1RUAL

Crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
218
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 51
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaL01
4X0KA 1DBJL 4LVHC 2P5WE 1AR2A 4HWBH 4Z9KB 1I1RA 3WKML 1OCWH 4F37K 2VH5L 1Q9LB 1YUHA 5D6CB 2CJUH 4QYOB 1LVEA 4MJ6B 2EIDA 2X7LB 3SKNA 1DQDH 3MLVH 5JW4M 5C07D 2JB6A 4GG6F 2Q7YA 5T1KD 5I6XC 4QXTB 3SCMA 4X6DF 2NXZD 4M1DL 1FG2B 3V7AE 4R4BA 2BNRB 1I8LC 3WIHH 5D7KE 4RISH 1CLYL 3RPIA 3P9MA 3LV3A 4OLYH 3CLFH 3RPIB 1I8IB 1DQQB 1N0LA 2YPKB 3U2SB 2OYPA 1DQDL 1FO0B 2A1WH 3KPMB 5HYSB 1H3XA 2R23B 4HWNA 2Q1EA 2P8PB 5C09B 2FNBA 1ZLUK 3RKPA 2CGRH 5IEKA 4LSUH 1PG7W 3HE6C 1RMFH 2L4OA 3BDXA 3O11B 3PGDA 4B41A 5IEKB 1GL4B 4R3SA 1KLUB 2ED8A 5J3HD 3GK8H 3O11A 3UJTH 4FQXC 5GGTL 3D87B 1A1NB 4RMVA 4K3JL 5KVFH 3QO0A 1EBPA 2YRZA 4P5TA 4ZAKB 5HGDA 4IM8A 1WFTA 1BBDL 5JOFA 1UB6B 4P9ML 1MWAB 4IIQA 4GLRH 1E28B 5FK9B 3OPZL 2AK1H 5D7KD 3ULUL 1VKXA 3C6LB 4G6KL 3E6FA 1XR9B 3IDJA 3AMKA 1MHCA 2WBJB 4LLVA 3RWEA 2W9EH 2EE2A 3MBXL 5IBLD 1MHCB 2WBJA 4PRPD 4X9HA 5INCA 4QHNB 2FHCA 1QFWM 4M5YH 3HPJA 2BVQB 1W72H 1S8DB 4RGNB 3S96A 5F96H 3IXAB 4QHUA 1CE6B 3OKDA 4FXKB 5LWYH 1KTLB 1HXYA 2RIKA 5K93A 1IM3A 4AEHL 1JWMA 2YUWA 4N1HB 1CXKA 3MJ8A 3GM0A 5JR1H 2EH7H 2MJWA 3LDBB 3MJ8B 1AR1D 4X4YB 1P9MC 4RSVA 3U1SH 3VFSB 1FNEA 4L3ED 1DL7H 3W5MA 4M4PA 5BZWA 5HGAB 2H9GB 1BFSA 5H2BA 1OP9A 4K07A 3FB5B 3GSWB 1NJ9A 2Q87A 2HJFA 5AG9A 5CGMA 1FHGA 6FABH 4DTGL 2ITDA 1U8JA 3K2MC 5J9PA 2WWMD 5FKPB 4PJ7B 3NCJL 5D4QA 1LO3H 2D0GA 2FJHB 1KELH 3S5LB 5CMAB 4F58H 4ZUWA 1KYOK 3KYOA 1B0GA 4JM2D 4M03A 4S1QL 1U8QB 4AL8L 4OZGF 4TULL 1FZKB 5HHQA 1NGWB 2VLRD 1RULL 4CW1B 1G0XA 3KHOA 1N5YL 5IBUB 1CGSL 3UDWA 5FYLD 4ZOAA 2QL1A 4JKPL 1PSKH 1OGAD 3K74B 5HHXH 1SM3L 4MNGE 3F7YA 4QRRD 2DQCL 5LGHL 3PXHA 1RUMH 1V3LA 3KG5A 5TF1H 2XYCA 3ARUA 3T4AB 4HPYH 4NM4H 4TOYH 2K7PA 1LEGB 2EKSB 5KVDL 5E95B 1N2RA 2QSTA 3CCHA 1JI2A 2IH1A 4KJPD 4F7MB 5DJXA 3R06A 4OKDA 1GGCL 5EU6D 4UV4L 5IW1B 4MQTB 5LGHH 3MRQA 4NC2B 4CU7A 5CCKL 1AKJA 1ZK9A 2IQ9L 2OK0H 1YMMB 4NQDB 2FX9H 3VFUB 5IIEB 4WRLA 1IT9L 1B4RA 4C58B 4NHCL 5D93C 5T1LB 2B4CL 3DX7B 4GKZA 4PUBH 1LO0H 3U0PA 4HBCL 4QF1A 5DWUL 2ERJC 5IM7A 1SEQH 4PJXB 4WW2F 4CRPA 4ELKB 1IARB 1N8ZA 2BRRH 1FFOB 3L3HA 1YN7A 2G5BA 3OXRA 4B50A 3ES6A 4NM8L 4N8CH 2D7OA 3ZKQD 1JTTA 1NCUA 4KTDL 1TZGH 3KPRD 2YPLD 3MFFA 2IANA 4M62H 2BVEA 1YQVL 3V4UL 4F7CB 4PJHE 1BMGA 2PTTB 4IRZL 4PJXE 2QSCH 1NBZA 3LS4L 3G6JB 4HFUH 4M7LH 1Y18A 4FMFA 2H26B 4PGCA 3O0RH 2FSEA 4JVWA 5IG7A 5E8OB 3EBAA 3L95A 3LPGA 4KI1A 4G8FA 2NX5D 4WU7B 3BWUC 4XVJL 5DMJB 5DRXB 1H3VA 3V6ZB 4FXLA 5D96C 5EU6B 3VI3E 4O5LH 1DFBL 3ULSA 2JCCF 1FLRL 4LU5L 2XZCH 3MLTA 3QEQD 2PYEA 1MFDH 3QSKB 2ICWI 2X1XR 4X4XB 3UDWC 1TXKA 3MLTB 3P4LA 1A6ZA 3RVWD 5GS0L 1FNGB 4NN6B 4XNUH 4HIIA 1S7UB 2XQBH 2PW2A 3QRGH 1CZ8L 3UPAA 3DXAD 1W8OA 5E9DA 2NZIA 4WHYG 5J13C 2A6JA 4LVOC 2VB5A 4O2EA 1LEKB 3GHBL 3HRZA 1MFDL 5FFLA 1MY5A 4F80A 3N85L 1M71B 3DJ9A 2MCPH 4LCCB 5DXWA 2BC4B 4ZUVB 3RWCB 2HKHH 5DHVH 1A5FH 1Y6NR 3FQNA 3B9KC 3VH8B 5FDWA 2X4TA 3QIUB 3WDIA 4B7IA 1GSMA 2DQHL 4U1JA 2NX5E 5I74C 4HG4K 1A1MA 2GTWB 3S98A 1DJSA 5J57B 1EEQA 1NFDF 1DBBL 1I3RB 1UADC 1WBZB 3S3JA 4WO4C 5IB5A 1A9EA 1F3RB 5IB4A 1ZLSH 4GRLB 2YMXH 3UMTA 3MRBA 1G6RA 3OJVC 4GXUN 5EZJB 3U7WL 3MSPA 4YBQD 2FYYB 5GSRB 4P5TD 3SKNB 4XWGH 2FBJH 4MQSB 1RVFH 3LPFA 4K3GA 4XCYA 3MROB 4U6VL 5B8CA 3S4SA 1BD2D 1S9VB 2FJFA 2NTFA 3MLPA 4ODTL 3BP4A 5JZ7C 4M43H 4GRMA 3TH4T 3C6SB 5ISZB 4O4YL 2GAZB 3D39B 5LBSH 3QT2A 5ANMB 2EO1A 1SY6H 5C8JB 4HK0A 2FEDD 1KJ2H 3AS3A 3CSBA 3KWWA 5ICYA 3F8UB 1ZHKB 1W8NA 4C59B 3ARYA 4OBRA 4ZXBB 3S7GA 1CVRA 1T6VN 5GGSY 4JFFA 3LMJL 4XTRD 5EZLB 4PJCB 4LPWA 1D5IH 3QEHB 3BVNA 1JGEB 3ARBB 5MEQB 3TVMD 1W0VA 1IFHH 3X14B 3IRPX 1EFQA 1KCLA 5ADPL 1UB6A 2ZCHL 3MRNB 5I75C 1AGBA 2NMSA 3HB3D 1X5AA 4P5TB 3IU3A 1FNFA 2C5DC 3O2VL 2VLRE 4BQ6A 4OQ1A 4KY1L 4JKWA 2F54B 3V6BR 3P2TA 3KYMA 5J11C 1KPVA 5I1DB 4HXAH 1WC7A 3QDAA 4N9OB 2WWKO 2FBOJ 4QRRE 4ZFOB 4G7YH 4JRXD 3OZ9H 4PV8B 2AJXL 12E8H 2W9DL 1KBGL 3UPRA 3VFNB 2GITA 3B9KD 3BKML 5I1IL 2VISB 1HXYB 5E03A 1KACB 3QHTC 1GC1C 3AREC 3D69A 5GZND 2VXUL 4U6YB 3RIFK 2KZ1B 2PXYA 4NO2A 3X3FH 5B8CC 1YECL 5C0EB 4DGVL 2MPAL 1DBJH 4BSWB 4HV8A 3EDKA 1BOGA 2VDKL 1IKNC 3HR5A 3WD5L 2UZXB 2IAMC 5ALCH 4YHNB 3BKJL 1BM3L 3ULVF 3I6GA 4FTVD 3MRLA 1BFVH 1MIEL 3RTQB 3JWOC 4HT1H 1YPZE 1HI6A 3VRLE 1U8JB 5BS0D 1KUMA 4QRPD 1YECH 3F65A 3V79C 2P5WB 4HWZB 5KVEL 3U7AA 2DI8A 3QNXA 2MQCA 1DQMH 5TQ2L 1YMHA 4I0KA 1NCCH 4ALAL 1YQ2A 4H8WC 5K9OB 5I19L 4MMXC 1AQKL 4YDIL 5E8NA 3HLAB 5EG6C 3HNTL 4A6YH 4P46C 5F7HA 4R9HA 1XR8B 1VCAA 1MHEB 4KPHH 1G9NC 2ILLA 3J8F7 4JRXB 4NKMB 5JQ6L 1M6OA 1T20A 2BJMH 5SWQA 2VKXA 3HCVA 3BEVA 3VGDA 4ACPA 5JPMB 3DURA 3LN5B 1OSZB 1EO5A 1ZLSL 5HDBE 4POZD 3QPXL 2HKFH 3SDDC 4XRCB 1B0RB 5I16B 4ZPTA 3PWUA 5KS9F 2GY7B 3CFEB 4U3XA 1U3JA 3U4AA 2ORBH 2P42B 1HDMA 1OAXL 3I9GH 5EULV 1OGTB 1ZLWH 3BKCH 4YNYB 4HUMB 3OKLA 4P4KB 4LNVA 1ACYL 4BFEA 4YNYA 4FABL 4H1LG 3PGCA 5IOPA 2YZ1A 4K8RH 4ZTPH 3OAUH 1H5BA 5JQHC 