1RUAL

Crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
218
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 51
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaL01
2LV4A 3WD5L 1OAUH 5DJDB 3F58H 1SVZA 4LIQH 5IB2B 3TJEH 3LD8B 2OI9B 5J1AA 3STBA 3QB7C 4E41A 3HNTL 1ORSB 4J3XA 1JGUH 1J05B 1ZE3C 3VWKB 4ZDHA 5DVNA 4GQ9H 5TPWH 2BVQA 5LBSL 3O2VH 3OHXA 5B21A 2XG4A 3BGFB 3P9MB 4ELKB 1UH4A 5JOFB 4FXKA 4PV8B 5GGSB 1O7VA 1EZVY 2Y07L 5HI4C 4K2UH 1ZANH 4QY8A 2NR6D 5CCKL 4YEFA 2IFGA 1BWWA 4UMGA 2NY7L 1FNAA 2AQ3A 2DJSA 3G08A 5KVGH 4URTB 2QLVB 3GSNH 5I8CB 5JA9A 4PGEA 3DMMD 1C16A 3S96A 2AVGA 4LLQB 1WICA 4C59B 4NP4L 2CJUH 3MXWL 1AP2B 4ONFH 3S4SG 4TUOB 4Z7WA 1JGEB 1WCBB 2AJVH 5DJCA 5F3HA 4PJFE 5JW4M 3GSOA 1WFUA 3SDAB 43C9B 1UWXH 2Q1EA 3MNWB 4DKAA 3KYNB 2JCCA 3EYSH 4U7MA 4AMKL 2C1PA 4FXLA 4K8RC 3UJJH 25C8L 3P73B 2DQFB 3T08A 4X99A 2R1YA 5E24E 3QFDB 1OP5H 3U7YH 1P4LA 4P9HC 2G60H 5F7LB 2PO6D 1WAAA 4LRNH 1BFOB 1G0YR 3ALXA 1KTKE 3FT2A 4DK6A 5HHNA 1T0NA 1IGTA 1SY6L 4OIBA 3RKDC 3T2QA 1CICD 4EN3C 1VGKA 1RSFA 3H42H 5GS0C 1HILA 1J11A 5KG9A 1L6ZA 1KCSL 1J1OL 3WYRA 1KTLA 1OQOA 4WHYG 1C5BL 3GKWH 3KPNA 3VG0H 5BXFB 4PJGA 1IBGH 3B9KB 2BHZA 1FAIH 2IMNA 3FHQA 2CIKA 3DRTB 1F4WL 5FUOL 1F3DH 3D18A 4X83A 4QTIL 3RNQA 4ZNCD 4GXUM 1FO0L 1DFBL 3T2NH 4CU7A 4YHIB 1MVFA 3QDJB 4G9FB 3GSUB 4JY5L 3RGVD 1JK8B 3C60C 3HE7D 2XTJC 3P0YL 4YBQC 5EO0B 2X4RB 5IOPA 1INQA 3U4BL 2W9EL 1CTOA 4DGVH 1L0YA 1EBPA 3LS5L 3WXVH 4HS3B 1TCRA 1SJEB 1WWCA 1QSFB 4ZNEA 4PRHE 4PB0H 2PTTB 3ZYOA 1LGVA 1EAPA 3CXHK 3SE9H 4FQ2L 1F3RB 4GLRH 3O0RL 4LPWA 3FOLB 3QFDA 3BZ4A 3IDXL 3TFKC 2D4FA 4UOW0 5C3LD 3QUYA 3DUSA 5CGTA 5DRZB 1WWWX 3OWEA 5ANMA 5FXCH 5CSZB 4I0PD 5L0QC 2VDLH 4I3RL 5FYJL 1U8JA 4NZJA 1YN6A 3EYUH 4UIMB 1QKZH 4NSKB 3UX9B 1IEBB 1LK2B 2WUCL 4HIHA 5JXAL 2WZPD 2IGFL 1D5MB 1TJGH 3VXRB 4EZMA 1RY7B 4PJIF 2FIKA 1N64H 1WGOA 1U8PA 4HIXL 3MLWL 3ARGD 4KJPD 3QIUA 5J7CC 1A4JB 1NMAL 3ZHDA 3TH4T 5ICZB 3QUKB 4RFEB 5EU6B 2MMXA 2BOBB 4Y4HD 4X9BA 2Z0BA 5F9JA 2NXZB 4NJ9L 4LARH 2YUWA 4AZ8A 3NZHH 2MNUA 3MV7A 1H3UA 3VE0A 4KKLC 2WK2A 3QNYB 4Z7WF 1A1MB 3HR5A 3BW9B 2HLAB 3ROLB 4HJGB 4KUCF 2M8XA 3KPSA 4L9LB 3QXTA 4NQEB 3K3QA 4LLWA 4YDKL 2PW2B 3DBXB 3NCJH 4FNLL 4PR5A 4L3ED 2ITCA 3NCFB 3OMZA 1KEML 3GZKA 4LAJH 2ICWI 1Q9WB 2VLRE 4JFQB 1ITCA 3KHOA 2PCPA 2ATPA 4O9HL 4M7LH 3MCLH 4FRWA 3SQBA 3QQ9D 2VDOL 2R1XB 1GHFH 5DWUH 3DIFA 2AXFB 1JE6A 5CUSH 4GKZA 3WO3B 5CINL 4QHUB 3W0WB 2QSTA 4F7MA 3S36L 1CFTA 4F58H 1IGCL 1IGML 2NW3B 4NGHL 3S5LB 4FQJL 3P4OB 1FNSH 4FTVD 2V2TA 4RZCB 4LLDA 4PGZA 2N7AA 1NGZB 3TPKA 1UT9A 2JELL 4X8JB 1A7BA 5A3IC 4NOFA 1MSPA 4NO3B 2UV3A 3BD3A 2AK1H 5GGQL 3OKKB 2V2XB 4TUKL 1RFDH 3VJ6B 3GSWB 5IHZB 4WVRA 1LNUB 3OKKA 5KOMC 3EOTL 4YDIL 1PG7W 2Q3AA 3DX9B 2BY2A 4XNYL 5IV2B 4LSQL 1QRNA 5I8OH 4ZUVA 1J9CT 1FHGA 1MJ7L 5GGUA 2ZNWA 5K9JL 5IFHH 1N8ZB 3HNSL 1DLHB 3JWDC 5DJ8A 1B0RA 5SV4A 4YC2C 5IHLB 5BOPA 1IMHC 3TJEL 3VFNA 5GS2H 1FN4A 4JGJA 5HGDB 1KFAH 4O5LL 3SDCB 5J1SC 4IRZL 4H20L 2XTJE 2A9NL 3SDCA 4KQ4H 1IGFL 3QHZL 3BESR 3RL2A 4ZAKD 5EIVA 2VISA 5BMFH 2VXVH 3HUJB 3A6BH 2F8OA 2R2EB 1F97A 3GJFA 3W9EA 1NMCB 5F9WC 4BFBD 1KELL 2PCPB 3AAZB 4JKLA 1WBXB 4BKLA 5SWQB 3O8XB 5D7JB 4GRWF 1J1XL 3ZHLA 4GG6A 1IM9B 1CDIA 3IB4A 3KJ6H 4OCXL 1VEPA 5C8JB 4L29A 4WDIA 5JR1H 4LHQB 4Z0XA 2MHAA 3B3IA 4L4TE 5F1OB 5D72H 5DUBB 1ZVSA 2MOVA 3E2HC 4X5XA 1T7ZA 5ICXB 1W8NA 3QUZB 1T1XA 4RZCA 4G42A 3SCMD 1K4CB 4WHTA 4ZXBD 4LCCA 4G7YH 3MNZB 1KGCD 3GMMB 1IZKA 2X4QA 2J6EL 3LKSA 2W1NA 3VFNB 1YPZA 3W9DB 2BNRD 4JFOA 3VJ6A 3TH3T 3ZZ1A 4U0RB 4ZO9A 2SEBB 3FQXB 4HK3J 4P2RE 1U8IB 4YO0B 4OB5H 4XBPA 4XPAH 4D9LH 4XVJL 4MDJA 1LE9B 1N5AA 1ZT7B 1IEBA 4HUUB 4NKDA 1NGZA 1UKTA 3L9RB 3GHEH 1Q9KA 5AUMA 3HZKB 5DJ0B 1U58A 3UTTE 4IRJC 2WIMA 3VFMA 2NY3B 2EYRB 1RK1B 2AEQH 1P7HL 2UY6A 4XNZC 4YBQD 5D70H 2H2PD 2V17H 1J1OH 3CFCL 2AV7A 4XPGH 5FYKE 5GS1C 3BSZH 4WFHD 2OCFD 1AGFA 4MZ3A 3U1SL 3QEHA 4O2EA 4PG9A 3KXFA 5C09A 4IRSD 1OTSD 2V7NA 3G6DH 1CR9H 4ZO6A 5DVKA 4P2RD 3QPXH 3DHMA 3I2CL 4P5TC 2MKLC 3I6LE 4PGDB 4AL8L 5DK2A 1UFUA 3VXSB 2H45A 3NFPA 1ZEAH 4RFNB 3SKJL 2D2OA 3SKMA 4YHML 1DQLH 4YBLB 5I6XC 