1TIUA

Titin, ig repeat 27, nmr, 24 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
89
structure length
89
Chain Sequence
LIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin-like domain
molecule keywords TITIN, I27
publication title Immunoglobulin-like modules from titin I-band: extensible components of muscle elasticity.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tiuA00
3V52H 3LEYL 2F58H 1A64A 2ZOLA 1DBJL 2FHBA 4P5TA 3T77B 1QFWM 2H2PD 4OD3H 1IILE 1EGJA 3WUWA 1FSKC 4IJ3C 4Z8FH 5T5FL 1URLA 3VGDA 1U91A 3K1DA 5LG1A 2RAMA 5J3HC 2IH1B 4P0DA 4KMQA 3BGMB 4XAWL 3BRDA 4MCZB 5DHVB 1MCDA 3ARTA 3T0EC 4YDLC 2VLKB 3B9AA 4P46A 5HHOE 3KJ4C 2EH7H 43C9B 2JCCF 1PLGH 1YZZA 4TOYL 5EOTA 1RFDH 3P11L 3SDCD 3L5XL 3QJHB 2YD4A 4RBPK 3IU4L 1U93B 1QSED 1I9RL 3O6MH 4P2YA 4BQBA 3DBXB 4LHJB 4BK4A 5FYJH 5DYOA 1ZS8B 3RL2A 1RZ8B 1XAUA 4ZO9A 1TPXC 3O4OC 3QO0B 3CFDA 4CADA 1NCCH 5GRXG 1A1NA 2EDHA 4PTTA 1A3RH 2ZG2A 1S9WB 4LL9A 3L3JB 3LN9A 1SEQH 2P46B 4YDIL 1BAFL 4PJIF 4ZAKB 3WEXB 1TCRB 2RCSH 4OCLC 5HVFB 1W72A 3T0AA 1ZLSL 3OR6B 4MQSB 4NP4L 2F53A 4DUVA 1CU4H 3W9DB 2JKXA 1JWSA 1SM3L 5BVJB 3TA3C 3MRQB 3BVNA 1CDIA 3D25A 3SGJA 4G6ML 4NDMB 4HIHB 1OQXA 1EGJL 4C59B 2DQJH 2NY1C 3E3QE 4PG2A 4L3EB 1R3JA 1MHPH 3RVTD 3SOBL 3W5MA 1IL1B 2HH0H 2P47B 4J3XA 3HMWL 5CJ8A 2CH8A 3QG7L 1VPOL 3IDJB 5EA0H 5DURB 2DLFL 5HD8C 5CKAA 1DN0A 1FNFA 2YK1L 5IOPB 2DQCH 1UZ8B 1WBZB 1XGYL 1A0QL 5MP6L 5GXBB 3V0WL 4MQ7B 4R97B 2HYMA 4YX2L 4OZGE 4GAJL 4M7ZB 1DQQA 3FJTA 4KK6C 2OYPA 2VXTH 3WNOA 1A6ZB 1Z9MA 5F89A 3L3KB 4WRLA 4Z7WE 4JPIB 4WU5B 5D5MB 1J5OH 4L8SC 3SCMC 1CLOH 4ENED 2EXYD 2VC2H 1XF3B 1DQJB 2W65A 2J7LA 4JKWA 3ZYJA 3GSNA 5FM4A 3O41A 4I18C 1SYVA 4C83A 1F4HA 4Y5XA 1OCWH 2NYYD 2VITA 5HGAB 3ZE0E 4S1DC 4AT6B 4D3CL 1V05A 2XXMB 5HY9B 1DLHA 2DQIH 2X89A 1IKFH 4LCIL 3GRWA 1JHLL 1EMTL 1G7LA 1UCTA 4G8FA 4YHYB 1KN4H 1HSAA 1KCRL 4DN3H 1XFPA 4PJGF 2CDFB 4EI5D 5EPMA 1FVEB 1I7TA 1OAXL 4HGWA 4WUUB 3DWTA 3RTQA 3DJ9A 4Q9BA 1QKZH 4HJJL 4RFEA 4Z5RA 1K3IA 1OGAE 5C0ND 2OR8A 2A74A 5C08E 3S96A 2PXYB 3CAFA 25C8H 3JTTA 3T0EE 1JV5B 5ACMA 2DYPB 4FQ1L 5T1KB 1LEGA 4HK3J 1OWWA 4LSTL 3M17B 3RZCA 1C16A 1SJVA 4JRYA 1I4FA 1XMWA 1VHPA 3EJYC 1AGCB 1AI1H 3R0NA 4PRPA 1RK0B 3SDDA 3VXMB 4TSCH 1RZIA 2DQHL 3LRSA 3OAYK 2EH8H 1X5IA 3M1BA 4GKSA 4MB5A 4V2BA 3CUPB 5D6DA 3MBED 4MAUL 4LRIA 3D85A 3LN5B 1T1WA 3VXSE 2G9HB 4PV9B 4DUXA 3GSNL 4X4XA 1A7QH 1IBGL 4QF1B 3EYOB 3EOBB 1RUPH 3GSVB 5HTSA 3LZFL 2P8PA 1KNOB 1GC1H 3GRWL 2GTWB 5ACZB 2Y6SC 5CAYB 1CICA 5JQ6H 1YNKL 2FJGA 3P0VL 4K7FA 5IBUG 1G84A 1PVHA 1OT2A 1BQLL 5HDQL 1T5WB 5DD0H 3BQUC 4ALAH 3OAUH 5HI4D 4MVBC 3PHQB 5ESVA 4X83A 5DD6A 5GIRB 5C9KA 3GUTB 2CK0H 5IF0A 1MJ8L 1QYGL 3ARYA 3FQTB 2XN9D 3EYVB 3P40A 3KHOA 3S37L 4KU1A 5FYLE 1BEYL 1ES0B 4UQ3A 4QXGH 1FBIH 3C6LC 4GXUM 4N0FB 4D8PA 2YR3A 4XP6H 1YECL 3ZE1F 3HNVL 3UCRA 4WFHE 1GGCH 1ZA3A 4LK4A 1MRCH 3F6LA 2F54E 4Y89A 3K8KA 4NKIH 4APQB 1UFUA 4Z7VA 3NFPA 2YEZB 3ZKND 5IVXB 4WHYG 2X1OA 1MFCH 2YSSA 4HBQA 3MJ9A 4ZO6A 2IAMB 3PWPA 3DX7B 4XNMA 4M1DL 4WFEE 4Z7UF 4KRPB 5HYIA 4MJID 2X1WL 2FGWL 2CUHA 2QADC 3GKWL 2IH3B 1EEZB 3IDUA 1E4JA 3GO1H 4JLRA 2P49B 2ITDA 4XPBH 3CVHA 2DM4A 1P1ZB 3TBVA 2OQJB 1CCZA 2DQDL 4BSJA 1T2XA 3DVNB 2IGFH 4XVJL 3OXRB 1N5YL 1PD6A 3H9SA 4LKXA 4HEME 1QACA 3QWOA 1AR1D 4H0GA 2VXVH 3OKYA 2ZOLB 2RFXB 1NLBH 1MFEH 4P5TB 4PFEA 2I07B 1J1PL 4ZO8A 3MRKB 1QBAA 4DKFH 5DGRA 4F3FB 4FP8H 3GM8A 3U7WL 1UEMA 5TPWH 1YEGL 1ZVYA 1PW3A 5AWNH 1TLKA 4P46B 4DQOH 1DJSA 4UOW0 3QEUA 3QNXA 5AZEL 1ACYL 5CP3A 1V7NH 4X6DB 5DLML 2B39A 1ZLWK 1QBLL 4I48A 1KCSL 3BT2H 3U7AA 3MXWL 5DYOB 4M8QA 3RL2B 3MJ9L 4OTXL 2VR9A 5BZWA 3CFDB 3QCVL 4P2RE 3ZYIA 2EICA 2OTUA 5EORH 5C0AE 4NT6B 1E6JH 2MSPA 1PX4A 4OF3A 1N3NA 1ZGLP 3CVHL 15C8L 4CVXB 1BECA 3G5YA 5HYJD 5GS0C 5CMAB 5KW9H 1IGCL 1UM5H 2ARJA 4XXDA 4G9FD 1F4XL 4UV4H 5E2VH 1JPSH 3BVNB 1UACL 1T0NA 3D25B 4NJAH 4PJXE 4NO3B 3L7EA 1QFUH 2UVFA 2GK2A 5FECB 1T89A 4QHUB 2LVCA 4FHBD 2FCBA 4JKMA 5D1ZD 1R3JB 1KIPB 3X17A 2LQRA 1CDHA 4HWZA 4LCWE 2PYEB 5KAQG 2YPVL 4HIXL 4NNYA 3VH8G 4JFQA 3PL6D 3VFUA 1AFVH 1UB6A 4JPVH 4POZC 1CK0H 5DJCA 1DN0B 2QHLA 5KVGH 5MENA 3MLUL 2OR9H 3VXRE 5HHOD 4Y8DC 1BQHA 1A4JB 3HE6A 1CFSB 3VDCA 5GRWA 4KHXH 4LSSL 1DQQB 3RY5A 5LCVH 5E2TH 5IB4A 4EDXA 5F89B 3SO3B 1QO3B 4GRWH 1MJ7H 2BRQA 2BHZA 3FONA 5I1DB 2H32A 3UJTL 2W65B 5B4MC 3E6FA 1MREH 5C0BE 3GSNB 5FO8A 5L8LB 2IQAA 1MOEA 5CGMA 4C83B 1I3RB 3UYPA 4X5XB 3IDMA 4Y5XB 3AS2A 3HR5B 3H0TA 4EDWL 4X6EA 4U1GC 1DLHB 1U58B 1G7LB 5ADPL 5GGTL 1RUML 4L4VA 3BHBB 4F7PB 2GITB 2UZXB 1YJDL 2FATH 2PYFA 4PRBA 5EPMB 2IF7A 1I7TB 2P8LA 3RX8A 4HGWB 3RTQB 4NN7B 3U4BL 4DOHB 4RFEB 2GTZB 3FHQA 1FRGL 2A74B 3TFKD 3QUMB 1P7KA 3IJHA 1WCQA 1JPGA 7FABH 4F8TA 3FT2B 4HHAB 3WHE1 1EFXA 1C16B 3SDAD 1NFIA 1FNAA 2ICEA 5D7SH 4JRYB 3HE7C 3ARPA 1LD9A 4XPFL 3SDDB 3O6LL 1T1XA 4FQQB 1MELA 3ILQD 4X98A 3A6BH 3TIDB 4U6TA 4RGMB 4GKSB 3MA9L 1S8DA 5DI8A 5IIEB 1I3UA 1TQCC 5MEOB 1REIA 1T1WB 2JB6A 2FX9L 1GGTA 3SBWA 2DLIA 4X4XB 1BBJA 2ZPKL 5I1CL 2VSDA 4Z0XA 2HFGH 1AC6A 1OP5K 3GMLA 5K59F 4RMWA 2DLEA 2P8PB 4LIQH 3FT3A 