1TIUA

Titin, ig repeat 27, nmr, 24 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
89
structure length
89
Chain Sequence
LIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TITIN, I27
publication title Immunoglobulin-like modules from titin I-band: extensible components of muscle elasticity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin-like domain
total genus 5
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tiuA00
3OKKA 3BEVA 4FXGA 4IIQC 1A6ZA 5E2UH 2CGRL 3GIVA 4OCXH 4YBLB 3RUGF 3RDTC 5C1MB 2JCCB 3JV6A 3CJJA 3M8OH 1AI1H 1NLDL 4FQ2L 1MUJA 3P4MA 2KZ1B 3A6BH 1NCCL 2QHRL 3UTQA 2AJSL 2E3VA 1OP3H 4DGIH 5EIVA 3MLWL 1LO3H 4H26B 4Y5VC 1YDPA 3HZVA 1RMFL 2FX7L 1FPTL 2OZ4L 5M94B 2V2XB 1SYVB 5GGTA 2I25N 3S88L 4H88L 3KPOB 5I1AA 1F3RB 2FYYA 3I50H 4R2GB 5EZIL 3AY4C 4KKAC 3ARBB 4M6AA 5D1ZB 1KG0A 2BNQE 4UBDC 5CFHA 1OY3B 1G7HA 3RWDB 2ZSWB 1H9VA 1B9ZA 1F58H 3DHMA 3U4AA 5HHOB 5HYSA 1LEIA 4FABH 3QEQA 4CNIB 3T77B 4UNTA 4GXUM 2EXYC 5EC2A 5DA4A 3QCVH 3SO3B 1ZT4B 3HKFA 3MBXH 1DBML 3N85L 5L2JA 1C5CH 3U2SA 2Y4SA 4HPYH 3WJLC 3DIFB 5DZOA 3N1GC 1CFQB 4CVXA 1JYNA 4MMZC 5E70A 15C8H 3AU1B 5FUZH 3ZT6A 1EHXA 2Z93B 1O7VA 4MSWA 4P5TD 3BRDA 1YN7B 2OS7A 2A6DB 5DEZA 4ZSOE 2X6MA 4OI9A 4Y19A 4APQC 3PHQA 3FT4A 3EAKA 1U3HB 4KWUA 1JK8B 5ACMA 1MCSA 5J57B 2E6QA 4K71B 1ZKAA 5GIRA 2OP4H 3DX8A 3VXSE 3R1GH 2VDPH 3D0VA 4UBDD 3MOAH 3F65A 2B4CL 4U1SA 5L2KB 4NZTL 1NEUA 2FWOB 4LLUB 4JDTH 4RFEA 3CDYA 1MVFA 1U41A 1DLFL 1QKZL 2EXYD 1WIPA 1EEUA 1N5AB 1UCBL 5HGHA 4HULB 2GJ6E 3LEVH 4FQLL 3WNOA 1XMWA 1TZGL 3MZGB 4JHAH 1INQA 2JJVA 3REWA 3H9SA 4BSWB 3AM8C 1BM3L 4X4YA 2P5WA 4ZPTB 4KZEH 4MD5A 4F7PA 3LOWA 3L5JA 5DDHB 5ICZB 4G3YL 1LP9B 4GRWE 4HXBH 2NTFA 4NN7B 4P2QD 2DTSA 4OFIA 1N4XL 1IQWH 1IM9A 5JDJA 2ZUTA 2BSRA 4FFZL 3CDFA 2VABB 4NN6C 2FD6H 4M8QB 5ELIA 3WYRA 5D71L 4X7TA 2FH6A 4MNQE 3S5LA 3O9WA 3BWAB 4OJFH 4RMWA 3BESR 4I5BA 4BQ9A 2W60A 4BM7A 2GTWA 1KGCD 4GAYB 2DKSA 3KNBB 5DJ0B 4JKPL 4HD9A 5DMJB 1ZT7B 4M4RA 3TFKD 1C7SA 4PJHF 2X89A 3NCJH 5DUPL 4ELMF 3BUTA 4JAMA 4JHWH 1C16B 2H1PL 3HE6A 2VITB 3CVHH 3VMNA 4XCNA 1ZOXA 1ED3A 3E0GA 4KPHL 2R2HB 4NQEB 3VW3L 1IEAA 4GSDL 2ITDB 4WU5A 1XZ0B 2WLZA 5TE7H 3L9RA 3MRKA 3U82B 3ULUE 3T65B 5DSCB 1W0VA 2F9BT 3ILPB 1FC2D 3VCLA 2EDFA 1Q0XL 3FCTA 3VG0L 3UJTH 4QRSB 4NO3B 4WUUD 1WISA 4YX2L 4XHJD 5GZNC 1L6ZA 1FGVL 4FQ1H 4G8FA 1MLCB 1KFAL 2V7NB 5E56A 4RMRA 5GZOD 1ZLWH 4PV8B 5IHBA 2VE6A 1QLRB 3ROLA 3O6MH 2HTLC 1BZ9B 1EBPA 4HWZB 3WXWH 1DSFH 3RPIB 2E7BA 4HH9B 1NC4B 4XBEL 2BSED 3X13A 2HN7B 2HMIC 1EFXB 4Z7UF 5BRZA 3D5OF 5E99L 3IYLW 3GRWH 1J0IA 4IOIA 2NCMA 3T4YB 1AD9B 2B1AH 3O8XB 1MSPA 5D7IF 1QSFD 3S7GA 3WUWA 1IM3A 1T22A 5GRJH 3V4PH 2VLJE 1QBLL 4ZFZA 4ZFOA 1PJ9A 3D3VB 4PJ9A 2VLKD 1HKFA 5GZND 1H5BC 3C5SB 3ARQA 4UTBL 2OBGA 1KJ2B 1DBAH 1OF2A 3FN9A 1RK1B 2IG2L 1S7QB 3D69A 3S36L 2YRPA 4MAYC 5DD1L 1X7QA 2GCYB 3EHBD 1OAUH 3UYPA 4WIQA 3BXNA 2ZZUT 4I3RL 5KSBA 1T03L 1JN6B 1HH9A 3U7YH 1JFQH 4KK5D 3IDYC 1ORQA 4MWFB 2WINA 1OD9A 3ZE0F 3CPLB 1WSST 3LQAL 1UJ3C 3MRFB 1OCWH 1FC1A 1T66C 3NFSL 3MRHA 2P8MA 1NLBL 4JFEA 1YN6A 2VZVA 1UEMA 1MNUH 5C8JA 5EFIA 3CLFL 3BEVB 4JPWL 4FXGB 3VXRE 2XICA 1A6ZB 1R5WB 1CFBA 4Z8FL 3GIVB 4QOKE 2CXKA 3AFLA 1TQBC 1KJ2L 3JV6B 3LAFA 3PV7A 2X4TA 1EMTL 4ELMB 4XP6L 1MUJB 4WUKL 3MLPA 3P4MB 5KSUA 3NA9H 2ERJC 1NAKH 1RIHH 2R56L 1QLEL 3BUYA 5KSAD 4PY7B 3THML 1EV2E 3AS2A 3QDGE 2W38A 5DURB 4MAYD 1LE9A 4J4PD 3P30H 1EERB 3HZVB 1X5AA 4EI6A 4LLVA 4NKIL 2WMPA 1MCQA 1A9EB 2X9XA 5JA8B 4C56E 2EDTA 5HJ3A 3WFDH 5ALBH 3QUYA 4X9FA 1QR4A 2DQTL 1P4LA 1HCVA 2FYYB 1VADA 2BXZA 2O93L 1CLCA 1AXSA 1KG0B 2ZPKL 3DRTA 1R0AL 2CKBH 2X42A 4MNHA 5HYSB 4TSCH 4LSSH 3INUH 3S37H 1LEIB 3QEQB 3PGCA 1T0MA 2E27L 1MFDL 1ZLSH 2FX9L 1F6AB 3N1FC 5L2JB 3LRGA 4YLQT 1KLGA 2UWEF 2VDNL 5GGTL 4CVXB 3V95A 4U1IA 5HHNA 4M1DH 3QWOA 5H2BA 1DZBA 1LO2L 4CVUA 1TFHA 4WFFE 4F37F 4MSWB 3UTZA 3GHBL 3KPRA 3DI3B 3QRGL 4N0UB 1S7UB 5I15L 2NXYB 4HIHA 4Y19B 4MVBC 3SGEI 1RJZA 3PHQB 3ARBD 3BSZH 1DCLA 1TTUA 5D1ZD 1TCMA 4Z95H 3EOBA 3O45A 3N50A 3GMNB 5GIRB 3DX8B 1I9RH 1KBGL 5IMOB 3FQXA 2VNCA 4L9DA 2VMFA 3UX9B 4UDUB 4IMLB 1A4JA 3TPUA 5A1AA 5GS0H 4FOMA 4GAJL 5EO9A 3FB7A 2R2EB 1RZJH 5A2IH 4OUOA 4MCYA 1WC7A 4WJ5B 1MCFA 5DQ9A 3MLUH 3REWB 3HC4H 3H9SB 3QR2A 2D9QB 5KBNC 4OLWL 3OG6B 4X4YB 3H7BA 4I3GA 3T04D 1D6VH 2WBJC 4HHAA 3CAFA 4NZUL 4YEFA 2H32H 5ADOL 1UCTA 2F53A 3QRFM 3VMOA 1U3HD 4JRYB 4MVBD 3ZO0A 3RGVA 4BSVB 2BNUB 4HQQL 1OAQL 3W9EA 4AIZA 4NJAH 1IAIM 1EX0A 2IALA 1F4WH 3JVGA 1NQBA 1ERNA 3UO1H 2VL5B 2IAMB 3SDAB 4HKZA 4NKDB 3G04B 4O5LH 1MLBA 2Z91A 5FGBA 3HB3C 1A14L 2A77L 2C4FT 2PW2A 3I6LE 3O9WB 4YXKH 3S5LB 3RWEA 2EH8H 4LPCA 1F45A 5EUOE 4JFYB 5GSRB 2W60B 2GTWB 2WBKA 1I8IA 3ZL4L 5IW6B 3ISWA 1IVLA 3F7VA 2WBJD 4IJ3B 2BVEA 4JAMB 1UB5B 3HE6B 4HIXL 5GRYA 1WFTA 1UG9A 4D3CL 1PG7X 4BZ2H 1AFVL 1MIMH 4K7FA 1IEAB 3K4DA 1W8NA 3MRLA 4NUJB 4QRRA 2YD8A 5L6YH 4YPGA 4Z7NF 2XTJC 4AYFA 5C0GA 3L9RB 3MRKB 3QFJE 4G43B 3A6CL 2NLJA 4XXDA 1W0VB 3T0AA 2UWEB 3VCLB 1I8KA 3NGBC 3L95B 3G08A 1I1AC 3GSVA 3QT2A 1S7XB 4IMKC 4KZDL 3KYAA 4G8FB 4RA3A 4L9LB 4DEPC 