2UUDH

Crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10- 1.12 scfv in complex with the hapten
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFSFTDYYMAWVRQPPGKALEWLAFIRNKANGYTTDYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARGDYYGAWFAYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords NQ10-1.12 ANTI-PHOX ANTIBODY
publication title Structural Basis of Affinity Maturation of the Tepc15-Vkappa45.1 Anti-2-Phenyl-5-Oxazolone Antibodies
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 121
sequence length 121
chains with identical sequence J
ec nomenclature
pdb deposition date 2007-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uudH00
2R0LL 3FN9A 4G9FA 4PG2A 3N1MC 5JHDB 1ZA6B 3CXHK 5JHLL 4PJ7B 5I1IH 2L0DA 3MCG1 1A1MB 3OGCB 1HWGB 2HFEA 1MJUH 4LLVB 3I84A 4X7TB 1MCIA 5KVGH 3QDMD 3GKWH 3G6DH 1WC7B 3B9KA 1G7IA 4RGOH 4WUUB 1DSFH 4S1SH 3RNKB 3ZE0E 4CMHB 4JB9L 3QCVH 2KH2B 1FRGH 4OCSL 5LGJB 4PJAB 3LZFL 2WBJA 5ESAB 1OARH 3ESUF 3KDMB 1XF2A 4KVCH 4P3CH 3D0LB 4XNXL 4RMVA 4HWZA 2IH1B 4I0PA 2V5RA 2H9GB 3I6GB 1Z9LA 4QRRE 4W4OA 2OLDA 5HDOA 4GKSA 1S9KC 5GS0D 3CPLB 1X5XA 3P3YA 5C0IB 4M93B 2R2HA 2BHYA 2XZQL 3X17A 1MHEA 1KIRA 3DX8A 3SQBA 2BVYA 5D7JD 5KG9A 4KUZH 3MLXH 4HIHB 3ROLB 3RP1A 4LSTL 1EK3A 2DMKA 5EO0B 5IG7B 4Z7VA 1FZMB 2QQKH 3BDYH 5IVZA 1XCTA 4I2XA 4KZEH 3HHRB 2ITDA 5D7KD 5F9AC 3BPOC 4G42A 1GC1C 1X5HA 2J4WL 5J6GA 5IK3A 5SWSE 3S34L 1I3GL 4AT6B 1WAAA 1AGBB 1EV2E 3T4YB 3WIIL 5FYLH 4JGJA 2X9WA 1T0MA 4DKAA 3DX6A 1S9YB 1MIEL 1PEZA 3G5ZA 1AC6A 3MRMB 1KEGH 4O4YL 3ULVL 4RZCB 5J1TC 5FYJD 4ODTL 5EO1A 3MFFB 1HQRB 4HS6B 2HFGH 3AVEA 2J8UB 2VL5A 2X4OB 3UJJL 5BV7L 1AGCB 4NHCL 1W8NA 3TO4A 5MHSE 1Q9WA 4WI7A 1FZOA 5ENWB 2WSKA 1RFDL 5J8OA 5TDOA 5J13C 1XGQB 4JO1H 3OZ9L 1FNEB 4LSQL 4RX4D 5C0JA 5ALBH 4LEOB 3VI3E 4OLWL 2ADGA 1HHGB 2BRRH 4YXHH 4XP6L 4YNYA 3SGJA 1U3HC 1T7VA 1NUDA 1LDPL 3QDGD 1P9MA 2HWZL 2I9LB 4OFDA 1G6RB 1FAIH 4LSRH 4TNVF 1I1CA 4U7SA 5F96H 1CFBA 1MF2H 5D1XC 3BEVB 1V3JA 2RGSA 5IT2L 1U92B 5IV2B 4MVBD 3BO8B 4LCCC 3S4SG 3IXAB 5JXED 2IADA 3QDGB 2BSRB 4LPVA 3GHBH 3W82A 1P53A 4MJIE 1F02I 4XRCA 1BZ9B 4P9HC 2VMFA 1I9JH 3QUKA 5T1DL 1CQKA 1WFTA 4UILH 4WI2A 3S37L 3TJEL 5EZLA 2YKLL 5I16B 1CXEA 4P3DA 4K8RC 5J12B 5JPMA 4FQJH 5DUBA 4X6FA 3CZJA 2E8YA 2B1HL 3DSNA 4MJ6B 4MXVF 3B9VA 1KF9B 1VB9A 3CFCL 2OTUB 4X6CE 4PRID 2ERJC 3GMOB 5IMMA 1KJ2A 1PX3A 3JWOH 2ZKHH 5HGAB 3N1PC 2Q86B 4G8GA 4ZNEE 3MJ9L 1KPUA 3VRLE 2KQMA 3ZTNL 1R24B 1M7IA 4JREC 1YEDB 1YNLH 4QGTA 3HG1B 3SKNB 4U1SB 3QWRD 4PRIB 4RDQF 3L5IA 3KGRA 4F3FA 3SGEI 3AS0A 1J12A 2DDQL 1NCTA 4E5XB 2VDOH 1K8DB 3QI9A 5AUMA 1NFDF 4K7FB 4Y19E 4LU5L 3AXLB 2F54A 3SE3C 1RZJL 1IAOA 1VADB 4HXBL 1A7NH 4L3EE 4H5SA 4OCRL 1VFAB 3W0WE 3DMMC 1NAKL 5DFWH 1WEJH 1BFOA 4IEFB 3SDDD 1VFMA 4GS7C 1NQBA 1MVFA 4D3CH 3QCTL 1Z9MA 4J3SA 3I02B 4LPYA 2LAAA 5ALCH 4QF1A 3T0VA 1QKZH 3VWJD 1U42A 4NN6C 4YHYB 1U91B 3O6KH 1A3LH 4I77H 5F72S 4NQDD 3SDDB 4LCIH 1PKOA 1FBIH 4JM2C 3LEVH 5EU5A 2EKJA 5DJ6B 1SEQH 3CFDB 4CADB 2A74A 3H9SA 5JUEL 5GRXG 1RIUH 4PJHA 1NFKA 1JL8A 2NR6D 2UY6A 4PGBA 4DZ8B 3PL6C 3RHWK 3VWJB 3L3DB 2W0FB 4LQFH 4NQDB 1NBYB 3I9GH 2YBRA 4UTAL 1DQDH 32C2A 1QFHA 2H3NA 3BN9C 1CE6B 5B8CC 5TE6L 5KW9H 5EC1A 5M95B 3HMXH 4UIKH 1CG9A 5DZNA 2ESVA 1NGXB 4YR6A 3I6KA 3UTTD 3D18B 1J86A 4K71B 3WLBB 5JOPE 1DBJL 3BGFB 3KVQA 3WIFA 4JHBA 2WUCH 1KYOK 4LSVH 1Q9OA 3E6HB 3BQUB 3S36H 5DUML 3ALXA 1A3QA 4G6AC 1LP9E 1NAMA 4I3RL 5KBNC 4H8WL 4P4KA 2YPVL 1KCKA 1OM3H 5EA0H 2I24N 3UTTB 1CXHA 5IB1B 1CDHA 3TBVB 1N2RA 2W65A 3PP4L 5TDPA 2Z91A 5HTSA 4DN4L 4LNVA 3TNNB 1ZGLB 5IB3B 4NKMB 1JF5A 1ZHNA 4Y4HC 2FHBA 1O7VA 3I6LD 1J8KA 3KXFE 1YEHL 2A73B 2UZXB 1CFNA 4B5EA 1OGAD 4F7EA 4PJCB 4HLZH 3DO3A 5EOCL 3TN0D 1C5DA 3CX2A 4NQXA 2CLRB 1W0VB 5SX5K 2DKSA 3GK8H 3JV6A 1EEQA 4WO4C 2EICA 5J0BA 2Z35A 4LIQE 1EZVX 5LWYH 4WFFD 4ERSH 2R56L 3HNVH 3QUZC 4XNMA 1G1YA 3VFVA 2X4SB 1H3VA 3TN0B 5CSZA 4D94A 5HHOA 1VENA 2FX9L 4QRPA 5DHVA 2DTMH 1JNHA 4MB4A 1RUAL 5C2BL 1G0YR 2GJ6D 3DUHA 1GJIA 4WY7L 5IW1B 5C3LD 5TH2A 1RZIA 1H3PH 3BKJL 4G6MH 1CTNA 4CVWA 3MBEA 4DCQA 4L3AA 1G7QB 5ICYB 1A9EA 3O3AB 4XAWL 2P8LB 3SDYL 5EWIH 3BKCH 2A6JB 3TBWB 4HCRL 3S4SB 1HHKB 2GJ6B 4WNQA 1P4LA 1RULH 4QRSB 4JVPA 5D7SL 4JVUA 5T5FH 3DUUA 1E4XH 5FGRA 1SJHA 4PRHE 5IBUG 1CDCA 4H0IA 3KPSD 5A40E 3OKEA 3TZVC 1YEIH 1U2HA 4ZXBA 1BFSA 2E7HA 4J8RA 4JJ5B 4OGAD 3U1SH 4LLUB 5GHWH 5EPMA 1JGEB 5EUKB 1CFQA 4JE4B 2FZ3B 4D0CB 3KPSB 1YQVH 3LSOB 2B0SL 5K9KB 2PYEA 4OKVA 1CYGA 5EORL 4ZFZB 3MA7B 4XVTL 3F7VA 2MJWA 4S11A 5DI8B 4GAGH 7FABH 1U93A 3PUCA 4BH7A 2DMCA 1QNZL 3T2QA 2VC2H 2UWEE 4DAGL 3QNXB 1X4YA 4K2UH 3TVMC 3G6JE 4KHXH 3RY6C 2BJML 5GGSB 4PJDF 3HNSL 2A2QT 1N6QL 2NXZD 1XGTA 2IQAA 4RRPG 1D3CA 1QG3A 3B4NA 5MEND 2GAZA 4F9LA 3MACH 2PF6A 3VMOA 1K4DA 4Y7MA 3L3GB 5L2KD 2FSEA 2HVKA 3UAJC 2FECL 2YSSA 5JORB 3UTPD 1P7HL 2R9HD 5GXBB 3L3HA 4FQXD 3ZTJG 2X4QA 4JGUA 2NXZB 8FABA 3C5ZA 4Z7NF 3NIFE 1N8ZA 3TPKA 2E9WA 2ZSWA 4HAFA 5E5MB 4UQ3B 5ID0A 5MENB 4Z7WB 3LQAC 4DQOH 3KS0J 4RIRB 5HVHC 5L2KB 1UA6H 2FB4H 2VIRA 2P7TB 1YNKH 1JHLL 4ELMB 5D9SA 2BP3A 1NJ9A 5D2NC 1P7QA 1TCMA 