1RUAL

Crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
218
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaL01
4JAMB 4TNVF 4YDLC 1L0XA 1RJYA 1BOYA 4FQJL 2D03H 1MAML 5HBBA 4HKBA 4B0MM 4ZUUA 3LQZA 3VGDA 2Z0BA 3WHE0 1UQSB 1CN4A 1U8KA 4LL9A 4IRSB 3KXFA 2OX5A 1ES0A 1C7TA 5FYKE 3AU1B 4QYOA 4J7RA 3PHOA 1D6EA 4YFDB 3ZYIA 5C0JA 1YY8B 5HYJA 2J6EH 2I9TA 4DVBA 1INQA 1Y18A 4XMKL 1F4XH 2AJVH 5IB2A 3AB0C 3I75A 1OPGH 2XA8H 3WIFA 3PNWA 5FAAA 4QGTA 3C8HA 4Y1AE 5J9PA 1YNLL 2Q3AA 5IEHA 1PG7H 5JTWA 3MMEA 3HE6D 4L4TB 2O61A 2VLLB 1GXEA 3FQUB 4CN1A 2BERA 5SWQA 3RY5A 1A4KB 2YKLL 3SOBL 1B4JH 3G04B 5F9OH 5KJRL 4NYLA 4K9EH 3D39A 4ZQKB 3H2WA 3FO9B 4OBRA 4NO2B 4E5XA 1ZSDA 3S4SG 3UTOA 1Q0YH 3O4LA 1MJJB 4OAWB 2AKRA 1D9KA 1WGOA 4Z77A 4NQEE 3LPFA 2VL4A 2VISB 1OM3H 3ARDC 3EJYD 3HAEB 3MV9B 4M62L 4F3FB 4HV8B 3LV3B 5EWIL 5CAYB 3A6CH 3KPNA 3L1OH 4EN3B 1A7NL 4F33A 2QHLA 3UJIH 2DQUL 3SGJC 3DV6A 3GB7B 4KUZH 1GGCH 5T1DH 4KJPD 2FR4B 1YEIL 4GG8B 2R0KH 1MHCA 5CJQL 4WCYL 3U30B 5IIEB 4XAWL 3ARED 3FMGL 5I71C 4QHNB 3GMPB 5KVDH 3QDAA 5C0BD 1F00I 4X6DA 3RTQB 1S7UB 4LLYA 2F5AL 3U6RA 3NA4A 5DHVH 2VLKB 1RZIA 2NYYD 1DUYA 4MJ5A 5DTFA 3NAAH 3HPJA 5D7SL 2J8HA 3EOTH 2A74B 1OAKL 4IRJB 2B0SL 1TDQA 3JTTA 3D5OF 1IZJA 4JFDA 5GGVY 1CICC 4UNVA 3WBDA 1JPGB 1M6OB 3VH8A 3MV7B 4FFZH 4HK3J 4TVSa 5F1KC 1ZS8A 3QIBD 1HXYA 4N1CA 4R0LB 3BX7C 1SBSL 1SYVA 3ARFC 1UVQB 1LEIB 4H8WL 4JPKH 3LN4A 1OTUC 3RVXD 1QKZH 3QRGH 4HKXA 5J6GA 4PJ7A 4LU5L 3HG1D 3RVVC 3LIZL 4TQEH 1G9EA 5IMLA 4X6BB 1A21A 1DDHB 2Q86B 2DQFB 1AHWC 2G60H 1R5WB 3MBEA 4P48A 2Q7NA 5F7LB 3MRFA 4KROC 5F9WC 5A2FA 3QG6B 4OFIA 4GW1A 3IF1B 3IGAB 1A22B 2BVYA 3M8OH 5I0DA 4YH6A 1XF2A 5FGSA 1WISA 3TBYB 5DJAA 4HIXL 4JZOB 1P4IL 2AEQL 4X9HA 1T20A 3MA9H 4JRYD 1NLBH 3IJSB 3SGDI 2YK1L 3JWOH 4N0RA 3E8UL 3NCJH 1A6PA 1Z9MA 2F54B 2VOTA 4WFGE 5JZ7C 1OSPL 5I18L 1BFOA 1XF3B 5IFJB 3OHXA 3ET9F 3G6DH 4PJEB 5EUOE 1WC7B 1MAJA 2F5BH 2YUVA 5D7JD 1I3RB 4R8WL 3VFWA 3C6SA 3C5JA 3TJEL 3I3DA 3L3GA 4GKSB 5CFHA 3KJ4B 5ISZB 4PJFB 1UH2A 1MHHA 5LBSL 4L5FL 3S37H 4DN4H 1DBJL 1R5IB 1JGEA 3IJHA 3BP6B 3LEXB 5CSZA 3O41A 4CNIA 5JR1H 2VTFA 2OJZH 1X5HA 4PBWD 1WAAE 4P5KB 4ZD3L 1D5BA 2PR4H 1UYWL 4K7PX 4HKZA 1OP5H 5D70H 5GSRB 3U4EA 4MDJA 5FDYA 2JTDA 3ULUF 3CU1A 2W91A 3BN9C 2HRPH 1J1PL 2Y9RT 3TFKC 4XNQA 2HRLA 4LLWB 1U8HB 1SJXA 3VXQB 2Q76B 1NFKA 1OTSD 2VE6A 1G7IB 3ALWA 5ICXA 5I1AB 3MZGB 3VXTA 1YQ2A 3SGDH 1Q0XH 5JOPD 4PJEF 2MKWA 3BRDA 1ZEAH 3MUY1 4OM1L 5L2KD 2A38A 4S1RH 2DQTH 1GC1H 2VDPL 4O4YH 5JXEC 4MJIB 4PTUB 3P9MA 4NDMA 1CFVL 1LO3H 3M07A 3P11H 3EOAA 1S7QB 5F7HA 1X3DA 1BVLA 3QDMD 4D8PB 1AXTL 3HZKB 2E6QA 3OKLA 3EJZC 5B38B 1RZGB 1FH5H 1VEMA 2G5BB 4XVTH 3TWCL 2XN9E 1V3KA 2YPLD 3NFSL 3FAXA 1DVFB 4I77L 4ZSOB 3QULA 2XIDA 3WIHH 2DBLH 2BSRB 5BMFL 3CGTA 4N0CD 3MJGX 4JO2L 3CFDA 4JFPA 1SYSB 5IFHL 2D31A 5I76B 2K3TA 2OTWA 5C86A 2PW1A 4OGXH 3UTSA 3NH7H 3FQXB 4Q7DA 1Z0MA 5HHXL 3H9SE 3VE0B 1BM3L 3V0VB 5AG9A 3N1PC 5IBLC 3BT2L 4X0KB 3PL6A 4UV4H 3WS6A 4KI1A 3QIWC 4B53A 3S36H 3CLFL 4YHZH 5EA0L 1EAJA 2ATPB 3HZYB 2HG5A 4WWKC 1QHPA 3LY6A 3I6LD 2EDKA 4NZDA 2OXGA 1CQKA 3KLAB 5DDHB 2GK2A 2FNBA 3G5ZA 1XGUA 3F12A 5D6CA 3MNWA 3U7WL 5JXAH 4GKOA 1QLRB 4FP8H 4ZUVB 1AGCA 3K4DA 5ACZA 3RFZC 4MJ2A 4DUWA 3QEGL 3QWQB 3BEWB 4WI5A 1KIUA 3HI6H 1YMMA 3T1FB 5HYIA 5I6XB 1TENA 2OMNA 1FZJA 1RMFL 2BY3A 3RWHA 1FAIH 1XGQB 4M93B 3TBTA 3CZJA 5GGVH 4HUUB 5BS0E 5I1LB 2J4WL 4LKCB 2DD8L 3BD5A 3MPCA 4HT1L 3MLRH 1FNGA 3HRZA 3BDBA 3ZZ1A 3JWDL 4PPTA 1XF5B 2C1OA 4KJQC 2ZSVA 3MGOB 5E08L 1MIML 1AR1C 5HHNA 1VFBB 2QQLL 1QFWM 4FG6D 1JNJA 3NA9L 2YS4A 4NJAL 4HC1A 4F7PB 2XOTA 3DX7B 4GXUM 4Z7VA 3T0AA 5DS8B 1HZHH 2PCPB 1LQSR 4GSDL 4XGZB 4YHIB 5FO8B 1X6NA 4F7TB 1F58H 3SJVD 1K2DB 2VQ1A 3VG9B 4XPAH 3L5JA 3R06B 5FFLA 3CDFA 5HHPA 4X7CC 1N3NA 5D71H 3KPMB 5D2NB 1MI5B 2X5PA 5C92A 1QLFA 4ZOEA 5JDSB 4JFED 3QXVA 3T0WA 3C2SA 3MGTB 4OZFG 1FFOB 3FT2B 4N8VA 3KWWA 3C5SB 3O45B 5F97E 2J7LA 1QNZH 3GEWB 3W5MA 3TBVB 1FFQA 1RUMH 3FONA 4LSRH 2EXYD 3KLSA 4KAQH 3FN3A 3SQBA 2A0LC 2APBA 3IDYC 5DD6B 5JPNA 1HHKB 1HOCB 2DLFH 2E7MA 5HYSG 2MCG1 2DM3A 2WK2A 5DC9B 3EYFA 5TF1L 2QSCH 4JFQA 2R0WL 4JPWL 4I3SL 1OAZH 3HZVB 4O02L 1ZHKA 3O3UN 3PQYA 1MVUA 1S78C 2ZUUA 4J23A 4ERSL 5DJ6B 3W11C 4JAMA 3NZHH 4E41A 3PV7A 2XTJD 1S9WB 4CN4A 4JGMA 3LS4L 2F19L 2AI0H 4HXBH 4LLVB 2AJSH 1UQSA 2H26A 1OGAD 5IB4A 3GMNA 4LGSB 5F9JB 3VFTB 4IRSA 4PIRF 1DP0A 1BF8A 1MRCL 3SDXB 4JHWL 6FABH 1WFNA 3AU1A 4HXAL 3GO1L 2GJ6D 1YY8A 3VFOA 3FOLB 3GNML 4K3DL 3KPRD 4PJXE 1B9ZA 2R29L 7CGTA 1E28A 3SO3B 3UPRB 4U2ZA 4KRPD 4H8WC 1JNHB 1MREL 4L4TA 2Z93B 2CJUL 5I1JH 3MRHB 1A4KA 4NN5C 4PJIE 3T4AB 3G04A 3CIQA 3B83A 4MJ6A 4ZQKA 3FO9A 1VPOL 4NO2A 1ORQA 2X9XA 5TE6L 3PHQB 1OAXH 1FZMB 1MJJA 3QI9B 4OAWA 1UA6H 4WO4A 4JHAH 2VISA 2Z91B 2XKUA 3BIAX 3HAEA 3MV9A 1CDYA 4HV8A 4W4NA 3E1F1 5C0AB 1FZKB 3SDXF 2RFXB 1EJOH 5IB5B 3RDTB 2FX8L 1QACA 2GI7A 5HHOE 1S5IL 4XC1L 4LARL 1PLGL 3DUSB 3GB7A 2XFXB 5K9JH 1IGJB 2FR4A 3L3OB 1UM6H 4GG8A 4GRLD 2IFFL 1ZLUK 5IIEA 4L8SB 1KCSH 2XQYG 4C59B 4QHNA 3GMPA 3MRCB 