1TIUA

Titin, ig repeat 27, nmr, 24 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
89
structure length
89
Chain Sequence
b'LIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TITIN, I27
publication title Immunoglobulin-like modules from titin I-band: extensible components of muscle elasticity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin-like domain
total genus 5
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tiuA00
2UZIL 2WW8A 3HZVB 4NKIL 3KYKH 4NRYB 4I77H 1DUYA 1UM6H 1WSST 3HAEB 3BIAX 1HSBA 1L7IH 2BVTA 3C5JA 5FYLD 3MBEC 5DSCB 1YN6A 3K8LA 3LKSB 3LN4A 3AREC 1KB9K 4M6OL 4YIQB 1AP2B 1ACYL 2W0FB 5HDBF 3WSQH 2WM0A 5L6YH 4OM0L 5HDQH 1ZT7A 3E3QC 2HLFD 3LD8B 3OZ9L 4M48L 3SKOA 4WW2C 2QR0B 3WYRA 4YWGL 3L6FA 4JRXB 2ILLA 2P43B 1CXEA 1VFAA 1YEHH 4P2OA 4F7MA 3D39B 5IMMB 4MNGE 3C6LD 2HLFC 3QDGD 5DRWA 4MNQB 4GW5B 1FVCB 4QHUA 4NQEA 2XKNA 1PLGH 4F9PC 4NM8L 2O5YH 2UWEF 3EOYG 4PJFB 4GAGH 5INDB 3C6LC 4AG4H 4U1HB 3M8OH 2WBWB 3GDBA 4L3EA 2GK0A 3MCKB 3ZMRA 4Q74A 2Y06H 3STLB 4WDIB 1I1AC 3H9HA 2I27N 2HWZH 3W5NA 1JGUL 4JAMA 3VFMA 1U6AH 3B9KA 5L7XH 3K4ZA 4JR9H 3O6LL 3JXAA 4ISVA 4YO0B 3WHXA 4N8VB 4UV4H 4Z8FH 4FQQB 4DN4H 4WWKA 5I75C 1FCGA 5IHZA 1N6QH 1O5DT 1X4YA 2CIKA 4LPCA 4YXLH 5A2KH 2L0DA 3LQMA 4F7EA 3MOAH 3WJLA 2IANE 4JM2A 1DANU 3UDWC 3GHEL 4TPRL 1AD0A 5ESAA 1U41A 2R1XB 4R3SB 1CLYH 4HJ0C 1SEQL 1HNFA 4OAWB 4KJPD 3FL7A 4GXUN 4OLWH 1UB6B 3CVHB 3MLWH 2P45B 4LPVA 5DD0L 5DFVD 3PWVB 5IVZA 5J6GA 4KJPC 5F7YC 1CE1H 1SM3L 4P4KA 3QUYA 4LLQB 2AK1L 5T33H 1S9YB 2B1AL 5FYLL 1CICA 1HINL 2H8PA 4X6FB 4C59B 2R9HD 4LLWB 4RMTA 1J8KA 1QNZL 3KWWB 2F58L 5GJTH 1YEJL 3RVXD 1QA9A 2DQCH 5DMIL 4JEGB 3PNWA 1OL0A 3ARUA 3I75A 3O3EB 1NUDA 4XNMA 1UM5L 5ECJE 2P49B 1U58B 3X13B 3WE6A 4MQXD 1DLFL 1D7FA 4QRQB 2AJVL 2R9HC 5T3XD 3WHE1 5F6IB 3QXUA 1RIHH 2XOTA 5HJ3B 3CUPB 3Q48A 2HJKA 1KJVB 3RVXC 3TVMB 1G9ML 4U0RB 3GKZA 1U3HD 4MA7H 3BH9B 2GTZB 2F54B 1NBYA 3WIFA 3K8KA 5IW3A 2FJGA 2B0SH 3U46A 1Y6NR 1OSZB 2PXYD 4WV1B 2R1YB 3KHQA 3O3AA 5KS9E 1KIQA 4UQ3A 3TM6A 1BGXL 4X4YA 4PLKC 3NA4A 3CVIL 1NKOA 3CXDL 1DBKH 4FFYL 4G9FB 2VXVH 1UXSB 4W81A 3PHOA 3TA3A 3SGKC 2IEPA 1CDUA 2YRZA 3MLUH 4HMCA 4R8WH 3PP4H 2VYRE 5CMAA 1NMAL 1HDMB 3BKCH 3D0VA 1WISA 2Y1VA 4JN1L 4RNRA 2G60L 4OCYH 1DBMH 3WNOA 4TVPE 1B0WA 4UT9H 1YMHA 5IW6B 3LB6D 3RP1A 1FPTH 4LF3B 4G8IA 4PGDB 2A1WL 5E08L 1VFBA 3QFJB 4PG9A 2RFXB 4AENB 3ZE1E 3MGOB 3VXRB 4HS3B 2YPKA 3LB6C 1B88A 5FUZH 1YEDB 1HHIA 5I8KL 4CU8A 5I1EL 3JTSA 3PXJA 4IIQC 2PYEE 5DK2A 1GH7A 3ZYJA 4J8RB 2V9TA 1EFXD 3GJEB 4MAYA 3BKYL 1ZSDB 4U2ZA 2FYYB 1A6VL 3PHSA 3DGGA 5BOPA 2HVJA 4EI5D 4HLZG 2DQDH 5I73C 5C3LD 4PJIE 4OF0A 4XH2A 3GGWB 1LDPL 2PO6A 5IBTH 1QBBA 4R7DB 3B6SB 2DQIH 3RWFB 3DSFL 4XXDB 4RAUB 5FCUL 1W0VB 1NEZA 2QQLH 5HXMA 3RDTB 4MCYA 4I8DA 4HWBA 4XPFL 1HIMH 3WUZA 2BY1A 2MSPA 2APBA 2WWKT 1MCEA 2V7HB 3V4UL 4XCCL 1G6RL 3MREA 1B4RA 1U8QA 3MRCA 4P57B 3TO2A 5TF0A 4R0LB 4FFVC 1OT2A 2F8VA 3BKJH 3UTZB 2IGFH 3V0WH 2XFXA 1R0AH 4X6DE 3BYYA 4LPYA 4H26B 3R0MA 5EIIA 1RV6X 5SX5H 4F7TA 5HHXL 1VENA 3GMRB 3CSGA 2XA3A 3S7GA 3S6CA 4JZJA 5EO9B 5DD3L 4CMMB 3WIIL 5JHDA 4OGAD 5C8JA 5MEOA 3RZCD 3QI9A 3VXQB 5I0ZA 2CIIA 2HKHL 1MWAA 1HHJB 4IRJA 5DUPL 2OL3L 4H5SB 3IGAA 5IKCA 5I76A 3Q5OA 3RZCC 5D7SL 3SKUD 5HGHA 2OXHA 5H94A 5FGRA 5ISZE 3QHFL 2XTJD 4XGZB 4Z7WE 3D87B 4LASL 2UZIH 4NKIH 5E03A 1KIPB 4U1GB 3G08B 5HYSG 3ARGB 4J3OC 4P23C 3TBSA 5D8JL 3WS6A 3UZQA 1U42A 2DOCA 3M1BA 4PJ7B 4PJHA 3BP7B 4CVZB 1ACYH 2MOVA 1KJMA 3F7YB 5B38A 4YDVB 4OM0H 2O26U 1NC2A 1IM3B 3HG1B 1ZVSB 2W0PA 4FXGA 4QKXB 4HJJL 3FFCE 5F7DB 2FSEB 1T0MB 4NDMA 4KQ4L 1ITBB 1HKFA 3HC4L 1G6VK 3V6ZA 3RFZC 3W0WA 4L29A 1FFOA 4KUZH 4QO1A 4P5TC 4HUXB 4MXQD 1E4XI 4IMLB 1QSFA 4NM8H 1BREA 3IT8D 5DRNB 1EZVX 4RX4A 1CTNA 3IETB 3O9WD 4YPGA 4MXQC 2BVPA 4HV8A 1JGUH 3WDHA 3BPNB 2A9ML 4JN2B 3B2UD 2H1PL 3O6LH 2AEPL 3O9WC 4RA0C 4PGEB 5CBAB 2VL5A 5DRZB 1LK2A 3UYPA 3VXPB 3QT2A 3FQTA 3QEGH 4AIXA 1M71B 5DD6A 2PYED 4WHYH 3GHEH 1F8TH 4TPRH 1LGVA 35C8L 1Y18B 4KGLA 1CXLA 3JWDC 2IH1B 1SEQH 3OKNB 3R06A 2J4WL 2DIAA 3WL9B 1T1WB 3RAJL 1ZLWH 1CDIA 3LDBB 4IS6B 3DRQB 4P3DB 5DD0H 2EYRA 3MODL 3QNYA 2QKIB 3KPSA 4BFGA 2BNQE 3EZJB 4Z78B 1WBXA 3T2PA 1QRNA 1SM3H 2GFBA 2FIKB 1IQDB 4LGSB 1CT8B 4OZ4B 4P5MA 2AK1H 3UBXA 5FYLH 3Q6FB 1HINH 3CH8A 2ADJA 2EDFA 1Y6KR 3PWLB 2F58H 3QZWA 4N1EA 4NO3B 4YGAB 1YEJH 4JFEE 1X5KA 2CXKA 3D3VA 5DMIH 3VFWA 5DHYA 3FFDB 5BV7B 4OZHA 4P2QB 1I8LA 4Z77A 5IB2A 1JFQL 1UM5H 3BIKA 3QNXB 1JNJA 1QP1A 1DLFH 2AJVH 4OIAA 4NUGL 5C2BH 5JA9A 3CFIC 5I74B 4YNYB 1R3KB 1G9MH 1ZMYA 3MV7E 2XN9B 3GJFB 3MACL 2KZ1B 1VFOA 3DXAA 5DEFB 3CXHK 1RJYB 5JNYA 1CIDA 3HR5A 4NKMA 4JQVC 1XGQB 1IGCH 4NKDB 2HYMA 4Q7DA 3O0RL 3T0ED 1HQRA 2CK2A 1I85A 4PLJC 1TZIA 4FN0A 4IJ3C 3PL6D 1YYML 2HT2D 1OGTB 5E9DE 1BGXH 4OGYL 2F74B 5DMYA 3MLYL 4PGCA 4OD2B 4E41E 3CVIH 3CXDH 3BHBA 4FFYH 4P5KB 1L0QA 3OB0H 5ISZD 3D85D 3FT2A 1OCWH 3TPUA 1PSKL 1HXYB 1H15B 1MCJA 4Z0XB 4WTWA 5EIQA 1NMAH 3OKEA 4ODWA 5T3ZE 3K4DA 4C56A 3DVGA 4EN3A 1RJLA 2G60H 1T21A 4Y4FB 2Z92A 3DVNA 3HHRB 5JXEC 4GRMB 2A1WH 5E08H 3EOTL 1I7ZB 2NXZD 