2VERN 3ARRA 3CXDL 1QP1A 4XX1E 1MY5A 4KQ3L 1A14H 4FXGA 4R90H 3E6FB 2E6PA 3CSBA 3MRJB 1F58L 3O0RH 3WIHL 1KXQE 3WN5B 2N7BA 5MEPA 3UYRL 2CLVB 2XN9E 3LPWA 3WFBH 3G04A 5BQ7B 1BFSA 2BNRE 1UM6L 2GTWA 1PZ5B 2VIRB 2FL5B 1DLFH 2FCBA 1OWWA 3ARPA 3U7AA 2R4RH 3O6ML 4KVNH 1LK3L 1BZ9B 2EDJA 5D2LE 3HMXL 3HC3H 1T2XA 4IIQC 5DVOA 5EPMB 2B5IB 2JJSC 4OM1H 5GZOC 1WFNA 2NLJB 3ZLQC 3GMQB 2IAMD 2VLLA 3BPOC 1A6ZB 5D7SL 1FH5H 2AJUH 1N64L 4Y2DB 1I7RA 2YMXL 3H3PL 5IMMB 1ZGLP 3BE1L 1XF5B 3UDWC 2R8SH 4JRXE 4H8WC 1CTNA 5I2IB 1FCGA 3ABZA 1HZHL 4O2CB 3CLFH 1MLCA 4FFWC 1T2QL 4JB9L 4IS6A 4LARL 1FIGL 1QSEE 1FG2A 3GIVA 1IAOB 5TH2B 1EO5A 4WHYH 1H3GA 1ZLVK 1YEEL 1GIGH 3C5ZD 4DKFL 5ID0B 3VFWB 4X4ME 5FA4B 4BQ8A 1JGDB 3T0WA 4JJHA 4MDIA 2XQYG 4PJCF 5EZIH 1QSFD 5EN2B 1BQHB 3NCYS 4PRBB 5LGHL 4PTTB 5LKNA 4DFHA 1P84J 1UQSB 4XVSL 5ANMB 3BZEB 2MQCA 1IC5L 5D96B 4WUKL 3Q3GA 3WHE1 3PP3H 1U3HD 2DQCH 2P8MB 4PBVC 4ERSH 4Q0XH 4PJCB 3D39D 1WTLA 2X4SA 1TZIB 1VSCA 3S6CA 3GMLA 3MLYL 1F90H 4I0PB 2BY0A 3L3DB 1KEGL 4JKMA 1FL5A 1ZMYA 3OPZL 5F88B 2NXYD 2CPCA 1QYGL 3UBXA 1CFBA 5C0DB 4FFZH 3SY0A 2IQAA 3V0VA 1RURL 2NMSA 2DD8L 2I60H 1KENL 5HHOD 1T04A 3WKNA 4NPYB 3L7FB 3GSOB 4NKIH 4I0PC 5MHSE 3MRRB 3BKYL 3RWEB 3K2UH 2CDGB 4HV8A 3RGVA 4KKBD 2VE6B 4C83B 5E6IB 4IDLA 1Z2KA 4IIQA 3MRJA 1J8KA 2ADIA 4I1NB 5D2NA 1BFOA 1GXEA 3IRZA 3Q6FA 5CBAA 5C0GB 1ZHBB 3QUYB 4WUUE 3EYFA 1KCVL 2GJZB 3VXQA 2VZTA 3QWRA 3TYFA 1PY9A 3N1GC 4CU6A 1NLBL 2PETA 4L8SC 3PWUA 5DK2B 3R06A 4YK4C 4OGXH 4U33A 4CMHC 3HPJB 1YY8A 1CD1A 2GJ6B 4LSSH 2IAMA 3K4AA 3HPJA 4ZTPL 3VDCA 3C87A 15C8L 2NY4D 4P2RA 5HI3C 5CP3H 4HDIB 4J1UA 2KQMA 4WTZA 4CGTA 1MF2H 1KF9B 2R1YB 2KL6A 4OZ4A 4KQ4L 4K3JL 5DHYB 1NFDA 3UTZA 3V7AG 3EHBD 1JRHI 3V0AC 1CFSB 2A9NH 4RIRA 1CXIA 4HPOL 3TBSB 4L3EE 1OSZA 3MCG1 3KPRE 4OAWA 5AG9A 2X9YA 5CEYB 3FRUA 3OGCA 4PBWD 2W59A 2C3VB 3IVKB 3FAXA 1EO8L 2BVYA 3CFDB 4TPRL 4LOUD 1IAOA 5LXGH 2FEDD 5DEGB 3FQWA 3HRPA 3KXFE 3L3OA 3QZWG 1KELH 1PG7L 4EBQL 2FSEB 4A6YB 4G8IA 1MHEB 4O58L 1BJ1H 4PJXF 4BQ6A 4XP4H 3BAEL 2CK2A 1C12B 5ESVB 5GGVL 1ZHLB 1FCCA 2JCCE 4QHMA 5T1LA 4PJ7F 2AW2A 4NO2A 4QRPE 1W72A 4Y1AD 1S9KC 2CUIA 3GM8A 3BP6A 1CWVA 4U6HA 4UDTB 4DQOH 2DYPD 4HFWA 3S3SA 1UB6A 2GK0B 4N0FA 5BRZE 3HB3C 1RUQH 3FB5B 1GSMA 1MJ8H 4H5SA 4U1SB 5D1ZA 4JZNA 4S2SB 5DA4A 3NGBB 12E8L 3R4DA 3H9HB 3KPLB 4GAGL 5C8JA 5JHLH 2EIZB 5E8DH 3RIFF 2X05A 4MXWL 2ZPKL 3O6FD 3GSRA 2VLRB 1G6VK 3EZJB 3CNKA 4OZFA 2J8OA 4X98B 3HE6B 3LSOA 4LHUG 2FEEL 3HI1B 1YNKL 3LH2L 4XWOC 2VRAA 3JTSB 4MQXD 1DEEA 4LVHC 3H9ZA 5DYOB 2DF3A 2G2RA 4MDJB 3UTQB 4TQEL 1A6AA 3LQAL 1BIHA 3KYOA 2I9TB 5CJ8A 4R7DB 1IEAB 3PDOA 2GQHA 3WD5H 1YEKL 1WQVT 4JKPH 2HLFC 5IESL 1Z5LB 4U7KA 1MWAB 1BFVH 4Y2OA 2Y4SA 2OQJB 2CIIB 3PWJA 1AJ7H 3GK8L 4FFVC 4NDMB 3QYCA 4WO4A 4F7CB 5I1KH 3QIWB 5SWSD 2J8UE 1JHTB 1YUHA 2CO6B 4L1DA 2APWA 1KJVB 3O8XD 4M1GL 4FQPA 1OLLA 4JRWA 5CZXD 5FFLA 3QEHB 3VH8G 1DLHA 1EO7A 1I8KB 1E6OH 2EDDA 3N0PB 2DL2A 4NQDB 1ZEAL 3HI6L 3V9FA 1UM5L 5BZWA 2EICA 4JAMB 4C56A 1ITBB 2NY0C 4QXTB 3RZCD 3OJDB 2J7LA 5DFVD 2WP3T 3P0GB 3IXTB 3KLAB 2UYLB 3SDDA 5BJTA 3CXDH 3OAYK 4OFPA 4UDUA 4Y89A 4HS8L 5GJTH 1N2RB 1A9EA 3OSKA 1W72L 4HWBH 4R26H 3C8KB 3GBML 4GKNA 2WINB 4F7PA 4JFOB 1FBIH 4HXAH 5KSAB 4XP9H 5GGTH 3T2PA 4QRRA 1D6EB 3VXPB 3WLBB 2VDRL 5DJ2B 3T3ME 2Y1VA 5I17B 2HRLA 1YNTB 5IVXF 1TQBB 3IDJB 5IFJA 3ROOB 1LP9A 4U1NA 3SQOL 3MGTA 4X6DB 2WBJA 3H7LA 3ULSA 5EOQL 4EUPG 1X44A 1HOCB 5DGQA 4OCMC 4K3EH 3FKUS 4G6KL 1KCSH 3G5XA 2DTML 1F4YH 1HYSD 3WNLA 1TQBC 2QQNH 1NC4A 4Z7UE 4ZUTB 4F57H 4G80A 1HHGB 3LKOB 3TFKD 2VQ1A 2FBOJ 2Z8SA 3LEVH 2A77L 3S37L 3A6CH 1ZTXH 1P69B 2DQUL 3F7PC 4MCYB 3EDDA 1CLOL 2BHUA 2WM0A 4KRNA 2AJSH 1T3FA 2QQKH 1AQKL 4OQTA 3VXSD 4GFTB 3QDMD 4CJ1A 3F65A 1U8IA 4HWZB 3U6RB 5FGBA 4MQ7A 4MMXC 3NFNA 1CLCA 5D6DC 3DXAB 3ARDA 4H1LB 4Y19A 3PWPA 3VXOB 1MCOH 4LLDB 3F7RA 2P5EA 2F53E 4MLSA 5D7IA 1NGWB 1FV1B 3OXSB 5T1LD 3IGAB 4WNQB 2F54A 1MIEL 5JOPE 1NBYA 4ZFFB 2I9LB 5EIQA 5DJ8B 5IHUL 2J6EA 2W65B 2A6JB 1DSFL 4L8DA 1BMGA 3CUPB 3HMWH 1OL0A 3K4DA 1W8OA 3NCBB 5L6YL 1ZVSB 1P9MA 3RDTC 1F2XK 4OKVB 2R0ZL 3QXDA 4L29B 4PJBE 5ID1A 3AY4C 4R4NC 4ZD3H 