1O0VA 3QO0B 4GBXD 4L3AA 2DQEH 1S7UA 3RTQA 3FAWA 3D3VE 4MA3B 4QTIH 4KMTH 4GG6E 4AEEA 1HCFX 3OWEA 4RMSA 4HJGB 2FWOB 4U31A 2ZUTA 1B88A 2WWMC 3PGFH 2A74A 2D0HA 3RA7H 4WDIB 3QQ9C 4FXGB 3QYCA 2YPKB 3T65B 4XNXH 1JPGA 5CINL 1M6OA 1DZBA 1BD2E 4OIIH 4RDQG 3MV7A 1YN7B 4U1KB 5GGRY 5C0GB 3MROB 4KHXL 4XBEH 2B20A 1FNHA 5TE7H 4U1GC 1QBML 3GMLB 2F9BT 1YY9C 4R0LA 2IGFL 3DHJA 1RIVH 4QNPF 1UVQA 1LEIA 4UT6H 4TUKL 5C6PB 1XR9A 4HZLB 1E0OB 2DI9A 2HVKB 3X17A 3BE1H 4X6BA 1DDHA 1MCOH 4LASL 2Q86A 1NC2A 5FYJU 2DQFA 1R5WA 3RAJL 5IBTH 4O2CB 4QXUL 1OOAA 3QG6A 3GKWL 5GGSB 3IF1A 3HMWH 3IGAA 2DDQH 4QY8B 4XRCB 3TBYA 2EZ0D 2YR3A 4NBYB 4JJHA 2DMCA 3IJSA 3W0WE 5CMAB 4FQQB 4NQCA 3KLHD 1XF3A 5IFJA 4YHMH 5EB9A 4PJEA 1JWUB 2VITB 5FB8B 1U2CA 2LVCA 1WC7A 5JOEA 3MREB 4RX4D 1H5BB 3QAZB 1NPUA 1I3RA 3K46A 1A7PH 4XNZB 3MBEC 3V6OE 1CL7L 1UCTA 2ATKB 4GKSA 3QEHB 4H20H 5ISZA 2DQJL 2APTA 3O2DA 1ZVSB 2FIKB 4WHYG 5D8JL 3WFDH 4MNGE 1OAUL 1RK0B 4PGDB 1R5IA 2GTZB 5C0CD 3BP6A 4H0IA 3LEXA 1KIPB 3PGCB 4RFOL 5EO1B 1RZFL 4P5KA 4MNQD 3AROA 5FYJE 4ZAKD 2BNRD 3WDHA 4OF3A 5ELIA 2XY1A 5GSRA 2NLJB 4OF0A 2YPVH 3RQ3A 1HINL 1RU9H 2I25N 1A7OL 4LLWA 1U8HA 1A9BB 3VXQA 2IQ9H 2Y5TB 2Q76A 2BXZA 5CZKA 1G7IA 12E8H 2XACC 3QUMB 3LEYL 4D0CB 2XQBH 4ACPA 2M8XA 3MLZL 1U36A 1FPTH 3B8SA 3VRLF 4F9PA 3PABB 2C3VA 3QCVH 4MJIA 4N90E 4PTUA 5I74B 1L7IH 1AKJD 5IEKB 4IDJL 1S7QA 1RVFL 5D1ZC 4L8BB 4Z95L 1MFDL 4ZG1A 1WBZA 3ARYA 4K7PY 4D8PA 3HZKA 4HPYH 3H3KA 3KS0J 1GGIH 3RWDA 5B38A 1A4JB 1RZGA 4OSUL 2EIZB 3HNVL 4QOKA 1OW0C 2AK4E 4OCNC 2Y23A 4OZIB 2C4FU 2X2YA 2AP2A 4YXLH 1DVFA 4NKOB 2UZYB 3NFPA 2GYSA 2QV2A 4ZSOA 1DQJB 1Q1JL 4WV1B 2BSRA 1UKQA 3BPLB 5CP3H 3QXAB 4KGLA 1SYSA 2BVEA 5I76A 5EZIL 1H8SA 1RUKL 1GOGA 3STZB 1V3LA 3A6OA 4S1SH 3DBXB 3GUTB 4GOSA 3FQXA 3EZJB 3VE0A 3V0VA 5BW7A 1HQ4B 4OCRH 4X0KA 2NXYC 1G0XA 1BAFL 3CCHB 4WFHE 3LDBC 5I8KL 4Q9CA 1CT8B 2ATPA 2EDNA 2E7BA 3HZYA 4EZMA 4PRHE 2BMKB 3SEPA 3D18B 1PDKA 2R2EB 3O2WL 5D1QC 1F13A 1YMHB 4Q0XL 5GQBA 3KLAA 4ZXBC 5DDHA 4XVUD 1H3GA 4D0BB 4N5ED 1CGVA 2WQ8A 4TVPH 5KW9L 5KSBE 5KTEH 5ILTH 1IQWL 3HMXL 4OZIF 1QLRA 1ZXQA 4FZ8L 4ZUVA 3QHZH 3BEWA 3AGVA 2F8VA 3T1FA 4MXVE 1PJ9A 1KEGH 2WIIB 2H32B 1S9KC 1XGQA 4WU7B 4PJGE 3GSXB 4HUUA 1X5GA 1M1SA 4G7YL 4LKCA 2GHWB 3PL6C 3WS6C 3DVIA 1AJ7H 2NX5B 5FGBA 3HFML 1REIA 3BSZL 1CGYA 3ARGC 3OL2A 1XF5A 3MGOA 4L9LB 3RWJB 1VFBA 4NP4L 4TNWK 1QSZA 4F7PA 3DX7A 5DJZA 2HAZA 5CSBA 2IPUG 5DS8A 3G6JE 1JMXA 2PCPA 4XGZA 4YHIA 3P77B 5FO8A 3DXAD 5CJXA 4NNYB 1YEHL 1K2DA 4HF5H 5CWSB 3N85L 3V4PL 3O9WC 3QH3A 9CGTA 4M9OA 3EHBD 2PXYC 3VXSB 3KPMA 1IEAA 5D2NA 1MI5A 3FO2B 4Z7WB 5MI0C 5JDSA 4JZJB 2GUOB 5A2LH 3BIKB 3N9GH 3MGTA 2HLFC 4CRPA 5LGHL 3FT2A 5BRZB 3WFHA 4JY5L 4FOMA 4G9FB 3C5SA 3OPZL 3O45A 1INEH 3MLSH 3QUKB 3RP1A 4UTAL 2HH0L 5DZLA 3TBVA 4LDLB 2DTSA 3KYNB 2LV4A 4LFHD 3QUZB 3GIZH 4JANA 3U1SH 1HHKA 2P8PB 1IE5A 5SWZA 1HOCA 3ARSA 4PJ5D 2OS7A 4TVPD 4MQSB 4EOWH 5DHYB 3HI5L 4G8GB 4AIZB 2IPKB 5JUEH 4U0RC 1CF8L 2ERJC 5KOVC 5GRUH 2Q8BH 1VFOA 3HZVA 1GGBL 3RKDC 3U2SB 3KS0H 3VFMB 5DJ6A 3LEVL 3LN5A 1S9WA 4Z7WF 4P2RD 3ZDYE 2QADB 3LKNB 3RGVC 2LAAA 3SDAB 4WUKH 4LLVA 3T2PA 1TMCB 2MCPH 3ZE1E 3B2VH 4WJ5B 4KVCH 2E27H 5F9JA 1V5JA 3ILQC 3RKPA 1FDLL 3VFTA 5CGYC 1MJ7H 3SDXA 1RD6A 4KRMB 1FNSL 1JPTL 1WIUA 4JY4A 1NEZB 3DVNB 1GHFL 4PB9H 4HCRL 3DX8B 5DVLA 4BYHA 4XNMB 3GI8H 1QLEH 4YUEH 1JNHA 3OKEA 2Z93A 4X80H 4PRID 3T4AA 1I9IH 4YPGA 4UOW0 4MB3A 5FYLD 3TNMA 4K7PH 4O51B 3EZ8A 3BWUC 2PW2B 3PHQA 5IVXB 2BFVH 5DUPH 4P5TC 3D85B 3QI9A 1RIHH 4KQ4H 1L7TH 3U9UB 5H35B 4CVZB 3VMNA 2Z91A 3UDWA 4IRSC 4XAKD 3FZUD 3QXDB 3WN5B 3G9AB 5C0AA 3EYQC 2P5WB 1FZKA 2FD6L 5IB5A 1FO0B 4KZEL 5E2WL 4YIQB 5B4MC 3DLQR 3UYRL 3MYZA 4ZOCA 4DAGH 4LNRB 2UVEA 4HEME 2XFXA 1IGJA 3L3OA 3K3QA 4L8SA 2ESVD 3MRCA 4WUUB 3QO0A 3CH8A 3VFUB 4Y2DB 4NBXB 43CAB 5IVXF 4YE4L 1OLLA 1F02I 1K8DA 4HJGA 5CUSH 2FWOA 1IEHA 4K71B 3WKMH 2J5LB 1KFAH 4N8CL 3OB0H 4FXGA 1F3RB 5JOFA 1BEYH 2YPKA 2HLAB 2Z9TA 3HB3C 3T65A 4BSVB 1HIMH 2XPGB 1YN7A 2XY2A 3HC3L 3CLEH 4BFBD 5C0GA 2BRRL 3MROA 3SY0B 5C0FB 3IU3B 5EUOB 4EN3C 3O6LH 4LCUB 3EYUH 4DGVL 3GMLA 3H8NA 3P9WB 4NFDA 1VGEL 4TSAL 3N1FC 4Y16D 3E3QE 4RWYL 4TOYL 1TVHB 3IS0X 4U7SA 4A2MA 5I1IH 3GSNH 5MP6L 2OP4L 2IANE 3CUPB 3QIUC 4NHCL 4HZLA 4M43H 4UILH 2HVKA 3ORJA 4YC2B 4MMZC 1H3TA 3RTQC 3TNNB 2COQA 2D0GA 3VXUE 3QCUH 4PRNB 2VXTL 4M8QB 4O2CA 3LCYA 1J9CT 4B50A 5D2LB 3QUYC 4IRJC 1KELH 5GGSA 3K2MC 2BDNH 4OZFH 2R69H 5BVPL 4LSVL 2DM7A 4JR9L 4QY8A 1ZANH 1I7ZB 4XRCA 2VSDA 4MWFA 2VDQL 1LO0L 3MRKB 5EUOF 5BO1L 5CMAA 1IGCL 2M1KA 4KJWD 1J0HA 1CLOL 2DAVA 4M6NL 5DMIH 3CMOH 3FQWB 1FVEB 3V0AC 1P7KB 2J3SA 4ODHL 2VITA 5FB8A 2FECL 4NCDA 1RUPL 1I9RH 1H5BA 3ZT5A 3BDYH 3FTGB 3D69B 2A2QT 4HX1B 1H3WM 5TE4L 1A5FH 4N9GB 2FBJH 4JPVL 5IROC 2ATKA 3TVMC 3QEHA 1WAAF 3NFNB 3I6GB 3EBAA 1B6DA 1ZVSA 2FIKA 1MNUL 4J6RL 4PGDA 5D2LF 1JPSL 1JNLH 2GTZA 5AZEL 5D7LE 1KIPA 3PGCA 5EO1A 4AEHL 3BH9A 1YEKL 1JTPA 4KVNL 3PDOB 1TTGA 1FFRA 2YBRB 3P4OB 2EDRA 1TVBA 2NLJA 4JDTL 5IV2B 3S3SA 2FJHA 2Y36H 2UVFA 3DETC 1CU4H 4WFEE 3T0XA 1A9BA 3HG1B 