1RUAL

Crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
218
Chain Sequence
b'DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
molecule tags Immune system
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
total genus 51
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaL01
3C5ZC 3SDXB 1T1YA 2E7MA 4JY6B 5I0DA 3P11L 3FONA 1EBPA 4MCYB 1MRDL 4ZYKB 4HJGB 2RFXA 3X13B 3QRGL 3F6LA 1CXIA 1KYOJ 1TJGL 1C7SA 3EYOA 4JDVB 4WWKD 4XP9H 3B8YA 4EI6B 4V2BA 3NFPA 1T22A 3CAFA 5C0BD 4NT6A 1YC8A 2Y1VA 3RWDB 5E8DH 3QXTA 5ISZE 1PKQE 1P1ZA 4CGTA 4MQTB 4Z7OF 4KTEH 3WS6A 5C09A 4F15B 4NP4L 5FFLA 2OR8A 1LK2A 3FJTA 1J1PH 1HXMB 2DQGH 3ZKMC 5CEZD 3LEXB 3EOAA 1I85A 4U1MB 4EBQH 1GL4B 3KYOB 5HPMB 2Q86A 3ARXA 3O9WD 3RHWF 4UBDC 2V7NA 4W70A 4OFYA 5EWIH 4RGOL 4LLYB 4CU6A 4HIIA 1QQDA 1IRAY 3MPCA 5TDOA 1J12A 3OKKA 4F7CB 3W39B 5BQ7B 4MQXD 5M7QA 1WWCA 3RWCB 3CDGB 3QFDB 2AXFB 1G84A 4YBLC 2Z8WC 2FD6H 4MZ2A 3I9GH 1HKFA 1MLCB 4LPUA 2H6PA 2YPLB 4LGPB 1NLDH 3C6LA 3MRCB 3QWOB 3W0WB 4XRCA 4FP8H 1X5FA 3GSWA 1P4LB 2VAAA 4ELME 3LEVL 3U9UA 2NYYD 5HDOA 4ZXBB 2ICWI 2DM2A 4X9GA 2GAZB 4GQ9L 3LAFA 3UBXI 3WS6C 1J8KA 2MOVA 5FK9B 4M7LL 5IV2B 1NFDF 3ZO0A 1BECA 4I0PA 2MFNA 3QA3A 3Q1SL 3ULUL 5ISZD 4BFGA 4F7MA 5IT2H 3PQYD 4QHKI 1P2CB 1H3WM 3CFJA 4ZDHB 1S78D 4JVPA 3TWCL 3QUYB 4S2SA 3TBYB 1BWMA 5MI0C 3UC0H 1JGUL 5TE6H 1NCAH 3RU8L 2FEDC 1S7SB 3ILPA 3U7WL 4BYHA 1FYTE 1U8QB 2JB6B 1XAUA 2IFGA 3MRKB 2ICWJ 1NCAL 3RU8H 4XP6L 2JF1A 5FYLL 1R3KB 5I8OH 4LHJB 2W0PA 3J7HA 3O6KL 5DMKB 4OZIF 5JA9A 1HH6A 2UZYB 5HVHB 5HJ3A 3D2UD 3PP3K 1MJJB 4XP9L 2VLJD 1MHPH 4OT1H 5FCUH 5AZ2H 2NXZB 3QYCA 3QEHA 2YEZB 2QQNH 5F8RC 1UWEL 2FJGB 3DYMA 2C9AA 2H9GA 3ZTJH 2BSSB 3SY0B 1RJLA 4ZSOE 3PWNB 2GSIB 3PGFH 1RD6A 4K71B 3V9FA 4TPRH 3Q5TA 4JDTH 3NCYS 1UM6L 3BP7A 4NJ9H 3HFML 2FZ3B 1AC0A 3QNYA 2NY6C 2Q7YA 3C5JA 3EO9H 5JTWA 1LEIA 5FGCE 3LS4L 3DUSA 4MD5B 4JFFA 5DJCA 1T7VA 2AJZA 4Y2DA 3PV6A 4J4PA 2X9YA 2EDYA 1E4XL 4NKQB 1QTYT 4OLWL 2HAZA 1S9WA 4MJIA 5D1QC 4WU7A 1GOFA 3WE6B 5C0NC 1ZVYA 5DA4A 2NY4B 4HDIB 4PRID 4R97C 3O3DA 4KKAD 4YXLH 2BOBA 2YBRB 3EJYD 3MBEC 2VXTH 4JPIB 4JR9L 2D7TH 5FUCE 3EOTH 2NX5A 5HD8D 1ZMYA 5T5FL 3QO0A 5IOPB 4Y8AA 4D9QD 1QBMH 1R3LB 3QUMB 4YAQB 1A2YA 2FX9L 2CMRL 5TQ2H 3UZEA 3MFFA 1HZHH 1U3JA 3MREA 3DBXB 1ADQA 2ENSA 4R4BA 3MJ9L 2R1YA 4MNGA 3TV3L 5DMGD 1CBVH 1PYWA 1NC4D 1TJHH 5DEZA 3OF6A 1NC2D 1A7QL 2UWEA 4ZUWA 2VXSH 3CDFA 5EU7C 5HYSA 4Y16C 1T7XA 3B2VH 5I1EH 1CI5A 2C3VA 1KIQB 1WC7B 3WUWG 1ZHLB 4YXKH 4OUUB 5KN5B 1G9NL 4JCLA 4D9RD 5HVGB 2OK0L 1HK6A 4OD3L 5MEOA 4HH9B 5JHLH 4KI5E 3ESUF 4GRWB 4H25A 3ZYZA 4Q9CA 1V7NL 5CZVH 3RIAF 4GW4B 2CJUL 2DQJH 2Z91A 3HC4H 4M48L 1NC4A 1ZHKB 2ZUUA 5F9WC 3TYGL 3VG0H 1NGQL 3ZKNC 3BD3A 4M1CC 4JM4H 1TQBC 4XPTH 3RX7A 5ESAB 3ARGB 4NQVB 5I75B 3RNQA 3BGMA 5A16B 4MA3B 2B2XL 4L5FL 3GSNB 1JMXA 1UG9A 4N1EA 3BQUA 3VXNA 3UMTA 5KS9B 4I0KA 1OGAE 3W39A 3IDNB 1ZT1B 1S7QB 4YIQA 1UH3A 2HLAB 1AXSB 2JIXD 5F3BA 5C7XL 4I77H 3LKRA 5JUEL 2P7TA 2WIIB 1U8LA 2FR4B 2ICEA 4U1IB 1QA9A 4OCNC 1HINL 1E4KC 3F7QA 2H26A 3QPQC 1CT8B 1ZEAL 1CFNB 1BLNA 2RBLA 4KRLB 5GRVK 3BEWA 4NPYA 3Q6GH 3GFUA 5L6YH 3SY0A 1U92B 1DUZB 3SBWA 4PJDB 2BZDA 3QIWA 5J4MA 4PRIB 3KPTA 4WW1B 2DMCA 4F7MB 1TZIB 4F7PB 4ZFZB 1L6XA 5JZ7C 3QUZA 1AR1C 4X7EC 3AB0B 1G7JA 1QBBA 3W9DB 5LGJB 1KT2A 3MLYH 3VGBA 5SWSD 2FDBP 3K4DA 3NZ8B 3H3BC 1KLGA 1QVOA 2ZUQC 3MV9A 4I3SL 2JELL 1CGTA 3LKPB 5J6GA 1TJIL 2DLTA 2YRZA 5HHOE 3BPOB 2DMKA 3TFKC 32C2A 5IOPA 5HI3D 3LN9A 2AAVA 2NMSA 4GRLC 3X3FH 1OSPH 4N1HB 1JWMA 4QRPB 3TN0A 5T1MB 4U6HB 4JRYB 3MOBH 4JY5H 1NBYA 3MA9H 5F6IB 3C2AH 5I1KH 3LZFL 1RK0A 3U48A 1DBBH 3BESR 3K1KC 4RZCA 3VGFA 5HI5D 4M43H 5J12C 5C0BB 2NXZD 1NMCC 5FA3A 3KPSB 4NO5B 2PO6A 1CLOH 1RUQL 1OCWH 4HFWB 1UKQA 2N56A 4NHCH 5I9QB 3STBA 5T3ZH 3D2UB 3FFCA 3KJ4B 4JQVC 3QZWB 4PJEA 2DTMH 1EK3A 5CD5C 1NGZA 2CLRB 3NIDE 5J6HB 2WNGA 3CGTA 4ZFOL 2DN7A 2HT2C 3MA7A 3HRZB 1YMHB 1P84J 1Y6NR 2Q1EA 5IP4A 1C5DB 1JK8B 3CLEL 3V6FA 4NN6C 1KIRB 5E56A 1X44A 1KN2H 4N5EC 1F6FB 2YKLH 2APBA 1GGIL 1TDQA 3PHQB 1UKTA 3BN9C 5I1HL 4WRLA 1M71B 1N5AA 2R1XA 4OD2B 5JNYB 3H9YA 3AREA 3VFWB 4YEFA 5EIIA 4ORGB 3QUXA 3PWUB 1YECH 3ARBD 5EC2B 2C4FT 1T1WA 1EFXB 5JHLL 1SM3L 4MGXA 3DUUA 5FUCC 5CAYB 3U1SH 1PSKL 4NQVA 1J0JA 4WIQA 3RVTD 3VDCA 1GHFL 3IRZA 4OV5A 1DSFH 3E3QE 4GAYB 5I1GL 3BPNB 3T4YB 1CU4L 3VXQA 4N0YH 3G6AA 3HB3C 1ZA6B 5CWSB 4KRPC 2OTPA 2EYRA 5DQDH 1AXIB 3MLSL 5EBLA 1KSRA 3RTQC 2YD8A 1VADA 2PXYC 4APQA 1Q72L 3VG9C 4WGWB 2IC2A 4LBEB 2VL5B 2HYMA 3EHBD 4WWKA 3BEWB 2M26A 4A6YH 4HKBA 1MREL 1BBJB 4J7RA 5IB1B 4LOUC 3M1BB 2OXGA 1X5HA 2F8OA 3MUHL 1DUZA 4GKSB 4QRPD 4RGMC 4EN3A 2O5YH 1CXEA 5EZIH 1T80A 2X44D 4NKMA 1AE6L 4ELMF 3WUWA 3LKQA 1DQLL 3RY6C 4QRSB 2OI9C 2XWTB 3R8BB 2ADFL 4PJCA 4MD0A 2DLHA 3MLWL 2BY1A 4N9OB 5E7BA 5F88B 2DQTH 3O9WA 2J2ZA 4FFVD 2AJYL 4V2CB 4EVNA 3VFPA 3GBMH 4QXTB 4KTEL 1CR9L 3VFTB 3RWGB 1JUFB 4M8VA 4YPJA 1R3IH 3ZT6A 2XPGA 2XXMB 1MIMH 4MNHB 3ZE0F 3NGBC 3LKRB 5B38A 3BJ91 5D4QA 5F7EH 1WT5C 3W2DL 4JFHE 1JTTA 1NUFA 4JHZA 4S1RH 1BEYH 3HMWL 5C0BA 3C09B 2PYFA 1VESA 