4XNZC 3UJIL 1NGQH 3J8F7 4KPHL 2DDQH 1CICB 4MQXC 3T0WA 3U1SH 2FJGB 4W68A 4P2QB 1GHFL 5DJ2B 4XB7A 3NTCL 3NIDE 3VGBA 1QRNE 2V5MA 5GS1A 1EJOH 5LGJA 5C07B 3ARGD 1BP3B 1NCBH 5ESVB 5DD6B 4K07A 3JV6A 1X5LA 3W81A 4ZFOL 1BHGA 1BWWA 4LPXA 1I8IB 3D2UB 4FQXD 1ZANL 4PJFA 5D93C 1NBVL 1OGAD 2V2TB 5J3HD 5C08D 4HEPG 2BFVL 5E56A 1HI6A 4DTGH 3T0ED 5K9OA 1P69B 4YWGH 1SBBA 2IPTH 3IDNA 4KKAD 3IKKA 3BPNC 1EPFA 3VG0H 1ZA3B 2HLAA 1BPVA 2BJMH 4PGCB 1L7IH 1WEJL 2WBWB 4PJ5E 1F58L 4Z7VB 1UM6L 2B7DT 3GFUA 3G9AB 5JOFA 3VH8A 5DD3H 2R0ZL 2EDEA 1OB1B 3BN9C 2NY7L 1JZ4A 5KSBA 3CDYA 4PY8I 3FRPG 4ZPVA 1QBBA 3VXSD 3PWPB 4RAUA 2E7LA 1LQSR 2DQEL 1OAUL 3WO4C 4G8GA 3ALXA 1N64L 2BVOA 5HVGB 2ITDB 2R8SL 5FO9A 5AAMA 1FAIH 2P8MB 3CVHB 3GSRA 4LNRB 2FSEA 3PGFL 1P2CA 3NN8A 2WMPA 3QG6B 1V7MH 2V5RA 3ARWA 3LN4A 3TPUB 1Q9WA 5IHZA 5DJ6B 1PKQA 3QWOB 3GHEH 4BJLA 3WFEL 4OGXL 4UT7L 4OGYH 4YAQA 5B38A 5MERA 5E6ZA 3BO8B 3MA7A 2MWCA 2VZUA 4M7LH 3O0RH 2NY1D 1WWAX 3O3BB 4OCXL 5JR1H 4ETQB 2C3XA 3HZKA 4MA7L 2EC9U 2HJFB 5IG7B 3S34L 5E8NA 5EUKA 4Y5YB 4CVZA 4P5KA 5FYLD 4KQ4H 2IANE 5HD8D 5CEXB 5E8OA 5HHQA 2D7TH 3NH7H 3VFSA 4IRJA 4YQXH 1CDBA 5IROC 3KGRA 4WFHD 3RA7L 1T04A 3D5OF 4L8BA 1FVCA 2F54D 1CIDA 5B8CA 1D5MA 5F3HA 3H42H 2JLLA 2FIRT 4KK6D 4WUKL 1BM3L 4R4BB 2X9XA 2VDPL 2YD2A 2MHAA 4G80A 5BZWB 5TGBB 3V6ZA 3DMMA 2OTUB 2FB4L 5FYJU 1MPAL 5IK3A 3SCMD 1QLEL 1O7SA 2B1AL 2F5BH 4JDZA 4M7ZC 4X4YB 1EO7A 4ORZC 1OAZL 4WFED 3FFCB 3G5YB 1UVQA 3SKMA 2JCCE 1YMME 1S7UB 3NCMA 3O9WD 4OGAD 3F65A 3CH8A 4EEEA 2ARJB 5DUMH 3DROB 4S1DD 4I0PB 4S1SH 2J3SA 4TNWK 2QHRL 2WWKT 4EOWH 5D72H 4OUUA 3SKJH 1GGBL 5GRUH 1DE4A 4KUZH 4HWZB 4PP2B 4XWOC 1N4XL 4NNYB 3QUXA 1RUKH 3MACL 4LARL 4PJIE 3VFUB 2DKUA 5I74B 4YHYC 5DJCB 4ZOAA 5E2UL 4FA8A 2EIEA 5EOQL 1LO3L 1NANH 1BQHB 3H6JA 4PJDA 4X9BA 5DJZB 4YHIA 1GIGH 3I2CH 1UH4A 4KJQC 4D9LL 1I9JL 1NLDL 4ODVH 3X3FH 4GMSL 3KYOB 1EAPB 2VDMH 1YEJL 3OQ3B 1MQKL 6FABL 5HHMB 2H32B 4EZMA 3TNNA 2VDQL 4P2RD 1QSFA 4NOFA 2QQLH 3TT3H 4EBQH 5C0AD 3HFML 3E6FB 2GCYA 4XCNA 3CSBA 5EU6A 5CWSA 2VSCA 2ICWJ 3OJVC 3U48A 4LSVH 4R8WL 2NY5C 5HYSG 3FQNA 3MXVH 3VA2C 3QJFA 3F7PC 5I17A 4I3SH 1YYLL 4GLRH 1AQDA 4QY8A 1RUQH 3SKNA 2X4OB 2Y6SD 3IAGC 1EO5A 1YEEH 4QHKJ 5FO7A 3U0PA 3FRPA 4MAYB 2PYFB 4PRBB 3U82B 5IEHA 3CMOL 3ZYOA 2P8LB 3CFJA 5TDPB 1QPPA 2Q87A 3Q5YA 1BOYA 1IVLA 1PAMA 2YRZA 4J1UB 4MVBD 2R29L 1U8QA 3GJEA 4LCWD 4N8CL 5AZ2L 5C70A 3KVQA 2EEAA 3HUJA 4HPYL 3WIFA 4IDJL 2VABA 4ZFOB 3MPCA 1JPGB 4GW1A 1PQZA 5F9AC 4HUMB 3REVB 5GGRA 1EFXB 2ICEB 4M7JH 3WE6B 2DL9A 3VXRD 3KLAA 2V7HA 2DAVA 4WI8A 5C0CE 5TF1L 4MS8C 1B0RA 4PJGE 1T1XB 1KBGH 3MROA 4X98B 4IEFB 1S5IH 4N0CC 2O26U 5DZOA 3UTSA 2IG2L 1S8DB 2J2ZA 1CIUA 2JB6B 2AI0L 4NUGH 4Z0XB 3EGSA 3IFOA 3MQIA 4HUWB 4Y19E 1G9MH 4APQC 3MLSH 4K3DH 5FV2A 5C0BD 1A7BA 2DL2A 4IS6A 1ACZA 1DUZB 5JMRA 3LS5L 2ZSWA 2QADD 2HVJA 2HN7B 4YK4C 3LKRA 2YRPA 1JGUL 2XZZA 4M3JA 5EWIL 3V5HA 1FNEA 5E4IA 5I1IH 4OM1L 4BZ1L 4Z76A 3QFJD 4N8VG 3ARDB 5GS1B 2GW5A 5CGYC 3V0VA 3Q3GA 1NFKA 2GJZA 3JV6B 3T04D 4QNPF 4UQ2A 1M7IA 1EEQA 4JY4A 4HIEA 3TV3H 1UJ3A 1QUNA 4NNXA 4FQCH 3JUZA 3QDJE 1PDKA 3EDJA 1RIUH 4OF6A 4PR5A 1HI6B 2E7HA 3S3PA 5K9OB 1FVDA 4JRXB 5BMFH 3IDNB 4R2GB 4CAGA 1I1YA 4HS3A 2HLAB 3BPCA 4LGRB 3ZDXF 5IGXH 4JFOA 1TJIL 5E00A 3MLVH 5GSVA 3PP3K 1FGVH 1J8HE 5JOFB 5DTFB 3VH8B 1J87A 3TBYA 4XP5L 1AHWA 4P46C 4OCNC 5KSBB 1AXSA 4ZPVB 4U6XB 2CMRH 3MNWB 4ODHH 2Z0BA 4ZS7H 3ARFA 3G5ZA 3MOAL 1CDCA 5I15L 4AEIH 3G04B 4GQ9H 3GSRB 3ZE1E 2H26A 4AZ8A 1P2CB 3RGHA 5IHZB 1Q9WB 4FS0A 3I50L 1ZHKA 5LVEA 2GT9A 4OLYH 5B38B 3B8SA 4TSBL 5MERB 2ITCA 3BDXA 4JFZH 3IKCA 4PJFF 1FZKB 1QRND 5D6CA 2NR6D 2FBOJ 1BFSA 2H6PA 1DBBL 2XWBB 3QH3A 2CIIA 3HZKB 1RZFL 1JN6A 4Z7UE 1NAMA 1BVZA 5HYSA 1M71B 2C3GA 3MLRH 1HKLH 5EUKB 2C1PB 1MVUA 3SGJC 4P5KB 5C8JA 3QRFM 4FFYH 5DXWA 1KTDB 4PG2C 5FGBA 1KOAA 1IQWH 3Q6GL 5KAQF 3T65A 4PIRF 2I24N 3MLTB 1KYOJ 4KJPD 4L8BB 5SX4I 1GYAA 2EYTA 2GFBA 4PJ5D 4FXKA 1P9MA 1D5MB 3CD4A 1OTUC 5ITBL 4ELMB 1KPRA 3IJYA 3NCJH 4KC3B 1T7ZA 3BZFA 2P24A 3V6ZB 4OCYL 2MHAB 4R96B 5DRNA 3KPLA 4YHMH 4HK3N 4OV6F 1UXWA 1VDGA 3PV6B 2VERN 3U0WL 5C2UB 3ZTJH 4JG1H 4M1GH 4JDZB 5ACLA 3S7GA 2FX7L 3ARSA 1UVQB 1X5XA 3SKMB 4ZTPL 2HFFA 2HP4A 3EYFB 5FXCH 3GK8L 3QO1B 3G5VB 5DS8B 4N0RA 1QSVA 2A6JA 1H5BA 2G5BA 5HYEA 2UYLA 2X1PA 1NPUA 4HWUA 4NFCA 1HQ4B 3BISA 5DQ9A 1A6UH 4N8PA 2XZQH 3IXTA 1HH9A 1Q8MA 3P9LA 4OUUB 2EDTA 5IR1A 4Y5XC 1OWRM 1Q94B 4C54A 3IU3B 1RQ5A 2APTA 2MKLC 3QUYD 5IQ9A 1NL0H 1MRFL 4TRPH 3IGAB 4WY7H 3QIUB 1WZKA 4FABL 3BKMH 4QHMB 1XR9A 4XP9H 4LSDA 1UADC 3MSPA 3BPLB 4J3OC 5DJ8A 4N8VA 2IAND 3RTQC 5I8KH 4NN7C 2VR5A 1YEDA 4KMTL 4PJDB 1QOKA 5EO0B 1VFOA 1FFNB 4YHIB 3HE7D 3WN5A 1KFAL 1VERA 2DKSA 3L7FA 1YQVL 4AQOA 3MRNB 4KDVA 3O11A 3MCG1 3MYJB 1DBKL 2RGSA 5D1XB 4AEFA 3HRZA 2Y07H 5DC9B 3LRGA 3RZCC 2J8UA 2P43B 1QSFB 3GJFH 3QDHA 4NQCA 3N1GC 1P6AB 4NZTL 3VRIA 2UV3A 2GCYB 1WICA 3WNNA 4HXAL 3SDDC 5EU6B 1JMXA 5CWSB 5FYLH 3KR3H 2XRAL 5E1AB 5T3ZE 5KANI 2W9DH 2AKRA 1T20B 4PB0H 5D6DC 1YMMD 4KKBC 4LRIC 1YEKL 2F8XC 1QLFA 1AD9B 3MLYH 5ID0B 1E4XH 1DLFH 4QY8B 4U31A 3V52L 5CD3B 5HYQA 