3UDWA 3B4NA 1GAFL 5I8KL 3BT2H 2VE6B 3ROLB 1C12B 1OLLA 1J1XL 3ME0A 2BHZA 2C3VA 3NTCH 4N1HB 4JE4B 3UROR 2YA0A 5BRZB 1A64A 4XCCH 3O3EB 3ARFA 2VDKL 4IOIB 4GS7C 4DKEH 1EEZA 1DUYB 2E7HA 2UYLA 1MF2L 4FTVE 3T0EC 3P0YH 3SKMB 4ZFZB 1I1AD 5JDSB 1K5NA 4WEUD 5EO1B 2XG5A 4AIOA 1YC8A 3ULUH 4PJ9B 3MRIB 1G6RH 3DX6A 1J8KA 1P4IH 2ILLA 4G80A 4R26L 2X4OA 2JIXD 3IFNH 4Z77A 1HSAB 4KJWC 2ED7A 3E8UL 1KYOJ 1CXKA 1E4XL 1HNFA 4EN3A 3SGJC 1U3YA 3BXNB 3VG9B 3VXNA 3UZQA 5EPMB 5KSBB 2QSTA 1T5XA 2AQ2A 3M07A 2WINB 3JV4A 4JPVH 4JO1H 3W2DL 5IQ9A 4C83A 4N5UA 3I2CL 1BBJB 1QEWA 4LSRH 3MRHB 2P8MB 4JFEB 4YHKH 5MENB 3LY6A 1FJ1A 1B90A 4JG1L 5F3BB 3T0ED 5C8JB 4Y4HC 3GMQA 3O6FA 4GFTB 2VDRH 1CGYA 1BQHG 1ZTXH 3PXHA 1YJDH 3OKLB 2DLHA 1KT2B 4X7SH 3D1MC 2KKQA 1LO4H 3MV8D 3V0VA 1JGUH 1A6AA 1YMMA 3ARTA 3U9UA 5KSUB 3GI9L 1ACZA 2EYSA 2G60L 2JLLA 1CU4H 3BUYB 1OPGL 2BVPA 4JFHE 4KJWD 5DK0B 5I19L 3MSPA 4PJDE 4HCRH 3SE3A 2HKHL 5IFAL 1WT5A 4CMHB 1CICB 4EI6B 2YUXA 4DUVA 2AXHA 2R2BA 1KXVC 5F7EL 2YD1A 3C60C 1SY6L 2OL3B 3TLRA 3E3QC 3QUYB 1BWWA 3RBSA 2A0LC 1P4LB 1FQ9C 1VADB 1NEZA 4YDKL 1TTFA 1VPOL 4HUVB 5FK9A 4RNRA 1AXSB 2IH3A 3V4VH 1KCSH 3DRTB 5JOFA 2KQMA 4MNHB 1WAAE 4YHZH 3PGCB 5K33A 1T0MB 4UT9L 5IVOA 3AUVA 3QQNA 1P53A 3V6FA 4RAUA 3SQOL 1FLRH 4Q7DA 3QCUL 5CGYC 1KLGB 3O6LH 5KG9A 1VHPA 4Y1AA 5B3NA 5HHNB 4BYHA 2OL3L 3BZ4B 5H2BB 3EO0A 4KVNH 3UTZB 3C60D 3KPRB 2AEPL 5C07A 2CRZA 3FO2A 4KAQL 4HIHB 5HYEA 1YQ2A 1VKXA 1RJZB 4OIIH 4JFFA 5GS2D 4DCQA 5TGBB 3O45B 4F9PA 1FVCA 4XH2A 1UKTA 4JPIA 4OKDA 5LGHH 1KELH 1CZ8H 1G7IB 1FFPA 1R5IA 1N8ZA 5AWNH 3JV0A 4MCYB 2EEDA 2GQHA 5CGYD 3CVIL 5DQ9B 5C70A 4UOW0 2NW2A 1ZHLA 4AENB 1DVFC 4UT7H 1WBXB 3CH1B 5E2TH 2HLAB 3MXWH 3PWNA 3B6SA 3H7BB 3WS6C 4HHAB 2RFXA 5J89A 1INEH 2NXYD 1WV7T 3Q2CA 3IFLH 5EZLB 4PRHA 5FM5O 3C08L 1SJXA 4HEPG 1FZMA 5SWSA 1OGTA 1S7TA 3RGVB 1L4IA 3MA9L 2HRLA 1B0RA 3W9EB 3QO0B 5DLMH 2IALB 4P9HH 2FATH 2UY7A 5F9JA 4CW1B 4JFDA 5HDQL 3D9AL 3QIUA 4PJAE 4HKZB 4F2MA 3MV7E 4NRZA 4WFHD 3QA3A 1F11A 3QO1B 1MLBB 1Z3GL 3TZVA 2E7LC 4X8XA 2PW2B 3U7WL 1P7KA 2FL5A 2GTZA 3EOTH 4RRPG 4UOW1 4G8EA 1I8IB 1VERA 1DVFD 1RSFA 4RWYH 1I85A 1J8HE 4IRZL 4LCWE 3F7VB 1Q72H 5J13B 3TGXA 1QPPA 4PJCE 3FZUC 3WO4C 4JRYD 2GFBA 2A73A 1P6FA 5C6TH 5JR1L 3VXMD 2ESVA 2V5MA 1DQJB 1JZ8A 4LPVA 1H15B 2R2CA 2A83A 4K7FB 2IAMD 1S9XB 3MRLB 3SDAD 4G6FD 3EOAA 3F62A 3NFNA 4YPGB 5C0GB 3Q3GB 1MREH 4MJ4A 2NLJB 1W0WA 4XXDB 1CN4A 1PX4A 2D3VA 4KHTL 4NKOA 3GHEH 3ILQD 1I8KB 5KN5B 1JHTA 2NY2C 3X3GH 3G08B 5FKAA 1SBBA 2PYED 2PW1A 2Y72A 1C1EH 3FN0H 1WZ1H 2XRAH 5DI8A 2F15A 5E00B 1PKQB 3QUZC 3CSPA 4X6DE 5CP3H 4RMUA 2QTEA 1G7MB 1O0VA 4R0LA 5L7XL 1ZVSA 1PAMA 2LU4A 4KKBC 1TETL 4QF1A 1G7JA 3FZUD 1VGEL 1QQDA 1MRDL 4MNGA 3EDDA 4UNVA 3AMLA 2XWTA 4EBQH 3I9GH 3AREA 3O4OC 1HQRA 4U7KA 4PJ7E 3UTTA 1MEXH 1A7OL 2X4UA 2ZJSH 5DD5H 2VH5H 5F72S 3S9DB 4N8PA 2UYLB 4P23C 1IC4L 3HNTL 4BFIA 5C0FA 2NY5H 4F7EA 3OR7A 4NM8H 1CDHA 2NY2D 1OTSC 5DMIH 4H25A 3QI9B 4OF0A 3RA7H 3ZDYF 3UZVB 3MLTA 1K5NB 3QUZD 4B7IA 2RR3A 1KTDB 1AHWB 1BX2A 1BLNB 3DX6B 4MQXC 1JYVA 2X4OB 4MA8L 1S7VA 4NZRL 4Z77B 5ITFA 1QSVA 2Q1EA 3LV3B 4OCSL 1H0DB 3SJVB 1PBYA 3DJ9A 1JZ3A 4YFEA 3QEGL 1U8IA 4F7CB 1KTRL 3VXNB 1SYSA 1NGPL 3OMZA 4OD3L 4ZO6A 1T5XB 4OTXH 3JV4B 5IQ9B 5LGJA 3WKNA 4C83B 4XVJL 2Q8AH 5BJTA 4P23D 4KJYA 4U6YB 5GGSA 4JZOA 3RQ3A 3MLYH 1B4JH 1P4BL 3CFJA 5CS7A 3T0WA 1PG7L 1LK2A 1OTSD 4PJEF 5JW5A 3KLSA 2ZUQC 3KHQA 5I1GH 3DRQB 3MXVL 2F74B 7FABH 1NUNB 4HDIA 4MQXD 4WRLA 3SGEH 1G9NH 4PLKD 1A6AB 1CR9L 4POUB 4Y4KA 4HZAA 2EYSB 4PRDB 2W0FB 4OZGA 4XNZB 1PZUB 2BVPB 4LKCA 3QXDA 4K94H 3UAJC 5C0BE 1OM3L 3G6DH 1FYTA 3D25B 1Z2KA 3ARYA 4PJXE 4G6AC 4HUXA 3WMSA 2R2BB 2HJFA 3MBEB 4ODVL 4ORGA 3NZ8A 1AGFA 3CX2A 1MWAH 3TWCH 5MEND 4PPTA 1MI5B 4XI5D 1A3RL 4KXZH 4RNRB 5E5RB 5D72H 4U1HA 2IH3B 4AJ0A 2AEIT 2R0KL 3RIAF 3FFDA 3SCMA 4FQXC 4OKVB 3RNQA 2CSPA 1NGZB 2IBGA 3BO8A 1B88A 1CG9B 2P44B 4RAUB 5E94B 1H3PH 4PRIA 3UAJD 4P4KB 1MHHA 1EO5A 3G6AA 4Y1AB 1CICD 3SOBH 2YPLA 3LN5A 4G6AD 1T7VA 3GIZH 3EO0B 3TIDA 3SDCC 1T2JA 1PLGH 2VIRB 1A6WH 2J4WL 4LSTH 4N0CC 1PQZA 5C07B 3CDGA 4X6CE 3FO2B 2ATPA 1OAZH 1CL7H 3KPSD 1VKXB 2IPTH 5ISZD 5CWSA 3RVVC 2QKIB 2CPCA 1KPUA 2WANA 3CZFB 12E8L 1FVCB 4XH2B 3H9HB 4YUEH 1N2RB 4JPIB 1LDPL 2DQUH 2XZAH 1N3NA 3UC0L 1N8ZB 5IEKA 1C7TA 3ZDZE 2X4NA 2PUQT 5DUML 5IFJA 3L3DA 5DMYA 1NL0L 5F93C 2NW2B 1ZHLB 5F89A 1M6OA 3TT1L 4LOUD 1J0YA 3IFOA 2DB8A 3B6SB 3PWNB 1MOEA 3SDCD 2UZIH 2FDBP 1BZ7A 3QDMD 4ONFL 3SN6N 4FRWA 1ZA6B 3PWPA 4JO4H 4GAGH 1HHJA 2QADB 5SWSB 2YK1H 1OGTB 3MACL 4H1LA 2YXFA 3TCXA 3GBNH 3U4EA 1NAML 2Y1VA 1TQCB 4XZUB 5CSZA 4HC1H 3QIUB 4F2MB 1WBYB 2X10A 4XP1L 5BW7C 1ACYL 4ZNEE 4PYHA 4OZFA 3TZVB 1P7KB 3IU3A 2FL5B 2GTZB 1T2QL 5I71C 3BZFA 5EOQH 4YK4C 1IAKA 3DLQR 4G8EB 5FGCB 2LU3A 3KJ6H 1XGUA 3NOIA 2R1YA 2FGZA 1F4YH 5C09B 3IDIA 2EIDA 4UT6H 1K4CB 5HBBA 5I74C 2A73B 4FQCL 1ZAGA 3SGKC 5C0AA 2A83B 4V1DE 1MAKA 3GI8H 4X4ZA 3EOAB 3NFNB 3QWRA 2DMBA 4JLRB 3HHRB 3P0GB 5HHVL 2C4XA 1VGKA 1MAMH 1BOGA 3MQIA 4EDXB 1FVEA 1KIUA 2HWZH 5FKAB 1GHFH 4UIKH 2PW1B 4M6OL 1NCWL 3WJJA 3Q1SL 1J1PL 3PL6C 5I0ZA 5KS9A 