5DO2D 5L2KA 1HQRB 3D0VB 3VH8B 5J56B 3ULUD 2VAJA 3WS3B 5MEQA 1NFIB 3G6JF 1RJCA 2PYEA 4OGYH 1TJGL 4P4RA 3O3AA 5D7JC 3PL6A 1AI1L 3SGDH 5IB5A 3PJSA 1NAMH 1FVDA 5K9QI 1D5IH 2WNGA 4JREC 2FYYB 4QRPA 3QJHA 1KIRA 4NYLA 3FO1B 5A1AA 1BM3H 4DWHA 1YEDB 2PN5A 5T1MA 3WXWH 2F19L 4MXQD 2GTZA 3CC5A 4UV7L 4TNWK 5C0CD 4KVCH 1Q9LB 1NFKA 5HY9B 3D3VB 5JQ6H 1AGDA 5EZLB 3S35H 3LEVL 3S37H 3W11D 1IAKA 5L8JB 4CW1B 4LK4A 1LO5B 4EI5D 1BF8A 5DHVH 5HHQB 3FO9A 3LPGA 3UTSD 5ERWA 5C09D 4JPVH 5TE4H 3TA3B 3UCRA 3LKNA 3SDYL 1YY8B 3KYKH 4JFPB 4YHOL 2YD4A 4GW1B 3BOVA 5E08L 4KK8C 1FYHB 2W38A 1AFVH 4L8CA 3DUUA 3VH8A 4MD0B 3UEZA 4GQ9L 3TO2A 3LIZH 2EIDA 4JM4H 1I7RB 2HWZH 2JB6B 1YY9D 1II4E 2OJEA 4NC1E 1BQLH 4KI1A 2EYSA 4P4KD 2YKLL 1KJ2A 1U8HA 2QSQA 1Q72L 4P3CH 4LSVH 3D5OF 4Y4FA 1ADQH 3VD9A 1KIUA 1R3LB 1EA9C 4RGMC 1MCKA 1MRDH 3DX7A 4KKCD 4LSTL 3X12B 1QSZA 1HH9B 3CMOL 1EDQA 3UTPD 2EDYA 4ENEC 1VFOA 4EBQH 4LGRB 1DP0A 1OY3B 4NFCA 4QRQB 3WN5A 5H8DA 4QGYA 1H3WM 3WJLC 3OZ9H 5C07E 1A22B 5CINH 2LU4A 5FUZH 2FATH 1IGIH 3MBXH 4CKVX 3LEXB 3T0AA 1QO3B 4KJWC 3FQUA 3IDIB 4MWFB 3U46B 1YNLL 1MUJA 3CZJA 3FQWB 4OLXL 1BAFL 4Y5YA 3OAUL 4IMKC 3OG6B 2GSIA 1IC7L 4L3CA 5EO9A 5AYQA 3Q3GB 3RQ3A 5E4IA 5HHVH 4M9OA 1EX0A 4JN1H 4K9EC 1QA9B 1M7XA 1XGRA 1OF2A 2ZPKH 2I24N 3KPNB 5GSRA 5I15L 4QRRE 1JZ6A 4KY1L 4RFOH 4Y5VB 2GY7B 1NUDA 2Q7NA 4XAKD 1I85A 4H25B 2WQ8A 5D93B 3O11B 3JV4A 2HVKB 4X6BB 1KJMA 3RJDA 1A6UL 2WW8A 3H42L 1IKFL 1JMZA 3ZYJA 2RBLA 4P2RB 1YNKH 3MV7B 2Q76A 2ZKHH 3ARDD 4Y19D 1OTUC 4UOJA 4G9FD 2GI7A 2P5ED 3MRHA 1FSKB 4LGPB 1UENA 4LP5A 2F5AH 3QWRD 1F4WH 2YA1A 5FUOH 1Z3GL 1BQUA 1MI5D 5ALCH 3V6BR 4M8QB 5DD1H 1H0DB 3VG0L 5CILL 1R5IA 2BSRA 3BYYA 5IMKA 4OZIE 4OGAC 4HX1B 5DJCB 5F3HB 2Y72A 4KK8D 5T3XL 3K8KA 3T8XB 3BO8A 1QR1A 3QDHA 4NWUL 4GAYB 4X6EA 1KTLB 4GH7B 3OKDA 4NC2B 4Y19E 4KTEL 2HJLA 3GMRA 3DXAA 3FTGA 1I8LA 2OJEB 1LEKB 5FECA 3UBXB 5LCVH 3WNMA 5D2LA 2QHLA 2F54E 5EOCJ 5C6WH 1AC6A 4PREA 2EC8A 3VG9C 3P30H 1LO4L 1D5BA 3S34L 5I0ZA 2H6PB 3ZDYF 4Y5XB 4HS3A 2LABA 4OZIF 1SEQL 2XWBA 5EUKB 4M6OH 2FJHA 1FO0H 4JRXA 4XRCB 4MA8H 2A38A 5AEAA 5L9DH 4E42A 2YPKA 1LO3L 1ZV5A 5C0RL 1CT8A 2OZ4H 1BQHA 4HUMB 5F8QC 1GZPA 2HH0L 3EOAA 3IETB 3ULSB 1NKRA 1J8HB 1UM4L 3STLA 1AR1C 3BDYL 4YHPA 3B9KA 2DKUA 5IB4B 4CVXB 2Q86B 2VTFA 3QAZB 1FAKT 2A6DB 4EN3D 3ZKQD 3BPNC 2FH6A 1I9JL 1GGUA 5AWNH 2LTQB 1OTTD 2CD0A 4TSBL 4QT5B 4L3EB 3LQAC 2BNQB 5EOTA 4W81A 5IEHA 2K9UA 1NBZB 4K3DH 1U3HB 1B6DA 1QEWB 2QQKL 3TBVB 4HHAA 5C0EA 4GAJH 2XRAL 1MCWW 3X3GL 3KWWB 3L5XH 4Z7QF 3AROA 3QI9C 3GSNL 5SX5K 4OKVA 2EIBA 4NHUA 3BSZL 5CSBA 3C8HA 5DA0B 3QG7H 4HBCH 3SOBH 1CDYA 1BBJA 4TRPH 2QTEA 3B8SA 1KACB 1S7XB 1YDPB 1IQWL 1P7QB 4H26B 1QBLH 4LCWD 1FNEA 2GYSA 4OQTH 2ENSA 3QEQE 3CK0H 3MMEB 4OLUL 4JCMA 5DO2C 3ZKNC 4X6EB 4P23C 1NCWH 3TO4C 5HGBA 4RGND 5HYJA 2JJTC 2F15A 1BPVA 1U8KB 5E9DA 2XY2A 1RK0B 1V3JA 4QWWC 4ENED 3DV4B 4YEEA 2RCSH 1YMMB 4LCWE 5J6HB 1A7PL 2BNUB 3MA9L 3V2AR 3MXVL 3S5LG 4OD1L 4JQXA 1R3HB 3OKOB 1Z5LA 1EIBA 4X5WA 3TZVB 4MA1C 4ZNEE 4OZIB 1MCQA 1VESA 1Z0NA 3IYLW 3O8XA 4Q9QL 1I9IL 1M7IA 1UB6B 4N0FB 5EUOA 3RVVC 3B2VL 4H88L 4P49A 1D5ZA 3MREB 4ZXBA 4X6CB 1U95A 2DLFH 4I77L 2GEEA 3RWJA 3SDXB 4FXKB 1XIWB 3H3PH 4X98A 4R96A 4HKBA 2R9HD 3QG6B 3O9WC 1EEQA 4DW2H 3HG1B 3EDEA 3THML 4M61B 5GGQH 4ODBD 1N6QH 3D2UB 2FDBP 3VWKC 1FPTH 4CL7A 1OGAE 4D2NA 4ETYA 4C55A 1JI1A 2Q20A 4PV9A 1IGYA 1S9YA 4JM2F 3OX8A 3TM6A 5H35A 5K9JH 4D0BA 5HGBB 1G6RL 3RVUD 4ZPTB 3S7GA 5B38A 3C8KA 3KPRA 4MNQE 3CAFA 3V0VB 3KYKL 4X9IA 4XXDB 1QRNB 4PYGA 5T1LB 3UTZB 4WCYL 1MWAH 4YXLL 3MRGB 1XZ0A 3GRWL 3U79A 1AFVL 4Y16B 3LPFA 2ZCLL 3OKEB 4HH8A 5FYKH 1Q72H 4OSUH 1QVOA 2Y5TB 1JN6B 3LKQB 4UNTA 3TNMA 2P7TA 5B3NA 1NCUA 3T04D 1AGBA 4P2YA 3MROA 5DQ9A 2BVUA 2Y23A 5DZNA 1K2DB 4WHTB 1FYTD 3U9UA 3P77B 3B2UD 1I7UA 3HR6A 2Z91A 2OL3A 1KBGH 1VADB 4R0LA 3P4OA 4PG2A 2NZIA 5ICXA 5CMAA 4LSTH 3JUZA 5DRZA 3L5WB 2EDXA 2X1WL 3QRGL 1KSRA 2YHGA 4PS4L 4MNHA 4TVPL 4PJXE 3W82A 4CVUA 1K8DB 3Q1SH 1FIEA 1ZHKA 2GJJA 4JPIB 3NN8B 5KN5A 3BRFA 1YQVL 4O02L 1Z9OA 1DQJB 1BAFH 5I8KL 1VENA 3SO5A 3B4NA 3GJEB 3RL1B 3IDIA 4MWFA 4XTRC 5D1QA 5C70A 5HYEA 1OP9A 3WN5C 