1TIUA

Titin, ig repeat 27, nmr, 24 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
89
structure length
89
Chain Sequence
LIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TITIN, I27
publication title Immunoglobulin-like modules from titin I-band: extensible components of muscle elasticity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin-like domain
total genus 5
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tiuA00
1FNEB 1WZKA 1IM3A 2K1MA 4MJID 1MFAL 3QWRD 3WV0A 3BDYL 2NZIA 4ODVL 4A6YB 5L0QB 2Z9TA 5IEKA 2AABL 5FB8A 2O93L 4H25A 5DDHB 1Z5LB 3U83A 2YD7A 4NO3A 5FHAH 2OL3H 2ITDB 1I3GL 1C16A 2NTFB 2X40A 4NGHH 4XC1H 3KLSA 1TITA 4KQ4H 2IAMB 3NPSC 3EOBA 1RU9L 1D5IL 2JIXD 4LSRH 3TA3C 2DD8L 3QDMD 1Q38A 3QP3A 4P2QB 1KELL 1W8NA 2YBRA 4J1UA 3BH8B 4YE4L 1BVKA 4BUGA 4D0DB 1CLYH 3QXDB 3VXMB 4V2BA 4JO1H 1A6VL 2CKNA 1KNOB 4GKOA 3KG5A 4TYUA 3C08H 1IC4L 3LRGA 3NGBB 3L3GB 3TFKC 1E4WL 4JN1H 2WNGA 5E95B 1P1ZA 1OGAB 1YEGH 4Q9QH 4DGYL 5D2LA 4N0FA 1NANI 4Z7OE 1XF5A 2FR4A 2WLYA 3NAAH 3K0WA 4DW2L 4APQD 1YY8A 3SO5A 3EDDA 3FT4A 3MGTB 5DQDH 12E8L 5F89B 3GMNB 3W9DA 1YEDA 4S10A 1T0NA 2VSDA 4KTEH 4DGIH 4X6DF 1MHEB 2J88L 1ONQB 5CAYB 4KJYA 1YEKH 1LO0L 4M5ZH 1BQLL 4FQXD 1KJVA 2ZNXA 2LFGA 1N26A 1Z6JT 1LK2A 4J6RH 5CZVL 5E1AB 3WXVH 4M1CD 3L3JB 4JKKA 2YD8A 4E5XB 2LABA 1OP3K 1A7QL 1S9VA 4X99B 1YEJL 5I75B 2YOCA 1ROWA 5BOPA 3GSOB 5IWLA 2Y5TB 2ZUSA 5E4EC 1SJEA 4YNYA 1MI5A 4ELMF 2DN7A 4PGDB 4PD4K 4P2QE 4V1DA 2RHEA 4KJQD 4XP1H 1BFVL 1FVCB 4N8CH 1ZEAL 3UTQA 5I66B 4GS7B 1TQBC 1QR1B 3MO1B 4CVXA 4G9DB 5EBLB 3BRGC 4GXUM 4LSDA 5LKNA 5F1NB 2AJVH 4ENEC 5DUPH 5CJOL 3V95A 3N06B 2LU7A 3TF7C 1IAII 2UY7A 3G5XA 1UB5B 2NY1C 4UDUA 1OGAE 3PGDA 4AENB 3QXVA 4GQPH 1T89A 4X80H 3QDHA 2DI9A 2VXUH 2BERA 2H26A 3IFOA 4PJ9C 3B9KB 1NUDA 4D2NA 1FL3A 3OMZA 2HWZL 1HH6A 4KKAD 3NH7L 4R0LC 1NDMB 4HWBH 4MJ2A 5BS0D 1CGWA 1HXMA 4Z7VF 5E8PA 3QNZA 4NKMA 1RK0A 3L7EB 4LCWA 3MCG1 2X42A 3R06A 3RY5A 3ZTNH 2CR3A 3OHXB 5H37H 1MHPH 5I1IH 3OKOA 4OSUL 3UPCA 3SBWC 2Y36H 3OXSB 2AJYL 2FX8H 1EEZA 1J88A 1HHJB 1QQDB 3ZKND 3BIKB 2GY7B 2P24B 1LP9F 4NC1C 5ETUB 2HH0L 3EYVA 5J13B 1SJHB 3OR7A 4WJ5B 2XFXB 4ZFZA 4QHUA 1CR9H 1SHMA 1HI6B 3V0AC 4J3SA 2RFXB 4MJIA 5T3ZE 3QWRA 1AP2A 2V9QA 1A0QH 3IYLW 3HLAA 4KRMB 2G75B 5D6CA 4BJLA 2DLEA 5AYQA 5TF0A 3UTSD 3VD9A 4XHQA 5IW6B 5LGKA 3SDAB 1EZVX 2VDRL 5C8JA 1N5AA 5C3LD 4RWHA 1QFUH 3PWNB 1NCAL 2XOTA 3VFMA 1QBLH 1QBAA 5D2LF 1ZGLM 3GHBL 2BJMH 2DKMA 1Z0MA 1T2JA 2JIXA 3F7YA 3IU4H 1A64A 3CFEA 3QDMA 3UJTL 3MNWA 1NAML 1KXVC 3G6JA 4OGXH 3RJQB 3RWJB 1Q0XL 4BH7A 4YHNB 2F15A 4WI6A 5TDNB 5L2JA 5E94A 4PRBB 1RHHB 1X4XA 3LKOA 1Z3GH 5C70A 1WJ3A 2GYSA 3QI9D 4MA3A 2PXYD 3D3VB 1R3IH 3WS6A 5L9DH 1D5MB 2A38A 4APQA 4JHZA 4UTBL 2Q8BH 3NCEB 4GXVH 3L1OH 4HIEB 3TBSA 3EGSA 3MRHA 1ADQH 2NW2B 4GW5A 1UM4H 4HPYH 1FZOA 2IPTL 4F9PA 1F4XH 1N0XH 5I71B 4MA7H 2BOBA 4FP8H 4E41B 3TNNA 1S7SA 2I24N 1T4KB 4FQXA 3HCVB 2VXSL 1T66C 3ET9F 2W0FA 1VEMA 4YWGH 3UX9B 1NBZA 1I4FB 2DQGH 2BRRL 2H6PA 5ERWB 4CADA 3SKNA 3V4VH 1N8ZA 1A47A 5EORL 1WWWX 4C56D 2V17L 1I8MA 4UQ2A 3LRSB 3FN0H 1YJDC 3MRNA 1R0AH 4BFGA 5C0NC 4PY8I 2I9LA 4GG6A 3S36X 1G7JB 4OI8A 1I8IB 3GJFA 3HI5L 3VXSB 3SEPA 3QFDB 1E4KC 4RZCA 2F5BL 2BSTB 3TN0D 4QO1A 4WNQA 1YEIH 5D2NC 4YDKL 4ACPA 3VU2A 1AXTH 2CLRB 3CFBA 5IB4A 1GGBL 3D3VE 4UAOB 3RY6C 1L9NA 4KMTH 3Q0HA 1FGNL 2W65A 1FRGL 2EH8L 2O26U 4M61B 4CMHC 2ADIA 5TE7H 5C2BH 4Z0BL 1ERNA 5BS0A 4HWUA 4N0UA 4MAUH 2HVJB 3BT2H 4E41E 4PJGA 2G60L 2BVQA 3MMEB 4PIRF 2DQHH 5GGRY 2AKRB 4YHLH 5F7DB 4M6MH 5B4MD 1FHGA 4QXGL 3Q6FB 5KOMC 1A7PL 1GJIA 1J8HB 5IVZB 3WNKA 2KDGA 4OLVL 3JV5A 3MREA 1CGSH 5INDA 5E2UH 4C58B 1PG7H 3SJVB 1MWAA 5ITFA 5SV4A 1S9YB 4JY4A 4FFYL 3MA7A 5DD5H 5F3HB 2EO9A 1IGFL 2AEPL 2K7QA 4Q9RL 3KJ6H 4XAKD 4HIHA 1BQHA 3SDCD 3JV0A 3KDMB 4QRPB 5E4IA 4HHAA 1ZLWH 3VXSE 4J3UA 3K1DA 3CVHB 4MB5A 3G5VA 4F8QA 3S4SA 4JGUA 3OAZH 2XWBB 1A1MB 1MEXL 3G6JF 3GSVB 1NMBL 3CZJA 1BECA 1QBBA 4WW2C 5T1MA 2YMXH 3TBWA 5DGRA 1NCTA 3NA9L 4HK0A 5FKAA 4NQSB 1OAXL 25C8L 2X4PB 3UTSA 5CD5D 4ESKA 5I15H 1H3VA 3MRCB 3QDJD 2DIJA 1MUJB 4OIIL 2BNUA 4Z0XB 4OCLC 1U91A 3ARDD 4AG4L 4YDLB 1NBYB 4NZRH 4I77L 1JPFA 1Q0YH 4KAQL 2VITA 2ZSWA 5SWZB 5DRWB 3EHBC 4JFQA 3SGKA 1GAFL 4U6VL 5DD1H 3QCTL 4LLYA 5DJ8B 1JGLH 1JWMB 1HOCB 4NWTH 4D0CB 2P5WD 2R69H 3IDUA 5D1ZD 1WITA 3NZHH 5F1KC 5DRXA 3REVB 5ICZB 1A6ZA 1J8HE 4ZG1A 1LK3L 4NN6B 3HMXA 2BK8A 3O6FB 3ZDZF 3C2AL 4JFZH 1E27A 4Z7QE 1T03H 4XPAL 3SJVE 4POZD 5FEBA 1NGZA 1I1RA 4NM8L 3QI9A 4R4FH 2JK5A 2PXYA 2V5MA 4TVPD 4PRHB 1VDGA 4XVSH 3WFCL 4O2FA 1GZQB 2GUOB 1XR8A 4QRPE 3WHE0 1T5WA 4JFFD 2EC9T 3MFFB 4UMGA 3L9RA 2PYEB 3V4UH 4N68A 3DUUA 4YH6A 4CMMB 3UTZA 5I17B 4JZNB 1BVLA 2VQUA 4GG6F 5DJZB 1G6RH 3UZQA 3FOLB 1QBML 3O3BA 3ZL4H 5J06A 1N6UA 4AQOA 2E6JA 1KTKE 4YXLL 2CSPA 2V5YA 3QUXB 3B8SA 1YEEL 4OZ4A 4P49A 3MR9B 1CS6A 5HDOA 4AM0A 4Y4FD 1XT5A 4XBPB 1BAFL 4M7ZC 5GGVH 1ZTXH 3FQUB 4OAWA 5DEGB 2Y6SD 4NQED 4DN4L 7FABL 3KPNB 3RWFA 1ED3B 4XBGA 5SWZE 4WGVB 2ED9A 5ANMA 2IALA 4LF3B 4NNYA 5A2IH 3V6FA 3WSQL 3QCUH 5B8CC 5GIRB 4NQCE 5I76A 1FL6A 1FAKT 