 1L9NA 2BFVH 5CEXA 1GZQA 2JB6A 4Y8DC 2MPAH 3BH9B 4MJ5B 1HOCA 4GMTL 3RWJA 4DEPB 3ME0A 1ZHBB 5CD5C 2ZSWB 2GTZA 3TJEH 4BH8B 3D48R 3T1WA 4C56B 3TT3H 2HMID 1JRHI 3KXFE 5FF6B 1N0LA 1OAQH 3V4PH 3AS0A 4WO4B 2DBJA 3T0XA 1S7UB 5I1JL 4YXHL 2RHEA 5JW4Q 4WNQB 4YFDB 3IDYC 1AI1H 1AGFA 1HSAB 5EC2A 3QIBA 5HPMA 1A3RH 4LCWB 1UB6B 1DTUA 2YWZA 2VWEE 1TJGL 3VD5A 1UACH 3RFZC 4QHMA 3ZT5A 3FQWB 4PRPD 5E00B 1JK8B 2GJZB 2R4SH 3ZYZA 1BBJB 5B8CB 5DEZA 1R3LA 2HG5A 1VDGA 1QBBA 3CZFA 5C9JB 5E8NB 2ZCHH 1FC2D 4K23L 2XNAA 5KS9B 5E6IB 1YPZE 3KYOA 5EOCH 5FYKL 5HI5D 5EZLB 1P4BL 4S1RH 4RFEA 3TA3C 1YJDL 3DLQR 1N4XH 1YN6A 3FFCD 4TUKL 2EIZA 2J4WL 3OKKB 2HFTA 2AEWA 2IADA 4G8EA 3HE6B 4KK9D 4W4OA 4NRXB 4KI1A 3V8CA 4QHNA 1IZJA 2W60A 2HA1A 2OL3L 3NGBB 1HQ4B 3S35X 5L8LB 4ORGA 4LCCA 4G8GB 3SO3B 2A6IB 3TCLA 2DI7A 4RWYH 3Q5OA 5C0FB 3LKNB 3U2SB 1OAZH 5JA8B 1CDUA 3MV9E 5JIIA 1TCRB 3PHSA 3GSQA 3MRDB 4EJ1C 1CL7I 4K8RC 4R26L 1LK3H 4QWWD 5C71A 3EYSL 2NNAB 3T3ME 3ZDXE 1KFAL 3V6OC 4XGZA 1JMZA 4RGMB 3I6LD 3KHQA 1C5BH 2EDDA 4CVZB 1KTLA 2QV2A 4R3SB 4CVXA 4JLRA 2VAAA 2V2XA 1ORSB 3I9GL 2MQCA 2R2EA 3MJ7B 5EA0H 1NBZA 4AIXA 4RMRA 3VH8B 4KFZC 1EZVX 1NEZG 5T5FL 3RAJH 1Z9LA 3MRKB 2EYTA 5SWZE 2ICWJ 2J6EL 2MCPL 3ES6B 4IOSD 1T1XB 2I26N 3B2VL 4HV8A 5FYLD 3DX9B 2D7OA 4HUWB 4HGWA 3WXWL 1NFDE 5TFSL 3PWVA 3MBEC 1AGCA 3TPUB 4FTVA 2YPKB 5T3ZD 1DVFB 1A6ZA 4M48H 4PJCA 4JRWA 3U0WH 5SWQA 3VXNA 3OKDA 1BEYH 1NCAH 3GMOB 4J23A 3CVIL 4P2RB 1TVHB 3QEHA 5GRUH 2MQ0A 3WE6B 1KJ2B 2AJUH 1U8LB 2BSSB 2H6PA 3V6BR 5DJXA 3T2QA 5AEAA 4MNQB 3S3JA 3NN8A 1NBVH 3S4SG 3C6LC 4APQD 2B1AH 1G7JB 1F00I 1A5FH 4ZO9A 4P9HC 4NKDA 5DMIH 4J3TA 4S10A 3OV6A 3RU8L 2NY5C 4GBXA 4MCYA 4LLVB 5T1KD 3AU1A 4AIOA 4WFGD 3S3SA 1IGIH 2I24N 3WLWC 4WI9A 4R0LA 4DN4L 1FE8H 4OKVB 3C08L 5KW9L 4L29A 1U92A 4X6DA 2X4PB 4F8QA 3TBYA 5T1LB 2OSLB 3TYGH 1TFHA 4L3EB 4LQFH 3VDAA 5GS1C 3GSXA 1V05A 5ADPH 4UIMB 5J6GB 2D0FA 4P4RA 4XI5C 3T1FB 1PGRB 2DQDL 2VXSL 3IU4L 3TWCH 4JJ5B 4QRRB 4G6AC 2XRAL 1KC5H 2UWEA 1NQBA 1XR9B 2VDRL 4X4YB 3S9DB 3K4AA 3I6KB 1HK6A 1C12B 4Z7WA 1J10A 2PR4L 5HHNB 3VFUB 4OCRH 1GGCH 4JGMA 1KEGH 1JE6A 1CF8L 2OZ4A 4FQXA 3UZQA 1NGZA 4UNTA 2H45A 4WFHD 4CMHC 3ZT7A 1T1YB 5MENA 1JHTA 3WXVH 3TA3D 2DMCA 1U8HB 2EH7L 3GSVA 1IGFH 4ALAL 2QSCH 2B39A 2Y1VA 5EZJA 4XTRC 2XY1A 4J4PA 1WCQA 3VXTA 2YN3A 3IDGB 4RQQA 3HNTH 4RDQG 2O5YL 1M7XA 5F7DB 1RHHB 1U8IB 3QUZA 5EZIL 3OGCB 4GRWH 1D5MA 5FKAA 3L7FA 2OX5A 2RJMA 3NTCH 1ZOXA 2Q20A 4N9OB 1AGDA 2SEBA 1UXWA 4U1MA 3ARDC 1NLDL 4F7CA 5GGTA 2NCMA 2Z0BA 2DTML 4HH9B 4K8RD 1YEFH 1Y0LA 4YUEH 2YPLD 4U6VH 4NQVB 3VRLF 4JVUA 5I1CH 4HUVA 4M5YL 3GRWL 1CD8A 4DK3A 1NDMA 4AZ8A 2OTWA 4FMKA 1WSST 4JFQB 3FJTA 4XP9L 5EIIB 3BW9A 4XHJC 1IGYB 4I5BA 2DQJL 5FOBA 1KTDB 4J8RA 1UJTA 4IIQC 4LPCA 