4OBSA 1RZGA 4NQDA 2CXGA 1ZVSB 4K8RL 3V52L 3BH9A 1RHHA 2ZKHH 1G7JB 5JQ6H 4ZQKA 5IHZA 1QQDB 2P47B 1CK0L 3EYOA 4MNGB 4PB0H 5I30H 3ES6A 5FA4A 2XWTB 3AREB 1HQRB 4PBWD 2H3NA 5F97E 5IWLC 1YECH 3MX0A 4LF3B 3S96B 5C0FB 4F7EB 4ONHA 3P9LB 3O0RL 2RQ8A 4POZC 5JOPD 4UU9B 4GW1A 3QAZB 3IFPA 3MNVA 5LCVH 4XNMA 4S1RL 1BX2B 3DX7A 3IDUA 4DQOL 4QRTA 4OGXL 2NX5D 2P8LA 4PLJC 4LLDB 1A02N 1S7VB 3PHOB 4GRLA 3BW9A 2KUTA 2A1WH 4HUMB 1IGYA 2RIKA 4Y0GA 4X6FB 3DROB 4O2EB 5C0IA 4F7MB 5D8JL 3ZKNC 4Q9RH 3OPZH 1MCHA 3L6FA 4WWKB 1UZ6F 1V5JA 1LEGB 3LIZH 1WJ3A 3QZWG 1SYSB 4FMKA 2D03H 4HWBA 2E9BA 5LGJB 3K4AA 3MUGA 4BZ1H 1GZPA 3T1WA 4HFWA 4OLXL 4YXLL 5BJTB 4RGOH 2H9GB 1S7RB 5B8CC 4JZOB 1RUAH 1FRGL 3CFJB 4UNUA 2A9MH 3QI9D 4KI5F 4TOYH 1LK2B 1IKNA 5DR5L 2CO6B 3HMWL 1D5BA 2W91A 1N59A 4KC3B 3RVXC 4R4FL 4HDIB 2VQUA 2X4QB 3CCHA 3SY0A 4Y4KB 4P2OC 4U0RC 4PLJD 4LHUA 4OZGB 3STBA 1AE6H 4WCYL 1RUML 3QXDB 2DQDH 3SJVD 1A7NL 5L9DH 2VLKE 1FYTB 2FGWH 1JRHL 5DT1L 1V3KA 5JLZB 3AROA 1IZJA 5I76A 1WCBA 4ORGB 4K9EC 4AEHL 3BD5A 1AGFB 3DYOA 1HK6A 3U48A 4G6KL 4NFBA 1GGBH 1KLFA 1CYGA 3QPXH 4TNVK 1IGML 4H5SB 2A74A 3RI5K 3WN5B 4TULH 5ETUA 1CFVH 1MELA 2LAAA 3FFDB 3SCMB 2BHYA 3RVXD 1T7WA 3W0WB 1Z5LB 4X98A 5DVOA 2APTA 1K8IA 3LKRA 3O6KL 3FAXA 1KXQE 3JWOH 3BO8B 3MJ9H 1QD0A 3U4BH 5GISL 1J5OL 4BQCA 1MHHB 4KTYA 3G6AB 3LN5B 1PY9A 3S4SB 3RGHA 3MREA 1PEZA 1JPST 3MBED 3TIDB 4NYLA 4LCIL 2BJMH 2BY2A 5AYUH 1MI5D 43C9A 3CDGB 3MODL 5A2KH 4GMTH 4NGHL 1QNZL 4XMLH 3CD4A 4LLQA 5HHXH 4M9PA 3DOSA 3V5HA 4GXUN 5T1DH 3CX5J 2MJWA 1IAIL 5E5MB 2ICEB 4LSQH 1CD1A 3DGGA 1AO7D 1KEGH 1JPGA 5IEKB 4P4KD 4RIRB 3RI5F 3H7LA 2X4NB 1Q1JL 3DETD 3LRSA 2HYMA 3L3DB 3HNVL 3BPNB 2ORBL 5F89B 2H8PA 2JK5A 3WFBL 1GC1L 4UMGA 3EYSL 5JUEL 3F7PC 4MCZA 2Z8SA 3UMTA 3MPCA 1DBKH 2AEWA 2HFGH 2V9RA 3IFOB 4CMMA 3QISA 2JELH 1BZ7B 2DBLH 5SWQB 4GMSH 5IUSA 5EH1A 1HHJB 2ZOKA 1OW0A 3HG1D 3BP5B 2J8UA 4G7YL 2I07B 35C8L 4HK3N 5CSZB 2C26A 5I1IH 4M1CD 4UB0H 5AG8A 4TNWF 1M71A 3KPTA 3QXAA 4M7KL 3HPLA 3C5ZC 4OZFB 4YQXL 1FFNA 1PX3A 4K3GA 3IU3B 2OR9H 1ZLWK 2ZCLH 5E6IB 4RMQA 4ZUTB 2D7TH 3IDGA 1IT9L 4X4ME 3T8XA 1YZZA 5E4IA 4M62H 4OCNC 5K93A 1XGUB 4LVNC 4J1UB 3JTTA 4J12A 5E2UL 3QUKA 4N0FA 4Z78B 3M8OL 3Q5YA 5FM5M 1W0YT 2DMCA 4WEBL 4OF5A 3WSQL 3OX8A 2DQGL 5E1AA 2CKBA 2G2RA 4HFUH 5FUOH 1ND0A 2YD7A 3A6BL 5C0AB 3VFWA 2QSCH 4DGIL 4LQ1A 1LO3L 1AGEA 5HD8C 4AEFA 3LEYH 4AEIH 4Q2ZA 5GRVL 1VGKB 2HJLA 3SDDC 4Y5YB 2VB5A 1OWRM 3A67H 4QCIA 3QPQC 2APXA 3OKDA 4Z76A 3I50L 5KS9B 5C09D 5TJWK 3AB0C 5BMFH 3G6JA 1RZGB 4NQDB 4OIAA 3BH9B 2P8PA 3MLZH 5TF1H 4GG6E 5IHZB 1HHIA 3WUZA 3CDCA 4K8RD 5F96H 1Q0YH 4K23H 4OUUB 2GW5A 3C6LA 4H0HB 1HYRC 1NBYB 2ADJA 5I1HH 5I6XC 4XCYA 5EU6D 5FA4B 1I9IH 3RWIA 2RCSH 1C5CL 1M7IA 4HPYL 2MCG1 2H3NB 4TTDD 5DK2A 5KOMC 4NQCA 5FF6B 5HD8D 2ADFH 2BNQA 15C8L 4PJFE 5B22A 3RUGE 1QO3B 4N0RA 4KK9C 4M7LH 3SDDD 5FA3B 5CIPH 4ONHB 2HAZA 1F97A 4H8WC 3QPQD 4PLOB 3KWWB 3K2UL 3MNVB 3LKOB 4YDJA 3I75A 3VD3A 3MA7A 4XNMB 3BGMA 1ZEAH 2HA1A 1DLHA 3DX7B 3WD5H 3ZKMC 3OKOA 4QRTB 1LGVA 4GRLB 3R1GL 2VDPL 3BW9B 3DO7A 4R90H 2FIRT 1KCVH 5AZEH 3LN9A 4ZXBC 3HMXA 4JDTL 3SKOA 5D7JA 2LABA 2PETA 4YIQA 3NCMA 4MJIA 5JIPA 3KLAA 3L6FB 3WIHH 4S2SB 1DE4B 4LCUA 2EE9A 1OAXL 3CIQA 4UIMB 4JHAL 3VXSA 1P9MA 3MUGB 1GZPB 2NY1B 4HFWB 1G9EA 4L3CB 5TF0A 2WLYA 4GAFB 1KIQA 4KK9D 3EW3B 4GH7B 3R8QA 3C2AL 3RWGA 1HYSC 1FL6B 2V5SA 2EECA 4QHNA 4KZEL 3D39D 5HGBB 4Y8AA 4KHXH 5DUBB 3U6RA 3T3MF 2XTJE 3ETBF 3CCHB 4O2FA 1A7RH 3LQZA 2DQIH 3SY0B 3ZKMD 4RISL 4ZYKB 4ODTH 4HX1B 4X6BA 2FD6L 3SHSA 1A7QH 4QRPD 1HCFX 4WWKD 3VGAC 1EAPA 4HWBL 1J88A 1HN1A 3SE8H 4YJZL 4OJFL 4O58H 5I76B 2B8OT 1Q9KA 3AVEA 1CD8A 2H6PB 3D0LA 3BH8B 25C8H 1I8LA 1KCRL 3B3IB 5IBUB 4LLMA 4HZLB 4J6RH 2P5ED 3NCJL 3WFCH 2A74B 4JHWL 1SJEB 5LBSH 3DMMC 3D85D 2X5PA 3IRPX 1K8IB 3LKRB 1F4XH 2XQYG 4ZUWA 1VEPA 3IXTB 3CFCL 5HHQA 4GQ9L 5JA9A 5BVPH 1KPRA 3UTSD 3EFFA 3MLRL 4OGYH 4AG4H 3MRGB 2YOCA 3CGTA 1FCCA 3UTPE 3ULVC 5T5FH 1DQDH 2Q3AA 2OR8A 2M8XA 4D9LH 2ZSVA 3QDJD 5HHPA 1Q8MA 1OGAD 5F9WB 3VXQA 4CJ1A 1NGXB 4WTZA 4XX1E 1BAFL 3TA3A 1F8TH 3W5NA 5EB9A 3MRJA 4OZIA 3DMMD 4ONOA 5HYIA 1Q9WA 2E7CA 3O6ML 4JFPB 3WXWL 1DSFL 3BPLB 4DUXA 5TFSH 1GPOL 1TVHA 5FM8A 3VXUA 1CD1B 1EFQA 4RZCA 3DGGB 1JNNL 4OCMC 1JPGB 2EDQA 2WV3A 4G9FA 3LRSB 5D9SA 5DHVH 3BJLA 1HWHB 4H20H 4PJHE 3V6OC 2J7LA 2VDLH 4K07A 1IEHA 2H8PB 2JK5B 2O5YH 5HHMB 3C8DA 3TT3H 3HZKB 4MCZB 4ERSH 2ZUYA 3VFSA 5GRJL 4CMMB 4X6EA 4Y4FC 4NCC1 1R3IL 5EOCJ 3V4PL 4BUHA 2NPLX 1T20A 2DJUA 2E5EA 2NY6B 5T1KB 5C7XL 1SEQH 3TYGL 2ZUSA 4JY4B 3L3OA 2DIAA 4FXKA 5IJVB 4HWEL 2R8SL 4XNUL 1DBAL 1AXTH 3HC0A 2J8UB 1MHPL 1G0YR 1TLKA 3UPRA 1NFDE 1R3JA 3E3QE 4QO1A 4WGVB 4JFOA 4XMPH 1OAUL 4XX1G 1UADC 1M71B 3QXAB 4FQIH 2BC4A 3HPLB 1VENA 2CUMA 1BEYL 2HJKA 2YD3A 4HCRA 1NGQL 1VB9A 3U7YL 4TUOA 3WDHA 3MRNA 1JVKA 5F9DC 1OCWL 3JTSA 1JV5B 4W4OC 3T8XB 1FNHA 4LIQL 3OL2A 4NQTA 1HQ4A 4Y4FD 1RJYB 3QUKB 5F7NC 4N0FB 4MZ3A 4JZJC 3ECBA 4KI5D 4Z7UE 5FO9A 4NZJA 1YEEH 1XIWA 5I1JL 2CKBB 3NA9L 2G2RB 1NAKL 5IESL 4JZNA 2IADA 3OAYH 4M00A 1PEWA 3VFWB 5JW4M 4XWOD 2NXZB 5J9PB 3VXRA 3MUJA 2D31A 