4J1UA 4NQEE 1YNTA 1Q8MA 4IDLA 2R69H 5J1TC 4WFHD 5H37H 2EC9T 1C08B 1BBJB 4Y4KC 2CMRL 2BSRB 1KJVA 3U4EB 4OT1L 1EVTC 4H0GA 5D2LE 1X5GA 2J3SA 3H7LA 4UIKH 5CBAB 2WK2A 1DEDA 1G6RL 4PRHD 4ENED 1INEL 5JZ7D 4L8CB 1V7NL 4JQVC 5DVNA 3Q3GA 4OCYH 3WXVH 3ZDZF 3RX7A 4KRNA 4TNWK 4OSUL 4E41B 3OG4B 1KPRB 4OT1H 1WWWX 2CR3A 2VL5A 4LRNL 4MAUH 2QSQA 3FB8A 3IVKB 4FZEL 1CDIA 5MERA 1HEZA 4Q2ZA 4CVWA 1LO2L 5M7QA 1WZ1H 4EBQH 4Q2ZB 2J8UF 3M17A 4Y4FC 3NFSH 4D94A 4P46A 1TJIH 5FUCE 1HH6B 5D1XB 4R90H 2MQ3A 1NKRA 1LO2H 5HGDB 3ZZ1A 2R29H 1Q0XL 1LP9E 4Y16D 5BV7C 4ZPVB 4Z0XB 5CKGA 1ZHLA 3MRFB 2A74B 5DD0L 2NW2B 1XZ0A 3O6KH 2OI9C 4HWEL 2EEAA 4D0CA 2IQAB 5EOQL 1Z9MA 4PS4L 1ADQA 3U9UA 4HW6A 2CRZA 3ZDZE 5CP7A 1XZ0B 4WW2A 3H9SA 3B9AA 2CDGB 4ZG1A 4PGEA 4U6TA 3HZVA 5EU7C 4ZSOA 1QVOA 1VERA 5D1ZC 5DHVA 5EU3A 1BWMA 1K5NA 4PREA 5E8DL 1S8DA 4X5XA 2PR4H 4KKBC 4OLYL 3BIBX 3QZWA 4WHTA 4DVBB 3DRTB 3V0VB 4ZOEA 5DGQA 3TYGL 3B8YA 5IVNA 2RBLA 15C8L 1S9WA 4GRLA 4X6BA 43C9B 1XCQB 1KJ3L 3KPRA 2PXYB 5C0AE 4X5WB 5BV7B 3TCLB 4FQJL 2KKQA 5C2BL 5F72S 4LSUL 4X4ZA 2N7AA 4PRIB 2NXZC 5FHBL 4N8VB 5E6YA 5C2UB 4F9LC 3DIFB 2W0KA 1Q0YL 3TBYB 1EO8H 4D3CH 4RAHA 5L0QB 3SKOB 2FECL 3ET9F 1RU9L 4R97C 1QR1B 3ORJA 3V7AG 1IGJB 4P5KA 5IROC 4AEHH 3V52H 4M6OL 3UTOA 3IFOA 2ZOKB 4OZGA 1FL3B 5K9OA 3NPZB 4HWUA 4QCIB 1A6AA 1CLZL 3W11C 3MV7A 2ZG1A 4YPGB 3IDIB 4IS6B 1R5WA 3EO0B 5D1XC 2VQ1A 2WIMA 5DS8A 2IG2L 4NQDD 4MXVF 2KZWA 2F5AH 5D6DC 5HDQH 1GGCH 2LVEA 3BQUC 4MA3B 4ZAKA 3F7YB 3PWPB 4WW2C 4OGAC 1FE8H 1YEHH 3MRGB 1PG7X 5EWIH 3E6HB 2A77L 3FO1A 4TUKH 2P48B 1S5HA 4KROD 3DUHA 1CDYA 2LABA 5FKAA 5DA4A 1B0WA 3QUKA 1XFPA 4MQ7B 3L3GB 3MZGB 2HFFB 4DN4H 3QDGE 5J4MA 1WC7B 2N56A 2V2WA 1V05A 4B53A 4TNVF 3IS0X 1YA5A 1A6UH 1HSBB 1D5MA 4FFWD 1T1WA 2R0KL 2Z0BA 4G9DA 4ODUA 3BRGC 1YJDL 1UXWB 3VFUA 5IIEA 8CGTA 1TJHH 2NY4D 5MEPA 2YUZA 1DZBA 3VXRD 1RZ8A 3T2PA 2VSDA 4UILH 1BF8A 4G80B 4ODHL 2IALB 4JPIB 3ZSSA 2VXTH 1ZWIB 2P45B 1M1SA 2PO6A 5GS2H 3QUYC 1JPSH 4NDMB 2AJYL 5DFWH 4IRSB 3VXSB 4YEEA 4R90L 3DBXA 1J8HB 4PJ9C 1I8MA 3LKRB 1BOYA 1GOGA 5GPRA 3L5IA 1Z3GL 4KRPB 2EIEA 2IPUG 4V2CB 2W59A 4JANB 4OB5L 2VZSA 3O3UN 4WDIA 3T2NL 4F9PA 4TRPH 3VW3L 3LEYH 1N0XL 3KR3H 2OSLA 3DUUB 3KYOB 5I74B 1FZKA 2APFA 3TIEB 1MJ7H 1TTFA 3SDCD 1JN6A 4PGJA 4HJJH 3L6FA 1MPAL 1CR9L 3MYZA 4CDHA 2V2TB 3D25A 3BQUA 5F7WC 2NY4B 1CDGA 4LKXA 4ZAKC 1JFQL 3ARWA 3I84A 3DMMA 3B8SA 4D8PA 1NCNA 3LB6D 5IQ7L 5EZIL 3DURB 2AJ3B 3WIFA 5KS9E 5E4EC 4P99A 3GBML 2DOCA 4ZPTB 5KVMC 4Y16A 1T1ZB 4W6XB 3PL6B 3LIZH 3FOLA 2EH7L 3HNSH 5FO8A 3MMEA 1UM6L 1IGFL 2J5LC 4NCC1 5DDHA 2YN5A 2ARJB 3QG6A 3O8XD 3FQUB 3VCLA 4M7LL 3QZWG 2X4RA 1FORL 3QP3A 1MRFL 3EOTL 32C2B 1EX0A 3F7QA 2MKWA 4NP4H 5IT2H 5JOPD 4X5WA 3UC0H 4PP2B 4HD9A 4MJIB 5SWSE 4X6CB 2W0FA 1MCQA 1N3NA 3NAAH 4U1NB 4OZIF 5CWSA 4OD2B 4WEBL 2DIJA 3BP4B 2VZTA 1U41A 2X4SA 1S7TB 5IB2A 5BCAA 5ITFA 5SWZD 1GGBL 3E2HC 3RNKB 4MCZB 3KPPA 2F74B 2Y6SC 1V3KA 3MV11 3RGVC 3OJDB 1CK0L 5FYJD 1SBSH 5LGJA 1T3FA 4UV7L 3O6MH 5F6HI 1H0DB 3OKOB 4MB5A 4F9PC 3UBXA 4EIZC 4XAWH 3O6LL 4R96A 4OIBA 2F5BH 2V5TA 4CVXA 3QDGB 3GSNL 2NR6D 1G0YR 5LQBL 3D3VD 4OCWL 3RZCB 4JG1H 4AG4H 3GUTA 2IADA 4NM4L 3W0WA 1DBMH 1NL0H 1S78C 3VXTA 1RZGA 4E5XB 2J88L 3MODH 3DMMC 3ALWA 4PJIA 5I1KL 4F2MB 5HPMA 4XP5L 4MJID 2HRPH 2G60H 1XGUA 3LHPL 2BY2A 1ZHLB 1PD6A 3R4DA 2EH8L 3JTSA 4EUPG 2NXYB 1TJGL 3RX5A 3W0WE 3EYVA 2H6PB 1MJUH 4PR5B 3VXPA 4QXGH 5TH2A 1JGVH 2KH2B 7FABH 2HFGL 2Y06L 3BXNB 4PR5A 5DQ9A 2VWEE 5B4MD 4TNWF 1FVDB 1FYTB 2YXFA 3AM8C 4UNUA 1NCTA 4D9RD 1CQKA 2CR6A 1K5NB 4KK8D 3O3EA 4XVUD 1F8TL 3BGMB 1JZ5A 1SBBA 4PJGE 4BYHA 1CFQA 5HYSG 5IB5B 5T3XE 5IKCA 5ECJE 1LDPL 2B1AL 3O81A 1QRNA 4M1CC 1A7OL 4NZRL 1FFPB 2SEBB 3VA2C 1KGCE 3H3BC 3HZMA 3PWVA 4YFDB 1NCAL 5IF0B 5B38A 4FP8L 1AJ7H 2NNAB 3VGBA 4LSTL 1EXUA 5DMIL 3QDHA 1EEYA 5GSVA 4OCXL 1GHFL 3G5XB 4IRSC 3S4SB 2MOVA 1CGTA 3U30C 3TT1H 3A0OA 2NY2C 4YHKH 1HI6B 3MFGB 3BDYL 2Z93A 4U1LB 4FXGA 3MRLB 3ABZA 3CFJA 5CUSH 4K3DL 5TGBB 4Q74A 2OS7A 4OGXH 1QSFE 2DD8L 5GRWA 1MCJA 2B20A 5T1KB 4EI5C 4M7KL 4UBDD 2QHLA 5CZXC 3I75B 4Z7WE 4LEOB 2DIAA 1DBKL 1NC2A 1C1EH 2H3NB 4YC2C 3DV4B 1MIMH 3PGFL 4YBHA 5MEOA 2AEWA 1JPGB 4HXAL 1U3HA 4MAYB 2HT3C 3NCYP 1NCDL 5JXAL 1QBMH 3GHBH 3CLFL 5F7EH 1EZVY 2E7BA 2G75A 4HBQA 3UJIH 3PQYA 1CD1A 3L7FA 1AI1H 5LXGH 4YGVB 1BP3B 2A1WL 3RTQC 4A2LA 1FIEA 4E0RA 4ELMA 12E8L 2W9DH 2NY5L 5HDOA 2YPLA 1DVFB 2DQGH 2I5YL 4PJ5E 2VR4A 4GG8A 3UZVB 2HLAA 1K6QL 4JFYB 5EN2A 4X6CF 3UAJD 4UU9A 4DOHE 1YY9D 4GO6B 1OAYH 2Y07H 1EFXB 4YDJA 5F71A 2DDQL 5ESAB 4YDVB 2AQ1A 3MLVL 2PETA 3D5OF 1AHWB 3IETB 4Y2DD 4QTHA 1AC0A 4WU5A 5AWNL 5DJ8A 1INEH 1D9KA 3DXAE 4XCFH 2QADB 4OZHF 5DD1H 3UP1A 1H5BB 4TUOA 2X70B 4N0CC 5I15L 2OMNA 1U95B 2X70A 5H8DA 2GJZB 1UJ3B 3Q6FB 1F13A 5GRZA 4O58L 3TP4A 5CWSB 4Y5VC 3TO4C 2EEDA 1KIQA 1OAXH 4HIJA 2V17H 1KTRL 4XH2B 3L3JB 2VLME 3MLZL 1KPRA 5F3HB 3TJEH 2DLFH 4LARH 1X6NA 4YXLH 4HGWB 2UWEF 1AGEA 5LAXB 4GXUM 2A9NL 3ULVE 2HMID 5ICXB 3QEUA 2VO5A 3BYYA 5JUEH 1J0ZA 3OB0K 4LGRB 1C5CL 1FRGH 3S4SG 4Z7NE 1U8NB 2R29L 1YMME 4JLRA 