2F58L 4MQXD 4CMMA 3FZUC 5FO7B 5ENWA 4K23H 3ME0A 1B2WH 3EJJX 4OD3L 5D4QA 5IEHB 4Z8FL 3EFFA 3CFJB 4KZDL 3G08B 4P48A 1JL8A 3QXWA 4UBDD 3QXAB 3P4NB 2APBA 5E9DA 2F53E 1U8QB 3GJEB 1CICC 2C4XA 3R06B 3HUJB 1KIUA 3SQBA 3OJDB 1QQDA 2EH7L 5F7HA 1PLGL 4GW1B 1PQZB 4Y16A 3D0LA 1RFDL 4H26A 2EEBA 3KWWB 3WNMA 3QISA 1C08A 3DYOA 3KLAB 3O6ML 4X7SH 4L4TA 5KVEH 5FYJL 1B0RB 4XBGA 4GKZA 5C0DA 4ODXA 2BNQE 4LVEA 2Q3AA 4WCYH 2C26A 4NKQB 3DSNA 1NCCL 2XTJB 4C56A 5F9WB 1A3RL 1IFHH 4LSRH 4S11A 4MYWB 5IJKA 1LE5A 1SEQL 1HIMH 1R3LA 5BVPH 2RCSL 3IFOB 3V5DA 1LGVA 2CRYA 4J23A 4JHAH 1ORQB 4Q6YA 3DSFH 1CU4L 3DI3B 1P84J 4IS6B 3RRQA 1MF2H 3L1OH 3LKRB 1U8JA 8FABA 5C0IA 4HT1H 3V5HB 1FNEB 5CJXC 2DQJL 2ICES 1ZLVH 1VA9A 2WLYA 1MHPL 5I8CB 2Z8RA 5T1LA 3V0VB 1WIUA 1FN4B 2O5XH 4OZIA 4TYUA 5GGVY 1K8IA 2HH0L 4X0KB 4DCQA 2XT1B 4UQ2B 5I1KH 4JY4B 5CBEA 5EA0L 5EH1A 5K59E 1R5IA 1NMBH 1JBJA 4XT1C 2DQCL 1X5AA 1KN2H 1LO2H 1FVDB 4LPVA 3PDOA 2FX8H 3OAZH 4U7KA 4HS3B 2BY0A 4ZS6C 3BPCB 3MUZ1 3DURA 4N1CA 2VXTL 4YDVA 3QXVA 1EXUB 5E00B 1FDLH 5GRYA 5C0CD 4NO0D 4GRLB 3VE0A 1J5OL 1CLOL 3TBYB 1AHWB 2VC2L 4YC2B 1AXSB 4P3DA 4PJ9D 2Z9TA 2NZ9C 4NKMB 4R7NB 1BZ9A 1CF8H 3DX8A 4ZDHA 3WJLA 1OCWL 1S9VA 4GAYB 3ARFB 4PRPE 4Y19D 1VKXA 2NY3D 3MRHA 1TVBB 1KTRL 1LP9A 2DJUA 2DQIL 3BZ4A 4MNHA 1A2YA 1IKFL 2I60H 2Y7QB 2NX5A 4R3SB 4YHPA 1KN4L 3CFIC 4DN3L 2NY4C 4PRNB 1ZHKB 4ZG1A 5CIPB 2FIKB 5FHBH 2NY0B 3S3JA 1IGTA 1OAKH 2VDLH 3K74B 2WP3O 5D6CB 5E0QA 2DWEA 4JHBA 1QKZL 3VXUA 4WGVB 3QH3B 3MGAA 4FOMA 1BGXH 25C8L 3AMLA 3D39A 1I3GH 4XWOD 1RZ7H 4M1CD 3LS4H 3QDJD 4Y4FA 4ZUVA 2P5EB 4QRPA 1FCGA 1T89C 4TSCL 4P4RA 1IAKA 3PHOB 2ZCHH 3DVGA 1GRWA 3UDWA 2EH8L 4Q9RH 2EYTB 2GFBB 1I9IL 3KDMA 4FXKB 4U7MA 4RA3A 2BY1A 5I74C 1KPRB 1UCBH 1WISA 3BRFA 4ZUWB 4RZCA 1J8HD 2YUXA 4YBLB 3BZFB 3QDGE 4KJQD 4O4YH 1A7QL 2FWOA 4R90H 1RUPL 4MSWA 4ACPA 5A16A 5K9KA 4X99A 3HE6C 1DBMH 1NBYA 4HV8B 1ZT7A 4F7MA 1GC1L 1D9KA 2E6PA 5I1GH 1ADQH 3PABA 2HFFB 3DV6B 4MZ3A 3TNMA 1CFVH 5JQ6L 1XH3A 4YFLF 3S88H 2ZP0T 1H5BB 2G5BB 4JGUA 2Q7YB 2UYLB 3BEWA 4JY5L 1KJVB 5DD0L 4ALAL 1WZ1H 3OAUL 3PWUA 3PWPE 3C8DA 1H3PH 3IXTB 3SKOA 4GBXD 5EC1A 3P9LB 4NWUH 4O2CA 3MRLA 3N50A 5IR1B 2CK0L 1Q9KA 4HK0A 2X4QB 5IQ9B 3CC5B 3LY6A 4QTIH 4QT5A 4KWUA 3FOLB 4QXGL 3CCHA 1FBIL 4NQDB 3H9SE 1IAOB 5HVHB 2WIMA 4XP6L 4UNVA 1GGCL 1Y0LB 5DJ8B 1MRCL 1XGQB 4N8VB 4DGYH 1TZGH 3AUVA 4NKIL 2G60H 3WFBH 1YEDB 4H25A 4JFPA 1HZHH 1RHHA 2V2WA 1MFCL 2CRMA 1JRHI 4MS8D 2BOCA 3O11B 4MD4A 3MV7A 3VWKA 4YHLH 4JR9H 4N0CD 5E03A 4HKXA 2J8UB 1K5NA 1HINH 2DI9A 4WHDA 5BW7A 3GO1L 4XPBL 5JO5A 5GJSH 3KHQA 1V3LA 2XTLA 4YDKH 1XZ0B 2ICWI 4ZOEA 4N0UA 3RP1A 2IGFL 1I8MA 4Q9QH 1QLFB 2Y5EA 3PWNA 3SBWC 4FZ8H 4NHUB 2VXVL 3EKCA 1C8PA 5HYQB 1I8LA 3DO7A 1NLBL 1MFEL 2ZOKB 5ENWB 4X80H 3P9WB 4XBPA 4QHKI 2Z93A 1Z0NA 4EN3A 2VUYA 4G6AC 2E7BA 1FZMA 2AGJH 4CJ0A 4DKFL 3K46A 2Q6WB 5J6HA 3I3EA 2NTSP 5I16A 4FP8L 5TPWL 3WL9B 4DW2H 5AWNL 4LHUD 4EVNA 1DEEA 3HC3H 4DQOL 4GW4B 3ECBB 4Y16B 1CZ8H 4H26B 1GAFH 5GS1C 2CSPA 1CQKA 1QZ1A 1V7NL 4OZHF 3B9DA 2N4IA 1X5HA 3FN0H 1CD1A 3VFMB 3D18A 3HA0A 3BT2L 5GJTH 4L4TB 4N5EC 4XBGB 3FRUA 5C0DB 1U3ZA 1KG0A 5FKPA 4ODXB 2YPLD 4C56B 5EORL 2VH5H 4KROB 3S35H 3FOMA 2RB8A 1U2CA 3T4YA 5MENE 2G75B 4R2GC 1LE5B 4P46D 5L8KB 2P5WB 1R3LB 4OBSA 3V5DB 1U8OB 4PLJC 1IAIH 3E6HA 4WHTB 5KW9L 1HWGB 4G6KH 1UM5L 4UV4L 5E2VL 1JPSL 3ULSA 4XXCA 5T3ZD 1F4WH 1UM4H 4C4KT 8FABB 5C0IB 4NJAL 5GSRA 3BOVA 5HHME 1AIFA 5L6YH 2K3TA 4LLAA 1QFUL 2E7LC 3PGDB 1GZQA 2EDXA 3SGKA 5CJBA 4KTDH 4U1KA 3P9MA 5T1LB 1R6VA 4OZIB 1K8IB 3STZA 4DCQB 1AFVL 5FIEA 4JPVL 1R5IB 1CK0L 1YN6A 2F53D 2VYRE 5KVGL 2OR9L 4L4VE 3PDOB 2EE9A 4IMLB 5GZNC 2PTVA 1AGDA 5HDBF 4KHXL 5LCVL 5E2TL 5FV1L 4PGEA 1MJ7L 4KKLD 4UAOC 2WZPD 3N06B 2BNQD 4FXLA 3RWJA 4QNPE 1OTUD 1RK1A 3PNWA 4F7EA 1FFPA 4MXWH 1MREL 2QR0B 3G6AA 5H8DA 3LOWA 1K85A 4IRJC 3DX8B 5DRZA 4ZDHB 1XCQA 2WANA 3WCYA 1ZHNA 4HKBB 1VKXB 5FGCB 5B8CC 3MRHB 4GXVH 1FNGA 3WJJA 3QEQB 4UIMA 3H8NA 3N1QC 3BZ4B 4MNHB 4RFNC 1A2YB 5SWSA 2YA2A 3ZDXE 4N9OB 2NX5B 4ZSOA 3HI6H 1NSNH 3DMMC 4UTAH 5CZKA 2FATL 4JO4H 1WFNA 3WXWH 4OZIF 1OPGH 3VI4F 2AS5M 4QCIA 3ARBA 2YD8A 5F3BA 4NWTH 5IB5A 3ZKSD 1UWXH 1IGTB 4NHCH 1D7FA 3VXUB 5D7JB 1XIWA 3ULVF 5GGSB 3VW3H 5T33H 4Y88A 3RL1A 3KPQA 4R4FH 2D2OA 2BVQB 5TDOA 7FABL 5C71A 3MNVA 2VLRE 4Y4FB 5D7SL 4ZUVB 1H9VA 3WUZA 3CX2A 3MV9A 5DK2A 3QHZH 4QOKB 1IAKB 5EC2B 3TGXA 3A6BL 3UC0H 3QUXC 1I1AB 1TFHA 1VFAA 1FIGH 2JIXB 4PJFE 4TULH 4FNLH 3FQWB 4RZCB 4NRYA 3BPLC 2HFGL 2FWOB 1F5WA 1FZOA 5LXGH 4MSWB 1AGFA 1LP9F 1QEWB 4X99B 2L0DA 2YKLH 3LRHA 3RZCD 4ODUA 5JHLH 1NBYB 4LIQL 2VLME 2UZYB 1DP0A 1SEBA 2AW2A 1FO0B 3IB4A 1NGQL 3PABB 4PRPD 3TNMB 3MRGA 2DDQL 1CXIA 4GG8B 1XH3B 3U1SL 2L7UA 4O2EA 3BEWB 2Z31B 5I2IB 3QFDA 4KKBD 2WUBH 5EN2A 1EJOL 3D85D 3VD9A 1NCBL 3CPLA 3SKOB 5EC1B 4O2CB 3MBEA 1TZHA 4G8GE 3F12A 3FZUD 2VJXA 1ED3B 2N56A 4HK0B 4MNGE 3FB7A 4DTGL 3CCHB 4XPAH 5KSVA 5F7UA 4YWGL 2J6EH 2IPTL 1YPZB 1IC7H 4G8EB 1PKQE 4Y0GA 3VG0L 4KZEH 2BJML 5KANG 3VFRA 4X8JA 2PW1A 5INDA 2AXJA 3F62A 4CJ1A 3H9ZA 4JFPB 1GH7A 2W59A 3JWNC 1RHHB 3FO9B 5DD3L 2V2WB 