1BVLA 2Y7QB 5F7HA 2DQTL 3MA7B 3UZQA 1WGOA 4JFYA 5GZNC 2YPKB 3AY4C 3C6LB 2CUIA 3QWOA 5MHSE 5ILTH 2IPTH 1WSST 2VERN 4P4RB 2ENYA 3HE7B 1A47A 3QDGA 4GW1B 1ZLVH 5IVXE 3VXUA 4WO4C 1BIIA 3TYFA 5FM5M 3OR6A 3ARED 4PRHB 3UZVB 3MJ9H 1HEZA 3RBSA 3C5SB 3QDME 2O61A 4MNQE 1QFWI 3IAQA 4U1GC 4LOUD 2DQFB 4HF5L 2ZP0T 4LPXA 4P2OD 3SDYH 3WIHH 1TVHA 1T1WB 3EOAB 2VKWA 1OB1B 3QCUL 4URTB 2A73A 3DURA 1ZK9A 4Y4KC 1FG2B 2OL3A 5ILTL 4MJ6B 1OD7A 1KCUL 2ERJB 5BS0E 5KZCB 4UAOB 2PXYD 4FXKB 1AD0B 4JFXA 2VISB 1PW3A 3L5XL 1H8OA 4XCCL 4MA7H 2OR9L 2UVEA 1R3KA 4HZAA 5IR1B 2N7AA 3KPRA 1K8IB 1EGJH 4TVPL 2V7HB 4TULH 4PRBB 2R2BA 3N1QC 4HS8H 3TPUA 4OF0A 4XVJH 3E6FB 3K7UA 3RVTC 5MEPB 4K3HA 2EDEA 2GW5A 2RHEA 3P4NA 5EH1A 5FOBB 4JM2C 4NZJA 4CNIB 5HYJB 1M1SA 4JFDE 4XPFL 5EFIB 4Y0GA 5E4EB 4WDIB 4HS3A 3V5DB 4WI4A 5GQBA 2VWEC 1WBYA 1SJXA 1N5YH 5IJVB 4GW5B 4KK9D 2JJSA 4XXDA 3PWLA 1YJDC 2HWZL 3RPIB 2IPKA 4X6CF 4OZHF 4XNXH 1WZMA 3VH8A 3SKNB 2KDGA 4U1LA 5BZWA 1AE6H 5FHAH 4PJAF 4Q2ZA 4YHNB 2X7LB 1I1RA 1OGAA 4MYWB 4UT9H 1LEIB 4NZDA 4ZOAA 4MWFA 3TO2A 4LCCC 2P8MB 2FYYA 2W0FA 3N1MC 4KH2A 1MCEA 3LHPL 2CO6B 3VXTA 3CDCA 5DC4B 1DDHB 5I6XB 3U7AA 4EJ1C 4PGCB 4QO1A 3OTTA 2R56H 3G6DL 4KMTL 4POUB 3WFHA 1B4RA 1F3JA 4P5KB 4GUPB 4PV9B 2DQCL 3LOWA 2C5DC 1HXYB 1LK3L 4NCC1 4O5LH 3ULVE 1A7RL 4PJ7E 2ITDA 3VFTA 3FAWA 3PP4L 4IMKC 5INDA 1Q9LB 4RQQA 4CW1B 4PJ9B 1QEWA 4P5TB 1CYGA 2BHZA 2G60L 1FJ1A 3DVNA 1HWGB 2JJSC 4NRYB 3S8WA 3U46A 3KPPB 2F53A 2AEPL 3DI3B 4QY8A 5EZJB 5IQ9B 2OL3L 5FF6A 2FX8L 4JN2B 5CBEB 5T3XE 3P0VH 3R1GL 4L4TB 4F8QA 2GI7A 3GSVA 3VFOA 3HKFA 3SDCB 2CK2A 3QUYC 5FYKU 5I76A 3GMPB 5IJKC 1I3UA 4KKCD 1JI2A 2VL4A 1U3HB 4O2EB 5D93C 3HG1B 4NCDA 4BZ2L 3U0PA 3IFOA 1AR1D 3G5XA 3KHOA 4K8RH 2CK0H 3GDBA 1B9ZA 3DYPA 3FQWB 1S9YA 5C07E 1QSEB 1NSNL 5DJ0A 1Q72H 4LCCB 2X10A 5C1MB 1KIPB 4NGHH 4JQIH 1W0WB 3UTTA 1HINH 3GMQB 4R3SB 3SO3C 4YNYB 7FABL 4NQEE 4PJGF 3SGJC 4M1GL 4Z6AT 1TZGH 2OS7A 5DO2C 3Q5OA 2VRAA 1JN6B 5GPRA 1X5JA 3UJTH 1AR2A 1DVFB 1D5BB 5BCAA 2YMXL 2GT9A 2R2EB 2Y5TA 3MLZL 5A1AA 5E99H 4ZUWB 1OSZB 4JDTL 1O5DT 3QIUB 4BQCA 1I1AC 3KPRE 5DJ6A 4R7NA 1CT8A 4LVHB 3ZHDA 2VLRA 3BP5A 3WDHA 1CIDA 4JKPL 1JZ2A 1GIGH 1FZMB 1F4XL 1J8HA 3I2CL 2A77L 2CRZA 4JHAH 4JG0H 2JCCB 1SYVA 1NCTA 2FNBA 4RMRA 2IH1A 4WFGD 2GJZB 2XTJC 3WKML 4JO4L 2XACC 2A9MH 5IFHH 3QRGH 4G8FB 2HFFA 6FABH 5D7KD 15C8H 1BAFL 2A6KA 3FQUB 4JREC 4RWYL 3T3MF 4Q6IB 5I2IB 3MUJA 1OGTB 4WUUA 2WV3A 4R26H 5HYJE 3DV6A 4FQJL 3HMXL 1NJ9A 3RWHB 1I8MB 3FQXA 2ZUSA 4FZEH 1X7QB 1X5XA 2F8XC 2A2QT 4LCWB 1MJUH 3PGCA 3VI3F 1Q9LA 4RQQB 4QNPF 4XMKH 2HJLB 4XP4H 5F3BB 2EDBA 4HCRH 2SEBB 4GG6F 3O6ML 1HXYA 4BKLB 5EUKB 4OLYL 4NNYA 4S1SL 3ULUH 2AEWA 4KV5E 4G42A 5T1KA 4OJFL 4C58B 1PAMA 4MHHG 2Q86B 2VIRB 1AO7B 1IGJA 1A6AB 1WFUA 1K2DA 1QEWB 3VFSA 4PGJA 4HS3B 3V5DA 2RB8A 4KRNA 1XH3B 1FV1B 4OZFA 1P4LA 3EDEA 1SEQH 2FWOA 3JV0A 3BDXA 4JQXA 5D1QD 3HG1A 1TVBA 5EU5B 2ZZUT 3I9GL 4HWNA 3JWNC 3V5HA 2QQKL 1G7QA 1YEJL 2FBJH 1ORQA 5GGUA 4U1LB 1G7MA 2P43B 4WHYG 1JZ4A 4L4TA 1XCTA 3VWJA 2Q20A 1EZVX 3OKDA 2P46B 3HZYB 3ZMRA 4EI5A 1GGCL 2EE6A 3ARUA 1YDPA 3HZKB 3QEQA 4LCYB 3T2PA 1FLRL 3PG2A 4DN3L 4I3GA 1NEZA 4LSSL 4JRYE 5DHYA 3L6FA 2NY1B 2IPTL 4DGYH 4PGCA 4KQ3L 1I1AA 4KJYB 1WFNA 3V0VA 2LFGA 3D18A 1JPTH 5E08L 4CVWA 3K2UH 5BW7C 2A9NH 3QCUH 2WLZA 3WFEH 3KLHD 3DETD 1Z3GH 5EA0H 1NAKH 3CC5B 3B9KD 4CN6A 2WBJD 4GG6A 4PJHB 1T1XA 2RQ8A 2Y5TB 2XV6B 2Z4QA 4NNXB 1BWWA 5HGDA 2F54D 3QEUB 3LN4A 5AUMA 5IHZA 5TH2B 2Y36L 5F7FA 4LDLB 3BHBB 1JNLL 3NCFB 1ES0B 3KPPA 4KDTA 4OF6A 3U9UB 2YHGA 3QO1A 3QUXC 3EO0A 5LG1A 2MQCA 3TZVB 5I8CA 2Z9TA 1WCBA 3GI9L 4POZC 4Y1AB 1VDGA 2YUVA 1I7UB 4M6MH 1I9RH 4GAYA 2FEDD 1AO7D 4M61B 4JQVA 1NC2A 1NL0H 2X05A 2G9HA 4EUPA 1UM4L 5I8KH 4JRXA 3LIZH 1ACYL 4Q97A 4OGZA 4GAGH 5CCKH 2QV2A 4G9FD 1FIGH 1X4ZA 1OVZA 5TFSL 4B50A 2B1HH 3RX8A 3U82B 1NJ9B 3RWHA 3H42L 3HNSL 5E5MA 4PJCF 3FL7A 4K94C 4NQXA 3HFMH 5IVXF 1C5CL 4DN4H 4X4ME 3AROA 4X6DA 1YMME 5E2VH 3IB4A 5C3LD 4YHPA 3IF1A 1QLEH 2GK0B 4FZEL 2AJYH 4WCYL 1FFNB 5BRZE 5HHVH 1EUTA 1YJDH 2YBRA 3MJ9A 3HN3A 3C6SB 4U3XA 3MV7A 2XIDA 3QG7H 2V2TA 5E94A 4IRSB 1WZLA 4OLVL 1GH7A 2NX5B 4MQXC 2B20A 3ARFD 2OJEB 2IADB 1IL1B 1QG3A 3PHSA 1AO7A 1IGJB 3GSXA 3UP1A 2IANE 4PGEB 1CL7I 1P6FA 2BVTA 2N4IA 4C56D 1AIFA 2OL3H 2ZNXA 5CHNA 1KPVA 1DBAH 1IGIH 2YD1A 3CUPB 3O9WC 1G9MC 1SBBA 5CGMA 3IKKA 4XMKL 4DEPC 1BZQK 3O2DH 1I8IA 3QJHA 2G60H 3AC0A 3T0XA 4IS6A 4E5XB 1P7KA 1Q8MA 4M5YL 2Q7YB 5EU6E 3RDTC 1GZPA 3H0TB 4MD5A 3ES6A 3QCTL 1ORSA 2HTLD 3L95B 4U1HA 3QH3B 3PL6C 3MTRA 1PLGH 4YHZH 4P2QB 1FVDA 3UJTL 1A3RL 3CMOH 2BSRA 5E8PA 3UBXG 1HILA 1B88A 4LNRA 3ZDZE 3D5OF 4TVSa 4ZTOH 1BD2E 3HZYA 5KVDH 3STZB 4OZGA 2YD7A 3WLBB 2B5IC 4P5MA 3T3PE 4JHWL 3DETC 3W81A 4HWBA 4KXZH 4YBLB 5FKPA 4IDLA 2IMMA 3SGKA 1P69B 3QP3A 2H3NB 4P48A 4XBPA 3GRWH 3OPZH 5DUML 4YAQA 4G9FA 4HUWA 5L6YL 3FT3B 3OGOE 1BFSA 4XGZB 4LVHC 1S7RA 2ZG1A 4PYHA 3RJQB 2YKLL 3V0WL 3HG1D 1ZLVK 1SBSL 3IJHB 4HWBL 3ZTNH 2EZ0D 3SDAC 1SJEB 3BGAA 4GSDH 5KZCD 4ZOBA 1QPXA 3EJZC 4MD4A 5L9DH 1KLUB 3KXFD 5GRZA 5GJTH 4Z7WF 3G04A 2RGSA 