2ENYA 3UZEA 1QTYT 5GGVY 3ULVC 1EV2E 4ODHH 2MNUA 5D1QA 4N90E 4KROC 4CNIA 4PY8J 3QG7H 4TSCH 2QSTA 4X98A 2NXZB 4X5XB 3ZHDA 1KENL 1N2RB 1HEZB 5GGQL 3FOLB 5KS9F 2ZG3A 1MFAH 3QZWG 4EQ3A 4C58B 3MBED 5E6YA 1IAII 4PLJC 1UJ3C 2HTKD 3W9DB 4FTVE 2CJUH 1JI2A 4HT1L 1NC2B 4P99A 4I3RH 5L9DH 1HN1A 4BUHA 2N1KA 5EN2A 1QHPA 2IH3B 5D5MA 3IDJB 4BQCA 3IFPB 3DXAD 2C1OB 4ODVL 1LVEA 1S7TB 4O2EB 3C6LD 2G75A 3W39B 1YEGL 3IKCA 3HKFA 4W6XB 1FPTL 3F58H 4YHPA 1UQSA 4Y5YB 5IM7B 2R15A 1C7TA 3UTTB 5HHXL 1VKXA 3VFTB 3QI9C 1UKQA 2X42A 3WLWD 1IBGL 5C0CA 4LAQH 4UAOB 4TRPL 3RTQB 2IH1B 1TZHA 1X5ZA 2HAZA 3GM8A 4MWFB 3H0TA 3QPXL 3ARBA 3WNNA 1BJ8A 4OM0L 5D2NB 3ZYOA 1D7FA 1U8OA 2QJDA 3KR3L 2F74B 1XGTB 2HLAA 4G6AD 7FABH 1M4KA 5I1DB 2DLIA 2UWEE 1FGVL 5CGYC 2DQIH 4MDIA 4BYHA 4KZDL 1YEKH 4Y5XA 1T0PB 5BMFL 4WFEE 4LCIH 4FZ8H 2QL1A 2GK0A 2W59A 3MJ9A 4NKMA 3KLSA 2AXGB 5FEBA 5IW6A 4LHJB 4RMVA 3I85A 3D0VB 5IT2L 4WI6A 5T3XL 4NNXA 3P3YA 5IB1A 3TH3T 1D9KB 4U1LA 1S7SA 1SEQH 3PXJA 4DAGH 4F37K 4L4TB 1A6UL 3ET9F 2MMXA 1EHLH 5DFWH 4LVNB 4G43A 4RSVA 1ORQA 3VFMA 5CLWA 2GSGA 3FQNB 4FXGA 4P2OD 5CSBA 4K9EH 3TCXA 4NWUH 3ARDD 1Q9WB 4HKXB 4JY6B 1MUJA 3C60B 5D1ZA 2DLHA 2EEBA 5SX5K 3U7YH 2BCKA 4U6XB 4CVUA 2E6JA 3PQYD 1AGEB 5FYKU 3V6ZA 3KJ6L 1OB1A 5ABDE 4Q9QL 3X3FH 2X7LB 4FG6C 4HFUL 2IPTL 3QA3B 4QXWA 1A8JH 3UAJD 4UDTA 4XHJD 1Q38A 1Q9LB 2HVJA 1GRWA 1CGXA 3HMXA 5CIPH 4QT5B 1OAUL 5ICZA 3ULVD 4YHZL 4HS8H 4Q9RL 4CW1A 1Z0NA 5I73C 4KROD 5JQ6L 3CPLB 1G7HB 3S7GA 3PE9A 4U1HB 4WFFE 3KGRA 5FDWB 5GJSH 1AY1H 2X4NA 2BDNH 3D87B 5D71L 4HMCA 3WD5H 1MI5A 4LK4A 4WV1A 1FQ9C 4ZFZA 3OZ9L 4P3WA 4OQTH 3O4LA 1F42A 3SCMC 3ARED 2D0GA 1OAXH 3JWOL 25C8H 2GITA 3UROR 2UUDK 3SGJA 3DBXA 1BX2B 3MV7B 5CEZE 1I85A 2CLZB 3VXUA 2AJSH 3EUUA 1BM3L 3QUYA 2B0SH 5GGUA 4YX2H 5IF0B 2X4UA 2PETA 1O5DT 4MAYC 1QNZH 4QOKD 4KU1A 3QCVH 1DQJB 2FHFA 3QDJB 4X9IA 3GGWB 3DROA 4WW1B 1FNGA 1PVHA 2HKHH 5EH1A 2CO6B 4LLQB 2J88L 4OZFG 3QO0B 4PUBL 3QI9D 4NDMA 1I4FA 1SJHA 2O5XL 3T4YB 4N5EC 5C0CE 3QUKA 5E1HB 3DMMC 4N0UA 5FECB 3A67L 2BRRL 3W82A 3FMGL 4ODTL 1E27B 5DJYB 1G9NC 1CT8B 1OLLA 3H42L 3FHQA 3T3PE 1LO5B 4GMTH 2BJML 3T0BA 4PRDA 1F45A 1XGRB 2UYLB 5EB9A 3QZWB 3UBXI 3SKJL 5SWSE 1DQQB 2YD4A 3ILPB 5C6PB 5CGYD 1HINH 1GAFL 1LD9A 5I1JH 4YXHH 3BYTA 2CUHA 1ZSDB 3ALPA 4NSKA 3F7YB 2JJSC 3HG1A 3P0VL 4KGJA 4PJEB 1EFXB 1Z5LA 4KRNA 5C0RL 3CH1B 3KPTA 1QKZH 2XFXA 3IAPA 3VRIA 1KPVB 1EVTC 3PABB 3MRGA 3QFDB 1I3RA 1NDGA 1E4XI 5HI3C 1SY6A 1FBIL 5CZVH 3M45A 5T3XE 1S9WA 2V5RA 4GKSA 2DB8A 2XPGB 5KSVA 1R24A 2BMKA 4LBEB 3CCHB 1XEDA 1ZT7B 4NCDA 5FYKH 1VERA 1P4BH 3V5KB 1ZS8A 1YJDH 2X2YA 1S9YA 4AYFA 4F33B 4TUKH 2J4WH 3C8KB 3MNZB 4LKCA 5AZ2L 4PJ9A 5DQ9B 4RFOL 3CC5B 3FOMB 5JDSA 5ACZB 3CFDB 2OL3H 1I7TB 3U0TA 4J6RL 4FG6D 4W6WB 