4WI9A 3MREB 1DQDH 3EYSH 5F7YC 5HGHA 4DGIH 5I1JH 1A6VH 2BOCB 4K9EH 4MD4B 3VWKB 4M03A 4PJCB 4OF7A 3QSKB 3QDGD 5AYQA 4XPHH 4HKXB 1K5NB 3CX5J 4Y1AA 3F5WA 3FQRA 1F8TH 1AGEA 2R4RH 1YEFH 1FAIL 3OHXA 5ALCH 2IFGA 1MCNA 2R2BA 4N0UB 2XTJC 1V7ML 3W9EA 5HHXH 1CDJA 1IAII 1N7MH 1I8MB 5F9WC 2J4WH 4AIZB 4G7YH 3EOTH 4H0IA 4OGYL 2H45A 1INEL 4FFZH 3MJ6A 4RMQA 2FO1A 5JDSA 1HOCB 4M7LL 4XBPB 3O0RL 3DUHA 3PWPD 2WQRA 4EN3B 3U6RA 7CGTA 3EIFA 5JR1L 1MCLA 2PN5A 2CXKA 5J6HB 3X3GH 1N2RB 1P7HL 1T4KB 4PP1C 3RKPA 4EVNB 3JZ7A 3RWCA 5EO9B 3IJSA 4KQ4L 1FIEA 4ONHA 2KUTA 3A6OA 4U0RB 3T0BA 1KPUA 1J10A 2D7TL 3UP1A 3VMNA 3V7MA 3H9SD 3NH7L 4YQXL 1E6OH 2AXGA 5H37G 3IETB 1M05B 1QD0A 4H1LB 4L1HA 4ZS6D 1UJ3C 3H42L 1JPST 5IBLD 5TH2B 3FRUB 1KG0B 2ZKHH 3NCYS 1HHIA 3ESUF 4GRWB 4LFHG 3PGCA 4NQSA 1CT8B 2QTEA 3BP4A 3EO9H 1RIHH 4RMVA 1LDPH 2J8HA 2F5BL 3IF1A 4JEGB 5CZVH 5EZJA 2BMKB 1KPVA 2NZ9D 4CKVX 1CGYA 4TN9A 1QLRA 4DAGH 3VRJA 1BF2A 2OTPA 2P45B 1GCFA 5DUML 3U46B 3ULSB 4S1SL 4ORGA 1AHWC 1AQKH 5GSRB 2BNUB 4PJBF 5I1AB 3I02B 4EOWL 5D72L 1QSEB 2Q8BH 4G8IA 3BUTA 1GZQB 3SKJL 5J6GA 5GRUL 4KUZL 3DETC 2NY4D 4U1KB 3MLPA 2X7LB 1ZGLA 4CNIB 2A2QT 4HFWA 1RUKL 3RUGA 5GGUB 3STZB 4WDIB 1ZE3C 3BIKB 2C1OA 4I2XA 5MEPA 1J0KA 2XKUA 1FL6B 1IJ9A 2HFTA 5HYJA 4G9DA 3W0WE 2NY0C 5ILTH 2APXA 2VDOH 3A6CH 2YA0A 1RUAH 4G9FA 1GIGL 3I2CL 2E7CA 4ODVL 4RIRA 4M5ZH 2VDML 5IEKA 5L8JB 4XX1G 4DWHA 5D1ZA 3RWJB 4EBQL 3G9VA 2QQLL 1U6AH 3TT3L 4JCLA 3PNWB 4F7EB 5FGBC 1FFPB 4S1RH 3JWOH 5FYKD 3W39A 3G6AB 5MEND 1XGPA 4Y4KA 3EZ8A 3R8BB 1XCQB 3VXTA 1ZHNB 3V4PH 4M6OH 4LSVL 4LPCA 5IV2B 1AO7A 2EDYA 3I75B 4NGHH 4P5MA 5F93C 3MXVL 1ZHLB 3HE6D 3L3IB 1P9MC 1FNGB 1GOHA 2VL5A 4UIMB 4I3SL 3KXFA 2R23B 1QHPA 5SWSB 3PIQA 1RUQL 4YBLC 1XF1A 4UT9H 3UTSE 4ZSOB 1G7QB 1YEEL 1MHCB 2DM2A 4QCIB 5HHMD 4D0CB 5F3BB 5IB5B 1VSCA 5DMKA 4WI5A 1IGJB 5I73B 2W0PA 2OXHA 1JNNH 3U36A 3UTZA 3NCEB 1J9CT 4R7DB 5E4EB 3DVFA 1XF5A 1PYWB 2B5IB 3KPQB 5KSAA 1H5BC 5TDOB 4ZUUA 1LK2A 5DDHB 1I7RA 1Z9LA 4F80A 1D3CA 4M7JL 3NA9H 1K4CB 5T3ZH 4YHNA 5AAWA 4L4VD 5FA3A 5DO2C 1Q9LA 5DK2B 4BM7A 3R8QA 3SE9H 1KBGL 1WZMA 2D31B 5K9QI 4RMTA 1FL5A 4MXQC 4GG6B 1JE6A 1EIBA 1S5IL 5E5MA 4OFYD 4EI5B 2Y72A 1WBXA 2ADJB 3C5ZA 1FFOB 2V6HA 2HJKA 5HVHC 4NUGL 3Q2CA 4NRYB 4ZO7A 5E99H 5INCB 3RY6A 5ESQB 1W72H 1FZOB 1G9ML 3O4LA 1QR4A 2YN5A 1EFXD 3MLSL 2EDBA 4K3DL 5F96H 1A47A 3VGHA 3WN5C 1SEBB 2R9HC 4TVSa 3VD7A 1DSFH 3SDAA 3BWAA 1QVOA 2GJ6E 5I1IL 2ZZUT 2YOCA 3VDBA 3VA6A 3QFDB 5I9QC 5L2KA 4Y5VA 2PTUA 3FMGH 3REWB 3CPLB 3VGGA 3CJJA 3JTSA 3MBEB 1TZHB 5IFJA 3TV3L 3ILPA 3GSWA 4FQCL 1SMOA 1LEIA 3MUY1 1RIUL 4V2CB 2VZ1A 3FB7B 3U0TA 1ERNA 3Q6FA 3TH4T 1YC8A 4QRQB 4P3WA 4TNVF 1F3RB 2A0LC 1RVFH 5BMFL 3BPOC 3QDMA 2VLRD 2Z91A 1C5BH 3VFRB 4X8JB 5TDNB 5IGXL 5CLWA 3GBMH 3MLVL 1HHGA 1FGVL 5FGRA 3IFLH 1XGTA 2AVGA 4N0YH 5FOBA 5E8EA 5C86A 2OS7A 1JGDA 1DDHA 5F71A 1U0QA 4N5ED 3U9UA 3VG9B 5HI3C 1FFRA 4NC0B 4Y16C 5I75B 5FF6B 3L9RA 2CMRL 4ODHL 1II4E 4ZS7L 4FQXA 4Y1AB 4M7LT 5CILH 2XN9B 3F5WB 3FQRB 2BSSB 1OGAA 1VGKB 2EYRB 3GJFK 5C08A 3OHXB 1JGEB 2VLMD 4PLJD 1R3HA 3TYFA 4F15B 5ID1A 1XF4B 2YC1A 3C2SA 3Q1SH 4OLYL 1WTGT 5IJKC 4BSWA 3LEXA 3RY4A 4JFZL 3B43A 1X3DA 4O58H 3HC0B 4K71B 3U6RB 1T7WA 1UB5A 2DI8A 2FJFA 4CL7A 1D5BA 1DANU 4G8GD 1CTNA 1KJMA 2CDGB 2Z8VC 3MLRL 1HKLL 2EDFA 1FP5A 4WTZA 3RWCB 2XWTA 4U1NA 4MJIB 1A5FH 3V95A 3HZMB 1IQWL 3LEVH 1RI8A 3F7VB 2ZUXA 4P57A 2Y06H 4OUOA 3HHRB 5GZND 4UINH 3S98A 2FR4A 3NCJL 1ZTXH 4ONGH 4UNTA 1HHIB 4YHML 2VAJA 3PGCB 3I3DA 4NQSB 1U8HA 3BP4B 4JZNB 1WAAA 2X4NB 3IDYB 2AXFB 1NCAH 2C5DC 1S7RA 4JG1L 4M1GL 2D3VA 4W70A 1NFDA 3H9HB 2LAAA 5EZJB 2LU7A 4AENB 3ET9F 1JZ6A 4IRJD 3RPIA 4F33B 5JHDD 4OZHE 3BZEA 4ORGB 3ZKXC 5FYJE 4UU9A 5I1LA 1KLUA 5E6YA 3CFCH 1A6UL 2XZQL 3ZHLA 4S0SD 4G8IB 3UPRA 3WJLC 4Z7NF 4NQCE 3DMMD 5J6GB 2WUCH 3CIQA 3E8UH 5EIIA 5DD1H 3SHSA 4WO4A 1SJHA 3VWJA 4PG9A 5DEGA 1ZLVK 5HGDA 3WO3B 4HFWB 1NL0L 3RUGB 4JZOB 1GC1C 3V6FA 2IMMA 4WY7L 1F6AA 1NUFA 3BKML 3CXHK 2CUMA 4OCRH 4XP9L 2AP2A 3S35X 5HYJB 1ZT1B 5ADOH 4G9DB 1G6RH 1HHKB 3O9WA 5I8KL 2W9LA 4JFYA 4JVUA 5CEYA 4G9FB 1N8ZB 3MV11 3OAZK 1KXTB 1T5XB 5E9DE 3AAZA 4RIRB 5IEKB 1K2DA 3QUXD 2B0SH 1VEMA 2Y07L 3IXAA 4N9GA 2YBRA 4Y4FC 5D1ZB 4O5LH 3GSOB 2ZUYA 4J3WA 1Y6MR 5EDXA 4TUOB 4X7EC 3W39B 4MX7A 1XGPB 5FYLL 3KR3L 5J56B 2ICWA 2OP4H 3UDWC 1MI5A 2W9DL 4PB0L 4YPGA 1G6VK 2VL5B 3MLYL 4GUPA 1E4XL 1SJXA 1W0WA 5HDBE 4OV5A 3PIQB 1DLFL 4C56E 4FZEH 1HCFX 4IOIB 4K23L 5E94B 1B2WL 2QKIA 1FV1A 1FZJA 2EO1A 3EYQC 4XNXH 3S4SB 2E6QA 4PJ7F 5E6IA 4AG4H 5MEQA 5DMKB 1B90A 3GI8H 1D9KC 1Z0MA 4NQUA 2PR4H 3KAAA 3U36B 2Q8AH 3NMEA 3ISWA 4IDLA 5E8PA 1I7RB 4HXBH 5B39G 4PYHA 3W0WD 4YHNB 5FA3B 4X7SL 2V9TA 5D1QD 5KVEL 2A77H 2W07A 4YNYA 3ZO0A 4OZIE 3VI4E 1A7NH 1FL5B 4X6CF 4HCRH 3JV0A 4WCYL 2HMIC 5E5MB 4RCAA 1F3JB 1IFHL 4LSRL 4PJXA 3C5ZB 2OR7A 4BFGA 3ULVE 1NCDH 2LU3A 4C55A 1HIML 5BVPL 3LKOA 2A38A 2O93L 1NMCB 4JHAL 3EO0A 3DSFL 5C0RH 2QQQA 4DJMA 2E8ZA 1MIEH 1MF2L 3VXQB 3OKOB 5D7LA 3L1OL 4XHJC 2AV1A 3IDXH 4RWHA 3BD4A 1YY8B 4HT1L 2Y25A 3SDAB 1H8OA 5MHSE 2BERA 4ZNCD 3VWKC 1A7OH 1M7DA 3LQZB 3GBNH 