3QWOA 3MRJA 3MRCA 4IHOB 3CVHB 4RMWA 3A67L 4DUWA 5DQ9A 4M62L 4F9PA 2FWOA 3CFBB 3MRGB 3HZVA 5GSRA 1JV5A 1P5UA 2DLHA 1RZ8A 5JNYB 2VXSH 2VUOA 2YD4A 4L29B 3SGDH 4ZSOB 1BZ7B 3NZHL 3SKMB 1U8KA 2R69H 4BQ8A 1GC1H 3IS1X 1XF1A 4C55A 5KSBA 3MMEA 2QEJA 4HIEB 3QNZB 4DKEH 4MD5B 4CN1A 3V7AG 1IBGL 2FEEI 3GSQB 4XVSL 1RURL 4R4BB 4FNLL 3UTSE 5KZCD 4GXUM 2GITB 3GFUA 1LMKA 4UAOB 4X4ZA 1I8LA 3P40A 5HGDB 4WFHE 1M1SA 1AD0A 1UXWB 1Z0NA 4GBXC 3BD3A 3VG9B 1OAXL 2EC8A 2H26B 5D2NE 3RVTD 4I4WA 5IMKB 5KZCB 2CKNA 4M5ZL 3PP3K 4QKXB 4FQIH 1TNMA 4D9QE 3KWWB 1SHMA 4L8CB 3DVGB 3QQNA 1KXTB 3LN5B 5TPWL 4AENA 2VLKA 4O58H 1EMTH 4UTBL 4E0RB 1OPGH 5E0QA 3VXPA 4FG6D 5INDA 1ZXQA 2XKSA 2ZUXA 4NKQB 3KLHD 1FC1A 3GMNB 1IGFH 2XZCL 4HWNA 1WWAX 1CFVH 4G8EB 4DK6A 2XXMB 2AEPL 3HC3H 4AEFA 4PY7A 4HX1A 2Y06H 3JTSB 2VDML 2EIZA 5CINH 4J3UA 1A7PL 5F6IC 2ENSA 5L9DH 2E7LA 2P44B 1ZA3B 1XCQA 1SM3H 3D39E 1UB6B 4P9HH 4J1UB 4U05A 1FV1B 1WBYA 3VGEA 2XZZA 4U1LB 3HPJA 2P5ED 5CJ8A 2QQQA 2O5YL 4K8RH 5F1NB 4OLXH 1DEEB 2GSGB 5DR5L 4B0MM 1B0WA 1CU4L 1RAMA 3HNTH 3QFDB 3GNMH 5E2JA 2P5EB 3JV4B 3G04A 1NEZG 1YEEH 5IOPA 1M6OB 4R3SB 3LHPH 3DOSA 4H25B 4ODHH 5C0GB 3RWCB 3WKMH 4ZTOL 3VFNB 3QQ9D 3KYMA 1RZGB 4DUVA 3KR3H 1BMGA 3NOIA 5BZWA 3H3PH 5D2LE 1QSFD 5FYKD 3F62A 2CO6B 5E8EB 5F9JA 5JW4R 1KCVH 5B4MC 3X3FH 1Y6NR 2RHEA 5IMLB 3FFCA 3WCYA 2QQNL 4R96A 3WKNA 1NGZB 1BM3L 5F8RC 3CVIH 5D1QC 5BO1L 4WWKA 5HI5C 3IAPA 5IR1B 3CDYA 4YHIA 4YGVB 5GGRY 3RZCC 3U48A 1QSFB 5D5MB 3ARQA 5C0AA 5GGTH 4PTTB 3O2WH 4MQXD 4GAYA 3MLUH 3U4AA 3MV7D 2RCSH 5HHMB 4ZFGH 4DW2H 5CMAB 1WBXA 3DO7B 2D03H 4X4YB 5IKCB 2KDGA 1MPAL 4IRSA 2HH0L 2C3VA 1E6JL 1NGPH 1BFTA 2EXWD 2WP3O 2EE9A 3MV7B 3RTQA 4G9FD 3WO4C 1W72L 4EOWH 3KPRA 1J1XH 2Z9TA 3I3DA 4N0CD 1HH6B 2BZDA 5I15H 3BP4B 4D0BA 3OAYK 4TUOB 3TBTB 4R6UA 1N6UA 3MUHL 4OLZL 4F58L 5MEQA 1T5XB 3EOAB 1DJSA 2AW2A 3B9KD 5E5RB 4FA8A 5L7XH 1JBJA 2WM0A 4LLAA 3ZDXE 3BRFA 4G9FB 5E56A 2J3SA 5I74B 1MCRA 2WBJD 4JRXA 4KJQC 2JELH 3G6DL 2HFEB 3BW9B 4OFPA 4XI5D 3DXAE 1T83A 4BZYA 2APWA 3ZE1F 2AJSH 1IM3A 1FZJA 3QYCA 4I0PD 5FHBL 4N68A 3B9KB 1G7IB 3W9EA 1HINH 4PREA 1HKFA 2B5IC 3SO3C 4LIQH 4YEEA 1YJDL 5J3HD 1FYHB 2B4CC 5DD5L 2DJSA 5F1OB 2BOBA 3LS5L 2J88H 4M7KL 1XF2B 5DUPH 3NCBB 2IC2A 1X4XA 3O45B 4PPTA 4MXWH 4HWZB 4I0PB 5KS9A 1WTGT 4HSQA 4NM4H 1JPTH 1LEGA 3ZMRA 4GKSB 5FB8A 4Y5XA 3MLXL 5E1AA 2R2HB 3MJ9A 1EJOL 1MHEB 1KIRB 3DX8B 2V9QA 1SBBA 5KG9B 3GB7A 4KZEL 5LAXB 5IROA 4Z7VB 4G7YL 5IVZB 1XCTB 4I2XB 1L7IH 1QRNA 5IFHL 4F37F 4HS8H 2ITDB 3GGWA 2BNRE 3DRQA 3L3KA 1J8HA 2IQ9L 3TFKC 4ZYKA 1YEFH 4G42B 2ZWLT 3OX8A 1F45A 1BBDH 5J6GB 5DVMA 5IK3B 3TO4D 4EI6A 2AI0L 4Y2DC 1YYMH 1T0MB 2HMIC 3DX6B 4U2YA 1JNNH 2BXYA 5CS7A 3G5ZB 3RGVA 2EH7H 4NO5A 2AAVA 4X9IA 2W9LA 3IU4L 3O2DH 2C9AA 1OD9A 5EO1B 4PBXA 2VL5B 5I66A 3STLA 2O5ZH 3TO4B 4JPIA 1IL1A 1U3YA 4O02L 2FEEL 2HT4D 4OUOA 5TDOB 3HE7C 2XQYK 2APTA 1KJMA 2YA1A 4N0UA 5C0JB 4XCCH 2HTKC 3IGAA 1KIPA 1MCOL 2VDNL 4YXKL 1HCVA 1UADC 3MBXH 4PJ7F 3PJSA 2ADGB 3AREC 4Z7UA 4YNYB 3ARDA 2EYTA 2X7LB 2GHWB 2V17H 3INUH 1JZ2A 4Y4KC 4ALAH 4PJAF 3WFDL 1W2KT 2Y4SA 4OGXH 5GS1A 4M7LH 1IAMA 1MNUH 2IADB 2P8PA 2N1KA 1OVZA 3IU3B 4XRCB 3G5XA 3QUKB 4LVNC 1BD2E 4M1GL 3T65A 4LBEA 1XT5A 5EZLB 1VA9A 4P3DB 3S9DB 1B6UA 1INEL 5HHNA 5DUBB 2ATKA 1NANI 4P46C 4X6FB 1HHIB 4G8GD 1ZLWK 4JFEE 1OSPH 4UB0H 4K07A 5KN5A 1OT1A 2D0GA 5JMRA 4M6AA 2OS7A 3CX5J 4WFED 1PW3A 1R6VA 3OAZK 3R0MA 5IMMB 1KJ2B 4QRUB 4WTZA 5I8EA 2DTSA 4AJ0A 3T0EA 1ORQA 4FXLA 4J3TA 1UJTA 1WISA 4G8GB 3QI9D 1KPUB 4O2FA 1U8MB 2F54D 3TIEA 5CGYD 5BQ7A 1M7IB 2G5BA 3LN9A 3H8NA 3ULSA 2ZNXA 4N5EC 3NZ8A 4PV8B 3RPIA 2C3GA 4F3FB 1VFOA 1E6OH 3LQAH 5TFSL 1ZAGA 3MA9L 3RY4A 2J8UF 3RVXC 4JY5L 3QI9B 5I30H 5AUMB 2AJXL 3SGEH 2F54B 1NPUA 3TH3T 5IW3A 1IAOB 2A9NH 2GQHA 3TP4A 3CGTA 2ZCKH 4H5SB 2I07A 5E99L 1A6VL 4X99A 1KJ3L 5C0CA 4Z7OF 2AJUH 5TF1L 1BFOB 4XB8A 1JNLH 5KAQF 4ODBD 4FS0A 1QKZL 1CF8H 3O6KL 3H9SD 3RI5K 4CNIA 3UJIL 3EJYD 1UQSA 4HH9A 4BZ2L 1MAKA 2OBGA 3VXUA 1LEIA 5TQ0L 5FECA 4LCIL 4RQQA 5T5NF 1FBIL 1IGIH 3LEVL 1NSNH 1KB5H 5MEOA 5ERWB 4YDKH 4WI8A 3SDAA 4Y5YC 4HCRA 3AFLA 5EU5B 3EYVB 5H94A 4NO3A 2A74B 3H9SB 1RUPH 5DO2C 4G6KL 4PJHB 4PRPA 4PGBB 1SMOA 3PWPE 3I9GL 2CK2A 1FAKT 4HQQL 5E6IC 1HN1A 2ESVD 2EKSA 2YBRB 3DI2B 5I0ZA 4ONHA 2OK0H 32C2B 2H3NB 4C56A 4OF3A 4XPGL 4JM4H 4N90D 4BK4A 5F7KC 3QEHA 4HWBL 2F5AL 5EC1B 4HJ0D 2ADIB 4P4KD 2CRIA 1CG9B 1GAFL 4ELKB 2ESVB 4OD3L 4XWGL 5HVWA 3V79C 3I6KB 2A77H 3MOBL 2Y6SC 5T1MA 1ITBB 3WNNA 1Q9OB 4MXVE 5ADOH 4BM7A 3P0GB 4TUKH 5KVEH 3QP3A 1ETZA 4UNTA 1UENA 1BQHA 4OLUH 4P4KB 1FDLL 4I48A 4GRLC 1DDHB 4CW1A 2A0LD 2F8VA 1JJUA 2I27N 4C54A 3SDXA 1N2RB 2W65B 2EXYD 5TDPB 2Z91B 4PY8I 3U7AA 1PG7W 2BY1A 1D5XA 4WVRA 1ZHNB 4KQ3L 4FFZH 3RQ3A 4E42A 2YA2A 3RX7A 2ARJB 3E2HB 4Y2OA 3Q0HA 3SJVE 1CFNB 3WEXA 1U8PA 4F7EB 1TJIL 2VLRE 1C5DB 3BIKB 3P11H 3RX8A 1NFDE 4NQXB 5HHOD 1PYWA 4PJ9C 3JV6B 4QRPD 3HNVL 4ODWB 4MSWA 5FGSA 2Z35B 3QUYC 3FZUC 1AP2A 3DV6A 3LPFA 1MOEA 1BF8A 4XWOD 2H2SD 3MLRL 4XNMB 1C16A 3L3OA 3MBED 1DFBL 2HN7A 3VFVB 3ZHDA 3T3PF 3JWDL 3RX5A 2YK1H 5CSZB 3TH2T 3CXDH 5HHOB 4JPKH 3AY4C 2VZSA 4QRPB 2EDXA 1JNHB 