4F80A 1KC5H 2Y5TA 3BHBB 2A77H 3QUMA 1G0YR 4BM7A 4XWGL 4D0CA 1V7NL 4FHBD 2QSVA 4LHUG 2MPAL 2NR6D 3BWAB 2O93L 5DUMH 2IALB 3PABA 4LQFL 4DTGH 5IEKA 3AY4C 4YDVB 4R96B 5AYUH 4W6WB 1KXVC 4L8BA 5MENA 2OTUB 1RURL 4NO0D 2PTVA 1RULH 1NSNH 2JB5H 2NY2D 2V17H 2EEBA 4YHPB 3W5NA 2EIZA 2FSEB 3K2UL 4OLEA 1DSFL 4OCXL 4OZIA 4XPFH 3IDNB 4NKOA 2N56A 1JPFB 5KSAA 4JO4L 5I1DB 1DQJA 2E8ZA 2X40A 5L9DH 3BJLA 4WV1A 4R90H 1F6LL 3S3PA 2WUCL 1F4HA 3TV3H 3QXAA 4OLXL 1QSEE 3I9GL 3MYJB 4HDIB 3FHAA 3QDJD 5D7JB 3DBXA 3CXDL 4C56E 4DZBB 3GUTA 1RZ8B 1I85A 5DHVB 3QPQD 5EOCJ 4DUVA 4U1IB 3TZVD 4EVNB 1HQ4A 2VDKH 3CCHA 3MCG1 4TUOB 1MEXH 3MJ9A 1KJ3H 1CT8A 3MOBH 2DKSA 2BMKA 3D18A 2R2EA 1NBQA 1YMHA 2VDNH 3HC0A 3WE6B 4PR5B 3MBXH 4OZGB 4D0BA 1MHPL 5A1AA 1A3LL 5SX4I 1D7FA 3ZTNL 1YEDB 4XXDB 4S2SB 3DYOA 3BYYA 3S3JA 1JNNL 3SKNB 4X7TB 4XCYB 4R4FL 3QG7H 3GHEH 1ROWA 3KPSE 1YDPB 2WIIA 2H32A 2CDFB 1QEWA 1KLUA 3OV6A 1BGXH 5IVZB 4WU7A 1NGPL 3GSXA 2CKBA 4OLWH 3HLAB 3TYFB 1ZT4B 5DO2D 2HVJB 2AAVA 2WM0A 2CK0L 3VXRB 4I1NB 1MFBH 4F57L 1J1XH 4I4WB 5FUZL 1OL0A 4WHCA 2EIBA 3V6OC 4P99A 4L9LA 3RWJA 3UX9B 1T66D 3AXLB 4B5EA 4EUPG 5BCAA 5E56A 4XXCC 4LCIH 5T33L 5HHMB 1XIWA 1NL0L 3FL7A 3K4AA 4HK3N 4OZGF 3P77A 2NPLX 2A6IB 2VLMD 3QCTH 4KK5D 5KS9B 5CWSA 1JF5A 1NGZB 3IS1X 3PWLB 1EERB 2CLRA 4AM0B 4U6TA 3QQ4B 5SX4H 3VXSA 3WIIH 1P5UA 1JGDB 2WNGA 3FO2A 3QUML 4Z7WA 4M93C 3LD8C 4JZJA 3N0PB 4ZUTB 2GUOA 2Z31D 4D3CL 5F71A 2UY7A 3HAEG 4GT7A 3BIKA 2IAMB 4OGAD 3SE8H 2DQIL 2B5IB 1IGIH 4YFEA 1SEQH 5BRZA 4G9FA 1SMOA 3QUXC 3QUKA 3T1WA 1N26A 3I50H 2ZJSH 1UWGL 4PUBL 3KYNA 5B3NA 3QUZA 5GJSL 4JZNB 4XPBH 4YHKL 2P8PA 1YEGL 4HWBL 1R0AH 4LP4A 4WHYH 3KPOB 4LSUL 1ZAGA 4OJFL 5DHYA 4G8GA 3VG9C 4AIZA 2IPKA 1MRFL 1Q38A 3EYSH 5KS9F 4PREB 3IJYB 3RGHA 4K23H 5DFWH 5GS1C 3QJHB 4DJMA 2XZQH 4NQEA 5CJ8A 2RGSA 1U3HC 4I0PD 3VFMA 4KWUA 4LCWE 3IAGC 5GGQL 3VFGL 1U42A 4AL8L 5DT1H 5F70A 2AJUH 5JW4R 3LKNA 5LG1A 1J1OH 3WJLC 4G43B 3ETBF 5M7QA 4XCCH 5DR5H 3SE9H 3BW9B 4ODTH 5F3HB 4WJ5A 5HHOB 1OGTA 1QFWL 3L3IB 2QQQA 4OLVH 4PJXF 1L9MA 2ENSA 1FRGL 2OI9B 3L5IA 1WLHA 4HULB 4Y2OA 3VFVB 3KHQA 3SJVB 2F58L 1NEZA 3DVNA 1S7RB 1TQBC 4JFXB 5EOCH 3DX8A 2XQYK 3MRMB 3OXRB 4PJIF 3GK8L 4PRAB 4XNMA 5IT2H 3CVHH 1U8QB 5CZXD 4KFZC 3IVKB 1OF2B 1OT1A 1ZA3B 3TF7C 2V9TA 3KPQB 3V5HB 5DJ2B 4O51A 1BWMA 5J57B 2ORBH 5F44A 1NANI 2HTKD 4L3ED 4XP4H 4LF3B 4LAQL 3Q1SH 5IVXA 1S9VB 2VLRD 1JIBA 5D7IE 3U9UA 2MOVA 4RMUA 3MRQB 1AR2A 2WIMA 5H35A 4CVZA 2I9LB 2NZIA 3FHQA 1OAKH 4XP1L 1TPXC 2A6KB 5GRVK 3QXDA 5C0NC 1FE8L 2QQNH 3WN5A 2D2OA 1FN4B 4P0DA 4U1HB 1UWEL 4MQXD 4K3EL 1FO0A 2UWEE 1ITCA 1FQ9C 4YIQA 1WTGT 1JI2A 1CI5A 1UM4L 2RBLA 5J7CC 1ZWIA 2C4FT 4LNRA 3BKYH 5KG9B 3SO3C 1IBGH 2CR6A 1J8HD 4F8QA 5E1AB 1K6QL 1AGBA 2DWEB 3ZKSD 5JHDB 1U8LB 2XTJB 1CE6B 4TUJB 5H2BB 4DGIH 1LP9B 1PZ5B 3DURB 3ARQA 5CGTA 4G6KL 4WUUA 3V7AE 3FT3B 3VI4E 1A64A 4Y2DA 3VFUA 1ZLVK 1NKOA 1OGAB 4Z76A 43CAA 1TXKA 2FJGB 3G08B 3INUL 2GJ6B 4KK8D 3W0WB 4DKFH 2JF1A 2AJXH 3KPRB 4BSVA 2XPGA 4XPTH 1FVDA 4UT9H 3MRNA 1T1XA 3RDTC 2IG2L 1R24B 2VC2L 4M7ZC 2RJMA 3SY0A 5C0FA 3IU3A 5EUOA 4D0DA 1MPAL 4ETQB 2ZG2A 2IFGA 2AS5M 5GRYA 1TJGL 1TVHA 3MODL 4HUXB 4RRPA 4ZTPL 5A3IC 3SGEI 2RIKA 5J3HD 5IK3B 3V6FB 3CUPA 4L8SC 4Z9KB 4WTWA 3QP3A 2ZOKB 4NGHH 2ZZUT 1LP9F 3TNNA 4MNGB 2WINB 2Y06H 3DI3B 5LWYH 2VKWA 1NBYB 1WAAA 1MFEH 3DO3A 4OFYA 5T3XL 5K59E 4M8QA 1G84A 2AEPL 1UACL 5C2BL 3V4UH 5I17A 5E6ID 3GBNL 5FUCE 5D2LA 1EVUA 3MLWL 1EEUA 1OB1B 1S7WB 1N6QH 1I7ZA 3JTSA 3RI5F 4FQCH 2HT4D 1MIEL 4RWHA 2Z8VC 3ULVF 1BZ9B 2AABL 3L3HB 4JGJA 3VA6A 1X5XA 2I26N 2OTPA 3MRKA 3S96B 2DYPD 4GRLB 3P0YL 1N8ZB 1IRAY 2Z4QB 4U49A 2DQGL 4M7LT 1QRKA 3VXMD 1I3GL 3FQWA 4PYHA 1FVEA 1P7KA 5C0RL 4IDLA 4GBXB 1ZVYA 3CK0L 5AWNL 4MMXC 3C60C 5E9DE 1HI6B 4W4OA 1P4BH 1ZE3C 3V5KB 5F7DA 1C8PA 4DQOH 2X4UB 2YD4A 1GOHA 3D69A 4HX1A 1KPRB 4TRPL 4N9GA 4X7FC 5F9AC 1JTOA 4MLSA 1PG7W 4ZNEA 3NFNA 3I6GA 4LOUC 3KXFD 1VACB 2J6EA 2DB8A 5I73C 5HYJD 2YZ1A 1H3PL 3PDOA 2Y4SA 5EPMA 1CTOA 2YBRA 5A2KH 1AO7E 5IV2A 1EUUA 2AV7B 1XZ0B 3TA3B 4KKCC 1KEML 2UUDK 4OM0H 5E2JA 3HG1A 1TNMA 3PXJA 5DWUL 4AG4H 1U8PB 3FB5B 4JCMA 4NZTH 4TTDD 3X3FH 5J6HB 1R3IH 3T4YB 4KTDL 1O7SA 4WEBH 3QAZC 3D39D 3BWAA 3QDME 3QDGE 4YNYA 4Y19B 1UCBL 2HJKB 4JN1L 3O4LD 2P24B 2PUQT 4JKPH 2E7HA 4YDVA 3OKMB 4R96A 5FV1L 1D9KD 2CUHA 3WXWH 3ZDZE 1VADB 1NC4A 1XGYH 2MQCA 5C9JB 5KSBB 3FRPA 3H3PL 5J13B 4BSWB 3MRDB 4YHPA 1D5IH 2PYEE 3B9EA 3WJJA 2FSEA 4JB9H 2P49B 3FFCD 1D5XB 2VDML 3O8XA 4L4JA 3IDNA 4NFCA 4BELD 1JPFA 1J87A 1LO4H 5HI3C 5I1DA 4MX7B 4BQCA 2GJJA 3RIAF 2WUBL 2VUYA 3HR5A 3VCLB 2E9BA 3MYJA 4FA8A 3PIQB 3WD5L 1NAKL 5D7JA 4EKXA 3G5XB 5KVGH 4U33A 4DZBA 3GJEB 5DHVA 3BZFB 3TIDB 3L5XL 1K4CB 4FQ2L 5ACLA 2HWZL 3SKOB 4EVNA 2R8SL 5I74C 1K9TA 2P8LB 3FFDB 2IPUK 3EFDL 4ZODA 4IIQC 2VDRH 3ZKMC 1I9EA 1MCPL 5C0CB 1XR8B 1NEUA 3H42L 1OTTD 1P2CA 3TP4A 4FFWD 4JLRB 2FBOJ 1GYAA 3C2AH 5KSBF 4JFDD 1EHAA 3WE6A 4ZAKB 4PR5A 2JB6B 1WWAX 4OZGA 1X5AA 4NJ9H 3KPPB 1N2RB 5KVEH 1HYSC 5D1XD 1YEDA 4XXDA 4S2SA 4MXVF 3SKNA 3OF6A 3HUJE 1JN6B 2OL3B 1CIDA 