3DO7A 5I8CB 4GLRI 5IROC 4TUJA 3O3BB 1HHJB 1XAUA 3RWHB 3OX8A 2GIYA 5FO7B 4HAFA 4Y5VA 1DUZB 1TQBB 2X1OA 4R26H 5EOCJ 2KPNA 2XA3A 3EYSH 5E8OB 5KAQG 1G9MC 4HKJA 1UENA 1KFAH 1CG9B 2VAJA 4APQB 5DZLA 3MRQA 4BZYA 4RRPG 5ENWB 4BZ1L 4PJ7A 1QZ1A 3C6SA 4HS3B 1G0DA 5I8OL 1MI5E 5K9KA 4PGEA 1MNUL 1Q8MA 3O4LE 4LPVA 2NY0C 3NIGF 5T1KB 2DLGA 4EIZC 5IMMA 5DUML 3WFZA 1S7RB 5T5FH 4D8PA 3FTGA 4ODWB 2W0PA 4JFFD 1Y18B 3P73B 3SDDB 2J6EH 4F7MA 2MCPH 3B2VH 3DX6A 1UEMA 3IGAA 2Z35A 3VXUE 1QP1A 1UCBL 2NW2B 3GMRA 4IDLA 3WXWH 5J1AB 5TFSH 4NKQB 4MAYD 3MR9B 4LMQE 2VB5A 1M05B 4ZO8A 1MWAA 4WUUE 3D39A 5IWLC 1DQTA 1MH5A 2NZ9C 3ROLA 1JTPA 2WK2A 4JG0L 3CVIH 3BJ91 2P8MB 1MCDA 1OSZB 4N5ED 3NFPB 4HG4J 5IHZB 3DMMD 3MCKA 3OXRB 4FXKA 4N0UE 2DIJA 2FEEL 4U49A 1RUQL 4HW6A 5DJDB 4LCUA 2ZOKB 3JV5A 1QSFA 4UOJA 1NCWH 4RGNC 2E7CA 3MV01 3EAKA 3RU8H 3S5LB 4PR5A 5DVOA 3T2OA 3TA3B 3MV8D 3VRJA 4L8SA 1NMAL 4EXKA 4P5KB 5EU4B 2NY7L 4HMEA 1E6OL 3FQXA 4DN4H 1DP0A 1P1ZA 3DI2B 4OB5L 3C08H 4XCYB 2YSSA 5GRVL 4JFEB 5CJXC 1FJ1A 2Z8SA 4RFNB 1X4XA 5D93B 3BWAA 1LK2B 3L6FA 3HG1E 2DQDH 3IU4H 2VXSH 2W0FA 4FQCL 1A7OL 2AJZB 1YMMA 5GPRA 3GM0A 3CDCA 1FG2A 3MRRA 1LEGB 1CN4A 4U1GC 3CUPB 3IDXL 5HI3D 1VGKA 1FH5L 5DJ8B 2IG2L 3VFWA 1Z0MA 4YAQB 3TVMB 2PR4H 1WJ3A 1CF8H 2ICEB 3KPSB 1T7ZA 2R69H 3VI3E 1DUYA 3HZYB 2E7LA 3RL2A 1GC1L 5BV7C 3WUZA 3UTSA 2EH7H 2GFBA 3FZUC 4ALAH 4XCEA 2BY2A 4PJHA 3L3KA 1PAMA 3THML 3JTTA 2O5YH 4LDLB 3O9WC 3VJ6A 4M7KL 1A9EA 4FQHB 5EZIH 1R5VB 1PX3A 2IPUK 4Y4KA 5F3HA 3O2DL 2NQCA 5K9QI 3GDBA 1JNNL 4L8BB 1H5BB 1NLDH 1TJIL 3MLWL 2VLME 1E4KA 3EIFA 5SX4H 3H3KA 4OBRA 3ZYIA 1T83A 2VXTL 3EYOA 3RWGB 4M5YH 4X99A 1P2CB 1J0IA 3GRWH 3L5IA 5IMOB 5HHOB 3BX7C 5CCKL 2OK0H 4DK6A 3AXLA 2R23B 4XP9H 1T4KB 4JZNB 3TP4A 4PJEF 1X44A 2R1WB 4PJ7E 4RNRA 1G7MB 1JNJA 3LB6C 5GHWL 8FABB 2DQJH 1SVCP 1GGIL 2NY0D 1L6ZA 4UBDC 1IM9A 4KDTA 5ICXB 3DVGB 4LGSB 4UB0L 2WM0A 3PV6A 3RPKA 1VFAB 5D7SH 15C8L 1U3JA 2R39A 2VISA 1KENH 1MF2H 5GGQH 4GUPA 4NOBA 4JPWL 3LRHA 4OD2A 4D0DB 5GS2D 1EEZB 3V4VL 1KTRL 4RA3A 5IJKA 5FHAL 4W4OC 4M6OL 1HXMB 3N1MC 1YMHA 5D7JD 3HB3C 3WHXA 4HT1H 2NZ9D 4LCCC 5C2BL 2X70B 4BFBD 2VLLA 5B3JE 1SJEB 4DVBB 2PW1A 4ODVH 4NRYA 4HJJL 4KJWC 3QB7C 1YEGH 1MRDL 4ZXBA 4RGND 3WCYA 3TEUA 4H1LH 1MCWW 1FPTH 4OBSA 4LPWA 4XBPA 3VXMA 2EKSA 1PQZB 2EC9U 2ESVA 1UVQB 4P5MB 4NC0B 2VABA 4B7IA 4CU8A 4IOIA 5HHXH 3HPLB 1E4JA 3AMLA 1IBGH 3C8DA 3UO1L 3IVKA 3QIUA 4X80L 5E03A 4L3AA 3MUY1 4TRPH 3CXDL 4P2OB 5ELIA 5C0AE 3QPXH 4OCMC 1T2JA 4OM0H 4KXZH 4EI6A 3OPZL 2FGWH 2I9TA 4U1SB 3KR3H 5C0JA 2RIKA 1I7ZB 3MRBA 4YE4H 1YMME 3BRDA 1FGVH 4ERSL 1H15B 1FZMB 1J86A 4KZDH 1J0HA 5HBBA 3MCG1 4N8VA 1RZ8A 3ETBF 3P4OA 5A3IC 5HYIA 2J5LC 5EBWB 4EN3A 4EUPB 3TIEB 1U6AL 5IT2H 5T3XH 5DVNA 3QJFA 1EERB 4MHHG 2OR8A 