2QQLH 4KMTL 4XB7A 1F8TL 2N56A 1NCUA 3C08L 3T3MF 3THMH 5TH2B 1RZIB 2DQTH 4C83A 3BZDA 4XPTL 3MBEB 4MA8L 4DCQB 2F9BT 5EWIL 4DGVH 2ZPKL 2NYYC 4ZXBD 1A9EB 3Q1SH 3STBA 5T5FL 4F7TA 1EA9C 3BWUC 5FGCE 3HUJA 4WNQB 1YEIL 4NNYA 1P4LB 4AMKL 4BZ1H 3DUUB 1SJHB 4RWYL 4JCLA 4LMQI 4POZD 4XHJD 3OKEB 5T3ZD 2PYED 4RAVA 5D6CA 4ZXBB 4WHTA 4J8RB 1BOYA 3AB0B 3HLAA 1TVHB 1FGNL 5EPMB 1F3JA 2Q6WA 3FB6B 5C2UB 2ZJSL 3NCCB 2AJVH 4RISL 3ISWA 4DEPB 4DGYH 2PYEB 4OKVB 5K9OB 2AERT 3EO1A 5FIEA 2OL3L 2VC2L 2VXVH 3F7VB 4B41A 4K2UL 5DJ8A 4KHXL 1U93B 1XZ0A 1ZV5A 3L6FA 1FL6A 1CVRA 4BH7B 3MGAA 5BVJB 3HCVA 1V5JA 1CE1H 2CGRH 1F4WH 3GBNL 4J2XA 5C8JB 4U6XA 1M71A 4ZTPH 1CLZH 1YPZA 5CLWA 1XGTB 2WBWB 3C5ZD 2IQAB 2BCKA 3MODL 4PJCF 1FCGA 2GAZB 1YMHA 4M1CD 3TV3H 3K80A 3SQOL 4TNWF 1K4DB 2PR4H 4JKKA 2FSEB 2HVKB 2DLGA 2EDQA 1HIMH 2C3WA 5F89A 2B4CH 3L3HB 3D0VA 4QWWD 3WDHA 5ICXB 2X4QB 4RMUA 5IEKA 1P7QD 8FABB 4Z0BH 4XCFH 1UA6L 3BPLB 1FL3A 1N8ZB 2ZSWB 1MEXH 5ID0B 1YNKL 4YHMH 4R2GD 2NY2C 4M3KB 1T4KA 5FV2A 1CS6A 1WZLA 5D9SB 3VDCA 1P7KA 3O2VL 1NJ9B 3TCXA 1P7QB 3QWOB 1CGSH 3MRJB 3MRCB 4Q97A 5ETUA 4D0DA 4FQCL 5C08A 1LE5A 1PFCA 5DQ9B 4LPTA 2FWOB 4R2GB 3HZVB 2WANA 4NNPH 4PJBE 1JV5B 3C60C 5GSRB 5KSAA 1RZ8B 3HI5L 25C8L 1O0VA 2AABL 3GMRB 2DQGL 1EX0A 1U8KB 4LGRB 2DRUA 5DQJA 5KSBB 3VFSA 3MMEB 3MRIA 1CQYA 2BVEA 4L9DA 4OT1H 3QRGL 4NZUL 3GJFA 5CJQH 4QT5A 3UDWC 1U0QA 3VD3A 1F4XH 1W8OA 5SWZE 2AJYL 4E41A 3LD8C 1J9CT 1S9VB 5JLZA 4XGZA 2FGWL 1AD0B 2VLKD 3RWJA 1G9MC 3KPOA 8CGTA 1JN6A 4UU9A 4TOYH 1MQ8A 3C2AH 1UWGL 3MZGB 4I4WB 5F7NC 2ED7A 5HVGB 1W72A 5JO5A 1UFUA 4LCWE 4AY0A 5E8DL 5A1AA 1KN2H 3IVKA 4HUUA 3O9WA 4GW1A 3HE6C 5D7LA 4KXZI 4WI4A 4AENB 2VLKB 4UT9H 1MRDH 5B3JE 2NY7H 1IT9H 4O51B 2Y23A 3VXPB 4C59B 4FN0A 4U7KA 1YDPA 5INDB 5D8JH 3VH8A 1ZVYA 1VKXB 3PHSA 3QXUA 3X14A 1NH6A 5JR1L 4PY7B 1SM3L 4HX1B 2EIZB 2NY6C 1PKQE 5E7FA 4Z7WF 3FJTA 2P8MA 1AHWC 3H9ZA 4HULB 3ZLQC 1KIQA 4PJEE 4QHKJ 4GKNB 1XCQB 1CTOA 1A4KA 1CGYA 5IVXA 5C0ND 2F53A 3HPJB 4EDWH 4PLOB 4Z7NE 1G0DA 4P5TC 1QVOA 4UBDC 4Q9RL 4RNRA 2X41A 4XNQA 4KAQH 4TRPL 1Z0MA 1T21B 4TN9A 4Z7QF 2Y72A 1I8IA 1F4HA 2OXHA 3LKQB 4DN3H 4ENEC 3C87A 3EUUA 2AV7A 4U6TA 3WKML 4KZDH 3K2UH 4QXTA 2CKBH 5IOPB 3FFCD 2ZCLH 3OG4B 1S5IH 1A0QH 5HXMA 4WWKD 5HI4C 3KYMB 4Y16A 3Q48A 3HA0A 3R06B 4LARH 1AC0A 1U8IA 5BZWB 2ZUQB 3ULVD 3MV9E 3MXWL 3TJHD 2AGJH 5C0AD 3K4ZA 4BUHA 1S78C 2IMMA 2J5LB 4YBLC 5F9JB 5L0QB 4LSUL 1KCRL 4WEUD 3ULUL 5EB9A 3FFCB 6FABH 1NCNA 4R96B 5GISH 4A2LA 3FL7A 1BAFH 4WWKB 5CILH 1AGFA 4BELD 4YHIB 2PO6A 4ZFGL 3B2UD 1MCJA 4IRSD 5DRXB 5C0AB 2VLJA 1Y18A 4HUWA 5JIHA 4GAYB 4YHKL 3RTQD 3OQ3B 1WBXB 3KPRD 1P5VA 5K33A 2I5YH 2V7HB 1N7MH 3KPMB 3VXSE 3BJLA 4LP4A 3MRHA 3AS1A 4IRSB 4B7LA 3RU8H 4EOWL 2C3VB 4FQHA 2MCPH 1IZJA 1F42A 2X4RA 2H6PA 3RTQB 2HRPL 4S1DC 3KPRB 3VXRE 5D72L 4OD1H 3ZKND 4JRXD 1HWHB 4APQA 4D0BB 1IC5L 5M94B 2FJFA 1JGUH 3OKKA 5L7XL 2EO9A 4MMZC 5D71H 3QEQE 5MEQB 1Q1JL 2XY2A 3CMOL 5DDHA 4LDLB 1TETH 3SGKA 1QACA 1CGUA 1QD0A 2IALB 1HILA 2EH8L 4J7RA 4JRXB 4EXPX 3FAWA 1HINL 5L88H 1F3DJ 2UYLA 3D9AH 1VDGA 1IM3B 1FZJB 1NEUA 4DOHE 2D7PA 3GO1L 4PREB 2YPLB 3NABL 5GRWA 2J88L 2GSIA 3IDYC 4ETYA 4YGAB 1ZHLA 4AG4L 3WFEL 4HF5H 3U0WL 1I9EA 1JWSB 4RAUA 2H32H 4KUCD 2C7UB 4NM4L 5KS9B 4IIQA 1CN4A 4M43H 4JDTH 5ANMA 2A6KA 1RIVH 1WIOA 3MLTA 2J8HA 5HBBA 1XR8A 2VDRH 4K3DL 1LEGB 1QRND 3BT2H 1A4JA 5FB8B 4Y5XB 3ZHKA 1J8HD 3S96A 2G60H 3F5WA 3OGOE 5E94B 1RUQH 3P73B 4XXDA 2NXYC 2IAMC 5F3HA 1CT8A 3RIAF 1OF2A 3L5WA 4OCWL 3MLZL 4KTEH 3LB6D 3WJLA 5D5MF 1XMWA 1X4ZA 2QSQA 1QRNB 3RGVD 1VFUA 1XFPA 3DRQB 3L3KB 1RK1A 3I2CH 4JFXA 1J8HB 1D6EA 3O0RH 4ZYKB 3OX8B 1PZ5B 2R2CA 1X5GA 4EI6B 1QUNA 4H20H 5DFVD 4P2QA 3KLDA 2R8SH 1PZUB 4I9WE 2DM2A 5E6YA 3TM6A 2ZUUA 3RGVB 2W0LA 4NO5B 1DBAL 3LDBC 5IESH 2F5BH 3HI6L 4HZLA 5I66B 3STLB 4QLRA 1IL1B 4OZHA 3ARDD 4XCCL 5F7HA 3BIAX 2FEDC 1LK3H 5DHYB 3GSUA 2VXTL 4HUVB 1KJMB 2EDBA 4Q9QH 4LVHB 4N0UB 5ELIA 3O4OB 3IGAB 1B0GB 1KIPB 3QPQC 1U36A 3C8KA 3U4EA 4Y4FA 4NO2A 4YDLC 5IVOA 4YQXH 5IQ7H 4XMPH 1GOGA 4Z7UB 2JJSC 1X5FA 1ED3A 2AJZB 3ARDB 1AY1L 3QIWC 2EYTB 1EERB 4FTVA 5HSFA 4R7DA 3B2VL 1BLNA 2VR9A 5CUSH 5MEPA 2PXYC 3T08A 4TVPL 4ONGL 3C09C 1MNUL 3O6MH 2EEBA 3OKDA 2ZZUT 3VA6A 2W9EH 4Y8DC 1H15A 2C4XA 5GS1B 1WFOA 5F9OH 1C5CH 1QBMH 4HJJL 2P8PB 2BHZA 4HWBA 2NY3C 3HFML 3QISA 5B22A 4CGTA 5ADPL 1CXLA 4ZD3H 3G5XB 2WK2A 3MJGX 1S9WA 1S7RB 3S8WA 3T65B 4JY6A 4LBEB 2R4SL 5GRYA 5HHNB 1LO2H 3T0ED 4NP4H 2ATKB 4I13B 3R1GL 2V5MA 1EZVY 4QHLA 4I0KA 1EO7A 1INQA 5KN5B 4FQ1H 4Z7VF 4HD9A 3S35X 2XQYG 1F3RB 3ZYZA 5EH1A 3RVVC 3TYFA 5ITFA 4KU1A 1EUUA 5EUOA 3QNYA 4S0TD 3EJZC 4AIXA 2WMPA 4U33A 1A22B 3T0EB 1ORQB 4R4ND 4Z6AT 4JZJA 3RVWC 4I1NB 4KK8D 4O2FB 3TIEB 1WAAF 1E6OL 4EUPH 3W39A 5BQ7B 5F71A 1JMXA 1NCWH 2H8PB 4Q0XL 3ULSB 1CXFA 3RPIB 3T0XA 4CMHC 5C0CD 2QL1A 4WI5A 2J6EH 4MNQA 4XP4L 4Z78A 3T0BA 3IT8D 4O2CB 3O4LA 5JW5A 1QFUH 5BW7C 1CZ8H 4JFZH 3V52L 1S7SB 3OPZH 3V6ZA 4JKPL 1IKNC 1QRKA 3VXUD 2I07B 4J6RL 4WFGE 4YWGL 4X99B 4LPCA 2VLME 4NQVB 4L4TE 1GHFL 2VQUA 1K6QL 3SDAD 3V4UL 1ZT7A 1XEDA 3CX5K 3RUGE 4XNZB 1T89C 2ARWA 3U6RB 1AR1D 1OB1A 4OSUL 1YEKH 2UZYB 4U1JA 