2X89A 2H2PC 4WY7L 1CIUA 3ZTJG 5GS1A 2Q76A 1TTGA 2H2PD 4EN3D 5D7IF 2IH3A 3S35H 2Q86A 1JPFB 4R2GB 4AM0A 1A4JB 4IBLT 2EDBA 4YHYB 4Z78A 1C5BL 3U46B 2EDXA 1CG9A 3PNWB 5H35B 3QCVH 3RGHA 1D5XB 5J6GA 1E27A 1OW0A 3QUYB 1TPXB 1D5XA 4IRJB 5K9JL 2DYPA 2Q8AL 5TDPB 5E00B 1IQDA 4HEPG 4JFPB 4AY0A 1VKXB 2NYYC 4JFDB 3VXPB 1N5YH 1BHGA 2DLHA 4OIIH 1EBAA 3HZVB 3PP4H 3RUGF 1WCQA 2YEZA 3SY0A 3ARED 2BHUA 1QVOB 5EO0A 5BS0E 4WW2B 4OZFG 1T0MA 4LSPH 2VXSH 3BKMH 2Z31C 4QHLA 2V9QA 4H1LB 1T04B 4XCEB 5E2WH 4MWFA 2YSSB 3O6FD 3OKDB 1E6OL 2VN7A 1KCUL 2VQTA 3C8KB 5HY9A 1NLBH 5DJ2A 3N1MC 3SJVD 3DRTA 3EW3B 5CUSL 35C8H 1CF8L 3T08A 5I8CB 1BBJA 4NQVB 3R0MA 3QRFM 1RK0A 3K1DA 5TFSH 4OAWB 5E2WL 1JZ4A 3TBSB 3ULUE 1AY1H 4OF0A 4LCWB 2XN9A 1DBKH 4UQ3A 2OQJB 1FZOA 1OT1A 4NT6A 1WAAE 4X7EC 5B8CB 2YC1B 4OCSH 3G08A 3UTPE 2XG5A 1CLZH 4QXTA 1DUZB 3AC0A 3SCMB 4NRZB 1YEIH 3BGFC 4ZS6D 4DGYL 1KPUA 4OCLC 5CEXA 3BD3A 1QTYT 2I9TA 3HNTH 4A6YL 1OGAE 3WUZA 3O2WL 3H9ZA 4XTRC 1RV6X 2Y7QB 5ICYB 2OR9H 4KROB 4OF3A 4PRBA 1JZ6A 4E9LA 4ZXBA 1RHHA 5JQ6H 2VXQH 5DMYA 5HYJD 2P8PA 3CXDH 3KWWB 4JRYB 3KJ6H 1CVSC 3H2WA 5CGYD 5J11B 3GI9H 1N64L 4MAYC 4RA0C 2BXZA 3BAEH 4GH7B 5TDOB 2CSPA 5DVLA 3P4MA 4WI4A 1F4XL 4QXUH 2QSCL 3LPWA 3MLUL 1KENL 4ZMAT 5C0CD 3L3IB 4CADA 4KH2A 2BSED 1OPGL 5DK0B 4HIHA 2FX9L 2IWGA 1L0XA 4HPOL 3DYMA 3IDMA 5I15H 4YHIB 2C4XA 4Z6AT 1NANI 2B5IC 1K2DA 4L8BB 4LCWD 3RIFF 3BH9B 3LEVL 1CR9H 3G6AB 3R06B 3WFCH 1SEQL 5CP3A 4NKDB 4HUWB 1P6AB 4RMUA 5DQJB 1FFRA 3S36L 1P84K 2Z31A 1IQWH 3DVGB 4BZ1L 4Z7UB 3AS2A 3JWOL 5F7LB 4TN9A 3ZE1F 5D7LB 2RJMA 2R0LL 4ZYKA 2HKHL 1T7YA 2XICA 4WFGE 2NLJB 3DO3A 1B88A 2FJGA 1FE8L 1J11A 1JPST 2R2HA 3TH3T 2AEPH 1UM4H 1I9EA 43C9A 4ZQKB 2XZQH 4N90D 2APXA 2R2CA 4ONFL 5E2VH 5BO1L 1C7SA 4TTGA 4O5LL 1S9YA 1T7ZA 4PGBA 4P23D 2A2QT 3T04D 2ZSWA 3HE7A 4XPAH 3UO1L 1MCIA 2R1XB 5MI0B 5I1LA 3RWFB 3JV0A 1G7JB 3CC5A 2QV2A 5CSZB 4M7JL 2VLJD 1YY9C 4HIXL 4JQIL 4EDWH 4PJEB 5FGCB 5ALBH 2VZ3A 1WUNT 5K9QG 2Z91A 1BQHB 5KANG 3VXSD 3IKKA 3K7UA 4FQHA 1JN6B 1CFNB 3D0LB 3IDNB 1T20B 4KTDH 3N1GC 4PS4H 3DLQR 4ONGH 5HHVH 3WS6A 5ADOH 4LP5A 2J6EH 3ZDYE 5JXED 1UC6A 3CLEH 1QQDB 1BQUA 4OCRL 2GK0B 2AXGB 3MA7B 4JFDA 4OZIB 5I1AA 1WFOA 3PHOB 3VMOA 3DUSB 1UM6H 4F7PA 3CSGA 4GKOA 3OBAA 3HRPA 3TCXA 2ICCA 1PZUB 5T3XH 2X09A 3UTSA 4BFBD 3EDFA 1F4YL 3SE9H 5IB3B 3CFEA 3CK0H 1ND0A 4RA3A 2BVPB 3QQ4A 1ZEAL 1G9MH 2OP4H 1JGUH 4U0RC 5DK2B 4FMKA 3MGTB 3IDYC 4PJGB 1P4LA 4U1GB 1YMMA 5FOBB 3X13A 2Z4QB 3GSOA 1KIRB 1T2QL 3NTCL 3MRBB 2HG5A 3IAQA 1KB5H 2R2EB 5DF0A 1LK2B 1WQVT 1OT2A 1TIUA 4DN3H 3SDDB 1YEGL 1S7WA 2AK4B 2C1OB 5HI4D 4AIZB 1AC6A 4PG9A 2OL3A 4HAGA 5CBAA 1JCKA 1N3NB 4KRMB 4MJ4A 5AUMA 3O8XB 4LSRL 5DFVD 5EFIB 2CQVA 3WXWL 4XH2A 5F8QC 5AUMB 1NDGA 1D7FA 3TYFA 3QUMA 1A7OH 4NZRH 4ERSH 3U6RB 2DJSA 4XBEH 1S7RB 4J12A 4YAQB 3EIFA 3MGOB 2R8SL 1T3FB 2F53E 1I8MB 2HT3D 2V2XA 3MXVL 4P9HH 1I1AA 3RU8H 3S88L 1GPOL 4QTIL 1WV7T 1G7IB 3EYSL 4QRRA 4JRYE 1IC1A 1I9JL 2WIIB 3C9NB 5E9DD 2K3TA 1WFNA 2IH3B 2BDNH 2E9WA 3MV9D 3C9NA 1R3IH 4PJCA 3B9EA 4OUUA 5KN5A 2Z31D 3RTQD 3BVNB 1I8KB 2ARJQ 2BXYA 1HILB 1NDMB 3PWNB 2DWDB 3S88H 3VG9C 1B6UA 2IGFL 3AB0C 4I3GA 4PJ5A 3WKNA 4IOIA 5C0FA 1RIVH 2XWTB 4PB0H 1FL5B 3QH3B 4NP4L 5IT2L 3LD8B 1W72L 1JF1A 5CILL 2HT2C 2IC2A 3H9SB 1JJUA 5FIEA 4DN4L 1U8PA 4L8DB 4LSVH 5LGKA 1JF1B 2F54A 3EYUH 5CEZH 4PJAE 1GGIL 1MJJA 4PY8I 3RY4A 4OLXH 3PWJB 3B6SB 4JDVA 4HUKB 5GJSL 4I0PA 4PY7B 4BUGA 4LAQL 3LQAC 4WWKD 4YIQB 4EN3C 1EPFA 3KJ4B 4HQQH 1IAIL 2FGWL 3U1SL 4OTXH 3VGEA 1BWWA 1WT5A 3SGJC 2C7UA 3AXLA 2BVQA 1G6RB 1S9WB 4NO0B 2YD1A 1A1OB 4KHXH 1XCQA 5IMLA 2ICES 3QEGL 1A4KA 3VG9B 1IAOA 1A1OA 3D85D 4Y5XC 5DMGD 3TBSA 3VFWA 4QEGA 2VITA 2AGJH 5DSCA 4HQQL 4X6CA 1RK0B 1P1ZA 2NZ9C 3P4NA 1IEAB 3PJSA 4PPTA 2R4SH 3HE7B 4KXZH 4WFGD 3NCJH 3GSVA 1J0JA 2JB6B 5T5FL 4AZ8A 5GSVB 3KPLA 4KPHL 5HD8D 4AL8H 3MRDA 4G7YL 2ATPB 4UT7L 4W70A 5BJTA 3IJSA 4ISVB 1MAML 3MX0A 4P9MH 1RHHB 1UWXK 3UYOD 4Z8FL 1Q9OB 2ZZUT 4GKSB 3GBLA 1QLEL 4O9HL 5IVXE 3BE1L 1E6JL 1INDL 1Q72H 5F89B 5C09A 4CW1A 4Z7WF 4RIRB 5E5MB 2EZ0C 3NFPB 1RIUL 5DJDB 3F7PC 5HYEA 4N1CA 2VWEC 4PJAB 5CJOL 4O51A 3B9VA 4MA7L 4DUVA 4NYLA 5GRXG 3L5JA 4JHAL 4WV1B 1IAKA 1ZT1B 2NW3B 3JV6A 4KK8C 4QRPA 3QWQB 4L8BA 2EIZB 4QHMA 4Y5VB 4EUPB 2IH1B 5FK9A 5DJ0B 3FFCB 3QJHB 4HWBA 1DLHA 2VXVL 5IBTH 1C1EL 3N9GL 2BVYA 3KPNA 2IEPA 1DL7L 4R7NB 4XMPL 4JHWL 3FB7B 1AD0B 4CMMA 1ITCA 4H5SA 4YDVA 1T83C 2PCPB 1KPVB 3L3GA 3QUXD 1IL1A 4O2FB 2BJML 3OJMB 4O2FA 4GKZB 3BZEA 3NZHL 3KPQB 3B2UD 1SQ2N 1EGJA 3RWHA 4PJXA 4GMSL 3EYQD 4JPIA 5DUBA 3QAZC 4QF1B 5I18H 1KCKA 3IXTA 2PO6B 5C6PB 2ZG2A 4JM4L 3LKOB 1ZTXL 5F9OH 3UX9B 5FA4A 1CICD 1A2YB 2VAJA 3VMNA 3KS0J 4Z95L 5DUMH 1CICC 1MRDL 3NABH 4PJIF 2DBLL 2XXMB 3PP3K 1MI5D 2KL6A 4D0BB 4P48A 3S97C 4XAWL 3G6JA 4LRIC 3VH8G 3D3VB 4ZUTA 2OX5A 3PDGA 5LXGL 3V5KB 1ZLVK 1NBZB 3HC4H 3IFLL 3RY6C 2E7CA 4H88H 3QDME 5I17B 3ARFB 2X9YA 1KG0B 3GIZL 3QJFB 5ETUA 3ZYJA 2Q76B 4JANA 1FBIL 4M5ZL 1NGQL 4K3JH 4LCUA 4XVUC 1A02N 2DBJA 3CFBA 1XF5B 4WDIB 3MBEB 1JUFB 4P4KC 5F70A 5M95B 2XNAA 5J12B 1CU4L 