1OGTA 2BSED 1V8HA 2XKSA 4X6CB 5B21A 3SE3A 1KLGB 4W68A 1X5HA 3AUVA 4NN7C 3VW3L 3F7RA 4R90H 4XPTL 3NIFF 3TN0A 1FL5B 4O4YL 4LARH 3QRGH 4PJGF 2WWKO 5E5RB 5CEYB 1I7RA 3ARPA 3ARBB 5HHPB 2UZYB 3VXOB 2IPKB 2PO6D 3KHQA 3BN3B 2VUYA 3GMMB 4EDWL 4PRHE 4DZ8A 3VWJB 5DUML 4I9WD 4X5WB 1T21B 2HG5A 5AAWA 3WDIA 3OKKB 1KBGH 2PYEE 3S37H 1M7DA 3D39D 3DXAD 3U0WH 3U7YH 5MENB 5SWQA 1KC5H 1WC7B 2HJKA 3B3IA 4U2YA 5FK9A 5LCVL 4AQ1B 1KJ3L 5KG9A 3O4OC 3KLAA 5C0AB 5HY9A 3B83A 4MCZA 4LPUA 1A14H 4NDMB 4QRSB 3P9LA 4Y2DB 1HYSC 4OJFH 4P46B 1CZ8L 1NDGB 4JHBA 5KSVA 4JFED 1DE4A 1KGCD 4GRMB 3ARTA 2OJEB 1ND0B 2NX5B 5DFWH 2QBWA 3F6IA 2FWOA 1ZMYA 1J1PH 3C6SB 2OL3A 5I1HL 3ZTJH 1OD9A 2YPKB 3STZA 4JPWL 3CLEL 3IDXH 4ZAKC 3ECBA 3PNWB 1CFQB 3FOMB 2GFBA 3SDCA 4X6CE 4JFHE 2GY5A 3BJLA 3FO2B 3V5KB 1U58B 4L8SC 4KZDL 2XT1B 4DZBA 4LSUL 1DBAL 2PETA 2R2HA 3VD7A 4DEPB 1QSZA 4TSAH 5IVXE 1WLHA 2D7TH 1UT9A 3KWWA 4KRNA 1A1NA 1DLFL 3MLWH 2A0LC 3ULUL 1CQYA 5IFAH 3K4AA 5C09B 1N3NB 4NOFA 1SYVB 1H3UA 3W11D 1BJ8A 4FABL 1SBBA 3QDJA 4YZFF 3ARWA 4UV7H 4YBHA 3FT3B 3ARDA 5HXMA 3FT2B 1CL7I 4OCRH 5MENE 2VZTA 2X4NA 4JRYD 5DR5H 4P59L 4U33A 5C0AE 4TUOB 5BV7H 3ARGC 3GDBA 4BZ2H 2GSGA 1TVHA 4IOIB 2P5WA 1UM5L 5D1ZA 5HHQA 2GCYA 4Q2ZA 1NL0H 2FECI 3BRFA 3WJJA 3HC0A 4HDIB 2ZOLA 2BRQA 4WDIB 5IP4A 5JXEC 2NX5E 4ODXA 3EO0B 3SPVB 4LLWB 4GBXB 4Y5YC 2CKBA 3CDFA 2ZG1A 1KCVL 4G6FD 4R4BA 1R3HB 4MMXC 5D7JD 3TYGL 1I7UB 3QAZB 2NY5H 5TDPB 2DYPD 1KOAA 4JFFA 3DVGB 4KMQA 1NC2D 3OXRB 4HEME 5ADPL 1PY9A 5T3ZH 3CXDL 1ZT4A 3BN9D 3DPBA 1YNLL 5F88A 3RWEB 5INCA 3JV4A 3LEYL 2V2TB 5C09E 3T0XA 4NT6A 4OZFA 4WW1A 3SCMB 4IRSC 4FS0A 3BW9A 2OQJA 1N59B 5I1AA 4HJJH 4Y4FA 1G0XA 3CIQA 3HE6C 5CBEA 1NGXB 2XIDA 3FAXA 1EO8H 4NQEA 2GK2A 5F7EL 4OLWH 4XWOC 5FUZH 2PF6A 3P9WB 2VL4A 4HWBA 4I0PB 1HHIA 1HYRC 3ZDXE 2VIRB 4S2SA 3VGAB 1KIQA 3K4DA 4J4PC 4UT9L 1Y0LB 3WO3B 1S7RA 4JEGB 1G84A 1NUNB 2QTEA 1NMCC 1P2CA 2EYSA 3C6LD 3WIHH 3E6HA 4NUGL 4XP9H 2CDFB 4NCC1 4MJ5A 4MLSA 1CFNB 3AB0B 1DVFD 3TPKA 1TCRA 2PO6A 1U8PA 2O5YL 3LN9A 3QO1B 4F8TA 1WT5A 1IQDB 5C0CD 1RD6A 1RFDH 3EJYD 3RVWC 3MCKB 3SDDD 4G7YH 2DM4A 4IDJH 3B8YA 3CK0L 3DXAA 3D39A 3OX8B 4KDWA 1G9MH 3DURB 4DTGL 1U8IB 5GRWA 1S7TB 3NIGE 3ZDYF 3C5ZD 3GNML 3MLYH 3WHE1 3FAWA 1RMFH 3VD5A 5IR1A 3I6KB 1X6NA 1NAMB 2Y23A 4JFEA 4UUJA 5EC1B 3VI4E 4PJ8B 4O5LL 4X9BA 3OF6D 4PJHF 2XNAA 1ZLUH 1CVSC 4M93C 3FZUC 5HI5C 5F97E 5K59E 2QQNL 3T2PA 4JG0H 1M6OA 1T3FB 2NY2D 1BVZA 4OIBA 2AV7A 1FYTB 5ESQB 4OCMC 2HLAB 3VXNA 4FG6C 3S88H 3CZFA 5ACZB 1EEYA 2CK0L 4N5ED 5FCUL 2Q8AH 1X5YA 3HNSH 5CUSL 4HWZA 5IF0B 5A43C 2APXA 4ZD3H 4WHYG 5J11C 3QEHA 4M9PA 3BEVB 3BPCA 4HQQL 5JW4R 1FFPA 3VD4A 4JE4B 1A3RL 4NO2A 2X9WA 3V52L 2EDFA 4FMFA 1XGQA 2NYYC 1Y6NR 1LNUB 3CLFL 4Z77B 4NO5B 2FO4A 4YFLF 1IT9H 4JRYA 1X3DA 5TF1L 4K8RL 4G42B 1CTOA 4PY7A 1RIHL 4PJIB 5IBTL 5C92A 4LIQE 2FX7H 3CMGA 2EE3A 2HTLD 4FHBD 1K5NA 3IXAA 4H0IA 3IJSA 1TJGL 4G8FA 3S5LG 3F12B 3BDBA 1R3LA 3AREC 5LGHH 2EKSA 4CN4A 3QNXA 3V5HA 2XWTB 4YO0A 4X4XB 2AEIT 1CBVH 3O2VL 4UIMB 3BZFA 5BZDB 1P69B 5D7JA 2IMNA 2CRMA 5HHMB 3UJIL 5JZ7D 1AGBA 4DQOL 2DYPA 3TT3H 1FN4B 2VABB 1FYTE 4JDTL 4HH9A 4G6JL 4DKFL 1EJ6A 4GRWF 4Z8FH 4BH8A 3VRIB 1EGJL 4GAYB 1NC2A 1PQZA 3MLVL 4OCWH 1RAMA 1AO7B 3BPNC 4G6AD 1U8HA 2GT9A 4YIQA 1P5VA 5HDBF 4G9FB 5GRYA 3LB6D 1ZHBA 3MLUH 1SMOA 3JWDL 2ZUWA 2I60L 5ENWB 3HI6H 4IIQC 3QJFA 3IXTA 5FGBC 3AY4A 5C0FB 5F9WB 1EFQA 2HJLA 4OM1L 1CXKA 1DZBA 4JZJC 5ESVB 5F9JA 4ZUWB 3VFPA 2B5IB 3W2DL 3CC5A 2C4XA 2BFVH 3D69B 4I5BB 4PJIE 4KJPC 3S35L 4XCEB 2AXFB 5GGSY 1C12B 4BUHA 3K4ZA 5EO1B 1J5OH 4MXQD 1XH3B 1Z0NA 3C6LA 4X5LA 4MD4A 1RI8A 3THML 3U46B 3QDGA 1AXIB 3UTOA 3GSWB 5JHLH 1DVFA 1MELA 4WHTB 1RJLA 2DIAA 2P8MA 5IJVB 3BKMH 2MQCA 3HC3L 5C0CA 4ONFL 5HHME 4P2QD 4Y5XC 1UWEL 4J8RA 5CZXD 3SDDA 2JTDA 1Q94A 1AO7E 3GSQB 1G7QB 3OKEA 3UPRB 3OV6A 3C5ZA 4G9FE 3LQZB 1NEZA 1J0HA 5T33H 5DMYA 3DX8B 1S5IH 4GW4B 1OGAD 3FN3A 3JZ7A 4YXHH 1AR2A 4JKWA 3QUYC 5CP3H 4YHML 3RZWA 3HFML 3BGFC 1E28A 1S78C 3OF6A 1JWUA 3TP4A 2F19H 1HHHB 1ZE3C 3P4MA 1RZ8B 2BNQB 3N85L 2A6JA 2VL5B 1AI1L 2AJUL 2MPAH 4PBVC 5A1AA 3AU1A 3I3BA 1CFVL 1T5XA 4R96B 4LQFH 2XTJB 1XZ0B 4UIKH 2AGJL 3VFUB 1LO5A 4FQJH 4MS8C 3WN5B 1JYVA 1JNHA 2YEZB 4L9LB 5GGSB 4U1MB 1T0MA 1F58L 1IEBA 1QFWL 5F7LB 5IMKA 3WFZA 1DR9A 2R2BA 4DJMA 5D1QC 2EDJA 2I9TA 4HUWA 1XF4B 5D9SB 4EBQL 1VFBB 3BP7B 4UT7L 2EKJA 3F7PC 2R29H 2VDNL 3U7AA 4D0BA 1CLCA 4NCDA 2NW3A 3C5JB 4U1GC 1BFOB 2WAHA 2XKNB 4X6BB 3EJZD 4FA8A 3HI1A 1FZKB 4YJZL 5JDJA 5I2IB 4QYOB 1EHXA 5T3ZD 2HT3D 4KHTL 1G6RA 1Q9OA 3OKMB 3HZKB 1B4RA 4XNXH 3BGMA 2K9UA 3B9KD 2RQ8A 1MCHA 3IFLH 4LCCA 2BNQE 4QRTB 5BO1H 1ZS8B 2WUCH 1LE9B 8CGTA 4HWEH 3LV3A 2QQKH 2OS7A 3CVIL 1CLOH 4LPWA 5JPMB 4ZPTA 1IEAB 2PW2A 3RAJL 4EDXA 1JI1A 5FV2A 2X4QA 2XTJE 2ZPKH 4C4KT 4CRPA 4AY0A 3EKCA 3F7VA 1MFNA 1FFNB 4JM2C 4Q0XH 3FFDA 5HI4C 3MBEC 4JFYA 2P46B 3KJ4C 3TCLB 1QACA 3SE9L 4HUXB 1ZANH 3ORJA 3MCLL 4ODTH 5I8KH 2LU3A 1PLGH 3ZHLA 4RAUB 3KPMA 4Z9KB 1D5IH 1FNEA 3ILQC 2DD8H 3AS2A 4R8WH 1O7SA 2DF3A 2X70B 2Y7QA 1ACYH 3GBLA 4HMCA 4A6YA 1WZ1L 4XX1E 4PRDA 1ZHKB 3KPRB 1GGUA 5DDHA 3SDAD 