3OKLB 2Y4SA 3EO0A 1ZT1B 1U8JA 3VWKC 2DKSA 5I1EH 5I8KH 3PGFL 5C86A 4HLJA 5SV4A 4UNTA 3MR9B 3G6JE 2VLJE 1JZ4A 3BKYH 3DX9A 3VFUA 1R3JB 1JV5B 5FO7B 5K59F 5D5MB 1A6VH 3GM8A 3WEXB 3VFTA 3BO8A 1I8IB 2VWEE 2IQAA 1A5FL 4AQ1B 4L8SC 5E1AB 1QRKA 1LDPH 3QDME 1U8IA 2X1WL 3D5OF 6FABH 3QEQA 1QBML 4XWOD 3DSFH 2BNUA 1SJEB 2VLME 4J3UA 2D4FA 3O11B 3QUML 4XPFH 2HRLA 43C9B 4KGJA 5E00A 2Q86B 1U8PA 1WBYB 2Y6SD 1N5AB 3QG7L 3V4UH 4XCCH 1G6RH 4UDTA 1N59B 5EU3B 3NN8B 4XNQB 5BJTA 4X4XB 5D7JB 1HZHL 3RNQA 4X9FA 1A7QL 1MFDH 4LLMA 2NYYD 4KTYA 4X6CE 1F6AB 1VSCA 5C09E 4GQPH 5CEXB 4JVWA 5F96L 5C0CE 3QDJA 2CMRL 3LY6A 5DHVB 5DD3H 2XQYK 3WIIH 4X6BA 3VFNA 5ITBL 3QUZD 2H9GB 2NY0D 5GRXG 3RWDB 2HVKB 2HKHH 4B41A 5CINL 4X7TB 1MCNA 1CDBA 5DUPH 3ZTNL 1CN4A 1HQ4B 1EDQA 2OL3H 3O3UN 1T0NB 3DV6A 3NFPB 1NAMB 1CGVA 5D7SH 2IAMA 4K3GA 4WI3A 5I0DA 1YEKH 4PJXE 3QHFH 4JRYB 4N90D 5TH2A 3IDNB 5CIPH 2IALB 3BH8B 1FZOB 4LASH 4NC1E 1I3RB 3MV7D 3C2SA 2RJMA 1TQCC 2KDGA 1Q9KA 4PJ5D 5IJVA 4JFYB 3U1SL 4N0RA 3BZ4A 1JPGA 5BMFL 4QT5B 1MAJA 3VDBA 4Z7UA 1FN4A 3HC0B 4PJCE 2PW1B 3OAUL 4UBDC 1HOCA 4LCYA 3DTXA 2V5TA 1S7TB 4KQ4H 5ESQB 4HIIB 2HFFA 1H3PL 3HC4H 1H0DA 4FABL 4EZMA 5EU4B 1E4WL 1RMFL 4QRRB 4LAQL 3QO1A 4PJDF 3MQIA 2NTFA 3MV8B 4OFDA 2JCCB 4NO0B 3OKMB 1X7QB 1UQSB 4KHXL 2J6EL 4M6NL 4LVOC 5EC1B 1U9KA 3VWJB 1I3GL 2A9MH 2YZ8A 4IOIA 5GSVB 3L95B 1I4FB 3MRRB 2H1PH 3WNPA 2KUTA 2AEPH 3TH4T 2FATL 1U8KB 4GRWF 1AE6L 1A6WL 1FG2A 2OJZH 1S9WA 1QACA 3I6LD 3JV5A 3MRGA 4GLRH 4Q2ZB 5D9SA 1OW0C 5FB8B 4MHHI 35C8H 1DBBL 4DWHA 4JDVB 2FB4L 2X41A 2MHAB 2DD8L 1FNSL 2OI9B 4NNYB 3HMXL 1TDQA 2J4WH 1KLGB 3UTTB 4LHUD 3RAJH 1NGXB 2F53D 4JFDA 3MRPA 1LEIA 2AXGA 3BWUC 4G7YL 1VERA 3SKMA 2UYLA 2GHWB 4DKFL 4F8QA 3QH3A 5C0BE 2IWGA 4PJBA 2HMID 1BVLA 2VO5A 2DQEL 3TIEA 4YHYB 3AGVA 1IC4L 2VWEC 3KPPA 3SKNA 5DJ8A 5J06A 1OPGL 5FUOL 1FC2D 4AT6A 4MXVF 4G8GB 1P6FA 3K0WA 5KBNC 1B90A 1XEDA 4NHUB 5D6DC 2J7LA 4BQ9A 3QIBC 5D93B 2XQBL 3E2HC 3P9MB 2HMIC 1XZ0A 2XWBA 1QVOB 3DBXB 1CF8L 3BE1L 3NH7L 4U1JB 1JFQH 4NUGH 3TZVB 1G9EA 1JGDA 2FECL 4Z18A 2FCBA 4KJQC 5DC4B 1A7PH 1XF1A 4NCC2 5LAXB 5C09D 4QTHA 3MACH 3H9SB 1ZLSH 1VACA 1E4KA 1FP5A 3DX6A 5C0CD 1F5WA 2OQJA 4LIQE 5BRZA 4LCCB 2ZOKB 4ODSL 3O0RH 3MYJB 4D0DA 1BX2A 2OMBA 1AGDA 4PRNA 2Y07L 4LSSL 1RQ5A 1YYMH 3MLYH 5K9OA 4N0UE 3H0TA 5JORB 4HUVA 4YHNB 3CPLB 4HFWB 3SDXF 4S2SB 1YY9D 3IFNL 5ID1B 1WZ1H 2LABA 2APFA 1C5DB 1PSKH 3QCTH 4JO2L 4Y16B 4JFFE 4Q9QH 3PWNA 3B9AA 3KPMA 1AGBA 4G6FB 1QD0A 1YY9C 5CJXC 2VSDA 4WW2F 5FO9A 1K4DB 3HZKA 4NC1C 2YPLB 4CUCA 3IXAB 2R23B 3GSOB 5DO2D 1T2XA 1AGEB 4LAJH 5IBUG 3EOTH 4U6XA 4WI8A 4G8FB 1U8LA 1FVEB 4KKBC 4ETQA 4LPUA 1PQZB 1D9KC 4O2FA 4WVRA 3D6GA 1HHHB 3ECBB 1WJ3A 5JIKA 4UT6L 3TC9A 4MS8C 4LQ1A 2XNAB 5B3JE 2QHRL 4HKZB 3PV6A 5E0QA 4UU9B 3A0OA 4GUPA 5CEZL 3DJ9A 1X5LA 1A5FH 3BT2L 4PGBB 3FO2B 5CWSB 4HIHB 1KJ3H 3KPQA 4NRXA 4F3FB 1XMWA 2YXFA 4EJ1C 2IG2H 3EFFA 5D2NE 2HFGL 1QBMH 2CKBL 2YUXA 1ADQH 3MRLA 5FYJU 5DS8A 3R8BB 3ZDXE 2LVEA 1KC5L 2B2XL 3VH8B 1WFOA 1FH5L 1D5ZA 4N9OB 4CNIB 2BFVL 4TUOA 4EOWL 1V5JA 3EDDA 3BOVA 3P0GB 3OHXA 3L1OL 4QHMA 5E56A 3T8XA 1N8ZB 5FKAB 3UTQB 2X7LA 1TPXB 1U3HA 1HZHH 1A7QH 1IGMH 1VGEL 1DL7L 4J7RA 4Z7UE 1Q9WA 3LPFA 2Z8SA 1S7RA 4QXTA 1G6RA 5JOEA 5F96H 2PXYA 4OV5B 5TE4L 1P9MA 2EH8L 2DYPA 1HWHB 1R3HA 2YWYA 5TDPA 2CMRH 1Y6MR 2QSTA 4MA8L 3BD4A 5IQ9A 4NQDB 5ITBH 3CFJB 3KYMA 4YXKL 5L2KB 5CINH 3V7MA 3C8KA 2V17L 3ZTNH 5IM7B 4QGTA 2D4DA 3AFLA 5HGBB 1L9MA 1E6JL 4M93C 2OTUA 2V2WA 2VABA 3BSZH 1CDYA 1HCVA 1BAFH 1AXSA 4F80A 4G8EA 4F58H 3P4NB 2DQUL 2NLJA 3ETBF 5CD3A 4MA3B 5IWLC 3KPRB 2BC4B 2OL3A 3HI1B 2X4NA 5D2LB 1FZMA 1KTDA 5CD5D 2XTLA 5BMFH 1P1ZB 4F7CB 1AQDA 4XP6L 3ULUE 5DEGA 3UPAA 1D5XA 1WC7B 2VLRB 3O8XD 4H8WL 5C0DA 2GK2A 3OAUH 5GS0D 3FQUB 5CD5C 4XCEB 2ZG1A 25C8L 4X4ZA 3O3DB 5GS3A 1EFXA 1H3PH 4N5ED 2HJFB 3DUUB 4YUEL 1E4WH 1RMFH 2R4RL 3KNBB 4LAQH 4OFYD 1YEGH 3UJJL 4NFBA 5GS0C 2V2TA 1HH9B 3IS1X 1CLOL 4EI5A 4MD5B 5CP7B 4TTDC 4JFFD 1PJ9A 5GRVK 3G5ZB 4N5EC 3VD3A 4EUPG 4RGNB 3IDGB 5EDXA 4KHXH 2J6EH 4M6NH 4MNHA 5IJKA 3O2VL 2B20A 3UROR 1TLKA 1T1ZA 3EDEA 1EEYB 5I9QB 1F45A 2ORBL 3HNSL 1I3GH 1GL4B 4HDIB 4XBPA 3HNTL 1EVTC 2FATH 2NY6D 4MJ5A 4JZNB 3V6FB 2P42B 1AE6H 5D7KE 1A6WH 2CK0L 2Z8WC 1U8NB 5FYJE 5D1QA 1NGZB 3DSNA 3U2SA 4WO4B 5GGSA 4FZ8L 4J4PA 3JUYA 5D72L 4GW1B 2NY6C 4AEFA 3ARFA 1DBBH 5HPMB 1DDHA 5ERWB 1NFIA 3IDJB 4O51B 1PY9A 2DD8H 3M17A 1FNSH 4Y4HB 1A1MB 3HMXH 5F21B 3SBWA 5BVJB 3L3HB 5L0QB 3IRZA 2BRQA 5D7IE 5C0GA 3HAEG 4GRLD 4G7YH 1OWWA 4HLZH 4LRIA 4R4ND 4XCNB 2DQEH 4FQCH 3TIDA 1IC4H 3PDOA 4WI5A 5HYQA 2FO4A 2J8UB 3HE6B 1OPGH 1FNGB 5CGMA 2OJEB 1ZA3B 3AAZA 3DETD 3H9YA 2XY2A 2JB6A 4NZUL 4OM1L 4R4NC 4UUJA 4WU7B 5D2NC 2XQBH 1DQDL 4DVBA 4N0FB 2E27L 1LP9E 4QRUA 5L2JA 1CF8H 2BOCB 4ORGB 1BZQK 2GT9B 5D1ZA 3NH7H 4PBVC 5DURD 3EYFB 4PY8J 3O6FD 2ADIA 2FX8L 2OX5A 2EYTA 1J8HB 2EDWA 2DQTL 3L3GB 2F5AL 1A6AB 1IL1A 4OF8A 1G7HB 4Z5RA 3VXNB 3CFEA 3E0GA 5HHPB 3OKOA 1AHWC 1EEUA 4ODSH 4QY8B 1ERNA 3IU3A 3ALPA 1UWXH 1S78D 4I5BB 5BVPH 2Y07H 3NABL 3BFOA 1A1NB 4LSSH 4N8VG 4OCXH 2ZUSA 2VDKL 3UTPE 5E6YA 2YC1B 