3EDKA 1RIVL 1A6WL 4X6EB 5C0DA 3FZUD 3UTSE 5HHQA 1FFOA 2A6DB 3QXTA 4UINL 1F3RB 4FABH 3K0WA 4R97C 4HH8A 3H3BC 4PJHE 4WUKL 3VXOB 2Y36L 4ELMB 4Y4FA 5IG7B 3O9WD 4WWKA 4KRLB 4MJIB 4UIKL 1QFWI 2X05A 4G3YH 4O4YL 2O61B 1KTKE 3AREB 3DX8A 5MEQA 3V2AR 4EVNB 5K9OB 1UJ3B 3F12B 5LCVL 3D85D 2FHCA 1BF8A 1U91A 5KSAB 2DKMA 2Q7YB 3FN0H 4PG9B 3BHBB 6FABH 4NO2B 1F3JA 5IQ7L 3IT8D 3KJ6H 1XGPB 1R3HA 3OJDB 3QR2A 3WEXB 4YHML 2IPTH 3ESUF 4Y16A 3AROA 2AP2A 1N5YL 4UBDD 3IRPX 3RPIA 1OAUH 2DM2A 1MCJA 4YHZH 3BT2L 3PWUB 4Q9RH 1UZ8B 3GJEB 3TESA 5JQ6H 4YDKL 5KSBB 1CXFA 4Q74A 1RI8A 3MLSL 4HUXA 1S8DB 3N9GL 1CS6A 5DJ0A 4BQBA 3NZHL 5F71A 4XMPL 1LE9A 1AD0B 3GSRA 4KJYB 3GUTB 1PYWA 3JWOH 1Q9OB 4OLUL 2VIRB 5E95B 3UBXB 4A6YB 1T6WA 3VFRB 1RJZB 3F5WA 4LRNH 1AGBB 2ITDB 4Y1AA 4L8DA 2HJFB 4WTZA 1BM3H 3QUML 4JDTL 2B4CL 5BO1L 2FBOJ 1FORL 1GGBL 4K7FB 4KJWD 3LQAL 3UJTL 1A7RH 3LKOA 5HGAA 2V5TA 4PV9A 4LDEB 4OF8A 5IMLA 1E28A 5BOZG 4ONGH 1HZHL 2CXKA 4GW1B 5I76A 4PUBH 5HYSA 2VL4A 4M3KB 2O5XH 4PRNB 4J1UB 2ILLA 2P24B 3BH8A 3RHWK 3A67H 2AKRB 5D7KD 2BRRH 2FSEA 3FMGH 3QNXA 5E2UL 4LSTL 1QLFA 5D1QC 1VESA 1ZVSB 5F21B 3O6FD 4MNGA 4MXVF 5DSCA 4LPTA 3LAFA 4RZCB 1IM3B 1TLKA 3JV6A 4UV7H 3H42H 1JF1B 5EZOL 1W0VA 1QEWA 3LN4A 4V2BA 1URLA 3SKNB 4U3HA 4R7DA 2EEAA 3X12A 2BJMH 4IRJC 5JR1L 3W0WE 3FQUB 4OI9A 1LO4L 4RX4D 1ONQB 2NW3B 5J6HA 1WFOA 2EDQA 4PGCB 3WDHA 4OLWH 5F8QC 1DQLL 3PL6A 2A74B 3QHZL 4W81A 3H2WA 5A3ID 5GJTL 3JTSA 2PW2B 1FP5A 4XPHL 5C0GA 3MLXL 4KK5C 1MQKL 3ULUF 5I2IA 5DEFA 5C0RH 2CLVB 2YUVA 4HEME 4J3SA 2V9TA 4PGJA 5I73B 2B8OT 1GOGA 5AAMA 3STZB 3B43A 1J1PL 3PV7A 4YR6B 1YA5A 4ZO7A 2XTJE 3LEVL 4QLRA 2J7LA 5KBNC 2VE6A 1G7PB 2ICWI 3I3DA 2UY7A 3RRQA 2EXYC 2DYPD 3V8OA 5IEKA 4LP5A 1R0AL 4PG2A 4WI3A 1CFTB 1ERNA 2V6HA 3CFEA 1V3KA 3U46B 5HGDB 3MROB 5F9OL 2LTQC 4X8JB 2WUBL 5F1NB 1U3HA 5EC1A 4GS7C 2EECA 3STLA 5IEHB 4JFFB 5IVXA 3ARBC 1BQHA 2B1HL 3HUJB 5AZ2H 3NAAL 1KPRB 1FIEA 1YNKL 3SJVE 3TN0A 3DGGB 2YD5A 3LN5A 4RFOH 3IDMA 1BFVL 3P4NB 2IANA 4J6RH 2FLBT 5E2WL 3M1BA 3GSOB 2QR0B 2V9QA 3ZE1E 5CGMA 2EDTA 1W8OA 2YC1B 4KKCC 4WHTB 3NA9L 2YEZB 5MEND 1MOEA 2D9QB 5HGBA 3VG0L 2IMMA 3BPNB 4H88L 1OT2A 1VADA 3CK0L 4GMSL 1HHIB 4BZ1H 2R1YA 3BO8A 4YO0B 2W91A 1MNUH 1FL6A 4KWUA 1N8ZA 1PZ5B 5C7XH 5DUMH 5IW1B 3CU7A 4PRAA 2WIIB 5GZOC 4ELMF 3LN9A 1YEDB 2GSIA 5EU5A 1G7IA 4X4XA 3MX0A 5D1ZC 4Y1AE 4GG6A 5JW5B 5JO5A 5DC4B 1R5IB 4QHKJ 5K59E 2JB5L 3GHBL 4UQ3B 3B83A 1NGXA 4QRTA 3T0EA 4HGKC 2YXFA 2C4FT 1O0VA 5CSZA 3WJLA 3E2HC 1A6AA 2XKNA 5ID0A 4CUCA 4JG0H 3ALXA 2DBLH 4R2GC 2WP3T 4P57B 4JFXA 3ALWA 3G5YB 5JMOC 2HJLA 4L8CA 1J11A 2AJXL 1RUQH 3R0NA 4PGDA 3FB8B 1VPOH 3ROOB 1JI1A 1Q0YL 1IAKA 4N0CC 2COQA 3PP3H 5KSBF 1NMAH 4IRJD 4WV1C 4NBYB 2NY7H 1E6OH 3NPSB 2R0LL 4OB5H 4P4KA 2DWEB 