4X7TA 3LHPL 4XCYA 3SDCA 3BPLC 3MV8B 5DJDB 4ALAH 1YDPA 4PBXA 4EBQL 2CDFA 3KPLB 4MCZB 4W6YB 2HMIC 4R97B 2D03L 2ZKHH 1WFUA 1XFPA 3TYFA 3JVGC 4XB8A 2HVJA 4KRNA 3PP3H 2J2ZA 4LIQE 5TFSH 3VXRA 4I4WA 3RIFF 2IBGA 3ARWA 4GH7B 1CIUA 2XRAH 1M7IB 3AXLA 3L95B 2J6EL 2X42A 4P4RB 2VH5H 4D2NA 1F4XL 2FGWH 2AJVL 1IARB 1OPGL 1YPZB 2XA8L 2ITDB 3M1BB 2FLRT 2A6IA 5KS9A 3NGBB 1PG7L 3OR6B 3UAJC 3F7PC 4R2GB 3LKOB 3PWLA 2ADIB 2ZCLH 4FMKA 1PEWA 2VJXA 1T1YB 4JFEE 4RGNB 4AM0A 4NOFA 1U8OB 1J86A 5DLMH 1B4JL 2MHAB 1JWMB 4J3OC 5F9OL 3QQ4A 2CRIA 4K9EL 1UB5B 4L3CB 1JGDA 4LSSH 1GIGH 4ZUTA 5BJTB 1Q0YL 4YLQT 5IVNA 2IAMA 3C6LB 1MLBB 1OM3L 2H45A 1OAYH 5MEPB 3CFBB 4YWGH 1JZ4A 3QPXH 1KG0B 4GJTB 3GSOB 4WHTB 3A6CL 4JZNA 3U0TB 1AGDB 5HPOA 3Q5OA 4PJIA 3L1OL 4MNHB 3O3EB 3SCMC 2DLHA 3UJIL 4LBEB 4U1NB 3KPOA 1YPZF 4KUZL 1GGCL 5T1DL 3BGFB 3T2QA 4EIGB 4N9OB 2R0KL 3IJYA 4PREA 5IFAH 3GSRA 4RBPH 1QYGH 1JZ2A 4JZJC 4M5YH 4YJZL 5KVDL 3DUHA 3ZE1F 3LMJH 1WZ1H 2WBKA 4Y4KB 3CFCH 3EOYG 4G43A 2IBZX 2N1KA 5EH1A 4AEIH 1G6VK 3NAAL 4PLJC 3D0LB 5F3HA 3EOTL 5HHOA 2YRLA 3QZWB 1TCMA 4QWWD 3L3IA 4KI5D 4MVBD 1AQDB 4HC1H 4U1MB 4FFZL 3DXAB 2R0ZH 1CDUA 1C5CH 1S7RA 4JFXA 3MRMA 3OXRA 3WIHA 2OK0H 5D93B 3L7EB 4PRAA 5F72S 3WKNA 4I0KA 3IVKA 4PBVC 1ZA3A 2VR5A 4JPKL 1IQDB 1QKZL 2AQ1A 3QRGL 3KPQA 3V5HA 2CXKA 5DJ2A 3UTSD 4TQEL 4X9FA 1BIIB 1NCNA 1QO3B 2R1YB 4KXZI 4LF3A 3BH8B 1S9VA 4CMMA 3H7LA 2G60L 3SDAC 4R4NC 3NCMA 5BOPA 2I9LA 5DFVC 2YWYA 4WI7A 5C0IB 4ODVH 3M8OL 1FN4A 4U1HA 4PJ5B 5JHLH 3K1DA 2PKDA 3MA9L 2NW3B 1NLBL 4HIHB 4HIIA 1X5JA 3JWOL 2DOCA 5KG9A 3BZ4B 3NCJL 4EI6A 2LU4A 5I8EB 1OP9A 2DWEA 3RL1B 5JHDA 1KIRB 2BSSB 1CL7I 3ILPB 3G6DL 4Y5XC 1U8LA 2Y25A 3VDCA 1CE6A 4TUJA 5H2BA 1LP9A 1PZ5A 1UJTA 2F5BL 3DURA 3BJ91 4EI5B 2H9GB 2OSLB 4JRWA 4FQ1H 5IVOA 5GGRB 3MOQA 3FT3A 4LASH 1OGAA 2AXJA 5ALCH 2BVPB 2YEZB 4QXUH 3G08A 1CFTB 4WTXA 2GJ6A 3P40A 3W0WA 2EIEA 5A2JH 3S37L 4DN4L 3KPRA 5JR1L 4LDEB 2OJZL 4Z7NE 1YUHB 2PR4L 1ZT1B 3D1MC 5D70L 1KJMB 2X4SB 2EYSB 3B43A 2V7NB 5M94B 4MA8H 5EOTB 2HRPL 3AC0A 4ETQA 1JTTA 1XGTA 1NBZA 1MHEB 1OCWH 3SE3C 2AEIT 2JK5B 4HUXA 4QRRD 3OAZH 1EV2E 3CFEB 3WYRA 1J0KA 1PX4A 3RPKA 5IK3A 4XZUA 1Q0XL 4WI6A 5ANMB 5D96B 1ZEAL 2ZOKA 3BKJH 4NQVB 4S1RL 2DQTL 1GC1L 4MNGA 4O4YL 2WINA 2NY4D 2ZUWA 1KCRH 4LSQH 5D7LB 1LO3L 3RNQB 5GHWH 1EMTH 3P11L 1NBYA 3FN9A 1N64H 2JCCB 4K71C 5E8DH 2J5LC 1RY7B 4P23D 2OBGA 1ZMYA 1OB1A 1S7WA 1FH5L 2DMKA 4XVTL 3MCLH 1ZHLA 1MELA 1Z9LA 4OD2B 4QT5B 2DM4A 4Z0BH 4X9IA 1BZ9A 2WBWB 3L3HA 1JHKH 2CMRH 1EDQA 3S96A 3WNNA 3WIHL 2DBLL 4GRLA 1N8ZA 2Z4QA 4KHTH 3U46B 1A8JH 2EDQA 2ESVB 2BCKB 4HWUA 4GBXA 4OGXL 2PYFB 3NH7L 3CDCA 5AZ2H 5A40E 2G2RB 1HI6A 1A47A 4PJCB 3ME0A 3V5KA 3MJ8B 4E41D 4KMQA 3IFOB 2X4UA 4UV4L 1AD9B 2C4XA 3S36L 3P9LB 3EJYC 4YX2H 2K9UA 1G1YA 1K3IA 4YHZL 4I18C 5TDPB 4TNVK 2BNRE 4WVRA 2JCCF 5JW3H 1VACA 5I8CA 1OARH 4KKNA 7FABH 4BSJA 5JXAL 3LH2H 4XP5H 3EO9H 4KJPC 4OZ4A 2L0DA 1N5AB 4FP8L 4ZFFB 1ZK9A 3OXSA 4MAUH 5M95B 4HLZG 2AV7A 5TJWK 3TA3A 3HI6L 4OUOA 5EN2B 4O5LH 4PP1D 2VLJB 4J3UA 5CJOH 3AREC 1UKTA 4L4TD 5DQJA 2Q6WB 1CR9H 1AFVH 3FB5A 1FAIL 5GGVL 5J6HA 3T4YA 4PRHA 3ZKXB 1BBDH 2NYYC 4LEXH 4OD3H 3MLRL 3VDAA 1HILB 4Y19A 2HJKA 1E4WH 1OP3H 1RZJH 4Y0GA 2P24A 4Z8FH 3OKMA 4WO4D 1VADA 2WQRA 5KSBA 5C9JA 3MA7B 4MSWB 2QSTA 1TQCB 4BSWA 3MRDA 4LMQE 4NZJA 5L8KB 3QIBC 4FFVD 1HZHL 1D5XA 5HGHA 1CFQB 1DEDA 5CD5D 3ULUH 1F58L 1WWCA 4NQXA 1VDGA 4MX7A 1T2JA 4G8FB 4XPAL 3RVXC 3TLRA 1ZLWH 3LVEA 3VCLA 1ZHNB 2AJYH 3C09C 5D71L 1FJ1A 1VGKB 3BP7B 4J4PA 3FJTA 4K9EC 4JFFE 1MJ8H 5E7BA 3S8WA 2YD3A 2PO6B 1RHHB 1MCCA 1DEEB 1PY9A 2FH6A 3GJEA 2G5RA 5FM4A 1KN2H 3TIDA 1YYMH 3SKOA 2FEDD 4YHNB 3C5ZB 1XCQA 2P8LA 2YN3A 4J8RA 3RHWF 3OAZK 1QNZL 1BX2B 5C0CA 2EECA 1XR8A 4K3JH 4F9LA 1RUML 3O2DH 4LSRL 4WW2B 4JLRA 3S5LB 5FUCC 1G7HB 4KAQL 2IH3B 1W0VB 4ZAKA 2JB6A 4X4XB 3QHFH 1JMZA 4UMGA 3WV0A 1U3ZA 3TN0D 3KPPA 3MV7D 1N2RA 2DLFL 2RCSH 3Q6FB 4QHUB 1Q72H 2E9JA 1CXIA 1JN6A 2OL3A 2QSCL 3MV8A 2W9LA 2YC1B 1YN6B 5DJDA 4POZD 1OAZL 1RAMA 2P7TB 5D7JC 3NABH 4PV8B 3KPLA 4MCZA 2AXFA 5IJVB 3NZHL 4GKZB 5F96H 5EIVA 1LVEA 2AI0L 3MLXH 2AQ2A 4HXBL 3EIFA 2AJSL 1E4KA 1TCRB 4PGBB 1NC2D 1GRWA 2ZWLT 5DEZA 1NEZG 3HHRB 1MCJA 6FABL 1M7IA 3L95A 3OR7B 3QRFM 4P4RA 4WW2F 5F3BB 1FVCB 5D9SB 5C08B 1YPZA 3QFJD 4ONOA 2DJ4A 2ITDA 3M1BA 5TGBB 3X13B 1OWRM 3TJHD 3ULUD 3SDDB 4GKNB 4S1QH 3AM8A 2MWCA 1OTSC 1IAII 1IC4H 3LKOA 2ADIA 1IGMH 1T1YA 1F90H 5I1JL 4NQCD 3W2DH 4OCLC 4QF1B 1X9QA 2W0PA 5EO9B 2MHAA 1JWMA 2EIDA 3TZVB 4NQSB 1UB5A 4L3CA 4XCEB 5FXCH 4JKLA 3ZTJH 2H1PH 1OAXL 4FTVE 1WBXB 2QL1A 3OAYH 4OZHE 3VXPB 3UBXA 1UA6L 4JQVA 1LGVA 3C6LA 4JHAL 1EH9A 1MLBA 3DO7A 5MEPA 1NBVH 3OMZA 1KG0A 3EYVB 5ISZD 1DBBH 4TVPE 2OYPA 3GSOA 1FYTE 4WHTA 5D6DC 1R3LB 1EJOL 3U0TA 1AGDA 4MNHA 2BHZA 1IGTB 2V2XA 3O3EA 3O6FB 4LBEA 4U1NA 4N0CC 5K9JL 1T04B 5EU5B 3N1MC 5I19H 1UM6L 2X1OA 3UJTH 4LHJB 4P2RE 4UNTA 3CU7A 1O7VA 1RFDH 1KCSL 2FO4B 5ID0B 1T2XA 3FO1B 2DQEL 4MD0B 2H2SD 1UGNA 1IAIH 4QTIL 3T0EB 4KMTL 1PEZA 5KOMC 3T0VA 5I1GH 3ARRA 4Y4KA 1T22A 4WRLA 5B3JE 4MJID 5BV7H 