3UTSD 4KRLB 5L2KB 4WNQA 4OZGB 1F3DJ 4Y5VB 2X40A 4U1IA 2O5XL 5BW7C 5KS9A 2VZVA 4LEXH 4GKNA 4WWKA 4Z0BH 5IFJB 4WV1B 5I1KL 1HHJA 3ILPB 1LWRA 1PSKH 3GSWB 1C12B 4Z7WB 4WW1A 5FYKH 1LP9E 4KKCC 1NMBL 4DGVH 1VENA 2F5AH 1KN2L 2JK5A 3U0TB 3Q6FB 2NX5E 1X4YA 1SVZA 4M6NH 1LO2L 1NC4A 4PP1D 3RNKA 2FX8L 4P9MH 1I8LC 3NPZB 1CE6A 4TVPH 3ROOA 5JW3H 3QZWG 4GS7B 4EN3C 3IDGA 3O3AA 1BZQK 2BP3A 1FDLL 5CJQH 3VXOB 1XGTB 3E2HB 1K8DA 2FL5A 3QFJA 2OMBA 5FOBB 3D39E 1DDHB 1XF2A 4RAVB 5J89A 4OM0H 4NZUH 5F7KC 1OARH 2DF3A 3ARGB 3CGTA 3U9UB 4BQCA 1F13A 3D69A 5J06A 1CF8L 1WCBB 1UKSA 2AJVH 2Z92A 4QRPE 4FQXB 4LOUC 1EBPA 2ADFH 1OGAB 2RIKA 4WHYH 2YD3A 5C08B 3WIIH 1IZJA 3SE8H 3T0EB 4DK3A 1ADQA 2I60L 3EOAB 5ID1B 3TYFB 3CLEH 2H2PC 1G7HA 1T2QH 3KJ4B 1MFDH 5FHBL 4NC2B 2GJ6D 3DI2B 3U30C 4E0RA 1DFBH 1OAKL 2VDLL 4JRWA 1M1SA 1KXVC 3DYPA 4QLRA 4JGMA 1JZ2A 3NGBC 1BGXL 1UB5B 2FJFB 3DETD 1D5BB 3QXUA 3WBDA 1UQSA 1KJMB 1PFCA 1I3GL 4PGZA 4XXCC 1TPXB 3O4OB 1RZ7L 4JO3H 3VXSB 2LFGA 3L6FA 1IEBA 3LS4L 2XWTB 4KK9C 5FFLA 5H35A 5L7XL 4U1NB 9CGTA 3IFNH 3HNTH 2X4PA 4NRXB 5E7BA 3SGKC 1A6WH 4KY1H 5GRZA 3VRLF 3GMRA 2WWKO 3ARRA 4PRHA 1KIRA 2NW2A 3FT4A 5HPMA 4Q9RL 2BK8A 1G7PA 3LSOA 3X13B 2X9YA 3TBSB 4XMPH 1UCBL 2FR4B 3HAEG 4O4YL 4XPTH 2BVEA 1QRNA 1CLYH 1NEZG 2X4RA 4A6YH 4R90L 4ZFFB 1IQDB 1U8HB 4ZOBA 1KJ2A 4Z78A 1DBML 1S7RB 2OLDA 3MV01 3NCCB 2HLFC 2I25N 3GJFB 5I1GL 1R5WA 1ADQL 3B3IA 1CFVL 5DRWA 3S88L 3U4EA 3WFCH 2VE6A 1OF2A 4UU9B 5I1LB 3MV7E 1KLUB 1WZ1L 1TVHA 4EUPG 1H3PL 1ZVSB 2F74A 4PJ5A 5ITFA 5HJ3A 4NWUL 3KLDA 5EIIB 2Q1EA 3CK0L 1SQ2N 5JUEH 2D9QB 5DEGB 3VWJB 4AJ0A 4LGSB 3WJJC 4LLMB 3D1MC 4QTIL 4JFDA 3V6FB 4EXKA 4N0UE 3SCMB 1FORH 3IT8D 1QBMH 1MNUH 5IMMB 4NO5A 2O5ZH 3ARBC 2OJEA 1OSZA 4DGYL 3KPOA 4CGTA 3O9WB 1TZGL 4J8RB 2G60L 3WFBL 5I18H 4Q58C 5I19H 3W11D 2IMNA 1HZHL 5I73C 4PJBE 3X11A 4HKZB 1XIWC 2YD6A 4R0LA 3ZHKA 5DO2D 4ENEC 4KJWC 5E24E 1WAAF 2BSRB 1K2DB 1DVFA 2OCFD 1NBZA 4MXQD 1NFDF 4YHLL 4JR9L 2YBRB 4Z7QF 1HINL 4HH9B 3PDGA 1GOFA 1QTYT 3QUYA 1X4XA 2GSGA 5DHYA 4LASH 5GJSL 1T6WA 5DJYA 3DV4A 4YDKL 4RQQB 1P84K 3BP7A 5EOCJ 4Q9QL 3BIBX 4OFIA 1LILA 4FFWC 5BQ7B 1W0WB 2C3VA 4PY7B 4FZ8L 5EBWA 1NKRA 3AB0B 2AJZA 3FL7A 1T66D 5FYJD 1NUNB 3D3VA 4XTRC 4X80L 1Y18B 5K9QG 5ICZB 4HF5H 3K7UA 2GI7A 4PJEA 1E28A 4MDIA 5MEQB 2AGJL 3TBTB 5SV4A 1Q1JH 1CL7I 4NQCD 3TYGH 2Y5TA 2AJXH 1UWXK 2O61B 2ICCA 4M61A 4DW2L 5BS0E 3HC3L 3CU7A 4P2RB 3OR7A 5C0AB 2EIZA 5HHPA 4KK5D 3QUKA 1TTFA 1CZ8L 1GAFL 2AK1H 5E8PB 1T1YB 1XR8A 4OQTH 1R0AH 4QRUB 3P0GB 1IEHA 3FN0L 1JK8A 2A0LD 5LGHH 2JCCA 1IM3A 3MBEC 1YMMA 1SMAA 5GJTL 4HWEH 4ZXBA 5BV7C 3UBXG 3S36H 1AJ7H 3QQ4A 4DN4H 4XCCH 2OMNA 2VH5L 5E9DD 3C6SA 3MLWH 3S35L 4PJXB 3GB7A 2XFXA 5F1SA 4AIXA 2VLJA 4S2SA 4L8CB 1TJHH 4FRWA 3MRCA 5HI3D 1IAIL 1EJ6A 1JF1B 3RX5A 2FEEI 3EO0B 4LCWB 4G6KL 1I1RA 5D96C 5IHBA 3MJ7A 2AV1B 1F4WL 1UM4L 2FNBA 3KLSA 3RNQA 5L6YL 3B5HA 3VXRB 1U8KA 5GQBA 4ZNEA 5I75C 3MRJA 4XZUA 3WNPA 3BW9A 4IRSA 1NEZA 2KH2B 4C56D 1C7SA 3QQNA 2Y4SA 4KTDL 4U1IB 4HQQH 4D0DA 5F7DB 4GKNB 4WU7B 3TO4A 1HHJB 2N1KA 4WW1B 4LIQE 5FA4A 5SWSE 3C9NA 2JK5B 2YXMA 5A2IH 4NKDA 3CZJA 5B21A 4KDWA 5F9OH 1GZPA 4ZSOE 5C0BB 3ZKNC 1CE6B 4EUPA 1I8KB 4JJ5B 1OAYH 2PO6A 5DJ0A 2DIJA 3O3AB 2YUWA 4OZ4A 3P73A 5T1LD 1K8DB 2FL5B 3QFJB 4XRCA 4H0HB 2WIIB 4CMHB 4EKXA 5SWZA 4LAJH 5EO1A 3W82A 4MXWL 4YPJA 3KYMB 3P0YH 4NZDA 3ULVD 3TIEA 1A8JH 5FDWB 3MV9E 5EZOH 4GXVL 2CKBH 3KPMA 4KV5F 4NZRH 5C0EB 3Q5TA 3Q48A 4NYLA 3HI6L 1NSNL 4UTAL 4JO4L 3WXWL 3DIFB 1G7HB 1OPGL 5KS9F 3IDYC 5MHSD 4NWTL 2PF6A 5BRZE 3KPPA 3MCKA 4NO0A 3S5LG 4NHCL 2ORBH 4NNPH 2P4AB 4GOSA 4OCWH 2VIRA 1F97A 4QXUH 2BZDA 2WNGA 3VW3L 4NFDA 5T33L 2YRLA 4JKLA 1SJEB 4R4FL 3WLBB 1UQSB 5EUOA 4PJ9A 3TP4A 2PKDA 3OKEA 4ESKA 1X5FA 2UZIH 3L6FB 5A43C 3GMQA 2BC4B 4HUXA 1ZT4A 2EIBA 2J6EA 2NX5D 2X4PB 1V8HA 3MRRA 2BHUA 4Y4HA 4UDUB 3QHZL 3GMRB 4PRHB 4RISH 1KIRB 3FT4B 5HPMB 5I30H 3R0MA 3UC0L 5CJ5A 3LSOB 5CKGA 1NCUA 2R2HA 1FIGL 4PB9H 1S7WA 4TULL 1EUUA 4FNLL 2A6IA 1BFOB 1QRNB 3D39D 5LXGL 4Z78B 2YKLL 4PRAB 5JHLL 3GMOA 2MOVA 4HD9A 3ZYZA 1QFWI 2HJLB 4QRPD 4LLYB 1ZSDA 3KPNA 3QDJA 2XKNA 4MB4A 3UBXA 2VAAA 1CGTA 1JHTB 1DUYA 2MCPH 3AREA 1CFQA 2VE6B 4J3VA 5D1ZC 2WUBL 1ORSB 2IALB 3FO0H 1TVHB 1PZ5A 5CJOH 1V3KA 4LCYA 3NIFF 4PJ5B 5I8EA 2ZUQB 4Y1AE 4Y4KC 4QYOB 4OCSH 3EYQD 3RWFA 4JQXA 1ZAGA 1CD0A 4HIJA 3EHBC 2OSLA 3HMXH 4Q97A 5J8OA 5JPMA 1D9KD 4X7CC 1S9YA 4KTEH 4XPAL 2J6EL 2QQNH 3LIZH 1IC7L 2X70A 5JW4M 4NO5B 4KZEL 3EUUA 3LPWA 3KPOB 4FXGB 3C08H 2P1YA 3OTTA 3BXNA 1MAMH 4B50A 4R0LB 1WIPA 3SJVA 1DQDL 1YNLH 4U1GB 3NFNA 3EYSL 4Z7NE 5KSAC 3PQYA 4DGIL 2HA1A 5I1JL 1A6VL 2J88H 5KG9A 4K9EL 3ARZA 5JLZA 1HNGA 1NBZB 4GBXA 2HMID 4XPHL 2XNAA 2DTSA 4MJ5A 4LCCA 1F8TL 3QUYB 2R4RL 2C7UA 1W0VA 1YEFL 3RI5K 5DHYB 3BSZH 4TSAH 5ALCL 2PETA 2CJUH 2AJ3B 1QP1A 1CLZH 3EFDH 3MZGB 1INDH 4WI3A 3BJ91 3DRTA 1JNLH 5HHXL 1N7ML 1FAKT 2P42B 2J4WL 1BJMA 5ETUA 1IMHC 3C5ZC 4G7YL 3EOTL 4XHJD 2IANB 5EBWB 4Y2DA 1EUTA 4FFZL 3RY6C 1LNUA 3HE7B 3MV7D 4HAFA 4L1DA 1NDMA 4AIOA 3FQXB 4PJEB 1E28B 3GMPA 1MEXH 3V6OA 1J11A 1NAMH 3PWLA 4MNQA 4LF3A 3X3GL 5A40E 3SDAC 