3MA9L 4XNXH 4UV4H 1ORSA 1ZGLM 1GGUA 4HKBB 1R5IA 1RJLA 4PV9B 1I9RL 2E9BA 3BPLC 4XCFL 4N0FB 2E8ZA 3O9WA 1XAUA 2HTKD 1R3LB 1SJHB 3QFJD 2B4CH 5CJ8A 3G5VB 4JO2H 3QUZD 2VDMH 2QQQA 5E8EA 3KDMA 4K7PX 2X4OA 4GSDH 4HUVB 4I1NB 1S78D 1UQSA 3ZDXE 5D2NB 5GGSA 4BSVB 3MJ7B 5C6TL 3BRDA 1MCNA 3LN9A 3UTPD 3QQ3B 4HPOH 5GZOC 5FDWB 4MZ3A 3FHAA 3WUWA 2HKFL 3C8KA 3RZWA 4KI5D 2MNUA 4KZEH 3U0TB 3ARFD 4I48B 3WFBL 5JUEL 3TC9A 3IJYA 5TJWK 3GMRB 3U0TA 4HK3N 3L3DB 1H15A 5HHNA 1HZHH 3GMPA 3GMRA 5B38G 4MSWA 3SN6N 1QBLH 1RFDH 4NSKA 4QT5A 1T1YA 3ZKMC 2ADJB 2OL3B 3IDUA 4WUUD 1IEBA 3WFBH 3L3JA 1E4KC 4UQ3B 4MD4A 2F19L 4LRIA 4WEUD 1T1XA 1OCWL 4U6XA 1NUFA 4LLUB 1HEZB 5D1XD 3KXFD 3RY6A 2EDQA 1I8IA 4BA8A 4YWGL 1J18A 1I9IH 4Y4HB 2HT2D 5E8OA 5MERB 1YC7A 2GJ6A 4QHKI 1G7IA 5BOPA 3BEWA 3VI4E 1CGXA 3C5ZD 4LBEA 4N0UB 3IKCB 3V5HA 4JLRB 2UZIH 2BNQA 4HMEA 4P2OB 4ZFZA 2AQ3A 4RQQB 1P4BL 4JRYA 4L3CB 5E24E 1UEMA 3LEVH 1L0YA 2A6IA 1FCCA 3QYCA 5EZLA 4PP1D 5CIPA 4OCNC 4YWGH 2VZOA 4LCIH 3S35X 3P0YL 1J86A 4DGYH 4KK5D 4KVCL 3DHMA 3FL7A 3O3AA 2N7BA 3ARBC 3RP1A 2Z8SA 3IF1A 4J3SA 35C8L 1FNHA 3FMGH 3QIBB 3PP3H 3NCEB 1FL5A 3D48R 4HHAB 3VFRA 1F6LL 4KV5E 2JE8A 1F00I 4WCYH 3Q5OA 3W9EB 1QG3A 4PJAF 1DE4B 3ZYOA 2BY3A 1FYHB 3BH9A 3P3YA 2NXZB 1IGTA 4OZFB 2X4QA 1E4XL 2AKRB 4YXKL 3MRJB 1P7HL 2Z35A 4NRYA 1EAJA 4W4NA 4ZFGH 2Z35B 1RUPH 3BGMA 4XBPA 1LK3L 4AH2A 3NIDF 3NVQA 2FDBP 3KPQA 4LFHG 5J6HB 4MXWL 1K3ZA 4GW1A 1VA9A 2W1NA 5IB4B 1OGAB 4RFOL 3O0RL 1T21A 4YXKH 2VJXA 3BPOB 3HG1A 3B5GA 1RZKH 3F5WA 1KYOJ 3KNBA 5SWZA 3VFSA 3QNYA 3LN4B 4IRJC 3KPSB 1KN2H 1S7QA 4LAJH 1E4KA 3HAEG 5JPNA 1HNGA 1EDQA 3ARDD 4XHQA 4KDTC 3LQMA 1RUQH 2XXCB 3CDYA 4XWOD 4QNPE 4ZO9A 1NAMH 5KSAD 1HCVA 2AXFA 5ADPH 2P5WA 3JWDH 4HWZA 1DVFC 4WHCA 5TE4L 4L1HA 1OAKH 4OLWL 1DANT 3NAAL 3QXDA 1INQA 3I3EA 1BLNB 4J3TA 1U93B 1VEOA 4C55A 4PJ5D 4ODXB 3T8XA 2VSCA 1WEJH 2CIIB 4DUWA 1HHGB 1A6AB 4HEME 1MCWM 1QPPA 1V5JA 4OLUH 1J0YA 2DRUA 1UYWL 4KQ4L 1ZGLA 2DQHH 1OAKL 3FQXA 3DWTA 5I8KL 3ARBA 3HNSL 5GHWL 1GZPB 4HAFA 1F42A 1XF4A 1VFBB 3TA3A 3X14A 4CVUA 3RNQA 4D9QE 2DJUA 2HLAB 4JFYA 1OP3H 2ICWB 4BK5A 4DZBB 2O5YH 5BW7A 3MLXH 3RFZC 1N2RB 3PHOA 1QO3B 3O45B 1CDCA 4BH7B 1O0VA 1AE6L 2Z9TA 4M6MH 5FYJE 5IHLB 5JHDB 3M1BA 2WWKT 1TZHB 1R3HB 3ZT7A 4JG1L 1Z0NA 4ESKA 3FO1B 4D9LH 4YC2B 1IJ9A 2Z92A 4HC1H 1YEJL 1AXTL 1YEGH 3MMEB 3SHSA 5BZDA 4OFDA 5I1DA 2WLYA 3SDCA 2FATH 4K94L 1WWAX 4BKLA 2VDLL 1MPAH 1RVFL 1B2WL 4PJ8B 4WW1B 2QQKL 5DC9B 3LKNB 3H8NA 3FQRA 4EIGB 3MV9B 3DX7A 4F33B 2XPGB 5ID0B 3C5ZA 4NCC2 1Q9WA 3ZT5A 2WV3A 4J4PD 5FO9B 3WN5A 2F15A 1Q9WB 4FQCL 4QTIH 1S9XB 2J1KA 3P9LA 1L7TL 1MHPH 2PKDA 1MRCL 3SDAC 1YJDH 1CIDA 5I1JH 5MHSE 3SPVB 1U2HA 1DQTA 3JUZA 1NDGB 3TYFB 1AKJD 2CRYA 2HJLB 1KBGH 2EXWC 3ARPA 2IMNA 1JNNH 4JAMA 1AGEB 5LAXA 2NY1B 4YQXL 3DO7B 1JNHB 3GM8A 1X9QA 3OF6A 1BZ7B 4HJGB 2E6QA 2EO9A 5E2UH 4YHLH 5IUSA 1NUDA 1YDPB 4KTEL 5JNYB 4LSTH 1I4FA 4MJ5B 4ZO7A 3OKMB 3VXRB 4XP1L 2FR4B 5HXMA 5TE7L 2LU7A 1FSKC 2OL3H 4OUUB 5KN5B 4LLMA 1KOAA 4LDLB 4WFFE 3EYUL 1JHKL 1A7RL 1FV1A 5KANI 4PGDA 2Y4SA 1QFUL 2AABH 3TA3C 1QHPA 4APQA 1GIGL 4ETQB 1HHJB 3MV01 4YHPB 3ROOA 2AJVH 3WIFB 1S5IH 4APQB 5I0DA 2Y5TB 3RUGB 3BPOC 3FRUA 5EOCL 3DMMB 1BIHA 4I18A 5D7LD 3T2OA 2DQJL 1KF9B 4WI6A 5MHSD 3I02B 2FX8L 2ZUQC 1T89C 2XWBA 3DV6B 9CGTA 2YA2A 4XXCA 4DQOL 3OZ9L 4LLDA 4DCQA 5SWZE 4YEFA 2AJVL 1QSFD 3MJ9H 4NZTL 5C08E 1T66D 5IQ7H 4MZ2A 1MFCL 4H1LA 3MRCB 4CN1A 4P23C 3PE9A 2P8LB 1JWMB 1XGTB 1NFDB 1J5OH 1YNTB 1N26A 4YHOH 4JHWH 4M7ZB 3F5WB 5SWZB 2BOCA 5A2LH 4HF5L 3RVUD 1T2XA 1I9JH 3MROA 2VLKD 3UAJC 1KCVH 4OZFH 4MD0B 1S7TA 4H20H 1OP3K 1XIWA 4N9GB 3WIHA 3BP6B 1J5OL 4NRZA 3LV3B 2VAAA 4FNLH 5B3JF 3QCUH 2X4SB 4KK6C 2BCKB 1CLCA 3VWJA 1VENA 2P44B 1KT2B 4GAGH 4JFEE 4JKLA 5ESVA 1AGDB 3MGOA 1T0PB 2DQIH 4L5FH 3FB8B 5DR5L 1NGYA 4Q9RH 1GGBH 1BEYH 3FO0H 3TJHD 2ORBL 2YBRA 2GJ6E 4YUEL 3TV3L 1DANU 3NIGF 4Y1AE 1D5BB 2WSKA 1KLUA 4YXLL 4YGAB 1I7UB 4TSAH 3SCMC 3PWNA 3BW9A 3OG6B 5IR1B 1I8LA 3IU3B 4RMQA 3PWPA 4I18C 1U8IA 3NCMA 4EUPA 3SKUD 3MRGA 4MQXC 1T89A 4WY7H 2GY5A 4ZNEE 2FHFA 1DLHB 4NO3A 4QRPB 4Y2DC 3S34H 1HHHB 4NKDA 4L9DA 4YHIA 4XXCC 5JIKA 3IGAA 3RVWC 3CXHK 1NMAH 4UQ2B 2R15A 1P6FA 3MRQB 5HSFA 4NWUH 1HHIA 4XCCH 4ZS6C 3KXFA 4Y89A 4GOSA 3QXUA 1QA9A 3RDTD 5F3BA 3V6OA 4YX2H 1Q0XH 1KFAL 5F7KC 5JW3H 3C5SB 1CFSB 4G8GD 2XTJD 4TUJA 2BNUB 5DD0H 3FFCD 3E3QE 2CXKA 1KEGL 1HKLH 4GT7A 2OTWB 4JFEB 1NMAL 5JA9A 5IBLC 5FB8A 3T3PF 3KPSA 3L5WB 2CO6B 5GXBB 5GRUL 3ES6B 1MREL 1D6VL 3EFDL 3CPLA 2EYRB 3BHBA 1VFMA 5KAQF 4TVSa 3W82A 4NC0B 3A6BH 1TMCB 3SJVB 1JNJA 4S1DD 1KTDB 2WBJC 3ILPA 3LEYL 4NQCE 1F4WH 3VWJC 2PTVA 3V5KA 4H8WL 5HDQL 3RQ3A 3TNMA 5EO1A 4PLKC 3RWFA 2CRMA 1MREH 3EFDH 1RJYA 4Z76A 4S10A 5CSZA 3VFMA 2QQLL 3C09B 4J3XA 1QFHA 1INQB 4G6ML 3GK8L 3UJTL 3BP5B 3WIHL 2A6DB 5J9PB 2EECA 3ZHKA 1NC2B 2ZOKA 3QHZL 5LCVL 3TZVB 2DMBA 4CDGC 4KXZI 1JPFA 5KSBE 3CDGA 3PDOA 3EYFA 4Z78B 3O4LB 2IBBA 1H3WM 1EFXD 5KTEL 3X11B 5KW9H 1ORSB 5GGUB 1JGDB 1SJHA 2CGRL 1R5IB 1IGYA 3K4DA 1PJ9A 4NFCA 4I3RH 2IAMB 3B83A 4R97B 3VA6A 5I1CH 1AXIB 