1HINH 2YWZA 1Z5LA 2NY6C 4XI5C 2ITDA 2NTFA 4UTAL 4IM8A 3H9ZA 2IF7A 3W5MA 3CU7A 3IJYB 3VE0B 5CGYD 3DROB 2FBOJ 3IVKB 1CF8L 4JREC 2XN9B 4N1CA 1XGYL 3BH8A 12E8H 4D0DA 1FH5L 3CFJB 1XGUB 1OSZB 1KNOA 1UM6H 1CK0H 4QNPE 4MHHG 4DCQB 4YFLI 4LSVL 2HRPL 1OGAA 1UWGL 3D3VD 4BSVB 1Z9SA 5ID0A 4KZEH 4XPGH 3E8UL 3GMNA 4WU5B 4HS6A 1JNNL 4Q6IB 4XCFH 3D25B 2FJHB 3O6LL 3RPIB 3JUZA 1W8OA 4IDLA 1ONQA 5DVLA 3U82B 4XNMB 4E41D 5GGTL 4BK5A 1BFVH 1KCUL 3EYSL 2CGRL 2ILLA 2JJVA 3QA3B 3KPRE 1A6WL 5TQ2L 3MNZB 1RQ5A 2IBBA 5E1AA 3L3JA 1PX4A 1IKNC 4E5XA 1JYNA 2O61B 4YX2L 1RHFA 2WW8A 5CILH 3K46A 5KJRL 4HUNB 2EDTA 2Y5TA 3I6LE 4QXTB 4IEFB 5ALBL 3ULUE 4PGDA 4OFKA 2XN9E 3GM0A 1FVCA 3CD4A 1F13A 1IGIL 5I74B 3F7QA 3VXSD 5I66A 3L7FB 2YD2A 3ZHKA 1QR1A 3MO1A 4HJ0C 5BCAA 1U8MB 5F1NA 5IB1B 4MXVE 1RPQA 1UB5A 1NBVL 3UDWC 2Y06H 3K8MA 1YJDL 1EDQA 4HS3B 3ARZA 4TSBL 3BJ91 2CK2A 5HYJB 3PGFL 4X7FC 1JFQH 4OSUH 3OAUL 4QF1B 2WQ8A 5E24E 3LH2L 3V8CA 3UAJC 1P5UA 5ELIA 5CFHA 3WDHA 5EZOH 3SOBL 2AXHA 1YQVL 5GS1C 5AEAA 5FUCE 4H1LH 4FQCL 4X7DC 1NKOA 2HH0H 3L7EA 2WQRA 1D5BA 5I73B 4R26L 5ADOL 2Y1VA 4ZXBB 1J8HD 3GBNH 4Y5VC 2BDNL 4P2YA 3OXSA 1DDHB 4XC3L 5KS9B 3SJVD 1HHJA 5I1EH 1QQDA 3OB0K 3BIKA 1C1EL 3VG9B 2P24A 4YUEL 1IKFH 2I5YH 1DBKL 3D2UB 4QRPD 3EAKA 1SJHA 4WJ5A 2PTUA 2XFXA 4LMQE 4XNUL 4YQXL 1BMGA 1HI6A 5JHDB 1KPRB 5BQ7B 2MWCA 2NXZC 4LIQH 2GTWB 2RFXA 3MXWH 4W6WB 4D94A 1NAMH 3NZ8B 1BF8A 2AERT 1Q0XH 5HYSG 1OTUC 4HIIB 1U41A 2IQAB 4PRNB 2B4CH 5IW6A 3SDAA 5HHVL 5HYJE 1MH5B 4FFWD 2PTTB 1RK1A 4QRUB 4LLAA 1PJ9A 1MHHB 4D8PB 4DKAA 3QG6B 2B8OT 4YR6B 3PWNA 3U48A 1XCTB 2AXGB 5SWZD 1FCCA 4Y4KB 1J0KA 4G7VL 4WRLA 2OTPA 1MJ7H 4BFBD 4NQCD 4CVWA 3CX5K 1G7PB 1CN4A 1SVCP 3RWJA 5JOEA 3FCTB 4OD2A 1U8LB 3AVEA 1I9JL 1A7BA 4XVJH 2VZOA 5IJKA 2OLDA 1IRAY 4PRBA 3KAAA 1JF1A 3O6FD 3MRRB 3VRJB 1FORL 1RHHA 3LPGA 4L3AA 2AJZB 2R4RL 4UB0L 5KS9E 2V5SA 3PDGA 3EDEA 4PJFB 3WEXB 3HS0B 2HVKA 2VXSH 4UV4L 4XNYL 2DQDL 3D3VA 4PRHD 4KK6D 4XMPL 1D5MA 1MAML 4YHOH 1X4ZA 2BRRH 4M1DL 4TNVF 1CD1B 4HIEA 3V9FA 4D9RE 2PYED 5EORH 2FECL 1LILA 2V17H 3ETBF 5JHDE 1ORSB 3QYCA 3WFBH 4GQ9H 4AEFA 2NW2A 1EHLL 1KIUA 1EVTC 2J6EH 2J5LB 4E41A 2VAJA 1C08B 4OV5B 4MD5B 3EYUH 1PBYA 1T4KA 3MJ8B 1UYWL 1JZ3A 4LLDA 3HCVA 3E0GA 3QUXD 4NNPL 3G5YB 3GKWL 5KANG 1I4FA 3V6OE 3ARXA 2NMSA 5LQBL 4JR9L 4YDKH 4JPKH 1IAMA 4CU6A 2J8UB 3LZFH 1NLBH 3LRSA 2EO1A 4L8DB 3DMMD 4KJWD 4C83B 4PYGA 1IJ9A 5D71L 1G7JA 1FGNH 2YC1B 3B5TA 4NWUL 1CGUA 4WGWB 1FRGH 2CQVA 1I8IA 4JFHD 4OFDA 3VXSA 4S1DD 2ZKHL 3QFDA 4JO3H 2CR6A 2VQTA 3V8OA 2BSTA 2R1WB 3SO3B 5JORB 1BBJB 4UBDD 1H8SA 4IRJB 3ROLB 1JRHI 3NN8A 1QD0A 2JJSA 1B9ZA 2R0LL 3ARBD 2G60H 2CLRA 4PJFE 4ZFOA 1NFIB 4YDJB 4K55A 4F7EB 4GMSH 3O41B 3HNTH 3VWJD 1SY6H 2BHZA 3A67L 3DSFL 3A6BH 4M61A 1FGVH 1ZXQA 4WI3A 5MERB 3DV6B 2D7NA 5MEND 2HMID 1HH9B 3GIZL 4P57A 4DK6A 3VGHA 3BH9B 2X4SB 2HVJA 5C0AD 1IGFH 6FABL 4FXKB 5HYFA 4OGYL 1DFBL 5EUKB 4LLVB 2FEDD 2NZ9D 3H3KA 4UU9B 4Y2DD 2CRIA 1T83C 4R97C 5T1DH 4P46D 5F7DA 2FDBP 3Q6FA 3QPQD 2X1PA 3EO9L 2JJTA 1J8HA 3GB7B 2P7TB 5IVZA 3QT2A 1EHAA 2NX5D 1UWXK 3L5WB 2J8UE 5CSGA 5FO7B 3HNVH 5EPMB 1RVFH 2ADFL 1S9YA 3ARVA 3NA9H 4GKNB 3QWOB 4RGOL 5F3HA 5DLML 3NPSB 1F02I 4HKZB 3KDMA 5ITBH 1CXEA 4QRPA 3TA3B 4AG4H 4J3TA 2WIIB 5F72S 3CVHA 2EXWC 4JM4L 2R15A 1OD7A 4KAQH 4EEEA 2IBZX 4LKXB 5CP7B 3O2DL 2XWBA 3CDGB 1A1MA 2X4RB 1GAFH 3QCTH 3GIVB 1F00I 3GSVA 1IARB 4XNZB 5C09D 3SQOL 5M94B 1H0DB 2X4PA 1IZJA 5EC2A 3T3ME 5CIPH 3OG4B 1MUJA 3LPFA 4X6EB 4Z0XA 4YHIB 1NBYA 3C2AH 5EU7C 4LSQL 1TETH 5TQ0L 1P9MA 5SWZA 1G7IB 2DQCL 3T08A 2DBJA 1CE6B 4NM8H 5JLZB 5GSVB 4RBPK 3LKRA 1L4IA 2DIBA 3B9VA 5DJ8A 3CSGA 4R7NA 3WFCH 4NQCA 1JWMA 1HOCA 5IWLC 1AFVH 2MQ0A 1KT2B 4D0CA 5IB2A 1PG7X 5F6HJ 4HSQA 2VUOA 1QSVA 3CU1A 4PJAE 2XZAH 5L2KB 3FO0L 5F7MC 3M1BB 5ICZA 1MFCL 1WWBX 5I8OL 5GGRA 3O6FA 4H0GA 3QXWA 5BJTB 3Q1SH 4GBXD 3M17A 3IT8D 3FKUS 2X10A 4PRHA 4CDGC 2W9EL 3E3QC 1GZQA 2GUOA 5E4EB 4NHCL 4LRNL 1J1XL 1BAFH 4F9LA 1EO5A 3MFFA 4B7LA 4DN4H 7FABH 2PYEA 2E7CA 2DOCA 5HHOA 4Z76B 3BVNB 4H1LG 4CMMA 5I17A 1TQBB 4JZNA 1KJ2H 4JLRB 5EO0B 1F4WL 2UVEA 1OY3B 4DAGH 5I9QC 3C2SA 2XA3A 3FOLA 3G6AB 4ETYA 3SCMD 3QUXA 5LXGH 3V7AE 3VW3H 2NY1B 4XBPA 5DEGA 3FQUA 4ZS6C 4PJ9B 4NN5C 4I3GA 3KPNA 3UJJL 1ED3A 2V7HA 3ES6A 1AC6A 3L3HA 5FA4B 2E8ZA 2XXMB 4DFHA 1I9EA 2R0KL 2VLLB 3DMMA 4I0PD 4KVCH 3VXRB 4EDWH 5J57B 2BOCB 2OM5A 1XR9B 3DHMA 4KRLB 4WI8A 1KLGA 2VR9A 3MLSL 2UVFA 3P0VL 4JFOB 3RVTD 43C9B 1QLEL 2Y9RT 3LPWA 3UYRH 5ALCH 5L2KE 4PBXA 5C6WH 1FL5A 1WFUA 1IGML 2Q6WB 5TFSL 3T8XB 4JPIB 5IVXA 2EYTB 5CEYA 1C5DB 1KENL 4YPJA 1TZHB 4TNWK 1G1YA 5TE6L 2IPKA 5DD0L 1UCBH 4I2XB 2BXZA 3GMMA 1QVOB 3VWJA 4WFHE 5HDQH 2OR9H 1KXTB 4X5WA 2KZ1B 1T21A 2JB6B 5J9PB 3OKKA 3VFVB 1LEIB 4Z7QF 2Q3AA 5GHWL 4IMKA 4YAQB 1FG9C 1UH2A 4J3XA 4TQEL 5MENA 1WC7A 3FONB 5AD0B 5I1CL 4LHUB 1OAKH 1XAUA 3HRPA 3R4DA 3CLEH 4CNIB 1JIBA 4OLUL 1YQ2A 2PN5A 5C0AA 2D03L 5JIKA 2ZNWA 3MODL 4QRSA 4Y2DA 3GJEB 1I7ZB 2VZVA 1NDGA 4P46A 1AE6L 1DBAH 4M3JA 4PJ8D 1NGYB 2CUIA 2V6HA 5EWIH 3RZCC 5SX5H 4GRMA 1ND0A 2NX5A 3MV8B 2VZ1A 3QSKB 1DLFH 1M4KA 1Q72L 3C6SA 