3LZFH 4FZEH 3PGFL 1T89A 3C87A 3P0GB 3RA7L 3REVB 1KYOK 2RHEA 4P2QD 1AQDA 4U1MA 4OIIL 1GCFA 1YEEH 1KV3A 4X8XA 4LPVA 4NWUH 3DXAA 5IP4A 4WI8A 4XBEL 4QOKD 3H3BC 3CDGB 5TE7L 2GIYA 3LN9A 3S98A 4PRIE 1DVFD 4R9HA 3MRBB 3LKSB 5FYLE 5CP3A 1RIVL 5D5MB 5GGSY 1U6AH 5T5NF 2D7OA 4JREB 1IQDA 4PRPB 2IBZY 4UT6L 2P43B 4LPXA 3B3IB 5FO9B 1GC1C 5GZOD 3BE1L 1BIIA 1QO3A 3BH8A 1MCOL 4H5SA 5K33A 4V1DE 4ENED 4JM2F 1JP5A 5IBTL 4FG6C 4NKIH 5C0IA 3HMWL 2DDQL 2GAZB 2OI9C 3O4OC 3F8UB 5FGCB 3C8DA 3HC3H 4X98B 4KKAD 4HIHA 2Z8WC 1WCBB 2BK8A 2IANA 2Y07H 4ETYA 3BZ4A 3RWCB 5I8EA 3VD4A 1BJMA 1M71B 3RL1A 1KIRA 1SMAA 1SY6A 2BSSA 3GFUA 4NRYB 4YHML 5D5MF 2FCBA 3ILPA 3KNBB 3VI4F 5EBGA 4P2OD 1PKOA 4EI5A 2OSLA 1E4XI 5GGRA 2OJEB 3RL2B 1A7PL 2HT3D 4V2CB 5KSUB 1JYXA 2BVPA 3P30H 3J8F7 2EXYC 1CFTA 4H20L 4HPOH 3WFDL 2I60H 3CC5B 1BPVA 2OR9H 5KSVA 1FIGH 1YUHA 1ZT1A 3DARA 2BC4B 5I1HH 1AE6H 4LAJH 4U4BA 1KJMA 2X4SA 2YPVL 5DEFB 3L7FB 2V7NA 5EOTA 1RU9L 4I13B 2ADJB 2YD1A 4U2YA 3D6GA 4JHZA 2IQ9L 3CFEA 3I6KB 12E8L 2Q20A 2XTJC 2JJSC 4L3EB 2XQBL 2VLRB 4J3TA 5IGXH 3F6LA 5J0BA 1FPTL 4NQVA 5K59F 3UTPD 4OBSA 3QCVL 5CP7B 1KTDB 1L7IL 5D7LA 3SBWC 1IAMA 1YNKH 4BFIB 1ULVA 5INDB 3QJFB 2JCCA 4X6CB 4HPYL 1E4XH 1AO7B 1GGIL 4PFEA 1QSFB 1GH7A 2EDOA 4NQDE 4U3CA 5C8JB 1CGTA 3IDGB 5DD3H 2HKHH 1CLCA 4QT5A 4YXLL 4KRPC 1J8HB 1JK8B 5SWZD 1KXQE 4LPTA 1A6ZB 5FHAH 3F7QA 2IBBA 3C08H 3HKFA 3U46A 4F58H 2BCKA 4K8RH 4DEPC 4S1SL 4HW6A 2PYFA 1XT5A 1YC7A 2G2RA 4MLIA 5C09E 5D7KD 4PJCA 3BAEH 4OCRL 4JRXD 3MJ8A 4K3HA 3QNXA 3IFOA 4OV6F 1MCSA 3RWFB 1AD9A 1OQXA 2YHGA 2PYEB 1PSKH 3VMPA 2W9EH 3BDXA 3VWJD 1KPVB 5DURB 5TDPA 1FLRH 3GDBA 5C6TH 4BQ6A 3ARBB 5IMKB 5J56B 4Z7QE 1J05A 4D9LL 4TVPL 5C07E 4PD4J 3RX7A 4N0FB 3MCKB 5ILTL 2QSQA 4LCCC 5KTEL 1T83C 3CVHB 1NGYB 1N5AA 4ZFFA 4GRLC 3QHZL 4RSVA 5EG6C 1EA9C 5EN2A 2VLJA 2YN5A 1EGJA 1KEGL 1TZIB 1T4KB 4GBXC 2Q6WA 3L6FB 1DLFH 4DUXA 4YBHA 1WWBX 2DL2A 4L4VE 3BMWA 2V6HA 1HILA 3JWNC 1AJ7L 3R0NA 4YBQD 5E6IB 5JW5B 3QI9D 1NAMB 4OFVA 2MKLC 1VB9A 1A6AB 4LVOB 5A43C 2X4PB 2VIRA 3MA7A 4GRWE 4XTRD 4MSWA 2KL6A 1WJ3A 3FOMB 2Z8SA 1AQKH 1F3DJ 5K93A 2DYPB 4ELMB 3HI1B 5CEZE 1JL8A 1S7XB 4H1LB 2Y7QB 1P7QB 4MS8D 3QDJE 4HF5L 3VXMB 4QLRA 5DJYB 4E42B 2C3WA 4POUB 4G8FA 2EDFA 1C16B 1ZHNA 3TPUB 5E4EB 1VGKA 1JF1B 3BP7A 4N0UE 1I8LC 1EEYA 2PO6A 4K8RD 4M6MH 1EEZB 2W92A 1RHHA 1UJ3A 3R4DA 1DEEA 4HKBB 4M7JH 3R1GH 3N9GL 4YHNA 4JFYB 3C5ZA 2X4RA 5FECB 3KXFB 3ARUA 1INEL 1BX2A 3MLSL 3PHOB 1IC7H 4OCSH 4HBQA 2J8OA 5B8CC 2EZ0C 4WW2A 4HS6B 1G7HA 1W0VA 3GIZL 4X4XA 3VD5A 5DJXB 5EOQH 3WSQH 3U1SL 3D48R 2YXFA 4EOWL 3Q6FA 4NBZB 4QHUA 4UAOC 5DA4A 3KLHC 3BGAA 5JUEL 4YHYC 1KLGB 1KB5B 5KANG 3EO1B 2YC1A 1YN6A 5GRUL 2Q8BL 3WMSA 4GQ9H 4F15B 2P7TA 5IESH 5HDOA 1BREA 1QFWI 4PV8A 1ZSDB 3MLPA 5IJVA 3GRWA 5EBLB 2XKNA 2L7JA 4OF6A 1Q94B 2JJUA 2KUTA 1T03H 2EXWD 3V52H 4WUKL 2AV1B 1YYLH 2MCPL 2ARJA 4PGBA 2V5SA 3B2VL 4KVCL 2E27L 1YNTB 3MLTA 2FDBP 4R3SA 1MJ7L 1B2WH 4F9LC 3OJ2C 3FFCB 4X4YB 3T0DA 3OR7A 4K07A 4ZAKC 4JVWA 3UO1H 1F4YH 5F3BA 1FVCA 4PB9L 5D9SA 2VZTA 5C08A 3WFEH 3X13A 5TGBA 3Q6GH 3TC9A 1EZVX 3GI8L 1QLEL 4MXQD 1UZ8B 4NO5B 4YUEL 3SDDA 4MZ2A 3O0RH 3EDEA 4X80L 4D9RE 1UM5H 4L8CB 3X14B 4QF1A 4WWID 1I9IL 5EO9A 2XKSA 4K7PL 1CFNB 3TZVA 4NQSA 4Q9RH 1A3RH 4UINH 4XCEA 5GRWA 3U6RB 5AEAA 2BFVL 5DUPL 4KK9D 1WBXA 3AS0A 1RIHL 2EDLA 4KQ4L 1L7TL 3GI9H 5DTFB 1QRNB 5INCB 3WDIA 1Z3GH 2VDOH 5HGGS 3MJ9H 3JTTB 3ESVF 5I1EH 5IB3B 2DQCH 2APWA 3EYVA 3QB7C 1BJ1J 5D72H 3VD9A 1R3LA 4PGJA 2JKXA 5D1XB 5DC0A 3MOAH 1DBKH 1IGTA 3WUWA 3NCYP 4DAGL 3O6FA 5E95B 1T7ZA 2V7HB 2HFEA 4ZS6D 5EU5A 2HTLD 3ZE2E 3BOVA 2X7LB 3RY6C 3VRJB 4ZPVB 4KZDH 2H32H 1DE4B 2FO4A 4XMLH 5ID0A 4N0YH 5IMLB 2APXA 3FO1A 3QEQD 1JZ7A 4MD0A 1F3DH 1NUNB 2CKBH 3T0EA 3C6LC 3DMMB 2X89A 4ZFGH 3AMLA 1S9YB 5CUSL 1A1OA 1ZOXA 1Z9OA 3WKML 2P8MB 3MUHL 5MEND 1MQKH 1KFAL 1HKFA 4X7SH 4XVUC 1A7QH 3UZQA 1BEYL 4DVRH 4N5EC 1HIML 4G6MH 1R3KB 1P4LB 2ICCA 2R4RH 3CLEL 4C57C 4JFOB 3O6LL 3EYUL 3CDGA 4KQ3H 3CDYA 3LKSA 5KSAD 1HKLH 1U92B 4CU7A 4LSPH 5D5MA 1BFOB 5IHBA 2YD2A 5I1IL 3GSNL 4PRPA 1X5LA 3ZE0F 4M43L 4UILL 3B3IA 5FO9A 4RNRB 3H7BB 1NQBA 2R2CA 3VFWB 2AGJH 5FYKH 5GS3A 5GS2H 3BFOA 3GBMH 4KDVA 3L3GB 4L1HA 4PJAB 4HMCA 3QCUL 5JIIA 1X7QA 1D6VH 4LVHC 1T89C 1H3VA 4OF7A 2BX5A 4XH2B 3GGWB 1KELL 4XP9H 1JGEB 1MCIA 2E6JA 3GSVB 5CSZB 4C4KO 2BDNL 1GZQB 2GAZA 2R69L 4RA3A 1ZANL 1WICA 1P9MA 4X98A 1CQYA 5HJ3A 3N1QC 5MHSD 4MDJB 4NO3B 1WCBA 4MXWH 5D93C 4UOW1 4IS6B 3EHBC 3L3KB 2WMPA 4XNQB 1IKNA 5FA3B 1NLDH 5DMIL 4TTGA 3CXHK 3CMOL 2VE6B 2K7QA 4NRYA 1KJ2B 3KNBA 3VXTB 4NFBA 5I30H 1JYWA 3UTTB 3MNVB 1U95B 1I9RL 4MAYB 3UPCA 3BDYL 2OJEA 3RL2A 1ZV5A 4IBLT 1FCCA 2NQCA 4KU1A 5GSVB 1A5FL 4R4BB 5KSUA 3BVNB 2FBJL 4PJDB 1R3JB 2EE6A 1U2HA 3CC5A 1MQ8A 1JNLL 1G7PB 4H88H 2B1AH 2NY3D 1VHPA 3IDIA 3WL9B 2BC4A 2A9MH 1XIWD 1PKQB 1BBJB 4Q74A 5DEFA 3E0GA 3GHBH 2Y36L 3VFRB 3CFDB 1UH4A 4JFPB 2ADJA 5J11B 1CU4L 1UWXH 1KC5L 2CDGA 2PW1B 3H0TB 2A77L 3I6KA 2DLGA 3DVGB 3OKKA 4L3EA 2ARJQ 3MXWH 1A0QH 2RB8A 2VLRA 1BJ1H 3BQUD 1UH3A 3JV6B 3EJJX 5FM5O 