2ZSVB 4GSDL 4YPJA 1S78C 1HILA 1MPAL 4RGOL 2WWMD 5IVXA 2PTTA 4NGHL 32C2B 4PRHE 4HK0A 4JO2H 5C08E 4KJYB 4HWUA 1ZLWK 2WK2A 1S9KC 2WWMC 4NM4L 3RWGB 1FYTE 3FB8B 2DLFL 3HZMB 5EZJA 1OAYH 3T65A 1A4KB 3UYOD 3ULUD 5F7KC 2WSKA 4CDGC 1YPZE 1ZHLB 4QRPB 2BOBA 3VXTB 5F1OB 1VADA 2DF3A 1R5VA 1A2YB 5KS9F 1KEML 2ICWB 1FNFA 2IQ9L 3ZKND 5LXGL 2P5WA 3ULUC 5C0AE 1GGBL 3SY0A 1S8DA 5F8RC 2J5LC 2X4TA 4H0GA 4U1LA 1AO7B 4UT6H 5F93C 3W82A 4FQLL 2W92A 4OGZA 1BQSA 2R0LL 2QHRH 1U8HA 4XI5D 3EFDL 2ZOLA 1UKSA 5CLTA 5CEZH 5DJDB 3GSXB 3SJVB 4S1DC 1AFVL 2QBWA 2DM2A 3BT2H 5FO8A 4RSVA 1U93B 2EIBA 1ZA6A 1M7IA 1G7JB 2CKBH 2H45A 2ZUVA 2B2XH 2EZ0D 2MMXA 4C4KO 3ZE1F 1FH5H 2E9IA 4PY7B 5FYJD 3U4EB 2BFVH 3N9GL 5E5MB 5EBLB 4EOWH 3WFEH 1SYSB 4DCQB 4JPWL 4ONOA 1NSNH 3PXHA 3L1OH 5CGTA 3OB0K 5BS0D 2P8MA 5KSBB 5LQBL 1XR8B 4GOSA 2A6DB 3IB4A 2P1YA 3QUMA 3QQ9D 4QRSB 1M7DA 1VGEH 1DL7H 1D5BB 3DGCR 5F1IA 3D2UA 4X9GA 3HUJA 3OKDA 2ATKB 4PJIF 2HN7B 3O3BA 3IAGC 2EDQA 2EH8H 3CZFB 4OUUB 5MERB 3TN0B 4OZGE 5EU7E 1W72B 4LARL 3DWTA 4LSQL 1PY4A 3PL6A 2EH7L 4MA8H 1LO3L 2QQNH 5JUEH 4XNZC 1U0QA 4U2YA 2H3NB 3K1KC 1N3NB 4YXKH 2XPGA 5ID0B 1H3XA 1TQBC 3VMOA 2V17H 4ZTOL 4L8CB 3GSNL 3G6DL 2G5RA 4HKBA 1NCCL 3MNVB 1N6VA 1KUMA 2RR3A 3L5JA 2MQ0A 5L8KB 2I9LA 4X6DF 4FQXA 4WFFE 4YHPB 2DQUH 1BLNA 3LRSA 4HCRL 3X12B 5JLZA 3ZTJG 3HUJF 3CNKA 4NZTH 3VXUB 4R90H 2V7NA 4MAUL 3WMSA 5I66A 4AL8H 1R5IA 1I8KB 4H8WH 3QYCA 2Q6WB 4ZNEA 1RJZA 1KN2L 4PV8B 3I85A 1KGCD 3UTPD 5I6XC 1NMCB 1MFAL 5IB5A 2QADC 3LOWA 3QEHA 3JVGC 1CCZA 4YUEH 1IEBB 3UJJH 4WI4A 1CLOH 2QEJA 4PRHD 4Z7WF 5FYJL 5C08D 3V52L 3FTGA 4M62L 4ZUUB 5F7UA 1FYTD 3WIHL 1RY7B 1JVKA 4JQIH 1A7OL 3GUTB 3O2VH 3HLAB 2D31A 3IF1B 4PUBL 3GEWB 2B5IB 1VEOA 2OTWA 5TDNA 5JW5A 2ORBH 3HNSH 3PABA 5EBMB 4U3CA 5CJ8A 1H5BC 4U1NB 1KBGH 1FE8L 3FCTA 2CK0H 5C0AD 4CU6A 1N5YL 2J6EA 1N2RA 4IRSD 3QG6A 3BEWA 1A6UH 2P5EB 3QRFM 2BHZA 3G5XB 3N1GC 2X4QB 3FO9A 5D72H 3S35L 3HFMH 4R2GB 4XVSL 1KJ2L 2YN3A 3MRKB 4LLVA 4GBXD 2ZUTA 5HGAB 3VGHA 3Q6GL 1IGYB 4LPTA 2J2ZA 4FQJH 1J0HA 5MI0B 3ZDYE 3H3KA 4Y5VB 3PQYD 2DWDB 3CCHA 5ESVA 4LLUB 3QUZA 2A74B 2QQQA 1BVKA 5IQ7H 1WFNA 4J3VA 3IAPA 3HMXA 2KL6A 4HS6A 1ZKAA 3CDGB 2E7MA 4MGXA 3U36A 1KEGL 3E1F1 4APQA 5LGHH 4OM1H 2VR4A 3GNML 4LIQH 4N8PA 5AUMA 3EHBD 1DQDH 4TULL 4QRTA 3T08A 2E27H 1INEL 2GUOB 1MJJB 3HI5H 3T2NL 3V5DB 5FFLA 5BXFA 1RVFL 1AXTL 4NJ9L 3BGFC 2FX8H 5GS0H 2K7QA 4PJ5A 1WCBB 4LBEA 3SDDB 2DQTH 1G84A 4N9GA 1ZLUH 4O2CA 2F54E 1EERB 1TVBB 4KY1L 3U82B 5FM8A 3S9DB 3LPGA 1DQJB 4KDTA 2OBGA 1RZIB 5CS7A 2EDXA 5JTWA 2NY1C 5KJRH 1JGEA 5JPNB 4OT1H 3NABH 5EU7C 5FYKD 2X2YA 3QXDB 2OCFD 1ZOXA 5TDOA 4N1HB 2GSGB 1Z5LB 3EO1A 3CSYB 2D0HA 4RGOH 3T4AA 5EO0A 2Z91B 5HVHB 5EZIL 5A3IC 1INQA 4OCWL 1NAKL 4PJDB 1H3TA 3MBXL 4NHCL 5E8OB 2XRAL 2R0KL 4YC2B 3S35X 1T20B 2QLVB 5F9OL 1RUQL 4NM4H 4QYOB 5JW3L 2DLFH 1JWUA 4XC3L 5IHLB 1JTTA 3EYOA 4JRXD 1IGJB 4ZQKB 3W9DB 4XX1G 2GTWA 1KEMH 3D39D 2AAVA 2IQ9H 5LXGH 5GS1C 2P8LB 3MSPA 2XWTA 3LD8C 4MNQD 1F11A 1GGBH 4NC0B 4GRWB 3HI6L 4CADA 4UQ2A 4UIMA 3P30L 5F9WB 5TQ2L 4HF5L 1ZEAL 4OZIA 1CFSB 4PTUA 1U91A 1IKFH 4LCIL 4FQLH 4E42B 2R0LH 3EFDH 2F53A 4I3RL 1Q1JL 4ODXB 1T04B 5CGYC 3C8DA 3ROOB 4P46B 2BNRB 1AFVH 3OV6A 1Z9SA 3MLPA 4M5YH 3E6HB 4Q6IA 3WCYA 1BMGA 3SDAA 3JV6A 1AD9B 4YHML 1MVUA 5DZOA 1G9NC 3TBYA 3MNWA 4ZUTB 1PVHA 2C1PB 2XI9A 1UT9A 4IMKA 3HB3D 1FHGA 4JY6B 1ZT4B 3RGVB 3GB7A 4C54A 3N9GH 4X9BA 3RKPA 4JPWH 4EDXA 1IAKA 4K2UL 1SYVB 3LKRB 3G6JF 2CH8A 2CKBA 3HE7C 4FQ1H 3REVB 3C5ZC 5KSAB 5MENB 4F57L 5LQBH 2A73B 4HH9B 2EDDA 3LIZL 5FYKL 3LMJL 3PG2A 5D1XC 3TFKD 3Q5TA 4OLUL 3RWJA 3GSVB 4XPGL 3KLAB 4AMKL 4S0SD 1YMMB 3H7BA 4JY4A 3AS3A 4MLSA 4BZ2L 3EOBB 1RUKL 3QIWB 4LARH 3TFKC 4LSQH 4JKPL 3VFRA 1G7IA 4XMKL 1LO3H 5CLWA 5CSBA 5DRXA 1J1XL 3ULVD 2HG5A 4DK3A 4LEXH 4ZTOH 3IFPB 4JFZL 3GSNH 4ZOAA 4K23L 3QCVL 2EIZA 4Z7QE 1CG9A 3FOLB 5H2BB 4ERSH 4JPKH 2R2HB 3MBEB 5IIEB 4RMUA 4DGYL 2F54D 2QSCL 2G5BA 4X6CF 3MV9A 1ZAGA 1NBZB 4DUXA 3WLWD 4HCRH 3VDAA 1NCAL 3QIUA 1XGYL 4L8DB 3D1MC 4WW2B 2Z4QB 2AQ3A 1QKZL 5HSFA 4MWFA 4XVUD 4X98A 1KN2H 4Y8AA 1HI6A 1EO8L 3FOMA 1A8JH 1OOAA 3SE3C 4DZ8A 5GSRB 1MFAH 3DO7B 2YD3A 4WRLA 5EO1A 1GC1C 4MYWB 4XVUC 3T09A 1A9EA 4I2XA 1S7WB 5E2WL 3MUGB 1QEWA 4BSWB 4PJXF 3QDGB 1UJ3C 4Y1AE 3MCLL 5FYJH 4TSBH 4X99A 3V52H 3MRMB 1I1AB 5C07E 4M62H 5EH1A 1DEEB 1A22B 2H2PD 3WIHH 3O4LB 4K9EL 1A7OH 1D6EB 3NTCL 4G3YH 4U6VL 3ZYIA 4PUBH 4PRIB 2ARJA 4HMEA 3QFJD 4HKXB 1K8DB 1EX0A 3CVHL 4K7PL 4GQ9L 4ZG1A 4OGXL 3BIBX 2H2PC 4PJCF 4WFGE 1FE8H 3RPIA 3MRHA 1V7ML 1N5YH 3DIFB 5EC2A 4FS0A 1K5NB 4Z76B 4ZS7L 4BK5A 3RUGE 5KN5B 3BMWA 5D7LE 2BSTB 1T83C 3S35H 4FTVA 4XVSH 1KJ2H 1GGYA 3P9LB 3VI3E 1F4HA 2JJTC 1UWGL 3ULVL 4I4WA 5A16A 3NA9L 2F19L 3ESUF 1EXUB 1EJ6A 5HHVL 4I3SL 4PJGB 1OD7A 1FNEB 2H32H 2WUCL 5E4IA 3VRIA 5ICYB 4TSAL 4R96A 1IAOA 3CFKB 3RDTD 4HZAA 2MJWA 1M4KA 4ORZC 1AY1L 1F02I 5GZND 5E95B 4ELKA 2P47B 1A6TA 4FQ2L 3P0YL 1MCKA 1KEGH 5E8NB 4ZSOB 5JIIA 4I0PC 2A2QT 3GNMH 2NXYB 2PNDA 2ESVE 4TULH 1FL3A 5C92A 3DROA 5HDOA 4HWNA 2Y5EA 2C3XA 1M05B 3T2NH 1CD1B 2FBJH 2DWEB 1F3JB 4WW1B 4XAWL 1RVFH 2B39A 3P73B 