2E27L 3D18A 2YPKA 4TPRL 2DWEB 2NR6D 3VXRE 1XEDA 1DLHB 4OGAD 1JPSL 1CFQA 2JELH 3T1FB 2ATPB 2EEAA 4MA8L 2OXGA 3WUZA 1FYTD 3V5KA 3WS6C 5ID1B 4KKCD 1U58A 2FJFB 3PF2A 5J4MA 3S3PA 1H5BC 1NCWL 4APQC 4M03A 3L3DB 3EFFB 1WGOA 3HAEB 4GW1B 3EFDL 2VXVL 4MZ2A 5C09A 4I2XE 1LO3L 1N3NA 1L0XA 2J2ZA 2RIKA 3LRHA 1SYVA 1HEZA 1ODAA 5J89A 4KGLA 1M05B 2DL2A 3I75B 4N90E 4OQTL 1HXYB 3WLWC 2R0WL 1EHNA 3DYPA 4HC1L 3FT3A 2Z31D 4NC1E 3U9PH 2FB4L 2X4UB 4M1CC 4OBSA 3RX8A 1KCVH 1AIFA 3TEUA 4U1JB 3EUUA 3Q6GL 4TUOA 4S1SL 1JHKL 5JXAH 3MJ9L 4ZTOH 3BZDA 4IOIA 4DKDC 2N7AA 3LOWA 2CIKB 5HYEA 5D6DC 3D9AL 1ETZB 4HDIA 4EQ2A 1XF2B 4WDIA 1U8JB 1DL7L 3EO0A 3MV8E 4LCUB 4MDJB 1YPZB 3R0NA 3SPVA 2VZ3A 1NFKA 4PGCB 2ENYA 4LLWA 2HT4C 1HIMH 2F9BT 4GBXA 3LEYH 1B2WL 5DC9B 4QTHB 3GK8L 2O5XL 2SEBB 1R3HA 2D4DA 1FO0H 1I7UA 1OHQA 5HHMD 5KTEL 1JHTB 2ZWLT 1X5GA 5J8OA 3DVGA 5F96L 4RQQB 5F7EH 3OXRA 4QXUH 5SV3A 1AO7D 2XY2A 5F44A 2GW5A 2DQUL 4G9FD 3RWEA 4X6CF 3KHOA 3EYFB 2V2TA 5D2NB 1NMAH 5IUSA 4D9LL 3BXNB 4OB5L 1OWRM 5CJQH 1N59A 5HTSA 5IVXF 1KCLA 3KYOB 4NUGH 4EZMA 4NQUA 5M95B 4HPOL 4LVEA 4OLXH 5EDXA 4CMHB 3HMWL 2XA8L 3D1MC 4LRIC 3GHEL 2O5YH 4I0PA 4HLJA 1OP5H 3QULA 3G08B 3V0WL 3W39B 1FJ1B 3GSNH 1Y0LA 3QISA 1FPTL 3IDIB 3DX7A 5F9OH 3U6RB 1AQKL 5GXBB 4DTGH 1JNJA 5FM5O 1QFOA 2IFGA 4UT6H 1MJ8L 1CFNA 5C0BB 2E7HA 1RUKH 3QO1A 1IQDA 2Z92A 3CFDB 3TO4C 4B0MM 1DN0B 2ZUTA 3U9UB 1VPOL 3NFPB 3MCKA 1LD9A 5EULV 3KLDA 1MCPL 3OX8A 2V9TA 5ABDE 1T20B 3DURA 4M4RA 4PB0L 1U8IA 3N1GC 35C8L 4OLYL 1WV7T 2YSSB 4QEGA 5E8DH 1Y6MR 4U1NB 5D2NE 2W0PA 4WW2B 3I6KA 3MA9L 1NAMA 1ZT7B 1FLTX 4NSKB 4PJ8A 1NANH 2CK0H 4JGMA 1BREA 5DMKA 5TPWH 2P8LB 5FXCH 4GLRI 2BNQD 1X5AA 1U0QA 4PRPB 5ACMA 2IQ9L 4OGZA 1WUNT 3I02B 3H7BA 2A9ML 1T3FA 4PLJD 3QI9C 2XTJD 5FF6A 3M07A 3BP6B 1FYTA 2EE9A 1OT1A 2VDKH 5ESQA 3WIIL 3RTQA 5JQ6L 5ACZA 1ZA6B 1W0YT 1PGRB 1U3JA 2A77H 4K8RH 5DTFB 3ZDXF 5IF0A 3R1GL 1BJ1H 1RIHH 1AR1D 3OPZL 5IBTH 5C0BE 3BEVA 1P84K 4HK3N 4HUUA 4NNXA 5FO8B 1ZHLB 2F58L 3AS1A 3IJHB 5EN2B 2Z31A 4HKBB 1LNUA 4JCMA 4NO5A 43CAB 4Z77A 4X9GA 2G9HB 4AH2B 2C5DC 1MRCL 4G42A 4KKBD 3IDYC 4XZUB 3TJEL 2XWJB 4JQVA 4PJIA 1BQSA 5T3XE 3UJIH 3DETD 5IROC 4DKFH 5D93C 4EVNB 2V5TA 4OFYD 4JO2L 1RZJC 1EGJH 3MLVH 3F12A 3NIGF 3SE3C 4G6ML 1NCDL 2OMBA 4WFEE 3I85A 3RVXD 2XWTA 4L3EB 1WBXB 3W0WB 2PKDA 4OFVA 4X4XA 3DTXB 4BM7A 4PRPE 2MTPA 4HIJB 5BZDA 1CGXA 3VI4F 3RVVC 5JIPA 3GMLA 3OR6B 3O0RL 1T0PB 3PHQB 4F33B 1PFCA 5B8CB 4ZFGL 1FN4A 1VFUA 2VABA 2X2YA 5IV2B 2D7PA 3PV7A 3VRIA 4GAYA 3EZJB 5IVNA 4LOUC 1AO7A 5K59F 4NN7B 2WBJC 4JFPB 1YC7A 5L88L 5C0RH 4G9FA 4FZEL 3RNKB 2VH5L 2AP2A 3V5DB 5ENWA 5D8JL 5DJDA 4V2CB 5C9JB 3CH1B 5I6XC 4LEOB 5C0FA 5IHUL 4WO4A 2QADD 5ESVA 2YPVH 4ZUWA 4C55A 2FL5B 3WUWG 1IC7H 1SJXA 5KOVC 3VFSB 3D69A 1G7HB 3STLB 3O4OB 4X7SH 2UZIL 4NM4L 3P11L 2A83A 4XCEA 2ZSVB 5A16B 5BOZG 1D6EB 1C12A 2DQTH 3VWKD 1TNNA 4MVBD 3KPRD 2OP4H 1MCWW 3PWVB 3S35X 4LU5L 2ZJSH 5EO1A 3LMJL 1U93B 3F58L 4YBLC 1XH3A 5SX4H 1UEMA 4L3EE 3W0WE 2D4FA 4WHTA 1CFBA 2GEEA 5IJVA 2WINB 3I6LD 3ULSB 3ULUD 3LD8C 2GTZB 1TFHA 4YHMH 4XB7A 1DUZB 2XN9D 2EE2A 2EDNA 4K3EL 4HS8L 3N85H 2L0DA 3GSQA 1G7QA 2ED7A 4L8SB 1VCAA 3UPRA 1AI1H 3RWDB 3WBDA 3WNMA 3LQZA 4KMLB 3X17A 2B2XL 3DX8A 3HPLB 2EECA 1RUQL 4GW4A 1CFVH 4M62L 4XP6H 5IOPB 3O4LB 3B9DA 3S36L 5FM4A 5J6HB 2DWDB 2DQJH 4NRZB 1HHHA 3CXHK 1K8DB 1RZ8A 1BJ1J 2BNQA 3MOAL 4BELD 1KPUB 4Y1AB 2VXTH 2VL5A 3RVUD 1FAIL 2D7MA 4XP4L 5EOCL 1B4JL 4EBQH 3D85B 4X98B 1IGYB 5IBLC 3L5IA 1IGCH 2EH7L 3ARGB 2DDQL 4R96A 3VFUA 5DHVH 5DMIL 3I3EA 3NIDE 3WN5A 1OAUH 3QQ3B 2YEZA 4L9LA 5GGSA 1HHGB 4U1MA 4PJIF 5EFIB 5F1IB 1R5WB 3C5SB 1SJVA 3CH8A 3KLHD 2EIZB 1I8KB 4Y5YB 3GMPA 3L5XL 4HH8A 5D9SA 1VFBA 3BQUA 5EG6C 4DUVA 4FXLA 5IMLB 4IHOB 3V6BR 5DSCA 3C5JA 1BFOA 4H5SB 2V7NB 3PQYB 2Y6SC 1SBSL 4X6BA 5L7XH 1FZKA 1D6VL 5I2IA 4FMKA 1HDMB 1KJ2A 3QEGH 4JVWA 3OJDB 4OFYA 3O4LE 2BSSB 3T04D 5HYJD 3LIZL 4IRSB 3IFPB 1EERB 2BCKB 4Z6AT 4QRTA 4BYHA 1ZS8A 2BVOA 1LE9A 3HE6B 4X8JB 2BSRB 5F7HA 4PR5B 4FFVC 4OF8A 5IQ7L 4LBEB 4NYLA 1IEAA 1JRHL 1OL0A 4AT6B 3VDAA 5LGJB 1FFOA 1KEMH 5H35B 5J3HD 1TTGA 1J1OH 4N8VB 2VJXA 4G5ZH 4ZXBD 2JB5L 1FFNA 3JWOH 4BZ1L 5GRJH 2EXYD 1HHKB 3CUPB 4Z7UB 3WFEL 1UFUA 1M1SA 5TE4L 4GAJH 1NMCB 3TCLA 3H0TB 2E9WA 4J12A 4GMTH 2VLJB 4TUKL 1WZ1H 4HUXA 4L1HA 1I9IH 3D2UD 1BOGB 3DYMA 5EA0L 2W9LA 3MTRA 1OAYL 1KEGL 4D9RD 5JHDD 3PQYE 2R0ZH 3B4NA 4ONHB 4RAUA 3ZKSD 4YPGB 1KACB 1A6TB 1JPST 5GJTL 3GMRB 5T5FH 1CF8H 3T77B 2MKWA 2KKQA 4HT1L 2DLFL 2X70A 1QO3B 3DOSA 3EYOB 3VWKA 4U1HB 1ZHKA 3KPRA 1H3PL 1LDSA 3VCLB 4ETQB 1MFBH 4XPHH 3MLPA 3U1SH 2EIBA 5J1AB 1NGPL 3EOTH 2YD1A 4TN9A 5DK2A 3LS4L 1HQ4B 1KB9J 1OAQL 4PJBB 4Y4KD 2GI7A 3MRIB 3VE0A 4PGZA 3DROA 2KZWA 4M93B 2BVEA 3IVKA 4EN3C 4XH2B 2Z8VC 3E8UH 2GJJA 1BEYL 4P5TA 5HDLA 4FOMA 2GQHA 4EUPB 3CMOH 1NSNH 3U4BL 1JNNH 3UMTA 3CFJA 4PBWD 1XGUA 1OSZA 3HAEH 2NY0C 4Z7UE 1G0DA 4XCNB 3MRPB 1YDPB 4K8RD 1UQSA 4ZUUB 3T0EC 2VLJE 1K4DB 2FBJL 3BKYH 5HVHC 3EYSH 3FB7B 3TM6A 5J11B 5KZCB 1IBGH 3H9HB 2A9NL 5H94B 5FGCE 3U7WL 3WUWB 2DI7A 4X6FB 1RUMH 4YX2H 3RA7L 3KPSB 4WU5A 3SE8H 4U1KB 5HGAB 2DMCA 