1BGXH 3JV6B 3Q3GB 4DZ8A 5TDNB 5FUZH 5I18H 2D0HA 3BH9B 3O11B 4KZDH 3OAZK 4JG0L 1XIWA 3IJYA 5JORB 1E28B 5GSVA 3HTLX 2BY2A 5BXFA 1SM3H 1U8OB 3ZDYE 4X4YA 3S4SG 4K7FA 1F4YL 3TYFB 1HHGB 1G7QB 7CGTA 5E1HB 5F9JB 1NGPL 3MV7E 1I1AD 3TIDB 4WJ5A 1RMFL 3LQZA 3SE4C 4M7KL 1CFNA 1QBLL 5D1ZC 1JCKA 4GBXB 4O02L 1MWAA 3EO9L 4H88L 1NC4B 4Z77B 3DHJA 4NJAL 1RIUH 1DEEB 1CLZH 2O5XH 4AMKH 5BMFL 2ZSWA 2FSEB 1RU9H 1T22B 4WTXA 3KS0J 1ZVHA 2EIDA 1MRDH 5J3HC 1MIEL 2V5SA 2DKUA 4DWHA 1IILE 2R0WH 2WP3T 5DJAA 5FO7A 1CG9B 1PG7X 4I3SH 1R5WA 1U8NB 4KY1H 3RKDD 1MIEH 4DTGL 3V4UL 1KEMH 1L0XA 3NPSC 4NC1C 3BWAA 4L3EB 1BJ8A 1KC5L 3GK8H 5INCB 1CLYH 1K3ZA 4KTDH 4XBEH 3UPCA 3GMNA 4DTGH 3IDNA 5I8EB 1G0YR 2EDHA 5DVLA 2XTJD 4PJGE 5I71B 4R4NC 5E8NA 1OT2A 2VUOA 2XFXB 5GS1A 4JM4L 3PXHA 1MSPA 4JB9L 5C0GB 2BNQE 4WUKL 3PWVA 3QHFL 4UINH 2LTQB 4MCYA 4ODUA 3S35L 4ZYKA 3IDGA 2YPLE 3QUZD 1CFQB 4LSDA 4IMKA 4RAUA 1S5HA 3MRGA 4ZUSB 2A0LC 2H6PB 4WHTA 5CIPA 2GSGA 4KK5C 4MXWL 3F5WA 3CH8A 4IRZL 3H9HA 1LO2L 2W0LA 3X12A 1PQZB 1OPGH 2FRGP 12E8L 2ZOLB 4JFOB 4PG2C 5DD5L 2CIKA 1DDHA 5I17A 2FIKB 1EO8H 3B2VL 4UAOC 5GRUL 4HWBH 3ZTNL 1D5IH 1UZ6F 1ZWIA 2MQ0A 1RIVL 4X5WA 2AJSL 1WITA 3RIFK 5K59F 4UMGA 3I3EA 5T5NF 2EDKA 3NA4A 2I27N 2ATKB 1I7ZA 4NQDD 4FQIH 1EFQA 5LBSH 3OGCB 1JPTL 1MVFA 1MFBH 2DLFL 4QRUB 3BRFA 2HFEA 2VMFA 1JWUB 1RAMA 3IDXH 4QXGH 1YEHH 1JWSA 3UPRB 3VXQB 3ARBB 4PJEB 4F57H 4MVBD 2DKMA 1XF5A 3QUYD 5H94B 3DLQR 2UY6A 3DGGA 4M1GH 4LASH 2CGRH 5DK2A 3G6JA 5E08H 2AJSH 1OSZA 3H9SA 5CEZE 4Q9QL 2P45B 4XMPH 3QAZB 5E8EA 4QCIA 1C5DA 3TN0C 4JAMB 4ZQKA 4HUKB 1DP0A 1BBJA 4HMCA 1MJ8H 4OKVB 1SYSA 1WFOA 1BGXL 4YDJA 1TENA 4CU7A 5GZOD 4OLEA 2BSRB 5E8PB 4X4MA 5IFJB 2VN4A 4L8BB 2DD8H 4GT7A 1KIUA 1GYAA 4FFWD 5DZNA 1GZQB 1HYRC 2XA3A 1KIPA 3WO4B 5C0FB 2V9TA 1H8NA 4OZGF 3OB0K 1NFDA 2AV7B 5D7LA 3UBXA 5A2LH 3CD4A 1DLHB 1W72B 3O2DL 2PETA 3T0VA 4NKMB 1VACA 3T2QA 1GRWA 1BF2A 4U0RC 4LKXA 5CMAA 4E41E 4P57A 3UPAA 2FJGA 5DJAB 5HGHB 2KZWA 4KJWC 3W2DH 4GMSH 4ZUVA 3RKPA 5ITBL 5FB8A 2SEBA 4PUBL 1U42A 4NWTH 4DUVA 5J57B 3AB0C 3IU4H 1NANI 3AREC 4MCZB 4MA8L 1MVUB 4WO4D 1YEEL 2PYFB 1FIEA 5HHVL 1QO3B 1QR1B 4QGYA 2G5BB 2P5EA 4FG6C 5LXGH 3BIKB 5E6ZA 5GZND 5HPOA 3BW9A 4FQQA 1RUPH 1INQB 3EUUA 4DAGH 1JIBA 4JFFB 5DJCB 1CE1H 4QOKA 5A2IH 3P0YL 3GGWA 1VGEH 1S7TA 5EUOB 4L8CA 3CFKA 1HOCB 1MQKL 1OPGL 5C09D 1T7ZA 5IEKA 3GMOB 4LF3B 5L9DL 2MKWA 4OZHA 3UYRL 2NY3B 2FLBT 2Q8BL 4ODTL 1UYWH 4DUXA 1U8KB 1I3RB 3QWRD 4FXGA 2DL9A 4RGND 2Y25A 2NPLX 4NZTH 3H9SE 3GKZA 1CGSL 1CTOA 3G08A 3GB7A 4TOYH 3KYNB 3WE6A 1JJUA 2X5PA 4LSTL 4IRJA 4Y4KD 5EZOL 3JTSB 1DQQB 5BV7L 4AIXA 5BV7C 2ATPB 3D0VB 5CJQL 3TVMD 5EG6C 1REIA 4M3KB 2Z35B 3QPXL 2NY2C 5FYJH 2ZUQB 4L4VA 1IAII 3WHE0 3UEZA 1HNFA 1CFBA 4C57C 3V79C 2XKNB 3VU2A 1XT5A 2M2DA 1OAUL 4Y4HA 4WW2A 2Z4QB 4BA8A 1JRHL 1A6PA 5LAXB 3QG6A 1I8LA 4OLXH 1GGCH 2XFXA 4OZIB 2UY7A 4KMLB 4DZBB 1RK1A 3ZKXC 5F89A 5C0GA 8FABA 4NUJB 4KKLD 5L2JA 1DCLA 3SKOA 3BT2L 1J1PL 4HUXB 4WDIA 4X9IA 5ICZA 3IFLL 4JFYB 5D7SH 1MHPL 1U58B 2VR4A 3DROA 3T1FA 3KPSD 1T1YB 4JY6A 4D3CH 3REWA 4K3DL 2Q76B 5KSAA 1KV3A 1G7PB 4OKVA 4OUUA 4U6YA 4HUVA 3HB3D 2WINB 3H42H 2FJFA 4I3RH 3L6FB 4I1NB 1ZAGA 2VZOA 2EDXA 3U2SB 1IZJA 2Q6WB 5ENWA 5DWUL 5E5MB 3S88L 1NC2B 5JHDB 5JQ6H 2DI7A 4JO1H 4YGVA 5EDXA 2DOCA 1FZJA 4OF8A 2AV7A 2XWJB 3RTQB 4JN1L 3B43A 4HBQA 4K55A 3QHFH 3IYLW 1YNKH 1QSFA 3V7AE 2C3GA 4MDJB 2PW1A 2EO9A 3SE8L 1M7IB 4I4WB 4WEBL 4XH2B 4KHXL 2V17H 3FO1A 1B0GA 3NABL 4L4VD 4Y19B 5IR1A 4HCRL 3SKMB 3MUGA 2NY7H 4OM0H 4P49A 1ZHNB 1YEKH 1UWXK 2CLZA 3QG7L 4XI5D 4WV1B 1MLBA 4LQFL 3NABH 4GO6B 4P5KA 3RDTA 1CD1A 1YEJH 2APVA 4X99A 3ZT7A 3P2TA 3VGEA 1CK0L 4K3EL 1WBXB 3DSFH 5FYLD 3ARDD 5CSZB 2MCG1 1PEZA 1K4DB 5CD5D 5FA3B 2RFXB 1HHJA 4DVBA 2UV3A 5JHDE 5D5MA 1UJTA 3CVHH 4OLZL 1G1CA 3DRQB 4Y88A 1AQKH 3CSYB 4HFUH 1J5OL 1JGVH 4NQCA 4O4YH 5I16B 4LSSH 4IEFB 4OAWB 3V4VL 4KRPD 2X4PB 2DAVA 4JRWA 4DOHB 2JLLA 1X4XA 2NZ9D 3BAEH 2NNAA 4CJ0A 2DWDB 5D7JD 2A6JB 1RZJC 3KR3H 4G6ML 5CBEA 2OYPA 2FHBA 5F72S 5C09B 4PJEE 4KU1A 1I9IH 2NX5E 1Y0LB 3MLTA 4KUZH 4LSRH 3STZA 1TMCB 4HIHA 4MQ7B 1CICB 3RWDA 3N1GC 3HNVL 3LSOB 5F9DC 1C12B 1IC7L 5LQBL 1MOEA 5F7YC 4E0RA 3OKNA 1AQKL 5DRZA 2DJSA 1NKOA 4LNRB 1X6LA 3KPOA 4APQD 4OD2A 2Q8AH 4JKKA 5DJDB 4LHUB 3VFWA 1QSEA 4Q9BA 1R5VB 4RDQG 4LLUA 1JV5A 3RZCB 1VB9A 3S98A 1XIWC 1DVFA 4UT6H 5ALCH 2YA2A 3MFGB 5E7FA 1I7RA 3WHXA 4ZPTA 1BQUA 2B2XH 4L5FH 3T65A 2KKQA 2E8ZA 4P4KD 1IM3A 3V6FB 5TDOB 1U95A 3IXTB 3I50L 1YEGH 4N0CC 2EDJA 5DQ9A 4ESKA 2KPNA 1IARB 1ROWA 3L1OL 4ZD3L 1QD0A 5C0CB 3PDGA 1HOCA 5A3ID 1C5CH 5ICZB 3DXAB 2HKFL 1EEYA 3QA3B 9CGTA 3U2SA 3MRCA 4OIIH 4NQEA 5F6HI 1G7LA 4JEGB 5TFSH 1IGTB 2O5ZL 1MWAB 2B4CL 1HHIA 3INUL 4U6YB 3C60A 1JRHI 4OGXH 3FQTA 2D7TL 4HX1B 1GCFA 1D9KB 2Z93A 4AEEA 2APXA 1N5AB 2DM4A 4GQ9H 1DQMH 3JTSA 2DQGL 4UB0H 1BQHG 5J1AA 2AK4E 3WUWB 4ORGA 3WN5B 3ZKND 1XZ0A 3P9LA 4J12A 3BKML 3TJHC 3CVIH 1D5MB 4PRPD 4P2RE 1UVQA 3OKOA 4FQLL 3PHOA 3B3IB 3HUJF 4K8RL 3SO5A 4LDEB 1F2XK 4PJ5D 3SGEI 3FB6B 3V6OA 4HPOH 4K7PL 2XYCA 1FNSL 3EOBA 4PRNB 4FZ8H 3NIDF 1AP2A 