1AGEB 3P30L 1DP0A 1MIEH 5D5ME 1YY8B 3SO5A 2YA1A 2HJLB 3FFCA 3MFGB 3VRJB 4KTEH 6CGTA 3TO2A 5E6ID 4QCIB 3WFDL 4OT1H 3Q48A 5ALBL 2AAVA 1RPQA 1WCQA 1I8MA 3TO4A 3QDAA 2VQ1A 3MJ7A 2EE3A 3C09B 3QDGA 4WFHE 4PBXA 4P4RA 5I1CH 1T83A 2CKBL 4GG8A 4JM4H 5L0QB 1HHIB 5GRWA 4PJGA 3INUL 1JNJA 5KZCB 2ADJB 4XCYB 1ZLSL 1JTTA 3GSNH 5F1IB 2D7OA 4JJHA 4LBEA 3ZTJG 1DANT 4XPTH 4NQCB 1DQQA 2BNQB 3QIWB 3VXME 2DKMA 1LK3H 5I75B 4OV5B 5LGKA 1A3LH 3FL7A 5J6HA 4P3CH 4YBQC 4LQFL 4Z18A 2BMKA 4JGUA 5ILTH 2HRPH 3ULUF 2DL9A 3MA7B 3BGMB 3LZFH 4MJ2A 1DLHB 3BSZL 2H32B 3I3BA 4Z95L 3OKOB 4BA8A 1GJIA 2ICES 3QEUA 5J3HC 1NCAL 3OKNA 2PYEE 3NPZB 3SKOB 1BFVL 3PP4L 2AI0H 5ANMA 4YIQB 5GS0L 4ZSOB 4UQ2A 4OZHE 1LD9A 5LWYH 1C5DA 1DL7H 1RZJL 3WNKA 3W39A 8FABA 1BGXL 1HXYA 1AQDB 1TJGH 4DK6A 2LVCA 3VXSB 3MLUL 2DQEL 2Q20A 1Q94A 5JHDD 5IEHA 1CLYH 4HUUB 5HYJD 2W0KA 3PWUA 1Z0MA 3NVQA 1NCDH 4OD2A 5E1HB 3H9ZA 5FDWB 4HWNA 4YBQD 2D0HA 2FO1A 3U6RB 2GJ6B 1KCUH 4O2FB 4CKVX 3LQZB 5C0ND 4QGYA 2YXMA 4J7RA 4X6BB 5JMRA 3TN0C 3UO1L 1F90H 1FIGH 4O5LL 5J6GA 3ARDD 4Z7VA 1EAPB 1ONQA 4AZ8A 3ZSTA 4XAKE 4YXKL 4GRWB 3HR6A 2EH8L 4I48B 4KRPC 1Q9KB 2E7MA 1Z9LA 2G5RA 2GJZA 2OLDA 3D0LB 4UQ3A 2KDGA 1T4KA 1ZSDB 1NCBH 1NSNH 1XGPB 1HE7A 4XNYH 4LRNH 1QRNE 4QHKJ 4MNQB 3RP1A 3BGFC 1ORSA 3KXFA 5EOTA 1QFWI 1A6UH 4I2XA 4KDWA 2FZ3A 1NMCC 4BZ2L 5I1KL 1MIML 5JXEA 4LVEA 3M17A 2EICA 3TN0D 1UWXK 5DQDH 3L3JA 2UZXB 2XY2A 5DD3H 2VXVH 3C9NA 1JWSA 5CEXB 3HS0A 4KRPD 4M7JL 3VDAA 5HHPB 4ODHH 2W0LA 5FYKE 3VXQB 4X5XB 3U7AA 5MEQA 3TA3B 3H6JA 4XRCA 1GCFA 3MRJB 1T1YA 1A1MA 3BT2L 4OZIB 2WM0A 5DRXA 5DEFB 1Q9WB 4D8PA 2EDEA 3NMEA 1J1OL 3L5WA 4Z5RA 4KMTL 4JFZH 3ZMRA 4RZCB 1XCQA 5DRWB 2HT4C 5C2BH 5D9SB 4DW2L 1IGTA 3TVMA 2OJZH 4LPWA 4DZ8A 3RIFF 1SQ2N 3ZE2F 3O4LD 3VI4E 2X1OA 4PGBA 3QJFB 5GQBA 3B9EA 1JF1B 1F6FB 2YR3A 4HJJH 3ULUL 1I3GH 2CLVB 2YSSB 3TNMB 1P4IL 4FXKB 4EI5A 3EJJX 4LMQI 4Y16B 2P45B 4NIKB 2CJUH 4QWWD 4JDZA 4LRIC 4PUBH 5CMAA 5GGRY 1RZ8A 5EBLA 1GOGA 2VLJB 1EVUA 4ZS7L 3WXVH 1T89A 2YUWA 1L0XA 5TH2A 1U2CA 2HJKB 2HT4D 2ICWJ 1RIVL 4TUOB 3MRNB 4JPVL 2FIKB 5FGSA 4N9GA 5HHMD 3RTQA 1Q9LA 3MRPB 1L7TL 1ZT1A 1MFNA 4LSRL 3BKYH 4PJBA 1IM9D 4YHKL 5EO0A 4KQ4L 5DYOA 3BZEB 4OLVL 2VDRL 4X9BA 5T1KD 3ECBB 2DLEA 3VFGH 5BVJA 2FBJH 5EZJB 3O3DA 1LO4L 3O2VL 5FO9B 1JGUL 1U8PA 1XIWB 3GO1H 3GBML 2IMMA 1CU4L 3QDME 4U1GB 2V2WA 4JZNB 3HI6H 3U83A 4I1NB 2YPKA 4ZUSA 3VXRB 3GJEA 4LSUH 4HCRL 2D31B 4QOKB 3NIFE 2IAND 5CHNA 3TO2B 3ARGA 4KKLC 1I8MB 3BE1H 4NO0A 4R4BA 4W6XB 3QDGB 2W65B 5GS2H 5IW3A 5EUOF 3I6KB 5D1XC 3H2WA 4KGLA 3NIGE 4GG8B 2XWJA 3EYQD 3M1BB 1KCLA 3CH8A 3QXTA 4GBXA 4I4WB 2ZCHH 3C6SA 1KNOA 3GEWB 4PJIE 3BFOA 3NCYS 4LEXH 1A8JH 1RK0B 4KK8C 1FLRL 4UV7H 3RFZC 3QIBC 4LBEB 3O6LL 3ZTJH 3MV11 1V7NH 5FUCC 1XGRA 5C0EB 1DQQB 1MFEH 4D0CA 2DN7A 4ETQA 2J5LC 4KVNL 2HG5A 2WBWB 2CRYA 5E2WH 4KKLD 2BMKB 1U6AH 3F7YA 2VDMH 1A22B 3EKCA 2OJEA 3EYVA 3TJEH 2GUOA 1DEEA 3OKEB 2DQCH 2D2OA 3OKNB 5D1XD 4KUZH 3S34H 5FHBH 4OAWA 5LGHL 2YBRA 1KELL 2VRAA 2CDFA 1CZ8L 5B39G 3MRBA 4UQ2B 4HC1A 4CN6A 4L29B 4NO5A 5AWNL 1LD9B 1C5DB 5GS0D 5AAMA 3W39B 8FABB 1HXYB 3QIBD 1OLZA 4U0QB 4M1GH 2BHUA 3SPVB 3QIWD 4PGDB 5IEHB 4S10A 4UT7L 5E2TL 3MXWL 4RRPA 3QYCA 2APVA 3PWUB 1FP5A 1TJIL 4YNYA 1KTLA 1INEL 2XXMB 5EBGA 1YEGH 4OCRH 4LMQE 5INDA 1CE1H 2V7HA 2ADIB 4UUJA 2BRQA 4YAQA 4AQOA 1E4KA 4DGYH 5GRXG 32C2A 4AY0A 4P9HL 5JOPE 5ACZA 2XWBA 4X4XA 5LXGH 5MHSE 4A6YH 1A9BA 1ONQB 4WHTB 1L6XA 2NX5E 5J11B 3LS5H 2H45A 3NCBB 3IDJA 1CGTA 1RJCA 3B9KA 1U8MB 4IS6A 2MQCA 2GJZB 3FRUB 1HINH 4XP5H 3R06B 4UQ3B 2X44D 2Z92B 4FS0A 4AMKH 4YHYB 5JXAH 1VA9A 3MUZ1 4NUGH 5GJSL 2CLZA 1FNEA 1HIMH 1Q72L 1P2CA 1FVDB 4EIZC 1RUKH 4KUCD 3WS3A 5C6TL 1ORSB 1J10A 2EYRB 1V8HA 1JL8A 2FZ3B 3S98A 1RZFL 4OGZA 1MFBH 1J8HA 3PQYA 3M17B 2CQVA 3BIBX 3UBXI 3HE7A 5GGQL 5EU4B 1BQLL 1YEHH 2C3GA 4YZFE 1UC6A 1MREL 2B1HL 3B43A 3L3JB 4LSPL 3O2DH 2EDKA 4P46C 3HNSH 1OSPH 1S5IH 3GHEL 4MLIA 3C9NB 3WHE0 3EJZD 4PJDF 3HS0B 5FCUL 3FN0L 1C1EL 5HVFB 1WZ1L 2XRAL 4HT1L 1CFTB 1VFAA 3N1MC 5MEQB 1JZ5A 5J56B 4MNQD 4LSVH 5JIIA 4IRSA 4YGVA 5H8DA 3LCYA 1OWWA 4X7EC 4D8PB 3VXOA 1IQDB 1H8SA 3L5WB 4Z5RB 1VFBA 3ULSA 1XCQB 5SWZA 3I9GL 4X6DA 2PXYA 3TH2T 3MLVH 5IMLA 1IGTB 1NUGA 1WAAF 1MEXL 2ZJSL 4WW2A 2F19H 2NY5L 4LLAA 3DVNA 4NWTH 4P46D 4NM8L 3IF1A 3VD5A 4JDVB 4Q0XH 1HHKA 4MAUH 4L8SB 4YC2B 5J1SC 2JJWA 1G9MC 3RA7L 1N6VA 4R3SA 3CSYB 5F6IC 5IG7A 1J86A 4HBCL 4DVRH 4G7VH 5FGBC 4LEOB 1YJDC 3OWEA 1BQHB 5DVMA 1GIGH 4QXTA 4LCCA 3DUHA 3K80A 3EDFA 4FTVB 2CIKB 5FYKH 4JDZB 1FH5H 3BEWA 2BOBA 4W68A 5CMAB 5EBLB 4WV1C 4S1QH 5TH2B 2AJVH 5I1DA 1OTUD 1NUFA 3H9YA 4WDIA 4N9GB 4QHLA 2PR4H 1Q9LB 4R96B 4F7TA 2Q8AL 3GSOA 1S78D 1HEZB 3TBSB 3MLYL 5EO0B 3UYRH 2DMKA 5DYOB 1AO7E 4QNPE 1MWAB 1HDMA 5GGVH 4JHBA 1WICA 5I1GL 1KF9B 3P4OA 3B8YA 3O3DB 2B0SH 1I1RA 1G9NL 1U8PB 2BOCA 4QY8A 3QXUA 2VXTL 2V2WB 1N6UA 2FH8A 5AZ2H 4K94L 2YPKB 1GVIA 1FZOA 4ZUSB 3VWKC 3G6DL 4JQXA 1JYXA 3LB6D 5DRNA 1BFTA 3HG1E 4BJLA 4XXCA 3BAEH 3D87B 5CHNB 3ZYIA 4PJAF 3ARGB 4L8DA 2A6KA 1H3VA 1I7UA 3DO3A 1MWAL 4X99A 4NO0B 1JTOA 4OQ1A 4U6TA 3X12B 1DBJH 4PJDB 3BKCH 2F54E 