1ES0B 3PIQB 5BOZG 1GPOH 1UVQB 2Y6SC 4MNQB 5F7DA 5HY9A 4GQPH 2VWEE 2Z4QA 2HFEA 4JVUA 3RI5F 2C4FT 3O9WA 1A7NL 1ZGLB 4X4YA 1IQDA 3SE4C 4GUPB 3ARGA 3TC9A 3D85B 4LSSL 5C9JB 4F33B 5LG1A 1DQQA 3P77A 4GBXB 1TQCC 4WV1B 4J3TA 4AG4L 3J7HA 5E03A 4BFGA 3QEGH 3D0LB 3SGJC 3MNVA 4LAQL 5I1HL 1I1AA 3QNXB 1X3DA 1YECL 2JB6A 1W72B 1L6XA 3QNZB 3SGEH 1JGDA 4RISL 1XZ0B 1FE8L 1UWXK 4FZ8L 3B2UC 1JWUA 3QHTC 5FEBA 1F3JA 5ITFB 1M71A 4HIJA 4XCNB 3PP3K 2DIJA 4K2UL 1EH9A 1C7TA 4IHOB 3MJ8A 4W6WB 3KYAA 5B3JE 4U6YB 4HWEH 3OX8B 1KXTB 1MLBA 5CEZD 1BLNA 1PY4A 2KUTA 2ED7A 4HT1H 4PGDA 4WW2C 3O45B 1LMKA 2ICWJ 3KVQA 2EE6A 1YQ2A 3HPLB 3PQYE 4M7KL 3D85A 3Q5TA 4PRPB 1KCKA 5EN2A 3HZYA 4JHAL 4DAGL 4PG9B 1MFBL 5IM7B 4PPTA 3RAJL 3BH8B 3VWJB 1EBAA 1JWSA 4U1MB 1C16B 1XEDA 1YEIL 5F7YC 4WGVB 1U8QB 2VWEC 4RA0C 4B53A 3MLRL 3QIUD 2LVCA 4RX4A 1UJTA 1AKJB 1G9EA 1LO4H 2IAMB 3CJJA 1TNMA 3TWCL 4HKZA 1JPST 1TCRB 1PZ5A 3PL6D 2Z8WC 1T7YA 2GAZB 2IH3B 4XC3L 1S9XB 3EYOA 3FFCD 4F2MB 4XNUL 4QRSB 3MV7D 4MA8L 4NQDE 4PLKC 1HHIB 1HOCA 1UJ3C 3HA0A 3X17A 4PJDF 2JE8A 1R5VA 3TJHD 3SGKA 4B50A 4R4FH 2ICCA 1MVUA 3LV3B 3C5ZA 1TVHB 4PUBL 3WUWA 3SE3A 1N5YH 3W81A 1BZ9A 5EZJB 4CADA 3D87B 2PYFB 4XBGA 1FE8H 1KG0A 2N4IA 3HFML 1HKFA 1BIIB 4XPTH 4LHUA 1MEXL 4HZLA 1GIGL 1QSVA 1E4KC 1NAKL 3JWDH 2CDEB 2IBBA 4OZFG 4Q6IB 4X5XB 4U49A 5DT1H 1L7IH 4M1CC 1YEKH 4YR6B 5E8PB 3KR3H 4XNQA 5K9KA 3SDCC 4LLVB 4GBXC 4XP6L 1N26A 5CJQL 1U8LA 3D39B 1RJYA 1KJ2B 4HJ0D 5DK0B 1MELA 1H5BC 1LK3H 1UM5H 2BOCA 1JFQH 4AEFA 4ELMA 2FX8H 4JLRB 4KAQL 3PGFL 1U58B 1OAKL 1LO2L 2X89D 2C4XA 2G9HB 4DGYL 1X6NA 1S3KL 1IAII 1QZ1A 4AJ0A 2NR6C 5I1LB 1JTTA 2YMXH 4QRTA 1HHHA 3IXAB 4K23L 3OPZH 5T1KD 3S3PA 1EHXA 5KS9A 1SBSL 4HW6A 2XKNA 1INDL 1T22B 4JFZH 1ZLWH 1A5FH 4FS0A 3L6FB 1JPTL 1JWSB 1MFAL 1RVFH 2FIRT 3LRSB 4ZSOB 2VDLL 4PJAB 2EH8H 3QZWA 4UT9H 3GMMA 3D3VD 3SKNB 1AXSA 5DRNB 5JMRA 5JORA 2F58H 3KXFD 5F7UA 5H94A 3TVMD 2JK5A 1VB9A 3CPLA 2E27L 1E4XL 1CS6A 3OV6A 1FL3B 1NCTA 4GAFB 5I2IA 1A7QL 3DO7B 1NMAH 5DHVB 2FB4H 4XPGL 3QA3A 2VXTL 1VFAA 4UINL 5I1IL 3GSRB 5E2UL 5FGRA 3T77A 3MQIA 4XCNA 3M45A 5I66A 1R24B 1HXMB 2MCPL 4U1GB 4N8CH 3TIDA 1NLBH 3OB8A 3ZO0A 4LCYA 2CLRB 2ZG2A 1H3PL 3VW3H 3CXHJ 3MO1A 4H5SB 2J88L 2YS4A 3C08L 4OQ1A 4I8DA 2MPAL 4ZOAA 3HCVA 3SDAC 4XNXL 3DARA 4XP6H 4MCZB 2HN7A 1ZSDB 4XVTL 4FQLH 3IJHA 5IMKB 2FNBA 1F11A 3DUHA 4NHUB 4MYWB 2APBA 1G6RH 3QO0A 4AIOA 3MCKA 1QG3A 3PGFH 3DO7A 4R90L 3RIAF 2J4WH 4BH8B 1AE6H 1CFVL 4P46B 4JFFE 1U3YA 4N5EC 3EIFA 4D0CB 5CJXC 5DJZB 1B0WA 3O3EB 4JHBA 4LEXL 5AZ2L 5I76A 3I6KA 5A2IH 3VCLB 1WBXA 1G7MA 4LFHD 1W0WB 3AU1B 4FQQB 1IT9L 4U6XA 5C07A 2P43B 2FR4B 1GOHA 5ELIA 3DX9A 3PXJA 3P4MB 3DVGB 4EEEA 4P59L 2DWEA 2QSCL 3M17A 2AJ3A 3ULVE 4N0UA 3OKOA 2BXZA 1S7RA 3C5SB 4GS7B 1HSAB 1DEDA 2DLGA 4K8RD 4E42B 4PP2A 1LP9F 2C4FU 1DUYB 2AV7B 4E0RA 1NAML 5DD5H 2GITA 1D5XB 4F58L 2YPLE 2H6PA 1NUGA 4NBZB 3BDBA 2DI8A 3M1BA 4LBEA 3NAAL 4X4ZA 4NZRH 3PWUB 1RZFL 4M6NL 3QQ4B 3TEUA 1MAML 3IRPX 5AG8A 2X1QA 3U30B 1YDPA 1C12A 4YDVB 3LHPL 1L7TL 3QPQD 2WBJD 3VFPB 4PRHB 4F7PB 4KZDH 1IAIL 2ZSVA 4NRZA 2YEZB 3QUMH 4YHLH 3PWLB 1NGPH 3DX7B 5GS2D 3EW3B 2VLJA 3MGAA 4Y88A 3WO4B 4X6DF 1HINL 3D3VE 3HI1A 4LSQH 4PD4J 5CJOL 2XXMB 1QFWI 1ZSDA 1BBDH 3WFDH 2VLRA 3HCVB 1XFPA 4JAMA 5T1DL 4BFIB 5DUBA 2XA8L 4KTDL 4E0RB 5JW4N 3KPMA 1H0DA 2VUOA 1JPSH 5ESAA 4AENA 4KROD 3V6FB 1VACA 3E6HA 5D1XC 5TGBA 1S7SB 1GL4B 4HCRA 4HJGA 4X5LA 2NNAB 1I3RB 2GFBB 1UZ6F 1RURH 25C8H 3DURA 4PLKD 4WWID 5FYJU 5L8LB 1MCCA 3B9DA 2HJFA 2VN4A 4L1HA 4U6XB 4RA3A 5I19L 3SE8L 5BMFL 5DJAA 5DMGC 2HFFA 1YN7B 3QEQD 1CXHA 3U0WH 5EUOB 5EBWB 2X1XR 3ALPA 2ZUUA 1J86A 4TNVF 5JR1L 5IBUB 3MV8A 4ZUWA 3TBYB 2GTZB 3CC5B 2EE2A 4GG6F 3BQUA 3SEPA 4NQSA 1YNLH 3AM8C 5D4QA 1OAXL 4HK0A 4G9DA 3BD5A 4HXAL 4JVPA 1U41A 2WBJC 3BZFB 4R7NA 2C3VA 5I74C 1U8MA 3VE0B 3I6GA 3BP4B 4XPFH 4NFBA 4BZYA 1NCCL 3DYPA 5GHWL 2HFTA 2P45B 1EEZA 5IMOA 4MJ5B 1UXSA 2BFVH 2GAZA 3QUKA 1G9NL 5EU6A 4QXWA 3V79C 5BVJB 2WAHA 4Z7VA 1CGXA 1RMFH 2XQBL 1ZS8B 5FYLH 3MLSH 4K94H 4U6HB 1A6VH 5JLZB 5BRZA 1YPZF 3ULVD 2EXYD 1H8NA 4I3GA 4BH7A 5HJ3B 4OD3H 2ARJA 4RGMB 5A2FA 4ODHL 1WWBX 3BKJL 