2AGJL 2CKBH 1HH9B 5CEYB 1DN0B 5EWIL 3SKOB 5IEHB 4I9WE 1RUML 3V4UH 5E00A 2VDMH 3HAEH 2ARJA 5T33L 1VFMA 1CD1B 2JCCA 4M7LT 1U8MB 1OP5K 3FB8A 1RZFH 3EYQD 4RFEA 3AU1A 4L3EA 5E1AB 1OAZL 5D71H 1W8OA 2R0WL 5A2JH 5SWZA 1AJ7L 2FATL 4OT1L 5FCUL 1I7TA 5T3ZL 4JO3H 4DGVH 2V9QA 4QRTB 4IHOB 4POYA 4NKOA 2Q7NA 1FGNL 4JZJA 2HFGL 5IM7B 3QQ3A 1VENA 1UCBL 1YUHA 4G6JL 3MSPA 1G7IB 4LARH 3TA3B 1KG0B 2VXUH 3U4BH 3BDYH 2OSLA 1A1MA 4G6MH 4EUPG 1UB5A 5FYKH 1MWAL 2E3VA 1ZS8B 2C1OB 3MRIB 4MS8D 1KEGL 4WU7B 1CU4H 4UTAH 4M5YH 2HRPL 1KN4L 1XF4A 3QQ4B 5KSBA 4XBGB 3V4VH 1NAKL 4I5BA 2XRAH 3QDGE 2DQJL 5J56B 3O4LB 1HWHB 3BIBX 3F6IA 1YDPB 3KYKH 3LV3A 3QEQB 3TO4B 3WLWC 4ENEC 1I9RL 4QXWA 1U8HA 4CVZA 1F5WA 3O6FC 4PJHA 3PQYB 1BD2A 5I18L 4X0KB 1E4XH 1TQCB 1JGEB 3FN0H 5HGAB 1ZLUK 4ZPTB 3WIFA 1N6VA 1KGCE 1S7XB 1WV7T 1S9XA 2D4FA 4BELD 4XNMA 3F62A 3MREB 2YPKA 4HBCL 3GSNA 3B6SB 3HNTL 1U95B 1TNNA 1IAOB 2FWOB 5MENB 1LO5B 4NRXA 4L3ED 4X8JA 5J9PB 5L88H 4RFOH 3W0WD 5CKGA 4GKZB 4JFEE 2F74B 3BZFA 2ORBL 4ZPVB 4DGIH 2P7TB 3VD7A 5FGRA 3QEUA 2AV1B 1FQ9C 4XPAH 4LLQA 2VR5A 5C0DA 4QRRE 3BQUD 2XZAH 4HK3N 4AMKL 1I1FB 5DMGC 4LAQL 1D3CA 1XGPA 3MRPA 1PY9A 5IHUL 1B90A 1AFVL 4FHBD 1MRCL 1YY8B 5F9OL 2NY5C 3V6OE 2A9ML 3VXSA 1D6VH 1F3DH 2VDOH 3CNKA 1LP9F 5EC1B 2MSPA 3PWLB 5I8KL 5GGSA 3FT4A 3GMLB 2W9EH 3OKMA 4I3RL 1V7MH 4GBXD 2IANB 3S5LB 4Z9KB 3MBED 3EJYC 2DB8A 1U8PB 1SY6H 2Y5EA 3FQTB 2DQCH 4KKAC 4MB3A 1DLHA 1MJ7L 3T1WA 5C0ND 1U8JA 2CIIB 4I2XB 1BEYL 4XPBL 4TNVF 2V5TA 5CLWA 2ZKHH 3MNZB 3PABA 2V2TB 4PJ8D 2CH8A 4U1SA 1X5AA 4X9BA 2FD6L 3LKSB 4WEUD 2R1WB 3C8DA 3K1DA 3BX7C 3FOLB 4GBXC 5DTFB 3DGGB 2LU4A 2BRQA 1A6WL 2P5WD 3BPLB 1I7RB 5E00B 3SO3B 2CR6A 3BAEL 4K23H 4ONFH 1XGYH 1R5IB 5HGDB 3RAJH 4XBEL 4PJFE 3U7YH 3C08H 3VCLA 3RUGB 1AC6A 1Y6KR 3BKCH 2IPKB 3BQUC 3EO1B 3OJDA 2X1WL 2IFFL 1OAQL 2BNQB 4P59H 3LEVH 4JZJB 1S9KC 1OY3B 3QB7C 1U8MA 3BKCL 3M45A 4XVTH 5DEFB 2YK1L 4HXBH 5EIVA 4M61A 1A4KB 5EZJA 4OF5A 1ORSB 3CMGA 3L95A 1QSFE 2BRRH 4R4FL 1T66D 3FQRB 1ZEAH 25C8L 5AYUH 4Z0BH 3I02B 1XCQB 1P5UA 1OP3H 4ODBD 3WL9B 1QOKA 2ESVA 3MV11 3WLBA 1I8KB 4NQXB 4Q0XL 5DUMH 1SQ2N 4JFEA 4HIEA 4MJ2A 4N0UE 4YBQC 3UDWC 3T08A 1LD9B 1MFEH 5MI0B 4Z18A 4R9HA 4BH7B 4DAGL 1X5IA 1UWEH 5ETUB 1R0AL 4N8PA 4MA1C 2ZUYA 5IT2L 1FVCA 1WK0A 4MS8C 5FKPB 1AHWB 1I8IB 3QJHB 5FV1L 2UUDH 1KLUA 4M8QA 4HD9A 2VTFA 1FJ1B 3DVNB 4OCSH 5IMMA 3A6CL 3UTTE 5C0RH 2WUCH 3BW9B 3FB8B 2DWEA 5DF0A 1DE4B 2GT9B 2AXJA 2J6EL 4U31A 4GXUN 5D2LA 2VZ1A 2FGWH 3IFPA 3EYQC 4RMQA 4DZ8B 3K74B 5C2BL 4QT5B 1KPRB 2PTTB 1AGEA 1PG7H 3TT1L 2NLJB 4FOMA 3W9EA 3H0TA 5BVPL 4LL9A 1BQHB 3VFRA 1IJ9A 4LASL 1FIGL 4JJ5B 3VWKB 2F15A 4FXGB 3REVA 3TBSA 1QFOA 3SDCD 1J88A 1UM5L 4TYUA 4AENB 1NCWH 4ODVH 5T3XH 4OLVH 2DYPD 5IVZA 1NL0L 4K7PX 1W8NA 3ZL4L 3GSOA 4G9FB 2XQBL 2X1QA 3L9RA 4L29A 2W38A 3PABB 1QBML 4P2RA 3WLWD 4ENED 5LKNA 4XCEA 4KMTH 1OGTA 2MCPH 2AXGB 2DIAA 4JB9H 4JGMA 4M7ZB 2GJJA 4Y2OA 4XBPB 1H0DB 4QLRA 4PRHE 3LHPH 2B8OT 2I25N 3VRIA 3Q3GA 3L3JB 3R06A 4S10A 5I1DA 5JO5B 4YHLL 3LKOA 5DMIH 1U8IB 4DZBA 2HLFC 4XCFH 4G6JH 1DANU 4LARL 3WD5L 2JCCE 4MB4A 3VE0A 4R8WH 2XPGB 2D9CA 4FQXA 5L2KB 1P9MA 4WFED 1ZGLA 3SGKC 5F9JA 4HC1A 1AJ7H 1NCNA 3B5TA 3NMEA 1E6JH 5EU3B 3H3PH 4O5LL 5DDHA 3U0TA 5DJ6B 5A3IC 4K9EC 4GH7B 2ADIB 3B9KB 5IIEB 4Z7VF 1RJYB 1IC1A 4C4KT 1MEXL 4G7YH 4OQTL 5KW9H 4Q0XH 5DS8B 1T20A 1M05A 1YY8A 4EI5D 1A6ZB 4F15C 2GEEA 5DJ2A 4Y4HD 2FJHA 4U1JA 4UU9B 2ESVB 4BZ2H 2H41A 2ZSWB 5SV3A 4B53A 1A1OA 2XG4A 3MRFB 3LS5H 3VWKC 4HIJA 2E9BA 1LHZA 3QIBB 4LAJH 5AD0A 5E95B 5HYEA 4K9EH 1U93A 3TF7C 1MFNA 4W4NA 1QSFB 5HHQA 4EN3C 1NGWA 3ROLA 4MXVF 2DQHL 2DQFA 2D03H 4KTYA 5KBNC 5IUSA 4QXTA 1HIMH 4Q9RL 3QWRA 1EO8L 3CCHA 3TO4D 1F6AA 3RY6A 4OGAC 2FH8A 3TESA 1FZOA 3HS0A 1H3PL 1QFUL 4QHNB 1TZHA 4O2FB 4OD1L 1VSCA 1CDCA 4JFQA 3EAKA 2YC1A 4DVRL 1XH3A 4MAYA 4LVOB 3RWJA 3QXUA 3W11C 2FX7H 1OM3H 1EDQA 5DJZA 1D5XA 1M7XA 2OCFD 3QXWA 2ZNWA 4ODUB 3EFFA 3LQAC 5MEPA 4UUJA 3HUJE 5D7JA 2CRIA 3WFEL 4LCWD 5C0AD 4TVPD 4KY1L 4WO4A 2AJXL 1KB5A 3U0WL 5C0IA 4Y1AE 2XQBH 3JWDC 3VWKA 3MJ7A 4DW2H 1H5BA 1TVBB 2F53E 3QHZL 3NIFF 3MGTB 4M6NL 4PRHA 2W9EL 3H7LA 1ORQB 3MLRL 1I7UA 3FFDB 1EJOH 1KJVB 1UENA 1KACB 3G5ZB 3L3DA 3V8OA 1JFQL 3OZ9L 3IDJB 4RFOL 1AFVH 2VZ3A 3C9NB 3CH1A 4RMTA 4HPOL 3OR6B 1WJ3A 3RGVC 3Q48A 5GRWA 5F96L 1IAKA 2DYPA 4PYGA 3WFBL 2EYTB 5E2VL 2FECL 1CLOL 1JV5B 3RZCA 4JN1H 2JB5L 3ZTJG 3LY6A 4XCEB 3QDJD 1EX0A 3EO0B 3GO1H 2MPAL 5EB9A 4JLRA 3VI4E 3ZL4H 1MAJA 1IGIL 4RFNC 1UVQB 3WDJA 2B1HL 3LZFH 4AEIL 2VLRE 2CDEA 5D2NB 3PWPD 3ZSTA 3MV01 4GG8B 4I13B 5D7JC 3C5ZA 1MFCL 3LN4B 4FRWA 2B39A 2CDGA 4U1IA 2ZUWA 1KTKE 2B4CH 1QFWM 4UNVA 3QUKB 2ITDB 3X14A 4LVOC 1AP2B 3NTCH 1DVFD 3MACH 1IL1A 4XP4L 2OLDA 5I8CB 3IAPA 5J12B 1B3JA 5FB8B 2HP4A 4JQIL 5J1SC 4AEFA 3SDDB 3DXAD 4U49A 4R2GD 5ID0B 1SMOA 4PLJC 5D7IB 2VLKA 1KN4H 2UZIL 3JBG7 2CRYA 4GW5A 4MJ4A 2VYRE 4G9DB 1FFQA 1G7LB 2YXFA 3GSNH 1NCBH 2R23A 3OKYA 3LDBC 4P4KB 1IC5H 2EC9U 2Q3ZA 2YUWA 4PJXE 3ULUD 3U79A 2I9LB 4TSCH 4JO2H 2A1WL 4HGKC 5E70A 3MCG1 2IG2H 1YYLH 5CBAA 5EOTB 2ZCLL 1F4WH 2Y07H 5F97E 