4CNIB 1UQSB 3VXUB 3LN4A 5JHDE 4HEPG 4PRPD 1LEIB 4RQQB 1N5YH 4PJ7E 4BH8A 1TJHH 5GS0C 5MEOB 1H3XA 1OAUL 1FYTB 1RUPL 3WFCH 3BWAB 3R8QA 2VNCA 5D7JC 4C56D 4WUUE 1WFUA 4NO3B 5H94B 3NCJL 3QEUA 2DJUA 4YBHA 2BDNL 2E9JA 2ICEA 4L4VA 4PRPB 5J1SC 5DT1H 1V8HA 1MWAH 3ME0A 1DL7L 1G7MA 1G9MH 4NPYA 1C1EL 4KVNL 4FP8H 2EDHA 2OR9L 3QDME 1RQ5A 4K55A 4PBVC 3X3GL 1QTYT 5CZVL 5LGKA 4PLNC 2B8OT 3QEHB 1B4RA 4P2OA 4FFWD 3OG6B 1W0YT 2OL3A 1ZLVH 4HPOH 3MV8A 4PGDA 1JGLH 3RAJL 1Z9SA 1Q0YH 1FLRL 4PIRF 2R15A 1JPGA 5T1MB 1KUMA 4N1CA 2VQTA 1T2QH 2CIIA 1BQHB 4HKBA 1BREA 4I48B 2R23A 4CW1B 1U3JA 2CUHA 2D0HA 4G6FD 3SDXB 3CDFA 3VH8G 1EHXA 1II4E 1UKTA 1D5XB 5DJXA 3PHQA 3QSKB 2X4TA 2CXKA 4OCYH 5D7KE 1AKJA 2W60A 4HG4K 5I1AA 2RBLA 3WEXB 1U8PB 2J8UE 4NYLA 4GOSA 4G6FB 1BFVH 4H1LH 2G9HA 4MVBC 2WWKT 3NFNA 1PYWB 2Y36H 5HVHB 5JXEC 5J12C 4WTXA 5HDQL 3ZDZF 5INCA 3KLAA 1MHHA 1AP2B 3DV6B 3MROA 4HAGA 2YK1L 3HC4H 5D2NB 5FYJE 4YUEL 5DMGD 3OL2A 2B1AL 2UUDH 1C16B 2HN7B 3L3OB 4N9OB 1Q0XL 3LPWA 2ID5A 1AH1A 4F33A 1J0IA 4G5ZH 5FGBC 5F7WC 4PJHF 4C83B 1OW0A 1GGCH 4FQPA 3SO5A 1WV7T 5FYJU 1KPVA 2BXZA 1CBVH 1F2QA 3JTTA 4XXCA 3IFLH 3QDGE 4FZEH 3WL9A 3T4AA 4F7TB 1OAZH 1T22A 1TCRA 2E9IA 4Q2ZA 3GMQA 1SYVA 2DQDL 4NHUA 4GG8A 4NNYB 2QKIA 2WINA 2DWDA 4K94C 3PHOA 5MERB 3TF7C 4EQ2A 3O41A 1EHAA 3O6FA 5D6CB 1R0AH 5FKPB 4DGIH 4WHTB 2EYRA 3REWA 4UV7H 3WIHH 4GBXB 6CGTA 3HLAB 2J8OA 1N3NA 3BE1H 1F3JB 1YY8A 3CC5A 1B4JH 3GSNH 2VXVL 4JFDA 4X4XA 1MREH 5JW4M 2K1MA 1RPQA 3GSVB 3EO1B 4X9HA 5GS3A 5LXGH 1JF6A 4R90H 4YHYC 4Z76A 5DJ8B 1H0DA 3PXJA 1XZ0B 3L6FB 3WNMA 5C6PB 5HHVL 1FL6B 4MCZB 3SDDC 2XFXA 2D7QA 1NCBL 3G08A 2JCCA 3HCVB 4RMQA 1ZWIA 3HG1E 4PRIE 2FLBT 2ICES 1M71B 4MYWB 2NY5H 2HG5A 2GK0A 4U6XB 1KEMH 3PDOA 4LASH 1YPZB 5EZIH 35C8H 4BUGA 1TQBB 3VWJC 2BCKB 1HEZA 3VFMB 1LK2A 1YMHB 2IANA 3O3DA 2AQ1A 5J6HA 1OL0A 1IC4L 2VJXA 4XCFL 4DZBA 3L7EA 5DMKA 1MEXL 5TGBA 3D0VB 5IFJA 4P2CG 2NR6C 5IEKB 3BAEL 1KSRA 4QO1A 5C08D 2DQIH 5DRWA 4XZUA 3H42H 4K71C 1JVKA 3A6OA 1DVFA 3BGFC 1KLUA 1BHGA 3DX7A 1T4KB 5KSAD 1L0QA 5LCVL 1KCLA 1CGXA 4PJGA 1P7KB 5DTFB 3T3PE 2JJUA 3ZKXB 2Q8BH 4NNPL 1WT5A 5ETUB 4D0DB 1LE5B 3K8LA 4KI5D 4WEBH 2ZCHL 2PW1A 3A6CH 3HRZB 2IBZY 1UT9A 2IG2H 2M2DA 2VZTA 5KSAB 4UMGA 4OI7A 4EZMA 3JVGA 1KPRB 1NMCC 3EFFB 4LPXA 4X5WB 3W81A 1CWVA 1S7UA 3B3IA 3NFSH 4HXAH 4NQDE 1IAKA 4R0LA 4AL8L 4E41D 3VFSB 3EJJX 3QUMH 5I17A 3MRIB 3GRWH 3O6LL 4MDJA 1IFHH 2JE8A 5GQBA 1PSKH 3MRPA 1F4XL 1UM5L 1K5NA 1KCUL 1T1ZA 3U9PL 3WJJC 1UYWL 4NKIH 3FQNA 3GJFB 3EO9H 4QT5B 4M48L 4NKDA 1YEGH 3Q6GL 3CSBA 4OLVH 3O9WD 3C2AL 5JLZB 4XGZB 5D7LD 4NZTH 3TN0C 3RWJB 3KPOB 1MQKH 4WEMB 1JN6B 4UU9B 5DA4A 1KN4L 5J11B 2VR4A 5IHUH 2BVUA 5JO5B 3LH2H 2YUWA 4GLRI 3QIBA 1EFQA 2QHRH 3WO4B 1GGBL 1MRDL 2NY7L 3IVKB 4HUUB 3UTTE 3O9WB 5IEHA 5TE7H 4GW1B 4FFVD 2MFNA 4YIQA 3I50H 2VAJA 1WZMA 3ARGA 4DFHA 1BWWA 1YDPB 2AK1H 1XIWA 1OSZA 3VH8B 5D96B 5E95B 5KTEH 2F53D 5F1KC 4Q6IA 3DHMA 3SN6N 3X14B 4PJCE 2DN7A 4D8PA 4LKXB 4LAQH 3CU1A 2P8MB 1OHQA 4FABH 1UJ3A 1KIQB 1MFDH 2BNQA 3OJDA 4EDWL 2MTPA 1A4KB 3I6LE 4OAWA 3NACL 1ZANL 5IVXB 2F53B 1IKFL 3MPCA 3FO9A 4CAGA 4GQPH 1QVOB 5AAMA 1MJ8H 4K3JH 4RNRB 4K3HA 1P69B 3DGGA 4XNQB 4OI9A 4KZDL 2X5PA 1I8IB 2R0KL 3K2UL 4Y16D 2CKBL 4OGAC 4WFFE 4PUBL 5HJ3A 3EOBB 2ZCLL 1UM6L 5FOBB 3VFUA 3HI1A 2AV7B 4XC1L 5IFAH 4QXTB 1A0QL 4ETQB 5GGQH 4P59L 5KSBF 1I9RH 1P1ZA 4Y16B 4K9EC 3V6FA 4Z8FL 4MWFA 2GJ6E 2PO6D 1U8IB 4Z95L 6FABL 3IDIA 2QR0A 2OMBA 2E5EA 2VLJD 3BPNB 1XGYH 1JWUA 1GXEA 1ODAA 1IARB 4GKOA 2NXZC 5GGSY 2Y7QA 1AGFB 3UJTH 5C0BA 3ET9F 2PO6B 2HKHL 3FQTA 4EN3A 2VLJB 5A3ID 5F21B 1Y18B 4HUWB 3KPSE 2I5YL 5CJOH 4GUPA 2D4DA 2R9HC 5CEYA 2V2XA 4FQXC 1I1YA 5F9DC 3GDBA 4NQSA 4APQD 3BMWA 4POYA 5JPNA 3MRHB 2E7CA 1JWMB 4NRYA 1EEUA 4I0CC 4FQHB 4QNPE 4WW2B 4HUMB 2HJLB 2X4RB 5GS0H 2H6PB 2LU4A 3MUY1 5D71L 12E8H 3AREB 4WHDA 3NCFB 5KVFH 2BRQA 2FJFB 2H2PD 1NC4A 3OKKB 1AI1L 1IEBA 3WXWL 3MLVH 3BKMH 5DDHB 5DEGA 4X80H 1MLCA 1NCCH 1X44A 2ADFH 4JR9H 3RJQB 1DUYA 5J56B 1HILB 3SPVA 3K4DA 5E2UL 4WV1B 4UAOC 5MENE 4N9GA 3SY0A 2UYLB 5L6YL 4K7PX 5L2KE 3CFJA 4HKXB 3UTPE 4U0RB 3EBAA 5E4IA 2DLEA 1LO0H 4DFIA 4ELME 3IETB 5LGHL 3DTXA 2GSIB 4OQTL 4KRNA 1FFQA 5JQ6L 2B39A 5FYJH 3QHZH 3BKYH 4OQ1A 2E3VA 5IBTH 4WDIA 1RZKL 2OP4L 2XZAH 4RAUB 1E0OB 3VI3F 4Z7QE 2XG5A 4IIQB 4OGYH 5ANMB 1ZK9A 2A6KB 1G6RH 3MLTB 1Y6KR 1U58A 2NTSP 1H5BA 5IMOA 3RVTC 1GZQA 4ZSOE 1XR8B 1YEJH 1QPXA 1BJ1H 1JRHH 1IEAA 1A4JB 4OCLC 4HW6A 4XMKH 4I3SL 2KZWA 3S96B 3F5WB 5CWSB 3TPUA 1I1FA 4KTEL 4XXDB 3LKPA 3V0WH 3H7LA 5F3HB 1CT8B 1LVEA 4QHUA 3BZ4A 4LRNL 1OF2B 3ARBA 3L5WB 4P2QD 3DYOA 3A6BH 3GM8A 3IJHA 4QXUL 4FG6C 1RU9L 2EDWA 3ULVF 2D7MA 1QYGL 3KLHC 3IAGC 1A6PA 2QSTA 4HHAA 4PB9L 4XP9H 4Y0GA 2C3HA 1RK1B 4H20L 4JFXB 1D6EB 1INDH 3RBSA 1IGJA 5EBLB 1XF5A 4O2EA 2FL5A 2X4UA 4ZUUA 4P2QB 2MOVA 3CD4A 4C57C 3DYMA 2GY7B 1AXTL 4U6VL 3VG0H 2YD7A 4OLYL 4NQCA 1ZLUK 1TITA 1T7WA 1X3DA 1I8MA 4X6CF 4Y4FD 1LK3L 5JIPA 3T2NH 5HHXL 4HZLB 1OTSD 1B2WH 4LQ1A 3EDDA 1IJ9A 4OZHB 5ACMA 2Z8SA 4FTVD 3GSUB 1CCZA 4CDGC 5AZEH 1K9TA 2CIKA 2XG4A 1MY7A 1AQKH 3C8KB 3U4EB 1I3RA 4Y4FB 5BS0A 1URLA 4AEHH 3HZYA 2EO1A 