2JF1A 1CTNA 1K4DB 5HI3C 1MJUH 3ARFC 4E0RB 2N7BA 4YHNA 1IFHH 2A6IA 4NDMA 1KC5L 5T1MA 4EVNA 2XWJB 1RURH 1XGYH 3C6SB 1KNOB 4U1MA 3PV6A 1MPAH 5EUKB 1EEYA 4ZTPH 3VD7A 1LHZA 4OB5H 4PJCF 3VWJC 4G9DB 3EYUL 2AKRB 4Q9BA 1WFNA 5C3TA 4QOKD 3FONB 1RZIA 3VWKD 4PJEE 1BECA 2JE8A 4M93C 2R0WH 2QQLH 1RY7B 3GIZL 4ETQB 3JWNC 5BS0A 1PLGL 1A6WL 2PYFA 3E2HC 4LSTL 1N7MH 1KN4H 2JJSC 1X5GA 4EQ3A 1IC7H 4EN3C 1OAZL 1CBVH 3G5YA 4LGSB 3F7YB 3GDBA 2IPTL 5I66A 3IDMA 2Y6SC 3CLEL 5FEBA 1DEEB 2H26A 5EBWA 4C56D 3CXDH 3K8MA 4NHUB 4OAWB 3VJ6B 2YBRB 4OLYH 2DQUL 4JO3H 1QFWH 4ODXA 3O6FC 5D96B 4BELD 3MRBB 5AEAA 5D6CA 4NO5B 4JKWA 4MS8C 3VWJD 3P73B 4XPAH 3WLBA 5HTSA 1FNSL 3UBXG 3NH7H 3RU8H 1N5YH 4N5EC 3QCTH 1KJ3H 2R1XA 2UZIL 3CFEB 4PJ7F 1U8HB 4YNYB 3ZYJA 3SE3C 5BXFA 4AL8H 3MNWA 4WWID 5INDB 4JO4L 3QDHA 5DS8A 4UUJB 1T7XA 3WHXA 4PGCA 3GBNL 2Y6SD 4JEGB 32C2B 4WFFD 4OM0L 1I9JH 5ACZB 2XWBB 4HC1L 4ZD3L 3T4AA 3K8KA 4OI8A 5C6WH 4J3OC 2I60H 4JJ5A 1WFOA 4EDWH 4PS4L 4DTGL 1ZS8B 4MS8D 3BPOC 3BJ91 3B9KB 5EOQL 3QQ9C 4P5TA 2X4SA 2FHBA 1CWVA 4M6NH 3TP4A 3KJ6L 1YYML 4N5ED 4PJAB 3IDXH 3MV7B 2CLZB 1FNEB 3Q5OA 4ZNEA 1BFSA 1P2CB 5I18H 1AQKH 2V6HA 1PY4A 2GKIA 3VXTA 1YYLL 4HGWA 1MH5A 2DQHH 3RPKA 2EXWD 1EJOL 5JW4R 3PWLA 1J8HB 3PQYB 1MCWW 2CD0A 5C08D 1QLFA 5DJZA 1B2WH 2GY5A 4LVOC 4PJCB 2ED8A 3WJLA 2ARJQ 1MAML 3QUMA 4LLYB 5GS1B 3PE9A 3KLHD 4Z7WE 5I8EA 5IBLD 2HWZL 1GHFL 4UIKL 3DXAE 3O2WH 5DFWH 4G8GD 5EC1B 1E6JH 5CIPA 2D4DA 2A9NL 4PJXF 3BRFA 4M5ZH 4K3EH 2Y06L 4BH7B 5F44A 4P2QA 2DS4A 3I6LD 4IRSB 4YGVB 2ZKHL 4X9HA 1JF6A 5D6DC 4PFEA 3RY5A 1S9VA 4NC0B 1T0PB 1YEKH 1FDLL 4N0YL 3VXOB 1ZANH 4HKJB 4WEMB 2FR4A 1VFBB 2GK0A 3ULSB 2P5EE 3BP7B 4X6DB 5ID0A 2PXYB 1ZVHA 5KW9H 5IMLB 4XPGL 4WW2B 4JKKA 1MY7A 1PD6A 5JHLL 3DVNB 2V17H 3IF1B 5CJ8A 4KDTA 4FHBD 4MA1C 1CE6B 2O61A 4NNYA 3QUXB 4R3SB 5LCVL 5I8CA 5D2LA 3B2UC 1KXTB 3QFJD 4O4YL 2YUVA 2Z31C 4LARL 2R0LH 3MGTA 4LCCB 4U1LB 2A1WL 3AS3A 4X6CF 2QR0A 1JPFA 2CK2A 3QDJE 1D5MA 3WIIL 1U8OA 2VSCA 1TTGA 4Q9RL 3OPZL 2HT3C 2NW3A 1U8NA 2HTKC 3GB7B 4MXWH 3RAJL 3LIZL 1YMHA 2DWDB 3KPNA 2D03L 5DK3A 5I1DB 5I16A 3TESA 2XQBL 5C0JB 4WDIB 5IJKC 4L3EE 2X7LA 4QHLB 4QT5A 1VFMA 4PRAA 4MXQD 3GSOB 4L4VD 4WUUA 5E4EC 3FOLA 3ZDZF 1G0DA 4TOYL 2A9ML 5I2IA 4ODSL 2ICWI 3FB5A 1VACA 5FYKU 2X1PA 4QTHA 3P4OB 5IQ7H 3B2UD 3UZEA 3VU2A 4I18A 3WNMA 2BOCB 4QY8B 2Z31D 4OBRA 3ULVE 2J88L 4EOWH 3WL9A 5GGRB 4FTVD 1X5KA 2DQDL 2XKUA 1T2XA 2DQFB 2AJZA 4NP4H 1CIUA 2CUIA 5CGMA 5I17A 2FGWL 3DTXA 4R0LC 3TC9A 5JQHC 4HIEA 2BSSA 3FB6B 5IMMA 2P43B 2HT3D 2ADGB 3SDYL 2HTKD 4K9EH 4F15B 2PKDA 4Q6IC 4RGNC 5DJ8A 1GGIH 1QSFA 3TIEB 2A6KB 2BZDA 4TSBL 5EBMA 4X99B 2IMNA 1PYWA 2R4RH 5C0BB 2VLKA 2Y36H 1WFUA 4PJXB 2VXUH 3K2MC 4TULL 4YHNB 1CFVL 1UZ6E 2A6IB 3V6OE 4NDMB 2C7UA 1MY5A 1JZ6A 2X9WA 1A3QA 3STLA 5F7DA 3JWOL 2COQA 4U1MB 3MJ9L 5J12C 3U4BL 3PV6B 3VGDA 1EEYB 1A7BA 1GGCL 4GO6B 4M8VA 1UWEL 3O3AA 1TZHA 3UPAA 4HK3J 2BNRD 2HFEA 5DHVA 3CUPA 4JQVA 3JXAA 5A16A 1KUMA 3CFBB 4XTRD 1F3DJ 4HS8H 4KDVA 4NQSA 5DA0B 1B0GA 1G0XA 2PYFB 4RGND 3WLWC 4PP2A 2BJML 5AYUL 2KH2B 3V6BR 4JFHD 1RHFA 3OBAA 3LN4A 3G5YB 3RWHA 2AV1A 4GMTL 5ESAA 1FNGB 4QKXB 2EDOA 5CEZD 5I66B 3IDMB 1FFOA 1H3GA 5MI0C 5D93C 5HHXL 2FX8H 4XPFH 2H26B 1H5BA 5EBWB 2HT2C 2FSEB 3BD3A 1Y6KR 2OQJA 3FRPG 5KSAA 2PTTA 4XC3H 3NPSC 3U0WH 2EYTB 2XV6B 4MAYA 4LSQL 4ODXB 4X6CB 3L3IA 2Z4QA 4J4PA 5DTFA 1KEGL 2G75B 5D6CB 1ZK9A 4E41A 4XVSH 5IOPA 3WLBB 3DBXB 3TH4T 2F58L 3DHJA 1UJ3A 1DBKL 4R7NA 2R69H 4KY1H 1DQMH 4TSAL 5DJ6B 4S0TD 2MCPL 5EWIH 2DBLL 3PG2A 1YY9D 3MNWB 3RZWA 3QNZB 4IIQB 4NOBA 4P59H 5DS8B 2JCCA 3WHXB 4PGCB 4PB9H 3RDTB 3D6GA 4ODWB 1HH6A 5DFVD 5HI4C 2JTDA 5DC4B 4DAGH 3RZCC 1ZHBB 1T3FB 1VESA 2AJYH 4UB0L 3T4AB 1WWCA 4H26A 4XMKH 3CSGA 1FNFA 4Y5VB 4M6ML 1RZKC 1YPZA 1EK3A 2V2XA 3EO9H 5EA0L 5IVNA 4YDLC 2OR9L 3QXWA 2AQ1A 3L7EA 1R24A 1OAKH 3KPOA 2X4SB 2D7TL 1VDGA 4M62L 2UVFA 2IJ0C 4X80H 5F1NB 2VN7A 5J4MA 2FEDD 4XVUC 3ARBA 2H2SC 3D3VE 5D1ZA 4KK6D 4LVHC 3RWDA 3VFTA 3O41B 1MH5B 4YFDB 5JHDE 4C58B 3OJMB 4RCAA 4HFUL 4CNIA 5HYJE 4H0IA 5HI4D 1WBZA 2WP3O 3PWLB 3RZCD 4BFGA 1MCEA 1QLFB 1U95A 4FFYH 4DGVH 5DJZB 3DIFA 1G7LB 1OAYH 4AEIL 3EJYD 6FABH 3U46A 3QUMB 4URTB 4YPJA 3A67L 1EIBA 2FEEL 3HN3A 4RMVA 3OJ2C 4OFVA 4YH6A 1YN7A 1KJVA 2VDQL 2A6DA 3OV6A 1G7QA 5F8QC 3C8KB 1KIRB 3K74B 4V1DB 5CIPB 3MV7D 4WVRA 2FB4H 3QJHA 5BMFL 1U3HA 1QFHA 3RY4A 4XVUD 5F7MC 4P2QB 2H2SD 1EHLH 3PGFH 3MLZL 5TF1L 3B9VA 4XPBH 5F96L 1Q0YL 4K23L 1S3KH 1QBAA 4UDTB 2I9LB 3ABZA 4FQJL 2VLMD 2GK0B 4LCWD 2BDNH 1I9IL 1CQKA 1N5AA 5ID0B 2P42B 3QUML 1T04A 5A2LH 3QZWB 4BSWA 1NLDH 4M7LL 4FQ2H 1MCKA 1D5IL 1JHKH 4XBGB 1NCCH 4ZPTA 2WBJA 3MLSL 3RWJA 3LHPL 5DDHA 5I8CB 3X3FH 5D2LB 5ICZA 3MLWH 1ZEAL 4GLRH 5TE4H 3WD5L 3T2QA 5I1LA 1FPTH 2OZ4H 4YWGH 5E6YA 1W2KT 3RUGA 3S88H 1NKRA 4R90L 2QR0B 2NY0C 1KCVL 4POYA 3QEQE 4L4TD 4WGWB 1KYOK 3RWFB 1KENH 4M8QA 1U8OB 5ADPH 4NN6B 1CDJA 2NW3B 2VOTA 1U8NB 1MRCH 1OP9A 1LO0L 1SJVA 5I16B 2DYPB 4PGZA 4MDJB 4QT5B 4PRAB 5CILH 3DWTA 4GAYA 3KNBA 4OI7A 1T7ZA 2K1MA 5I2IB 2DIBA 3QUXD 3FB5B 3N85H 4MX7B 2M2DA 4KHXL 4QTHB 3RY6C 4ZFGH 1A7RL 3OXRB 1EVTC 