2FJHA 3PWJB 1OARH 3RPIA 1CE1L 2NPLX 4K7FA 5ALBH 4KK5D 4NJ9L 4JG1L 4XNMA 1KTDB 2YD4A 1LE5B 1FDLH 4PY8J 4ELKB 1VACA 8FABB 5GZOC 4OLZH 3I3DA 3QA3A 1R3JA 3MNZA 4ZTPL 1M7IB 2Z8RA 3VGGA 4S1RL 1F42A 5GPRA 4WVRA 2O61A 3LQAL 2VLRB 2F74B 1AGEB 3ZT7A 3HE7D 3AREB 2NY4D 2OZ4H 1NBVH 5GQBA 1YJDH 4QXTA 4M48H 2BNRB 2APFA 3PGFH 2VMFA 4UINL 4Z5RB 1Y18B 5JUEH 5MEQB 3L7FA 5F21B 1X5XA 3LH2H 4RISH 3P77B 3DARA 1P4BL 2N7BA 1MCKA 1U8MA 5IB1A 3UBXG 5GGQH 4IRJD 1WBZB 1NCCL 4M7KH 3BE1H 3AC0A 1YNTB 4PPTA 1EV2E 4HS3A 1EFXA 5ECJE 3WMSA 4F15C 3KR3L 4R26H 5J7CC 1AGFB 1TJIL 5HJ3B 5HYJA 2Z91A 5E2TH 4IIQB 4KTYA 4QNPF 3TV3L 1S7WB 3KPSE 5IHZB 3I50H 2IMMA 1MF2L 3QPXH 1YYLL 4NOBA 4OTXL 5DURB 4JZJB 4HGWB 2XI9A 4LL9A 3FMGL 4QHKJ 3NFSL 1DVFC 2ARJB 1FLRL 4XNUH 2QHRL 3QZWG 4ZXBA 5EO9B 2IH1B 2H41A 3GSNA 4HG4K 1RZFH 3U79A 2VLRE 1GCFA 2HLFC 1DDHA 3D5OF 5D7LB 5KS9A 4ZUSB 1LHZA 2NY7L 5ICYB 2X4OB 2QEJA 3C5ZC 3X3GL 4P2OD 2BNRE 1RURL 1GIGL 5FGSA 1BZ7B 4QOKB 3M8OH 2E7LA 5AWNL 1JN6B 3D2UA 5K9KB 2AV1B 2DBLH 4EKXA 4DFIA 4JFXB 2IPUK 4YDIH 1MCQA 4Y5XB 4RMWA 1NCNA 5J12B 1JHLL 1K85A 5JHDA 1KPRA 1EBPA 5CJXC 3ULUF 1B6UA 5T3XH 1AGCB 1MLCB 4G7VH 2GTWA 4NO0B 5EIIA 5D7IB 3IKCA 3NZ8A 3DSNA 3VJ6B 5EOQH 3TFKD 1JWSB 1I9JH 4HIIA 1EZVY 2IQAA 3KPTA 3REWA 3TBYB 1HSBB 4ZS7H 3FO1B 1TPXC 1MH5A 4NQVB 5DO2D 2PTTA 4YDVB 4MXVF 3QUYB 1MHCA 4QRUA 4W4OA 3BGFB 1FORH 4GAFB 1MHHA 2X7LB 3QG6A 4YR6A 3U30C 3GFUA 1KB5L 1EJOL 5DFVD 4JDZA 4ALAH 1CL7H 5KVEH 2DTML 4XNYH 4Y4KA 1GOGA 3GRWL 2DM3A 5T1KB 4XMPH 4BFIB 1GHFL 3EO1B 3FCTA 5CCKH 1U8LA 4DGVL 2R56L 1HKFA 3NTCH 5L2KD 1XGPB 5FA3B 2WWMD 2E5EA 2VR4A 5CEZH 3AS0A 4XB8A 3O2WL 1EHLH 2ZCKH 3VRJA 3MRRA 5I18L 4JY5H 3U2SB 5D7LE 2AJZA 1LWRA 4CL7A 1URLA 3IFNL 1SYSB 4PJFA 3HS0A 4N9OB 4RGMC 5LWYH 1IAOB 1VADA 4QOKE 3GKWH 1YUHB 5D1QB 1GOHA 4WFHD 4QWWC 3CX2A 3QHZH 4U3HA 1TENA 3PWLA 4K3HA 2F53A 1MJUL 5LQBH 5F7WC 4JR9H 4L1DA 1QA9B 5BXFB 3GJFK 3K81A 5E8NB 5EU6B 1ORSA 2YK1L 1XCQB 3UYOD 1ITBB 4U1GB 5D7IE 2BP3A 1KTRL 1C08A 1JPGB 2EEDA 5D71H 4MD5A 4NUJA 4ENED 4NWUH 4Z7WB 4KKNA 1Z9OA 4AIZB 2ZKHH 2VDQL 2NY1D 1XGRB 1Y6KR 3EDJA 4GUPA 1EGJA 3KS0H 3RWCA 4PJ9D 4QTIL 4Y4HC 2J8UA 4M43L 4LSSL 4R3SB 3LN5B 3HE7A 2R0LH 4JY6B 5JOPE 4Z78B 5GJSL 4L8DA 5AZ2L 3VXRD 4C83A 3JV6B 2YC1A 3H9SB 4PTTB 3G04A 1DQLL 2R1WA 1BBJA 3GIZH 3BI9X 2HA1A 2HFEB 1J7VR 4LLUB 4IRJA 3RKPA 3ROLA 6FABH 1CU4L 4JM2B 4OGYH 3RWGB 3K2MC 2P48B 2CRZA 1NFIA 3MBEB 4JHAL 1TDQA 5I1JL 5D96C 3RJDA 4YDJA 2A74B 2OTWB 3KJ4B 4F7EA 1WISA 3O41A 4F7CB 1JGVH 5FAAA 1PSKL 4N90D 3GSUB 3EO9H 4TULL 4PJCB 5DUBB 4HLZG 4U3CA 3BWUC 3JXAA 5E6IC 5KS9F 2IG2H 5KVGL 5MERA 5EU6E 3IDGB 3DV6A 1HH9A 2V5RA 3ARFA 4KI1A 4LHUD 2X4SA 3L3IB 4RGOH 2UUDK 5DLMH 3F5WB 4FXKA 4MCYB 3U36B 5EUKA 1TLKA 4LLVA 1VENA 4Z7WE 2PCPB 1MJJB 4PJAA 1OB1B 3O2DH 3GB7A 3BFOA 2P7TA 3MV8D 1TMCB 1FZMB 5FO7A 3VMOA 2ZUYA 1A7OL 2LVEA 2NY6B 5EPMA 1A6UH 4GKNA 3SQOH 4P2OA 3WJLA 5GS0C 5DA0B 3PHSA 3H9SE 4PREB 2GJZB 2R4SL 4HKZA 4K3JH 5EU3B 4JREB 2WIIA 3UBXB 4LSQH 3PXJA 3T0VA 1A02N 1MPAL 4LKXA 2DQCH 4KRPC 5CP7A 4C59B 3CDGA 5BVJA 1KN2H 4CU8A 2R8SL 1DBBL 2X4RA 4I3RH 5HGDB 3GIVA 2FZ3B 3L95B 1HZHL 1YC8A 3WE6B 4ORZC 4U2ZA 1UZ8B 1H0DA 5EOTB 3NACL 4PJCE 4X6EA 2EDOA 2Z8SA 2YPLB 4TSCH 5BV7C 5I8OH 1S7XB 1AHWA 2ZZUT 3PJSB 1AD0B 5JR1L 4E9LA 3MV7B 2WP3O 4PJFF 2CXKA 4U0QB 1QYGL 1G7IA 4FQ1L 1CE6A 2VDML 5GSVA 5JLZA 1QTYT 5F3BB 2P5EB 2W9EH 2VC2L 1J1XH 1KT2A 2PR4L 3S9DB 5ILTL 4M9OA 3IB4A 5JO5B 1TVDA 5L2KA 3IS0X 3M1BA 1T66D 4F7MB 1JVKA 1GPOH 1MRFH 3PL6C 3EZ8A 2NY5C 4Q9BA 5BJTA 2D9CA 4MAYC 3I2CL 4AEEA 5DT1L 2MSPA 5E8OB 3QRFM 3ALWA 4XHJC 3N9GL 3C60A 5HVWA 3MLXH 2J8UF 3KS0J 5C0ND 3FQTB 5KAQG 2FIKA 3IETB 4Z76A 4HD9A 3BVNA 4GG8B 5EO0A 4OCSL 1AXSB 1MWAH 3G6AA 5FECB 2UY6A 5CLWA 3MLSH 4BQCA 4BFEA 1QLEH 1T1WB 2YPLE 4OZGE 4GRLC 1UCTA 1IGMH 4NBXB 5TFSH 1V7MH 4PJ9A 4XXDB 3MV7E 5DZLA 3LN4B 2NXYC 1B0GB 2HKHL 5L8KB 5FA4A 5TE6H 5DWUL 5DD0H 4PJXB 2C4FT 1IGTA 3T3MF 2VLLA 1LO4L 5DJYB 3VXRA 3N1PC 2P5EE 1PYWB 2BOCA 1AY1H 1XR9A 4K3DH 3DUSB 5GS1B 3HB3D 2YN3A 4HXAH 4RAHA 5EBWB 2VZUA 4U6HB 5I8EB 4JFOA 2Y07H 43C9A 3TCXA 5SWSB 1MSPA 1F2XK 1HKLL 2VQ1B 4GSDL 1T1ZB 4G8EB 3WD5L 2V9RA 3T8XA 2F8VA 2EYTA 4OLUH 2W92A 2D03H 4Y5VB 4MDIB 1Q9KB 1TZHA 3H3PL 4ERSH 5C0BD 4I2XA 1TJHH 4I8DA 1UXSB 3INUH 2OI9C 4PJAF 1G9MC 2H1PH 1AE6H 5HHXH 1R24B 5B39A 1QVOA 3HR5B 2ICEB 4LSPL 2JB6A 2IFFH 3DVNA 3VFVA 1LEIA 3MLRH 4Q6YA 3MV9E 3QQNA 3RU8L 4YAQA 3FONA 4KDVA 5AD0A 4LHUA 1GGCH 1K8IA 5JIIA 4M6OH 4CNIA 1BZQK 3C8DA 4DVRL 2YKLH 1JPSH 4LGRB 1BX2B 2DQFB 4OCYH 5T3XD 4POYA 3FRUB 4MA8H 1QHPA 3GJEA 1I7ZA 3MLTA 4N5UA 4L5FL 4P3CH 4BSWB 1H3WM 1NCWH 1NGYA 3OKDB 4HFUH 1OM3H 3MRJB 1MRDL 4KDTC 4WFED 3MV8A 1I1AC 1RUAH 2VXVH 1IFHL 4PJXE 4PRPD 1LO3H 2LAGB 2DWEA 4S11A 1Z9LA 4K2UL 1DLHA 4X9HA 3DX6B 5GS3A 3EHBD 1OSPL 4OQTH 2FX9L 1S7UB 3T1FA 3K74B 4BZYA 1INDL 2ATPA 2R0WH 5I1DB 3H8NA 3IDMB 5ID1A 5K9QI 2FJFA 3O3AB 4JDVB 1CICD 2OTUB 3BGAA 4YK4C 2A6KB 4DOHB 3L3DA 3HZYB 3EFFA 5AYUL 3RIFF 3AAZB 5JW5B 2F54D 2YZ1A 4S1SH 4Z95H 4OM0H 3MJ9H 5CEZD 3HAEA 1JCKA 3O3EB 3PIQB 4H20L 1GGIH 5GGTA 1IM9A 4HBCL 3I75A 5FKPB 