1JWUB 2MWCA 3MGTB 4PYGA 2WAHA 1BFTA 4WY7L 4JDVB 1HH9A 2LU3A 3FN9A 2MCG1 1IAOA 4OGYL 4KK5D 1FO0L 1M1SA 1T0NA 4KUCD 5D6DC 4FQCH 3QUYC 3IDIB 3HA0A 1A7OH 2QQLL 4L9LA 4OF3A 3GO1L 3LKPB 3GSNL 3W9EB 1H8OA 1JGUL 4CJ1A 1JN6A 3SKMB 4YDJB 5E2JA 4FQIL 4XVUC 3P77A 3IDXH 4QY8B 1FH5H 4M8QB 3WLBA 2IG2H 4YPGB 2IBGA 4PY8I 5DMGC 3KLAA 3LEYH 2EXYD 3GSNA 2R0WL 2NY0B 4Z78B 1G7LB 3WL9B 5FO9A 5TDOA 4IMKC 4Q0XL 3CSYB 3VGAC 1GC1H 2WWKT 4LVHB 3BN9D 4HUUA 1S7QB 2FIRT 3CLEL 1AP2B 3VI4E 5IVXE 1NCNA 1YNLL 1GJIA 1YY8B 3THMH 2OCFD 4RWHA 2XZAL 2VDQL 3MRCA 5DO2C 2RCSL 4M7KH 4YLQT 3IETA 5DDHB 2DQFA 2ZZUT 4I77H 1JZ3A 3O2DH 1OW0A 2IANE 2H2SC 5I18H 2E27H 5D7JB 5KJRL 1TJIH 1A64A 5HJ3A 4M00A 1MLCB 3DPBA 3E1F1 3NFNB 4KKCD 3V52L 2RFXA 2VXTH 3ARGA 1HCFX 3KYNB 4UILL 3QQ9C 2XY2A 1ADQL 4HFWB 3D9AL 4RGNB 4HK3J 5IBUB 3LHPH 3ECBA 4BZ2H 1ETZA 5FB8B 1NC4A 3UPRA 5GHWH 5TE4L 4X5WA 4DWHA 2BNUA 4UMGA 5AG8A 3VXQA 1M7IA 4N8CH 4W68A 3BKYL 4RIRA 3WBDA 3KWWB 3QQ4A 15C8H 5IB2A 5C92A 2Z4QB 5D1ZD 4JPWH 4GG6E 3CFJB 2F9BT 5T33L 2OP4L 1BFOB 2D7MA 2Y25A 4WDIB 4PJ9C 3U30C 3OHXB 3ARPA 5F7MC 4O2CB 5FHAH 1H3PL 3T0EE 3D69A 4Z9KB 5EU6E 1IEBB 4IOFC 4IDJL 2A0LC 4JPVL 2BNRA 4U1GB 3B2UC 5C2BH 5I17A 1JYVA 5FGBC 4YFEA 4Y5VC 4N9GB 1JPTH 4R2GD 2XQYG 4LIQL 1U3YA 1YZZA 1A02N 3SE3C 1U8QA 4HJJH 2W92A 1REIA 1RURL 1MRDH 4JY4B 4EI5C 4XAKE 3O81A 5C0IB 3QDAA 2KBGA 1G6RL 1I8KB 5JORA 4N0CD 4JAMA 2FRGP 5DLML 2ID5A 3FQRB 3Q3GB 3KVQA 3NACL 4MX7B 4JREB 4M61A 5I1AA 3UO1H 3O9WB 4X80H 1L0YA 3EOBB 3GHEL 3CXDH 3QO1A 4PP2A 2Q1EA 3V79C 3D85B 4G8IB 5DQJB 3B3IA 3OPZH 2H8PA 5C09D 3TV3L 4RMTA 1DL7L 4K7PL 5ILTL 4D9QE 3H9YA 3U6RB 1X4ZA 1F4XL 5F6IB 2FD6L 5IIEB 3KPRA 4ERSH 4L4VA 1T04A 5DHVB 5BOPA 2PYED 1DLHA 4XVUD 1MVUB 3WSQL 1CFQB 3LD8C 2P43B 3BP6B 5DMGD 4Z5RA 3SPVB 4LHUA 5FUZL 2PN5A 5EOTB 5HTSA 1CIDA 5FXCH 3HAEB 3QEQB 5C6TH 1KJMA 3DRQB 1A2YB 1B2WL 1RIVH 1A6WH 2X4QB 1OTUC 2AJ3A 3A6BH 3TNNB 2YBRA 2DLTA 4DZBA 4ZPTB 5H35A 4UINH 4WJ5B 3KDMA 4WUKH 2Y36H 4F9LC 1WFNA 1YEJL 4UIKH 4JN2A 1J9CT 3OF6A 1JPFA 3BH9A 2EO1A 4XP5L 4MJ5A 2H2SD 5J8OA 5LCVH 3TO2B 1ZHBA 4I48B 3CXHJ 4JGUA 4BH8A 4X9HA 4C56A 5CKAA 5IFJB 4S1DC 3BZ4B 4I4WB 4N5UA 5FF6A 5C0BB 4WO4A 4ZPVB 4CN6A 1S7UA 5BZDB 4WNQA 4P3CL 4QXGL 1OM3L 1JZ6A 3QQ9D 1KLFA 4M43L 1HSAA 2BSRB 4MD4B 3IU3B 4PJFB 5FCSH 2QHRL 4LCWA 1UB6A 2RBLA 5HHPB 4YHYC 5KOMC 1B6UA 3MRHB 1N5YH 2GUOB 3CAFA 3EDEA 3FQWA 5E00A 1JK8A 3MUGB 2GJZA 5DR5L 1BBJA 4HULB 2PNDA 4K3DL 5B8CA 2ICCA 4TPRL 1H3VA 2VH5H 2ZOLB 3MLSH 4JQIL 3MRMB 3T0DA 3O6FB 3N9GH 5C9JA 5J56B 5E8NA 3WNOA 2X9WA 4XPAH 1WF5A 4DFIA 3I3BA 5FGCE 2G9HB 3VE0B 5KS9A 1RFDL 4PJ9D 5E6IA 1VENA 4KUZL 4XMPH 5FUOL 3LS4L 5IKCB 5EZLA 1BBDL 4IOFD 3L9RB 1MIEL 3RWDB 1FZJB 5AUMB 2A0LD 4OLUH 2OYPA 4V2CB 5C9KA 2BNRE 3OKKA 