1JIBA 4MA3A 4OV6F 1WITA 4ORGA 3A67L 1BQLL 1MF2H 4KVCH 4YFLF 5D2NA 5GGSB 4BSVA 1ZV5A 2PYEE 2XQYK 2XRAL 3QQ3A 2HMIC 2EDDA 1FC1A 1OAQL 4FTVB 1P4LB 2AAVA 2B2XL 3P73A 4NJAL 3QFJB 3GMLA 5CGYC 3SKJL 3JWNC 3OXSB 4P2YA 1W72A 3G5YB 4FFVD 4Y5YC 2Q7NA 3ZSTA 3LKSB 4NNPL 2LFGA 1IMHC 3A67H 4BZ2H 3VFPB 1JMZA 5T3ZE 3Q6FA 3TFKC 4YE4L 3LRGA 5FV2A 3UTTB 4G9DB 4ODUB 4I13B 5C0AD 2JF1A 2OR9L 4MD0A 5SX4I 1IC5L 4NQED 5TPWL 1I9IL 1RZJC 1A7PL 1FNSL 1OQOA 1T5WA 5LVEA 1KEMH 4GG6E 5EPMA 4MA8L 5ACLA 1NEZA 3BO8B 4UT9L 3L5XL 3VXOA 4ZAKD 2X4PB 2W65B 4YDKL 4L4VE 3LRSA 1EHXA 1A22B 3GNMH 4JAMB 4PJIE 3DBXB 3KPMA 1JFQH 3WYRA 4AG4L 5F1NB 1RUKL 4UTBL 2UYLB 5K9KB 3KAAA 4JQXC 3DGGB 4OGYH 5EUOB 5DYOA 3QUML 1FO0A 1GVIA 1G7MB 2JK5A 4P4KD 5E2VL 3AS0A 1FFNA 2MHAB 5ID1A 3UBXB 1IRAY 5HHXL 2BY0A 4AM0B 4C56A 1I7RB 4DTGH 3BJ91 1WWBX 2ZPKL 3UROR 5JLZA 3TGXA 1YYLL 1A64A 1UACH 4PGZA 4ODWB 3OB0H 3RZCC 3JXAA 1C5DA 3MRNA 4BQ8A 5F93C 4I3SL 3MJGX 1NGZB 3GHEL 3OTTA 2P5EB 3O9WB 5HHMD 2IQAA 2V2TA 4Y5XB 1SYSA 4X6DB 5D1QD 4M6NH 3KPSD 4WHYH 3OQ3B 1A9BB 4MNGB 5D2NC 3C2SA 4NZUH 4D0CB 2IQ9H 1C5BH 2OR8A 4MXWH 5GJTH 5T1DH 4ZODA 2ADGA 4X6CE 2DLIA 2YEZB 3SY0B 3RWCA 1Z9OA 5FYKL 4GS7C 3PDDA 2YD7A 4W4OC 3MLXL 4ZS7H 4LLDB 3S96B 1UG9A 3FB6B 1H8OA 1N4XL 3HUJF 3JV5A 3MNZB 4X6FA 2DQTH 3I50H 3FO2B 4HC1L 3W0WD 3SE3C 5EBLB 1L7IH 4Y19B 4XI5C 3GBMH 4P2CG 1OTSD 2PR4L 3BGAA 1Q9LA 5GSRA 4U7SA 2APWA 4U49A 2PUQT 4JEGB 2C9AA 3BN9C 3EDEA 1JGUL 4KJYB 3HC4L 4EDXA 2A9MH 1MCWW 5HGHB 2DQTL 1ZA6B 4U1LA 1G7JA 5DLML 3OKEA 4X9FA 3UJJL 3IJHA 1UB5A 4XAKE 3E2HB 1J88A 1D6EB 1UZ6E 4DZ8A 1X3DA 4FQQA 5I1KH 5BMFH 5I1GH 4Y19E 2MFNA 4WWKA 2O61B 2FWOB 3CLEL 2F53D 4GAFB 5EORL 1I85A 3ARDB 4RFNB 5I1CL 3FZUD 5INDB 4M48H 2H32A 4ODVH 4R2GC 3EZJB 5E4IA 1JGVL 3D18B 1OP5H 1N59A 2YKLL 2I5YH 1B0GB 3U0WL 3RU8L 3JTTB 3VJ6A 1NEUA 4XPAL 3UO1H 1OAQH 3RZCA 3MUHL 1SMOA 4JCLA 2AV7A 1EK3A 3HI1B 2YD5A 1GZPA 1ONQB 4PJHB 1J1PH 1WF5A 2F53A 3MRIA 5FEBA 1DQLH 1ZGLB 4KQ3H 3CFKB 4YFLI 2HN7B 3VMPA 1CD0A 1B0RA 3MLYH 5B3JE 2HVKA 3CH8A 3WNNA 3U9PH 1K4DB 2BVTA 3TESA 4PJFA 2J4WL 3G04A 1DBBH 4XVSH 3B43A 3MO1B 2Y9RT 1LO5A 4DN3L 4K94C 5DUPL 4TULH 2H6PA 4W4OA 3P0VH 4NUGL 5ESAA 1F2QA 5A2FA 2AKRA 4ZFOA 3THML 2V2WB 4FQIL 1B9ZA 4LLQA 2IBGA 4H5SB 1MEXH 4U31A 1X5IA 5F6IB 3SDCB 4ZUUB 5JHDD 1QYGH 3I6KA 4JFZH 5JOEA 1IBGL 3GMNB 1HNFA 5DJAB 2NY6C 4PP1C 5IKCB 4OLWH 1EH9A 1QSEB 3JWOH 4X6EB 4OLXL 4L3AA 1U58B 4PJ9D 3OKKB 4C83B 1MIML 3PGFH 4NZDA 2AI0L 1N8ZB 2OJZH 1I1FB 1A3RH 2E9IA 5FA4B 3H9HA 4OLUL 1X5JA 3QWRA 4RX4D 4Z7QE 4CUCA 4DUXA 4KROC 2ZOLA 1LNUA 4ODHH 1J1XL 2VERN 2HJFB 4PJDF 5F7DB 1GRWA 1TLKA 5GGRB 5DRZA 3CFJB 5DEZA 1Q38A 1TNNA 5F1IB 3GI8H 2C3VA 1TJGH 5IVXB 3CD4A 3S9DB 3MOAH 1QSFB 5CS7A 2FIKA 3VXUA 1X5HA 2G60L 5B4MC 1OTSC 4YHKL 2GQHA 4OV5A 2K7QA 3REVA 5I1HL 1RQ5A 4ERSL 3OX8A 4P23B 3VG0L 1DDHA 4JHZA 4GAYA 1ZSDA 3HMXH 4K3DH 2FB4L 1B2WH 2IAMA 1MAJA 4X6DA 4L4TB 4O2CA 4NWTH 4K2UH 5EUKB 5C9KA 4HX1A 1MUJB 5CJQL 3MR9A 5I0ZA 3TPUA 3WFDL 1EHLL 5IHUH 1CGUA 1CXHA 3ARVA 4MB4A 4QGTA 1NMBL 2IBZY 1K4CA 3QUXA 2VDOL 2JIXD 5A43C 1T1ZA 1Z2KA 1GZQA 2BDNL 3MJ7A 3NPSB 2B39A 5HBBA 1NFIA 1OAUH 3OMZA 1EJ6A 4G8EB 5EBMB 2AXHA 5ISZD 1Y6MR 1T80A 1U36A 2RCSH 3WNLA 1AY1L 4DVBA 5KSBA 1JHLH 1M05B 1I3RA 1WBZA 5C0NC 3N9GH 5MENE 2NZ9D 1ETZB 3U4BL 3V5DA 4WI2A 5E94A 1E4WL 4MDJB 2DKMA 5EU5A 3QIWA 5I9QB 3QI9B 5KSAB 1ZEAH 1MH5A 5EB9A 3QI9A 3SDDA 4AIZA 2VDQL 4OM0L 3GRWH 4OLVH 1T2QH 5DR5H 2ED9A 1JK8A 4NSKB 3KPLB 1FORH 4XNQB 1S9XA 2BCKA 2L0DA 3RWGB 1FVCA 2AXJA 1XGRA 2XKUA 5D1ZD 2AVGA 4XPHL 1J1PL 2JCCB 3BUYA 3E0GA 2R23A 1KPUB 5K33A 3RNKA 4EUPH 5K9JH 2H2SD 4JZOB 1X5XA 4J2XA 4BQCA 2WIIA 3ARFC 3U36A 1IILE 1K8IB 4XC3L 1F58L 3SE8L 4TNVK 4X4MA 3VGHA 2XFXA 1RUAL 3TT3H 4QRRB 3M17B 2W07A 3VD3A 3VJ6B 2J8OA 5D2LF 2FR4A 3IFLH 3HUJE 3S34L 3FFDB 5DEGB 4XP4L 5HHOD 5BRZB 1A7NL 3NA9H 1MI5A 2OBGA 3VRJB 4DKAA 1PG7L 3L3KB 1I7UA 1U3ZA 2HWZL 4PD4K 1RUAH 3TT3L 5JW4Q 3QIBA 1JF5A 4J6RL 3V0WH 2YPVH 1MCKA 4P4RA 5CZVH 5D5MA 4O2EB 1AP2B 5T3ZH 3WV0A 1IKNA 1M7IA 4R7NA 4Z7UA 1VGKB 1ZAGA 3G6AA 5EC1A 4M00A 2K1MA 4RGMB 4JHBA 1SYVB 1I9RH 1QLRB 4RDQG 3X17A 1FVDA 2EYTB 4XX1G 3QUZB 5GQBA 1WCBA 2VLLB 3HPJB 4KRPC 2P5WD 3P0GB 4XBPB 2A83A 4K8RC 4MCYB 1UVQA 4XP6L 5CEZL 1NMCB 2B2XH 1QSEA 5D71H 3WFHB 5GGQH 2CUMA 1KJMB 2GSIA 3FO2A 4X6EA 1ZHBB 4LEXL 3D39E 4QRTB 4H1LH 3RDTB 5KAQG 2Q8BH 3BMWA 4P46D 5BS0A 3KYAA 4JN1L 1HOCB 4MAUL 5BRZD 3TNNA 2WUBH 3QQNA 4UINH 3SJVA 4KHTH 3UBXI 2JJSC 4L4TE 3SKOA 1ORQB 4XMLL 4IOSD 4WWKB 2O61A 2R1WB 4R8WH 1LDSA 2EIBA 3C6SA 2ZCKH 5TPWH 5C07A 3V6FB 1BGXL 1AJ7L 2GAZA 3ARFA 3D39A 5E56A 5C07B 4LCUB 2WP3O 4FFYH 3HMWH 2P49B 1NLDL 4NJ9L 2XY2A 2ZUVA 1U8QA 4GRLC 3FQWB 3HE6A 3WFCL 2I26N 3W9DB 1KIPB 5CMAA 1GOHA 4AMKH 1XGPB 2BVOB 2QSVA 4R8WL 1H5BC 1RSFA 5I1EH 2ZNWA 1HE7A 1MRDH 2M1KA 3NABL 4KKLC 1CL7L 1MWAL 1U3HB 2DQEL 1MIEH 3MV8A 1EERB 1IAKB 4F9LA 3BGFB 4U1IB 3TO4B 1A6UL 2QEJA 5I16A 3QUXB 1REIA 5ESQB 4LVOB 1BFTA 3T3MF 5LG1A 1GZQB 2ZSVA 4OI9A 5IROA 5GRUH 4OI8A 5BQ7A 3TIDB 3UTZB 4CGTA 1P4BH 5ACZA 3RL1A 4UTAL 3MUGA 2P7TB 