4OZ4A 2FECI 4NPYA 4ODTL 3WL9B 1Q38A 4RDQG 1QFWM 4JY6A 3O4LE 4KJQD 3WJJC 2NY0D 3LH2H 1A7QL 4ZDHB 1TVBB 1XZ0A 2AJZB 4NN5C 5I17B 1QSZA 2BSSB 4O58L 5DSCA 5HYSG 3ILPA 4N90D 2EIEA 2X09A 1GGTA 3DNKA 5DJ8B 1F2XK 4XPHH 4NZTH 5EBMB 1I1AA 25C8L 2P5WE 5DVLA 3KYNA 4IMKA 2V7NA 2VLKB 3BN9D 1S5HA 4L8BB 2ZUUA 1A0QH 4FQLH 2JIXA 5LBSL 3BHBA 2B7DT 1QFOA 3OGOE 1QLRA 2GK2A 3STLB 1IJ9A 3G5XA 5F7DB 4K7PY 1F4XL 4MXVF 5DMGD 4GXVH 5BQ7A 3FQWA 2VZ3A 1ADQA 4HJ0D 5BVPL 5JO5A 2HN7A 2XNAA 3O3BB 1TITA 4G3YH 4OGYL 4AG4L 4F9LC 4PRPD 5DHVB 3CUPB 5ICXB 2J6EA 2Q8BH 3ULVH 3T3ME 3T4YA 1BMGA 5T5FL 1AXIB 5A16B 4WO4C 2W92A 1N4XH 2DM4A 4NQSB 4PP2B 3T0EA 3GMOB 4M4PA 3RWHB 2AV1B 5ESAB 2R29H 5C0BD 2IANE 1I3UA 1F8TL 1UM4H 1MCPL 3C5SA 3MV8A 1KJ2A 5GGVY 1U3ZA 5HY9A 1H5BB 2OQJB 3MOQA 3DVGB 1FLTX 2GCYA 4MAYB 4HPOH 3WE6B 1IKNC 3L3IB 1HKLH 2Z4QB 5DTFB 2MHAB 2BXYA 4WFEE 5DUPH 1Q9OA 4GG6F 2AK4D 1JN6A 2ENYA 2HKFH 4H20L 5BCAA 4D0DA 2VDLL 1ITCA 2O5YL 1FL5A 3LS4H 3IDYB 4WW1A 3TT3L 2EDDA 1PG7W 1UJ3B 2PNDA 2XQYK 5HPOA 4R7NB 4WO4D 4KPHH 2AXJA 3HUJE 5E8EA 3IT8D 3VW3H 1R5WA 4R8WL 3OAUH 3K4ZA 3CC5B 4PJFF 1SEQL 1I4FB 4U6XB 2NY4C 3IGAB 3L5IA 4PJHA 1TQBB 3MYJA 1JWUA 4ELMA 1HH6B 2QL1A 5F7YC 1AXTL 1XF3B 3NZHL 4PY7A 2IGFH 2ERJB 4F58H 4PR5B 4FZ8H 4I13B 4FFVC 1FL3A 4AM0B 4DOHE 3QQ3A 4O9HH 4FG6D 4QXWA 1YPZB 4X8JA 1A9EA 2KL6A 4R6UA 4UZGA 4J3UA 3L7EB 5CZKA 1R24B 3V2AR 3C60A 2RAMA 1QSED 1T21A 3HZYA 2APWA 3BGAA 1NFDA 5KTEL 3IDNB 4B41A 4ZG1A 4NKMB 4RFOL 3D2UD 2FJGB 5FO8A 5LJYH 4OIBA 3X11A 4JY5L 4U4BA 4Z9KB 3VFTB 5FUCE 1UH2A 3O11A 3RDTD 1YEEL 2NY4D 1M05A 4DZBA 3LKSB 2EIBA 1WBZB 3LKQA 1F6AA 1QBLH 3ZKSD 1U95B 1QZ1A 4FFVD 3GSNB 3QB7C 1P84J 2QLVB 1MIEL 1RJLB 5KSBE 5E8OA 4L1DA 3U46B 4Z7UA 1WUNT 4UTBH 2DTMH 3BPLC 5CD3A 1M1SA 1KJVB 4N0UA 4JFEE 3FQUA 1G7QB 1S7UA 5D7IA 5DD1H 1U2HA 4TVSa 3ESUF 5CGTA 3BRGC 3QJHB 5I1CL 4KKAD 1T03H 3GMNA 2EKJA 3MROA 4IHOB 4QTIL 5IMOA 3LQAH 3WUWG 1UZ8B 4UDUA 2YD4A 1RIUL 4IMLA 2JB6B 4R7DA 3ZE1E 3LSOB 3GSNL 4P5MA 4JPWH 4KTDH 2R2EA 4Z8FH 1CGUA 4GKZA 1XR9A 1T04B 4XPTL 4WJ5A 3FO9A 4BFEA 3SKJH 1FO0H 2GSIB 4GT7A 4GG6B 1LK3L 1QA9A 4XP6H 4WUKH 1A3LL 1DVFA 3TPKA 4QHMA 5J8OA 4P3CL 3JSSA 3THMH 1UEYA 4V1DD 5ILTL 2WBJB 2HRPL 3RWJB 3LZFL 3L5XH 2VISB 4JRYA 4APQD 1CS6A 3L7FA 5I1LB 4BSVA 3BP4A 4NKIH 2BNUA 1MVUA 4PJFB 3RUGB 3VXMA 1OQXA 1FSKC 1K8DA 3MNZB 3SDXE 3MRMA 2VL5A 2IAMA 2AI0L 3SDAA 3PIQA 1WLHA 4NKDA 5D7SL 3NCYP 3G04A 3V0WH 2J3SA 5LWYL 1DL7L 2IFGA 4GUPA 2WWMC 2EDYA 4I3SH 3IB4A 4JFYA 5GSRA 2CH8A 2PYEA 2DM2A 4UTAH 1CLYL 5IW6A 2EDNA 3E1F1 4NNXA 2E27H 2CK0H 2DDQH 1JNLL 4YE4H 1UB5A 2VDNH 5GGTH 2VJXA 1KCUL 4O02H 4OZ4B 2AGJH 2NY7H 4NPYB 4U33A 1RU9H 1UJTA 4JY6B 3GHBH 4NUJA 1F90L 4K7PX 4ZS6C 5GXBB 3QWQB 1E4WL 4G43A 1S9YA 2XTJB 5BV7C 4F8TA 2DYPD 3TNNA 2UWEA 3U0PA 1NFDF 2BRRL 3L95A 2WWMD 3SBWA 4NNPH 3C6LC 1BF8A 5CJ5A 3NGBB 1S7XA 1I1AB 2A2QT 5TQ2L 2AABH 1GSMA 2YD6A 1NCBL 1NSNL 1X6NA 3FMGL 3KYNB 3QUZA 4LRNL 3VRLE 3SE9L 1S5HB 4L9LA 5F9OH 4GAJH 5CEYA 2F53E 3CXHJ 2JIXB 3BHBB 1U8JA 4DEPB 1BP3B 1REIA 3MCKA 3G5XB 1E27B 4KROC 1C12A 5BQ7B 3FQWB 4PGJA 4JN1H 3GSXA 2I24N 5E08H 5JO5B 1DQLL 2XNAB 5SX5H 2VLRD 2K7QA 5DQDL 3O3EA 4ZS6D 1RUPH 5A43C 1NPUA 1NMBH 3ELAT 2IWGA 1DUYA 3RKPA 3V7AE 5DD3L 1Y18A 2DLIA 2VXVL 4GS7B 4FP8L 4P23A 5D7JC 3SKMA 4ODHL 3T0EB 4GKOA 3WV0A 5JDSA 5D5MF 2QHLA 2DI9A 4HUKB 5EO1A 1JYWA 1RD6A 3MRIA 2ZG2A 3B8SA 3MV8B 3TH3T 1P9MC 4N8VA 4TUJB 1FORL 5HY9B 2L0DA 5HI5C 1HSAA 2WAHA 3SGDH 4WI3A 4MJ6A 1ADQL 2HTLD 4ODUB 2A6JB 4JFZL 2XACC 4HXAL 4ZMAT 2EE2A 5L88H 4QRRE 3UXFA 5C2BL 1DTUA 1Q9OB 2J6EL 5EPMA 2R0ZH 2VZTA 3GSRB 2HMID 4D0DB 4XP4L 1FL5B 4HIXH 3MFFB 1BBJA 4WW1B 4OSUH 5MENA 1SY6A 5F3BA 3BKJH 5E8EB 1DBBH 3LKNA 4HJJL 3O3UN 1I3GL 3OKLA 4Y4HB 4AEEA 1KT2A 3V7AG 4PJHB 1KTKE 3A6CH 3MYJB 1JWUB 4D0BB 2MQ3A 3B2VH 1HZHH 4JCLA 4LKXB 5DK0A 3EUUA 1FL3B 4KZDH 1YNKH 3N0PB 3QQ3B 2EDHA 1CICA 1XCTA 5CSGA 1RVFH 2QQKH 4X8JB 1GAFH 4LASH 2OL3A 3C60B 1T21B 3HZYB 1T66D 1NFDB 4OZHF 3KPSA 4ZOAA 1IGIH 4HUVA 5FO8B 5ISZA 3KYMA 5KVDH 3X11B 3VFGL 1UACH 4J3WA 3O11B 2VDKH 4CL7A 1YEFH 4DZBB 1M05B 4S1SL 1MF2H 4Q97A 3GO1L 3BDBA 4F57H 4KKNA 4MQ7A 2DLTA 3HI6L 1G1YA 3LKQB 1W72A 4W6WB 3TV3H 5K59E 2VZUA 1I1YB 3ZE2E 3OR6B 1E6OL 3C5JA 1N0XL 2YEZB 5AUMA 3ARSA 2P4AB 5E8OB 3BZ4A 4Z7UB 4R26H 2HH0H 5CD3B 3SDCA 3OAZH 3T2NH 3E8UH 3QDMA 3FQUB 2VSDA 1E4XH 5D7IB 3QG7H 3BVNA 4YHML 1G1CA 2H41A 2QQNH 2VN4A 4UINH 1P5UA 3B9DA 3QXVA 5TGBA 5E6ZA 4TRPL 3MROB 5E5UB 3BWUC 1YMME 2ZCHL 2UUDH 1DDHA 1DUZA 1R5VB 4J8RA 3ZTNH 4R7DB 2G5BB 4JG1H 3NFPA 4OF3A 1G7IA 4P5MB 2WWKO 4F3FA 1V7ML 2OSLB 4UV7L 4HK0A 1FFQA 4GKZB 1XR9B 1CT8A 3V9FA 1V7NL 5B39A 3FO9B 3ZKQD 2BERA 3LVEA 1MFEL 4AENA 4PJ5D 1HHHA 5B38G 1QA9B 3OJDA 4KXZI 5HGDA 3GSWB 1WBXA 3CH1A 1I3VA 2HLAA 4Z0BH 1DVFB 4U1NB 2G60H 4ZOCA 4QHMB 5IKCB 3MCG1 5C08E 5I19H 1U6AL 3VH8G 3DX9A 5EZLA 1BF2A 2HKHH 2HFTA 1J05A 2JKXA 3IU4H 5C0RH 3TJEL 1QACA 3L7FB 3BP4B 1MVUB 3VXMB 2ZUXA 3QO0A 4G6ML 4JM2C 2DQCL 4NC1C 4WI5A 1K8DB 4KUZL 3S34L 5FHBL 2DI7A 3V7MA 4G8GE 4EXPX 4CW1A 1JGDA 3MRMB 5J06A 4G6FB 3PIQB 2WUCL 3H3BC 1ZA3B 4YDKH 3QO1A 4MGXA 