3MGAA 5DUML 1LE5B 5FYKD 5CP7A 4HUMB 1KTDA 4DTGL 3RVTD 2HG5B 4KV5E 5AYUL 4GMTH 5INDA 3QJFA 5BRZD 1RULL 2EH7H 5DVOA 1NSNL 2JB5L 4X6CA 4IOSD 4G9FD 4PJDF 1RUAH 2V17L 1AO7A 2J12B 5CBAB 4PG2C 1QSFA 1MSPA 4M1CD 4Y1AD 5HI5D 5C8JA 1WIPA 2EH8H 2WW8A 3ROLB 3QUZD 1FO0H 4XPFL 4RGMC 5J12B 3W82A 1J8HA 4DKDC 3ZHLA 1AGCB 4GQPH 3MLUH 1G9NH 5L9DL 4YXKH 4R90L 1A6ZA 4G8GD 2VXQH 4OTXH 3TV3L 1U93B 4JE4B 4JKWA 4JQXA 1D3CA 2HN7B 2CR3A 2C9AA 3DGCR 3TBTB 4NQED 5D96C 1FYHB 5EZLA 2AQ3A 2VDKL 4KKLD 1T3FB 4LVEA 2QADD 2PYEA 3VGFA 4P46B 1MEXL 3FZUC 4X5WB 1KJ3L 1KPVA 3S7GA 3MOBL 3PGDA 5HYJE 1XGPB 3P2TA 4RAVA 3ARBA 2VDNL 4OT1H 3NMEA 3MBXL 4WGVB 3DV4B 4J1UA 4PRBB 3I84A 2AK1H 5HDBE 1S7SA 3MCKA 1T1ZB 2VQ1B 4UT7H 3CVHA 5CLTA 1NGYA 4POYA 4QRRB 4HIJB 4I48A 5IWLC 3QG7L 2ZSWA 3D39E 5ICZB 3GHEL 1MCWW 3VGEA 1OWWA 1T4KA 4CL7A 2ED7A 1BGXL 2D9CA 2BY0A 4OLWL 3IU4H 2EKSB 2MTPA 2PTUA 3P4MB 1IAIM 4HBCH 3D2UA 5E6IA 5HGDB 5JW5A 1MFBL 1J1XL 1NAMA 2CGRH 4P23B 1A6AA 2X4PA 4A6YB 2DBJA 1DBMH 1DBAH 3FOMA 1DN2A 5EFIB 4LCIL 1EHLH 5F6IC 4U6VH 5J1AB 4Y16C 4TNWF 4X5LA 5LXGH 1S7XA 3QCTL 4H1LA 2Y7QA 5JA8B 1P7QA 4OCWH 5SX5K 3VXMA 5DJYA 3QXTA 1KF9B 4E42A 2DTMH 1A6VH 2D7QA 1XCTB 1LK3H 1W8NA 3SQOH 1C16A 3T2NH 2Q1EA 1MVUB 3OKNB 4X6DE 1JF1A 3WIIL 3MRRB 4E41B 5JW4N 3MR9B 4GFTB 1EEZA 1AC6A 1NFDE 4QXGH 4XNUH 1JHTB 1QVOB 4WUUD 5JIPA 2NY0D 3SE8L 4HH8A 4JFYA 1IGIL 4Y2DD 2H26B 1EEQA 5IB4B 3GMNB 4JFDE 1SEQL 1NMAH 5FECA 1NCBH 3CZFB 4TSCH 2UZXB 2WWKO 3I50L 2ZJSL 4HWZB 2NY1D 3MJ6A 1TQCC 4OV5B 4HS6A 3VFOB 1I1AB 2ZUQB 4HJ0D 4XPBL 1VCAA 5F7YC 5K9QG 2A6DB 1YQVH 4GMSH 5DJXA 5CEYB 5GISH 3EGSB 4CW1A 2EE3A 4WFGD 3FO0H 4KRLB 1E28B 4KJWC 1R0AL 5DVMA 5E5MB 4M48H 4CDGC 1T0PB 4S1DD 3RRQA 4N1EA 1BQLH 5EULV 3EYSL 2DN7A 1KLGA 5F8QC 1KB5A 2EC9T 4K23L 2F53B 3EO1A 3QNYB 4LLQB 4PJ7E 4LSDA 4M3KB 4XNYH 2XZQL 5DRWB 5L88H 4MJ6B 1ORQB 5KBNC 5EBLA 5DT1L 1Q94A 3QZWG 2AJUL 5H94B 1J1OL 4WO4B 3C5ZC 2DIAA 2QEJA 4FFYH 4O58H 3PWJB 2CO6B 2AV1A 4XCCL 5DR5L 3SE9L 2ZUXA 4ODTL 1KNOB 2BOBB 1V7MH 1YNTA 4HS8H 4OFYD 1OT2A 4OLVL 4OI9A 5T1KB 2GQHA 1WT5A 3FFCA 4X4YA 1DANU 5I2IB 4PJHE 4P4KB 3P73B 2X70B 1IAOB 3MUGB 1ND0A 3DUUB 4HG4J 5EOCL 1C5BH 3K4ZA 5IT2L 4NO5A 1UZ8A 3CVHL 4OCYH 4ONFH 4L8CA 3X14A 1ZGLM 4OZHF 1CFNA 2NR6C 5FK9B 3NTCH 3KAAA 4U05A 2ORBL 4XP4L 2O5YH 4M7KH 4RMWA 4LFHG 3Q1SL 5I1CH 4XCFH 5JQ6H 4WFFE 1QFUH 1QRNA 5INCA 5E6YA 2NY2C 4G8EB 2NMSA 2XN9D 5IB3A 2QQNL 1EZVY 2X1WL 4NM8H 3TN0B 2PF6A 5D1XA 1IC5H 1CD1B 1E6JH 1SHMA 3RBSA 2FLBT 4EBQH 3OJVC 3KYMB 5CZVH 3ZYJA 3BKYL 1IBGL 5E2VH 2V7HA 1VEPA 4HUWA 2OZ4H 1J88A 2X7LA 4IRZH 1XR9B 4ZPVA 3VRJA 4DOHE 1DL7H 3BZDA 3VGAB 3QPQC 3TZVC 4DGIL 1DE4A 1BQHB 5B3JF 1T7WA 5DZNA 3ZSTA 4NRZB 4Y5VA 5JORB 3H9HB 1NC2B 1RI8A 5FOBB 3DRTB 4KI5E 1FSKC 3DMMA 4KDTA 1S9YA 1J0IA 4L8DB 2P8MA 3DSFH 4DKFL 3ELAT 3QSKB 2AJXL 3SKJH 3WS3B 1NC4D 4XPTL 3QFJB 1R3KA 4UT9L 1P4LA 4TPRH 4JFOA 1C08B 3O8XD 1QPXA 5J1SC 3IFLH 4NQCB 1CLZH 1U92A 3FKUS 5HXMA 5KANI 1HXMB 2FX9H 2HFGH 4LSTH 1IMHC 1IM9B 2KQNA 1H15B 4UDUB 2P5EE 5DO2C 4NGHL 4RNRA 3H7BA 2WBJB 35C8H 2Y06L 3BPOB 1JJUA 4I9WD 2JIXB 1MRDH 5ADPH 5LWYL 4PJAA 1MFEL 4M1DH 1NGWB 4DW2H 1T66C 2DLIA 3V4UL 1ZA6A 4XH2A 5HVHC 2ZCHH 1MCRA 3GGWA 3GSVA 1TLKA 1GZQA 1RJZB 2R23B 4AMKH 1OLZA 1N6QL 4FQCL 1JRHI 4XC3H 4KK5C 1CGXA 4YDLB 4NO3A 4NUGH 4I3GA 2Z92A 2VABB 2VXSL 4IS6A 1YMME 3L3KA 2VR4A 5FA3A 3OF6D 2CDEB 4BZ1H 3DECA 3SDCD 1KJ2A 4JREC 4CBPA 5ITBH 2Z31C 2FZ3B 4HFUH 2L4OA 3MNVA 4OGAC 1L9NA 2VUOA 1P4BL 1U95A 4QHLB 1P84K 4XHQA 4ESKA 4MAYA 4MYWB 2C3VB 4Q6IC 4APQA 4DQOL 5FM5M 3AB0B 4YK4C 5GSVA 3RZCD 1SJHB 4LRIA 4R4BA 3BVNA 1WBZB 3NCFB 1CDCA 4PJDA 4M61B 1NKRA 3VXRD 4P2QB 1R3JA 3RWDB 5DVKA 2VSCA 4BQ9A 2DIJA 1K4DA 4GLRI 2OCFD 4QOKB 1G7PA 4JEGB 5E00B 4PLOB 3WL9A 1HWGB 3NFPB 5HHMD 1PKQA 5EDXA 1F11B 1BBJA 1NJ9B 4G80B 1IKNC 1N5YH 3VFRA 3U0WH 1J18A 2MNUA 4OM0L 1JRHH 4I0PC 1NDGB 3H0TA 4AG4L 1W0WB 5IR1B 3DVGA 4NZTL 3X3FL 4ZPTB 1R3IL 4WEBL 1OD9A 2AXHA 3JV6A 3V79C 3IDXH 1VSCA 1NMCC 1LE5A 4IHOB 4QRPB 1A14H 2AJZB 3Q5TA 2IAMD 4JKPL 1WQVT 3WXWL 1JPST 1CCZA 3F7RA 1XGYL 4IMLB 3HE7D 3IDJB 5CBAA 1D5IL 2WZPD 4JB9L 1T21A 1BWWA 3ROLA 2W0FB 1EBAA 5CZXC 1LO4L 4AENB 4GLRH 3PQYE 4F37F 1UENA 3MQIA 1U93A 2AW2A 2VXUH 4P2OB 3HCVB 2HN7A 1IKFH 2HTKC 2EE2A 3IRZA 4G7VH 2NCMA 3QT2A 5KVGL 3DOSA 4GRWB 2ZP0T 1T3FA 4UUJB 5BV7B 2ADGB 3S5LG 3WLBB 2VDRL 3GIVB 4P46A 4X5WA 4C4KT 2H8PB 4Z7QF 1JYVA 3L3JB 1V3MA 3ARFB 1XGPA 5B39B 1D5MA 4ODWB 3VWKA 5HHOD 1WTLA 4X7DC 4FQLH 4MQXC 1G6RB 3S97C 3C2AL 5DJZB 1J5OH 1F2QA 4U1LB 3OAUH 3DV4A 2XWTB 4PRBA 4NJ9L 3ULVH 3V0WH 5KVEL 4N0UB 4NN7C 5SWSB 2OMBA 4L4TE 1T1ZA 2IPTH 4NN6C 4QRRA 1RQ5A 3QH3B 4HIJA 1AXIB 3ARZA 3GSUB 4G3YH 4KROB 5ICZA 5KVFH 1WV7T 5F9WB 4ALAL 1IEAB 4AZ8A 1XF4B 1B90A 1OP5K 1X4YA 2P47B 2EKJA 2ZNWA 5B22A 2ZKHL 3I3EA 3TT1H 2EKSA 3P4MA 4LLDB 5F93C 1IZKA 4GRWF 2MQ0A 3PG2A 4KK8C 3WFHB 3MV9E 5TFSL 5HGDA 4P23A 5DC4B 4LEOA 3X3GH 1MCBA 2NY7H 5FYJH 1LDPH 3FQRB 4A6YA 4CVXB 2XRAL 4JO1H 5J89A 5EFIA 2VH5L 4JANB 5AAWA 5SWZB 2FGWL 1H8NA 5J1AA 4B7IA 4YEFA 4MCYB 4RQQB 5J3HC 