4PRAA 2D7OA 3NA9L 3V5KA 1Q38A 3QQ9C 4FTVB 4U0QB 3PGFH 3QG7H 3QQ3A 4R7DB 1BLNB 5C9KA 5MEPB 3MLSL 4K94H 5F9OL 1EXUA 3OKDB 3GBMH 5K9JH 1H15B 4M9OA 3SJVB 1S7QA 1NL0L 1KLGA 1WZKA 2JIXA 4G3YH 1NBZA 2C5DC 3HZMA 1QFWI 3LKOA 1MCPH 1CICA 2XA8H 5I1DA 4Q74A 2P5EE 4G6JH 4U6YA 1S9WB 4MQXC 2NY0D 4JY6B 3L5XH 3VCLA 3F6IA 4ZOBA 2CLVA 4KUCF 2CJUL 5GS2D 1NGWA 1Z3GH 4HPYL 4NZRH 4QHLB 4MLSA 4CVUA 4A6YB 2YMXL 1WCBA 3U82B 4OFVA 2V7NA 4GFTB 5FO9A 2NY0B 5ITFB 2EXWC 5EUOB 4PG2C 2AQ3A 5I74C 4XVUD 1EBAA 4N0CC 2AVGA 1MFBH 5F7FA 1CDYA 1NCWL 4MNQD 4JZJB 3UZQA 5F7DA 3O4LD 2VXUL 1QSFE 3HMWH 5D5ME 3W39B 2P46B 3OV6A 2J6EL 3B9KC 4JFOA 3B5TA 1JZ3A 3MTRA 4XNYL 1QFUL 1FG9C 4PR5A 4JFZL 1F90H 4Q9CA 1MCEA 4FFYL 4Z78B 4IBLT 2HVJA 4HK3J 2AK4A 2H45A 5E6ZA 3O4LB 2MQ0A 4XI5C 4YPJA 5JW5B 3BRDA 5I19H 1QFWM 4XC3L 3PG2A 4I0PC 3V6ZB 5IBLD 3MV7E 5B38A 4JFPA 3ZT5A 3P4MA 4W4OC 5J3HC 5E2WH 3QEGL 3ARRA 5E8OA 1RZ7H 2Y25A 5CEXA 1YEKL 1OQXA 4TPRL 1ZT7B 2PUQT 4Z7UF 2IGFL 5EOQH 3KYNA 3KYKH 1R5IA 1OB1B 2ZUVA 1N5YL 1VGEL 1TJHL 2YRLA 1XR9A 4XT1C 3MZTA 1LNUA 1A6ZA 1T5WA 1M7XA 4G9FE 3WE6A 3LN4B 1QQDA 4L4VD 4BQ6A 1I7ZA 5FEBA 4BH8B 1F4YH 1KFAH 5EOTA 3EYOA 2GT9A 1ZTXL 2AEQH 2QSCL 2F8XC 4YFLI 4MNGA 2OZ4L 4IMLA 3PWLA 3QEUB 4YBQD 1N0XL 5F44A 2ICEB 4L4VB 3TGXA 2BFVL 3QWQB 4P2OD 3FRUA 4JZOA 1P6AB 2P48B 3MV8D 3MSPA 3WLWC 1G7MB 1RIHL 4NPYB 2I60L 4DUXA 1E27A 2HJFA 1PLGH 1IE5A 1FO0H 3TO4C 1RJCA 4NFBA 1UWEH 1TZGH 1HXMB 4JDZA 2CK0H 3GIZH 1B9ZA 1JPSH 3KJ6L 4P2OB 3V8OA 2OL3B 1YYLH 3MV8B 4PGDB 4YAQA 1U8NA 2QHLA 3WXVH 4JLRA 1OWWA 4TSCH 1JPGB 3MV11 4QGYA 43CAA 1X5AA 3IAQA 3SGJC 4Z7VE 1JFQL 4PJBB 3HB3D 2HT4C 1P9MC 2CIIB 4HKBB 4I2XE 2RQ8A 1H8OA 3MLWL 3VMNA 4FZ8L 4FMKA 1AKJD 2R23B 4YO0A 4MXQD 2R29L 1FNSH 5AAWA 1WAAE 3D3VA 3K2MC 4JN1H 2X09A 2BHUA 2ZUYA 5FUZL 5DJXB 1D9KA 3PHQB 1CL7I 3V6BR 4K3EH 2X4TB 4W81A 1MFAL 4U4BA 2W60B 5I1AB 2EIDA 4NWUL 3TT3L 3DSFL 4HC1H 1X9QA 2G9HB 3NFNB 4G43A 3HC4L 2Q8AL 1RZFL 1NUFA 3VFPA 4Q6YA 3KLAB 3P30L 5I6XC 5E08H 3MROB 4ONFL 4X6BA 5FUCC 2FBJL 4LNRB 2ZOKA 3FN3A 4MA7H 4NZJA 4LVOB 1G7LA 4G5ZL 2AXJA 5I8KH 2YZ8A 4NSKA 4K9EH 5ITBL 4HMEA 4F33B 3Q5TA 4YK4B 1XGRA 5HHPA 1GGCL 3GUTA 2XYCA 1NLBL 2P1YA 3U7YH 4ZUWA 4J3OC 3SBWA 4JN2A 3EOTL 3BGAA 3G6AA 4G8IA 1RK0A 4FZEL 2FIRT 3MJ7A 4TSAH 5I8CA 5AZ2H 4AIZB 3FQXA 1KPVB 4S1RH 3JTTB 1IM9A 3BEWB 3O6FD 2DL9A 4NJAH 3WL9B 4YXLL 2O93L 1DEDA 3T4AB 1T22B 3OAUL 1TCRB 4Q2ZB 1SYVB 3QI9C 2PN5A 4NHUB 4NUJA 4O5LH 4PJEB 4GG8B 1FORL 5CGYC 1CLOH 1JGVH 5FHAL 2QKIB 1EHNA 2WINB 2DWDB 1JK8A 4KQ4H 3RWDB 4JFDD 3WIHL 4ZS6D 2DI9A 1G7HA 4NIKB 3O41B 3O6FB 3TESA 3REWB 4PYGA 4HH8A 1MREL 2R39A 1N3NB 3EO0A 3VRIA 5FUCE 1YY8B 4PRNA 3CC5B 1J0ZA 5T3XL 2FYYA 4JFDB 4X4XB 4N0FA 2X44D 3T1FA 4G8GE 3SDXF 1CK0H 1QFWL 2IAND 4N8VA 4CUCA 3S5LA 1H0DB 4WHCA 4JFFA 2NY5L 2XFXB 5EZIL 4OTXH 3NVQA 2JCCB 2ZG1A 1QPPA 1ZWIB 3GI8L 4WFEE 2HG5B 2GK0B 1TTUA 3EJYC 1EFXA 3ESVF 3PDOB 4QHMB 2VZVA 4V1DA 2DBJA 5C0DA 5I9QB 1HEZB 3L7FA 2IANB 2EE2A 2F54E 3U30C 2VDLH 4UT6L 5J6HB 1UM4L 3MRRA 1DVFD 3D5OF 3ZL4L 4DZBB 3L7EB 4BA8A 4E9LA 1KBGH 4P5TB 3N50A 4GMTL 5IFJB 1GYAA 4Z0XA 2E7BA 4NM8L 1MVUA 5DRWB 2CKBA 3DHJA 5FAAA 5ISZA 4XZUB 3HAEA 1A6WH 2D7NA 3ZDZE 4P9MH 5TJWK 1DVFB 3SE9H 1KLUB 3B83A 5LBSH 3DX7B 2Q8BL 5I76A 3ORJA 2PTVA 5HDBF 4NQTA 4PJGB 3ARFA 3QJHA 4M8QA 4HJ0C 4P4KC 3MOAL 4ZAKA 1FH5H 5J7CC 5GGVH 3SKJL 4KY1L 5DMIL 2PW1B 4NRZA 5I2IB 5F7LB 2DQFA 4LHQB 4XNUL 4L1DA 3H9SE 3NFSL 4PJHE 3V4VH 3E8UL 2ILLA 2DQHL 3TT1L 3LRHA 3QUML 5SV4A 3E2HC 5JA9A 5JW3H 1S7UB 3B3IB 1DBKL 1IAKB 1ZLSH 4R0LB 3QCUH 4YZFE 1GVIA 5I17B 2A0LC 1IAIH 4KKAD 4G7VH 3MREA 4MDJB 3UYRH 4GT7A 2EXYC 3MRPB 1YEGL 1AR2A 1T1ZB 1BOGA 1YA5A 1KELH 1H3UA 3FQNB 1CR9L 5CBAA 2A6DA 4M9PA 4NKDB 3QIBD 1E4WH 2P42B 4LEXL 5ILTH 3FHQA 4HT1H 2JKXA 2ESVE 3JV0A 5GJTL 1MQKL 4ESKA 3IJSB 4HGKC 4F57H 3PWNB 3S36X 4YX2H 2NY1B 2YUXA 3ARGD 2DQUL 4R26L 4KTDH 3BN9D 1XIWD 3LQZA 1DE4A 3CDCA 5FUOH 3I50L 4ODXB 3BX7C 4XWOC 2H2SC 4LHUA 1YPZF 5DXWA 5IEHB 3OKNA 2WWMD 3MBEC 3RVUD 4YIQB 1K8IA 3ZE2F 4NUGL 1Y0LA 3NTCH 1RSFA 4ZUSA 2BNQD 1FNLA 3ARGB 4UV4L 1L0XA 1FNFA 1XIWB 1OSZB 2P24A 3GHEL 4YHZH 1LO3L 1VACA 4PRBA 4Q6IB 1FE8L 4FABL 1MFDL 3EYUH 5DC9B 2K9UA 3OTTA 4D8PB 1CD1A 3FOLA 1JYVA 1HZHL 1UJ3B 2H1PL 3OJDB 2BNQB 3KHQA 4ZXBC 4ONOA 1QR4A 1I9IH 4OQTA 4L8BA 2H32A 3RWIA 3AB0C 3BH8B 4OAWB 1VESA 1FCCA 1JZ6A 1QEWA 3FO9B 1J0HA 3B9DA 3CK0H 4TQEH 4DEPC 1J1PL 4XHJC 4KH2A 5HHOE 2CMRH 5GJSH 3K8MA 3DGGB 2MHAA 4QRPE 5EZOL 4XP5H 1KACB 1B88A 3U0TA 4XVJH 1J18A 5F93C 1DQJA 1CL7L 1V05A 5GGQL 5FKAA 5HJ3B 4IDJL 3VFUB 1A1NA 3HI1B 3PV7A 4FMFA 5I1CL 3WN5A 3OB0K 4BFGA 5JOEA 3IFOA 3VGHA 1CFTB 4LKCA 3JBG7 3G5YB 1J05A 4OF8A 2ADJB 3V6FB 4F9LC 5HGBA 4MWFB 5C0BD 5HPOA 1TMCB 4U1KA 3IDGA 5HYEA 2VQ1A 3IDIB 2QR0B 4EN3D 3UPRA 3WD5L 3MUGA 1L0YA 5DD3L 2EDYA 1PGRB 5F7UA 3T0DA 1QA9A 3BPLC 1NMAH 3DROB 4NGHH 2Y7QB 2KQNA 4L9LA 1Q72H 4M1CC 5C0BB 1C7TA 4OLEA 3FQTB 4EN3B 1I7TA 3GBLA 3UO1L 1G9NC 3IDMA 4GUPB 5CEYB 5T3ZE 3P0YL 2PYEE 1HYSD 2V2XB 4QWWC 1I1YB 1WVZA 2Z92A 2OYPA 3BDXA 1KC5H 4NQSB 3H9HA 2Y07L 4KJYA 1NC4D 5B38G 5JPNB 4FQ2H 4F9PC 1OAYH 4NRYB 4R2GC 4TVPD 3S35L 3FT4A 