4I4WB 4YDJB 3ZT6A 4HBCH 3UTZA 4HKZB 3ZL4L 4EN3B 5FUOH 2NY5H 3HI5L 1LE5A 3HUJA 1KENH 1PEZA 1JTOA 4R0LC 1G7QA 4XNZB 1ED3A 1U8LA 1IL1B 5T1LA 5KVDH 1YEIL 1E4XH 3LCYA 3CX5K 1ERNA 3WL9B 1P69B 5FYKH 4Y4FA 2DYPD 4JO2L 1QNZL 5D6DA 1RZFL 1S7WB 2AK4A 3VFPA 3ZHDA 3IRZA 1DP0A 5JXEA 5J0BA 4FRWA 4D3CL 1HH9B 5IQ9B 1T0NA 5MEND 4MAYD 1KXTB 1A2YA 3P9LB 2FX7H 3WLBB 4OM1L 5HJ3A 3AAZB 4OGYL 4NFBA 4K7PL 3OKNA 4JE4B 4Z7QF 2ZSWB 2A73B 5CEYA 3E3QC 2VXQL 5HHMB 4XC1L 5IV2A 2E3VA 5F1NA 5L9DL 4Z5RA 3PQYE 5C3TA 3LRSB 2ZUXA 4HGWA 5DEFA 3VFTB 5EZOH 1FVEB 3GB7B 4YUEH 3TV3H 4XB8A 2B1HL 3FAWA 1FVEA 1UM4L 4MJ5A 3VE0A 4MQXD 1BJ1J 4NC1C 5D1ZA 5D9SA 4JFFE 2XZAH 2GT9A 3DETC 2XV6B 2GEEA 2ZWLT 5I8OL 2AJZB 3PHSA 1L9NA 3SDXB 3ARXA 4JY6B 2A6IB 1WFUA 4BH8A 4FTVE 1QSFA 1FZMB 2BERA 3OF6D 3EOBB 3EO1B 2C1PA 2QLVB 4KVNL 3OAYH 3QUYA 1S9KC 5ISZE 4NNPH 2DYPB 3TJHC 3ELAT 2FL5B 3BP7B 4PJ5B 5C3LD 3KDMB 3W5NA 4HUVA 3UYPA 3QCTH 5LWYL 5KOVC 3VD4A 4U1HA 3NFSL 3ESVF 3VRIB 3QCVL 3V0AC 1FYTA 1FNSH 3NH7L 3H0TA 1NUNB 2R9HD 2P5ED 2Q8AH 3P40A 2NY0B 1A0QH 4IEFB 4OFIA 4XXDA 4U1JB 4PTUA 2WW8A 4F37F 2I07A 2V5MA 3QAZB 4IJ3B 5EC2B 1TVBA 5DJCA 5GS3A 2NX5A 1MH5B 2DQDL 4F7EB 3DROA 3W2DL 5B38B 3MUZ1 1F4YH 5EU5B 5F7YC 3SE9L 5BS0B 4HS8L 5E2TL 1P2CB 4JO3L 4NQXA 1V3JA 3KPOB 1NC2D 3SBWC 5GIRA 1WTLA 4U6XB 1MCRA 1T2JA 1SHMA 2MKLC 5F7FA 5E9DE 5HGHA 2DQDH 3AMLA 5CINL 2R56H 4YK4C 1RAMA 5E99H 5LGJB 4WO4B 3UTQB 4HS3A 3F7VB 1MRCH 4HS3B 2QTEA 4X98A 3W9DA 1TZIB 1BFOA 3H7BA 4LVEA 4EQ2A 4NNXA 1QUNA 1LEIB 4R3SB 5L2KB 2V9TA 3ZE0F 3QEHA 1FGVL 1TQBB 2P8MB 1SVZA 1EUTA 5BV7H 5JW4R 2P47B 7CGTA 1NC4B 1G9ML 2OP4L 4G5ZL 1KCRL 4LCYB 4E0RB 4NQUA 1MFEL 4U1SB 5DTFA 3IF1B 1NC4A 1J1OH 3CK0L 5ICZB 4JFXB 1WTGT 3I50L 4I5BB 3QEGH 1ZT4B 3LIZL 4ZUSA 4LDEB 1EVUA 5DJ0A 5JHDA 1ZT1A 3JV6B 5FHAL 2XY1A 5EBGA 3HMXL 1X44A 2XZCL 1ZLUH 4QXUL 3UCRA 1TETL 2YWZA 4LLVB 1BVLB 2X4UA 5GS0H 4S0SD 5DQJA 1A7RH 5EU3B 1KNOB 1RK1B 1CGYA 4YIQA 2CRIA 5F9OL 2BNQE 1D5ZB 1CN4A 1MHHA 4G6AD 5DURB 3VFNA 4J4PC 4IRZH 1RPQA 2R9HC 2X10A 3MV9A 4F33A 1RZ8B 4Y4KB 3RI5K 2WANA 4E41D 4EOWL 1PY9A 1UXWA 2ZG3A 1U58A 4MGXA 4PY8J 4ZQKA 1SJEB 4TSCL 1UA6L 2UUDK 3JVGC 4G43B 5J13B 5F3HA 2JELL 4LP4A 4IDJL 2GYSA 4HUXA 5ITBL 4ALAH 1BJMA 4HJ0D 5DI8B 3SGEH 3VD5A 4S1RL 3MRRB 5ILTL 3MC0A 3WDJA 3I6LD 3CJJA 4FQLH 1WIOA 3H42L 1QFUH 3LQAH 3BT2L 4Z7NF 3PG2A 5LQBH 1D6EA 2JJWA 4UB0L 4DGVH 1FNAA 1ZVSA 4FOMA 2LU4A 4OD1H 4IRSD 5HGGS 2QKIB 2C26A 4XPHH 4H0HB 5KBNC 3GKWH 1CK0H 3VFVA 4NUGH 1LE9B 1CG9B 1FJ1B 2XOTA 3NH7H 1T4KA 4RAUA 3VWKB 4OF6A 4KUZL 1P7QA 1DEEA 3I2CH 3RHWK 2EDLA 4PD4J 5A2KH 5E0QA 1QQDA 4NKIH 4X7FC 2GI7A 3KLHD 4YZFE 2HYMA 3C6LC 1J0KA 1BX2A 5ACZB 4QHMB 2ESVD 1QO3A 4LPTA 3A6CL 1XH3B 1FN4B 1YNLH 4H25B 3SE4A 2Z4QA 3GSOB 1MJ7L 1ADQL 4NC1E 2NYYD 1M05A 2DQFB 2HG5B 3ARDC 4RFNC 5C0BB 4NHUA 4C56E 2D7TL 3L7EB 4MJ2A 5DJ8B 5FOBA 3FT3B 1UH4A 4NGHH 5FM8A 5C0RH 4NN5C 2DQUH 2DL9A 2CLRA 2XPGA 5LBSL 4UNVA 3T3PE 3AREA 4GRWF 5E1HB 1EHLH 1T0NB 2CLRB 2DQIL 2PXYC 1PW3A 4OD3L 4MVBC 3MREA 4KMQA 2DB8A 3WO3B 3UPCA 3AAZA 2FATL 1S3KH 1XGYL 5HVWA 3MOAL 1IEBB 1UT9A 3KYNA 4BFIA 2Y5EA 3OAYK 1MAMH 4YX2L 2X41A 3QR2A 5C71A 3ARGB 4YAQA 1JK8B 5JR1L 2VL5B 4CMHC 4GG6A 5KG9B 5LKNA 3LEXB 4HKJB 4PG2A 1E6JH 4MD4B 2DMCA 3NZHH 3SDYH 2C4FU 5B39A 3VE0B 1BVZA 4WHDA 1R5VB 4ORZC 5CJQH 4CJ1A 3PHQB 1R6VA 4HF5H 3GB7A 4IMLA 3ZTJH 4I8DA 4LSQH 3DXAB 3OKOA 3RIAF 2VLKA 1A7QL 2VZVA 3BEWB 1ZMYA 3STLA 5BRZA 3QDJE 1TQBC 4MS8D 3ULSB 4ODWA 2J2ZA 3O3DA 3MGAA 1KCSH 3CDFA 3BH8A 3OR7A 4L3CA 4NJ9H 5IW3A 3M8OL 1GPOH 4LLMB 4NN7B 1FDLL 4DW2L 3I3DA 3GFUA 4G7VL 2RFXA 3Q48A 1RJZA 1OWRM 3BKYH 5E00A 1KLFA 5DK0A 3PNWA 4KUCF 5GS2D 1E27B 1EO7A 4DFIA 2FL5A 4TVPE 1R3LA 2UV3A 1HKLL 5L8JB 2V5SA 3C6LA 4OBSA 4JO4H 4UBDC 2CKNA 2DICA 5AWNH 1I7ZA 3T77A 1MJJB 3O6LH 5F21B 3HFML 2X4TB 3QIUA 1GXEA 2CDGA 5A3IC 1W0WA 5FO7B 2VZUA 5D7JA 5JDSB 1BJ8A 4POYA 1JV5B 1PDKA 1XF1A 4M8QA 4RISL 1BZ9A 4L3EA 1DBML 4QHLB 4M8QB 2OTWA 1IC7H 1BD2B 4XGZA 4EVNB 4XXDB 4Y4KA 3WLWD 3MRCA 4H8WH 3DGCR 4HS6A 3BZDA 5HVHB 4C54A 1CFVL 1QBBA 3TN0B 5J56B 1RZJL 1KTLA 2EH8H 5E5UB 2ICEB 2DTML 4LHUD 1HOCA 2E8YA 1IGCH 4ZSOE 3IFPA 5IFAH 1FZOB 3GSVB 3MRMB 3TCLA 1NH6A 3DRQB 1G9MC 1P1ZB 3BAEL 1XF3B 4G42A 4RDQF 2GUOA 4GBXB 4IHOB 4UT6L 4PJHF 1T03L 4P2QD 1K8DB 5GIRB 5HGAA 4XP9H 1LP9A 3GSWA 4FQXD 2XN9D 1MCCA 3S3SA 1CFBA 1OY3B 1UEYA 1TZGL 1II4E 3QA3B 5L6YH 3T65A 3K80A 5CJXC 3GBNH 3P9WB 4WTXA 4FNLL 5FF6B 5KVGH 4D2NA 5TF1L 4UI2A 1D9KC 3HZKB 3UXFA 2QADD 2XTJE 5ELIA 4PRHE 1AE6H 4ODSL 1UKSA 2OJEB 1DN0A 5K9QI 5HHME 2HVKB 1MI5B 5CSBA 3D85B 1EAPB 1K4DA 1WIUA 3LOWA 3OSKA 1PKQE 4U1IA 4Y5VA 3TO4A 3MCKB 4JVUA 4ZNEA 5CCKH 4E42B 3FFCA 3QJHA 2HLFC 4LOUC 1OL0A 2EDOA 1HCFX 3IDMB 2D7MA 1CBVH 3EYOB 5HHOA 1R3JA 4JFED 3GMLB 3N1FC 1X7QB 2YD2A 5C0JA 1IGTB 4ZXBD 2YZ8A 3QXVA 4Y1AA 1BVLA 4NHUB 2MMXA 2W91A 2DF3A 4FQ2H 3R8BB 4WI3A 5EU7E 4FQCH 4JJ5B 4WU5B 2CXGA 2V6HA 4OM0H 2ZCKL 1G7QB 4YHZH 2V9RA 2ADIB 5GISH 3ZKXB 4XBGA 3L5WA 2DM4A 4NPYB 4KJWC 1IM3B 4JFEA 1U92B 2ADFH 1N4XH 4N5UA 2BY1A 4Y0GA 3TVMA 3HZMB 3SGEI 1P4IH 