1OAQH 5C9JA 5CSZA 1T03H 1TQCB 3STBA 2NLJA 3EDEA 2DTMH 3QUKB 4KKCD 3LCYA 1C7TA 1XR8B 4Y5VC 1E6OL 3QULB 5C09A 2AV7A 3A67H 2JCCB 3S5LA 1TNMA 1IM3B 1YMMB 1N6VA 4ZXBB 1WVZA 4NOBA 4XNZB 4R6UA 4U3XA 5J9PA 1LE9A 4EN3D 4PJ7E 4DVBA 2ZKHL 4RMSA 4PY8J 3MRIB 5C0JA 3MRMA 3C6SB 4I2XE 3EO9L 1BIHA 1RIHL 2FZ3B 1QPXA 2W9EH 3BUYA 1LDPL 5HYJE 2VLJB 4K94H 4W6WB 5EFIB 5CZVL 3MRCB 1KB5H 5SX5H 4PGBB 2VXQH 1A1OA 4L8DA 1BX2A 1ZMYA 3LKNA 4LHUA 5EOCH 4DAGL 1FJ1A 3KYKH 4LOUD 3MJ7B 5D93B 3FO2A 1RULH 3EOYG 1AQKL 1LO0H 1U42A 3RNQB 4XNUH 1U3JA 1OHQA 1G0DA 2Q8BL 3T3PF 4XZUB 3BW9B 3H7BA 4X6CE 3V2AR 4PLKD 3BPNB 5KTEH 4FQXC 4HDIA 1H0DB 4D0DB 2VZOA 2YPLA 2WM0A 1JGLH 3DRQA 4UB0H 1AO7E 4GJTB 3HS0A 3WXVH 3OKLB 2OX5A 3OZ9H 4KKAC 3KXFE 3C9NB 5BS0D 3GIVA 1T7XA 5ILTL 1GZPB 1MCCA 2VDOL 5CCKH 3GEWB 3HB3D 4JG0H 5FYKU 3A6CL 2JJTA 2UY6A 4KK9D 1RUAL 1MCHA 3WO4B 5IVNA 2FO4A 2R15A 3BKYH 2CR6A 5IQ7H 1J0ZA 4LCUB 3P73B 4CBPA 2LAGB 5IJVA 4M5ZL 1JPTH 5IW6B 4NUJB 4HIIB 4XRCB 3K81A 5FKAB 2XQBH 3MGTB 1CXLA 4U49A 1U6AL 3HPLB 5EO1B 1BLNA 5F1OB 2NY6D 4S1RL 3JWOL 3SDXA 3BD3A 3WS3B 5FAAA 5D7IA 3X14A 3RWEA 3V4PL 4M6OL 1RD6A 2UWEA 4NGHL 3IFPA 5T1DH 2B4CH 3KPMB 2HLFD 2FECL 1TDQA 4KXZI 3DLQR 4XGZA 4UT9L 1TXKA 4NYLB 4OZFG 1MCWM 3VFGH 3N1FC 5C0CB 3MCKB 4NO0B 2OL3B 3O4LE 3EAKA 2VQTA 4PJGB 1JNNL 2IFFH 2BNQA 1OP3H 3RIAK 1MQ8A 2HKFH 1EO8H 2VLLA 4PJ8A 4PJ9B 3OKEB 4I3GA 1DR9A 3P4LA 3BH8A 3RU8H 4ZFGH 4HUXB 4YHOH 3FQUA 5SWSD 3NA9L 1ZT4B 5T3ZL 4Y19B 2NY3B 5L2KE 4AMKH 2FYYA 2UUDH 4Y4HB 4Y2OA 5EZLA 3QHFH 4WO4C 3ARBD 3SE9L 4DZBA 3VWJC 1RZGB 1ZV5A 5HHNA 3CVIH 2A6IB 3I84A 1XIWD 1LK3H 2XXCB 3MFGB 4IOFC 5E99L 4KJWD 4NSKA 3KYNA 1W72L 3O9WC 2KBGA 4G42A 3QDME 4OGAC 2BOBA 2F8VA 2JELH 2ATKA 3CX5K 5F96L 1SYSB 3GMOB 4WVRA 3B9KA 2OTWA 3OKKA 3CSPA 1ZSDB 1J1OH 3STLA 3MV9D 3GGWB 1P4LA 1WWWX 5ISZE 3QDJB 1DSFL 3VRLE 2XKNB 3UBXB 2VAAB 4NKOA 5FCSH 4K55A 4ERSH 4Z7OF 3DGGA 3AREB 5KOMC 1CFQB 1DEDA 4HLZH 4DEPC 4FFWD 1PZ5B 3FMGL 2FBJH 1HSBA 1UXSA 2VKWA 3IVKA 4LHQB 5I8EB 4W4OA 1WTLA 4OT1H 5EUOF 4JHZA 1TVDA 4XTRD 5BRZD 1GPOH 5IKCA 5IESH 1J8HB 5BJTA 1S9XA 5HGGS 4R4ND 4HIJB 5JXEA 2OSLB 3ULVH 5JPMB 1S9YB 3AB0C 1JUFA 1RVFL 1UEYA 3BN3B 5EU5B 4R9HA 2DQFA 3HI1A 3ELAT 4XX1E 1XGRB 3MRFA 1C5BL 4XBEH 5E6IC 3VXPB 4JCMA 2BDNH 1C5DA 3GBML 3Q0HA 1JFQH 4ZYKA 1OY3B 2F9BT 3CFKA 3BXNB 3IFLL 1MUJB 1YDPA 1VEPA 4N0YL 2FLRT 3AM8A 4LNVA 4HUNB 3QIWD 3PJSA 1CGSH 4QRRA 5I66B 4GBXB 1GVIA 2XNAB 4OD1H 4NQVB 5CILL 4MJ5B 2C7UB 4X6FA 4N68A 4P99A 5SV3A 1H3TA 4OKDA 4Z7UB 1N0XH 1P5UA 3CFBB 4U1JA 2OJZH 3DRTB 1MCOH 3F7YA 4JPWH 5ETUB 3Q1SL 3HG1E 3S97C 4Y2DB 1I1CA 4FTVA 1X9QA 4O58L 1WC7B 1WAAE 2GY5A 2DQHH 3MO1A 1R5VA 4N1EA 1NFDE 5C3LD 1S5HA 1PY4A 2H3NA 5E2WH 3PWLB 4Z7QE 4Y1AD 3BP6B 4RMUA 3PG2A 2R1YB 3QDGA 3L3OA 5DJDB 1I7ZA 1N5AB 4GXUN 2NLJB 4LPWA 1A5FL 1RZKH 5IB1A 4FFVC 5TE7H 4HJ0D 3LEVL 4TTDC 4OZFA 3TVMA 2E27H 5C09B 1G6RA 2AV7B 2Y06L 2BXZA 4WWKC 3S5LB 5DFWH 4UINL 2PCPA 1F90H 1LE9B 4YGVA 1ZTXL 2BX5A 4YK4B 4ONGL 4DVBB 3B2VH 3NOIA 2DLTA 3UTTE 4X5WB 3PV7A 1WFOA 5CINH 3NFSH 5C0JB 5CJXA 2IBZX 3MRMB 3BUYB 4QXWA 1NCAL 3QUMH 1A02N 3VFNB 3G6DH 1KEMH 4L29A 4PRDA 3MRBB 4YFDB 2EDKA 2IC2A 43CAA 3LKNB 4LHUB 2FJHA 3VGAB 1FFQA 1FJ1B 5JNYB 4KRNA 1D6EA 4OLXH 1MHEA 4CMHC 4TPRH 3V5KA 1TQBC 4GAGH 1RJZB 3CFCL 1YA5A 3TN0D 4EIGB 2XWJA 3V8OA 1DQLH 1IC5H 3H7BB 2YZ8A 4KJYA 3BEVA 2WUCL 3E8UL 1U3HA 2YPKA 3MRPA 5DD1L 4WFFE 3T8XA 3WUWB 4HDIB 1U91B 2YPLB 3DRQB 1MI5E 3VFPA 3NIGF 1WFUA 3HS0B 3UYOD 3S36X 4J4PA 1F45A 1PEZA 4OCRL 3ABZA 2HWZH 5ADOL 4KTYA 12E8H 3GIVB 1G6RL 4M93B 3ZHDA 5EOTB 3LB6D 2JJSA 2X10A 4WIQA 2FO4B 2XZCH 4LVHB 1S7TA 1EVUA 3IAPA 1KTKE 3WFHA 4UNUA 5EU3A 4CADB 2B0SL 4HCRA 1Q72H 4FQPA 3RI5F 1A1NB 3MRDA 2AEQL 4PTTB 1CFTA 5KVDH 4O5LL 1CE1H 1BLNB 2AXHA 2WBKA 4YBHA 4S1QH 3KYAA 5IFAH 2OP4L 3AXLA 4MCYA 5E1HB 1W72B 4QRTA 3IFPB 1EZVY 2F53B 4HJGA 4HULB 1JWSB 2E9BA 5LAXA 5DA4A 3TC9A 3LPGA 3QAZB 4FZEL 4JM4L 2NR6C 2X4TA 4XNXL 4AG4L 5TF0A 3GI8L 4YEFA 4OI7A 4P9HH 4MWFA 3RIFK 2PR4L 3W2DH 1CN4A 5J0BA 3CSYA 2BNQB 2ZSVA 5T1MA 4Y4KD 2Q8AL 5D7LE 2VLLB 1AO7D 4PJ8B 2GEEA 1WWBX 3BH8B 4RRPG 4DUWA 3EHBD 3KXFD 4HXBL 4JN2A 1TJGH 2KKQA 3FQUB 4KJPC 4KV5E 1CS6A 3ULUH 2ZUQC 1NEUA 4IHOA 2A77L 2GY7B 2ZUVA 4DZBB 5M94B 4B0MM 5KS9E 1A7NL 1G0XA 3BH9A 2XG5A 4HCRL 1BFTA 1S78C 2CRIA 3QHTC 5HHNB 3SDXF 1UKQA 5I6XB 1I1FA 4OCMC 5IM7A 1NCDL 5D7IF 4QRSA 5KSAD 2UWEF 4GKOA 3KYNB 4B53A 3PXHA 4LLQA 4G42B 3O41B 2BOBB 3FAXA 3TJHC 1SYVB 1M6OA 5C0RL 3I9GH 1UGNA 2VITB 1MIEL 5B3JF 2CDEA 5F7MC 2OTWB 4R0LC 1Q9OA 3DX9A 3IDXL 3STLB 1DL7L 4NKOB 1YNTA 4FMKA 1DVFC 2C3WA 3QFJE 1A7OL 5MI0C 1CR9H 4G8FB 4K2UH 1HSAB 3GBNL 2JJUA 2BCKA 3C5ZD 3QUYC 5IMOA 1HSBB 1UXSB 4LEXL 2PW2A 4Z0BL 5GRVK 3RVVD 4OFYA 4Z5RB 2CQVA 3O4LD 1PSKL 4RSVA 5IKCB 4JDVA 5BJTB 5FYKL 3UPCA 3S96B 1S9XB 2XY2A 2ESVE 5CEZE 5JPNA 1LO5A 4DGVL 2F5AL 3JTTB 5D9SA 1Y6KR 1FNHA 4KUCF 1BOGA 5L9DH 1LEGB 4M6NL 4XVTH 1JUFB 4ZQKA 4NZJA 3DTXA 2XPGA 3RZCB 1RSFA 1A6AA 4O9HH 5IWLA 1RPQA 2IJ0C 2Y1VA 3HI1B 4TVPL 1I4FB 1D5ZA 5JW3L 2HAZA 3ZTNH 3O3UN 4M48H 1G7MA 4PRPB 4XNQA 4LFHD 5L2KD 4ZYKB 1AP2A 