3B2UD 3BZFA 3O4OC 3QQ3B 3HE6A 4U6YB 1FRGL 4NRXA 3EYQC 5LGHL 1CR9L 3HFML 2ZP0T 2J5LB 3PGFL 2B4CH 2ICES 1FORH 1GGBH 1HQ4A 5KZCD 3LQAH 3UJTH 2P4AB 3EDFA 3O3DB 3VXSB 3KPMA 4EI5D 3JWNC 4G8GA 2A6IA 2E7BA 5C0FA 3LKNA 3U2SA 1X5GA 1TCRA 3MRDA 5C0EB 5DRZB 4KTEL 3GB7B 3ESVF 5CLTA 4KDTC 3CMGA 5GS0L 5E2UH 3RUGF 1PD6A 3B9AA 4LSTH 3IJYB 2DYPB 2ICWB 2BHYA 4CVZA 1PEZA 4PBVC 4R3SA 5EZOH 1P69B 1ORSA 3RVXC 3MJ7A 5DJ2A 4LLAA 4DZ8B 3QIWB 1CDGA 5DHYB 5JR1H 1MCNA 1NCUA 5HYJE 3MRKA 4N1HB 2YD7A 5IJKC 1LO4H 3KPRE 4L4VE 5F7WC 2BC4B 3ES6A 3DHJA 2XIDA 5F89B 3D39D 3C8HA 4XC1L 3DX9A 3O6LL 1DQLH 3QHZH 4HUWA 2M8XA 2EIBA 3OKNB 5GJTH 4XPHH 4XXDB 2DLFL 2GTWB 3TPUA 4HCRA 3U4BL 2Y4SA 1NAMB 5J7CC 2YPKA 1DVFA 3IB4A 3NA4A 4FXLA 4GXVL 4ZD3L 5TGBB 1QSFD 1C16B 1OTUD 3GMOA 4M03A 2YD8A 4P2RA 1J1PH 1TVHA 2A73B 3WE6A 3I3EA 4IRSD 1KJ2A 4PJAB 1U8LA 2BSSA 3BUTA 1CLZH 4MNQA 1G7JA 1Q94B 2H3NB 1R0AH 8CGTA 5C07D 2QADB 1G6VK 2WUBH 5GRZA 5GZNC 1U8MB 3CFCL 4LLVA 1EHAA 2EC9T 3WS6A 3T2PA 4C56E 4IEFB 2B1HH 4ISVB 3MPCA 3WS3B 2VDLL 4HC1A 3VD7A 3NAAH 1YNKH 4G7YL 4HKBB 4KV5F 1HSBA 2X4PA 3TNMB 1BFVH 5T1LA 2OSLA 4L3EA 3VRLE 3CVHL 2J8HA 3D3VD 5E2WH 4ODXB 5J6GA 1XR8B 4I0PB 4LCWE 1ZGLP 1JPGB 3T1FA 2N56A 5IV2B 4XB8A 3RWFB 1FFNB 4QRRA 2Z8WC 4D9LL 1K8DB 4QRPD 5CJ5A 1YQ2A 1XR9A 3NIDF 4WGWB 3NA9H 4EN3C 2VR4A 4ZTPL 4X4YA 2LVEA 4QRSB 3VG0H 3I6KA 3GBLA 4H88H 1C12A 1BMGA 2NY4C 1JV5B 3CK0H 5HHNA 3VFUA 4I8DA 1AO7D 2AERT 3D1MC 5KS9E 1T1YA 4Y4FC 1KGCD 3DO3A 4IRJB 1U95B 3GKZA 4JZJB 3T0VA 5FA4B 5CAYB 1U41A 1U8HA 1E4WL 3G6JB 2ARWA 5FUCE 5CUSL 2BVEA 3IDGA 3UYRL 4UUJB 3BPLC 5F7DA 1RHHA 1U8IA 3DRTA 2XXCB 3OGCA 3UTOA 2HRPL 3V0WL 3PJSB 1PZUB 2JB5H 3GHBH 1IVLA 1QRNE 4ZUSB 1JL8A 3BJLA 2QQKL 1JGVL 3DUSB 2VKWA 3WFBL 4HH9A 4TULL 3QDMD 2WQRA 2VLRE 4NQVA 4PJFF 4LL9A 2CDEB 1B3JA 1LE5B 4JFQA 4JQXC 1I75A 4BSVB 5EIIA 3F62A 1IGYA 3V6FB 1Q0YH 1KTDA 3SGDI 3TYFB 4FQQB 3RVXD 4GS7B 4R4BB 4UT6L 1JP5A 3HS0B 1UCTA 2C3HA 3AM8A 4K3EL 3H9ZA 5DUBB 2R0LH 4X5XA 3PF2A 4FS0A 1TETL 1N2RA 1HEZA 4LHQB 3FOLA 3GJFH 6CGTA 4LSQL 2NXYC 4HZAA 4WY7H 4UT9L 3F7PC 4FRWA 4NN7B 2P8PB 1PKQB 4AMKL 4OGYH 1FO0H 1J8HD 4XMLL 1K4CB 3FN3A 2QQLH 4PJCF 1Q72L 3GO1H 4WTXA 1RPQA 3GSNH 3P4MB 1NC2A 1JGUH 3JSSA 3VFGL 4FQIH 4LASL 4TSBL 2IH3A 3VXMD 3IDJA 3QWOB 4ZS7L 4DTGL 3IFPA 1T6VN 4ZOBA 5BRZD 2ESVD 2C1OA 2FJGB 1S7TA 1QYGL 4JDZB 4MNQE 3W39A 3B9KD 2R0WH 1DFBL 4GFTB 3BGFB 4LOUC 2DQGL 5KN5B 4Q0XH 5E56A 5A1AA 4Y5YA 5IM7A 5GZND 2IFGA 2HFFB 3UTTA 3CLEH 3VFTA 4MHHI 1YNLH 4OD3L 3RTQA 1BD2D 2IH1A 2VDQH 2XZAH 2RCSH 1MCRA 4KQ4L 4X6DF 4ZS6C 3WNPA 4XXCC 4G6FD 3PUCA 4KKBC 3K7UA 2XQBL 5D2NA 3QUXD 3Q48A 3LMJL 4ZFOL 2BOBB 4NHCL 1XGTA 3PL6C 5JXAL 5EBLB 1MHEB 1XZ0A 3PP4L 4QRRE 3V52H 2VDKL 5I1DA 4WHCA 4EN3D 1M7DB 1K6QL 1UFUA 4R2GB 