3E2HC 3FB7A 4IM8A 4TUKL 4L8CB 4PJAA 2NY2D 4NQCE 3DX7B 1T03L 4NKOB 1LO3H 5FYJL 3TVMC 4ODHL 4IRJB 3SHSA 1YECL 3MV8A 3OHXA 2EH8H 1K3IA 5B8CA 3WNPA 2OSLB 2KQNA 2P5EE 5FO8A 4J6RL 5JO5A 1NGQH 3EOYG 2AK1H 2K7QA 3ARDA 4KZEH 3A6CH 2BC4A 5DJ8B 4HQQL 4Y4HB 5I1JH 5TGBA 5KVEH 5FGBA 5DD0L 3HC0B 1KJ2B 5D2NC 4YHOH 3GMMB 4NRYA 1EHNA 4FQQB 5AYQA 4QEGA 3OSKA 4LVNB 5IK3B 5D1XC 4KRPB 3AM8A 3CJJA 1TTUA 4YX2H 5JOPE 4LHQB 1OQXA 2LAAA 5DHVB 1QSEE 3N06B 3KG5A 5I71C 1NUNB 3LEYL 3BOVA 3U4AA 5MP6L 4OZFG 1KIRA 3SDCA 5JXAL 1CXHA 3D85B 4WCYH 3ULUE 3MXVL 1M7DB 2D2OA 4DKAA 3O6MH 2AQ3A 1CBVL 4W6XB 5EZIL 1W72L 3LS4H 2DM3A 4P46A 3S97C 5CFHA 3J8F7 3WMSA 5GGQL 4XNUL 5K9JH 4LEOB 3QZWG 5KS9E 4N0FB 4PG9A 5EUOE 4KJWD 3QFJE 4RWYH 4U6VL 1ZVSA 5AZEH 4EDXA 2LU7A 3LB6C 4ZO7A 5IBUB 1MY5A 5GIRA 1GOHA 3GEWB 3MRNB 4L1DA 4HEME 5FK9A 3ROOA 5I30L 2F19H 1Z9SA 2E5EA 4H0IA 2BK8A 4GAJL 5HGAA 2OQJA 5C6TH 5C0CD 3O11A 1TVDA 1X5KA 3BH9A 1T0NB 4FFZH 4YK4B 3MJ6A 1NMBH 3JTTA 3QFJB 3SQOL 5FECA 3D3VE 2HH0L 1P7QB 4WVRA 1S7SA 3FQNB 4MD4B 1GPOL 4GQPH 5EZLB 2CSPA 3EFFB 3WSQH 1V3JA 3C5ZB 3BPCA 2W60B 4L4TE 4M00A 3T1FB 2V2XB 4Y19A 2VB5A 2IF7A 2IH3A 3OXSA 1KB5H 4XAKE 4Y2DD 3BYTA 4XPBH 1WFTA 5ELIA 1RY7B 4FG6D 4NZTL 1MWAH 4FQHA 2YD6A 2YN3A 3ZT5A 4Z0BL 4CVXB 3IJSA 3T4AB 3QDJA 4MAUH 5BRZA 1YA5A 2VDML 1A6UH 4TRPL 5I2IA 2I26N 1J8HB 4J3XA 3OG6B 1NCDL 2DQUH 5C70A 3C08L 1LO2H 4MA7L 1IAKB 5HDBE 3T77B 3LRGA 4PS4L 4CDGC 1KUMA 3MLPA 2BVOB 3AREB 4M7JH 3OF6D 4LSVH 5JIKA 1IQDA 3VA6A 2BVPA 1NFKA 3OKLB 1MAKA 4KROC 5I17B 2DWDA 2I60H 2EH7H 4D94A 4R2GC 3DOSA 4RISL 3B2UD 1IGCL 1F6LL 4ZAKA 1L6ZA 4PJHF 3BGFC 3HLAB 4GG8A 3MXWH 1CF8H 4NFCA 2E9IA 2EDTA 4XX1E 4U7SA 5FAAA 2PYEB 4HWZA 3WV0A 5DGRA 1KCSH 3MRJB 5CWSA 2IAMB 1IAIL 1YEIL 3X3GH 3P73B 4I77L 5I8EA 3A67H 3O41B 4NN5B 1HHJB 2X1XR 5GZOC 4NM8H 1O7VA 5IQ7H 5DJDA 4J6RH 2DRUA 2BOBB 2BX5A 3AS3A 3FAXA 4XCCH 1MRCH 4IRSC 1HDMB 3BUYB 2HKFH 1Q1JL 1FDLL 4I18C 1R24A 2R29L 1YNLH 4GKSA 4RA3A 2XZQH 4BH8A 4JE4B 3ARYA 5F9OH 1I4FA 3BT2H 2QLVB 4MVBC 3BP6B 1CLZL 3GRWA 3KJ6H 4Z7VE 1JNNL 2B4CC 1SVZA 4YHIB 3EYUL 5GS0L 4OSUH 4ELMA 1WIOA 3L3IB 2VDKH 1OP9A 1VEMA 4ACPA 1VPOH 4QRRA 3WNNA 3HPJA 4X7SH 3RKDC 3LQMA 1NLBH 1ZWIB 1G6RH 5JQHC 2WW8A 3VWJC 4P2RB 3PGFL 1U6AL 3ARRA 1H8SA 4MNQA 5FDYA 5L8JB 1UWGH 5D7LB 3UBXB 1DQML 1CD0A 1RHHB 1P9MC 1FFPB 3D0LB 5TGBB 2F5BL 1IVLA 5JOEA 2VH5H 1H3VA 3L3JA 4DKFH 2E6JA 5IESH 3B5GA 5DGQA 1HHKA 4K3JL 4TSCL 3W11D 1I9IL 2H45A 4LSRL 3UTSB 4EBQL 5GGVL 2P5WE 4PB9L 4YUEH 2IH3B 3OXSB 2FX9H 5K9QG 1MIML 2X09A 2GK2A 2GFBB 4F33B 3O8XD 4O00A 3D25A 3PE9A 4ERSH 3CZFB 3CX2A 3QUZC 4WEMB 1OD9A 3WEXA 4JO3L 2HRPH 5D72H 5JXEC 1KXVC 3OPZL 3H9ZA 1IM9A 4GW1A 4U4BA 5IWLA 1AXSA 1WWAX 2ICWB 2X1OA 1RUPL 4ODTH 2Q8BH 4HX1A 3TVMB 4P46B 4TUKH 1W72A 4P23A 5DYOB 4E41B 1EGJL 1C8PA 4LSPH 5E1AA 2ADGA 3KWWA 3W9DA 3CMOL 5KSBE 1A9EB 3CFKB 3MNVB 2YA1A 3EKCA 2NY3D 3BH8A 3ET9F 1KNOB 4MA1B 3ALXA 4A6YA 2QSTA 1FAIL 3K80A 2VWEE 3P0VL 3R1GH 4YC2B 2DI8A 1HYSC 3ARFA 3VXUD 4HUNB 3MRQA 4JFED 3W0WE 2A6IB 1AKJA 3C09C 5TE6L 3I84A 4OKDA 2XKUA 4EIZC 4WWID 3LRHA 5CP7A 3MRMB 2YD4A 5CHNB 2W60A 5GHWL 2XN9A 4JFZL 4KHTL 3IDYC 4UV4H 3EGSA 4X8JB 4U1MA 2BOCA 5HYFA 1T5WB 5I1AA 3BRGC 3EFDH 3O6KH 4YHOL 2WWMC 4BZYA 1OHQA 4JDVA 1S9XB 2J12B 1XGQB 2AW2A 1GIGL 4HIIB 4XPTL 3EFDL 3U46B 3OKKB 2EDRA 4JRXD 2AJ3A 3QNXB 4DCQA 3VRLF 1DQJB 3P4MA 4WI7A 2ICES 2HA1A 1A7RH 3GNMH 5F7NC 1PKQB 2BY0A 1Z2KA 5EOCL 1ODAA 1GPOH 3HCVB 2EZ0C 2XTJB 4XCNA 1UM5H 4Q6YA 3TP4A 1FPTH 43CAA 4LLMB 4S2SB 5L0QB 2LTQC 4H0GA 1CD8A 2VZSA 3KPQB 5DJXA 3Q6GL 4LNVA 3Q0HA 5C08A 3PWJA 1AGDA 1Z9MA 3I2CH 5MEQB 2OMBA 3QCVL 2AJXH 1N7MH 5JPNA 4G8GE 5E2JA 4YGVB 4RBPK 4UOJA 1YQVL 1KCRH 4NHCL 4IIQC 1E0OB 4LMQE 5L2JB 3KYOA 4JG1H 5HPMA 4ELKA 1IAIM 1MI5E 4U6VH 1RHFA 2R1XB 3D25B 1KFAL 5HJ3B 2NTFA 1SEBB 4PLKC 1WUNT 4H20L 3R4DA 3WIHA 4C59B 1AGFA 4PTTB 3NAAH 2VITB 3PL6D 4KI5C 1QBAA 1G9EA 3RZCC 4P2RD 2Q76A 3RUGF 1EFXA 3K4ZA 5J6HA 4ZFFB 3BE1H 2WAHA 5F9WB 5HGGS 2LAGB 4ODXA 1HHGA 4CUCA 3ARSA 4GKZA 3RPKA 1R5IA 4QOKE 1UACH 2NW3B 3ARGC 7FABH 5EC1A 5I75C 2G2RA 1YMMB 2VZTA 2ADJA 5J1TC 4DGYL 1UEMA 2A74A 1P4IH 2EDWA 3CFJB 4I8DA 3IU3B 4PJ8A 3DMMA 4TSAH 2NR6D 2HRLA 2HVJA 5JA8B 3Q1SH 2JJWA 4ETQA 2Z8SA 3TVMA 1K6QL 4QRRD 2X40A 1MHCA 5FYKL 5T1LD 1T0MB 5KVMC 2PW1B 5EBMB 5E5UB 4NQSB 4OM1H 5D8JL 3VXOA 3K8MA 4NBXB 2C1PA 3MXWL 2FBJL 3A6BL 2MWCA 2X4UA 1VHPA 5IW1B 4YBHA 1JI1A 1JYXA 3QNYB 1YNTB 2IALA 3QI9B 1N0LA 3RGVA 3RI5K 3VFGL 5FOJA 2KUTA 1BX2A 2MHAA 4PJGB 2EYSB 5EO0A 5GRXG 1ULVA 2WBJA 1J9CT 3W5NA 2B0SL 4MSWB 1S7VA 3R0NA 3S34L 2EYRB 4B7IA 1A6TA 3KPOB 2BVQB 1NUGA 4JFZH 1T7YA 1N59B 4NKDB 1ERNA 2YSSB 1L9MA 5D70H 1QFWL 4DK3A 2R1YB 1QRNA 1FV1A 4OZFB 4L8SB 4OAWA 4XMLH 1SMAA 3JUYA 4PJ8C 2BC4B 1T5WA 3DMMC 4LPWA 5I1AB 2GITA 1DQTA 3VFGH 3BPOC 3QDMB 2QQLL 3SKJL 4POZD 4P0DA 5H37G 1A7BA 1OT1A 4UOW0 4WUUE 1JHTB 2FCBA 3X3GL 4P4RA 1EUUA 1IGYB 4CN4A 2AJZB 4JANB 1F4AA 3RJDA 3MV9E 4QRSA 3LSOA 5I1JL 2VE6B 5DRWB 5EOCJ 2C3WA 1LE5B 4AENA 1FO0H 1AGCB 5AWNL 4D0DB 4S1SH 1E6OH 4CDHA 4L9LA 2O5ZH 2WBJC 2HJKB 4OZ4B 1ZVSB 