2ZCLL 1XCTA 3S4SA 3O2VH 2XXCB 3OKNA 4HGMA 5DLML 5JHDD 5I75C 5ITFA 3MRRA 3LN5B 4JRXB 1G9MH 4LSSL 4RFEB 5CEXB 2IEPA 1GIGL 3MR9A 4CMHB 3AUVA 2VLKE 1U8JA 3VWJB 4HFWA 1JHTA 1QVOA 3BEVB 3IFNH 5E6IC 4P57B 3QWRD 1OAYL 4P9HH 2ZUYA 4YWGL 3CZFA 3SGKA 4HWZA 3U4AA 3QPXL 2HT4C 4YDJA 5LVEA 2BHUA 3DHMA 1MWAB 3W0WD 4OV5A 5T5NG 3VXNB 3ARTA 4JY4B 3IT8D 1I1AA 2EYRB 2A6DA 5CEYA 2VMFA 3EGSA 4Y8DC 1T7VA 3O3BB 3ULVD 5E5MA 1IFHL 3KVQA 4G6FB 3OKEB 1U3YA 1ZGLB 3G5VB 3TEUA 5DEGA 3WO4C 4FTVA 2F53A 3QNYA 4JM4H 4LLQA 4YPGB 5IFAL 5E4EC 3TNMB 5DRWA 1QR4A 4HWNA 1QYGL 4M5YL 1PYWB 2VYRE 5T1LB 5DVNA 3LMJL 1WZ1L 4MDIB 3R8BB 1T7XA 3CFCL 5H94A 2VB5A 3PWUB 1FYTA 3U79A 3PWJA 4AEIL 3HNSH 5TF0A 1K3ZA 5FDWA 4JKMA 1KNOA 2BOBA 2X09A 3KYAA 5FYJD 3TH4T 1CZ8H 5T1KA 3UC0H 4HC1L 5I2IA 2EC8A 4OLYH 3P73A 4P4KA 2X70A 1WCQA 2R0ZL 1CGUA 1IAOA 3MUGA 1C5CL 4PS4H 3DUUA 1K5NA 1N0XH 2F54E 1JGVH 2OK0L 4UQ3B 5I0ZA 2H3NB 3QIWB 4PJEE 3CFKB 5ECJE 2UZIH 3RI5K 4TTDC 4WWKB 1K8IB 3OB8A 4XMPH 5FK9A 1TETH 3G6AB 1A1NA 1ITBB 3LKRB 5GGTA 1IEBB 2FIRT 5DMJB 1D9KC 5ISZE 3GJFH 4PJFE 1K8DB 3D0VB 4G8EA 4KPHH 2VZ1A 4XWOD 1RUQH 5JOFB 4WY7H 4ODVL 4RDQF 2YD7A 4FXLA 3TN0A 1MCEA 5JHLL 3PJSB 3RPIB 1CD1A 3QHTC 3KYMA 1WUNT 1IC1A 1P53A 4R7DA 1N7MH 4P59H 1A6UH 4RMRA 1FFNB 2OL3H 1WWWX 1IM3B 3S6CA 3TA3D 5GJTH 4V1DA 1BFSA 2VL5A 5FM8A 2JLLA 5IW6B 1BQHA 3RZWA 1D5ZA 4FQ1L 4NRZA 3ZYZA 1BP3B 1OSZB 5JORA 3H9HA 4PRHD 5FOBA 3DRTA 2ADFH 2WWKT 5ALCL 3D87B 4Y19D 5HY9A 5F7UA 1OTTC 4FFWC 1WEJH 5HPMB 1U91B 4L8DA 4K3GA 1EFXD 3WS3A 2JJTA 5DYOB 2WLZA 5K9QI 3QFJA 1QBBA 1MCFA 4K2UH 5I9QC 5DUBB 5C3LD 4MWFB 5D1XC 4ZSOE 3HRPA 2J1KA 1QOKA 3QBTB 1C08A 4QXTB 4U6XB 4LPWA 2DLEA 4YBLB 4MA8L 3K8KA 1CDGA 1HNFA 3IRPX 4BUGA 1HXMA 1OCWL 4KUCF 3SE4A 1J8KA 1IM9A 5HTSA 2BSTB 1H15A 4P3DB 4UDUA 4J4PD 4YDIH 5JMOC 3BKJL 2WBJA 3RIAK 3IDYB 1RJCA 1KCRL 4LSQL 5MERB 2JIXA 2LU3A 5GHWL 1DQMH 1EMTL 3DMMC 5MEQB 2R39A 1NGWA 3NCBB 1N64L 5E8DL 3W81A 1NUFA 1UG9A 5C9KA 1RJZA 2R23A 3BH9B 5EU6E 3MCLL 4EDWH 1TVBB 4GXVH 4Z0BL 1JHKL 2CMRL 5F7EH 3PWPB 2FJHB 2VABA 2B1HH 4Z5RA 4XX1G 3W9EB 4KHTL 2CDEA 2A1WH 2ID5A 3B9KD 2HJFB 2W9DH 3MV8D 1BQSA 4Q9BA 2X9YA 2YA0A 3JSSA 4M02A 3QEQB 5AZ2L 2FZ3A 1X5ZA 4QHLA 5BOZG 3JWDC 2YMXH 1BMGA 1WZKA 4YX2L 1MF2H 5MENB 1SJHA 4LVNB 1C1EH 4M61A 5DD0H 4P2QA 5JW3L 3JUYA 2BNQE 4Y88A 1OARL 1JZ6A 7FABL 2VN4A 3CX5J 4X6EB 5E00A 1J10A 1L4IA 3BKMH 4AH2A 4RCAA 3RVWD 3LH2L 5KSAB 4XP5L 3EO9L 1AGEB 1EX0A 1F11A 1FLTX 4XVSH 1NJ9A 4G80A 4MAUL 5KAQG 5IOPB 2QJDA 3D9AH 1MI5E 4O5LL 5CJOL 4R2GD 4CVUA 3ARDA 3UTPE 1NDGA 3L5WB 4RGND 1CR9L 1W0WA 1AFVL 4Z7UE 1OVZA 5IR1A 3ZLQC 4ZPTA 1BBDL 4LEXL 1P6AB 1F42A 5HDQH 4OD3L 4HAGA 4IHOA 4QRPA 1E4WL 1RZJL 2AJZA 3NIFE 4LRIC 3TBSB 4Z8FL 4QWWC 3SGJA 4KI5C 4M9PA 3C6LD 4U7KA 4MVBC 4DFIA 4U6HA 4IMLA 4BQBA 3HC0B 3IDJA 2AXGB 1I1YB 4D9LH 4G42B 4RFNC 5T3ZH 2CRZA 5CHNB 2W0FA 3ULUL 1IGYB 3WNOA 4F7CB 3CFIC 3T04D 1S9XB 3B6SB 5CILH 4AENA 4FABH 4L4VA 5J11C 2AJYL 4P2OA 2FO1A 1SY6H 3HCVA 1QEWB 1KLUB 1MJ8L 1XF1A 1CICA 3T0BA 4OKDA 2CKBB 2KDGA 1KN2L 1YYML 3ECBB 2ARWA 4UUJA 1GJIA 2ADGA 5JW4Q 1LDSA 3WLBA 4Y4KD 1RZKH 3SDXE 3ZYOA 3GIVA 4I3RH 1HHHB 1GPOH 2H8PA 3L3JA 4K3JL 3ARFA 5B39A 4ODWA 2NY3B 3O2DL 5HDBF 3WNPA 1MCHA 1G6RA 4GAFB 4AIOA 4U1LA 5HYSA 1TZGH 3FCTB 1XIWB 4XBPB 3QHFL 4NNPH 2XWTA 3MNZB 5J12C 4N0UA 2RCSL 2FH8A 5E94B 1CBVH 1UEMA 1T2QH 5SWSA 1Q72L 2HA1A 2D7MA 3WHXB 1NFDB 2CLRB 4M3JA 3GSUA 1NCAH 2D4DA 3UTZA 3EFFA 4RGOH 5DRNB 3BQUB 1XF4A 3NABL 5ESQB 3M45A 5F96L 5JIHA 3WXVH 3MLXL 2I27N 4LLDA 1TFHA 3WEXA 2XZZA 2ZG3A 3AVEA 3P0VH 4X5XA 5C0AE 4OQTA 4Y1AB 3FQRA 2WLYA 3TIEB 2A83B 4CVXA 1S5HB 3NZ8B 1DCLA 1EO8H 1IGFH 2X05A 4QNPE 4UU9B 1DLHB 5T3ZD 1SBBA 4GAJH 1KENH 1F4WH 4QTHB 4MCYA 4S1QL 2IAND 4RQQA 1RSFA 1IC4L 3BPNB 1B0WA 1IGML 1F90L 4AT6B 1NFDF 1H0DB 3W2DL 3MLVH 4NQEB 3W39B 5HHVH 3RX8A 4YQXH 1SQ2N 4JRXA 2NY4C 5I8OH 4RFEA 5CEXA 1TZHA 5EBMB 2H1PL 4EI5D 3VWJA 1F4AA 3BEVA 1AC0A 2CH8A 3VH8G 2EDDA 1ONQB 4JVUA 4XHJD 4P57A 3PUCA 1NUDA 4P23C 1OGTB 1CXHA 1NBVL 5DGRA 1F45A 1HSAB 1DBBL 5IKCB 1DUZB 1MWAA 3BP5B 4AQ1B 3VXNA 3U9PH 1KCVH 2EYRA 4LPCA 1CGWA 1ED3B 3RWGB 3O3BA 2O5XH 5JXEA 2DJUA 5I19L 1ZGLA 3G5VA 2E7CA 4LK4A 3SN6N 3UJTL 1EGJH 1KB9J 4X4ME 1EXUB 5AAMA 1RFDL 3ZMRA 2R4SH 1JV5A 3HR6A 1QG3A 1PYWA 5T1LA 2B2XH 1IAIL 4MDIA 5K9KB 5I1GL 1E4JA 3PWUA 4EEEA 3GBLA 4P49A 5BV7L 3LZFL 1N59A 5D7LD 1I9JH 4FZEL 4PJHF 2Z35A 3KYKH 5I1KH 1YEEL 2ZUQC 4NWUL 1LE9B 4X6FB 1FL5A 1CE1H 4WFED 1ZWIB 3CSBA 4UQ3A 2H3NA 4PP1C 4YDKH 1AGBB 2NXYB 3QIWA 1CXEA 1U6AL 3CFKA 2OLDA 2BJMH 4PY7B 2XA3A 1EK3A 1HSBB 4G6AD 4WWKA 1U8MB 1K8IA 2BP3A 1A7RH 5D1QB 2KZWA 3G6AA 1J0JA 2LTQB 2NY0B 3LKRA 2CKNA 1IEBA 2YRPA 1SM3H 4Z76B 3B2UD 4KH2A 4WO4C 3RNKB 1WK0A 3D0VA 3WLWC 2NY1B 1KJVB 1T80A 4KK6D 4F7EB 4BH7B 3V6ZA 4NKIL 1YEFH 3BD3A 4FFVC 4GAGH 4R6UA 1SJEB 1FVDB 3MRNB 1T1XB 1VKXB 5CD5C 3P4NB 1DJSA 3PJSA 3UEZA 3RPIA 4D0DB 5HHQB 1KPUB 3QQ3B 3UJJH 3BESR 2P5EB 2Y07L 2D9QB 4HMDA 1JGUH 4ISVB 5GS0H 1PVHA 4C56D 1FFNA 1VESA 5E8OA 1IM3A 3ARGB 3K80A 3RVUD 3U30C 3KGRA 5CS7A 1NFIA 4ZO6A 2VLJD 