1P4IL 5JXED 2X09A 4LPUA 4UILH 5JHLL 1ACYL 1IGTB 4CJ0A 5I75B 2EDJA 2NY4D 4NCC1 4NM4H 5TE6L 2AXGA 4Z7WF 3D9AH 1CXKA 1KJVB 1NANH 4NN5C 2CR3A 5DRNB 3D0VA 4Y4FD 5TQ0H 1D9KA 5GGRB 4G9FA 1WT5A 1T89C 4PG2C 4PJAF 4L4TA 4NZRH 3FB5B 2FL5B 3SDAD 3MRJB 4MA8H 1AC0A 4P59L 2LABA 3FQNA 2XN9B 5T33H 2OP4H 3WNMA 4OCLC 5BVJB 5C09B 3TN0C 1H3PH 2DQHL 4Y19E 1Q9WA 3BE1H 3LZFL 3QWRA 4HKXA 4JY6A 3C60A 4U6XA 3FHAA 3MOBL 1AGEA 2PYEB 4TNVF 4D0BB 5JUEL 1WUNT 2JIXD 3P30H 5EULV 2CO7B 5BS0B 3EJYD 4LIQH 3OBAA 5DYOB 2VERN 2X7LA 5E2VH 1RURH 1F6AB 3QA3A 1UH2A 3HHRB 1Q9LA 1G6RH 1I9EA 2AK1H 3VGAB 4QT5A 2EE3A 4LSVL 4D94A 3GI9H 3NACH 4U7SA 3CPLA 2BVOB 4CMMB 1G7HA 1P53A 3GHEH 4FHBD 4U1HA 1TCMA 5FDWA 3HTLX 1ZA3B 3QHFL 5D8JL 2NXYD 1WVZA 4Z7VB 5MP6L 1KULA 4JFHD 3G6JF 3ZSSA 3TV3H 1DL7H 2EDLA 4K7PH 4PLKC 4JFZL 5ILTH 3QDGB 1V7ML 3UXFA 4GW5B 5AZEL 1B0RB 1P5UA 3QFJE 1F4XH 1CFNB 2FD6H 4PRIE 5ALBL 4LLUB 1BX2A 3MV7A 5L0QC 4TUOB 1U36A 2CLZA 3WJLC 3WSQH 3UZVB 5D5MF 4KUCF 1ZLUK 4AQOA 1DLFL 5DMKB 4WU7B 5IF0A 4U7KA 5C86A 5F3BA 1YJDC 1TENA 4QXUL 4ONHB 5C08D 1DQJA 4LOUD 3GGWA 4WW1A 4MMZC 1B2WH 4LLQA 3G9AB 3QO0A 3UTTE 3CIQA 5JLZB 3T4YA 5LGKA 1NSNL 5FECA 3UTPD 4ZMAT 5DVLA 1YEJH 1J18A 4LLYB 4ZS6D 4M1GL 1E27A 3RY5A 5DJYA 1CT8A 4JVWA 4KKBD 1RUAL 3DHMA 4XP5H 4JFDE 1LO5A 4P4KC 3LVEA 3QT2A 1R3IL 3PL6D 2YR3A 1XGRA 2UYLA 4WEMB 3QZWA 4BFEA 3ZT6A 1DQQA 4LLDB 1MFBL 4KDWA 3L5XL 3WN5C 1QRKA 2P5EE 3I6GB 3PHOB 4JB9L 4P3CH 3OR6B 1OM3H 4M43H 2DAVA 1ZSDA 1T1WB 3LKSB 4TTDC 4ZOAA 4EI5B 3F7YA 2QHRH 5ID1B 4B5EA 2OJEB 4PJ5D 4AL8L 2ZUUA 2IAMD 2ZG1A 5IB4B 3LEXB 4PJEA 1EFXA 4AEEA 1BZ7B 1J12A 3CH1A 4C4KT 5DR5H 1G1YA 4G9FE 5F9WB 1ACZA 4K3DH 4KVNL 1KPVA 1ZT4B 3PABA 3NIGE 3PGDB 3QFDA 4HDIB 4RGOL 3OB8A 4L4TE 3V5DA 1I3VA 1QD0A 5JDJA 3OGOE 5F8RC 4NO0D 4JQIH 2Y07H 3X14B 5E94B 1T2XA 3K2MC 1EAPB 2AXFA 2XPGA 1RZJL 1RFDH 4LBEA 5FYLL 4KUZH 3TN0D 3LS4H 1ZT7A 3T4AB 3V5KA 4F33A 1WZLA 3C8KA 3WDIA 3MNZA 4N8VG 1JTOA 1MCQA 3LD8B 3EBAA 1FRGH 5DQ9A 3CC5A 1CR9H 5LGHH 1P7HL 2AQ1A 3HFMH 1KIPB 3FOMA 4X9FA 4W70A 5ACZA 3CFDA 1I7TA 4BM7A 4GKNB 5I8CA 2X4TB 1H3XA 3O3BA 1HHJA 3RWHA 4DGVL 1R3JB 5FO7A 2IFFL 3OB0H 2XZQL 1DUZA 1A9BB 4FFYL 2FNBA 4KTEH 4X9BA 4HLJA 2ARJB 4JR9L 1KNOB 5DA4A 1CBVL 5E8OA 3MSPA 1MJUL 2GCYB 4IRSB 5TJWK 4BUGA 1G0YR 1CG9A 5GS0H 1EH9A 3UJJL 4APQA 2IGFL 4YFLF 3D25B 5ENWA 3H6JA 1DR9A 4HS3A 5C07B 5TDNB 4NBXB 1ZXQA 3VGBA 3WJJA 1UWXK 4FA8A 5T1KA 3RIFK 4UU9B 2WANA 4PLKD 5L88L 1T22B 1S7RA 3UMTA 4HCRH 4X7FC 4ODWA 1Y18A 3P73A 1QLEL 3G9VA 4ZSOB 1V3LA 1KELL 3SDDA 1FNSL 2AJYH 4XC1H 5IFAL 3O6LH 3CZJA 5J1AA 3D3VB 3CLFL 5FYKD 1YN7B 1BREA 4WU5B 3NCFB 3U4BH 2ZCKH 1AQDB 1M05A 2W1NA 4PRPE 1DBJH 2R0ZH 4QRPB 1CGWA 2BVPB 4GXVH 1BIHA 2YA0A 3DVIA 4UNVA 3PDGA 2DJSA 1Z9SA 2P8MA 1OSZA 