1QBBA 2A6JA 4L8DB 1DBKL 3RWFB 1UZ8B 1OAQL 4KJYB 2A1WL 5TE6H 2BX5A 1A6UH 5ACMA 4YWGL 1P7QD 3V6OA 1A7RL 4R4ND 1UCTA 1KJ2H 1NEZA 3O9WD 2YD1A 3WNOA 4X4YB 2J8UB 3GO1L 2HLFD 4OCLC 1UADC 3QDGD 4KMTL 2QADB 3GDBA 5DD3L 4OTXL 3G6AA 5DUMH 3CFCH 5BS0B 4U3CA 2UZIL 4NN5B 1I8MB 4F37K 4Z0BH 4GRLC 2Z93A 2JF1A 4TTDD 5IG7B 2X4OA 4PRPD 4W70A 1R3KB 4M4PA 1EXUA 4Q2ZB 1X5YA 4RFNC 4DQOL 2O5ZL 4R9HA 3TZVD 2V6HA 4YHKH 2R0WL 3MGOB 2M26A 2NCMA 5F72S 3VGEA 3L3HB 2A6KB 5A2LH 4UAOC 1AO7D 2RGSA 1OARL 4GMSH 4XPHH 12E8H 2B4CL 3BGMA 2FJFA 3AREC 5EUOE 1CL7I 1A0QH 4L4TB 1A4KB 3RWCB 3LN9A 4KI5E 1HIMH 2BSTB 3HLAA 4JDVB 3D2UD 3RWIB 4W68A 4ONGL 3I9GL 1FVEB 1FG9C 4J3VA 1JHKH 3V5HB 1U6AH 3O6FC 3ESUF 4RBPK 5L9DL 2PTUA 5C0CB 1T2JA 3C5JA 2PYEB 3BN9C 4PJAE 1AR2A 4NNXA 1Q9KB 2JCCF 5HGGS 5T3ZL 4WI7A 2RHEA 4RMUA 1GGIL 3ARTA 4POYA 2GIYA 3LV3A 3RDTB 1I9JH 1U91A 5AWNL 3UTTB 3ELAT 5J9PB 1ZHKB 1UJ3B 1DBAL 5EULV 4MAYC 4F7EA 1HHJA 4Z77B 3DRQA 4I13B 1FGVH 1QFUL 2C1PB 3D6GA 4Y4HC 3LS4L 3I50H 2X41A 3BUTA 5LJYH 1WIUA 1JTOA 5IMMA 1IL1B 3OF6A 2B1HH 5ERWB 3E2HB 3TA3C 1FYTB 4NQCB 1XF2A 2HTKC 4YHOH 4NZDA 3BZEA 1QBLL 5EZLA 3MRCB 2J8HA 2DQHL 5L2JA 2AEWA 2I5YL 1D5ZB 1AE6L 1PZUB 1T20A 3T1FA 3TT1L 5LGHH 4G6ML 3BKCL 4Z9KB 4D8PB 4HH9A 1B0GA 5IWLA 1KEGH 1FVDB 4K9EL 5GS1A 4Y5YB 3OG4B 4NN7B 4XB8A 5TDOA 2XN9A 3PWVB 4N1HB 5FYLD 1DBJH 3HC0B 4H8WL 1SEBB 3N1FC 2WWKO 4O2CA 3P9LB 3QUXB 3WUWG 3X11A 4IJ3C 4MNQD 3FFDB 4X6FA 4D94A 3V4VL 2VO5A 4HWUA 4PRNA 3CVIH 2K7QA 3GHBH 4FQCL 3EKCA 5CHNA 3VXSA 2DOCA 5IB2A 1CXKA 3GNML 5CWSB 3TJHC 1RZ7H 3OAZH 2CXGA 4YDLC 3WKMH 2Z8VC 3X12A 4MCZA 2IADB 4NT6B 4HIXH 4X7TA 3JTTB 4LEOA 1VCAA 2D0GA 3QIBA 4Y4KB 3OXRB 3VGGA 3BH9B 1C8PA 5ESVA 1ZKAA 1OTUD 4JY4B 3E3QE 5BQ7A 3N06B 4NJ9H 3TLRA 2X4TA 1J7VR 3NACH 1MRFL 3F6IA 4LCCC 3FQRA 3WFEL 5SV3A 1MCOL 3NVQA 1AGEA 3RKDD 1FFNA 2EDLA 4KHXL 4Z7VE 3SGDI 1WBYA 3SDAA 43C9A 2VQTA 3QULB 5IW6A 1B0GB 4DVRL 4ZFGL 1TJHH 1VFUA 5E8EB 4OFYA 3X3FL 3FT4B 4J3SA 3BEVB 2N1KA 1WK0A 3IETA 1P5VA 1KB5L 5HYQA 1QFWL 4M03A 3V6ZA 2M2DA 1NGXB 2AGJL 1CN4A 2E6JA 1A1OA 3FQNA 3W0WD 1MFCH 3SJVA 4GG8B 3PQYA 3PG2A 2J8UF 3P9WB 3U83A 2XKUA 2LVEA 4N8PA 4DEPB 1KIQB 4NN7C 4PJ8B 1JPFB 4UQ3B 2V5SA 3SDXA 2B7DT 3REVB 3QFJD 4HKXB 2DQDL 2K7PA 1C5CH 2VSDA 2HJFB 4UNUA 4BQ9A 4KKCC 2ZCKH 2YOCA 3TYFB 1UACL 2ADFH 3C9NA 1XGYH 4FQ1L 3WLWD 4CDGC 4BSVA 4CBPA 2A6DA 2DKMA 3RUGA 1HHKA 2ZKHL 5M95B 4Q58C 4NUGL 5IVZB 1GCFA 1LHZA 4YR6A 3WDHA 2J3SA 4M62L 1F11B 3T3PF 2M1KA 4P2QD 4LVEA 4PRHD 3WHXA 3P4MA 2O93L 1NCBL 3N50A 2EDRA 3OJDA 1J8HD 2BVPA 5FKAB 1EEYA 2BFVL 3AFLA 3OBAA 4HUKB 1MCLA 3RU8L 5CEZE 5F9JB 4PRAA 1SMAA 3GI9H 3O2DL 1JF5A 5E4EC 2DB8A 3RWCA 3I6KB 1HNGA 2EDKA 1V7NL 1QSEB 3IS1X 2QKIA 4KHXH 1XAUA 4DZBA 1CDJA 3DYOA 5C7XL 1F4HA 2DM2A 4NWTL 3DIFB 2MCG1 4HLJA 2X4SB 2ZP0T 1C08B 4NM4L 5KOVC 1NEZG 4GRLD 3IJYA 3L5JA 1SYVA 3CDFA 1HWHB 3CPLB 4W4OC 3OR7B 3QO1A 5D2NC 3TN0B 5I1KL 5F9DC 3OKDB 3Q48A 5LQBH 1TIUA 1MRDL 4NC0B 2DWDB 3MRPB 5ACZA 3P11H 3T4YB 1R3HA 3AB0C 3MRMB 1BREA 3HUJA 2NTSP 2ZWLT 2F74A 1VDGA 4WO4C 3AREB 3J8F7 3BHBB 2W9EH 3V6OC 3K2MC 2YK1H 3EJJX 1VFMA 4Z0BL 4P5TD 4M7KH 4XGZA 4YK4B 4UU9B 1FZMB 1HH6A 5ENWB 4IM8A 1B4JL 4U1SA 4U2YA 3VI4F 4YUEH 3EYQD 5EUKA 3D25A 5D7LA 1OM3L 2VZOA 1TPXB 3W0WA 2GJZA 3WFZA 1T21B 5EZOH 1QBMH 4MA7L 5AYUH 4LFHG 1PEWA 5GIRB 2E8YA 3NIDF 4APQB 1JNLH 1YYML 1CE1L 5I1JL 4EIGB 1I1AD 3NPZB 4OFDA 4OZGE 5HHMD 1D9KB 3SBWA 2ZUXA 5DD6A 4S1SH 1Y6KR 3BUYB 2YUXA 1WEJL 3QQ3B 5IVXE 5FOBB 4HG4J 2B2XL 2HG5B 1MPAH 5HGAB 4PJBF 3UJIH 1XGPB 4HZLB 4RAUA 5IQ9B 1DL7H 3QUMB 4XHJC 5CSZA 1TLKA 4WJ5A 4PP1D 1F6AA 3Q2CA 1JHKL 5C0BA 5KANG 4F7TB 3QCVL 3O6LL 4PR5B 3SY0B 5CIPB 3IFOA 2C3WA 3HC4L 5GZOD 3STLB 1ZA3A 1OSZB 3GMOA 2HMIC 4HJJL 2EDFA 1LQSR 3TV3H 2IALA 5A16A 4RWHA 1BQSA 4HUVA 4LASL 3QIWA 1SJEA 3DX8B 4X4XB 4HK3N 5FK9A 4QO1A 1IM3A 4MD5B 1CK0H 1UA6L 1OTTC 4JQIH 3QXWA 3MBED 3LY6A 1P7KB 2IBGA 3GJFH 1A4JA 4PTTA 2NZ9D 4W4OA 4M6ML 5BRZD 4JKKA 4X6DE 5C0AE 2UVFA 1FNGA 3EYQC 4MAYA 3V5DB 4PP1C 4P9MH 4G7VH 5TGBB 2UY7A 4L8SB 3VG9B 3WEXB 4AENB 4TVPD 1CICB 4M3JA 3U4EB 1YEFL 1LE5A 5E8OB 4U1GC 4M7LT 4YH6A 2VDNH 2GW5A 5I18H 2VXSH 