5E2TH 1H3WM 3WMSA 3EYFA 4XCNA 2VN7A 5HYIA 3VFRA 4BFEA 1WTLA 3B43A 1KENH 1A7BA 4RFNB 3UC0H 1N64L 3IFNH 1NC4B 3CFKA 3WNLA 2JB5L 2ADFL 4JR9L 1IEBB 1WFNA 2HKFH 5DEGB 1ZEAH 1WZ1L 5BVPL 1Q9LB 1DUYB 5CJ5A 1FQ9C 3WFBH 1WITA 4NKOA 2IPUK 4G8FA 1S7VA 4TYUA 4N9GB 3U7WL 2ITCA 2NY4D 3N85H 1I8LC 4JO3H 3SY0B 1ZGLM 3CFJB 4JCMA 3QHZL 3BKYL 4GAJH 3SOBL 3DTXB 4EI5A 3FONA 4PV9A 1OP5K 1MFCH 1RVFH 4WDIB 1JTTA 2NY4B 1G6RL 2D9QB 3OR7A 5HPMA 3QUXA 3ARBD 1NMBH 3BXNA 4XMKL 1A14L 2A6IA 4JQIH 5IMOB 1GZQB 5DD0L 4JHAH 5C7XH 5I1GH 3V0WL 4LSSH 1IEAB 3DRTB 2V2WA 3O8XA 2B2XL 3QXAA 5KSBE 3CU7A 1I1FB 1EUTA 3LKPB 3MR9A 4HUXA 4RMTA 4BSVA 2P5WA 4D9QD 4QHUB 1YECL 2J6EA 3BZ4B 3F58L 3ARBB 4MZ3A 3IJHB 2E7LC 2MSPA 1MJ7L 3ZT7A 4RGMB 1C7SA 3NCEB 1A3RH 4HHAB 4NQCD 2X4PA 2F58L 1MCHA 3PNWA 4KK6D 4ORGA 1IGJB 3S97C 1VEPA 4O9HL 1XF5B 4O2EB 2FL5B 2X4UB 3VG0L 4ZUUB 2DF3A 2DLFH 3DECA 3QDMB 2YD2A 5JOFA 2NCMA 1J7VR 4WW2F 4NQCB 5C0NC 4JQXA 1GPOL 4IOFD 1ZKAA 4DKFH 1I8MB 2R2BA 5CGMA 1KJ2H 5BS0D 3B5GA 2VLKE 4PJDA 3MQIA 3V9FA 4EDXA 5J89A 1R5WA 1AQKL 5K93A 4F37K 5GZOD 5HGHA 1MIML 1DQLH 2ZUQC 2K7QA 2CIKB 1FVCA 2VITA 4M6OL 1I3RB 2J5LC 1R3JA 1A6UL 1X5YA 5BS0B 5L0QC 1J5OL 1L9NA 3HZYB 3MCLH 2A38A 4PRAB 2OZ4A 1IQWL 2IEPA 2JIXD 4XBEH 5D7JB 3V5KB 2XY1A 5FCUL 4WWKC 3QQ3B 2HLAA 2DM4A 1CICD 5CJXA 3K1KC 3LEXA 4GMSH 3ULVC 3ZZ1A 3TJHC 4R8WH 1UACH 1CIUA 3BD5A 4G3YL 2X1PA 3LKRA 5GRJH 4YE4H 1S7QB 5BV7C 1MCPL 4M6ML 2XA8L 4J3WA 4WI6A 4L8DA 2JIXB 3X12A 1T04A 4OCXH 3FB8A 2VDQH 1UCBH 3HZMB 4RGND 1HKLL 3LKOB 1RI8A 2O5XH 4OZIA 1CICB 3B2UC 1N4XH 4IRSC 5BRZA 1GIGH 1SJXA 5KVDL 2A9MH 4QCIA 4EVNA 3CSYA 3JSSA 4MAYA 3RTQC 3MV9A 1ZT4A 5TE4L 3V0AC 2GCYA 3VCLB 1DN2A 1XGUA 4F2MA 2CLVB 5DVNA 4UDTA 1NGWB 4RGNB 2CLZA 4JG1H 1TTFA 5IB2B 4GSDL 2CDFA 4NN5B 2NW3A 5IGXH 4JANA 1YC7A 2V7NB 4W6YB 5FO9B 3FFCE 4N8VG 3S5LG 2LU3A 4WUKL 4X6EB 2XTJD 2Z31A 4R4FL 4AQ1B 5CP3A 3ZKNC 4P2RA 2X4NA 2OJZH 3CNKA 3BZFA 5EFIA 1LO4L 5F7DB 2AK4D 1T83C 4P23A 3ULVE 2FNBA 5C0AE 1A7OH 2HYMA 4UIMB 1FPTH 1F90L 4TULL 1UKSA 3F7YA 4JFOB 3LIZL 2XTJB 4JDVA 4PR5B 2Z4QA 1EVUA 1EGJL 1ES0A 2HVJB 2AK4B 1EO8H 1NEZA 4OZHF 1CGVA 2R0WH 7CGTA 1R3IH 2Z8RA 1RZ7L 1LO5A 5B38B 1F97A 4JFPB 3UTZA 2FECI 3HAEG 3KPRE 5EBMA 3P4MB 1GGIL 5EBWA 1A9BA 1BVZA 5CEXB 2DQCL 5A16A 5C0EA 4Y5XC 1P4IL 2WIMA 1AFVH 1J1OH 1BBJA 1PG7H 1R5IB 3BFOA 1TVBA 4UOJA 1F4YL 4RCAA 1XR9B 5D70H 5TDNA 1LNUB 1MRFH 1A6ZB 1T5WB 5IROC 1T7XA 4KPHH 1QQDB 3BUYA 5F7EH 3WE6B 4KDTA 1FVDA 1I7ZB 4LLDA 4CJ0A 3Q5YA 3QAZC 4QTIL 2AEQL 3CLFH 1RUKH 4JRXE 5FM5M 4CU6A 5EOTB 1MJJA 3EYOB 1D5IH 4QOKA 1OAQH 2UZIH 1RZJC 1QHPA 4MNGB 1FIGH 4IMLB 3PWLB 2FX8H 2YPLE 5DURD 3WIHA 1DBMH 1X7QA 3RA7L 4D9LH 2CRMA 3LB6C 2WIIB 5I71B 5IW6A 3V5HB 2PTTA 3FRUB 1K4CA 5KANI 1OCWL 4BJLA 4S2SB 1FO0L 3RGVC 2C1PA 3N1GC 4NC0B 1UWEL 4TSBL 5I1HH 5C0RL 1JNJA 1H8SA 2G2RB 2ZNWA 5F6HI 3ZDYE 1KV3A 2HJFB 4X6DA 5KS9E 3TLRA 1BQLL 1YYLL 5I1EL 3W2DH 5DURB 5DFVC 4JDZB 3WXVL 1MRCH 2R0ZH 1Y6MR 1VCAA 4LVHC 3OKLA 4YAQB 1U8NB 3O4OC 4WCYL 1IAIM 5EUOF 4JLRB 1A7QH 2LVEA 4IOSD 1MFNA 4XPFH 1ZOXA 5CBEA 4OI8A 2VISA 3O3BA 5LQBL 4QHNA 3D3VD 3ARDC 1ZSDA 3BI9X 3MLYL 4LHUG 2D7TL 1D9KD 4RDQG 1SVCP 3ARSA 1QRNE 5IWLA 1UWXH 4PP1D 1J8HE 5GPRA 2HA1A 4YO0B 4XMLL 4RFOH 4K3EL 3VDAA 5BMFL 1X5JA 5GS1C 1DLHA 3D3VB 3FN0L 4MB3A 1D9KB 4K23H 1KCSL 4NQEA 3PDDA 3N9GH 1EEZA 5ABDE 3WHXA 2DD8H 5T3ZH 3TWCL 2EYSA 5I1KL 5J9PA 2BY2A 5I18L 4L5FL 4G43B 3NH7L 3C6SA 4ODVH 4OIIL 3VFPB 3VW3H 4MA7L 4EBQL 1D5MA 4CVXA 4HBQA 3N06B 4S10A 1NGQH 4H8WC 5D1ZA 2DBLL 4M8VA 4N0UE 1R3LA 4X6BB 2ZOKB 3QT2A 5E2VH 1QR1A 5F9WB 1G7LB 1U9KA 1FZKA 4X7SH 4Z7UE 4NSKB 1OTTD 1IM9D 1IC7L 4MAUH 5HHPB 3IDJA 3T0EC 3TO2A 3GUTB 3QUMA 2P47B 4ZUWB 5AZ2L 2OI9B 4JN2B 3GEWB 3VFWA 1NMCB 3PABB 3G6AB 4G8IB 2JJTA 1RK0B 1S7XB 1JHKH 4IRZL 5AEAA 3MJ7B 5I8CB 3BSZL 4PLKD 2KPNA 3FQXB 4OV5A 1AD9A 3DV4A 5ESQA 3WSQH 1IM9B 3MC0A 1SBSL 2EDTA 5C6TH 4PJ8A 1ND0A 4JPWL 4R4NC 2ORBL 1F5WA 1YMMA 1NDGA 4GXVL 4NUJB 1E28A 4KK8C 2DI8A 1G9NH 3CFEB 5BZDA 1UXSB 3AC0A 3OBAA 1WF5A 1JK8B 4GW4A 2R4RL 4S1QH 1A64A 1K3ZA 4ZFFA 2IPTL 1OGAB 1HI6B 3MNZA 2A1WH 1CD8A 2X89A 5HDLA 2Z0BA 4JG0H 1EAPA 1HHHA 4JFFD 3EO0B 4WHYG 4MQSB 1FGVH 4Z5RA 3VRIB 4PRNB 4XNZC 1BGXL 2YRZA 4GXUN 4PJBF 3U4BH 3CFIC 1U6AL 2E6QA 1MCKA 1HDMA 2FYYB 1LWRA 4OM1H 4N0FB 5FM8A 1EFXD 4M02A 3VFGH 4V1DD 1Z2KA 3T0EE 2DYPA 2XPGA 3T1FB 5EIQA 4N8VB 3BJ91 5EULV 3S5LB 3SDAC 4JFFB 2RJMA 5D6DA 5JTWA 1GH7A 1AR1C 2GKIA 4KKBD 3VMPA 4F7CA 4XHQA 4OZ4A 5C0DB 4PB0H 2VWEC 5FK9A 4UOW1 5MP6H 5ISZD 2W9DH 4LP5A 4YC2B 2RFXB 5EG6C 4KK5D 4MHHG 4LLWA 3ARFD 5C0CE 2DQJH 4BK5A 5T33L 1MY5A 1AE6H 4Z0XB 4F7MA 5DGQA 4Z18A 3FT3A 5CCKL 4NZDA 4ZAKD 1MVUB 2XRAH 2O26U 1BF2A 4OJFH 5DJDA 4KHTH 4OM0H 5ISZB 3HAEB 3V4PH 4JHWH 2W07A 5B3JF 3OGCA 4M1DL 1A7RL 2R0LH 5I76B 2IPKA 4LLVA 3X11A 4X7TA 3VXUE 5JHLH 3ARFB 3QJHB 4M8QB 5H37H 4BSWA 4UT7L 4FFWC 4HWEL 3IJYA 3RNKA 3C5SA 1NCDL 4ZAKB 4KV5F 1FYTE 1LEKA 5LGJA 4HIIA 4PJAA 4NRZB 1G84A 4EUPG 1T1XB 4OCSH 4JO4L 4PJEF 3LZFH 2YS4A 4PRPE 3DETD 3QCUL 3MNWA 4LSPL 3M1BA 2VWEE 4CN4A 1RHFA 3UYRL 5EO9A 4HIXH 4NOBA 4XNXH 3PWVA 1NCAL 4K7PL 3CPLA 3OJ2C 2XI9A 2GYSA 5C0IA 