4XCNB 1S7UB 5D7LD 4EDXB 3CFCL 2L4OA 1NDMA 1IGTA 4JY4A 4R90H 1ZLWH 5CEZL 1OF2A 4ONGH 4X6CE 4OZHE 4RFNB 4GAJH 5JHDD 1RFDL 3EYFB 3IDUA 4JGJA 4O2CB 2J8OA 3NH7H 4A6YL 4K8RD 2EEDA 1JF6A 3FMGH 4HJJL 5HI4D 1IGFH 3ARGA 5FYLE 2XY2A 5KG9A 3FN9A 1JHLH 1ZHBB 4AG4H 3PJSB 5CJOL 4TUOB 1J10A 3FB5A 1F3DJ 1F3RB 1TCMA 5IMMB 1FNAA 2Z91B 3H2WA 3UCRA 2YPVL 3IXTA 1I7ZB 1A0QL 2EIZA 1RIHH 1IFHL 4YIQB 3BKJH 5F21B 3SDDC 3UDWA 4PJIA 4NYLB 5ID1A 2HT3C 4R4FH 3E3QC 4K3JH 1UH4A 4UQ2A 5BV7B 2NW3A 3BGMB 5A16A 5DHXB 4HS6B 4TSAL 4JKWA 3SQOH 3CVHA 3WD5H 5KSUB 1A3RH 3BKMH 2ADJB 5H2BA 1R0AH 5F7UA 1KB9K 1QO3A 4X7TB 4NNPH 4PRDA 4AL8L 3DMMB 1UYWL 4Q74A 1MHEA 4J3TA 5EIQA 4DN3H 4RFEB 1EEUA 1G6VK 1YYML 2VQTA 4HH9A 3SDXA 4F7PA 3AS1A 4QOKB 4UTAL 1NMBL 3T4AA 1BQHA 2DBJA 4NM4L 4D8PA 1A6VL 5DEGA 1DZBA 3WN5A 1I9JH 1E4WH 4OFDA 1HSBB 2ZUXA 5D6DC 5DFTA 4U6TA 4ZXBC 5FV2A 5H37H 2VXUL 4RSVA 3MRLA 3U4BL 5CUSL 1F90L 5E9DE 5F7WC 5ISZB 4KZEL 1AGDB 3MLUL 2ID5A 5GGRA 3ARTA 4FQIL 4CVXA 4ZSOB 3D18B 1LDPH 5FDWA 2WANA 3CK0L 3OJMB 1GGIH 4E9LA 1BQLH 1B4JH 3JV4B 5JW5A 2DQEH 3KYNA 1WISA 4X6EB 1T1XB 3FQNA 1EAJA 5FHBH 3TO2B 2VR9A 2EYSA 1CGUA 3RWIA 4RX4D 1RSFA 5CGYD 2Y07L 1J8HD 2FR4A 1J05A 5DMJB 1T04B 4R0LA 5DDHB 3U0TB 4LVNC 5T1KD 4U3CA 1N8ZB 2EIBA 32C2B 2OJEA 4Z78A 1GVIA 4OGYL 3SOBH 3HI6L 3KJ6L 1EEZB 3F7VB 4ZAKB 4MB5A 3WJJA 4U6HA 4G8IB 2WIIA 4FFYL 1PX4A 2R0ZH 1S5IL 4WO4B 3C8KB 3X11B 3VW3H 2ADIA 3IETA 1D5XB 1CDYA 3RPIA 2V5MA 1EBAA 2PO6B 1KT2B 4CW1A 3QDMA 1U91A 1T21B 3SDXF 3EDFA 4HMDA 2EKSA 4F7EA 3KLSA 3OR7B 1ZE3C 4O02H 4N8VA 6FABL 1U93B 43C9B 1U0QA 3SE9H 2FL5B 4LSQL 3WNOA 1V5JA 3BUYA 1UXWB 1ACYH 5FHAL 1MFCH 4KJPD 3I3BA 3LPGA 4YXHH 3LN5A 4U2ZA 1OOAA 4CVZB 4ELMB 2O5YL 3P11H 4RMUA 1WICA 5B39A 3BMVA 1LK3H 1L7IL 2GJ6D 5F6HJ 1KBGL 4TSBL 5I1IL 3MV9B 3W82A 1MFDH 4PD4K 3UTQB 4WFEE 3QNZA 3RL2B 5KSBF 1JHLL 3U0PB 2EIZB 4X7SL 1W2KT 1S7WA 5TF1H 3VXSE 5E8DL 1OTTD 4HUWB 3QULB 5CEZH 1UZ8A 1JN6A 4HIXH 4X9HA 5TDNA 4R97B 3ECBB 5MERB 3G6AB 2W59A 1XIWD 4RZCB 5KSAD 4ZTOL 3MUGB 3D85D 1CS6A 3U7YL 1T3FA 4IRZH 4TQEL 5CJ5A 1P4IL 4APQC 1N7ML 5IV2A 1EERB 4RRPG 3VGAC 1MCPL 2VLKB 1U6AH 1JE6A 1JGLL 1RK1B 1LP9A 4D8PB 1U8OA 4MMZC 3MJ7B 1FFOA 1H9VA 2OZ4A 5LCVH 3HE6B 3MGAA 4RCAA 1ZXQA 4P9HL 3E0GA 5JPMB 4LLWA 4I2XA 5CLTA 4YJZL 2XICA 4NOFA 5KVEL 5EOTA 4ZSOA 25C8H 5IGXL 3GIVA 3P30H 5D70L 4HC1H 2A6KB 3D39B 3RVXC 1G7PA 4JM2B 5MEND 3BH8B 4QF1A 2YK1H 4M6NH 5KG9B 1M7IA 4H26A 2EYTA 2JE8A 2HFFB 2VXQL 4PRAA 5ANME 2COQA 3RL1B 1B0GB 5HSFA 1R3JB 3L3GB 5AAWA 3MCLH 4KUCD 2PXYA 2VDQH 1KNOA 5IKCB 4GKNA 3PXJA 4YXKL 3MV8D 2BNQA 4N8CL 4MDJA 4NC1E 5B38B 5L88L 4A2MA 1RIUL 5DK3A 3O6LL 1DQDH 3WEXB 5KSUA 5GGQH 4YHYC 2DQEL 2VLRB 3BP5B 3HPLA 4N8CH 1JUFA 4LCWA 3GM0A 5ITFB 3NVQA 1BVLB 2Y7QA 4XP1H 2J5LC 1U3YA 4EN3B 4G8IA 4JFDA 3GMMA 3NH7L 3CLFH 2VABB 1OAXH 5EUKA 4JM2D 4F7TA 4HPYH 3MYJB 4MAYD 4BQ9A 4UT9L 2AABL 6CGTA 4KDVA 5IWLC 4XVUC 1T21A 4Z77A 4G7VL 4J3OC 5HHNB 2YN5A 2Y23A 3VWJB 3MLXL 2PF6A 4M4RA 4QWWC 2X41A 5IMLB 2KL6A 2BHUA 4HUMB 3HE7A 1A6WH 3MLVL 3HZKA 4H20H 2Z8VC 4TNWF 3MRHB 2XN9D 1MRFL 2H2SD 3H7BA 1CDBA 1GC1L 4JKPH 3JUZA 2XWTA 1K85A 3PNWB 4D0CA 4BFEA 4XAWL 3WS3B 3NFSH 4HIHB 4P2OC 1FC2D 4JPIA 3HUJB 3VFNA 1OAQH 3IFNL 2F58L 3DX8A 4NO3A 3WIIH 1RZ7H 5C07A 3CZJA 4JHWH 3GJFH 1CQYA 3N9GH 15C8L 3UJJL 2R39A 3OL2A 3V0VB 5GRVL 1EVTC 2A38A 3JWOL 3SJVB 3KPMA 1EV2E 1FPTL 1VKXA 2CKBL 4PGBB 4PD4J 3W9EB 1UWGL 2P24A 1MCSA 4GG6B 4FMFA 5EU5A 3OMZA 3H3PL 5EFIA 2X2YA 1NLDL 2EKSB 4Z95H 1WQVT 5TQ0L 4M6OL 1J11A 1FLRH 2H2SC 1AD9B 4V1DA 5D5MF 5J0BA 3BEVB 4M03A 1P4BL 1TCRB 4ISVA 2QR0B 4PJ7A 1G0DA 3QEGH 4EUPH 4M3JA 2GJ6A 2XN9E 1OAYH 4L8BA 4LEXH 4XVUD 1JNHA 4N0FA 5TDPB 2D31B 4H25B 4MAYC 4DKDC 1P7HL 1G7JB 2JJVA 1GZQA 4QTHB 3ELAT 1EVUA 1JGUH 2ZPKL 1OTUD 4WNQB 5JW3L 1OQOA 4XMLL 4ETQB 1XGTA 1XF4B 1FCGA 4GRWH 2X7LA 1IC4H 3CIQA 4PRBA 2QHRL 3WO3B 3T0EC 1KXQE 1IKFL 4QRQB 4L4TD 5F8QC 2PN5A 4X4ZA 2FGWL 2X4SB 2XNAA 4RAVA 1JWUA 4U7KA 4XP1L 3TIEB 3V0AC 4F2MB 3T3PF 1KGCD 4DGIL 1HKLH 4AJ0A 5F1SA 3CPLA 1D5ZB 5E0QA 3O3AA 4ZFGL 2ITCA 4PLOB 2CO7B 2XTLA 1DN0A 1QR1A 1DQDL 4HGWA 1XF3A 5LVEA 4N5UA 3E6FA 4XNMB 3MV7B 4PV8B 5CP3A 5GRYA 4BSVB 4G6AC 3ZKSD 3MRJA 4ZO6A 5FOBA 1WEJL 2ORBH 3K2UL 3GSRB 1RURL 4PJ9A 3BZFB 2P5EB 4A2LA 5DRNA 4ONGL 5E2TL 1XF1A 1IBGL 3BKYH 4L9LC 5DJ2B 4F37F 5D7LE 1T89C 5C7XH 4MWFB 3DO7B 5F3HB 5IJKA 5KANG 4JGUA 5JLZA 1U8KA 1BJMA 2NXZC 2W0FB 3V52L 4FFWC 3K81A 3OAUH 4KJPC 5C0EA 5L7XL 3OX8A 5IBUG 3VFUB 4XZUB 2K3TA 4L1HA 4XX1G 4YHLH 5GJSL 4IS6B 3G5YB 2BNQD 3TLRA 1IFHH 4I0PB 4B41A 1TZHB 4PJBB 1YUHB 3TA3A 1BX2B 5KANI 3FT4B 3GMLA 5CZXD 4O2EA 3VDBA 3RWJB 4ZNCD 3MRHA 1CLCA 1KYOK 5FKAA 4WTZG 5HHXL 2GTZB 3BN9D 3C6LC 1UFUA 4YUEL 3MACL 1J8HE 5TPWH 3MODH 1GGBH 1KLFA 3TNNB 1DBJL 4OZIA 3O4OC 1G9NH 1RK0B 3ULSB 1BZ9A 1RUMH 4HWZB 5C86A 1NMAL 2NTSP 2VH5L 2R2EA 5C3TA 1DBJH 1RZKL 1U2HA 4UQ2B 5CGYC 3DVFA 4M62L 3FFCB 3GI8L 4XGZA 3B9DA 5C9KA 4P2QE 1MFBL 4ZG1A 4R7NB 5I1LB 1V05A 1FZMA 4YE4L 1MI5A 3WO4C 3QQ9C 3EO1A 3OJDB 4HJJH 5D6DA 5DR5L 1A9BA 1F58H 3UO1L 1CZ8H 1GSMA 4KKNA 4BFIB 2XG5A 