2WAHA 3O6MH 5IW6A 3RY4A 2FEDC 3GRWH 1QP1A 4Y5YB 1FNAA 1OSZA 3W9DB 5E2TH 1A7BA 4OGZA 3P30L 2NZ9D 1W0YT 4JDZB 5I17B 5HPMA 1U91A 4XVJH 2XWBB 4HPOL 3O9WB 4NCC1 3PHSA 2I60L 2C3HA 2ITCA 4OZIE 3JTSB 2PXYB 3TN0C 2OR9L 5DYOA 4DK6A 1FIGL 5DUBA 3OGCA 5I1HL 5MI0B 1AE6L 2GSGB 4X8JB 2KH2B 4FNLH 4QXTA 4R0LC 4U6XA 4PB0H 4YXHH 4RZCA 4POZC 3EKCA 4S0SD 3TGXA 4IOFD 3LKQB 4I5BB 4LHUB 3NPZB 3T3ME 2BSTA 3VG0H 4P3DA 4CU6A 4ORGB 5F7DB 5IGXL 1MCLA 2PO6D 2E5EA 1RZJC 2FX7H 4GAYB 5EU4A 5MERA 5GGUB 2XN9B 1FG9C 5MEQA 1YNKL 3C5ZD 5EBWB 1HEZB 2FHFA 4U0RB 1E4XL 1JGLH 5ICYB 2MMXA 3IAPA 1KSRA 3NACH 6CGTA 5DD3L 3RHWK 4QRSB 3TJHC 1I8KB 3TCXA 2CPCA 3ULUC 1L6ZA 5EPMB 2HKHL 3BISA 1P1ZB 3PWPA 1I3VA 3H9SB 5FHAL 4QKXB 3W9EA 5GS0D 2CD0A 3X12B 3E6HB 2UYLB 3C08L 2HJFA 2CUMA 5HD8D 4F58L 5EZJB 1JZ5A 4K8RL 2Y1VA 3QEQA 3JUZA 2Y6SD 1KBGH 1MFAH 3SKMB 4D94A 4YNYB 2NX5E 3BAEL 1CK0H 1J0YA 3X11B 4PGEB 1PSKL 1CD0A 2W9EL 4MQTB 1T0NB 3KJ4C 3OSKA 1NC4B 4LRNH 1FLRL 5C6TL 1Z9SA 2EDWA 2X6MA 5DRZA 1CFSB 4X6EA 4G6JH 3O8XB 2P48B 4WI4A 1AGEA 1T5XB 5C08D 1QPPA 4P5TB 3OB0K 4UB0H 5BS0B 4KKBD 5DK3A 3TT3H 1ZKAA 3HR5B 3VXSE 4LCWD 3JBG7 4F7MA 5IOPA 3SDDD 4HS3B 4Z7WE 3L5WA 4N8VG 3NVQA 1DLFL 2H2SC 3DGGB 1FZOB 4F9PC 1EIBA 3U48A 5BRZE 3HC4H 4G9FE 4DKAA 2DJSA 2BY2A 4EUPB 3TBSA 4FN0A 1NCTA 1PBYA 1P2CB 2X4QB 4F2MA 4PJBE 2AXGA 1AQKL 3QWOB 1I1YA 4G42A 3T08A 1JZ8A 2G9HB 4G8GE 1DVFC 4GRMB 3T09A 5CHNA 2D4FA 1CGSH 2AJ3A 1IGYA 4U7MA 1Q9WB 4F7CA 1CXLA 5FEBA 3SDYH 3SDCB 1S9XA 3B6SA 3O6FD 1I8MA 3MRIB 3RBGA 3PDDA 5GZOC 1X5YA 2AEWA 2B4CH 4M6ML 3B5GA 5BW7C 4M7JL 5T3XE 3R1GL 4ENEC 3RZCB 3ECBA 2IC2A 1JHLH 2YUZA 3P3YA 4JM2D 3T0ED 1FAKT 1I4FB 3TESA 1VFAB 2VZ3A 2X89D 1HHHA 1OAQH 4ZDHB 2FATH 2YWZA 1IC7L 4DFHA 5J06A 4OCSL 2H2PD 1N6VA 4OFDA 2UY6A 3CAFA 3FCTA 4KKAC 5IW3A 4XBPA 3QIUB 5EOQL 3WSQL 3MNZA 4S11A 1MFCH 4JY6B 5TPWH 5E94A 2IH1B 4EQ3A 2R1XA 3Q0HA 3WHXA 1NFDA 2EE9A 2BVUA 5I6XC 4P2OC 1KB9K 4GQ9L 5DRNA 3QUYB 3BQUA 3CSYB 5IESL 3BKCH 4FQHB 5IVXE 4PRPD 5ESQA 1IAKB 1RZ7H 2HT3C 5DJ0B 3IXAB 2I07A 1T03L 5FGBC 5BV7C 3V52L 1I8IB 1YYLL 4G5ZH 2VZVA 3HE7B 3LRSB 4PJXB 1GAFH 4KMLB 2P5WE 1B2WL 4Y1AA 4OQ1A 3TIEA 2A83A 3ZHDA 1S5HA 5IHUH 3NZ8A 1BFTA 1BZ7A 3IAQA 2W0LA 4PJIB 3UO1L 1F4YL 4UU9A 1DLHA 4JFHE 5CJXC 3WFEL 1N0LA 1EO5A 3Q6GL 4QTHA 4JG0H 2R2BB 3REWA 3O0RL 3AS3A 1P69B 1UM5L 3ZKND 3TVMB 4AT6A 1NH6A 1H0DA 3GSRB 2HFTA 5D2NC 4WUUE 2LU7A 43C9B 3W39A 2YA1A 4Q9RL 1UFUA 1A3RL 4HWEH 4OLUH 4NKDA 4UINL 5HGAA 1VENA 5EBMA 5DMKB 3DIFB 2V5YA 2VO5A 3IETA 3QA3A 3GI9L 5IBUB 1ONQA 3B9AA 4PJHA 3DX9B 4D9QD 2W65B 3QNZB 1Z3GL 2FGZA 2VDOL 3MJ9L 4QGYA 5I1EL 2VWEC 2DQCL 3KYOB 1HSAA 2CUIA 5EIIB 4EDXB 1DQTA 5IKCA 1DUZA 1PQZB 3BP5A 5D72L 3QQNA 4C83B 3MXVH 4KY1H 3B9DA 3L9RA 3MOAL 1DBKL 4ZUWB 1ED3A 3RWGA 3G5YB 1LD9B 2DKMA 1BQHG 3D3VB 5HYFA 5E9DD 4GG6B 5D1ZA 2E9IA 4ZO8A 2N7BA 1ACYH 3V8CA 1EXUA 4MB5A 4KZDL 4XCNB 4XMLL 3AAZB 4N0YL 3ULSB 4CMHC 2DWDB 4TSBH 2VXVH 2CKBL 4CMMB 1OW0A 1AGFB 3VWJC 5K9KA 1BD2B 3LRHA 4BJLA 5L0QB 3LQMA 5D2LE 4ZFGL 4OI7A 5J8OA 5DJ8B 1NAMH 3V4VH 1MQKL 4UIKH 4X7SL 1A7QL 4Y89A 2R0LH 4DVRL 25C8L 1AO7D 4G6ML 1X6LA 4UOJA 1QSFD 1EAPB 2R4RL 1LE9A 4X6FA 4HIIB 1OD7A 1HQRB 4KQ3L 1B0RA 3GKZA 4EI6B 4H1LH 1HKLL 4LSPL 3ALXA 5C0BE 4PY7A 5GIRB 5L7XH 4P2CG 1HSBA 2KBGA 1E6OH 2EDBA 3QDGD 4GG6F 1U8MA 3UP1A 4I8DA 4LIQH 5D1QA 4OF8A 2GY7B 4PJFF 2D7TH 4ZXBA 3HTLX 4YBQC 5ADOH 2OXHA 2AGJL 3QI9C 5FYKL 4IMKA 2J88H 3GBML 3RNKA 4ZNEE 4YFLI 4XTRC 3UDWC 4V2BA 1D6VL 2PYED 1KN4H 1KJVA 2ZUVA 4F7EA 4BH7A 5DURD 4XP9L 3BN3B 1AD0B 5F89B 1NMBH 3TYGH 1SJEA 3U4BH 3ARBD 1VKXA 2XZCH 3P4NA 4PLKD 1MH5A 1QR1B 4MS8C 4YAQB 3LQAH 5E8PA 1MCQA 5HHQA 1E27B 5HSFA 1KPUA 1C12A 3QQ3A 2KZ1B 4MXWL 2P5EA 1TTUA 4OIAA 3BRFA 1XGTB 4ISVA 1NBZB 3HG1E 3O3AA 4CJ1A 1NLDL 3S35X 1G7MB 3ARGA 1KB5H 2NTSP 4K8RC 4UI2A 3OGOE 4PV9B 4XZUB 3BRGC 5I30L 1GGUA 4PYGA 2OQJB 3KR3H 5TDOA 3CNKA 1YJDH 4S0TD 4Y5YA 3F7YB 3W9DA 2Q87A 5B38G 2FHBA 1RIUH 5EU6B 1FV1B 2ICEB 3D2UD 4JDZA 2A6JB 5DD5H 2XWBA 4JRYE 3O9WA 2EDYA 1QQDB 2QTEA 2PXYA 4Q9QH 4H88L 1ZHLB 2B1AL 2H6PB 1TJIH 4J3XA 2QBWA 3LD8B 2A9ML 2GSGA 4EIZC 4X8JA 2VXSH 3IDMB 3GHBL 4XPHH 3V7MA 3DX6A 3T8XB 1P7QD 3ZTJG 2P44B 3LKQA 1F5WA 4LHQB 4I5BA 3A67H 1ODAA 2F74B 2B8OT 3LAFA 4LHUA 3QUXB 4I9WE 3P4LA 2XXMB 3PE9A 3MXWL 3BXNA 1A0QL 4NC2B 4ORGA 2EXWC 1ZLUH 5C7XH 3WFBH 2VAJA 2PN5A 2BNQB 4GAYA 3OBAA 3NCCB 1Z0NA 5GGUA 2AK4B 2XN9A 2DS4A 4GMTL 5FHBH 4MJ4A 5EBWA 1QD0A 1HEZA 4LPYA 2EH7L 2VZOA 3ARPA 1TNNA 1G0DA 4OZGE 1RUAL 5GS1B 5ICYA 2XI9A 5I8CB 1CLYH 1K85A 2EH8L 1U3HB 4QRSA 1I8KA 1FO0L 4UV7H 2VZSA 4MXQC 4OZ4B 4PRDA 4Z7UB 2YZ8A 1P1ZA 3OXSB 1G9NL 3MLUL 4YBLC 3RGVA 3H9SA 5EO0B 4YXKL 5JOPE 2E8YA 3THMH 1ACZA 2VXQL 4OTXL 5L2KE 5DA0B 3X12A 3LSOA 3E6HA 1C7SA 5DQJB 2UYLA 3RU8H 4GS7B 1CDIA 3MUZ1 5EZJA 5AYQA 1MCDA 1IILE 3OG4B 4PRHB 1H5BC 3OQ3B 4KK9C 2XICA 1Y6KR 3SKMA 4UTBH 3VXRE 4XNZC 5B39G 1TQBB 3X11A 4PGEA 4BFEA 1EFXB 4OF5A 1T0NA 2YPLE 5EIQA 3UMTA 2I5YH 5HHME 1BFVH 4OT1L 5F1NB 1CFSA 4PGCB 5LCVH 2Q7YB 4HMEA 5HGHB 5KS9E 1AI1H 2AK1L 3MZTA 1AP2B 4NQXB 3CD4A