1RULH 5JPMB 3VFTA 3RJQB 3QO1B 1EJOL 4JG0L 4X7DC 1QBML 1S9XA 2CUMA 1U8OA 1S7WB 1BJ1J 1AY1H 2ESVA 2Z31D 1Y18A 4J3WA 3RZCC 4MNGE 4UV4L 4TVPE 5FO7A 1P7KA 1T5WB 3HI5L 5JIPA 4G6AD 3UO1L 4TOYH 1TCMA 2R0KL 1PLGL 1LO5A 5TQ2L 3R0MA 2A73B 3VXUD 4HC1H 2A73A 2CH8A 4RGOH 3ARFC 4LPCA 4Y2DD 3Q0HA 4PJDA 4ALAL 5HVHB 3NPSB 3O4LA 3Q1SL 5C9KA 3FONA 3UTTD 2UUDH 2VDPH 4M7JH 5C92A 3DROB 3PL6C 5KSBF 3CVHB 1I9RH 3LDBB 3NFNB 3PNWA 4LCUA 2QQLH 2Z92B 2K3TA 2E27H 3LOWA 2XYCA 2VLJE 2A0LD 2H1PH 4L4TA 4WY7H 3QDAA 4OIIL 4P4RB 1EK3A 2R2BA 3MRFA 1AO7A 2EXWD 5I9QC 2MJWA 3MJ9L 1JL8A 2Z4QB 2AV1B 5CP7A 3U4EA 1LEGB 2X4PB 1WFTA 3U0PA 5SWQA 1UYWL 2MCPH 4NGHH 3QEUB 3MRLA 4EKXA 5IQ7H 2LQRA 1NLDH 5D1ZC 4Z5RA 4ZXBB 3MV9D 5DZOA 4UQ3A 3G5XB 4I18A 5FGCB 3TA3A 3GSNA 4TYUA 2YA2A 4XNXH 3C60A 3TZVA 3B8YA 1ZLSH 2HT3C 4K55A 3QDGA 1VACB 2NY6C 1NDGA 3OAZK 1KJ3H 4E41B 4QNPE 1QKZL 4AIXA 3MNWA 5ADPH 4H0HB 2YWZA 1AY1L 4PRPA 3PWPD 4G8GE 3AS3A 5JXEC 1IAMA 5E8EA 2R29H 1JNNL 4G6FD 2OBGA 1JV5A 4HT1L 3D39E 2FYYA 3LKPB 4NQED 4K7PX 1FP5A 4F7TA 1UACH 2ADFL 3VGFA 5GS3A 4XBPB 4O2FB 1NC2B 1AKJD 1RV6X 4Z7WE 1JHLH 2DIAA 1Q0XH 2NY5H 2W0PA 5E7BA 5HI5C 4XMPH 5E6ZA 3OB0K 2CDFB 1YYLH 5JNYA 4P57A 1MHPH 4ORGB 3IDMB 5C08A 3QUYD 3DUUB 1FFQA 4RMQA 1QNZL 1J0IA 4NZRL 4JGMA 1A3RH 1KPVA 3F5WA 3KLHD 2CKBH 1OWRM 4LNVA 3LKNB 1JP5A 5KZCB 3C5ZC 4NCC2 1T7VA 3FO9B 2JB5L 3MRQA 3OJVC 1PYWA 4NQEE 1BVKB 1LWRA 1WZ1L 1PX3A 5C07D 3MA7A 5HD8D 3BP5A 3EYVB 1YZZA 3ARBC 4OM0L 2XN9D 3S98A 3FFDA 1DVFD 3ARBB 4ZUUB 3U4BH 1U3ZA 3C2AL 1VERA 4HGKC 3WXVL 4X7SH 2O5XL 1R3IH 2C9AA 1NMCC 2WP3O 4HPOH 2NY6D 3NA9L 3DX6A 2IANB 1ES0A 4PJGE 5FCUH 4KTDH 3ZE2E 1RUAL 3X14B 1MF2L 3DX6B 2IQ9L 3ARZA 5DSCA 4K3JH 3V4UH 2DDQH 2IG2H 4DCQB 1X5IA 4P2OC 3JZ7A 3GGWB 5IFAH 1A2YB 1CYGA 2VSCA 2Z9TA 3B5GA 2XI9A 5EOCL 3GMPA 1XR8A 3ILQC 3REVA 2WWMC 1S9WB 2F5BL 1CD0A 4LMQI 4XAWH 5E1AB 4OCWL 1NBVH 2Q6WB 5KVMC 1MHHB 1YY9C 4HUXA 5JUEH 3BMWA 4P4KC 4IRJD 5DDHA 3KHQA 4P3DB 3C60D 3WJLA 4XNUH 4YNYA 2AEPH 3UROR 2EO9A 2A2QT 2PTVA 3ET9F 1J0YA 2PYED 2F8VA 3IAGC 1F58H 3C6LD 3O2WH 4HIIB 3TIDB 1ZOXA 1RZGB 5ECJE 2G75A 3N1MC 1QNZH 2YEZA 2KPNA 4QOKE 3UTPE 3UYPA 3G04B 3LRGA 3VWKD 5I1GL 4LNRA 1RI8A 3FZUD 3WFCH 1FDLL 4R4BB 4HFUH 1SJHB 1ZWIA 2FD6L 1CF8H 3LKPA 3PGCA 3RA7L 2VKXA 4ODUB 4D8PA 3DJ9A 3RP1A 4DZ8B 1Z9MA 4RAVB 5SX5H 4YGVB 3R0NA 1FLTX 3L3KB 3O6LH 5DGRA 3MODH 3U0TA 5DSCB 1JTPA 5DI8B 4LLUA 4XB7A 4HKXA 2P44B 3O6MH 2OR8A 3EO1B 3MJGX 4UILL 3UZVB 2AXGA 4NOBA 2VNCA 2O5XH 1FZKB 1I7TB 3BH8A 4HAFA 3RL2B 4PRIE 2Z31C 3KPOA 4I4WA 4O9HH 3ARBA 4ZUUA 3MV7E 1Q94A 3ZT7A 4JFXA 3EDJA 3ILQD 4Y5YC 5I75C 3SKOA 3H8NA 3ALWA 4KK5C 2RJMA 3AGVA 3LDBC 2ZZUT 1MCHA 1UXWA 2G9HA 5D2NE 2DLHA 5FO9B 4XVTH 1J1PH 4NQDD 4DKEL 1E4WH 4F9LC 5KVFL 2F53D 3RHWF 4PLJD 4RAVA 2XOTA 1I1AC 1DE4A 3DMMC 3KNBB 4LPVA 4LVNC 2W60B 5KAQG 3U48A 4ZUVB 5JDJA 1FIGH 3SCMC 1PD6A 4IMLB 5JIIA 1Q8MA 3NIFF 2UWEF 3FMGL 5FF6B 3P4LA 1ZA6B 3QI9A 2AXHA 3BW9A 4Q9RH 1HNFA 2KZWA 3RPIA 2R8SL 1PAMA 1CFVH 2VR5A 1W72H 5I1EL 5IMLA 5JOEA 4EDWH 4XBGB 1EHAA 1KNOB 5LGJB 2X4QB 4E9LA 1CI5A 1K4DA 3R1GH 4LOUC 1J0ZA 1QLRB 2FLRT 2NY4B 1CXLA 4L3AA 3O2DA 4HFUL 4MVBC 2CRZA 4HFWB 2WUCH 4ELME 1JUFB 1FL6B 5HVGB 1A8JH 3V4PH 3R06B 3T77B 1T1YA 1MHHA 4Y4KD 4M5YL 4M8VA 1T5WA 1J88A 1TZHA 1CICC 3RI5K 4Z78A 4LSUL 4PJEB 3VXRA 4K71B 4KU1A 4HWBA 3PGDA 1TZIA 2IWGA 1MJJA 2BDNH 1OAYH 4JANB 3EJZD 2B0SL 4ZTOH 2WANA 4C56D 3TBWA 1FVCA 5IEHB 1NC2A 5KS9E 4RDQF 3NMEA 2FH8A 3FB6A 3NA4A 4QXUH 3BPCB 3QHZH 1DEEB 3QWOA 3IVKA 4EQ3A 2GY5A 2DQJL 3MBEB 5KJRH 3CFBB 4WY7L 3VRLF 2QBWA 3H9YA 3JUYA 4KHTL 4Y1AB 1E27A 4FZEL 1X5LA 4M1CD 4QRTB 1HSBA 5MHSD 3AMKA 5B38G 2NW2B 4LDOB 5F88A 3NGBC 5CJOH 4X7FC 1OW0C 2APFA 2WV3A 2FJGB 2FX7H 5GRWA 1DQDL 4HD9A 1XF5A 4UQ2A 3KPQB 5FV1L 2NZ9C 2DM7A 3GSUA 3NCJL 4TTGA 2H8PB 2C1OA 3C09B 4ODVH 4P5TA 4DGIL 2P8MA 2BOCB 3OKEA 3MFFA 5I0DA 1OD9A 1GC1L 1M71B 1U8OB 3T09A 4XCYB 3UC0L 3BPNB 3B9KC 1R0AL 4KUCD 1JF1A 1N6UA 3QEQB 4YAQB 4OI7A 1OB1A 5T3ZD 4QXGL 2AKRB 3KPRB 1HKLL 3BQUD 5KVEL 4JFFD 2VC2L 1KCUL 5LVEA 1A1NB 4HMCA 5FYJD 4LCWA 1CDHA 2YRPA 2WLZA 1JYWA 3IKCA 2YPVL 5I15H 1YMME 1JV5B 3RZCA 4LIQL 3ZKXB 