3PIQB 4KXZI 2DQDL 2RR3A 3NTCL 5I1CH 1IEHA 2K1MA 4MLSA 1K6QH 2X89A 2CKNA 4OBSA 5GXBB 2R4RL 2I5YH 2OXHA 5T1DH 5K9OA 3T0BA 1XEDA 1GHFH 3I02A 3MO1B 3H7BB 2ZUTA 4D0BA 3VGHA 2A0LD 4JFPB 1YEIH 3L5XH 4LCUA 3EDDA 1K4CA 2CRMA 1SJHB 3CVHL 3FQXB 3VXRE 1Z0NA 4TUOA 4M1CD 2OX5A 3U4EA 4EIGB 1ACZA 1CZ8L 1KENL 4HKXB 4O51A 3R8QA 2AERT 3GSUB 3HG1E 4G8EA 1B0WA 3O3DB 4WW2B 5GS1C 2WQRA 5AAMA 1GGTA 1JPGB 3EYUH 5GS0H 1DLFH 3P4LA 5IVNA 3MJGX 1H3GA 2YMXH 3HI6H 1CFSB 3RIAK 2F54E 3LKSA 1A7NL 1CGWA 1IM9B 4WI3A 1TETH 3PGCB 4UIKH 4HWEH 4Z7NE 4LLVB 3SGJA 2NY5L 3BSZL 2VDRL 4XB7A 3QUML 1VADB 1CFTA 1DL7H 4AH2A 2B0SH 3LQZB 1FDLH 2Q8AL 5F3HA 1WBXA 1UB6A 2ADFH 4PG2A 3SGDH 3BEVA 2J88H 3L7EA 4UTBL 3MV9D 1A6AA 4JFFD 5DRNB 3HZVA 3VD9A 4GS7C 4JPVL 3MRDB 4BSWA 4DN4L 1GC1H 5JOFB 3PGDB 2J8UB 1UEYA 4OI8A 8CGTA 1NGYB 4YWGH 5FO9B 4NRZA 3KVQA 1NAMB 4LU5L 1KCLA 5DJ8A 1YQVH 4JR9H 3L5HA 4FFZL 4IMLB 2EE2A 5J89A 3B9EA 1CICA 3F7YB 4F2MA 1SY6L 4BKLA 3OG4B 2IAND 4X9FA 1TVHB 4OZGE 4E0RB 4NO0B 3PL6B 1QNZH 4LK4A 4M1DL 1R3LA 1G6RL 1BQSA 4OGXL 3WNMA 2HT3D 3BVNB 2C26A 1XF3B 3EJZD 3UYOD 4LSQH 5ACMA 2X4NA 4FABH 4MA3A 4KKBD 1YEEH 1Q0YL 3UPRA 3MBEA 4B5EA 4Z5RB 2R2CA 3KNBA 3C8KA 4ZUTB 1JF1A 2BFVL 2Y9RT 5T1KB 2KBGA 5SV4A 4R6UA 1ADQH 1T3FB 4XCYB 4OV6F 2EE3A 3GMRA 4PJXF 3VXUE 1SEBA 3V4PL 5HVWA 4K8RC 3C5SA 4K71C 4R4BB 3THMH 1PKQA 4H1LG 1KB5L 2H26B 1ES0A 3O0RL 2AGJH 3TBWA 4GAFB 3IGAB 2W91A 1EFXD 3H9HB 3O3UN 2GY7B 3O2WH 4RIRA 5DS8A 5C0EB 5KN5A 1NEZB 3S7GA 1BPVA 4U05A 5ICXB 5SX4H 3CLEH 1D6EB 5C08B 1MHHA 4I18B 4DKEH 1AO7E 2VDQL 5EO9B 3JVGA 2QJDA 2CR3A 3MMEA 3S96B 2APFA 2ZOKA 3BZEA 2HTLC 3ARZA 1PG7L 2X89D 2IBZY 43CAB 4J8RA 2IPUK 1T0NA 1OARH 4L8DA 1S8DB 1OB1A 3S6CA 3UJIH 1FC1A 4UINL 3ARGD 3N85L 1K4CB 3HR5B 4PP1D 2J4WH 5B38G 5AUMB 3DMMD 4KDTC 4OUOA 5IHZB 3S37L 1IZKA 2C7UA 5ESVA 1FNGB 1MI5D 4HG4K 1KEGH 4OLUL 1LNUA 2IWGA 3LD8C 3VDAA 2HMID 1F6AB 1V3LA 4Y5XB 2XQYG 3QO1B 4XMPL 1A4JB 3O6LH 5IEHA 4P9HH 2QADC 2HG5A 4PS4H 1BFTA 4YDIL 2WLYA 1UC6A 1WBYB 3L1OH 4PPTA 4ZD3H 1JZ6A 2FO4A 2EICA 4HXAH 3ULUF 2LQRA 5F1IA 4MCZA 4PJXA 4S1QL 1NGPH 5ACLA 1ONQB 3FONB 1A8JH 2NYYC 2J6EA 1XF2B 3HZVB 3T8XA 1JGDA 3QQ3B 5HHOB 5FUZL 1WEJH 5KS9F 1KB9J 1QRNB 4LLWB 1WVZA 4QY8B 2BNRD 1J7VR 3LQAH 1FLTX 3FHAA 1UB5B 2VSCA 3MR9A 2P47B 5SWZB 2Q87A 3IU3A 1QLRA 2JK5B 3OXRA 1R24B 3VRJB 1T6VN 1SVCP 5FF6B 4OCLC 1KJVA 3HNSH 3VG9B 1A21A 3GMOA 4LF3A 4XB8A 4UBDD 5L7XH 5C0JB 3FO0H 2WWKO 2J7LA 1YZZA 3MYJA 4PRAB 1HXMA 1ETZB 4HWUA 3NCJH 2C1OA 1CXLA 3MRIA 1P1ZB 4D0DA 5DFVC 3FQWA 4Q6IC 4UB0L 4P23D 4G8EB 4I5BB 3W5MA 1ZT4A 4WI9A 3O8XB 4OZGB 3V2AR 3CFDA 3NCCB 2BDNH 2DM7A 4TQEH 5JXEA 4PRPA 5HHPA 4K9EL 4R8WL 5EC2A 3MRRA 4MHHI 2OZ4H 5DD3L 2KZ1B 2IG2L 5C07B 2BNUA 3CDYA 4MNGE 3KAAA 4PLKD 1WBZA 4GRLA 1IEBA 4QHNA 3JVGC 3O2WL 3P0YH 1R3IL 1AQDA 3TN0B 2YPVH 2R0KL 3B9KC 1VFOA 3D48R 2P8LA 1CLYL 4KTDL 4N8VG 1VFBB 5HYJD 1Y18A 1D5BA 3MRBB 5TF1L 1KTDB 3P9MB 3KLHC 1I4FB 1LO5A 3GUTB 2JJTA 4X7TA 3VH8G 3CX5K 5MENE 5EBLB 5GGTA 2WM0A 5HBBA 1I85C 2ZSVB 4HUXA 4ZPVA 5F70A 4Y5YC 2X6MA 1N2RA 4H8WC 1F00I 4RA0C 4BK5A 3TBWB 2CXGA 5M95B 5KAQF 4PREA 1G6RB 1FN4B 3IFOB 3FHQA 2A1WH 1XFPA 1W0YT 2ESVE 5GRJH 5IGXH 4DOHE 5I1CL 3G5ZA 4QRRB 1IAIH 4TTGA 4PJHE 4XBGA 2YXMA 5DXWA 3NACH 4XVSH 3SEPA 3QT2A 5JW3H 2VXSL 4ZTPL 4PJ7F 3F7PC 2RCSL 4PJBE 4OD1H 4M7KH 2PCPA 4GRWF 3RTQA 4PGDB 2WUBL 3CU1A 4PP2B 1MCOL 1RIVH 2CDEB 1JNLH 5SWQB 3UC0L 3L5WA 1BF8A 3O8XC 2IQ9L 4X4XA 3VFPB 3L3KA 1XR8B 2OK0H 5EN2B 2NCMA 1BZ7B 4HQQH 1X9QA 1UT9A 2YEZA 4TULL 5JW5B 3FN0L 4JVUA 1AHWC 5J9PA 1KXTB 4X6CB 4F33A 3PWNA 3TIDA 1YEHL 2Z0BA 5ERWA 1INEH 4W6YB 2IH1B 2L0DA 3W0WA 3RX5A 3IETB 4NFDA 1DL7L 4HGWB 5GS0C 1HSAB 3LKNB 4U33A 3SDDA 1M6OA 5C0RL 2GTWB 4P23B 4MJ5B 5DYOA 5F1NA 1DJSA 2DDQH 5JLZB 3AMKA 4Q58C 1X3DA 4H88H 5BVJA 1K4DA 2J8UF 4XT1C 4ZDHA 4J8RB 2H2PC 3FFCE 4AYFA 2BNRA 2XZQL 2I07B 4QHLB 4KHXH 1HN1A 1L4IA 2NZIA 5FO7B 2FBOJ 2O61B 3GHEL 2QKIA 2GSGB 1YQ2A 4H5SB 3MROA 3O8XA 4JHAL 1RFDH 4Y2DB 4GLRH 1T04A 4R0LB 5D1ZA 4U1SB 5J06A 1C12A 3QO0B 1BIHA 4IRSD 2BNUB 1OWWA 4HUUA 3WFBH 3QEQE 1DBML 4M7ZC 4OB5L 4OLYH 1H15B 3QIWD 3BPNC 3T0WA 1A02N 4YH6A 4NNYB 1HI6A 4PJDE 5DD6B 2XT1B 2AJ3B 3QNXA 1O0VA 2V7HA 1EXUA 5DO2D 1FNFA 1CFQA 4RAUB 3LPFA 5CJOH 3VA2C 5TE7H 1RZKC 1A2YB 4OCMC 4OBRA 5IF0B 3ZHLA 3P77A 3DRQA 1NFIA 4WU5A 3HC4L 4M48H 4AQ1B 3B2UC 3BZ4A 3K0WA 3MLWH 3D85A 3ARPA 5E9DD 2X4PA 4QTIH 3DX6B 4LIQE 4KROD 1W0VA 3M8OH 4KQ3H 4FTVA 3BP7B 5C71A 4PY7A 2PW2A 3DVGA 4XZUA 1S9VA 5E8OA 4DEPB 3RY4A 3KPNA 2E7CA 5CD3A 3C5JB 1KCKA 2ILLA 4P9HC 4N8VB 4YDLB 1RUQH 4LQFH 4FQCL 2OJZL 3OKEB 3QEGL 4KKCC 2EXYD 4JJ5A 5F93C 3VH8B 5B3JE 3VD4A 5IFAL 1ZA3B 1S7WB 3ZKQD 4QNPE 3O2DA 4V1DE 1HKLL 4LFHG 2QQKH 4KGLA 4NQEB 4OTXL 4JRXE 1FNEB 4GG6E 2B1AL 3MUZ1 1CVSC 3FZUD 2R9HD 3HC3L 3GIVB 1AGFB 4ALAH 1CGSH 5IW1A 3BUTA 4ODHH 1EA9C 2YD9A 1K8IA 3LMJH 3NACL 4PTUB 4G3YH 3WDIA 3N1FC 1V7ML 4HBCH 4K7PY 1H0DA 5CSBA 3G6JB 5EZLA 1FBIL 3DBXA 4NQDB 4YPGA 2R69L 1I3GH 4L3CB 3UTSD 5IIEA 3WBDA 5DD0H 5HYQA 1HIML 5D2LB 5KOMC 3HC3H 5E8EB 1GJIA 5B4MC 3VFRB 4Z7WB 4AY0A 3DYOA 1B0RB 