1RZIB 4ZUSA 4P23A 3G6JA 3LRSB 5CJQL 3T0DA 3M1BB 5ANMA 3NIFE 5HSFA 3LKPA 2EE3A 3D85B 4OM0L 4NZUL 1OARL 4XC3H 2YMXH 2DJ4A 4JFHE 3VD3A 3F6IA 1WF5A 4QRRB 1LEKA 3QPXH 3RHWK 2AJVL 4MLIA 4A6YA 1S7SA 2ADFL 4U1LA 3QDMD 2KL6A 4I9WE 1T83A 4JQIH 4PRHE 1JYXA 4ZXBC 3WIIL 3SE8L 3B9VA 4YE4H 4YIQA 4U1JB 4U1HA 1OLZA 1JWMA 3CLEL 2VLRA 4K7FB 1Z5LA 4NQXA 5CP7A 5K9JH 5ISZD 1T2QL 4NCDA 1MFDL 1UENA 4UBDC 1DFBL 4XI5C 3RIAF 3QRGH 3MO1B 1T6VN 3UJJH 3GSXA 3IS0X 3C09B 4Z95H 3ZZ1A 5IF0B 3FB8A 4JO3L 2FX9H 2QQKH 5IHUH 1CVSC 3QDGB 5IBTH 4UQ3B 1I7ZB 5LBSH 4D8PB 3IFNL 3HNTL 4IRSC 1A6WL 4KY1L 1NDGA 3TVMB 1JIBA 3ZSSA 2I9LA 1MIMH 3NFPB 2ILLA 4XMLH 3TO4C 2PCPB 4XMPL 2ID5A 4L9LA 4EQ2A 3AY4A 1A9EA 3O8XA 4JFDE 1ONQA 2YSSB 4NM8H 4XPTL 5IMKA 1CLYL 1VFBA 4A6YL 4CVWA 4RRPA 1J18A 1WK0A 1LDSA 4XNMB 3OKNA 5GPRA 1K6QH 2PO6C 4L29B 2CLZA 4JLRB 2YWZA 5KVMC 3JVGA 43CAB 1PY9A 2A73A 2FJHB 4L3AA 4MNGA 3TBVB 2X5PA 1D6EB 3UEZA 3VJ6A 1MHEB 3WFCL 1BIIA 2AJSH 5L88H 4LKCA 1VB9A 1AH1A 3H9SB 3PWVA 4LKXB 1JJUA 3DUUA 3V5KB 1AE6H 5SWQA 5GRVL 4O51A 3HG1D 2BY2A 4HMDA 4KJYB 3BEVB 2VDKH 3P77A 1U3HB 5BV7H 2WK2A 2YPKB 4HS8H 1F00I 4HGKC 3T8XB 5JUEL 3BDYH 3K0WA 3WFZA 3PP4H 1X5GA 1FORL 3L3GA 1QBML 3IAQA 1MNUL 4MA8H 4ODSH 4XCEA 3QNZA 2O5ZL 5ERWA 2H2SC 3QEUB 3QNXB 2DMKA 4GW5A 5I18L 3D3VE 5I19L 4X4MA 4OQTA 5JHDA 2AERT 4PJEE 4I48B 1HWHB 2YHGA 2A6DA 3T3PE 1E27A 4M8QB 3GNMH 3RDTA 4PJ9C 1TIUA 4WO4D 3VWJD 3WFHB 4FQ2H 3WDIA 3MRDB 2NY4B 1NCWH 3UTTD 1CFTB 4S0TD 5HHVH 4BQ8A 1N3NB 2NY3C 4IOFD 1S7QA 4LASL 4Y4HC 4QTHA 1D5XA 1HDMA 2D7NA 5E08H 2DIAA 3FKUS 3EO1A 4XXDB 4YHKH 5IW1A 4OLEA 1OP9A 4U1MA 1DQMH 3QBTB 1T0NB 1EEYA 4Z77A 1M4KA 3D87B 3O45A 3MOBH 2X4TB 4IRZH 1RZJH 3L7EB 4K9EC 4HF5L 2VLJE 4E41A 4Q0XH 2EE6A 4HFUH 1Q1JL 5I0DA 3TYGL 2GHWB 2XG4A 2AJXL 4MWFB 5EB9A 4OJFH 1RU9H 4WFFD 2CO7B 2YA1A 1P4BH 3CSYB 1IGIH 1XEDA 4JFQB 2ZSVB 4M1CC 4YXLH 2H8PA 1UB6B 2YD9A 3ALPA 4LRNH 4NN6C 1MI5D 3AREC 3OJMB 4LLWA 4QHLA 1D6VH 2AQ1A 5IBUB 5TE6H 5MENB 5SX4H 4JN2B 4OQTL 1R0AL 4ZNEE 4F9PA 3WHXA 3BJLA 4X7TA 5LGHL 3HE6B 3WDHA 4P4KD 4HWEL 4KAQH 2NY2D 4JQXC 1EK3A 5E6ID 3QIBA 3S36L 3HR6A 5H2BA 1AJ7L 5IB4B 4EDXB 4DN4L 4XCCL 1QR1A 4DKDC 3MLWL 3FONB 1IEAA 1B0GA 1T22A 4PJAA 5IM7B 4XMKH 4F7TA 4LLVA 4QRSB 1TJHL 1BVKA 1X6NA 4LLQB 5FO8B 4ONFH 4OB5H 2IQAB 1M6OB 2MKWA 4UI2A 1KC5H 3IDMB 2F15A 3H0TB 2CDEB 4KRMB 1SVCP 4K7PH 1Q9OB 4X6EB 2CKBA 4X9IA 4IIQA 4ISVA 1YNTB 3I85A 3W0WA 4L4VB 4GBXC 1F2XK 1MCBA 5D1QA 5F88A 5SWZE 2VL4A 4RDQG 2BCKB 4K8RD 4HQQL 1PZUB 4LCCC 4HKJA 4BK5A 3NCYP 2W0FA 3PXJA 1UA6H 5JDJA 2R2CA 4NBZB 2A1WH 5JPNB 4JB9H 2PTTA 1LO5B 1P7KB 4HPOH 5C7XH 3IJHB 2V17H 1U8NA 5D7LD 3TJEL 1BOGB 5F9OL 4JFXA 4M8VA 4Y2DC 3UTQA 2XPGB 2DRUA 5F9JA 1A6AB 1NFIB 2H1PH 3MNZA 1OAYL 4BUGA 4Z7OE 5GISH 4FFVD 1G7MB 4NPYA 1LD9B 3V6OC 4F7CA 1KGCE 5DRXA 4TTDD 3SPVA 4I0KA 4JM2D 1BVLA 2HVKA 3M8OH 4S10A 5AEAA 1DTUA 4WWKD 5ANMB 5EUOE 4MJ2A 5DI8B 1IE5A 1W0YT 2VISA 3QA3A 4GRMA 1LEKB 1BBJB 4WENB 3P0YL 1S3KH 4MCZA 4ZOCA 4A6YB 3GMLB 1S7SB 4QWWD 1NC4D 2DMBA 4NM4H 2EEDA 5EZOL 4U1LB 2CKBL 3FT3B 4HUKB 3VFTA 4NZRL 43C9A 4MJ4A 1U8IA 1JWMB 2VLRB 1Z5LB 4WGWB 3SGEI 1U93A 3RIFF 2Z4QA 5LGJB 5F7EH 1RZ8A 2ORBL 4NNPL 3JWOC 3GSXB 3QO0A 4OCWL 3RKDC 4QXUL 1GSMA 4I8DA 3VGAC 1S9WA 4PJFB 3L3JA 3LMJH 2UZIL 4QEGA 1A9BA 2AEIT 3HMXA 4ZAKA 2ESVD 3HCVA 3WEXA 1TCRA 5CEZD 5LQBH 3ORJA 1UYWH 3KS0J 2VDNH 3G6JF 2X4SA 3HLAA 3W9DA 3DXAA 3WHE0 2ZCKH 1NDGB 3LS5H 4RISL 2NXYB 5BVJA 1A7RH 1EHAA 4XNYH 5I30L 1BQSA 5AG9A 1EHLH 1B6DA 4PB9L 4NDMA 3UX9B 2I26N 3RWIA 2E3VA 1X4ZA 4OM1H 2GJ6A 1PG7W 1A9EB 1T1ZA 4HBCH 4L3EA 1ONQB 4M6AA 3RVUC 5IMKB 4G6JH 1VFBB 4M93C 5D71H 3DPBA 3KLHD 4RAUB 4JFHD 1KB9K 3OKNB 2JJTC 2DB8A 3AS1A 2MTPA 5H37H 2R56H 2ERJC 4G8GB 3IDJA 2GK0A 1A3LH 2BVOB 4LVHC 3OX8A 1F02I 3MCLH 3P30H 5FO9B 2A73B 1QSZA 1UZ8A 2FSEB 3FFDA 3A0OA 4I9WD 4IMKA 4MNGB 4PRHD 5SX5K 3UZVB 5JA8B 3JUYA 3NN8B 2MCPL 3SJVE 3VJ6B 4KVCH 1BIIB 3QDAA 3LN4B 4LKCB 3PQYE 1A14H 1PKQB 5SWQB 3FO0L 4YAQB 4O51B 3JWDH 5F97E 3MA7B 4FG6D 4OCSL 5DWUH 5D5MA 4F58H 3MLZH 3BAEH 3RVXC 3HMXL 3UYRH 1XF3A 3GI9H 1DQJA 2WLZA 2V9RA 5E8NB 4KTEL 4UAOB 2MQ3A 3LIZL 4CVZB 3L3GB 3QAZC 4X7FC 3K2MC 5ERWB 5E8OB 5HHQB 4GW5B 3M07A 4GQPH 4LDEB 3VFSB 4IRJB 3C08L 5JHDB 1T04B 2Z8SA 4CU7A 4KKLC 2J1KA 1FVCB 1MAML 2A6DB 3V6OE 3GIZH 5B8CB 4MNQE 5F3HB 1E27B 3RHWF 1YNLL 3WSQH 3ZMRA 1GGUA 2CDFA 5FB8A 4RFNB 4PJ8C 2J88L 2AK4A 4WUUA 1L6ZA 5HYFA 4G80B 5DR5H 5CFHA 1S78D 1VACA 3DMMB 4JFDD 2EDRA 3NIGE 3MMEA 4HLZG 5IK3B 3F7RA 2PXYA 1S7QB 5C09E 2XQYG 3BSZL 4TSAL 4QTHB 2CJUL 1HDMB 1JV5A 2K9UA 1KB5A 1CLZL 3EFDL 3TJHD 1INDL 1X5KA 1JNLL 3EO1B 3F58H 3QB7C 2IPUG 5I6XC 5I1EH 3JXAA 4U1MB 5KZCD 1EEYB 2EO9A 4NJ9H 1HXYA 5CGTA 4CU8A 3O45B 4Z77B 3VXMA 4G6FD 4LAQH 4H8WC 2IPKA 4RFOH 1DVFD 4E5XA 1U8MA 4WI6A 5KBNC 4E41B 3NIDF 1MEXL 1DE4B 3CUPA 3B9KC 1NAML 3OSKA 3LN5A 2WBJD 4WFGE 2G9HA 4PV9A 4JO2H 3QUXB 1OAQL 3EYOA 1T03L 2Q76A 1OP3K 2DTML 1P4IH 4LLWB 3I6GA 1F11A 1TMCB 1T0MA 3WHXB 4X7TB 3TESA 5ACZA 3A67L 4W4OC 5GS2D 3D3VD 1JHKH 4OZHA 2UUDK 2YPLE 2NQCA 3QIBB 5F6HJ 5DFVC 2V2XA 5JXEC 5FUOH 1QR1B 1MCFA 4WEBH 