4FQXC 1AXTH 4KFZC 1C7SA 1WIOA 3SGJC 3BZDA 4R0LC 1H3GA 2XN9E 1MRCL 1MRDH 1T6VN 4KRPB 2AEQL 3RY4A 4Y19A 3MMEA 4GLRI 1QTYT 1T7XA 3GMLA 3UAJD 4J6RL 1JMZA 3N0PB 3O8XA 2VXUL 5DZNA 1NANH 5LWYL 4NQXA 2LU3A 1EUTA 2K1MA 4Y5YA 2VUOA 1XCTB 2EDYA 3TCLA 4K7PX 5JOFA 3CDFA 4OFYA 3QQNA 2BX5A 2FZ3B 5EZIH 4NQTA 5EOQL 1GZPA 4WFEE 2C1OB 4OCWH 1NAKH 3ARGD 3NFNA 3MBXH 4NHCH 1MHEB 2XRAH 3DV4B 3W11C 4YHKL 2JJVA 5C0IB 3MA7A 2LU4A 1ZE3C 2A83A 1RUQH 4G5ZL 3MRNA 1SJHA 4OF6A 1ZWIA 4XC3H 3HG1D 3ARGC 5EUOA 1U8OA 4J3TA 4NYLA 1MJ8H 3D25A 4YAQB 3DX7B 5DJ2B 5BW7A 4MQSB 2XY1A 4N0YL 1T5XA 4K55A 5HHNB 2CDFB 4JPVL 2O93L 3HI6H 1SQ2N 3P30H 5TQ2H 4HF5H 1ZEAH 5CHNB 3SE8L 3T04D 4MNGB 1CE6B 4LCIH 2FEDD 1YY8A 4PJ9B 3BPLB 1F3DJ 1LEGB 1Q1JH 4GRLA 4BKLB 5I73B 4HT1L 1KTLA 3K46A 4CRPA 1J87A 1YQVH 3IDXH 5F7WC 3GMOA 5C0FA 3DRTA 2FJHB 5CJQL 5CSZA 2MTPA 4EUPH 5HGDB 1PX3A 5I1DB 5ETUB 4APQC 4AZ8A 4WFGD 3JZ7A 1UWXK 1XF5A 4O2EA 2KZWA 3REWA 4PV9B 1BOGA 4X4ME 3K2UL 1LE5A 2Y7QA 1JWSB 4PREB 3O6FA 3U30C 5FECB 4K2UH 1LO4H 2YPVH 4UOJA 5E1HB 2CJUL 2IANB 3RWHA 4NWTH 5B3JF 2ED7A 1CFBA 5FYKH 3LIZH 3LMJH 3QRGL 4G7VL 3UPCA 5KG9B 1KCLA 2GW5A 4OLUH 4XPGH 4KDTC 1QYGL 4AMKH 1YJDL 1TJHL 3BESR 3UZVB 3WDIA 4YX2L 4U1IA 2IADB 3ARBB 1C5BL 3LDBC 3QSKB 3HAEH 1RUKH 3ZSSA 5B21A 3NIFE 4JKPH 1W0WB 4XMKH 2ZNWA 3QDHA 1WBZB 1E27B 1J1XH 5DVNA 5E6IC 1MH5A 3LQZB 1IGIL 4OCSH 4J1UA 4HJGA 2HT4D 1OLZA 4MJ6A 2JKXA 2PYFA 1LNUB 5BV7C 3QCVH 2XN9D 4N5UA 5KSVA 4GMSL 4P23B 3SO3B 4DGYH 4OKVA 2QSCH 5EUKA 2HT4C 2A6IB 3GSNA 4LK4A 1NCAH 1S3KL 1FZJA 2F5BL 5EBWB 1ZHNB 1E28B 2B8OT 1BVZA 2JJUA 3NFSL 4M61A 5AZEL 4PJEA 3RTQB 2M26A 4K3DL 3VH8G 1HHGA 1CR9L 3RVUD 4PYGA 5KS9B 3MCG1 3VGFA 4HCRA 3TYFA 4P5TB 3LRGA 5SWSA 2I9TB 5FF6B 3T77A 2JCCE 2ZSWA 5E2WH 3RVUC 3OKKB 4AIZA 1Q94B 3MCLH 5CEYA 1UH4A 3ZL4L 5J9PA 3HS0A 3KG5A 4Y4FD 1QOKA 5DJXB 4ZUSA 4HUKB 4M1CD 2Y5TA 5DQDH 1I9IL 3ARZA 4K9EH 3KPLA 3WLBB 4R4BB 3O9WB 3DUSB 1X5AA 4B5EA 3ULUF 3FQWB 3CVHH 4L8BA 4PP2B 3TBVA 4GQ9H 4OGXH 4M1CC 3QJHB 4Q9BA 1RK1B 4K8RD 3BP5A 1J0YA 3WIHA 2JIXB 3IJSA 1V7MH 4KI5E 5BS0A 1LO2H 2VSCA 3UX9B 4L4TE 4ZS7H 1B2WL 2W65B 1RZGA 5FA3A 4K8RC 3O6KH 4M1DL 5D96C 5JOPE 4UB0H 3OF6D 4L9LB 3QQ4A 4MJIA 3OX8B 5BV7L 3ULVH 4ODHL 3NA9H 2F19H 4QHNB 3BUYA 1HXMB 4OQ1A 5HHME 2YS4A 3F5WA 4I3SH 5KSUB 1EAPA 1A9BA 2WUCH 1KJ2A 3LN5A 4K7PY 4TSAH 5E8EA 4P2CG 5GGRY 3OAYH 4V1DA 4ZUWA 5T1MA 4G8GE 2J3SA 4KK6D 4LKCB 4FQ2H 3P0YH 5JIHA 4TTGA 1PZUB 3ALXA 4TOYL 5F44A 4X5WB 4F7PB 4Z0BL 5E2JA 3ES6B 1ACZA 5F88A 4ACPA 3P0VL 2NCMA 3KYOA 2H32A 2Q3ZA 5D7JD 5AD0B 4NUJA 2AEWA 4XAWH 1GC1H 4G6KL 4JLRA 1J05B 1YN6B 4LRNL 3U0PA 2YKLL 3K74B 3E8UL 3VI4E 2Q7YA 2W60A 3L3DA 1MRCH 3E6FA 5HY9A 5D7JC 2HFEA 5D7IF 5DWUL 1ZT7B 3IDMA 5CBEA 4X6DB 4YHZL 2Z35B 5IMKB 3ZHLA 1NPUA 4J6RH 3W2DL 1I8MA 1VFAB 1JHKL 4QWWD 4OKDA 4IJ3B 4HUWA 3TNMA 1P5UA 2VXUH 1NGQL 5I1CL 5IFHL 5CUSL 5LWYH 4NQEB 4KKCD 3HPLB 4CVUA 4TUJB 3T1FA 3MROB 3FMGL 1LP9F 1MI5E 4E0RB 4JRYD 4L3EB 1W2KT 4B53A 4BSVA 1JHLL 4BSJA 2P7TA 2EICA 4A6YB 5EOQH 3PGDA 1UM4H 3QR2A 1R5WA 3QXAA 2AJZA 3DPBA 4ZYKA 4CW1B 2EC9T 3VFMB 1LD9A 4Z7WB 3B9KB 4XP4L 2CLRB 4ISVB 4KK5D 4G5ZH 1MIEH 5I8EA 3WHXB 1AJ7H 3GSQB 2XQYG 3N1PC 15C8H 2NW2A 3F12A 4X7DC 3DYOA 2X4OA 1EHLL 4NQVA 5F8QC 4IOSD 3THMH 1TITA 1J12A 4KK5C 2FECI 4IRSA 3VWKB 1AD0B 4XP1L 2WNGA 3RL1A 1D6VL 2GEEA 4JPVH 1P7KB 4QRRD 4YHIB 3FFCB 43CAA 4PJAE 3KXFA 1TCMA 4GH7B 3MV8D 3SO5A 5A40E 4QOKE 5FAAA 4NO0D 3KDMB 4WEMB 4ZMAT 4GBXA 1AR1D 1DCLA 5IVZB 4GKSB 1U3JA 4RDQF 4HT1H 3FRPA 5F7NC 4L8SB 5J6GB 1K4CB 3MRDA 1ZVYA 3D9AL 2VDLL 3PQYA 3K8MA 1BIIA 3MJGX 4WEUD 1J9CT 1CS6A 3VWJD 4U4BA 1ZHKA 3GSRB 1YYLL 3M45A 3VRJA 5E8PB 4LCUA 4YGVA 2HT3D 1E4JA 3ARRA 4ZPVA 1YPZF 4M7JL 3QPQC 1MHPL 1HE7A 4A2MA 5DTFA 1BQLH 4LGRB 1QA9B 1IC5L 3IDIA 3VWJC 3I75B 2X1PA 4KI5D 1BFOA 5ICXA 3QFDB 3K2UH 3CX5K 3VFOA 4LNRA 2HT3C 5FM5O 1BM3L 5I8CA 4CN1A 3U9UA 3WN5A 4EUPA 2HJKB 1KULA 2VDQH 1Q9OA 2XACC 5I18L 3C5SA 2BCKB 2AK4E 2CJUH 4I18A 1C12A 5JOPD 3G9VA 4KI5C 4UZGA 5IMLA 3FKUS 3WIFB 2IPUG 2H26A 3B8YA 1KIRA 4KXZH 1NAML 1WAAA 5GGVY 1QYGH 4IHOA 1YJDH 1TJHH 2OI9C 2M8XA 4YX2H 3O3AB 5I19L 1C5BH 1XGRA 4F2MB 1NJ9A 3B83A 4NQDE 1I9RL 1RZJC 2WBJD 4G8GD 4IDJL 2BNQB 3IJYA 4UDUB 5L2KE 5LGHL 4O5LL 1UVQB 1OLLA 1V8HA 4URTB 4XNUL 1IGIH 2AV1A 2WBJC 3HZVA 2VNCA 3HAEA 1KB9J 4FQPA 3S97C 3T0BA 3D0VB 4JFEB 1S7UB 3MV11 5DGRA 1X5FA 1TQCB 3H9SD 2W9LA 1AP2A 3KPRE 4GMSH 5FGSA 1GCFA 4G8IB 4MMXC 4LSDA 1T89A 2QR0A 1F2XK 1VFBB 1VFMA 4PG9B 1MJUL 3MV7B 5F97E 2OTPA 1K9TA 4JRXA 2D3VA 3NBNA 4OZGF 4HMDA 1Q0YL 2IPTH 2YPKB 3D39A 1S3KH 1HHIB 4HAFA 4JFHE 4MNQA 1FVCA 4LCCC 3NFSH 3HTLX 12E8L 4X8XA 5AZEH 1UFUA 4U6YA 3W39A 1F13A 1CR9H 1V3MA 4UTAL 4PJFA 1MI5D 5JPMB 5E9DB 1MUJA 4U1HA 3DGGB 3MCKA 3KS0J 4WTZG 4E41B 4Y16D 3STLA 4WDIA 1MIML 1TJIL 1WTLA 3VGAB 1G0DA 2PO6B 4G6FD 1ZLVK 4RGNE 3RVWD 3ZL4H 2ZUYA 3L5WB 2BY2A 4Q9CA 1NUNB 4LVOB 4UIKL 3QUXD 4N8VA 2UY7A 1YNLL 3MRJA 4FQQA 1I9IH 5E94B 4JO3L 3RRQA 1ZGLA 4YDIH 3BYTA 4PLOB 1JGLL 1UCTA 3MREB 3MOQA 3QUXC 1U8QB 1ORSA 3X3GL 4R3SA 5DDHB 1TIUA 2XFXB 4GS7C 4OAWA 3ZKSD 1EK3A 1B2WH 3JV4A 4L3CA 1R24B 