2GUOA 4K3GA 5TE4L 1BM3L 5K9OB 3RVVD 1KULA 3IU4L 3P4OB 4YHPB 1U92A 3MUY1 1VFAA 5KAQG 1HSAA 3LKNA 5GGVH 1OP3K 4R90L 5HDQL 3HMXA 4X80H 4BSWB 2QKIB 4YFEA 4GRMB 4WUUD 5EPMB 5IFHL 1VERA 2OTUB 5ACZA 4OCXL 1TETL 3F7RA 1IGFL 2YD3A 3JWDL 1ZT7B 2C1PB 4XVTL 4X80L 4HULB 1YNKL 1ZHKA 2FHFA 3U6RA 3SJVE 3QHZH 1OLZA 3RGVB 3EDKA 3CFIC 1RPQA 2D0FA 3FRPA 3WFHB 1JYNA 3B3IA 4RMSA 2BVOA 3O3BB 5DQJB 5E4IA 5JQ6L 3HMWH 1A3QA 4YXHL 2BNRE 4CMHC 4KK8C 1NAMH 2YZ1A 3CVIL 5DFWH 4YK4C 2MCPL 4NO3B 4HT1H 3GBNL 4ONFL 4X7CC 5EBWA 4Y5YB 5I73C 1N59A 4NKDA 4KQ4L 4WU5B 4HLZG 5GRJL 2V17L 2XWBA 2WIMA 2C3HA 3V5KB 1ZLSH 4NIKB 5FUOH 1CICC 4M6OH 3NPSB 1ZKAA 4AEIH 1I1YB 1FVDB 1RVFL 4AM0B 3ARVA 1UQSB 2WSKA 3GO1L 4OZIE 1OARL 4LLDB 2ZPKH 3BIKA 1KPUB 4JFDB 3X17A 2WWKT 4PJCE 1L9NA 5JR1H 1F58L 3D39E 3GMPA 5C0IB 3GGWB 1A1MB 2DQUL 4K7FB 4NHUA 5EU6A 4GXVL 4LEXL 5IMOB 3S5LG 1OF2B 3V4PH 2GJ6E 1KOAA 4XCYA 1D9KC 4OFVA 3G5XB 3GB7B 5CJ8A 1DANT 5CEXA 3LDBB 3N50A 4PR5A 2PO6C 4WHDA 3VXSB 3SBWC 4PB0L 4QHKJ 1SBSH 5ENWB 1P4BH 1MCHA 2IQAB 3ULUC 1HQRB 2W92A 1MCWW 4WHYH 3IGAA 3GSNL 1JPFB 2Z35A 5LCVL 4RISH 2WINA 3LEXA 1B2WL 4WW2C 4YHIA 5C0AB 4O2CA 1OAKL 3TM6A 5KTEH 1VFUA 3QAZC 4N0UB 4UDTB 5F44A 1CGVA 2Y6SC 4WFFD 4ZOCA 1EO5A 3ALPA 3CSGA 3HUJA 5ALCL 3VFNB 4Z5RA 5ADPL 1IC7H 5LQBH 5KVDL 3MQIA 3MX0A 2PNDA 5DD6A 1MPAH 4XC3H 3RWCA 1QSED 4WTZA 4DKEL 1U8JB 5ADPH 4HFWA 5BOPA 4L3EE 1CWVA 3AVEA 5I73B 1V8HA 3TIEA 2BXYA 3ZE2E 4FN0A 3MRKA 1MCCA 3QUKA 1CGYA 4XTRC 4JPVH 3O3AB 1V3MA 5IESL 1JPST 2H9GB 3OWEA 4NP4H 3UAJC 5D7SL 2AK4B 3BP4A 1Z9LA 3MGTA 3N85H 2BP3A 4YFLI 3FTGA 4MMXC 1I8LC 5DLMH 3QIBD 4F9PC 2C3XA 2EDQA 4QHUB 1RURH 4NQTA 3VGAB 3QDGD 1MCFA 1NCWL 2P1YA 3VGDA 3QUMH 3TZVC 3DIFB 1NLBL 1CK0H 4WHTB 3SJVD 3OKDB 4EI5B 1FYHB 3RWIB 5BW7A 4PJ9D 4RAVB 3ARQA 1BM3H 1F8TH 4U1GB 4JFOA 5BOZG 4WY7L 3EHBC 4XAWH 5DRZB 3WFDL 1DR9A 1X5ZA 4JFFE 4MD0B 2W07A 2DJ4A 4NC0B 2X4QB 4M6AA 2RAMA 3WL9A 4BQ6A 3L3HB 1ADQL 1Q9KB 2O5XL 1FL3B 3PV6B 5CKAA 1MJJA 4JZOB 5SWZD 1DVFC 3UTPE 3BXNA 1JZ3A 4AK1A 4OM0L 1LWRA 1D5ZA 1QRND 4GRWE 5HHOD 3U36A 2VDNH 4HDIA 1JTPA 3WNKA 4DKFL 1HQ4A 1K5NB 3BISA 3JSSA 1NCCH 4NOBA 4YDLC 4PIRF 2FATH 2QHRH 1FO0A 1CE6A 5I1LA 1JF5A 4WFFE 3H8NA 5H94A 1GXEA 4G42B 2DJUA 3P3YA 4NZRH 3OAYH 4ODXB 1B0RA 2GUOB 5DUPH 2AJUH 3WXVH 2ZSVA 4RGNE 4BQBA 1J0HA 4EN3D 4ZUSA 4KVCL 5LWYL 3OR7A 2I5YL 2LE9A 2ZCHH 3QDJE 2CJUH 3GJFA 43C9A 2E9WA 2NY2B 1QACA 4L8SC 2AK4D 2DWEB 2CKBB 1MI5B 5CUSH 4LMQI 3VWKD 3KPLB 1MCRA 4LLMA 2N7BA 4G6KL 4PREB 3GHBH 1QSZA 5HGBB 5H35B 2Q3AA 3DXAA 2MMXA 2AK1L 2BSED 3RA7L 4DGVL 2HT2D 4EI5C 2XZCL 5IB3A 5KVGH 2QL1A 5J13B 3VXOB 5JMOC 3UTQA 4Z8FH 1BZ9B 2E7BA 4HKXA 1AHWA 2I9TA 1T5XB 5EO1B 2DTML 1P7QA 3DTXA 3G9VA 5DD5H 4R2GB 3RBGA 3TT3L 3WCYA 2RJMA 1CL7L 1DFBL 2VXVH 1AQDB 2WBJB 3V6OC 1EGJA 2L7JA 5AWNH 4MXVE 5HI5C 2GCYA 5IW3A 2AS5M 3A67L 4P2QD 3V7AG 3GHBL 5JDJA 5K9KA 1UH2A 5LGHH 4CNIA 5HYJA 1II4E 2DD8L 1DLFL 3B9VA 4IIQA 3B4NA 4FQXB 5CIPH 5FYLH 5L2KA 2DLIA 5LBSL 4GRLD 1EAPB 3QXDB 3D3VA 3HE6D 3TFKD 2VLLB 5ADOH 4L8SA 1MJ8L 3NFNA 3MGOA 2RCSH 4QHUA 5KS9A 4PJDF 3QDJB 3C60C 2OI9B 4XHQA 3NAAL 3LD8B 4HKZA 4X6CA 1FN4A 1C08B 5E2WL 2BSTA 5CILH 5HYSG 4M93C 2E7HA 4H1LB 4FQHB 5HHME 5IB2A 4KGJA 1HQRA 4CMHB 1N64L 2CLVA 2G9HB 4BUGA 2NX5D 2F5BH 3VXTB 1CFVH 2D7PA 1XGYL 1YY9C 3NIFE 4HIXL 2NY4C 2HWZH 5BZWB 3QCVH 2I07A 3VD3A 4WV1C 3GKWL 5C9JB 2H8PB 4LQ1A 3IFNH 2FJHB 2WBWB 2VZVA 2X4QA 3RWFB 3UYPA 1C1EH 3B83A 3P0GB 1MCNA 1TZIA 5J8OA 2M1KA 1CFSA 1KF9B 3FMGL 1LQSR 1ZS8A 1C1EL 3V6ZB 3VXNB 3HPLB 4P57B 3I6LE 2R0KH 1KCVL 1MFAL 1ZV5A 3SPVA 3K8LA 5ICYB 3QQ4A 5KSBB 2X70B 4PUBH 3ULVD 1KLGB 2AP2A 1I9JL 2FECI 5JIIA 1ZGLB 2BVUA 4LLAA 4S0SD 4JZOA 1QA9B 4MQSB 2HLFD 1BFVL 1MQKH 1JTOA 2J1KA 2VXTL 2VLRD 5CEYA 1JGVL 5CJBA 1RJCA 3S36X 3S9DB 2EC8A 4L4VE 1MJUL 1AIFB 2YWYA 2APWA 3MJ8B 3GBNH 5IMLA 1INQA 1E28A 4G8GD 3BE1L 5JW4R 1TIUA 1I3RA 4I0CC 5TE7L 3MRFA 3KPLA 1ZGLM 4Z95L 1OAYL 4NKIH 4CMMA 3MRPB 5I1HH 1KTLB 1J1XL 2A83B 3GMRB 2FLRT 1I7TB 4M5ZH 4MA8H 1QSFD 3EYOB 4E5XA 4KI1A 1X4YA 4OM1L 1NFIB 4G5ZL 2X4OB 5A43C 2VC2L 2D4DA 4GMTL 4M93B 4OGYH 3SOBL 4BH8B 1A6VH 4ETYA 1QUNA 1XGRB 3EIFA 4PFEA 4YGAB 3OAZH 5KVFH 5DR5H 1IQDB 1IGCH 1CL7H 2VXVL 1T66C 3MOAH 3HRPA 3I75B 1NGYA 1TQBB 1ND0B 3GRWL 2VJXA 1TTFA 5JXAH 1FZKB 2ESVD 5E6IA 5H35A 2J88L 1T2JA 4IBLT 2H3NA 4C4KO 5HHMB 4FQXD 4X5XA 2D03L 5J11C 2NY1D 3VMNA 2UVFA 2X1PA 4WW2F 2AEIT 2RIKA 1G7HB 4LCCA 1OAKH 1JP5A 1RZJH 1PBYA 3DX8B 35C8H 4QYOA 4W68A 1JZ8A 1JYWA 1JF1B 2I9TB 4FQ1L 3CDGA 1J1OH 1QSVA 1MCDA 3SE4A 4ZS6D 1PLGL 4I48B 2DLFH 2FEEL 3KR3L 2OTWA 4PJ5E 1WAAF 1YPZA 2GCYB 4NUGL 5BS0D 5BZDA 1ZANL 3GSWB 3PWUA 5F1IB 3QEHB 2V5RA 4AG4L 5CCKL 3MLXH 1DBKL 3O4OB 2KQMA 5KSAB 3QEQD 2ZKHL 3ETBF 2UYLA 2Z31B 5HY9B 2YUXA 1VEPA 3ZE0E 3I6LD 3RDTB 3RNKB 4OV5B 1U36A 3VGGA 4FA8A 3X11A 1CCZA 3MMEB 3S96A 4EZMA 5JUEH 2G5RA 1WLHA 2FHCA 4ODVL 5T3XL 1F2QA 5D1QA 5GS2D 5E9DB 2BJMH 2DMBA 1ZA3A 5HGBA 3SE9L 2DQIH 3IAGC 2OR9H 4UZGA 5AEAA 4GRMA 4LRIA 5DURB 1JNNH 4XHJD 5JHDA 5GS2H 4D3CL 5C09E 4Z7UB 2BERA 4LSUH 2A6IA 3NFSL 4XWGH 1YEFH 3DUHA 4M9OA