3MREB 4OB5L 1E4WL 3MGTA 3DUSA 4NJ9H 4HT1L 1WCQA 3LRSA 3P0VL 4HUNB 1BOGB 3T1WA 4M7JH 3ARWA 3P2TA 2X40A 2A6DB 2YEZA 4F57L 1V7ML 2XZQH 4FQXB 3CLEL 3STZA 4FQLL 1QSZA 4LHUD 2BOCA 3VXTB 4WENB 4LSTH 4KJPD 2OQJB 2BVOA 1KTDA 5DRNB 2JCCF 3LQZB 1ZGLP 1A6AA 1DE4B 5DWUH 3RKDD 2J4WH 1TVDA 5IHZA 4LHUB 1IGCL 5D93B 1S9YA 3OKNB 3S34H 5DHXB 3SDXE 1I3GH 2VDPL 3M8OL 1K8IB 3WIIH 4YHZL 1Y0LB 1HQRA 3MXVH 4PJ5A 4ZUSB 1MIEH 5T1LA 1ORSA 4O4YH 1AJ7L 3ULVH 2P24B 4NCC1 4ODTH 1VACB 4ZFOL 1GCFA 1QOKA 4PRBB 3UJJH 4QYOB 4NHCH 2BSSA 1U2CA 3GSWB 1CD1B 3FOLB 1RFDH 5A43C 4LEOA 1F11A 3OZ9H 4N8CL 2ICWJ 4L8BB 3FO0L 4LSQH 1GRWA 5I1JL 2DQEL 3RWIB 1EIBA 4OLWH 3QQ4A 5DD6A 4PJGF 1G6RA 3B8SA 3L1OL 1LDPH 3BEVA 5MI0B 3DBXA 2HWZH 1F58L 2MHAB 2DS4A 3U0TB 1CIDA 3BO8A 1DQJB 1ZHKA 5HDBE 5FKAB 5IT2H 2I26N 3ULUF 3NCYP 1T0NB 1MSPA 3CIQA 2C4FU 2AP2A 3WN5B 1JI2A 3FAXA 4PYHA 3IFOB 4ZS7L 3LMJL 1W0WA 4LKCB 5KOMC 1TQBC 5CD5D 5DVOA 3VD9A 1ULVA 4FXGA 1MAML 1WJ3A 3SEPA 3B8YA 5ESVA 3VGFA 5F1SA 4GG6B 3HUJE 4U1KB 3IDGB 1OAKL 5T1DH 4UI2A 2VQ1B 1D6VL 3L9RA 3S37H 3TJEH 3UPRB 3OR6A 2FHFA 5CEZL 2LABA 4DKDC 3MUGB 4NGHL 4MJ6A 1HOCA 2D31A 2WWKO 3FB7B 3BRGC 2FH8A 2Y9RT 4PJIA 2B1HH 3EKCA 4PGEA 1J0KA 3DGCR 5E9DA 4L9LB 5EDXA 5JXAL 3S88H 3CFCH 5AD0A 1MCNA 2Q86A 1L7TL 1I7TB 3L3JA 1LD9A 3I3BA 4V2CB 3IDMB 2Z92B 1VFBB 3HG1A 2APVA 3ZKXC 2HRLA 3MJ9H 4POUB 3H9HB 3ZTNH 2XKNA 5DLMH 3TC9A 3UXFA 2WUBL 4I8DA 3FT4B 3VWKA 4CKVX 1U8OA 1JZ8A 4UINL 3RNQA 1CGTA 5KSAC 2DLIA 3EYFB 2DDQH 4XCNB 2RB8A 1YPZE 2VN4A 5JW4Q 1VADA 2E27L 4BQBA 3SE8L 4NC2B 4WJ5A 1VFAA 3ZE2E 4LU5H 4HZAA 4KI5C 5IBUB 3CFKB 3OXSA 5FO7A 15C8H 1N26A 4HXBH 3K74B 3U9UA 4OCRH 1NAKH 3RDTA 3BH9A 1JMZA 4JO3L 4EI5D 2IH3B 4XCYA 1QBAA 3L95A 3I02A 3ES6B 1XF4A 5KJRL 4NKOB 4GAJL 5DD1L 1S7VB 2ITCB 3TH4T 1WWCA 4U1GC 3QCTH 1RY7B 2K3TA 3QUXD 1VPOL 1RVFL 1S7WA 1IILE 5J11C 1REIA 4EI5B 1KTLA 3FONB 2XQBH 4PV9B 2CR3A 3V8CA 5C08E 5B39A 4PJXA 3O8XD 1T3FA 4URTB 3O9WC 1FFRA 2YOCA 5JUEH 2W0FA 2P5WD 5I1GL 2EECA 3BXNB 2A6IB 4MMXC 5I1IL 1FC2D 2RIKA 5D96C 4Y5VA 1MJUL 2EE6A 4KI5E 2V2WB 3O8XB 1PQZA 3QXAB 5KVGL 1ACZA 3GKWL 4RGOL 4FFVC 4BSVB 2P5WB 1DSFL 4S1SL 2YWYA 5TE6H 4W6XB 5HYJA 3QCVL 4KGLA 3KJ4B 1FRGL 4QY8A 4X9GA 1YJDC 1OARL 5EC2A 3RRQA 3BQUA 5HD8D 2VYRE 2X4PB 1RJZA 4KVCL 3UROR 4P3CL 1DBJH 1EGJA 2DLFL 3R0NA 2WBJB 3PNWB 4ORGB 4FXKA 5DUMH 2IPUG 3PP3H 2YXMA 4JEGB 4I3RH 4H8WH 3TBVA 1I7RA 2YPVH 5JOFB 4J3XA 3NPZB 4LCYA 5IB3A 2WBKA 5I75B 1CI5A 2P49B 4LVEA 2R2BB 3PP4H 4KUZL 4DN4H 4PJDB 3MGOA 4EDXB 1EJ6A 2QQKL 5FA4A 1R5WB 3BDYL 5JZ7D 3F7RA 4Y16C 1YEHH 5HGHB 4OIBA 4PG9A 1DP0A 3D85A 5EOCH 1FVCB 2VITB 3DX9A 5A2JH 1TIUA 1R3JB 3BPNC 2J2ZA 4IMKA 5FYLL 2APFA 4ZO9A 3MO1A 1HH9A 2R56H 1KEGL 5IVXE 1N59A 2F53E 2PO6C 1FO0A 3LEXB 2HFGL 3VXNA 1T03H 5BRZD 1UCBL 3LKRB 1E4KA 5HVFB 5IW1A 3T77A 2FX9H 1JZ7A 2O5XL 4MAYD 3MV9D 3QDAA 1RUAH 4L8DB 1H8NA 4JO1L 4QTHA 3FB8B 5C2BH 4RBPH 1Q9WB 4WY7H 1FZOB 4PGJA 4HGWA 5ALBL 3BKJH 4OZIB 1E4XI 2YUZA 3RUGF 5BRZB 1FVEA 2BRRL 4YXHL 5A3IC 2EC9T 4YFDB 4QCIB 4EVNB 4WW2C 3CSYB 1M05A 3MUZ1 4MAYB 4XAWH 1ZT4B 4BFIA 2Z31D 3FT2A 3SDYH 1XGUB 4F2MB 5IGXL 1FAIL 3ECBA 4P2RD 4HCRH 4LSRL 4UDTB 4APQC 5F96L 4AH2A 1MF2L 2CLZB 5D7SH 1D5ZA 3RIFK 4P23D 4OZFA 2CDFB 2NW3B 4JANB 4YHLH 3SGKC 2LQRA 2Q7YA 2Z31B 3GHBL 1HXYA 4UZGA 4P2RB 4WV1C 2X4NB 4Y8AA 5CIPA 3PGCA 3BZFB 5E5UB 4LRIA 5EFIB 2H2PC 3BP7A 2R1XA 4LHJB 4P23B 1I9JL 1JZ4A 4I3GA 4UILL 2VLJE 2M26A 2X42A 2EZ0D 2B0SH 4U0RC 5EORH 3F7YB 3UYOD 4XVTH 4IOIA 4FQJL 4Q58C 4JDVB 5DZOA 1RUMH 4LDOB 4NRXA 3QZWG 1R3IL 2Z4QB 1LDSA 1QNZH 4MNHA 4DAGH 5JPMB 1NEZB 2M8XA 4GW5A 3DVIA 4TVSa 5I6XB 2BJMH 2WAHA 4IIQC 3J7HA 2GY5A 2HP4A 3HNSH 3VXMA 1LO5B 1N6QH 4HS3A 3OAYH 3UTZB 3JWOL 3J8F7 2ZKHL 5EBMB 1A9BB 1HK6A 5A16B 4JFQA 1MRFL 4ZOAA 4QOKD 1BBJB 1YNLL 4Z7WA 4ZNCD 5TDNB 3MX0A 3V5DA 3BUYB 4LLDB 3WJLC 2VDOL 1I85A 1A2YA 2UZIL 4JPVH 5CAYB 1MJJB 2J1KA 4X98A 3ELAT 1OLLA 4QOKB 1FNGA 1A7NL 1JHLH 1T80A 1UG9A 1BEYH 5T3XD 3SGDI 3EYSH 1WEJL 1FFOA 3EDEA 1NKOA 3A67H 2PTTB 2OJEA 4M62H 2C1PB 1Z6JT 4ZUVA 4D3CL 3BHBA 2VH5H 3I85A 2IMNA 1SQ2N 3QO0A 4X6DB 5ANME 5ALCL 1CXKA 3NZHH 3IFPA 1A3LL 4I77L 4ZDHA 4H26A 3OKLB 4QF1B 4HDIA 3VFTA 1JGDA 1TQCB 2GITA 5KSVA 4WI9A 2Q7NA 4Y4FC 1SEQL 4UOW0 1IBGH 4HJGA 4XVSH 5CBEB 1RURH 2VISB 1OTSC 1RIUL 3O3BB 4FNLH 3BN3B 4QHNB 4H0GA 3ILQD 5EIVA 1ZSDB 3WS6A 4LQFL 4NQED 4RFOL 2Y5EA 3I75A 1DQDL 2V9TA 1X5LA 5E8PA 1OAXH 3DVGA 3U30B 5KW9L 4P2QE 3QFJA 1DLHB 3HMXL 2APXA 4M5ZH 1N5AA 4HG4J 4UIKL 1TENA 4NQEB 1HSBA 5D1ZD 3NCYS 1EEZB 5TPWH 3MFGB 2E9BA 2EYSB 2WUCL 4LSVL 4UTBH 3ZKMD 5J9PB 2BSTA 3S36L 4YR6B 4P5MA 3D6GA 2X1QA 4OZHE 2AXGA 5CJBA 4OZGA 3QXWA 3WIFB 1WSST 5E2VL 1D5MB 5DJ2A 5EU4A 4CVXB 1OM3L 1TTGA 4X7SL 5EA0L 1TLKA 1R3LB 1NAMB 1ZA3A 2AEPH 5T5NG 1YUHA 5F3BA 2VDMH 1QR1B 1IC1A 1A7PH 1FZKB 2NY0C 4HKZA 4AK1A 1OTUD 3IDJB 4FTVE 4PJ8D 5F1NA 1YMMD 4JZJC 2GSGA 5FDWA 2HT3D 2O5YH 4XBGA 3OJVC 4HFWA 3GK8L 3QPQD 1AD9B 3DV4B 5ESQB 5DR5H 4NC1C 4XVUC 2X89D 4PJ8B 5LWYL 1ND0B 3LVEA 4ERSL 4PGCA 5IB5A 4HV8A 1S3KH 1YMMB 5HY9A 1NDGB 5F7YC 1FJ1A 1E28B 5BZDB 2CDGA 3IDNA 3IDXH 1RJYA 4JG0L 4ZTOH 3SKOA 3JWDC 1NBQA 4ZFFB 