4LNVA 3D9AH 1OTTC 5IG7B 1DL7H 5LAXA 1HNGA 3Q3GB 4WI9A 4LMQI 5DJAB 3LS5H 4KQ3L 3SKMB 2X4UA 2BX5A 2CDEB 1N2RA 1N64L 3GK8H 4OF5A 4U1JA 1O7VA 5F71A 3X3FH 4TTGA 4WHCA 2DLTA 2D31B 2YS4A 3SE4C 2P47B 4ZOCA 2EDQA 4F7TB 4P9HH 1BZ9B 3QUZC 1ETZA 3OAYK 4X9FA 1CFSB 4JQXC 1U8JA 3BISA 4LCUA 5KBNC 5F9DC 2DTSA 4L3ED 3W0WD 1A4KA 3A0OA 4C4KO 4FRWA 4L9DA 1AC0A 2D0FA 1VFMA 2JF1A 3A6OA 4QTHA 1LEGB 2IPUG 2SEBA 4OB5H 3JTSB 5DHYB 1QKZL 2AXJA 1NC4B 3BKJL 2MFNA 3K80A 1J05B 1JHTA 1LMKA 5T1LB 1UVQA 2YA2A 4I3SH 3PG2A 4MNGA 1RZJL 4RQQA 1BQUA 2MCG1 3WNPA 3G6DH 4O51B 4DOHE 1E4KA 3DLQR 3GHEH 1E6JH 2DMKA 1MCOL 2H32B 4NFDA 4Y8DC 3EYFA 1LP9A 3BPLC 2XY1A 2F8XC 2FATL 1X5LA 3MLZH 4AEIL 2ZUQC 3BXNA 3CPLB 4MXWL 3RX7A 4CVZA 3AM8A 3RY6A 5I30H 3KYOA 1J87A 1QSEA 2B0SL 4Z7NE 3MOBH 2Q1EA 4EOWH 4HIXH 2JCCB 4HKJA 2JJTC 3KYKH 3EJJX 4H25B 2ATKA 4HUKB 4ONGL 1C16B 1P7HL 2GKIA 5DXWA 4G8GB 1I85C 4ZOBA 1FJ1A 1L7TH 2P8PB 1YECL 1RULL 3DIFB 4E0RB 1HYSD 4TRPL 3TZVB 3U6RA 4R97B 2VDOL 4PB0H 4KUZH 5IGXH 2EDDA 1N5YL 4LVNC 4J1UB 4F2MB 5E08H 2VRAA 5C0BA 5B3JE 3MA9H 5FHAL 2OL3L 3CFDA 2CJUL 3C87A 1DN0A 4POUB 3IF1B 1KTLA 3PP4H 3NFPA 4NGHL 4XC1L 4KQ4L 1P1ZB 4X83A 1T20A 5D2LB 4LSRL 3RI5F 2FR4B 2IQ9H 1KB5B 3BP5B 4PLNC 3N1QC 2YSSA 3BOVA 2CKBH 1NH6A 5EBGA 2A9MH 4U1NA 4ZO8A 4FFZH 1TZIB 4WW2A 1C5CH 1YEDB 2A0LD 4MQ7B 1L0YA 3O4LD 4TVPH 1UC6A 4NSKA 3C08L 3GBMH 2P8LA 4KHXH 1I8LA 3SQBA 1YYML 3R1GH 4XXCC 1YEGL 2JCCE 1V7NH 4Q9QL 1G9EA 4NP4H 3MRMB 4KK8C 2JJUA 3NAAL 1I9RH 3SN6N 3O6FC 2VZSA 3BKCH 3VXME 4HJGA 1R3KB 3D85D 3QDAA 4YBQD 3I02A 1S9VB 4G8GE 2AEQH 2ORBH 4OZFH 3ARGD 1KCSL 4Y16B 1RZKH 3BP6A 3OAYH 1FBIL 1CICA 4KTEL 4DGIL 1SJEB 3QIWC 1ZA6A 1WVZA 4X0KA 2LE9A 5ESAB 4M5ZL 5IFHL 5DTFA 2F54A 3QHTC 3WO4C 5JXED 2R39A 4GRWH 3CSPA 4RMTA 1JYWA 4FZ8L 4O02L 5MI0C 4J6RL 1BQHG 3WXVL 1TCMA 4WUUB 4U6YB 2FNBA 5FO8A 1ZHLA 3S4SG 1E6OH 3IJHA 5EN2A 1JNLH 1NCDH 3F6LA 3KYNB 4CUCA 3MNVB 4HKBA 2XZQH 4G43A 43CAA 3G9AB 4MHHI 1S9KC 1DCLA 2IANB 4I18A 2G9HA 1TIUA 4AH2A 5KSAA 3PQYD 4R7DB 4XP1L 4XZUA 2FHFA 1FL3B 1NCUA 1HH6B 2P45B 5FHBH 5I9QB 3DMMC 1SVZA 4KJWC 4EVNA 4NBZB 4RIRB 4J7RA 5JW4Q 5GRUL 5DMGD 3RP1A 4IRSD 2X5PA 3PV6B 3WFDL 4L3EA 1WBXA 3HE6D 3W0WA 1JZ7A 2VH5H 5GSRA 4KI5E 3MUGB 4X80L 1WEJH 3R06B 5EU7E 4NN5B 2A6DB 5TJWK 4XWOD 4RGNC 5IBUG 1QOKA 1BGXL 5HHNA 5FV1L 1XFPA 3OKOB 4F33A 1G9NH 3GGWB 5B8CA 4FN0A 3TVMC 1G7LB 1X5KA 4N8PA 4J4PD 2MHAA 3X12A 1F90L 3RGVC 4JFPA 4LEXL 2IBGA 5K93A 1KYOJ 4IMKC 5SX4I 1OCWL 4ZNCD 3OR7B 3RNKA 3P4OB 5DVOA 2VLJD 4QHUB 1EPFA 5C7XL 1MHPL 4WUUE 3V5DA 3AXLA 3TBTA 4LU5H 5C9JA 1A7RH 1DANT 3LMJH 2Y36L 2NZ9C 3CAFA 3E3QE 4LEOA 4P46C 2FX8L 3UTPE 1EIBA 3RVWD 2IANE 4GT7A 3PDOA 4X7EC 5C0IB 3ZYJA 1FE8H 2FL5A 3EYQC 4HWNA 1ZLWK 4HBQA 1O5DT 5IB5B 4L8CB 2VDPH 1G7HA 1NUFA 3STLA 2KQNA 2I26N 3OAZK 1CR9L 2ZSVA 4M1GL 5A16A 1D6EA 1RIVH 4K3EH 4HS8H 4P9ML 3WL9B 3PWVA 4PJDB 3IRZA 3MROB 4K71B 1J11A 1U93A 3O8XC 3QUKA 4CKVX 5JW4M 4RMVA 1A0QL 2ICWB 3O2DA 3QNYB 3RZCB 5TH2B 4WW2F 1QFWI 1RUQH 2RR3A 3ULSA 2GTZA 4UNTA 3FZUD 5HI5D 1DUZA 3J7HA 3S36H 4PV8B 1CIDA 2P42B 3UZVB 1QBLL 5GISL 4UQ3A 4MA3B 4FQPA 2B1HH 3IU4L 4L8SA 1QRNB 4FG6D 4XP4H 4KV5E 1WTLA 3RWDA 1H5BB 4OGXL 5EOCH 3C8KA 3T0DA 3HPLA 2ZUVA 4WU7B 2EH7H 5CGMA 3F65A 5KZCD 4GW5B 5DMIH 4UNUA 5J6HA 2HN7B 4NRZA 1K8DA 1Z3GL 3KPSD 1KPUA 2NYYD 5L9DL 5DF0A 2WUBH 3PWPB 5E8EB 5A3IC 3L5XH 4ZUTB 2Q8BL 3D85A 4X98A 3UC0H 3TT1H 4LASH 1IGYA 1S9XB 4LPTA 3SKNB 1FFQA 3BIAX 3L1OL 3ZYOA 4XBEH 3ARGA 2XKUA 1DP0A 4S0TD 1ADQL 4PJDE 1A7NH 1HE7A 4HPYL 1LDPH 1PVHA 4HK3J 3QEQB 1N0XL 1WTGT 3QQ3A 4MA7L 4JHWL 1HHGA 5DA4A 2VLRD 5EFIA 5HVGB 1R5WA 1DBJH 2OCFD 5JXEA 3ARED 3GJFB 2EIZA 5D70L 3RWHB 1I8KA 1U3HC 4Y5YA 3DGGB 2BNRD 4WEUD 3VFGH 5LBSH 3V4VL 2PYFB 5IMLA 4JO4H 4IHOA 5IB4B 3FN0L 4K7PX 1R0AL 5IQ9B 4H5SA 3TGXA 2V7NA 1QRNE 3PQYA 4RFEA 2NLJB 4MSWA 4FTVB 2HYMA 4IBLT 1HDMA 1JRHH 4XAWH 1BBDL 4FQQB 1N6QH 4M7LL 2BSSA 3OKLB 3ROOB 1OF2B 1YEIL 2Q7YB 5I0ZA 4IRSA 1ZT1B 3IFPA 1DSFH 4QHKI 5A40E 2BCKA 2DQIL 3QHFH 5DJ6A 4P23B 4CN6A 1WFOA 5TE4H 3HE6A 3DBXB 1UJ3A 4X8JA 2BSRA 1M71A 4PR5A 1DEDA 3O9WC 4XMLH 2UV3A 4LBEA 4KMTL 3FB8B 3PWPE 4XPBL 3BUTA 3T65B 4JFDB 4AT6A 4IMLB 1V3LA 5HGBB 4GOSA 5C2BL 5LGJA 1JGUH 5H35A 1ZK9A 4N8VA 2EDEA 4WUKL 3QEQE 4YGAB 3K2UH 4HZLB 3ZT6A 1OW0C 3BT2L 5E6YA 1HHKA 3CCHA 3CUPA 4Z7UA 5GJTH 2E8YA 5D7LD 1JI2A 2DQHL 3H0TA 3N1FC 4GKZB 1UH4A 1E4XI 3QQ4B 4YHLL 2VLJA 4WCYL 3ARSA 2P1YA 1JL8A 2UWEB 3NIDF 4QOKD 4B7IA 1H3PH 3S6CA 2YXFA 2HFTA 5HVFB 2UZXB 2D0GA 3P0YL 1BOGA 5E2UL 4CGTA 3TO4B 1PG7L 4WV1C 4F58H 3TBWB 2B1AL 4HK0B 1OAQH 3Q48A 4JQIH 1FZJB 4ONHA 2B4CC 4KROC 4NO0D 4OZFG 4FTVE 4ZOAA 1A6TA 3OSKA 3GMRA 3T77A 1GYAA 5EU5B 1QO3A 1BEYH 3EYOA 2VITB 1W72L 2WK2A 2FH6A 4U1HA 1T1YB 1YEHL 4I13B 3U4BH 4K23H 2AJSL 3VCLA 4ETQA 2C1OB 2G5BB 4RCAA 3QUYD 2YMXL 4KKCC 5EOCJ 3RTQC 3OQ3B 2WBWB 2FRGP 1HQ4A 3ZE0E 5DJXA 4NC2B 2C3GA 2FBJH 3V2AR 3BD3A 5JOPD 4LVOB 2HAZA 3MRIA 3B6SB 3HN3A 5T1KD 3UO1H 5IB3B 3KPLB 4JFDE 2QQLL 5EZIH 2DL9A 2A9NH 3U7WH 1Q0YL 5EZJB 4OQTA 1K9TA 4EUPA 3RA7H 5H37G 4HC1A 2JK5B 2FJGB 5DD1L 3F62A 1JGLL 1CE1H 2Z31C 4MS8D 