5HVWA 3NFPA 4CU6A 5EORL 4HX1B 1T7XA 5IHZA 3OXRA 1MCCA 1AO7B 1FIGH 5DJDA 1MSPA 2ZOKA 1KLUB 4OFVA 4RA0C 3AB0C 4NZUL 4C59B 5KSUB 1YYML 3RY4A 1CFBA 4OF0A 4P4KD 2WBJD 5DMJB 3S5LA 1DBKH 4GRLC 3TA3A 4QHKI 3CFCH 2ATKA 5FOJA 1BVLB 3FFCE 4HSQA 1OCWH 3PHQB 3QAZB 2IBBA 4P5KA 5EU4A 1YC8A 5HYQB 4OUUB 5F7HA 2VDLH 4NPYB 4XCYA 1QVOB 2GJ6D 4Z7VF 4JFEA 4CDHA 2YK1L 4ZAKC 4TTDD 3SN6N 3CVHH 1NGWB 4YDLB 1LK2A 4LSUL 5ERWB 3QDMB 4JCLA 4D9LH 2AJZA 2VZ3A 4PJEE 1WIUA 5HYSG 3WMSA 4YNYB 1KT2B 4DUVA 2YD9A 1LEGA 4ZTPH 4YDIL 1SMAA 3V6OA 3MUJA 3CUPA 3ZHLA 4TNVK 5DJ8A 3F8UB 3TVMA 2OTPA 3I6LE 1JGDB 1QPPA 2ICEA 2XZZA 3KPSA 3M17B 4OZFA 4P46D 1MLBB 2EYRB 2P48B 4OM1L 4HHAB 3HZYA 3U36B 2ADIB 3RIAK 4PREA 2EIDA 1ZLWH 1F58L 3ZE0F 1E4WH 1FSKB 2LU4A 5CUSH 1ZT1B 2R1XB 2A2QT 3WIHL 4DEPC 3UYRH 4DUXA 2XYCA 3GMLB 5FYLE 3U83A 2XT1B 4FQHA 2ZNXA 1R5VA 2HRPH 3V0WH 1VFUA 4U0RC 4UTAL 1A7NL 4WO4C 1J8HB 1UWEL 1LP9B 2QQKH 2JJVA 1H5BA 4L8BA 2XZCH 3C09B 3QG6B 5T3ZE 5D7LB 1JGVH 1KCRL 1TNMA 2VZUA 4IRZL 3WFBH 4P9HL 5TDPB 2NY5L 1NC4D 4ZUVB 3KPQB 3RWGA 1ZLUH 4AM0A 1MCBA 1P2CA 3RNQB 1GYAA 5IMOA 5HHOA 4I13B 3RJDA 5B8CC 4Y88A 1QR1B 1N3NB 2R23A 5J9PB 3B9KB 3DX7B 1T4KA 1RAMA 4JZNA 4FNLL 2R1WA 2XWBB 8FABA 4KH2A 4Z7QF 5ICXA 2VLKD 3DVGA 1BQHG 4WFGE 2DQUH 4UT6H 4M6ML 4K3EH 4Z7UB 2PO6C 1VFAA 2VMFA 1VCAA 1BD2B 1HDMB 2I9LB 3FB7B 4LU5L 4RISL 1J05B 5T1DL 3S36X 5KVEH 3UYPA 3VFVB 4ZNEE 1ZA6B 4QRUB 4LSQH 5FUCC 1WIOA 4D0DA 4UT9H 1EEZA 2FB4L 3HZKB 4U33A 4AMKH 3QUXB 3HE6C 4KHXL 3ZKSD 1HXMA 1VACB 4XMLH 3E8UL 1OD9A 3HCVB 5CP7B 2F5AL 1Q72H 3NGBC 1V7NL 3DECA 4XHQA 4NWTL 3SO3C 2X70A 1X5FA 3VFGH 4LASH 3EOTL 1SJEA 4TSBH 1Q9KB 5FIEA 4KJPC 5D2LB 4ZS7H 4DVBA 4DTGH 4YBLB 4L1DA 1QYGH 1PSKL 2CKBL 5SX4I 5C70A 3V5HB 4WFHE 2DQGH 1IC7H 5E99L 4GRLD 4RGMC 1OOAA 1PQZA 2MPAL 1X5XA 4J3WA 2DF3A 3CSGA 3STBA 1UVQA 1OAYL 4P5MA 3C87A 4UV4H 3HPLA 4NGHL 3SDAB 4LVEA 4OD3H 1B0GB 3MYZA 4MSWB 3BPLB 3TJEL 1EHXA 3RJQB 4P2OA 2V7NB 3ZTJG 1CVSC 1OP3K 4ZAKD 2OR9L 2XQBH 2XICA 1WC7B 1ZHKB 3V0VB 5A2KH 3LMJH 5T5NF 4NHCH 4O9HL 4U1SA 1WBZB 5DJ6B 2NY6B 1I7ZA 1A3RL 4Y2OA 5ANMB 2VDKH 5AWNL 1RMFL 2YPLE 2JIXB 5INCB 5I1HH 1WBXB 1H15A 4YGVB 3ULVL 1P4IH 1FZMA 4WCYL 2R4SL 3V6OE 5CBEB 1DVFC 3MXWL 5JHLH 1S7VB 2M1KA 2ENSA 4Y2DB 4WW2B 5EBWA 4EUPA 1NCDH 2PXYC 3TIEA 3VA2C 3VDBA 3TBSB 7CGTA 2NPLX 4LPXA 5AAWA 1YC7A 5DMYA 1HWHB 1QR4A 3OF6D 3BP5B 4X6EA 1JNLL 2A6DA 3VXOA 1CQYA 1HHHB 4ELMA 2H9GB 4WI7A 2NXYB 2LE9A 5CBAB 5IG7A 4MJIA 3WS6C 2O61A 3BGMB 2DQCL 4XC3H 3AREA 3PWNB 4EVNA 5K9OA 1UJ3A 3CMOL 3F12A 2DQHH 4MLSA 1C1EH 3LZFH 4PJXB 5KSAA 2Q7YA 2HFGH 4PFEA 4PG9A 3KLHC 4RWYL 5DJCB 3BHBA 4AIZB 3S37X 5JUEH 4NO2A 2W0KA 1RZKH 3SE9H 4HIIB 3BGAA 4KXZI 3DXAE 1IGJB 4H0GA 5E7BA 5I74B 3VFPB 3TZVC 3OJDA 3WEXA 4XNZB 1EHNA <