4ZS7L 4P3CL 1K9TA 4GG6B 2BP3A 1HXMA 1LD9B 2J6EA 4HFWA 4PLOB 5IV2B 1JL8A 1ZANH 2ZUSA 4ZTOH 4UOJA 5CD3B 4JFQA 3LH2L 5GGRA 4M1CD 1NJ9B 4KZDL 5JIPA 3UTTE 4JM4H 1Y0LB 4Y4HC 5FUCC 1G7MA 2FH6A 2JK5B 2UUDH 4GXVL 3O6KL 1QLFA 1JHTA 2AJYH 1UWEL 1HYRC 2AJZA 2R4RL 2V7HA 3VFGL 2R0WH 4BH8B 4U2ZA 1U93A 1F6AA 4LF3B 4D0DB 2BHYA 3EO1A 3EOBA 4HKBA 3WO4B 2FX8H 4MA1C 3G9VA 1KGCD 1IGYB 4Q9QH 2EXYC 1I1AD 1YQVH 4WFFD 3V4UH 3GSUA 4PLJD 1NGQH 3KJ6L 3UTSE 3ULUD 3E8UL 3DSFL 5BVPH 2W9EL 4PRNA 4CKVX 1CD1B 3L7FB 4BZ1H 3I6LE 3TYGH 1A0QL 5F1KC 4X7DC 4LCCA 4ZUVA 5GZOD 2YD6A 5J8OA 2I60H 3OGCB 3O45A 4MVBD 4UMGA 2OI9B 3PL6A 5AZ2H 2VMFA 3CH1B 4XPBH 5HYQA 3UC0L 5CJBA 5BVPL 4XWGL 4U7MA 4P2OD 3H0TB 1C12B 3LB6C 5JORA 1EEZB 4OKVB 1EO8L 2CLVB 4NOBA 4DEPC 2EC8A 1KN2L 3X13B 3UEZA 4OKVA 4XP9L 2QQNL 4HH8A 5EBLA 4ZXBC 5HYJA 2D7PA 3R0NA 5HY9B 4X0KB 1YEHL 3F12B 3MBED 3NCFB 5DJ2B 5I73B 4Y4FB 4JRYD 4OIIL 3KPOA 1VFAB 5EU4B 4MS8C 3I3BA 3EJYD 3P0VL 3BPNC 5F7UA 3HC0B 1NEZB 2FO4B 5BXFB 3LEXA 1WVZA 4JGMA 4LKCA 4OF7A 2ENSA 5SWSD 4M93C 4KV5F 3BN9D 5EFIA 3E1F1 2UZYB 1O5DT 1LP9B 4LKCB 3WE6B 1HZHL 2EYSB 5ANMA 1VFOA 3FTGA 2GKIA 1CGSH 2F58L 1CZ8H 4Y4HA 2HJLA 3VXUD 4OQTH 4RGND 3BZ4A 2I9LB 1B90A 5JHLH 1KT2A 4WUKL 5E7BA 4AK1A 3V4VH 1EJOL 5SX5H 4YDKH 1A3RL 1YEFL 3O6FA 1NDMA 4ELME 3IB4A 2AW2A 1OSPL 3FN9A 2NY6B 4DAGH 1OM3L 2G5RA 4BQ9A 4Q0XL 2Z8RA 2GCYA 4YHOL 3GMQA 4P4RB 2D0FA 4UOW0 5ICZA 1KFAH 2R2BB 3MRFA 2G9HA 3C08L 5F88B 4Y16C 3GSXB 4V1DD 1JWUA 1KEGH 2KQMA 1OARH 5F88A 3P0YH 3NOIA 1JV5A 1DSFH 1MFNA 1JZ3A 5DD6A 3WHXA 3FQNB 4TSCH 4N8CL 4UQ2A 3BIKB 4W6YB 1GIGH 3KXFB 4WI5A 4POZC 3INUH 3ZE1E 4KKBD 1VHPA 1G7HB 2JIXB 4G8IB 1UCTA 1A4KB 1WCBB 1WK0A 4P5MB 1MVUA 4JZNB 5ALCL 3EUUA 1A14L 4JFHE 1JGLH 4HIEA 3B2VH 3AY4C 5IMLB 1OGAA 4HIEB 5D1QB 3H6JA 1NANH 2ESVA 1BEYL 1R3KB 5C0RL 3VFGH 2R0WL 4P2RB 2X1OA 3BSZL 4YQXH 2O5ZL 3X12B 4HUUB 3FZUC 3EKCA 2AJSH 2VC2L 4K55A 5I1LB 4QGYA 1FO0L 2V5RA 3MRPA 3WJJA 3BI9X 1LDPH 2B1AH 2H9GA 2XZAL 3IJSB 1YEDA 1IGJA 1NCBH 4XT1C 3ZDXF 1S3KL 5LJYH 1R24A 3EOYG 4CU8A 3VFOA 1U91B 3IDGB 5BJTB 3Q1SH 2D03H 1FZJA 2R1YB 1FL6A 2WBJD 4M7ZC 1J87A 3C5JB 4RWHA 1LHZA 5A1AA 4NKIL 1BQHA 3QPXH 5E6IC 3NACL 1F4AA 1WBXB 4O51B 3SGDI 1UH3A 3PDOB 2IF7A 4M8VA 1LE9A 4YBLB 3WNOA 3MLRH 5IFHH 4NQCB 1A5FL 4PJHA 4NYLB 3BWAA 2XG4A 3SDDD 3CFKA 2YN3A 1EAPA 5C6WH 1X5FA 4MD5B 1ZT4A 1N6QH 2WQRA 1JF6A 3MV7D 4L4VD 1AQKH 4YDIH 2HFFA 4DGIL 3VWJD 4HDIB 5A2IH 4WEBH 4F7MA 5SX4H 4H20L 1ED3B 2YOCA 5HHVL 3W2DH 5ADOL 5A2JH 5IFJA 4LIQH 1ETZA 1LE5B 5SX5K 3KS0H 3AS1A 4XBGB 4DEPB 2I24N 3H42H 1LK2A 4R4ND 3L3DA 3QB7C 4NPYA 1D5ZA 4AEIH 3F12A 3T0EA 1W2KT 5EIVA 1Q9KA 1MCOL 4X7SL 2D3VA 4LRNH 4OTXL 2OLDA 4DKFL 4EXPX 5C0IB 2YS4A 2VLRB 4O4YH 5E1AB 4NDMA 4K9EL 4LPXA 1A6TB 4NWUL 4L9LC 3GMOA 4IRSA 5ITFB 1SY6L 1WZ1L 1ZVYA 4EBQL 4HZLA 3LMJH 5H37G 1N7ML 3BD5A 5KW9L 4LLUA 5ERWA 3L5HA 1JMXA 2APVA 4UDUB 4DVRH 2R1XA 1MFAH 1T83A 3BZ4B 5ERWB 2HH0L 5D2LB 2V17L 4EI5A 3NA4A 3VXQB 1Y18B 2AI0H 2OJZL 2E7LA 4HH9A 2E27L 2D4DA 2VH5H 4GW5B 5IW6A 1JI1A 2VQUA 3VXRA 5K9KA 1KB5B 4I0PC 4OD3H 4YR6B 1N6VA 3A6CH 5E6IA 4XPGH 1MJUL 3GRWL 4OLVL 1GHFH 3DXAA 1CDUA 1MY7A 3MBEA 3MRHA 3GUTB 2DS4A 1WT5C 1MCHA 3SGJA 3F58H 3EOAA 4M1DH 1F4WL 4LF3A 5ANME 4D0DA 4ZFFB 1CFNA 3D0LA 4CNIB 1UJTA 1AO7A 1X5KA 1KLGB 5C0FB 2X4NA 2Y5TA 3RUGA 4Y5XA 4IJ3C 4ZD3H 5IMMB 3B3IB 4GMTH 5FYLL 2JLLA 5AD0B 5MP6H 1GGYA 4JFPA 2YPLE 5C0GB 2IFFH 5CBEA 2AJ3A 1GC1H 4R4FH 5I1HH 1L6ZA 1QPXA 2V7NB 3MRJA 5DJZA 4U1GC 3MCLL 4WI9A 1D6VH 4WTZA 4AIXA 3QI9D 2EYTA 1B6DA 3D9AL 3OKLB 4P4KA 4EXKA 3LSOB 3VD7A 3UJIL 4EOWH 5EBMA 4GKNB 3M8OH 3WFDH 4MCYA 1DBAH 3TT1L 1ES0A 3MQIA 2M8XA 3MZTA 3ECBA 2HT4D 3ARZA 3LQZB 1I3UA 2NX5B 3L7EA 5GRVL 2E7HA 1BD2A 4XGZB 4U6HA 3EO9L 5CLTA 3U7YL 4JDTH 3KHQA 3QDMA 4JO4L 2VLJA 5DJCB 3Q1SL 4TQEH 4FG6D 3MOQA 4NZTH 4KK6D 2FO4A 2XZZA 4M1GH 5JW4N 5EORH 4G6AC 3IFNL 4UB0H 4I0PD 1AD9A 4PB9L 4KJYA 2ATPA 4F8TA 1NCCL 4WFED 5LCVH 3G08B 3GI9L 5KG9A 1TNMA 1UENA 5HYSA 2ATKB 3SO3B 3F6LA 2FEEI 3VWKD 4ONHA 2YPKA 4K7PH 2V2XB 3I75A 2I9LA 4ONHB 2F5AL 1B4JH 3ULUH 2BRRL 2FGZA 3T8XB 5JIIA 1FL3A 1KB9K 3DGGA 2FEEL 1V7MH 3NFPA 1WBXA 4PJDB 5IHZA 2H32B 3V4PH 4AT6B 4RIRA 1R0AL 2OJEA 3WJLC 4RZCB 4J3VA 5DJDA 2X42A 4NBYB 2IAND 1G0DA 1AGFA 1F58H 3SE8H 2M2DA 2NY2D 2OZ4L 5D93B 3QO0B 1PQZB 5I8EA 1M7XA 5J1AB 1MEXL 4JFOA 1P7KA 3D2UD 2A74A 2NY5C 4XCNB 1LO5B 2CMRH 3ZTNL 4AQOA 4XP4H 4LFHD 4U4BA 1INDH 5AAMA 1UZ8B 3H9YA 4CMMB 2P1YA 1YYLH 3IDJB 4I77L 4Y1AB 1CLOL 1QA9B 4ELMB 1JRHH 3AU1B 2AK4D 1X7QA 1OPGH 2A6KB 2BSSA 4JFDD 3MXWL 5C09E 4BFGA 4BQBA 1MCLA 4G8IA 1G7HA 2JIXA 2HH0H 1VADB 1GAFH 2NY3B 3EJJX 1CGWA 2WQ8A 4I77H 4NUJB 4R7DA 1MVUB 2XA8L 5C0IA 3TN0A 1C5CH 1FRGL 5AYQA 2EYRA 3BHBB 2NY0D 4BSWA 5HYFA 2YKLH 3T0AA 2Y36H 5DI8A 4NO2B 3TVMB 1RULH 3OKKA 4KFZC 4C83A 1D3CA 2IANB 4AENA 4OZIE 4ODSH 1DR9A 5JPNB 2Z93B 1T66C 4BSJA 1B3JA 5GGTA 3DIFA 5L0QC 5CEZD 2EDEA 3VFTA 1OAZH 3MYJB 3QWOB 4QLRA 2CH8A 2APTA 4ZUTB 3RVXD 1TJIL 5C0CE 4NQSB 3WS3A 1NFDE 5GGTH 2F19H 1BVKB 2FB4H 1DLFL 3X3GH 3ULVH 5FKPA 3QNXB 5EOQH 4Z7WB 