3F6LA 1UB6A 3CVHA 5EIIB 3UPRB 2VXSL 1UH2A 4F7TB 3IKCB 5DQJA 5GGRA 3T0DA 4M1DH 3PWVA 5EOCL 2VLJB 4R26H 4DQOL 3LQAL 5BV7H 2WIIA 2NNAA 5I1AB 4MQ7B 3VFVA 3BEVB 2YXMA 2A0LD 4FP8L 4WHTA 1J1PH 9CGTA 5JHDB 1FL6B 1UXWB 5MEOB 3QI9B 4LHUB 5HTSA 4KRLB 3KWWA 3GJFH 3QDMB 1MHHB 4JKLA 1YEIL 4K07A 5K9QG 2C7UA 4BQCA 3QIBB 3E2HB 5HGHB 4TOYH 5KOVC 5E70A 4QRQA 5F3HB 4Z0BH 4OFPA 1U2HA 3MZTA 1XR9B 5F1NA 3TVMA 4WNQA 4G6KH 1J8HE 4LRNH 3TBSB 3QAZC 3E8UH 5DK0B 5J1TC 1MFCL 1TPXC 1Q72L 1OSZA 5B38B 4WV1A 1NC2B 1EHNA 3BN9D 4YHZH 3QISA 3QJFA 4P9HC 2H6PB 4X6CB 4FXGB 3B4NA 4B0MM 3KS0H 4NQDD 3KLHD 4YXHL 3W2DH 1L0YA 5F1SA 1NCWL 1JHKH 1WK0A 2AXFA 3BDYL 4YHOL 3ILPB 5C0CB 5L2KD 3TLRA 5I1CH 1FJ1A 4G9FA 3BN9C 4KVCL 1I9EA 1L9NA 3W0WB 5C0JA 5CUSH 5F3BB 5IFHH 1SJVA 1UXSA 3KLHC 1JPST 3ZE0E 4P9MH 1LO0L 1QSFB 3ULVF 4GG6E 3HC3L 1MCHA 1JZ3A 1HDMA 4GMTL 2RHEA 4LEOA 1JHLH 4YPGB 1RAMA 4ZAKD 1MRFL 4MX7B 3KPRD 2DQHL 5IW6A 1MCPL 1LO5A 4PGDA 4ZFOL 4XP4H 1B0GB 3HRPA 5F7FA 3U7YL 3ELAT 4DUVA 2GJZB 3QFJA 2RFXA 4AENA 2BRRL 2QHLA 1LK2B 3MGOA 2RGSA 3MLXL 4ZAKC 3VXRA 5T1KA 1GJIA 1J5OL 4HS3A 1QUNA 1QLFB 3FQTB 1YEDA 4JFHD 3TJEH 1B9ZA 1EHLH 2E9WA 3MRBB 3SDCA 1MJ7L 3ARDA 3L9RB 4J8RA 1DVFC 1WEJL 5I2IB 1D9KB 2YD5A 3GJEA 4PJCB 4XP1H 5I1GL 3O2WH 5I30L 4JGMA 1ZSDA 1D6VH 2FYYA 4OCRL 3R06B 1RZ7L 1NL0L 4GKZB 5DA0B 1PAMA 3GGWA 2EYRB 3QNYB 4K71C 2VZVA 2EDRA 4R7DA 4RGND 3SJVE 3B6SA 2Z8RA 1YN7B 2B4CC 4XXDA 1QRNB 5IVNA 1W0VA 3D9AH 2VDLH 4LGPB 5FXCH 5JMOC 4WHDA 2CR6A 4C83B 3RDTA 4P5MB 3BGMA 1LWRA 1NQBA 3UBXB 4RGNC 4JJ5A 4XNYL 1YYLH 3OKYA 4BFIA 1MFBL 4HIJB 2ADJB 2V7HA 4M7JH 3QZWB 1HEZB 1MHPH 4P2RA 2ITCB 2R56L 3D3VB 4P57A 3VFWB 5DHYB 4OZHB 1CXKA 4WO4D 4Z77B 5JR1L 1EEZA 3BIKB 5DHVH 1M7XA 3IXTB 5EG6C 3UTZA 3AU1A 1BM3H 3FB5B 4H26A 1LHZA 3AC0A 5I18H 1KCUL 1XGPA 5KSBE 1GYAA 4WO4C 4Y4HD 5AYQA 4ZFGH 4XTRD 5JNYB 3HR5B 1JZ8A 1KPRA 4NKMB 3DARA 3SKJH 4H25B 4CMMA 1NAMH 1QHPA 2VAAB 4W4NA 3VXQA 5I19H 4L4JA 4XTRC 2AV7A 5ENWB 5T5FL 4OI7A 2OLDA 1I9RH 3HE6D 3AM8A 4IDJH 5C0BB 4H5SA 3RL2A 5EOCJ 2ADGB 4HWEL 2YWZA 1HYRC 4R7NB 3FT2B 3GMNA 4RIRA 4XGZA 3TPUB 3GKWL 4M93B 3KYNA 4U6TA 1JHTA 3T2OA 1J86A 3G08A 4XXCA 1J8HD 3JSSA 4ONFH 2FHFA 3LS4L 2DQGL 4HIXH 3DVGB 4C56B 1X5YA 1T21B 4PJ7A 3WS3B 5JW4N 2Z92B 3QUKA 3DVNB 4YDVA 5IHUL 1ZVSA 3BW9B 1MJUH 3VXUE 2FR4B 5F7DA 1T0MA 3GI8L 3EYVB 1Q0YH 2VQ1B 4I13B 3W5MA 3FT4A 1T7ZA 2VH5H 12E8H 4M7ZC 3RX8A 4Y4KA 5GGTA 3ESVF 3VRLE 5IF0A 3X17A 3IETA 4BA8A 4LNVA 5INCB 4N0UB 2DKMA 5FOBB 1W0YT 1MIMH 4Z7QF 5BCAA 1FL5B 5IG7B 1JWMB 1U8IB 3PJSA 3QEQB 2BNUB 4JN2A 4M00A 4UIKH 3GI9L 4PGEA 5CBAA 2EEDA 5DRZA 1LMKA 5E00B 5DMKA 1U8PB 3F62A 1M71A 1NLDL 4ZXBA 1OF2A 2AJUH 2Q76A 1F4YL 4UDTB 1X3DA 5GPRA 5IROC 3ZHDA 4K94C 1Y18A 5BJTB 5IW1A 3WN5C 1G7MB 2P5EE 3LKPB 1OGAA 1CFVL 1P7QB 1AO7D 4XMPL 3WL9A 1T1WA 3VD5A 2VXSH 3DRQA 4P3DA 2YSSA 3SJVD 2DBLL 2CGRH 1BD2A 3LQAH 4GXUM 2AI0L 3C6SA 1X5IA 1Z0NA 2FIKA 3VFNB 3LEVL 1G1CA 1NGYA 4FP8H 4OZ4A 2ICCA 4QXUL 4YBQD 1DN0B 2IFFH 4LCWE 1FGNL 5EULV 3LKNA 1S7XA 3PWLA 3KAAA 4NO3A 4PR5B 3LKQB 4ELMA 4PG2A 5JHLL 1YEIH 3FFDA 5D2NB 4P2QA 3DV6B 3MJ7B 2IAMB 3FN0H 3X11A 4BJLA 1DBAH 4JHZA 5TH2B 5I8OL 4NN6B 1MREL 1ES0B 2N56A 3CXHJ 4MB3A 3GJFA 1JL8A 2NY7H 1IKNA 5TQ0L 4F9LC 5IJVB 3VI3F 5DEFA 2VB5A 1RJYA 2OR7A 3BX7C 3EZ8A 4Q97A 1T89C 1XGQA 1MFCH 4G43B 4MDIA 1OM3L 1Q72H 4RGMB 5GGQL 1I3UA 4Z7UB 1AHWB 5F6HJ 1L0XA 4YXHH 5KVDL 4W70A 4YHOH 4OD2A 2XYCA 1GHFL 4P5KA 4KVCH 1CXFA 1OTUD 3RWEB 3WDJA 4L4VE 4ZD3L 3QO1B 1LO0H 2NTFB 3AXLB 4GKNB 1HXYA 1H15A 3NZ8A 3HC3H 1MFEL 4M03A 4GMTH 1OTUC 3QQ3B 5D71L 4KHTL 5EA0L 5J3HC 4Y4FA 1CLZL 1MRFH 2DQHH 4D0BA 1EHXA 4G42B 5GQBA 1P2CB 1MSPA 4XAKE 5EZOL 1EHAA 5GRJH 4WUUE 1KLUB 3U7YH 3ME0A 3U7WL 3VXUD 2BRRH 5HHOE 5T1LA 1J5OH 3TCXA 2ID5A 1ZT1A 2OK0L 2G75B 4YBLB 1HKLH 4GAFB 3T3ME 2APVA 1MJ7H 2VZSA 2J5LB 1WEJH 2BERA 5EPMA 5I1GH 5I30H 1YEHL 5F9JA 1JV5A 5D5MA 3RJDA 1RZ7H 3OF6A 1NL0H 1I8IA 3MRPB 1PLGL 4OD1H 5E1AA 1JZ5A 1NANI 2E7HA 2BNRE 4JHWL 1SJEA 1LVEA 4XCYB 3TIEB 2HLAB 3KGRA 3KPPB 4IOFD 4JM4L 2BVOA 3O11A 5DJ8B 2Q86A 2ZNXA 4XNYH 1MFBH 1N5AA 5E8DL 5L7XL 3VG0L 3QEUA 1MHCB 4CN6A 5TE7L 3HZYB 2C4FT 4IOFC 1N59A 4ZFZB 1H8OA 3NN8A 4UV4L 5JR1H 4XNQA 1TZGH 4DN4L 3L5HA 2P5ED 3MLTA 1KPVB 1N6QL 1TNMA 4S1SL 3MOAL 1JGDB 4R2GD 4WUKL 1I1YB 5EU6E 4NPYB 1YUHA 5I17B 1F6AA 1KCUH 2PN5A 1RD6A 4QTHB 3U48A 5CEXA 4WU5B 1T3FB 5AG8A 2DB8A 2EDOA 3IDYC 5DHVA 4R2GC 5BRZB 3AMKA 2E8ZA 1YMME 2I5YH 3ZKMD 4WJ5A 2H9GA 1U2CA 4J3WA 4OIIL 4LCWD 5D7IB 1AGDB 4OZFA 3VXME 4PRNB 1IEAB 3VMPA 5MI0C 5T5FH 4XNZB 2BDNL 3ZKMC 3H0TB 1VCAA 3MJ8B 1NAMA 4HUVB 4HWEH 5T33L 1TQBB 4Y88A 4F33B 1JPFA 3TWCL 4NBYB 4JRYA 3IDNA 2V9QA 2IALA 3BH8A 3SPVA 1FZOA 3GKWH 1KIUA 7FABL 1I3RA 3PWNB 3NCJL 1AGBB 1MAML 4PD4K 1MCIA 3SDDD 3LS4H 5FO9B 3HZKB 4U05A 2NX5E 2NY5L 3SCMD 3RY6C 3B5HA 3VFGL 2B4CH 5FGBA 1JN6B 3EOAB 3K7UA 5B8CC 1KT2A 2PW1A 1A4JA 1QPXA 3SDDC 4XNXL 3SGEH 1O7SA 4U31A 4YZFE 1MCDA 4ETQB 4Z7VE 3O2DL 1S7TA 4H0IA 3NIFF 5JIPA 3SCMC 2XIDA 4HIIA 5I1IL 5I6XB 4O2FB 3T4YB 1AKJD 3GK8L 5EU4A 4QRRA 5JZ7D 2QADB 3MV8A 3P2TA 3PV6B 4NO0A 3OKMA 4KRNA 3H42H 1UQSA 