1NANI 1MQKL 3FONB 1BVLA 4X0KA 1I75A 3S5LA 3MLXL 2VABB 3ZTNH 2CK0L 3O3DA 1T1WA 5SWSB 5GIRA 2VXQH 2XKSA 4WW1A 1CICA 3SKMB 1DBBH 3K1DA 4WTWA 2FGWL 4Z8FH 2HFFB 1JZ2A 5BZDA 1A6TB 1A64A 1FNGB 4RMVA 2XA8H 5EU4B 2FEDC 1S7QA 4KDVA 3WIFA 4IMKA 5JO5B 2CKBL 2DMBA 3MZGB 5B3JF 4RCAA 2DKSA 2OJZH 5CIPA 3I75B 5DK3A 3ARUA 3ZKXC 3F7VB 3NN8A 4IDJL 3MRLB 1JF6A 1X5JA 2F74B 4M4RA 3AB0B 2E9BA 3SKUD 2E8ZA 4AQOA 1EVTC 1FRGH 5A2KH 3CCHA 3UJTL 3JV6A 2Y07H 1RUPL 3MLVL 3BUYA 1ZT4B 5C0FA 4H1LH 3HPLA 2Z91B 4MAYD 4HGWB 3FAWA 4MD0A 2IQ9H 3MOQA 3PDDA 1N7ML 1LP9E 4DN3H 5I71C 1LDSA 1OW0A 2FZ3A 4OJFL 3KPPA 4JM4L 1LEIB 3CSYA 4N8VG 4NQCE 5CS7A 4ZMAT 7FABH 3QEGL 3TZVC 2A74A 5KSVB 3NFPB 3JWOL 4GKNB 4Z7OF 4N0YL 5JIHA 2WUBH 4CW1A 4OCWH 3OKLA 5F7HA 1E6OL 5HYJD 5TDNB 1YA5A 1BQHG 1J05A 5EDXA 4MJ6B 1I1AB 1U8PB 2GJ6D 1HQ4A 5JXEA 1ZA3B 4QGTA 3KPQA 4UOW1 5C0RH 4AEEA 2YXFA 4WI8A 2ESVB 4EUPH 2NX5A 2DN7A 4OZGA 4PB9L 1S7WA 5C0NC 2D03L 4BFIA 1QQDB 2ZUQB 5DURB 2CXKA 2EYRA 4J3UA 5MERB 5B4MD 1BGXH 1IQDB 3W11C 4RSVA 3MLRH 1HQRA 3D0VA 5DD6B 3RGVC 1GJIA 4UIKH 4RFOL 4H1LG 3AAZA 2DS4A 4L8CB 3P4NA 3L3GA 4YHZH 3GBLA 2NY0D 5GJSL 3BPOB 2AP2A 2EXWC 1DVFB 1KN4L 4DKFH 5FYLE 3SQOH 3PP4L 2JJWA 3ARXA 3NFSL 4KWUA 4PGBB 1BX2A 1RU9H 4ETQB 4MNHB 2R4SL 2P5EB 3PWNB 3L6FA 43CAB 4DN3L 1ZANL 2UVEA 4HUXB 4I0CC 4PJFA 3U82B 4Z7UF 4ZS6C 3PHQB 5TF1H 3WSQH 5IBTH 3BIBX 4C4KO 2XZZA 4V1DD 5DHXB 3VRJA 3U9UB 3WV0A 1ONQB 4JE4B 1S7RB 3FRPG 4O58H 1R3JB 4NO0A 4JFDB 4OCSH 4X4MA 5FDWA 1LDPH 5HDQL 3RRQA 1N5YL 4JPWH 4WENB 3TN0A 5EU5B 4PY8I 2XPGA 5FO9A 4YBLC 2K1MA 3CFJA 2O61B 1JFQL 4YPGA 2OZ4A 1S78C 5IBUG 4S1RH 3AVEA 1NUNB 4ZO7A 1JNJA 4KAQH 5FM8A 1G6RA 1T66C 5GGSY 3KR3L 4MSWB 4AL8H 2DIBA 5FIEA 4MNGA 2CDEA 1GGBH 4D0BB 3QUXD 5D8JL 3UYRH 1F4YL 4GSDL 2BXYA 3KPPB 1FFPA 2FWOA 2W0KA 4KQ3H 1RJZB 3R8BB 2VB5A 2NYYD 4LCIH 4LPTA 4PRNB 4LLYA 1XH3B 1D6EA 4HUWA 3LRSA 4UIKL 1CU4H 1TVHA 2VL4A 4FN0A 1CXFA 2D9CA 3VD4A 5KS9F 5L7XH 1FC1A 5IVZA 1R6VA 2X1OA 3AS1A 4GMTH 1FGNH 2VR4A 5I1LA 1ETZB 1SJXA 3EO0A 1XR8B 4HDIA 4J1UB 5DI8A 4K7PH 2RIKA 2DYPA 2GSGA 3B43A 2BSED 1FAIL 4YXLH 1IGJB 2FR4A 2GSGB 4KV5F 1JMXA 5C2UB 5F9OL 4J2XA 3DECA 4JG1L 3ZL4H 3ZSTA 3T2OA 1DUZB 4KKBC 3ARSA 3MRBA 4MD4A 4PJCE 1IKNA 3UBXI 5CGYD 5GRZA 5DDHB 3P9MA 4WTXA 2Y36L 3VI3E 2VN7A 1PJ9A 4LNRB 1QSFE 3RX7A 3AUVA 4WI9A 4ZD3L 1MCSA 3EUUA 5HDOA 4E41D 3SGEI 3KPLA 1SMOA 4KVCL 4XAKE 2YBRA 5BVPH 1HYSC 2XKNB 2O5ZH 2H9GA 2BOBA 4JRXD 4LCWB 1CK0L 4G6FB 5GZNC 1FZJA 3IXAA 1FFOB 3MRRA 4LDEB 1G9ML 5DR5L 5F6IB 5ADOH 1GH7A 4QOKB 4P2OB 4X9HA 4L8BB 4U1LA 5TF0A 4HMDA 5DMIH 2PW1A 1GVIA 1WZKA 4TRPL 3SDYH 1JBJA 1A9EB 4GOSA 2B4CH 1G7LB 3IDMA 5C08B 3DETD 5D71H 2H3NA 4EI5C 3STZB 5C0AB 3SE3C 3ZE1F 1CDUA 4G7VL 4JLRA 4NKMB 1QYGH 1MHEA 1U8JB 3EYVA 1PFCA 3QA3B 3N9GH 4ZFOA 1A7OH 1GOFA 4YXKH 3GJFB 3W9EB 4WFFE 5F9WB 3QFJE 1JPFA 4V2CB 1FGNL 3H2WA 2YSSB 4S0SD 3QQNA 1F4AA 2H26A 3DXAD 4PRIB 1A9BB 1KYOJ 5L2JB 3MLXH 3ZTNL 4MDIB 4ORGA 2NX5E 2P48B 4G8FA 1F42A 1G7PB 1KCVH 3V7AE 3EJZC 1HI6B 3WBDA 3ULUC 2DQIH 1YECH 4HQQL 4JHWL 5C1MB 5CKAA 3DXAE 3WL9A 3NPSC 5TDOB 4NKOB 1NDMB 5E5UB 1YEHL 3CFDA 4R2GD 1Y0LA 2X2YA 2ATPB 4UB0H 5DD0H 1BOYA 2BC4A 4ONOA 1YJDC 4KI5C 4OLZH 4U3XA 5GZND 4TUJA 2NXYB 4M93C 4WCYH 3TN0D 4OZFH 2OL3L 4OZHA 2H32A 1A47A 1F5WA 4J6RH 2NLJA 4M6AA 4Y16D 5SWZE 1J18A 4PRDB 3ZDXF 1P4BH 4MXVF 4KROC 1U92B 2W65A 1DJSA 5JW3L 3WE6A 3RWEA 1A3LH 1U8HB 2GK0A 4O4YH 5EORL 1MHCB 4JO1L 4K7PY 3SO3C 3H6JA 2JLLA 4JFFB 4PJ9D 1CBVL 2VLKA 5CCKH 3KLHC 4KRPD 4WHCA 3WJJA 3IFNL 4FHBD 2ZUQC 2VITB 1ZLWK 3A67H 3TVMC 5D7LD 4EUPA 4YHNB 3F58L 3NCEB 4WW1B 3GJFK 4M5ZL 3RZWA 1PSKH 4EI5A 4PS4H 4WIQA 2G5BA 1MCPH 3RU8H 1X5XA 3O3DB 4I5BB 1P9MC 3RDTA 5DJXA 4NP4H 2OMBA 2FZ3B 1OP5K 3UTOA 4JDZB 3QR2A 3H9SD 4LF3A 1GGCL 2ZJSH 4PY7A 1RIUH 4NSKA 1JNNH 4F3FB 1I3VA 1FNHA 2RB8A 3FB7B 1OAXH 1MHPL 1CQYA 2FO4A 4WWKA 2X09A 1G7JB 2JELH 5EBMA 3LEYL 1A9BA 1YQVH 4O02H 2FEEI 4YAQA 2Q7YB 1UZ8A 4RDQG 3U1SH 4HBQA 3SDXE 3MGTB 3EAKA 5EBWA 1AD0B 3I3BA 3S3JA 5IFJB 1X4YA 2V7HA 1XF2B 1XCQB 1NAKH 1MCBA 3PP4H 3MREA 2EXYC 2DBJA 4PV8A 5GGSA 3O4LD 1GAFH 1T66D 2Q8AH 2YD9A 4GG6E 2D7PA 4GAGH 2OYPA 