5I18L 5MEOB 3TBVA 5CIPH 3SGDH 3RDTC 4MAYA 4ODTH 1YEEH 1FJ1A 4OCSL 3WJLA 1H3PL 2NQCA 4FG6C 2H3NA 1FNGA 1XGPA 2VDOH 1JPGA 3FONB 4G6MH 5IMMA 2AV7B 2XQYG 4PJAA 4FFZH 1IKFL 2B0SL 1OSZA 2FH8A 1DN0B 4TTDD 2BFVH 1YNKH 3HAEA 4XRCA 1FGVH 2LAGB 3VDBA 3LD8C 1NKOA 3LN5A 2FD6L 1DVFA 3ZKMD 1KXQE 4N1EA 5EN2B 4TQEL 1N64H 1C16A 4HKZA 3FCTA 4PLNC 4RGOH 4F3FA 1R3HA 3MUGB 4I4WA 4I3RL 3EJZD 1X4YA 2I07B 3WEXA 1PYWA 3SDAD 4W68A 2HAZA 4RGNE 1IGCL 1U8KB 2GFBA 1Z5LB 5DDHB 2X89D 3ZE0E 2GJZA 1MQKL 3C8DA 3U9PL 4K7PY 2DLTA 2LTQB 2VTFA 5FHAH 2VDML 3C5ZB 3C60A 4JG0L 1U95A 2DI7A 3T2NH 3ZL4H 3QG7H 2F58H 4N0YH 2XN9B 3ALXA 5DRWA 2CO7B 3ZE2F 1YUHB 5D6CA 3NN8B 5DUBB 2AEIT 3U79A 4M48L 4YHYC 3U0WH 5KSUA 2D31A 4Q97A 3HZYB 3L9RA 5FUZL 3VXMB 5IB2B 2VRAA 4NRXA 4ODVL 4DKEH 3LRHA 2EYSA 1X5YA 3SDCC 5BRZE 3PHQA 5A40E 5KOMC 2CLZA 3EGSA 5IW6B 5ICXA 2H26A 5DD3H 5JNYA 4H26A 4RGMC 3DO7A 4YR6A 5L2KE 3GDBA 3O4OB 4BELD 3SDXA 3GO1L 1KB5A 4AT6A 4R96B 3FFDA 3DI2B 4TUKL 1YEKH 5L8KB 3QDGA 2W0PA 5CZVL 3REWA 3WSQH 4RQQA 2RFXB 1IQWL 1A4JA 4UAOC 3OR7B 4RMRA 4PGDB 1F97A 3QDJD 5HVHC 1S7SB 2XKNB 1E28A 1MRFH 2BZDA 1HHJA 4NO3B 4YHPA 1NGZA 3V8CA 1S7SA 2XKNA 3DYPA 1J12A 5TH2B 1IGIL 2Y72A 2GIYA 3MR9B 4JR9H 2VLJE 2GJ6D 1WAAF 1J05B 5IFHL 3U9UB 3JTSB 1KIUA 1VGKA 5EC1B 2YA0A 3B6SA 4JDVB 3T3ME 1P5VA 3RAJH 2AERT 3CVHL 4X7CC 4PUBL 1AHWC 1T0MB 1I3GL 3EHBC 5DD6B 2UVEA 1HKFA 4OZHA 1OM3H 1OAYL 2Y07L 3MV7E 1G1YA 4NZUL 2ARJA 2F8OA 4OQTL 5BVJB 4HCRL 3ECBB 3LQZA 4RRPG 4QRTA 5GGVY 1SJEA 2VOTA 3QNYB 32C2A 5D1QA 1ADQH 2FLRT 3HR6A 4BJLA 1F4HA 3WFHA 5F44A 2HA1A 1R3KA 3LH2H 1S9VA 2FJFB 2WAHA 3ROLA 3O8XC 5F9WB 3K4AA 3TEUA 1N0XH 3KR3L 3OKEB 1DUZA 3OAUL 3RUGE 5EOTB 1QLEH 2HJKB 4K7FA 2ZUQB 4OB5H 4O9HH 2UWEE 3CC5B 5IVOA 1UWEH 2R69L 3U4BH 1XGRB 4HJJL 3HC3H 1DFBH 1WWCA 3TBWB 4HWBL 1J0HA 4PJEA 4QOKD 4N90E 1QFOA 4JY5H 1F11A 4OCYL 3KPRE 4MNQB 3LHPH 5C0AA 1H8SA 2ATKA 4PTTA 3DVFA 4V2BA 3KVQA 1BLNA 1DQJB 3MV7B 5EU6E 2WBWB 1FPTH 1F3JB 2BVOA 2DM3A 4JO1H 3HZKA 1HINL 3WXWH 3JTTA 1OTTD 3FQWA 1OF2A 3PQYB 1BM3H 1Y6KR 5FGBA 5FYKU 4JDZB 1F8TH 5T1LD 5HDBF 2NW3A 4DZBA 3FQXB 3H9SE 2NY7H 2VIRB 5ESQA 3C5ZC 1KB5L 1MLBA 3G04B 1TTUA 5CKAA 1RZ7L 2H8PB 3WN5C 5BQ7B 3RWIA 5I2IA 4HGMA 1D5IL 2AABL 4G3YH 2QHRL 3Q0HA 4S2SA 1K2DB 1J0IA 1CWVA 5H94A 4F15C 1WEJL 1AHWA 4OFKA 5IW1A 3EYOA 3OXSA 4HUWA 3GSRB 4LQFL 1AKJB 4G9FD 3MLYL 3WHXB 1U8KA 3PIQA 4QRUB 3WNMA 1VEPA 4G6FB 1RZ7H 4HT1L 3QUZA 1NAKL 2PYED 1KSRA 4QXWA 4PJ7F 2YRLA 4J8RA 4U6VH 4AEFA 1BGXH 2X5PA 5IB1A 2R8SH 4Z7UF 5KVEH 2VDNH 2J7LA 2DD8H 2X1QA 3CVIH 5DJAA 3QPQC 1I3VA 5D5MF 4X7TB 4XWOC 4JPKH 3O8XA 2R2HB 3VXME 5I71C 4AMKL 5EPMB 4Y2DA 3K46A 2OTUB 3L3HB 1S7QB 1SMAA 3VXOB 3WN5B 3ZYZA 4UV7H 4NO0D 3HA0A 1XEDA 3X12A 4XPGL 2E9JA 2XN9E 4MX7A 3VXSA 5F7DA 1ORQA 4J3UA 2A73A 3PWPD 1XGQB 3VXQA 3F58L 5D7IB 3BKYL 2JTDA 1Z9SA 4WNQB 5IMOA 5D2LA 1LNUB 3VXNB 1K6QH 1Y0LA 3VFMB 5IFAL 5E2JA 5C0BE 4UINL 4JPWH 4WTWA 4N0RA 5FHBH 4Q9BA 1OP5K 1I4FB 1PFCA 1K85A 3TBVB 5T5FH 2HFGH 3BH8B 3CNKA 3MLZH 3QFJE 5JO5B 3BT2H 2EXYD 4P23A 2NY1D 4Z77B 2FZ3A 3MRKA 4UAOB 4OV5B 1FZMA 1T5XA 5GGVL 4P2QA 5IHBA 4CNIA 5I1AB 3OX8B 1OTTC 2A38A 4ONOA 3HRZB 4GQ9H 1ZHNB 1VFBA 4F7TB 4MHHG 3QEQB 2ICWA 4LLAA 1G6VK 5IJKC 3QFDB 1VPOL 1XF2B 3QPQD 4M02A 2N1KA 4XVTH 5D7JB 3IT8D 3DYOA 3G5ZB 3SOBH 1X4XA 3TIDA 3VRIA 1C12A 4K2UL 4MYWB 4J1UB 3C60D 1IM9B 1SM3H 4DW2H 4G7VH 3AFLA 4GSDL 4P2RD 1I1YA 2B4CC 2A9NH 3NGBB 1CYGA 1EEZA 1F90H 3I9GL 1ROWA 2GFBB 5KZCB 5HGBA 3FT3A 3ISWA 3VFWB 1PY4A 4YO0B 4MDIB 3BIAX 4LLWA 3NZ8B 5I8CA 2X7LA 2NY4C 3DROB 1I7TA 5IMKA 4S1SL 4CBPA 4LOUD 1XIWB 4N9GA 1VEMA 3HN3A 2D7TH 4K7FB 4XNQA 4JO1L 2FECI 3ULVD 1HN1A 1T1YB 1QHOA 4OLZH 3TBYA 1A21A 2X4PA 3ULVC 4JKMA 1EA9C 1JYVA 2P5EE 2XA8H 5ISZA 2RHEA 1NBVH 5GRJL 2JB5L 3EDDA 4KKAC 1WBYA 2CDEA 3RWGA 4ISVA 3L9RB 3CZJA 5HYIA 2Y36L 2Y7QA 3QA3A 1LO4L 5DEFB 5KTEH 1FLTX 2VXTL 2BNQB 4N0UE 5TFSL 3RWJB 1T6WA 3BQUD 1OAZL 3P77B 4XNMB 3IFNH 5I66A 4LSPL 3LZFH 4G9FA 4P46B 3D9AH 3DVNA 4XNMA 1I75A 3O9WC 3ARGC 5FCUH 3REWB 3D85A 2GTZA 4L4VB 2NY3D 5JOFB 3VGAB 2X1WL 4UTAH 4KC3B 5IEHB 1P7KB 1KB9J 4NJAH 3K2UH 2PW1A 5IJKA 4M6AA 1U8IB 2NW2A 1XIWD 5AD0A 3SQOH 5AG8A 3WIIH 5F96L 4HS8H 5DWUH 4KKCD 5FKAB 3CVIL 4K71C 2D7NA 4F15B 4JQXA 1VDGA 3E8UH 3MLSL 1M7IB 3STBA 3QO1A 2Y23A 4W6WB 3BIKA 1AO7D 3ZKSD 2Z31B 5JDSA 1VACB 3IXAA 4XNZC 5INCB 3IAPA 3I6KB 4NN7C 1NBQA 2ID5A 4TUJB 3HFMH 3IDXH 1JWSB 3KPRB 4MNQE 1MQ8A 3QHFH 4UT9H 1NAML 3IFPB 2IALA 3QDGD 3MRMA 4M5YL 2ICEA 4PJFF 4CVZA 1HXMB 1LD9A 4HFWB 5DC4B 3IYLW 3H9HB 4XCYB 1KTDA 2MWCA 3T1FA 4PRIE 1YYML 2CUHA 4J7RA 2CK0L 2HJKA 5BZWB 4ENEC 4KZEL 4GFTB 3P30H 1TQCC 1XCTA 2YMXL 3OAZK 4KVNH 3UZQA 1S7XA 1GYAA 3L1OH 1UACL 2DM2A 5HI5D 5E70A 1RFDL 1EV2E 2VL4A 3QCTL 2X2YA 3NBNA 1JBJA 2O5XH 2OSLB 1F6AB 3MUY1 3T0ED 3LDBC 4U1MB 2KDGA 3PABA 1NGYB 2J8UE 5CZKA 1E4XI 5C7XL 1SVCP 3X11A 2WINA 3JSSA 4ZO8A 4FQHB 2H45A 3EYSH 4FFYL 4WV1A 4GBXD 3VWKA 4WUUA 2CUIA 1P7QB 3SJVE 2HFEB 5JHLL 4KZDH 1F6FB 3MCLH 4AIOA 3TA3B 3GRWA 4MD5A 1F90L 4V1DE 4P2QE 3EHBD 5TE6H 4WWKC 2F5BL 4WJ5B 5H94B 4PJFB