4UINL 1T2QL 2W59A 1GVIA 5EC1A 3GHBL 3KPQB 4XAKD 5ANMA 3MLUL 1QFOA 4G6ML 3V6OE 5HVHC 3O4LE 4XBGB 1FNAA 2ZP0T 4I1NB 4ONHB 5GSVA 3L95A 4PRIE 4U3XA 3BP4A 1U8KA 5TPWL 2XXMB 4OCYL 4YC2C 4PLNC 2AW2A 1FYTB 1H5BB 4MZ2A 3T0AA 1FPTL 3CDYA 1IMHC 1NLDH 3OHXB 4Q2ZA 1GAFL 1F4YH 1YPZB 5DUBB 3T8XB 3WV0A 3OMZA 2VOTA 1CFVH 2OR8A 2MHAA 3ZDZE 5FUZL 1KLGA 3UTTA 5C0AB 5JDJA 2JCCF 4UI2A 3QNZA 4HW6A 1S7RB 3OJ2C 4QXTB 2LFGA 1ND0B 2GSIB 2BNRD 5C1MB 2PUQT 1RZ8A 2AI0H 1UKTA 3PWJB 5C0ND 3LEVH 4PJGE 5IQ9B 1MCQA 1MCFA 5IBTL 1FGNH 1CZ8H 3P9MA 2DQIL 3TT3L 4EIZC 4W4OC 3RGVD 3C8KB 5C0NC 3DBXA 2QQLL 4HSQA 3GRWH 3ARSA 3QDAA 4AK1A 3WJJA 2OTUB 2V2WB 4KI5F 5JW4Q 5JA8B 3TZVA 4AEIL 4XXCC 3RGVC 3VGDA 1MREH 5KSAD 1NFDE 1AXSB 5LAXA 2NLJB 3BGFB 3NCCB 4FOMA 3H9SA 5TQ0H 2X4NB 1AC0A 1RUML 1FZMB 1R0AL 5ILTL 5K9KB 1YMMD 1AQDB 5GRVL 5DEGB 1OM3H 4RRPG 1Q0XL 3I02B 3MYJA 3VXMD 1D5XB 3QIWD 4LVNB 1CL7L 5C0DB 4LOUC 2NY1B 4EXKA 1OQOA 1BJ1J 5DJ0B 5JORA 4OZGB 4NN5B 1GHFH 3BQUD 3CPLA 4HFWA 1EA9C 3QIWC 4GT7A 4S2SA 4ZD3H 5ID1A 3BD3A 1ORQA 1PG7L 2BY3A 4Y16A 4JFPB 5HYJE 4HBQA 1MFEH 4KMQA 3BQUC 2GY7B 2UWEA 1FFPB 3MBED 4HZLB 5D71H 4KHTH 5IV2A 2YPLA 2NX5D 3IXAA 1T1ZB 2R23A 3GSOA 1J7VR 5EZOH 1AGEA 4OUOA 4XBPB 3U7WH 1GIGL 5DQ9B 2OK0H 5D1QB 3U2SB 3GJFK 2M2DA 1PQZA 4POZD 5GS1B 2OR9H 4XHQA 5GGSB 1M6OA 1IVLA 4Z9KB 1HHHA 2VZOA 4ZFOA 3ARFB 4DK6A 4NZJA 2XNAA 2VISB 4UU9A 3M17B 4POZC 2NW3B 1OT1A 2CRIA 4U0QB 2JK5B 5C0GB 1FFNA 4KUZL 2VDNH 4TRPL 2DAVA 4MCZA 4HIHA 2VC2L 5CWSA 1I1AD 3IJHB 3DYMA 4F3FA 4NJAL 4JHWH 4JQXA 3O4LD 3TIDB 4PRID 3PDOB 1QSZA 2AQ2A 4JDZA 4JM4H 4WGWB 3BPOC 1CU4H 3VH8A 3V5KB 4CNIA 4RFEB 2JB6B 3V6OC 2C3GA 4NWUL 5E8DH 1JTPA 4KTDL 3VG0H 4HPYL 1D5IL 1TMCB 4M7KH 5TE7H 3INUH 5CKGA 4V2CB 4QRUB 1HN1A 4NNPL 5D1ZB 1Z9LA 1U3YA 1W72H 4M43L 3F8UB 3L3JB 3QEGL 4HJ0D 4S1SH 2EYTB 1ZS8B 3HE7B 4PJAF 4WUKH 3C5ZB 2X5PA 4JB9L 1F8TL 2YUZA 1BJ1H 4OFKA 1VEMA 1PG7X 3MFFB 5D1XB 4OV5A 1IL1B 4Z5RB 1ETZA 3C08L 3BZEA 3RX5A 1H3UA 1DFBH 1H9VA 3CFJA 1DQLL 3IU3B 1FAKT 4OIIH 3CMOL 2EE9A 3GIVA 2BDNH 3EIFA 1FC1A 2XZZA 2NXYD 2ITDB 3TO4D 3SE4A 2I26N 3TWCH 4PJ8D 7FABH 2Z31D 2NXYC 3PF2A 1QFWM 3C60D 3TO4C 3BN3B 3NCJH 4JFQB 1MAMH 1JCKA 4KRPD 3HI1A 5D2LA 3JUZA 4PJ8C 5C2BL 3G5YB 4G6JL 5CP3H 1NBVH 1P1ZA 3VGEA 4F7CA 1MCCA 2UZYB 5IESL 3V0VB 2NY5H 2Z31C 2P8PB 2BOBB 2BVQB 3VFGH 3C60C 1HYSC 1VADB 1WC7A 2VLRA 1PFCA 1T1XB 4KRPC 4XNXH 3FQUA 1IZJA 4G9DA 2P5WB 4NP4L 4XCEA 1QSEE 4Y2DD 4EBQH 1IGCL 3O2DH 4HBCL 4PLKD 5A2IH 3O3DA 4LP4A 5I1IH 2X4TB 1K2DB 3FONA 3VGGA 2HJFA 2HTKC 3DUUA 4H88L 5IB3B 3GK8H 3WNNA 3UJIH 4KXZI 2JLLA 3KNBA 3LHPL 2Q8BL 4Y2DC 5IGXL 5HYJD 2YD9A 1UJ3B 4UINH 1T2QH 3IDGA 3S3SA 4HG4K 4N1CA 1OCWL 3QULB 1BP3B 2GITB 4L5FL 3GHBH 4XP5L 1EEYA 5KZCB 3QHZH 4G6MH 2EC8A 5D2LF 1KB5B 4HDIA 1KELH 1IJ9A 3MNZB 1OARL 1XIWC 3V6FA 3W9EB 5TPWH 1RJCA 1NGZA 4NQCE 2C3HA 2YBRB 5IMOB 4KJWD 1FV1A 1GAFH 3A67L 2A9NL 2CDEB 4GW1A 4HQQL 1QR1B 2P8MB 1HSAB 5HPMA 3BMVA 5ERWA 3IDJA 4Y4HA 3OAZK 1A1MA 4KJWC 1GGIL 3QUMB 3L3HA 4K3HA 1M7DB 2GIYA 4PJ9D 3OKDB 2IBZX 2GAZB 4Y5XC 2C3VA 3F65A 1T22A 4R97C 3L5XL 4XCNA 3LSOA 3ZE2E 3HRZA 4PJ9C 3BPLC 1NGWA 3L3KB 2J8UA 1UB5B 2X9XA 3HE6A 1FNGA 2VDPL 4P59H 1ZA3A 5IEKB 2G2RB 6FABL 1FGVL 5MEQA 5FHAH 5T3XL 3TT3H 3ABZA 4I0PB 3MZGB 1J0JA 2GT9A 3EYFA 4KKLC 4HWZB 3MUY1 4FFVD 1QLEH 2LE9A 4KQ3L 4AEIH 2IAND 1HHKB 2VLKA 2I9LB 4FQXB 3L3GA 2MQ3A 1J1OL 1A6AA 1S5HA 1G7HA 3LRSB 1RUMH 3HPJB 4DKAA 5HHPA 1MFDL 5ILTH 4L1DA 2FH8A 3MA9H 1S7QA 3ARBD 5I66B 2E7LC 4QY8A 5BZWA 1Q0XH 2BMKA 2J88L 4I5BA 1IGTB 2IFGA 5I71C 1CL7H 4LLYB 3RIFF 1A1NA 2AS5M 2J8UF 3ARBC 2YC1A 1PKQA 4NQEE 5IB5B 5DHXB 3QEHB 3MUZ1 4ZDHA 4EQ2A 1D5MB 1PG7H 32C2A 3OR7B 1G7PA 4KJYA 4L3EE 1S5IL 3DMMA 4F8TA 2GJ6A 2EKSB 3AY4A 3ULSA 3QXTA 2ZUUA 3VXSA 4FMKA 2LU7A 5AYUL 4ZNCD 1YEKL 4HPOH 4GRWH 4P23D 3H9ZA 3HZMA 2D31B 1A7NH 3GMMB 2OTWB 1JZ6A 2EXYC 4QRPA 3VXTA 3KPOB 1FBIL 2VXQL 4RWYL 1A2YA 4A2LA 2OZ4L 3SO3C 2ENYA 2C26A 1RZKC 1T6WA 1GIGH 4LHUG 5E2UL 4FNLL 2VMFA 1JNHB 1R6VA 3QG6B 3RTQD 1QG3A 3BEWB 5I16B 1AO7A 3FO9B 5GS2D 5EBGA 3EYSL 5EOTB 4P5TD 2J1KA 3ZE0F 3VFSA 4GG6F 4LLVB 3RTQC 2IMNA 5DJDA 4C58B 1QLRB 1L6ZA 2LAAA 5E99H 1KNOB 4TRPH 2VC2H 5ESVB 3CCHB 4NJAH 2GYSA 2VKXA 4Y1AB 2FX9L 5C0EA 4JFXB 4KUCD 3V5HB 5B38G 3WXVL 2CLVB 1KV3A 3CC5A 4PY7A 5C07B 1BWMA 3U4EA 3PIQB 4TVPD 5E5MA 2VRAA 4APQB 3O45B 1JJUA 4DCQA 2ZG3A 4NWUH 5E4EC 4KTDH 2R15A 4HPYH 1D5IH 4QRTB 3F7VA 2JIXD 4PBWD 4WTZA 1KPUA 4J12A 4NNPH 2AJSL 4MA1C 4M43H 5BXFB 3U30B 1XR8A 2OJZL 2A6DA 4CDHA 5ABDE 2N7AA 2BP3A 2FL5A 4JB9H 4O2CB 5SWZA 3RUGB 4FFZL 1YEEL 5D7LB 4OUUA 3TN0A 3C08H 2D9QB 1N64H 5ACLA 2DI7A 4L9LC 1VFUA 3STZA 1DQLH 2P24B 3JWOC 3F7RA 2H3NA 4LDEB 3CMOH 1B0RA 5T5NF 1MLBB 5ID0A 1S7VB 4J23A 3B9EA 3MGAA 3UTSA 5E6IB 1EMTL 3MNVA 2IC2A 1INQB 4WCYL 5L8JB 2X44D 5J4MA 2QV2A 5KSBF 2ESVB 1OQXA 4JVUA 5TE6L 2PTUA 3X12A 4G6JH 4I3GA 2QSQA 4MD4A 1JWUB 1EBAA 5IESH 1IAIH 1A7PL 1WFUA 1ZLSL 1G7QA 4PLJD 3QXWA 4P2OD 4PV8A 4P4RA 4CJ0A 4NP4H 3UBXG 4HBCH 1XGUB 1T7VA 4NQED 4CADB 1UC6A 3MPCA 1S9VA 4UQ2B 5CP3A 3QZWG 4DAGL 2D7MA 4H88H 5DJZA 4OZIB 1LQSR 1IEBA 4P2OC 