3H42H 1DQTA 4NWTL 1G6VK 4JG1H 1FVEA 1YDPA 3MRPA 4ZUUA 3NZHL 1IQWL 4TNVK 1FYHB 1K4DA 3S34H 3FB7A 3MJ9A 2UWEE 1A3QA 4C56A 3UTZB 3T4YB 5D1QD 4K3GA 1KF9B 5J6GB 5FCSH 1N7MH 4ZTPH 5KVFL 3DNKA 3WUWA 3L3KA 3LQAH 4X6FA 4HUVB 4M02A 3KPSA 5EU6D 4E42B 4R4FL 4U1KA 5HGAA 3PWJA 4YFDB 4XVSL 4UILH 4XCCH 2WBKA 4AM0B 2ADJB 1ZSDA 5GRZA 1KTDA 1LE5A 4ELKA 3IDYB 4CU7A 4UINH 5FO9A 3V4UL 1A4JA 2EDKA 1Z9MA 5ANMB 2IALB 5D93B 3SDXB 3V6FB 1M7IA 1FV1B 1C7TA 1P4BH 2H8PB 1VEPA 2J4WH 2V2WA 2VLRA 1OGTB 3ZL4L 2F74A 1AGEA 3SY0A 2XPGA 1KLFA 4HV8A 3AREA 1F4YL 2MKLC 3OGCB 4FQ2H 5J56B 2BNRA 4D9QE 3RKDC 5GGVL 5KVDH 4RMRA 1ZTXL 2XQBL 1TJIH 3H9SD 2XG4A 4Z5RA 3ZE2F 3S97C 4A6YH 1QFPA 5MEQA 3FRPG 4AL8H 1T7ZA 3ESUF 3P77A 2H32H 1MF2H 5I1KH 2VXQH 4DZ8B 3QCUL 4K07A 4OTXH 4M4PA 4WO4C 3NFSH 1WBZA 4JM2D 2WBJB 5HI4D 4U05A 5E99H 4F57L 3MBED 4R90L 1AJ7L 1YNTA 5SWQB 3DRTB 2HJKB 2C3XA 1JZ8A 4LARL 2QHRH 3QRGL 1ZVYA 4R9HA 3KLAB 2E7MA 1LO2H 2CIIB 4LFHD 4Z7UF 5HY9B 2XZCH 4MCZB 2BY2A 1S7WA 5IHZA 2HTKC 5FGBA 1Q1JL 2DJ4A 1ZHNB 3WYRA 1VKXB 5DQ9A 4JZJA 4HGWA 1JZ4A 1IZKA 1KG0B 1KIPB 4W6YB 2WLZA 1FNHA 1KBGL 4XGZB 2ARJA 3S37L 3U0WL 3ILQD 3U7YL 2OL3B 4PJHA 5F8RC 4N9GB 3STZB 1DQJA 5DJ2A 5ANME 5DQJB 3SDXE 5EO9A 2IH1A 3DRQB 1A14L 3ZKMC 1Q9LA 4YBLB 4CW1B 2NY6D 4XI5D 2EYRA 5D7LA 4ZUSA 5ICYA 2X4OA 1BF2A 4I1NB 2R2HB 1ZLUK 4YEFA 2YR3A 4LLMA 4QOKA 1P7KA 1SMAA 4WI5A 1JN6A 3KWWB 3TESA 2AV1A 3LD8B 4R4ND 4JFXA 5A2LH 3T2NL 4N1EA 4Y5XA 1CDBA 3IDXL 4ODWB 1KB5H 3RX5A 2Q3ZA 2D7OA 3MRLB 1EJOH 1TVBB 3QDJB 1NGWB 2DTMH 1MLCA 4HUMB 5CWSB 4NO0A 3VFTB 5JA9A 3GRWH 5D7IA 4M6AA 3VJ6A 4YHKH 2MMXA 2R56H 5GS0L 3TJHC 3TBYA 4PGBA 1HSBA 4TSAL 3FO1A 2D7TL 3QIBC 4JPVH 4NQVA 2YPLD 3IGAB 3MLWL 3O2WH 3QUYA 2VWEC 5IFAL 3MV7D 2X7LA 1BD2B 4IS6A 3IFNH 1I3UA 5GRVK 3HC0B 4F3FB 2P5ED 5T1KA 3P2TA 4BFIA 4TOYH 4CN1A 3P4LA 3QCVH 4OCRL 4PJ7B 3U4AA 3VFWA 3BQUC 4X7CC 1XGPA 4R4BB 5FA3A 5BV7L 4P5MB 4HMDA 4G8IB 3ARRA 5C0JB 5CINH 4XVUD 3U2SA 1NL0L 1SYSA 4G6KH 1IAOA 4KXZH 1YNKH 5CJ8A 3Q5TA 5BVPH 1YUHA 5D1QA 4K9EH 4QY8B 3UZEA 1FNAA 6CGTA 5INCB 1QA9A 1F6LL 4NT6B 5BXFA 3MV9D 4LSSH 4NZUL 5E8NA 1MCEA 3BW9B 5I16B 1IC5H 2OQJB 2ARWA 5DYOB 3LSOB 3RVXC 4HJ0D 3VDCA 5CBEB 1JPGA 1T04B 2R23A 3DI3B 5L8LB 2OJZL 4Z7WA 4AIZA 3VXTB 3TIDB 2W59A 1XGRA 1DQLH 1II4E 2I07B 1P4LB 1GGTA 1SM3H 4MNHB 2BVPA 4XPFH 1BD2E 4R3SA 3LN5A 4JY6A 5BMFH 3GMQA 3RWIA 4Z78A 3BZ4B 4HJJL 4MQXC 3UAJD 4U7SA 4OIAA 1P2CB 2EYSB 5L6YL 5FM8A 1PSKH 3H9SA 1EO8L 3EDKA 3NABH 4PTTA 4OLWL 3MRDB 4MJ5B 4PJ7E 5FUZL 5BRZB 2J8OA 2VSCA 1TCRB 1U8PB 1BM3H 3WS3B 2BY0A 3HG1B 2QSVA 3FTGA 2HFEA 4Q9CA 5JPNB 4LLUA 5FYKU 2QADC 4HFWA 4JM2A 3C09C 3RWGA 2B39A 1S7QA 3MBEA 1KV3A 2A74A 2OTWA 3LKNB 4F7CA 3WIHL 3WKMH 3GSUA 4PJCA 4XP9L 1KXQE 5DUBA 2RB8A 3C9NB 2VKWA 3VWKC 4PS4H 5KW9L 2ITCB 4JB9H 4UUJB 3NCFB 5D1XC 1K6QH 4OFPA 1RFDL 4HZAA 4MCYA 4G7YL 2XNAB 4YFEA 3U36A 1QG3A 4MZ3A 3MOQA 5CEXB 3GI8L 2ZOKA 2F5AH 1G9ML 3LHPL 4S0SD 1MJJA 1MPAH 3B9AA 1OB1A 3MLYL 3WCYA 4P5TC 3TH2T 3MJ7A 1MREL 1NQBA 3GO1L 1CD9B 1DBBH 1FZMA 5D7IF 4GLRH 4P3DB 1HZHH 5HBBA 3V0VB 4HX1B 4ZUVB 4LKCB 1CDHA 1EEYB 2OBGA 5E2WL 5C0EB 3I9GH 4O00A 1LGVA 3NACH 4PREA 4OZHB 2DAVA 5JR1H 4NHUB 5EU3A 5BRZE 4EN3B 2IBZY 3BPOC 3O6MH 2HT2C 4PRAB 3HG1E 3OZ9H 5D7KE 4JG0L 5HGDA 3U0TB 2FZ3A 3L95A 3WE6A 2IH3B 4ORGB 2NY0B 3B2VL 4UI2A 2PR4H 1UZ8A 3UXFA 3T0EB 5D4QA 5EOTA 2EC9U 5HVHB 2E9JA 3EOAB 4YHYC 3NVQA 2YPLA 4CAGA 4OZGA 3W9EB 1S7XA 3PJSA 1X5FA 1AD0A 1CD0A 2NQCA 3MV7A 3T0WA 3I2CH 1J86A 4LQ1A 5DT1H 3QG7L 4NQDB 1D7FA 2PUQT 5F3BA 1C5BH 2P5EA 4P2RB 3MRGB 3IDNB 3FB6B 3N9GH 1U6AL 4JRWA 1GC1H 1RZIB 1U8QA 1IT9L 1FIGL 5JO5A 3RHWF 4F7MA 2VISB 4XT1C 2FX7L 4KPHH 4OCSH 2EIEA 1JF6A 4Z7WF 2DQEH 3ZTJG 5HI3C 3VXQB 4O58L 1U8NB 5E8OA 4XRCB 2VE6B 3MGOB 2C1PB 1IMHC 4M7LT 3V6ZB 1NC4D 2VAAB 4Q58C 5FOBA 4OZHE 2IGFH 5T1LD 5DJ0B 1CBVL 3K7UA 3MV9A 5DEFB 3IETA 1ZGLP 4O2EB 5DWUH 4GG8A 15C8L 1ZA3B 1WFTA 1LO4H 3QJFB 3IXTB 2LQRA 2EE6A 3TT3L 4Z8FL 1AXSA 2L7JA 4U7KA 5CZKA 5FECA 1KCRL 4PGJA 4OCWL 2XV6B 4U6TA 3T0EE 3UDWA 1T1WA 4ZFOL 2IAMD 1HKLH 4F15B 4K94C 4LHQB 4JM2F 4R6UA 1PX3A 4XXDA 4LSTH 3CVHH 5HD8C 3LN4A 5I1GH 3H3PH 5JW3H 1CT8A 4PJXA 4DK3A 4NQDE 2EXYC 2R9HC 1DQMH 3HI6L 4AEHL 4LDOB 1QEWB 3D87B 2P49B 3DO3A 4P2RE 5DJYA 1PYWA 4PJCF 4U49A 3VXMD 3DUSA 5GS1A 3SDYH 4G8GD 5EBWA 3QDGB 3K8LA 3ARUA 4P4KC 4U6HA 5I8EA 1DVFB 1D9KC 1UG9A 4PRIB 3TZVD 3WHXB 2VQ1A 4PG2C 4MLIA 1T1ZA 4G8EA 5C0CB 1JYXA 5DD3H 4DVRH 4YXKH 1JGDB 1HN1A 1KIRB 4Y8AA 4MDIA 1Q9KA 3I84A 3LKPB 4Q97A 4MB4A 3TO2A 1UXSA 3OKEB 1R24A 4L5FH 3HZVB 1QLRB 3P40A 5IESL 4OD1H 1W72B 4MQTB 4NZTL 2APBA 4YLQT 3ZE1E 3U0PB 4LCIL 2GHWB 2AI0H 5FYKL 2OXHA 5DC0A 2ZUUA 2EXWD 1JV5B 4W4OC 3FQNB 4K2UH 2NNAB 2H2PC 1BX2A 1OSPH 1X4YA 2DQFA 1NLDL 3P4MB 5EB9A 4P0DA 1INDH 3FQWB 3FRUA 4Y4KC 3FL7A 1F3DH 4LLQA 4BSWA 1F6AA 3OKDA 2YD6A 4OKDA 4XTRC 4ZPVB 3MRJA 3NCMA 5AYUH 5T33L 2EDRA 1TPXB 4KI5D 4AIOA 2QHLA 3LY6A 4PG9B 4AMKH 2CDGB 3U30B 3V4PH 4ZQKA 2F19L 4HBCH 4OZGF 5B38G 1S7UA 1ZVSB 2FYYB 3QDGE 5I1DA 4Y16D 1QSFB 3O3AA 4JDVA 2OTUA 4PRIE 2MPAL 32C2B 5DK0A 3HZYA 1N64H 3AAZA 4JANB 5JW5A 1CWVA 1XIWC 