5BW7A 4DN4H 4HLZG 1EO8H 4Y1AE 4GUPB 5MERB 4M1GL 2FHFA 4MA7L 3UJJH 1CL7I 2IPKA 2PYEB 4XGZA 2AXGA 4UT9H 5CKAA 5C07E 4NNXB 5JPMB 5MEOA 2YRZA 3SQOH 2DJSA 1YEGL 4OCRL 4BQBA 4OZHB 1CE1L 2DWEA 4ODBD 4JFFE 3N1QC 3WO4B 3STZA 3VI4F 1DQJA 3KYOA 1MJ8L 5HVGB 3ZDXE 2WQRA 1H15A 4WI8A 1TJHH 1A4KB 4JM2D 3TO4C 3OQ3B 1TPXC 5HSFA 1NEZG 5SX4I 1S9XA 3SGKA 2GHWB 2BVTA 2H2PC 4GW4A 2FLBT 5LXGL 2Y5TA 5HVWA 4HH8A 1B3JA 4LK4A 2OX5A 3Q3GA 1CDIA 5FDYA 1S9YB 1V3MA 2Y7QA 1T83C 3PWJA 1P7HL 2Y5EA 3HB3D 3FQNA 3TNNB 1P1ZB 1FG2B 3U0PB 5KN5A 3GKWH 4PIRF 1HINL 3MJ8A 2XKNA 2NY2B 4U6VH 4YDVB 3VGFA 5E00A 4LP4A 4AMKL 1PKQA 1EHAA 4NUGL 1HIML 2JB5L 5KVGH 3QUZB 4TN9A 2XG4A 1G7MA 3HCVA 5CEYB 4PRHE 1SHMA 1RUKL 2OXGA 2NX5A 2WNGA 1U8JB 1NCNA 4Y89A 3GNML 3MCKB 4L4VE 1S7WA 4TUKH 4LNRA 1QRKA 1MCOH 1UT9A 3GSXB 1MFBL 4JFDE 5D7LD 5J1TC 3FHAA 3Q6GH 3PUCA 2H2PD 5SV3A 2B2XH 3ZKXC 1YEHL 3O4OB 2XTJD 2V9TA 7CGTA 3HNSL 1OSPL 2NY3C 5AD0A 1Y18B 5EU3A 2AV7A 3MV9D 1UKSA 4P23B 1N64H 3S3PA 2IEPA 3QI9A 3NIFF 2EDLA 5HDQH 4QGTA 4OD1L 3W5MA 3KHOA 1KTDA 1AHWA 1BLNA 4LSVL 3U7WH 4N8VB 3VFPA 1FZJB 2ITCB 1OTTC 2BVUA 2ESVE 4C54A 3CX5K 1PSKH 3LV3A 4MJ6B 1H0DA 3SJVA 2ZCKH 4KJPC 1NMAH 4F7CA 3NIGF 4I77H 3OB0H 3JUYA 3MLVL 3P3YA 4PJIF 5JR1H 3WFHA 2F19L 3W9DA 4NWTL 5K9JL 2CLRA 4U6YA 5IGXH 4MAUL 1FN4A 1G9MH 5KOVC 1IEBA 5B8CA 1QVOA 1T7YA 3LKNB 2GAZB 4DVRL 4G7VL 2BNRE 3DRQA 2F74A 4Z7QF 3VFVA 4K7PL 2ZUQB 1OB1B 1U8QA 1GIGL 3UTPD 5DVNA 4RGNE 4PRDA 2W0FA 3RVTC 4Z7OE 3JZ7A 1FH5L 4MNGE 1OTTD 1MAJA 2EC9U 3ZSSA 1RI8A 3NABH 4NJ9H 5IVZA 1B6UA 5H35A 2J8OA 5CEZE 3D25A 4S1QL 4KRMB 1XCTB 3WKMH 3AXLA 3MBEA 3UTTE 1F00I 2PR4L 3MV01 1MI5A 1AJ7L 4MA3A 3WDIA 2YN3A 3KPSB 3LKPA 3P0VH 5GGVL 5ISZB 3KYMB 3RL2B 4Y4HD 2V9QA 1FFRA 1WEJH 5F8RC 2AK1H 4OKVA 2B0SL 4FQXB 1NGZA 3HNTH 4NBYB 4U3HA 4FXLA 4MQ7B 1ZWIA 1CG9A 3P9WB 1W72B 5E94A 1JGVH 4DN3L 4P4KA 2XA8H 3C5JB 2X40A 3HAEA 5CJXA 5AUMB 2APBA 5ENWB 2MPAH 4RMTA 4RBPK 1FBIL 1CIDA 3KXFD 1IMHC 2VIRA 3SDCB 5JTWA 3BYTA 3QDMB 4YFLI 2MOVA 4OCSH 4XBPA 1IKFH 3BVNB 5FYJD 3F58H 1DBJL 2A0LD 3OB8A 3QEGH 1ZLUK 1I9EA 2QKIA 3HG1A 5JPNB 1TENA 1NGPH 1IFHL 3TVMC 3CZFA 1UH3A 2V2TA 3H9HA 1N2RA 1XGYL 4RWHA 1W72L 1NAMA 5CZVH 1DDHB 1DUZB 3ZT7A 1JMXA 1V05A 4J8RB 4CVWA 1SBSH 3PF2A 3NFPB 2J1KA 2D7NA 4F3FB 1RFDL 1PG7H 4HK0B 3RWCA 1UGNA 1CT8B 1KB5H 1IC1A 5B39B 4EI5C 3C2SA 2R0WL 4M48L 5CJOH 1HHHB 1CR9H 3OJDB 5HGDB 2QQQA 3UBXA 4PJIB 3GSUB 2P49B 3QNXB 1IC7L 5FGRA 1ZA6A 1CBVL 4YZFF 1UWXH 3DX9B 4HWUA 1J05B 4PJEA 5GGUA 3RTQC 4ODVH 3BQUC 4XZUA 3R8BB 3CXDL 5T1LD 4MD0B 4OLYL 1JGDB 4JO3L 5MP6L 3TYFB 1QFWL 1WBYA 3GJFK 1FYHB 3GMMA 4PRIE 1JHLH 5E7FA 4NCDA 4HLZH 4KGJA 4XPAL 1QFUH 2BVOB 2YPLE 1CFSA 2R0KH 1U91A 3VMPA 3NH7L 3RU8L 3BDYH 5I71B 2X41A 4XP9L 2LU7A 1N5YL 3QCTL 2IPKB 4XGZB 4YK4B 2VLME 2AXGB 3QFDA 5MEOB 3T0BA 5C09A 4G5ZH 1NCUA 3VGHA 1K4CA 5GRUH 2DWEB 3F7QA 1EGJA 3RVWC 4OQTH 5I74B 1LMKA 4HAFA 5DD6B 3DI2B 3HZMA 3STZB 5CZXC 3KYOB 2IH1A 3HC3L 2CDGA 4ORZC 1F3DH 1NBZA 3BQUD 5I9QC 1EXUA 1I9JL 1KJMB 8CGTA 5EU6A 4GW4B 2X4RA 2Y5TB 4NT6B 4XHQA 5ICYB 4JLRA 1PVHA 2Y7QB 3PWJB 4EDWL 1F4HA 3FQNB 4EDXA 4O2CA 1TXKA 4GBXC 3GM0A 3SDDA 3WCYA 2YPVL 2YRLA 4L4TE 12E8H 4KVCL 3MJ8B 2XKNB 4M6NL 5IVXF 1ZLVK 3WFEL 4F80A 3IDXL 3UC0H 3PL6B 3PWPE 4FNLH 3HCVB 1AQKL 4Y2DC 2DKUA 1KN2L 2NX5B 2YUZA 1F6LL 3HRZA 1NL0H 2DQHL 4QNPF 1S7WB 4YHLL 4LNRB 3QHZH 5DGQA 1SJHB 4EKXA 5B4MC 3F12A 3CNKA 1B2WL 2GIYA 5FB8A 3SE4A 3FO0H 4LDLB 3MACH 2XZCH 1BHGA 4LF3A 2NYYC 5GS3A 4UAOC 3S96A 4DUWA 4N1EA 5AD0B 5EU3B 2AV7B 3P9LA 3O2WL 3D18A 3P11H 4UU9A 1VSCA 1E6JL 3D39A 4M5ZL 1OSZA 4K3EL 4QYOB 1IRAY 2D9CA 1TDQA 4XAKD 2EH7L 4N90E 4KMQA 4JGMA 4LLDA 3VFPB 1C08B 3PHOA 4Y2DD 1J7VR 4X6FA 2X9YA 2DICA 3BMWA 3DROA 3CZJA 4KKBD 4O2EA 2XZZA 4PJ8C 1ZANL 5GHWH 4F7MA 3OZ9L 1UM6H 2OYPA 4IRJC 3TEUA 2BCKA 4QRPA 4HKXB 3E6FB 4WWKA 1LEGA 1QRND 2FEEI 4H1LG 5B4MD 5KW9L 4OM1L 5LQBH 4BK4A 1E4KC 5TE6H 4ZFFB 4PREA 3WFHB 3W9DB 4XCEA 2CLRB 2H9GA 2V17L 1ZGLP 1S7RA 5IB1A 3REVB 2OI9C 1FN4B 1IEBB 3V5KA 5B8CB 1QVOB 4OZFG 2P5EA 2FJHB 1JUFA 1K3ZA 3RJQB 1T0NB 2ENSA 3VFVB 1KULA 1FGNH 1U8QB 2X4QA 4PRPE 3OSKA 3D85A 4MJ5A 5HHVH 1K6QH 2R0LL 2Q86A 2BY0A 4P2OB 4U0RB 5CBAB 5C0CD 4PJ8D 1NCWH 5FYKD 3Q1SH 5H35B 5IVZB 3UTSA 3LEXB 4WI6A 4IRJD 5JLZA 1NC2B 5K9OA 3AXLB 5ESVB 1JWMA 1CK0H 3QDJA 1BWMA 4MA3B 1OGAA 3KYKH 2YWZA 3LKPB 4Y5XC 1MQKH 1AR2A 3HE7C 3LDBC 3NAAH 2AK4E 1TMCB 5CCKH 4XCFH 4H5SA 3WN5A 3L5HA 5IQ7L 3W0WA 1Z5LA 1M7DA 3DMMA 4JR9L 4LDEB 4JO2H 2ZWLT 4ZO7A 4EUPG 5IP4A 1ZWIB 5BZDA 1QPXA 4DFIA 1AO7B 3U30C 4NP4L 2J12B 2R4SL 3HAEB 1XT5A 4PP1C 4S1RH 3H42L 3S4SA 3KJ4C 5K9KA 4K9EL 1HWGB 3TBVA 1GGIL 2W1NA 4XBPB 4XNQA 2YMXH 5CEZH 1JPTL 5D8JH 3P4LA 5I73C 4UILL 1EZVY 2EO1A 2VXUL 3HG1B 2BVQB 2IQ9L 2V2TB 4OLUH 2PCPB 4FQXD 1QSEE 3NIDE 4OLXH 4YXLH 3MOBH 1NAMB 3FT2B 5E5MA 5F6HJ 2ICEA 1NH6A 1QUNA 4YR6A 1FRGH 1GH7A 3EBAA 4RIRA 3RWCB 2HLFC 3GMLA 3RX5A 5DVKA 5SX4H 1UM5L 4R4FH 4PP1D 4RFNC 3JWDL 2ZOLB 4HS8L 3UBXB 5J0BA 3Q6FA 2P7TA 1JI1A 5SWQA 1RUMH 4Y4FA 3MMEA 4N0CD 3U1SH 5IF0B 1EJ6A 5SWZD 4RA0C 1JRHH 4Z7WF 1EUTA 3U9PH 4PJEB 5GGUB 3BP5A 2EO9A 1ZHKB 