4PTUB 3FT3A 1U91B 3PP3K 3WFHB 4LKXB 3LHPH 2VQTA 2Q8BH 4L3ED 1BFVL 4TVPL 5IGXH 4CVXB 1MCLA 1FO0B 3C2AL 3ARPA 4PB0H 2IBGA 3IVKB 2QSVA 3B9KD 1WZ1L 2HRPL 3N1FC 3HLAA 3IF1A 4L5FH 7CGTA 3JWDL 3QCTL 4Q6IB 2L7JA 4XP5H 4Q9QL 2G9HA 2ERJC 4C4KT 1A02N 5JXED 4U1NA 1OARH 3B9KC 3EKCA 2J8HA 4H0HB 1KN4H 3QWOB 3VWKD 1OB1B 4WWKC 4PRAA 3A67H 1IAKB 2A9NH 2ED9A 3RZWA 4HQQH 1C16B 3FFCD 3WJLC 4JM2C 3VRLF 1NC4A 3MRKA 3TT1L 1SMAA 4ZO7A 3LEXA 1GGIH 3DHJA 5HGAA 2YUVA 5D96B 1IGYA 3U6RA 4KRMB 3KHOA 2VTFA 4CBPA 1AC6A 1FNLA 3H7BB 4OLZL 4Y5VA 5C7XH 1WT5A 4X9HA 1I7TA 1T7WA 4X6EA 2YRPA 2A74A 3MRQA 3L5XH 5JHDE 2I07B 3VFRB 2AABL 2A6JB 2ARJQ 4PRPA 2VDPH 4OF5A 1KJ3L 4P4KC 3QUYC 1FGVH 2IG2L 5T3XH 1G7LA 5I1JH 1ADQL 1CICC 1MJJA 1NDMB 5IFAL 3V5DA 3O81A 1XH3A 1U8MA 2V9RA 4KQ3H 5DR5H 5F9AC 1U95A 2LAGB 1TZHA 1W8OA 1RULL 2G5BB 4XB7A 1J1OH 3VE0A 4ZO9A 4PJHE 3ZYOA 1DQJA 3IFLL 1RZIA 1SY6H 3QIUB 1YC7A 1IGML 3B3IA 2WIMA 4A6YL 2J88H 2IF7A 2JTDA 1IAIM 2BNQD 3QXDA 1UGNA 3FOMB 3KJ6L 3W0WE 2GSGA 4YK4B 1Z5LA 5DUML 4O02L 3OG6B 4JG1L 1CFTB 4MSWA 1QSFE 1A9EB 4I2XB 3RIFK 3PWUB 1NDGB 3IS0X 4PJDA 4X99B 4JFED 1S5IH 1EZVY 5E8OA 5J12C 3TA3C 1DBJL 1T20A 4LMQI 3K81A 5AYUH 3BSZL 4XVJH 2R2BA 5L88L 1BAFL 2PCPB 4F58L 4QHLB 1FBIH 2VXQH 4MD0B 3H3BC 1ZXQA 1IGJA 4ZQKA 2RB8A 4RWYH 3K4AA 2OZ4H 2P8LA 4UBDD 5E2UH 2R29L 1QFHA 1LILA 4FNLH 1P7HL 1UWEL 5DD1H 4MAYD 2COQA 3EYSH 2W9EL 4FTVB 5E9DD 4RAHA 4E42A 1ZGLP 4ODXA 1YECL 4NOBA 2X4PB 4E41D 3ROOA 3IKKA 4P46A 4DW2H 1MCWW 3BXNB 5C6TL 2PO6D 4MAYC 5FDYA 1NBQA 5A2JH 1YEGL 3KPSE 4NT6B 2DL9A 3E6HA 4ZO6A 5FUCE 1QRNE 5F9DC 2APWA 2V5YA 1ED3B 3VRIB 1IM9A 4R96B 1IAOB 2FX9H 3N85L 3VGAC 1TENA 2PO6C 3VJ6B 5T3ZD 3WXVH 2C1PA 2IPUK 1A6TB 1ZT4A 4JY6A 4S1QL 4UMGA 3D3VE 3FB7B 4LL9A 3KPNA 4OZHE 2D9CA 3DROB 3T3MF 1SYVA 3D69B 3LKRA 4J3XA 3RHWF 1UEYA 3REVA 5KSAA 2AJSH 5MENA 2A73A 2WUBL 3OL2A 4HH9A 5K93A 1EGJL 4PP1C 2XKSA 1A64A 3KLAA 3WNLA 4G80B 3DXAE 4L4TB 2VLJD 1DE4B 4Y19B 5C9JA 3MMEB 5ACZB 4FFZH 5IB4B 4FHBD 1YEEH 1YNTB 5JHDD 3EOBA 1UZ8B 3QI9D 4RMQA 3PWPA 1FQ9C 4JZJC 3OTTA 3BI9X 3QDMD 5GGSY 4NQXB 5HHMB 3D48R 1LK3H 4JPIA 3QIBD 1RZKH 3QI9C 3SE9L 4FQCL 2VLMD 5K59E 2Q87A 3ZYZA 3IFPA 3FJTA 1CBVL 4IRJC 4BYHA 4W6WB 2WBJB 3T2QA 3DMMC 1EMTH 1JF1A 5DJAB 4NNXA 3SDXA 3FOLA 1GZPB 3BKML 4WCYH 2R2HA 4S11A 3MBEA 5IIEA 4KJQD 3LCYA 1WWAX 3AREA 2FJFB 2W07A 4C56E 4HUMB 4NN7C 3MA7B 3BRDA 5TE6H 3TJHC 4DFIA 1SJHB 1N7ML 5EIVA 5GS2H 2FD6L 4YEFA 1NC2D 4WW2A 2Z4QA 4I48A 3BISA 1C08A 5CSGA 3WS6C 4JZOB 2FGWL 2BVYA 1VB9A 5F6HI 3D25B 1E6OH 1X5JA 4UV7L 5J11C 1X6NA 1A21A 3GMQB 1KXTB 1MAKA 3W0WD 4KI1A 3DO7A 1X5HA 4F9PA 5F7EH 4DAGH 1QSFD 5LJYH 5T3ZL 1S7WA 3RNKB 5BVPL 3G04A 4YH6A 3MUGA 4OCXL 3R8QA 3C6LA 4BSWA 3QDGA 1YY8B 5DZLA 4TVPH 1BFVH 3MRMA 2R69L 4JKKA 1I1AA 5F70A 1Q38A 3C2AH 3GO1L 4PRPE 1MI5B 3GIZH 3GMOB 4Q0XL 2AERT 2HRPH 3QEQE 3GSUB 4W68A 3JWDH 2QJDA 1K8DA 5TF1H 2FHBA 5GHWL 4NKQB 1A3RL 4IEFB 1XF5B 4TNWF 4KKBD 4YZFF 1M1SA 1OAYL 3UDWA 1BOGB 4Z7VF 3DIFA 3QUXB 1K5NA 5MEPB 1LE5B 5CAYB 2Y7QB 4EDWL 1P53A 3S4SB 2EDLA 1D9KD 3L7FB 2BSTA 4OQTL 1AH1A 4GS7B 4MS8D 5GGUB 3RWHB 3P9LA 3TT1H 2WV3A 4X7FC 3Q5YA 1IFHL 3SGEI 4AY0A 1U92B 1IC1A 1TXKA 4PJAB 1P6AB 3QDJE 4OLZH 1QRND 4U1IB 4HUUA 4QOKB 2ZZUT 1HH6B 1JI1A 1RZFL 3CFKA 3TPKA 2D2OA 1F58L 2ZG2A 3S98A 2WQ8A 2AABH 5H37G 5FUCC 3PDDA 1QO3B 5E8NA 4ZSOA 2OXGA 4AM0B 3D3VD 5JDSB 3RVTD 5IFAH 2X4SB 1T1YB 4KDVA 1F3JA 3P73A 2PYFB 1T2JA 3WFEL 3IU4L 5BZDA 3ZDZF 3RVTC 1EVUA 1I8LC 1DANT 1NSNL 1FVDB 4ODVL 3ISWA 4Z95L 2C5DC 1RULH 3DXAD 1OP3H 5I15L 3QAZB 3UYRH 3B5TA 4UOW0 3GSNB 2AK4B 1WIUA 3IFLH 1UH3A 1OAZL 4EI6B 2I24N 4X5XB 2YD2A 1FZJB 4PJGF 2XV6B 4RMVA 4RDQG 4A6YH 4AJ0A 1CLCA 2BSRA 1F90L 1RIVL 5C0BD 5J1SC 5DK3A 3MX0A 1XCTA 1I85C 5CCKL 3KJ6H 2JB5L 3MJ9L 5DUMH 3WBDA 2QQNL 3SGKA 4O02H 4D9QE 4PGJA 4JG1H 5JUEL 2FZ3A 4WFHE 3GBLA 2ZSWB 4K7FA 2C1OA 4GO6B 2OP4H 3S96B 5IR1B 1NFDF 4C56D 1DBJH 5C0IA 5KW9L 3MOBL 3R1GL 3G6AB 5L88H 4M1GL 3QA3A 3ARTA 2E6JA 4JY5L 4KVNL 4NFCA 4EN3C 4ZAKB 2PF6A 3P4MA 4R4FL 1OD9A 1YEFL 2X89D 4LFHG 3BP5B 2EYSB 5HHNA 2R29H 3IJSB 4IIQA 3BDBA 2CDGB 4NZTL 4R90L 2GY5A 1K8IB 5CIPA 1DVFB 4AL8L 2DI8A 1UWEH 1WFTA 1RZGB 1CGXA 1AIFA 5CHNA 4MNGA 3SGDH 2DIBA 1CE6A 2VLLA 2W9EH 3DUHA 2OZ4A 4TTDD 1LEGA 4BKLA 1II4E 1YECH 5ICZB 3QQ4B 2EDTA 4MJIB 4JFDE 4POYA 4K71B 5DF0A 5HHQA 5C6TH 1WT5C 1R3LB 4M6MH 2FJHA 3QEQD 1N0LA 3F5WB 4MMZC 1JP5A 4PJBE 3WO3B 1EAPB 4WENB 3QBTB 4PS4L 1A9BB 2E6QA 2IMMA 5E2TH 1DZBA 3LN5B 3N85H 4M6AA 1AGCA 3PDGA 4V1DB 4ZUWB 4JQIL 8FABA 2ICWI 3MUJA 4KZEL 3RWCA 3TNNA 4S1QH 1I1FB 4NZDA 1JWSA 5F88B 1TVDA 5FEBA 4BH7B 1B6DA 2D7PA 1KBGL 1P7QD 2XWJA 2IANA 1TETL 3ILQC 2JJSA 5KANG 4JLRB 4M4PA 5FYLE 2WUBH 3MV01 4DGIL 1FFRA 3MRFA 1EGJH 1A6UL 2IH3B 3OBAA 2ZJSH 5B3NA 3QDJD 3HFML 1Z3GL 1VA9A 3RHWK 2IADA 5BRZE 1A0QL 4PFEA 4LSVL 3BWAA 4O00A 3HCVB 3V9FA 4HUWB 4FQJL 1WBZA 3K80A 1E27A 1XF3B 3QO0A 3RZCA 3LQZA 2AKRA 2IAMD 3SE9H 4LVHC 5IQ7L 3S88L 1RFDL 1TJGL 1UCBL 2AJ3B 5HI4C 1CBVH 1PZ5B 2JE8A 1WLHA 1WITA 2YEZA 4BSVB 4RA3A 1LNUA 5DI8B 4LIQL 2XA8L 3BKMH 3QXAB 2IAMC 2AJZB 4P23A 5IHBA 4JHBA 1LD9B 3HI5L 