1Q0YH 3FTGA 2W9EL 1IEAB 1B0GB 5IVOA 4F7TB 3TNNB 2WV3A 2XKSA 4K94L 3GUTA 2DN7A 4DVRH 3EYVA 1KB5L 4XCNB 1BVKB 2VXQL 2XA8H 5EOCL 3ZKMC 1L0QA 3EDDA 1MH5A 4RX4A 3KJ6H 3FB5A 4N0FA 3FQNB 3RVWC 4PUBH 3QJFB 5I17B 5LWYH 2CKBB 3AM8C 1RULL 3ARXA 4IIQB 4ZXBD 1AQDB 1LO0L 4ISVB 1FNSH 3SKNB 4XNUL 3W0WB 2HG5A 1U9KA 5D1QB 5KTEL 3U0PB 3SDXE 4EI6A 2JJWA 1QA9A 3SGDI 4HKJB 2VLJD 5D7IE 3ARVA 1JGLL 4UB0L 4XI5D 5CZXC 2N7BA 2W0FB 2BY3A 2UWEE 3WXVL 2IAMA 3OZ9L 3WIFB 2VABB 5B3JE 4AQ1B 2IH3A 2IPUK 5CCKL 3QNYA 3BWUC 4JG0L 5GGRB 4POYA 5F9JB 4HMEA 5H94A 5IB2A 4OSUH 3HN3A 1JRHH 3MNZB 2OQJA 1WT5A 1BF8A 3C09C 4FQLH 3BKYL 2V7HB 5IQ7L 4IRSD 3DVNA 3O6KH 3OXRA 5DRXB 1EEUA 3SPVB 2G2RA 3MROB 2B2XH 1BVLB 1JPTL 3QWRD 4PJAF 4X9GA 4WW2A 4GO6B 3UTSB 2RFXA 2XQBL 4JQVA 3TO4D 4ZD3H 3RX7A 2I07A 2VISB 3MRKA 3QA3B 4GRMB 4KZDH 4PLOB 5E8DH 3EGSB 3TVMC 4LDOB 2DBLH 4F3FA 1IZKA 5T1DL 4YEEA 1JZ7A 2B4CL 2ZSWB 1HE7A 3VFTB 2PO6D 2NXZD 2HVJB 4M62H 1U8IB 4X6DA 3O2VH 1QFHA 4Z76B 4JREC 2Z4QB 3UO1H 1OGTA 3VFGL 2HKHH 2ZNXA 4JFFA 5SWZD 4K3EH 3Q3GB 2GJZB 4XVUC 2IFFL 3QCTH 3LD8C 1M7IB 1TENA 4HIEB 2HKFL 1UJ3B 4NT6A 1EO8L 4NNXB 1KV3A 5D2NE 3RU8L 3K80A 4ZFGL 1A9BB 4PR5B 3HCVB 4IM8A 4YHOL 4CVXA 1T7YA 5CMAA 3BE1H 1BFVH 4AMKL 3AS0A 1I1YB 2X4SB 3HLAB 1U3HC 3DXAB 5IBLC 3QHFL 4X9FA 5TJWK 2WQ8A 2H2SD 4JFOB 4OLVH 5GSVB 2CD0A 3V7AG 1KGCD 4K8RH 3LV3A 4NO3A 3RWIB 3CVIL 3BKJH 2VN4A 4J4PC 5FECA 2HTKD 2GJ6B 4QHUA 4I77H 1LK3L 1RIVH 1T1ZB 3R1GH 3RPKA 1D5IH 4MHHI 1KIPA 1MCJA 5A2FA 3QI9A 3JBG7 4FQIH 4OIBA 2PYEA 2JJSC 5HGBA 2JELL 4UMGA 3G5ZB 2VXSH 3O2DH 2GK0B 4NQEA 1R3IH 3OX8B 1J1OL 4KDTA 4Y4HD 4D0BA 3FFDB 2H26B 3QEGH 4ERSL 5A1AA 5J12C 2HT4C 4OLZH 1A4JA 4UIKH 1CFSA 2GT9B 4LSPH 4QRRE 3LHPH 1GL4B 1CQYA 1U8PA 2FBJL 2E6JA 1G9NH 2ITCB 3U9PH 1J8KA 1J88A 3IKCB 4OT1L 5IVZA 1QO3A 2H6PB 1GPOL 3B5GA 1LO4H 5IESL 1LHZA 2CIIB 5I1DA 1JN6B 3ULVL 1H3UA 1NAMB 3OKMA 5HYSB 3D9AH 3CDFA 3H3KA 3DUSA 4YHZH 1MVUB 3KS0H 5C8JB 1I3RA 4X5XA 3HR5A 3ARED 4BFBD 4FTVE 1KLGA 4XBEL 1K3ZA 1AI1L 1P7QD 1A4KA 2BDNL 2EDQA 1JFQL 3T65B 1AY1H 3IRZA 3MV8E 1U58A 3TZVD 3BHBA 1F6LL 4F7PA 1AD0A 2GITA 3D6GA 5FB8B 3IJYB 4HX1A 4F2MA 2OI9C 1CGSL 2AK4B 2P24B 5DRNB 4LSUH 3KPLB 5E70A 4YFLI 1VACB 1F4YH 1UXWB 3KPSE 4OD1L 1ZKAA 3MMEB 2GTZA 1R24A 3QUMA 5CEZH 5JZ7C 1KB5B 3DVIA 1N0XL 2M8XA 3FT2A 4HHAA 2P7TA 2OJZL 1MCOL 4JPWL 2A6JB 2R1XA 4ZODA 4LP5A 3SJVD 1HXYB 1N26A 4MLSA 1CGUA 5D5MF 3PQYD 4FQQA 3K1KC 1AR2A 5DQ9B 2IPKB 4HUVA 3TIDA 4E5XB 1U8MB 1HH9B 1FG9C 1I9IH 1U41A 2CGRH 5E2WL 5IIEA 1TZIA 5FM8A 5MEOA 4XWGH 4E42A 1OTTD 2Q76B 1ZOXA 1XR9B 4RDQF 1RZKL 3I6GB 5TE7L 1F11B 1IGFH 2E27L 1T0MB 5A3IC 3NA4A 4Y2DD 1Z2KA 3LKQA 4ZPTA 3WN5B 2NCMA 1F90L 4OZHB 4P2QA 1RJCA 3L7FB 3CXDH 5DJ2A 4WJ5A 3B2VL 4JY5H 4M00A 2V2XB 1XT5A 1BQHG 4MNQD 1HILA 3K4AA 1G0YR 5C07A 5CINL 3NFSL 1BD2E 1KJ2H 3FTGB 2OM5A 3HRZB 5IWLC 5I71C 3QUML 5I9QB 2BVPA 4NQCB 3G6DL 1I8IA 3D2UA 3VRIB 1HEZA 1KEML 3IRPX 1XGUA 5HI5C 5KVFH 2V2TA 4M9PA 4P23C 3TM6A 5C09D 1MH5B 3EZJB 4OLXL 2AKRB 3FB5B 1ETZA 1VADA 3OXSA 3SO5A 4TPRL 4GAGL 4PGCA 1TETH 3B2UC 2HG5B 3AFLA 1DQLL 1IC5L 4CMMB 2MNUA 3BPOB 4EI6B 1QA9B 2W1NA 3EFFB 4PJBA 2QSVA 1T83C 3VCLA 1U36A 1OB1A 2XY1A 5E9DB 4WFGD 3RKDD 3T08A 2BNRE 3P4OA 4OFPA 5C3TA 1QQDB 2HWZL 3BGAA 1HYSC 5KN5A 1FO0H 12E8L 3D0LB 3QNYB 2P8MA 2F19H 4LNRA 5H94B 5IB2B 1C08B 2VNCA 3OGCA 4LVNC 4X7DC 3SEPA 4HW6A 2FH8A 2XZCL 3QG6A 3TPUA 5C92A 1FL3A 2G2RB 5DJ6A 3VFWA 4GKZB 1GGIH 4K7PX 2AEPH 4WW2B 2CIKA 1Q72L 1E6JL 4KQ3H 4N1HB 2W38A 3BO8A 5FYKE 5KVDL 1CE1L 4BQ9A 3O3BA 4J2XA 4S1QL 1L9NA 1JPFA 4ETQA 2HJFA 3RVUD 5IG7A 2NXYC 3LQAH 3QXDA 5IFAL 3TWCH 3RZWA 4Y5YA 2PNDA 4TVPE 2GJJA 5BS0A 4L9LC 5IFHH 3AY4C 5CEXA 3O8XC 1U8JB 3BKCH 5IVXF 2R69H 5GS2H 2C4FU 1MCSA 1KCUH 2VXUH 1MCEA 4LLDA 3O6FD 3UZEA 1OGTB 2IEPA 4JFFB 3MLXH 4P9HL 4ETYA 2GSIA 4R4BA 3W2DL 3JVGC 1OSPH 5TGBA 1GXEA 4D2NA 3DGCR 5CBEB 3RVXD 4X4YA 1TJGL 3FFCA 2A9MH 1S7UA 3ULUL 5BOZG 3BGFC 5ESAA 3ZL4H 4TNVK 4WW2F 3QCUH 3DURB 2EDJA 3DROA 1X7QA 4I0PA 3NPSB 4YDVB 4TQEH 3VE0B 3LV3B 4B7LA 5GGTA 5E5UB 3ZKXB 4U6VH 2VN7A 4JANA 4P3DB 4PJ8D 3QI9B 4PP2A 4YBQD 1MCWW 5HGBB 1BZ9B 1Z9SA 3HNSH 3I9GL 3TO2A 1S9VB 1NBQA 1FH5H 4U6HA 4NQEB 1FQ9C 3TH2T 4KUCD 4X6DF 2APWA 5D7KE 3VD5A 1LP9B 4LQFH 3G6JE 2EKSA 3RDTC 1J7VR 4D0BB 3HAEH 5ANME 1CR9L 4YHPB 4K2UL 4H1LH 2DQGH 5DJZA 4PS4H 1VEOA 1U8PB 3GHBH 1BWMA 5IVZB 3KYOA 2DWEB 1EAPA 1FGNH 4MD5A 4GMTH 1JI1A 5B38G 3B9KD 4N5UA 2BRRH 3D39B 3OKMB 1JVKA 5L9DL 2CLRA 3H3BC 3DUSB 4TTGA 4XVTL 2GAZA 4WHCA 3CDGA 5DMIH 4G3YH 4O9HL 4EUPH 3NABH 1O0VA 2YS4A 4QRPB 3ZTNL 1KLGB 4M48L 4Q2ZA 1A4KB 3VU2A 4P4RB 2APVA 3DVGB 2ZWLT 5TQ2H 2X4OA 2KPNA 3KDMB 1AD0B 4XPGH 4MAYA 1CG9A 4HX1B 4XC3L 2YMXL 4F2MB 5DFVD 5TDPA 3QPXL 4UV7H 5JXED 5BRZA 4F9PC 1CTOA 4J1UA 5A16B 5K9KB 4UILH 1R24B 1B6UA 1ZT7B 4JO1H 3LDBC 4JQIL 2QSQA 2CLVA 4YR6A 4F7MB 4ZFOA 1D9KB 3UAJC 5J1AA 3QIBC 4YE4L 3REVA 2P7TB 4KHTH 4JDTH 3ZKMD 3IYLW 4HGMA 4LU5H 5JXAH 5K9JL 3WE6A 2R1XB 2E8YA 3RVWD 1H3WM 3MFFA 3LQMA 3QRGL 3PWUB 3WV0A 5ABDE 4HUVB 3W5NA 3UJJL 1RURH 4QRRD 1J86A 4N90E 4Z95L 5T5NG 1ZK9A 3MRLB 1KLFA 4XAKE 2EC8A