5BW7C 1A9BB 2GSIB 3O3EA 4UIKL 3PIQA 4HXBH 1T1XB 3VA2C 2J5LC 4WUUD 4PYHA 4R2GC 5FKPA 5HYQA 3PP3H 4RGMB 3HI1B 5F1SA 5IG7A 5CD3B 3O3DB 3Q3GA 5DJAA 3SKMA 3UTPD 5DVNA 2APWA 4U1SB 2IAND 1ORQB 1T2XA 2CDEA 1X5IA 3RDTC 1I3RB 2AJXH 1UA6L 1CDYA 2LTQC 3TH3T 3HE7C 1QKZH 2FH8A 3BKJH 1E4JA 2R29L 2NY4C 3ULVC 1OTSC 1FVDB 1S3KL 2D31A 4X7TB 5H2BA 1JE6A 5IMMA 1MFAH 4F7TA 3ILPA 3BDYH 1BZ9A 4ODVH 1CFSA 4MA1C 2AABH 2PW2B 4ZYKB 1VESA 3TLRA 1MCOH 4MYWB 1EXUB 1EK3A 1I3GH 4Y2OA 4Y4HB 4IRJC 4AEIH 1L6XA 3IFLL 5DHYA 1E0OB 1NC4A 3P73B 1J05A 5T1LA 1RU9H 1QSFE 1KELH 2QQKL 3S5LB 1CLOL 4PJXF 3VDBA 1KUMA 4O51A 5LVEA 3BSZL 4HF5L 1J18A 4YE4H 1VFAB 2H32A 4ONGH 1A6VH 1NUGA 3ARFC 1IC4H 4EQ3A 2E9IA 1E4WH 1RULH 4Q0XL 1EMTL 2J8HA 2IAMA 3KPMB 5D96B 2VDOH 3P0GB 4DGYH 5KSBB 1N5YH 1S5HB 4DW2H 4P2QA 2Y7QB 3KNBB 4GO6B 1WZMA 2JCCA 1CGVA 4PRDB 5E6IB 1ZANL 3MXVL 3QXDA 4M8QB 2Y4SA 4Y89A 3VXMA 2CJUH 5FOJA 4ODTL 4Y7MA 1R5VB 2DMBA 2QSCL 2J88H 4G8GA 3L3GA 4Y88A 1E4XL 4P2OC 5I8KL 3WJLC 1LO0H 2P8PA 4EI5C 1BQLH 1PLGL 3DIFA 1T2QL 4E0RA 3TZVA 1T83A 4WTXA 4R8WL 1MIEL 4F2MA 5CZVH 1MCDA 3IU3B 1ACYL 3RZCD 4P4RB 5IFJB 1A7QH 3MGTA 1F3DJ 5F89A 1HINL 4UOW0 1YEJH 2NTSP 4XNZC 2H3NB 2FD6L 1MHEA 3IF1A 4NIKB 3Q5OA 2DLGA 1YYMH 1W2KT 1ZEAH 4YHZL 5DO2C 3T2QA 1AHWC 2FSEB 5ID0B 1QRND 1FG2B 1KB5A 3BP5A 4OI7A 4KRPB 2BVUA 4PLOB 5DFVC 3MUHL 4X99A 1KCSH 1TZIA 3GRWA 4HS6B 5CJOH 5CGTA 4MQ7A 1FBIH 1UM6L 3GSOA 1CK0L 1UZ6E 5KSBE 3X11B 1FSKC 2VNCA 5IFHH 2E6QA 3WLWD 4WFGE 5BV7B 5F93C 2WWMC 2HWZH 1YEFL 3MRMA 4FZ8H 4O02H 1XGTB 3NH7H 2BZDA 4KZEL 3ZKQD 3PWPD 4XPGL 4HCRL 1FCGA 1R3KA 2IWGA 4G9DA 5EBLA 4BKLB 5FUOL 4Z7NF 5FFLA 3VGFA 4Y16A 5IW3A 4XCFL 3D0VB 4AENA 3C60C 3QEQD 5ESAA 1WCQA 5DK3A 5ICXB 3B9KA 3PABB 3D0LB 3PL6B 1NDMA 2HT4D 2AJYH 4LPVA 4MAYB 3MX0A 4WUUA 4U6YA 3CDYA 1AKJB 3S3SA 5GRUH 3OBAA 4U1LB 4Z7OF 3KYNA 5CILL 1MFDL 3WFDH 3MNVA 1B88A 5F7UA 1NFDB 1MCSA 2IANA 5B3JF 3AROA 4R7DA 3RQ3A 3OHXA 4FTVD 1BGXH 4W4NA 4WWKC 5IT2L 3P3YA 4ZMAT 5DS8B 1NPUA 4HULB 4RIRA 2H2SC 3NBNA 4URTB 3PV6A 1F90H 4LEXH 4P23D 3H2WA 5ETUA 2Y06L 4GRLB 3SKOB 1OCWH 2VDRH 2VLKB 2YD3A 4KTDL 3MUGA 5B38B 1D5BB 2A6DA 3D48R 4FQIL 5C7XH 2KUTA 3BUYB 2NXYB 5DRZB 1VGKB 4KY1L 3JWOC 1NCAH 1JFQL 1FNSL 4JFDD 2AQ1A 3GHBH 1PKQB 3GGWA 3UJTH 2JCCF 1G7LA 3EW3B 5EZOL 5CKGA 1FQ9C 2G75A 1MCNA 4WTZG 1A1OB 3E2HC 2XICA 2GK0B 1ZLVK 4NQXB 3SGEI 3P4OA 2VLME 4M1GH 2X6MA 1WICA 5F6IB 1BP3B 3GBNL 2VDLL 4P9MH 1UKSA 5I8CB 2OI9B 1R5IB 3TO4D 3UBXI 3QIUC 1NFDE 5I1EL 4UTBH 3B2UC 5C0IA 4YHNA 2EZ0C 5KAQF 5TDNA 1IKFL 2I5YL 1RK1B 5IB5A 3S98A 3JBG7 4L8CA 3JSSA 2IPTH 3RIAK 5F8QC 3WL9A 5GISH 4PJDA 3MROA 4LIQL 1FNGB 3MXWL 1GRWA 3GSRB 2YD5A 2ICWA 3RZCA 3QNYA 4OD2B 2VLKE 5TH2A 4ZO9A 1F4HA 3BD4A 4OD3L 1I1AB 2B4CL 5JOFB 3VXPB 1OP3H 4D9QD 3WLBB 3ZYIA 1JF1B 1PKQE 4PV8A 1DBML 3G5ZB 1X5ZA 4XVTL 5CHNB 1S8DB 2W38A 1HSAB 4KI5F 2HVKB 3HI5H 1MJ7L 3MBXL 1UB6B 1QRNA 2W0KA 2F5BH 1H5BA 1K3IA 4YK4B 1W0WB 3RBGA 4KU1A 5ERWA 4WU7A 4XVJL 1BLNB 3SGDI 1MNUL 1EAPB 4XNQB 1GGBH 4U4BA 1PW3A 2HN7A 4JHWH 5C6TL 4LLDB 2EH8H 3ZMRA 5E00B 5D70H 2Q20A 3BAEL 2MOVA 1FIEA 3IRPX 4Z0BH 3PWPA 4YHOL 5E8EA 2M26A 3LVEA 4ZUTA 3SGJC 1S9XA 3BX7C 3FQXB 1PG7W 1K3ZA 3X13B 2QSQA 1RSFA 3WFBL 4GQ9L 3DI2B 1PZ5B 4PLKD 1CDCA 3QEQA 2J6EL 1IAKB 2JLLA 5MEOB 4B41A 5D6DA 4QXGH 3QUZB 4Z18A 3EYUL 4ZFFB 1A7PH 4QT5B 1I1YB 4FXGB 3O11B 4FQHB 4OLVH 1BBDH 3RWHA 3DGGA 1CTNA 1CDUA 4M7LH 1P4IL 5FIEA 4HKXB 4JPKL 1TQCC 4M5YL 3NN8B 2J3SA 3LZFL 4FFYH 3RVVD 2DQIH 1NLBL 2AEPH 2PYFA 4ZFOB 4Q9RH 1WWAX 3AM8C 3MMEA 4UOW1 5IQ9A 3TYFB 2ZCHL 4KKLD 2AKRA 4XPBH 2X1WL 2NLJA 4LOUD 1ZLVH 4FTVA 3GKZA 2WBJD 3VA6A 1V3JA 1B6DA 4JO3L 1MEXH 2N4IA 4FQQA 1RJZB 1NMBH 3SJVA 4P57B 3BPLB 3OKLA 4WUKH 4D3CL 3IS1X 3ROOA 1OF2A 1UH3A 2AW2A 2Q7YA 3HB3C 2ZUQB 1ZT1A 4KV5F 1OAXH 25C8H 2AK1L 4P23A 5C1MB 5DC4B 4OIIH 3DBXA 4ODBD 4QGYA 4GMSL 1T7YA 5F9AC 3HNTL 4WCYH 2CH8A 4I77H 3MPCA 3FB8A 1SY6L 4WEBL 2OYPA 2COQA 3DUHA 4LRIA 3A6BL 3CSYB 3T65A 4JFDA 2CMRL 4IMLA 1FGVL 3P0YH 5HGBA 3MUJA 3OB8A 2Z4QB 4U6VH 1Z2KA 5FYJU 2W1NA 3BYTA 3T1WA 2B1AH 4N0YL 4DVBB 4FNLL 1VHPA 4HZLA 1L6ZA 4NQSA 2K3TA 3SHSA 3MRCA 5JTWA 1LK3H 4ODUB 4GKZA 5T1DL 4LVNB 3QQ4A 5SX5K 4PJDF 5LG1A 4XPAH 5EH1A 1W72H 2UWEA 1YEHH 5DRWA 2AJSH 3T4AB 5AZEL 3R0MA 3HNVL 3TO4A 4LHJB 1RVFL 2FHBA 5F7KC 2E3VA 1U8KB 1EAJA 4KH2A 4LAJH 4L4TB 1GXEA 1MQKL 5EC2B 1FZJA 2XZZA 4RWYL 1IC1A 1I8LC 3REVA 5E56A 1RZ7L 5ITBL 1J8KA 2QQLH 5C08B 5EU5A 4PP2B 1VERA 1L7IL 4PD4J 1T1YA 1QBMH 2LVCA 3MYZA 5C86A 2C1OA 3LKRB 4YXLH 2G5BA 1MY5A 4R7NB 1WZLA 4NQCB 1YEEH 3LKQB 4CJ0A 1CICC 2HP4A 5IB2B 1BD2D 2GJ6B 2A6IB 1IQWH 1T89C 5ISZB 1EH9A 5CMAB 3MV01 3B6SA 5DRNB 5FDWB 5IB3A 3KPLA 5GGRB 4QHMB 1TETL 2QR0B 4OLEA 5KVFH 4GH7B 4LVHC 5EZJA 5DJZA 5HYSB 3M17B 3WSQH 5GZNC 2BC4B 1XF3B 5IBLD 2RCSL 1A2YB 2FJGA 5FDYA 4JVPA 3VG0L 1IGJB 4OI9A 4RMQA 5FYKE 3QIWB 5BZWB 1AFVL 3MR9A 4XPTH 1H3GA 2NY3C 4I18C 4O4YH 5KSAC 2XZAL 3WO4B 5HHOB 4U3XA 1UEYA 3T4YA 5J6GA 5MI0B 5A2KH 4R0LB 2APVA 3Q1SL 5MHSE 1YY9C 4LF3A 3QH3B 4TVSa 5GIRA 5C0GB 4HUVA 5TDOB 5DUMH 3DX9B 4L4TE 4OKVB 1F4YH 4E42A 4X6CA 4WHYH 5DD6B 2OR8A 2ADJA