3WFDL 3MRIA 4NN6C 4PRDA 2A6IA 1CWVA 2E6PA 5I8EB 1N7MH 1BZ7A 2FD6H 5GS0L 4BZ1L 2X4OB 1O7VA 4UT7L 1NCBL 5EBWA 2EECA 1DLHA 3WFBH 2FGWH 1E28A 2ICEB 2NZ9C 1CK0H 4M8QB 4UV7H 4ENED 4RGMC 4M9PA 5KS9A 2DJUA 4XVTL 1CI5A 2FIRT 4M7ZB 4P5TA 5GRUH 43CAB 3KJ4B 4V2BA 1OAQL 4Z7NE 1J88A 5KJRL 3KXFB 2EXWD 4OT1L 5T3ZH 2C9AA 5B39B 3BJLA 3SN6N 4ENEC 4YE4L 3PGCB 1AGFB 3OKKA 1Q94A 2BXYA 4M5ZH 1S7SB 1NCDL 1XGTA 2R69H 3NCYS 4JHAL 3V8CA 5DJXA 4GG6B 2EXWC 2MKWA 3GO1H 1BIIB 1CXIA 4Q0XH 2A6KB 2HTLD 3WLBA 1F6LL 5M94B 4R4BA 1ZHKB 3O9WA 1Q9LB 3DUSA 3VRJB 4LCUB 3FQWA 2CD0A 4FA8A 5K9QI 1UJTA 2FWOA 3K3QA 5GHWH 5JO5A 3QJHA 1A3RH 1QR4A 2HTLC 2Q1EA 3U83A 5DVKA 4AH2A 1FYHB 3V8OA 3VFOB 1A14L 4LNRB 1I75A 4EDWH 1KG0A 3U9UB 3WN5B 1FZKA 1Q9OB 4YBLC 1ULVA 4OQTH 3GBNL 3ZLQC 4TNWK 2PYEA 4Z7OE 4JFDD 2ZUXA 1TCRB 1IFHH 1KIRB 1VGKB 4LSPL 1HXMA 5TGBA 1F6FB 4S1DD 1IKFL 5LGJB 1V05A 4PJIA 1RZFH 1FG9C 4U33A 1F58H 1JI2A 1T66D 3IJYB 4KUCF 1J0ZA 4CMHC 4MDJB 4LKCA 5IK3B 4M5YL 4X5WA 2W1NA 2X6MA 4X7SH 5CZVH 1FSKC 4BM7A 3ES6A 1C5CL 1T66C 2AV1B 5FDWB 5AD0A 2AJXL 3B9VA 5D7KD 2EE2A 4YHLL 1J05A 4B7LA 2VR9A 3IU4H 1I7RB 4YR6A 2E5EA 3L7EB 4ODVH 4Z95H 2V5SA 1LE9B 5I15H 1JUFA 5DT1L 4X6DA 1ADQA 2Z35A 4JQVA 4U1KB 4FQ1L 5IMKA 5BRZD 2EIEA 1MQ8A 4F15C 1OAZH 3LS5H 1E4KC 3ZE2F 4UTBL 2SEBA 4GW4A 2R2EA 1XCQA 2X70A 3HPLA 3VXOB 1F90H 4TUJA 4U6YB 1RIVH 3W39B 3MROA 3T0EA 2P44B 4EEEA 5CCKH 1DUZA 3HN3A 1G9MC 3IRPX 4PTTB 3CX2A 1CD8A 2JB5H 3FB6B 3MJ9H 4E0RA 1MUJB 2AP2A 3S8WA 4A6YA 2MPAL 3SDYL 1VKXB 4DVRH 5ISZA 1QQDA 4LEXL 4CW1A 3ULUL 4Q6YA 3D85A 4Z7WA 3P9WB 1OAXH 2CLRA 5KW9H 3MOBH 2VXTL 3GSQA 3MRJB 3R1GH 5JXEA 1RK0A 4FXKA 4JPKL 4M1GH 4ERSL 1ZGLB 4JY5H 3PV7A 4KVNH 2A77L 2DTML 4R4FH 1YEFH 3VWKA 1ORSB 1E0OB 5CJBA 5ALBL 4N68A 1P7KA 4HC1L 3N1QC 4YHIA 4RCAA 3FFCA 4P99A 4X7EC 2QADD 3CLFL 5C0RL 3JV4B 4L3CB 3KDMA 1A47A 1KSRA 2P46B 5DQJB 5GGRB 3BP6B 3OGCB 4GKSA 4OLYL 3EAKA 1CL7I 2WIIB 2NNAB 4L8SA 1K4CA 5FK9A 3VFVB 1QPPA 1BBJB 4WHTB 1MOEA 5DFVC 5EU5B 3GSRA 1I9JL 4TSBL 5E8PA 4PS4H 2HJLB 3RA7L 5D6CB 4RQQA 3CX5J 4XBEL 1RU9L 2C7UB 4HD9A 4G3YL 4KZEH 5I1HH 3QFDA 2DI9A 4JM2F 2XTJE 5EFIA 5F1NB 4PRBA 2QQKL 3V79C 4WNQB 2AXHA 2BCKA 4KWUA 1TETH 1NLBL 4MQXC 4DGIH 4GG8A 1U3HC 1F42A 1KYOK 1PW3A 3U9PH 2DYPD 4HXBL 3IDYB 4RISL 1Z3GH 3QJFB 1A0QH 4XB8A 4F2MA 4LSVH 3WD5L 3RVVD 4IRZL 2VJXA 1ZHBB 2BJML 3S34H 4LFHD 1C1EH 1RHHB 1SEBA 2AXFB 2PXYC 2BNQA 1P9MC 4UDUA 1EGJA 1FJ1B 5C0JB 1UVQA 2CXGA 3QP3A 3P77B 3RVVC 5I1LB 4LCWB 5A2FA 3S88H 4AEHL 1RFDH 1TJGH 1UCBH 2BZDA 5IVXE 4LEOB 4JFEA 1S7UA 2GCYB 4X8JA 2XA8H 4Q58C 3BZFB 3O41B 1LO5B 5CJOH 3WFDH 2FBJL 3MLSL 4F37F 5HDLA 3MV7A 3U4BL 3DHMA 2NY4B 5T1KB 4BZ1H 4BQBA 5K33A 1MRDL 5B8CB 2VE6B 4ZFFA 2WP3T 1CGWA 4UT7H 1NCBH 3SHSA 1IZKA 2NY1D 2WINA 3SDCB 1X4ZA 2P5WE 4D8PA 4HX1A 3ARDB 3SCMB 5SWQA 1ZK9A 4QCIA 3OJDB 4LVNC 4XVTH 4OLXL 5JPMA 5E9DA 5KVMC 1OAQH 3UJTH 4E41A 3EGSA 3T3PE 4YE4H 4NN5C 1F00I 1HK6A 1NMBL 5A3ID 4OCNC 1UACL 1AKJB 4L4VB 5BOZG 4D3CL 1NCDH 1MY7A 5CJ5A 3L5WA 2D7QA 4JHAH 1YDPB 2ADFH 4EI5C 1C7TA 4BZYA 5DVMA 5E94A 3BGMB 3BVNB 4JJ5B 3UMTA 4WFFD 2W9DL 4BFIB 4G6AD 4GKOA 5IJKC 4P2RB 3LZFL 5GZOD 5D1QD 3WO4B 3ZZ1A 4RWHA 4WUUB 1CFQB 4HIEB 2IPKB 1EEZB 5J89A 1OW0A 5DDHA 3AU1B 4J4PD 1A14H 1Z9OA 4G6AC 1PGRB 5HHOB 1GXEA 5E5RB 3ARFD 2JJSC 1R24A 3RJQB 5GZOC 1MJ8L 5D1QC 1IAII 1XGPB 3UPRA 3GBNH 3ZSTA 1CQKA 3IKCA 3NCFB 1T0PB 3DX8B 3G6JA 3VG9B 4J4PC 2VLJA 4ODUB 3ARFC 3NOIA 5CGYD 5I1AA 1KPRB 4MQ7A 3BEVA 3HUJE 4LSPH 5HYSA 1JK8B 5HGGS 3NIDE 1PD6A 1SBSL 1FL6A 1UXWA 3T0EE 3SBWC 1GZQA 4LHUA 5BQ7B 3O4OB 4OQTA 3FO1B 3RBGA 2AV7B 4FQHA 3QDMA 1GGCL 1MHHA 5KVGL 1YQVL 4UAOB 3U0WH 2VDML 3IDXL 5D6DA 5DYOB 3RL2B 4LRIC 4OGAC 3QIBA 4XPBL 4XMLL 3RY5A 1BFSA 5E24E 4JDTL 5F3HA 3T1WA 1CIUA 1CGTA 3I9GH 3GMNB 4RIRB 4U3HA 5D1ZD 3QXVA 1XR9A 1C5CH 2V2XA 3KYNB 1PG7W 4XZUA 1JHTB 2AJXH 2FX7L 5CKAA 2Y72A 3FHAA 3TBTA 3HE7D 4YHLH 4PYHA 3C5ZD 3ZKQD 2XTJC 4M6OH 5DK0A 5D1ZC 5FA4A 3QUKB 5D1XD 1B3JA 1XF4A 1LO4L 2A38A 2YPVL 5DT1H 3OZ9H 4M48H 5EU6B 2H6PA 4NWTL 4X6CA 3D18B 5C09A 4YWGH 4HHAB 4RBPK 1T4KB 1ZLVH 3ILPA 5C0CA 3FT4B 4UTBH 4ZNEE 3VA2C 1BPVA 5F3BA 1QFPA 4Y4KB 3VXMB 5IF0B 4HGWA 4O58L 1R3IL 4UNUA 3P11L 3F7PC 3TBWB 3B43A 4I0CC 3BQUB 2MPAH 4MX7A 1ONQB 5DFWH 3SDYH 5J6HB 4OJFL 4OCSL 3PJSB 5CJXA 3ULUH 4PJXA 4RFNB 4NBZB 4LDOB 1B0GA 2Q7NA 1LDSA 2GJZA 4PJHF 3MJ9A 3IDUA 2VXTH 4HGMA 2BVEA 2EEAA 1LEKA 1QLFA 5DMKB 3CZJA 2W0KA 2A77H 2DTMH 4KH2A 2NY3B 1OF2B 2P5WD 3B2UC 3MRBA 4ZXBB 1MY5A 2NX5B 2Q76B 3L9RA 5I2IA 1D9KA 5IW1B 4PJCA 4U6HB 1Z6JT 1L4IA 2VAJA 5ALBH 1OGAB 4HC1H 2UUDH 4ZPTB 5ITFB 4Z7VB 3CLFH 5C0RH 4KMLB 4GKZA 1G9NL 1VDGA 1J0KA 2AXJA 4WI6A 5DJ6A 2YSSB 1OY3B 4OLYH 3FAWA 5IEHB 1YN7A 1BD2B 3MYZA 1OP3K 3C6SB 2VZ3A 5IB1B 4C83A 1NGYB 3FRUA 5KZCD 5EZLB 2B1AH 3LV3B 1I9JH 3EJZD 3C9NB 1A1OA 4HIJA 1QNZH 3LKNB 2N7BA 1S7XB 3BPOB 1HEZA 4RAVA 2ITCA 4ELMB 3RA7H 4XBEH 1RU9H 4IDLA 5DQDL 3B9DA 3JTTB 3IXTA 3EJZC 3X11B 1PEZA 3HMWL 1JPTL 4N90E 3ARVA 3FB5A 2QQKH 3S37L 2DMKA 4L1HA 4PBXA 1NLBH 1ROWA 2Z8VC 3NAAL 4PJ5E 3D2UD 4H1LB 1LO2L 3N06B 4KKAD 2X09A 4H25A 5HI5D 2FEEL 2WLZA 4HKJB