2FX8L 3RVVD 1YNLH 2GT9A 3CK0H 1U36A 2I07A 4G6KH 3HTLX 3GFUA 2M1KA 3GMMB 3BN3B 1IGMH 3C5ZB 4PD4K 5D2NC 4XVSL 2X70B 1CFSB 1A2YA 1U91B 5E6IA 4LHUG 4ZUTA 3HLAA 1NGWB 3O6KH 2SEBA 3QFDB 2R69L 4KY1L 1DQML 4W4OA 4J1UA 5EWIL 3H3KA 4LVNB 4ETYA 1UH4A 3MRCA 1LNUA 4XXCC 2UZYB 4Z78A 2Q6WB 4JZJA 3LPGA 3VGBA 2Q3ZA 5AG9A 3HZMB 3MR9A 5CUSH 2IH1B 3I3EA 2B20A 2CDGB 4DAGL 1NBZB 4LCIH 2P48B 5IBUG 1EXUB 5EU6B 2AJYL 1QBMH 2X4RB 3MODH 4IDJL 4XMKL 3DUUB 1RZKH 2QSVA 1KEMH 4GQPH 4NGHH 4YO0A 4CN4A 2DQJH 3RNKA 3EO9L 3ARWA 3UPCA 5C92A 4Y5YA 5LAXA 4XVTH 3BP6B 1HILA 4O2CB 4YBHA 3SDDB 2XN9D 4MB4A 1DFBH 1QFPA 2PO6C 5CINL 1EGJL 1XGQA 3K7UA 4LIQE 5IIEA 4M3KB 1Q1JH 3AB0B 2LFGA 4GW5B 4JREC 4DKFH 3HRZB 3I6GA 3WFBH 1S8DB 2ICWA 3EYSH 4OUUA 5JUEH 4FFWC 3NCCB 1NBYA 2F5BH 3M45A 5EOCL 5ESQB 1I7RB 5I6XB 1SEBA 4DGVL 3HRPA 2RJMA 3F12B 3PABA 2VTFA 4XWGL 1YEDA 2YKLL 5FB8B 5FF6A 4U7SA 4M5YL 3ULVF 6FABL 1OL0A 1QO3A 2EDBA 5C3LD 5JHDA 5FA3A 1FO0A 2Z0BA 4U05A 1IE5A 5HYJA 3D18B 35C8H 4PG2C 3KWWA 3LKOA 4M43L 3D39B 3EO1A 5MHSD 4U6HA 1OSZB 2PO6D 3PL6D 4M7KH 3BZDA 1T6WA 3LMJH 4YQXH 3PGFL 4U1JB 1S3KL 3L3GA 1BBDL 5DWUH 4FFWD 4ZXBB 3LD8C 1LP9F 4OFYD 2BDNL 2BCKB 4QRPB 3ARDA 5E2VH 4S2SA 2YA2A 1DE4A 5HYQB 4H1LH 4UIMA 3I02B 3RL1A 4PREB 4L3AA 1LO5A 4WEBH 4L3CA 4XCEB 3WSQH 4H8WL 2DQGH 1JHKL 4IDLA 5IB1B 4ALAL 1FL6A 3V5KB 3MRQA 5TPWL 4CBPA 3FHQA 4MQSB 4OZFH 2AVGA 4POZD 2P5EB 5HGBA 2VLRE 1JUFB 5DUBA 3X3FL 5TE4L 3G6JE 3D85B 1CLZH 4MJ5B 4YWGL 5DJ2A 3R0NA 2Q86B 1PGRB 4P5TC 2B5IC 4P2RD 1ES0A 4ZYKA 4HX1A 3CVHA 2WUBH 3P2TA 4U2YA 1AC0A 1KENL 4OCYL 1Z9SA 3HFMH 3Q0HA 3TN0A 4A2LA 5IB5A 5ADPL 4FQQA 3UTSB 4ZAKC 1X5LA 1MRCL 3ZKND 1CDUA 4CVZA 3VGAB 5K9OB 4NQCE 3VFRB 3CMOH 3WNLA 5ALCL 2CDEB 5T3ZE 2R1WA 4KU1A 2YZ1A 5CILL 1JWMB 2H6PA 4HMEA 1DQTA 3QDJB 5E9DD 3BH8A 4QHUA 2VUYA 1OGAB 1T1WB 3B3IA 1WZKA 1AY1H 2DL2A 4HZLA 1JCKA 2R9HC 1IARB 1GL4B 1BD2D 3LQMA 2YHGA 5C0DA 1SJEA 3QP3A 4ZFGL 3VD4A 2V5YA 4G42A 5DHYA 1EZVX 1M7DB 3DMMB 4K3JH 4L3EB 5E8DL 3PHSA 2X4PA 4EUPH 4X83A 4P2OD 2VQTA 4FMFA 3GUTA 3IXTA 3LH2L 5IBTH 5BZDB 4LLWA 2E9WA 5D1QC 3K2UH 4MJIE 3VFUA 2DLFL 2VR5A 2VKXA 3GMRA 3SQBA 3MRGA 4ZAKD 1NC2D 5K9KB 1Z0NA 1HXMA 2PF6A 3GRWA 1P7QB 3TBVB 5DD0H 4XPHL 3HA0A 3O4LA 2D0GA 4XNQB 4ISVA 1A7PH 1NGXA 5CAYB 4YDIH 2WSKA 2R9HD 1A0QL 1J0KA 1OAXH 1MCDA 4JFPA 2F8XC 5MEPA 4KDTC 4GXVL 4TNVF 4R97C 4QXUH 3C2AH 1JZ7A 3TFKC 4WU7A 4YR6B 1BQSA 4RGMC 3BIKA 1CXLA 4CU7A 5D1QD 4QXGH 3GMLB 2DJ4A 2HVKB 3S37X 2W9EL 3VFMB 3ULVL 2Q8BL 3MRRA 1OARH 3HZKA 4RISH 3Q6FB 2P7TB 4ZPVA 2VDOL 4FZEH 4Y4FB 3VDBA 3MMEB 3IJYA 2R29L 2XOTA 5T1KA 4M7ZC 1WTLA 4HWBH 4JY4A 1BVKB 1UM4L 3EGSB 4EQ2A 1UYWH 5IJVA 1S9WA 2GT9B 5DZLA 3PDDA 5EG6C 3T3PE 5ITBH 5K9QG 5DJXA 4XHJC 4LRIA 3KR3H 4HPOL 1KCRH 5IB2A 1HKLL 1H3XA 2F54D 3AAZA 5GZOC 2IANA 2HKFL 5DMKB 2LAGB 3ROOB 1A2YB 4I18C 3LS4L 1FAIH 2OR7A 3HLAB 2C1OA 1JV5A 3EIFA 1UXSB 1OHQA 2SEBB 1UQSA 4JPKH 2V5TA 3S35H 4MXVE 3CFCH 4GQ9H 3DYMA 1RJYA 3OAUL 1U92B 3OXSA 5SX5K 4OCXL 1CXHA 3V6ZA 3MRCB 2BX5A 3MLRH 1CGXA 1LNUB 2Y25A 1CXIA 4JZJB 1AI1L 4PJ5E 3MR9B 4U7MA 5IB3A 4OCLC 4RDQF 5FYLE 4OZIE 4J23A 1U58B 2IGFL 4B53A 4F58L 3QSKB 4FZ8L 4S11A 2ZG3A 1JF5A 3HUJA 5J9PA 3VXUE 4Q9QH 3GMPB 2VZOA 4O9HL 1IGFH 4YO0B 4YHOH 4G9FE 1BAFH 5T3XE 1YY8A 3C5ZD 2GITB 3RNKB 3TBYB 1RUQH 3VRJA 5LAXB 1HILB 1S7SA 3IKKA 3EHBC 1GPOH 5J1AA 1FZKA 2YC1A 1XGQB 4NBXB 1JNNH 5IIEB 1D9KC 3QNYB 2K9UA 2YWYA 4K3DH 4KK5C 1HI6A 4B5EA 1AKJD 4JQVC 5I0DA 1F58L 3I6GB 5D1XA 3KPPA 2ICWB 4FABL 2N7AA 1JI2A 3QCVL 4QLRA 1R3IH 4WTZG 3MBXL 5F1IA 1CF8H 2O26U 4JCMA 1SEBB 1WITA 3PABB 4ESKA 1YEDB 3V8CA 5C7XH 3QIBA 4I0PC 3L3KB 3TYGH 5FUZL 3QIWA 4R4NC 5HVHC 4HWEH 2R8SH 4XNUH 4OV5A 5JHDB 2D4FA 5KSAC 4NC1E 1FO0B 2DTML 1MHPH 5HYJB 4J4PC 3EO1B 1DN2A 4U6HB 3KPQA 3OJVC 2ZUWA 2H32A 1BEYH 2LTQC 4HIJA 1D9KD 1NGQH 3RVUC 4MHHI 2OP4L 1R3LB 3MOAL 3L3GB 1X5XA 1WZLA 1F3JB 1XFPA 1L7IH 1MFAH 4LIQH 3AMKA 4ZSOA 3OKKB 3ARDB 4KTDL 4YBLC 3LEVL 1T1XA 1NFKA 1AQDA 3F6LA 5DC9B 3SKJL 1FO0L 4I0PD 3FFCE 3RL1B 1LO5B 1WIUA 4EIGB 4R4ND 4J3XA 5I1JH 2AW2A 4HUUA 5IESH 3VGGA 5D7LE 4F37K 1PW3A 3MRQB 1AIFA 3UTQB 5FDWA 4IOSD 3VD9A 2GJ6A 4LU5H 3L5XL 2LV4A 1YDPB 4E41D 1W8OA 4HXBL 4JRXD 5DJ2B 4P3DA 3MV9E 1IQWL 1OVZA 1ES0B 3RVUD 4PJGE 3CVHB 5I1AB 3OAZK 4RQQA 3DXAD 4GOSA 2GYSA 4ZXBD 3TN0B 5IB5B 4R2GC 4FQQB 3ARBC 3V0WL 5D1ZC 3VGEA 4CVZB 3DYPA 1G7HB 3GKZA 2WIIA 4I48A 1EHNA 4I3SL 5FV2A 2R1WB 1B6DA 1I1FA 4BFBD 4KRPB 2B4CC 2UUDK 5IROC 3SDXA 3SO3C 4UTAL 4QHUB 1ZSDA 2CK0L 1XGPA 5EC2B 2DDQL 2W9DH 1HYSD 1M7XA 3X14A 3U2SB 4YE4L 4MNQA 5C0DB 1NDMA 3RKDC 3BGFB 4O02L 1SMOA 4G42B 3CVHL 5DHYB 1VEMA 2AGJL 2NY7L 3HUJF 1H3UA 5KVFH 2X4PB 1RU9L 2XI9A 3GUTB 1NMCB 4LLWB 4P57A 5ANME 4LQFH 3VFUB 1M4KA 2L7JA 4GRMA 5TE7L 5JORA 1U3HC 5LVEA 2W07A 4R2GD 3GMRB 3FT4B 4K71C 5BV7H 2C4FU 1U0QA 1HXMB 1U93A 1ULVA 4P46A 1MCIA 1NCAH 3D0VB 3FN3A 5JIHA 4NNPL 5CEXA 5HHOD 4U1SB 3UJTL 4LL9A 4L5FH 3O4LB 1BFVH 4RFEB 5HYFA 4ISVB 2AABL 1XR8A 3PP4H 3N1PC 4X5XA 4FQ1L 5F9OL 5AYQA 1S9KC 5HGHB 1URLA 4L8CA 5T3ZH 1BGXH 1G6RA 5CSBA 1INQB 4L3ED 2DQEH 2MMXA 5DEFA 3RKDD 4LGRB 5MEPB 4JN1L 4PG9A