4WU7A 2CDEA 1ZLWH 2DTML 3MNZB 4R97B 2DYPD 1D7FA 1EAPB 1NGZA 1HHHB 4OM1L 1H3PL 5CSBA 5DHVB 2PKDA 3T0WA 3OAZH 4Z5RB 2XWTA 4G6ML 3KYOA 4AM0A 2QQNH 3PXHA 4I18A 2XIDA 5IBLC 1BM3H 1ZT1A 1M4KA 4ISVA 5EUOE 2NQCA 4PTTA 3BKCL 2DYPB 2XN9A 2XPGB 2FH6A 1RULL 2KBGA 1E4XL 4ZFOA 2C4FT 3GJFH 1U8QA 4F7CB 4CN6A 3E0GA 2AQ2A 2FO4A 5C3TA 1T1YA 4OZ4B 3WFHA 3AGVA 3U1SL 1Z9OA 5GHWL 5FK9B 1MPAH 3PWUA 3O4LE 1E6JH 1YQVL 1AE6L 2VOTA 4YBQC 4JO2H 4OJFL 1CFQB 3EOAA 4LLWB 2HT2D 4P2OC 2DJ4A 4F7MB 4GAGL 3UTQA 7FABL 3LRGA 4JRYA 3FT3B 4OLZH 5DJDB 1C5BH 4F58H 2CH8A 5CLTA 1CD9B 4JQVA 4LPWA 5DRZA 4OF6A 1BECA 5DVKA 3BW9A 2IPKB 5B39G 3X11B 2Q3AA 4BSWB 3RJDA 3MACL 3IJYB 3FQUA 1MH5A 3C5SB 5LVEA 1LEKB 3BP5A 2JF1A 4HIIB 5DS8A 1KXVC 1P2CA 2IF7A 5FHBH 3FO1A 5M7QA 1SEBA 2VO5A 3RWGA 1HYRC 1YJDH 4GRWB 1J0JA 4HIXL 4L4VE 5DD5H 2YSSB 3O45A 3HB3C 3MNWB 5D4QA 3M1BB 4LGSB 1KGCD 1QO3A 3LS5H 4M7KH 4DQOL 3TA3A 5EO9B 4NJ9L 1K3IA 3C5ZB 3PWVB 2FB4L 2KZ1B 4M7JL 2OM5A 4MXQC 1KLFA 3MGTB 3DUSB 3LRSB 1LGVA 2VIRB 4XH2A 2YEZB 4HMCA 3MV8E 5LAXA 3STZB 1EJOH 5E00A 4LVOC 2BOCB 5K9QG 5C9JA 2VXSL 1AO7A 1UZ8A 5DWUL 4G7YH 4PJ5D 4MQ7A 2BVOB 5IFHH 4YK4C 5I0DA 1KTDB 5T1LD 1UWXK 3HR5A 2R69L 1GC1L 1QP1A 1A6AB 2IQ9H 3OF6A 5SWQA 4KRMB 4DKEL 5IHZB 3MXVL 1OW0C 4X8XA 3NN8A 3SDCA 3DI3B 2DKUA 2AI0H 4XXCC 3B6SA 4PJ5B 4MJ2A 1HHJA 3RL1A 5T1LB 1ORSB 3IU4H 3SCMA 2BSSB 2E8ZA 1T2JA 4NCC2 4O02H 1MLBA 1NUGA 1ZVSA 1F11B 2EDJA 3O6FC 5IHLB 4FQIL 4X0KA 1SYSA 4GH7B 1MCOH 2VDNH 4YXKH 4MS8D 2QADD 3IKCA 3QQ4B 5DD6B 4BFBD 4QNPF 2X7LA 4AIOA 4ZUTA 4O58L 1S7TA 3ALWA 1EMTL 3O11A 1OPGL 4ZS6C 3DBXB 1A8JH 1GOFA 1IGFL 2MKWA 4YDIH 1HCFX 1CFVL 1ZHKB 5FF6A 5AYUH 2AJ3A 2QADB 3HC3L 3BDBA 1MCWM 3WFDH 3BD4A 2Y06L 5CINL 3IU3A 4KV5E 4XPAH 2NMSA 5L9DL 1W0WB 5DEFA 4OZFG 1WQVT 1IGTA 5I9QC 4P9HL 3T09A 2EEDA 4FXGB 5ESVB 5E9DD 3IDUA 1NC2A 2FCBA 4F15B 1IMHC 3EYQD 5EU6A 3BUTA 3L9RB 4K8RL 4M1GH 1HHIA 3OR6B 4OLXL 1WBYB 4ELMF 4X9FA 1HOCB 1QSVA 1INEH 2D31B 3S88L 5CFHA 1KG0A 2ZUSA 3HG1D 4PJIB 3QIUA 2IFFH 4U49A 4PGEB 5IJKA 3HNTL 4KKCD 3GNML 5E9DB 4QRUA 2GIYA 1YEEL 1DVFC 3VWKD 5AD0B 3L3JB 3LHPL 4ODHL 1LD9B 4JFDE 1U8MA 3L5HA 2N7AA 3LCYA 1NDMA 3G04B 1G7PA 5DLML 3KR3L 4PV8A 1WT5C 4R9HA 3H3PL 2XKNB 2VTFA 4U1HA 1KCVL 2JCCE 3X3FL 2A83A 2OTWA 3VWKB 2OR8A 1U8OB 3RNQB 3RDTD 3ULUC 2VRAA 5TFSH 3CVIL 3JVGC 3MA9H 2JTDA 4JY5H 15C8L 4WJ5B 2AJXH 2IANE 5ECJE 3FB5A 3ABZA 4LOUD 4R0LC 3OXSB 4KJWD 1MHCA 5FO7B 1FSKB 3MJ6A 5GGTL 5L2JA 3O2WL 3U9UB 2FATH 2W38A 3MLUL 2RCSL 5E99H 5TQ2H 5IB4A 4DW2L 4NBYB 1A6VH 3RDTB 1KJ3H 2KL6A 3BH9B 5TF1H 4XCYB 3L95B 2D03L 5BV7B 1XF4B 2LFGA 4NNXA 1H3TA 3K4AA 2L7JA 2DKMA 5ERWA 1NGPL 2XQBL 3NCMA 4KKAC 3QPXH 3OHXA 3UJIH 4BZ2H 5TQ0H 2NY1C 3AM8A 1J1XL 1S7WB 3GZKA 4PJGE 2D0FA 2VLLA 1KTLB 2VZ1A 3EYVA 5I15L 4RFEA 1TDQA 2HTLD 2F74A 3OB8A 3NIGF 3QIBC 5B39B 1JI1A 4PJXB 3SE4A 3CH1A 1T3FB 5DJYA 2AEIT 4G6KH 5J4MA 1A21A 5HYJD 3ULUE 4UQ2A 4PTUA 4GG6F 3ROOA 1YZZA 3ARGC 4HQQH 2JELL 3W11D 1XIWC 3BQUD 5IUSA 4Y5VB 4Q6IC 3HRPA 1PQZB 2V5YA 2AJSL 3RWHA 2ADIA 4EIZC 2WWMC 3RVUC 4XPGH 4ELKA 5DK3A 5F88A 3KS0H 4IJ3B 4LIQL 5IP4A 5HYJB 4HWBH 2F5AH 4QY8B 1UJ3C 2XWBA 5A2LH 3W9EB 5D7IA 1GAFH 5EC2B 3BIBX 4OD3H 1I8KA 4XWGH 3MOBH 4KTYA 4EJ1C 3JUYA 4LGPB 1RJZB 5DUPL 1UCTA 5C09A 1JUFA 4FXKB 4JVWA 4MXWL 2BOBB 3LV3A 1DDHA 3X13A 1IZKA 4LMQE 3VRJA 1FG2A 1JPTL 1I7RB 1FDLH 4A6YH 4LCYB 3D85D 2ARJA 3U36A 5E1AB 3MGOB 5GS2H 1TNNA 2BNUA 4KQ3H 5FA4B 4YHOH 4XBPA 3GB7B 1L7IL 4OKDA 2WLYA 3BIKA 4HS8L 4L8SA 1PEWA 4ODWA 4PG9B 1FL5A 1YEFL 1I3VA 3D85B 3QAZB 1TJIH 3DX9B 1BBDL 5I8OH 3GGWB 3AMLA 2VAAA 1QLEH 3NPSB 1QSEA 4X83A 1YYML 2BNQE 1T03L 1JNNL 3MO1B 1HH9B 2YHGA 4PP2A 2EH7L 1N59B 3MLRH 3O2DL 2QTEA 1I75A 3QG6A 1FO0B 3VXNB 1DFBH 2R1YA 3JWDH 4WWID 3ZYIA 4EN3C 2O5ZL 5GGUA 1V3LA 3T77B 4W70A 4JZNA 5C07A 1ZMYA 4KMTH 2G75A 1F8TH 4QTHB 1U8JA 3QH3A 3C6LA 4JPIB 2YUVA 1CDGA 3C08H 4HGWB 1XH3A 1OGTA 4XPTH 5F1IA 4MA8H 5I73B 1N0LA 4NBZB 4PJFA 3MBXL 1FVEB 4LLQA 1M7DA 2MCG1 2ZPKH 4QHKI 3FFDA 1M05B 1HYSC 4MGXA 4BFIB 4J4PA 5KANG 3FT2B 4RFNC 3PJSB 3ECBB 2V17L 3INUL 1EHLH 4YHLL 4AH2B 4ALAL 4AMKH 2HFTA 4ZODA 5K59E 1D5ZB 1OWRM 4OZFB 4X7EC 4RWYH 2DL2A 1TVHA 3PQYA 4X4MA 4OGXL 4M7LL 4M6NH 3FB6A 4KDWA 3BYTA 2Q7YB 2NZ9D 4Y1AA 1HXYB 2NX5A 1JIBA 1FGNH 3HMXA 5CIPB 3K7UA 3PGCB 5K9OA 5C0BE 3S3SA 3BP7B 2R1XB 2ZJSH 2BSED 4JFHD 4RISH 3RPKA 2FBOJ 1RUML 1U41A 3VXMD 3MRFA 2OL3H 2IBGA 3D2UA 5BVJA 4IOIB 2CXGA 1A5FH 2XT1B 4IRJA 4XX1G 5C8JA 4NRXB 2JK5A 4EEEA 1OSPL 4UB0L 3QDJA 1ONQA 2NY4C 4MNHB 4GW5B 3GBNH 4M7ZB 3ARXA 3VXMB 3WS3A 5DC0A 5E4EB 4HS3B 3MODH 1H5BC 1NANH 2W91A 3SQOH 1DQMH 3ZSSA 5ICXA 4JFQB 5I8EB 3GMMA 4TVPE 1NBVH 5CZKA 2JLLA 2UVFA 1MELA 4JPVL 4OD2A 3ARBC 3V5DB 3LQAL 4QRTA 2G5BB 3V6OA 4YJZL 5IVNA 1A2YB 3NZ8B 1MI5A 4RGMC 5FM5O 5I30L 1IGYA 1BEYL 4X98B 4D2NA 3EYSL 2A9NL 1K2DA 1FNGB 5IIEA 1XF3A 2ICWA 2ZCKL 1LQSR 1EBPA 4XP1H 3O2VH 2VR5A 4P57A 4OZIF 1OP3H 4OF5A 2AJUL 1CDIA 1FFOB 1DANT 3HZKA 4FQCH 2VH5L 4C4KT 2OJEB 2F15A 4J23A 4X7FC 1JNLL 3D1MC 3CJJA 2XACC 1RV6X 3GMRA 5C0CB 3VJ6A 4ZUVB 3BHBB 4KK6C 1CF8L 1KXQE 1WLHA 3HI5H 3QO0B 25C8H 4HMDA 3V95A 1FFNA 1IGMH 2AABH 4KKLD 1U95