4YDKH 5DJXB 5IT2L 1AR1D 1RIHL 5E70A 4U4BA 4GO6B 4DKDC 1D9KC 5T33H 4LPUA 4KVNL 4MD5A 4PJHA 4EVNB 3R8QA 2AAVA 3QPXL 1UJ3A 3E3QC 5CD5C 4Y1AA 4Z78B 4M1DH 2PXYB 5BRZB 1HI6A 2ZCHH 4UUJA 3MLSL 4LLQA 2HT2D 3HMWL 3TO4B 2OX5A 3V5DA 3JV0A 4JQIL 5HYJB 5AAMA 3NIGF 5IBTL 4KI5F 4ZFZA 3MLPA 1YPZE 3E8UL 5IJKA 5MP6L 3ARFD 2WWKT 5E00B 3WHE0 3ULVC 1BD2E 2WIIB 2ZSVB 2P5EE 1ZT1A 3H9SE 2CR3A 4G3YH 1IM3B 2V9TA 3ZKND 4GBXA 1YUHB 2X1PA 3BZDA 1XIWA 1JN6A 2F9BT 3TNMB 1DQTA 3D1MC 1IARB 1T3FB 3PE9A 4OTXH 3HE6D 2G5BB 3VXTB 4HHAB 5C0EB 1WBZB 3E6HB 4Z18A 1W0VA 2WBWB 5JTWA 5IMOB 4FQ2H 5FKPB 1MI5B 3GMNA 5E7FA 3EYUL 2E7BA 4YXHL 2IBZY 1B90A 1FYTE 3O2DH 5DF0A 1XF3A 3F12B 4M3KB 5I8OL 1ZAGA 2IALB 3GHEL 1Q1JH 4P48A 4GMSL 2VLJB 1DDHB 2XIDA 1CT8B 2X9XA 3H9HA 1C1EL 3NCYP 5D7IF 5F8RC 4Z6AT 4XH2B 3T4YA 1UB5A 1JYVA 1EPFA 4L9DA 1L9MA 3FOMA 4PJIE 3OB0H 3OJ2C 1NEZB 4L5FL 4YQXH 5J1TC 3TCLB 2A6IA 1I7UB 4F57L 4ERSL 5JHDD 4HF5H 3MLWH 3BKYH 3K2UL 1E6JH 2CKBB 1D9KA 4O51A 3AXLA 4I2XE 5SWSE 4W6XB 2V7NB 4QEGA 2GJ6E 3G5VB 2D9QB 3CFJB 4OD1H 1DCLA 4WTZG 1VHPA 2B1HL 1GYAA 1FQ9C 4HS6A 1YEJL 1CLOH 1F90L 4ZOCA 5LAXB 4TULL 2X10A 5DZLA 5EC1A 3T4AA 1ORQB 35C8L 5GRYA 3P0VH 3VFMB 5H35B 2ZNXA 1I8KA 2VIRA 2YD8A 5E1HB 1NGQL 3MUZ1 3PWPB 5IHUH 3VXOA 4YE4H 5IF0A 3RVXD 2ZCLH 3QXAA 4HUUA 5DD5L 3S34H 2I60L 3ORJA 1F3DJ 5E1AA 5DHYA 4WDIB 1CE1H 2CIIA 3BMVA 4YJZL 5I1JH 1NKOA 2YC1A 1CFNB 5ITBL 1F4XH 3RBGA 1MJUL 1OT1A 1QSEA 3WDIA 2VLKE 4U1JA 5TE7H 2KBGA 1MH5B 5AD0A 3OXRA 3RVUC 5CGYC 3VGAC 1I1CA 3AMLA 3CDGB 2QSVA 3ZE1E 3JTSA 2R4RL 5BCAA 6CGTA 1RZJH 4M7ZC 4O00A 4U1HA 3O11A 3UBXG 4UT9L 1H5BB 4JFDA 4OLWH 3OF6D 4XVUC 3F7YB 2VXTH 1JHLL 4UINH 5I1IH 2YZ1A 3WO4C 2V2WA 3VXUE 1KV3A 1V7MH 4X7CC 1ORSA 2BMKA 3HHRB 4NNYA 2F5AL 1WT5C 5CUSL 5D5MF 1A2YA 3RWDB 2A9ML 5IF0B 3BEVA 5J11B 5C6TH 1NAMA 1KC5L 4CMHB 1G1CA 5E9DD 4KGLA 5I6XB 1ORQA 4ELMB 4RWYL 5H2BB 3L9RA 3UAJC 4MNGB 4KHTH 4EJ1C 2CO7B 1HCVA 1Z6JT 3CDGA 4XWOD 3K8LA 4OF6A 5FB8B 5GRXG 2AK4B 1NEUA 1T6VN 3S35L 3S4SA 2FHFA 3QRFM 1FNSL 1HHKB 1UZ6E 4LP4A 5CGMA 1TTUA 4YPGB 2PXYC 3NABH 3I84A 4I0PA 5CSGA 5JHLL 4L4VB 2WWMD 1S7UA 3LKSB 4XTRD 3U0WL 5FO7B 3ZTJH 1UCBH 5EBLA 4Y8AA 5I18L 1AC0A 2CRYA 4PJHE 1XIWD 1DQML 3PV7A 3DGGB 3MRQB 5F7KC 4UTAH 5MENA 1GZQB 3T0VA 5DC0A 5FO8B 2XZAL 4JM2B 4N68A 3MXVH 5B39A 1MJ8L 2NY3C 4N9GB 4XC1H 1MFDL 3INUL 4XXCC 1A02N 4GG8A 1VFBA 5IK3B 1UG9A 1T0PB 1CBVH 3ZDZE 1U0QA 2LU7A 2HKHL 3TO4A 4Y4HA 3C8DA 4XMLH 4MJ2A 5FAAA 4OZ4B 3S88L 2VUYA 2JIXD 5KTEH 3VD7A 2BRQA 1HQ4B 5ICYA 3GBNH 4OF3A 2IH3A 5FGBC 3WMSA 5TH2A 4LVOC 3RKPA 4GXVL 4HWNA 3WJJC 2AK4A 3D9AH 4P9HH 4YBHA 4LEOB 1S7VA 1QO3A 1K8IA 5J06A 3IAPA 3MOAL 3ESVF 1WIOA 3B5HA 1JNHA 1MCEA 2P24A 4HMEA 4ODHH 1TITA 5GXBB 3EYFB 5HI5D 1IRAY 3CZFA 4YDLB 5D72L 1EAJA 1SM3L 1T1WB 3HZYB 1NGYA 5E2JA 4U31A 5DK0A 4HKJA 1XGYL 2HKFL 1XT5A 3BH9A 1KC5H 2PW2A 4FQIL 4JR9L 4TSCL 2GUOA 1IZJA 1DFBH 3T2NL 5CD5D 4JFEB 4X6FB 1LEKA 5FA3A 1FYTA 2ARJQ 3ZHKA 2EDTA 1WT5A 4KK6D 5IQ7L 3G9AB 3MYJB 4JFDD 4LKCB 4NPYA 3UP1A 5IVXB 2R2HB 2EYSB 3TT3L 4DGVL 4R2GC 5J8OA 3NABL 3F7VA 1HWGB 5DLML 3HZMA 4ORZC 4PUBH 5F3BA 4XPAL 5HYSA 2EYTB 1DANT 4UILH 4U6VH 2ZOKB 2F53B 3OKMB 1R5VB 4P2QE 4A6YA 3JXAA 1VFAB 4S1DC 3GI8L 3VA2C 4JO4L 4UAOB 5IR1A 4O2FA 5F96L 5D7LB 5L8KB 3FO2A 3LQZB 3JWDL 4Q6IA 3FRUB 4K8RH 2DM4A 1AXIB 3Q5OA 1KG0B 2V2TB 2XG5A 1EEUA 4KZEL 4G5ZL 1BZQK 2L7JA 4ONFL 5E8OA 5HI4D 1AGFB 4GXVH 1X5FA 2O5YH 3I2CH 1BP3B 4R4FL 1AQKH 1LD9A 2ZUYA 1DZBA 2ORBL 4GKZB 4YFLI 4MJ6A 5ACZB 2IJ0C 3RVWD 5E9DE 4L4VE 5ALBH 4JM2C 4F9PA 2AJZB 3EDFA 1X5ZA 3VRLE 2FX9L 3FB7A 3HZMB 4XMKH 3HRZB 1P4IH 4P3WA 1SJVA 2XICA 2R2HA 1C08A 4HKZB 3RTQA 3C6LC 2NY5C 3DX8A 5AZEH 3V5HA 2GK2A 4G6AC 2QQNL 5D1QC 5CBAB 3BP7A 1LE5B 1JUFA 3V0WH 2D7MA 2KZ1B 2Q3ZA 4NZTH 4LAQH 5JW5B 1OQXA 4PJGB 1DDHA 4QRQA 3NIDE 2HMID 5IESH 5IVNA 3QCVH 3QXVA 5MI0C 2YPLB 3NA9H 3KDMA 4OCYH 2FO4B 3T3PE 2PO6B 3TYGH 4MB4A 5C0IB 1ZLUH 5EWIH 5KSAC 5TJWK 2P24B 1XGUA 4ZQKB 3FHAA 1JGLL 4WU5B 1EFXA 1T1ZA 3VWJD 2X4RA 5K93A 4UT7H 2P5WE 2EDEA 2C5DC 1RZKH 2B39A 4NKQB 1EJ6A 2EH7H 1E6JL 3TBWB 3GK8H 3QIUB 1CVSC 3U4AA 5EU4A 2H32B 4PJ9C 4ZPTA 4JANA 5B38B 1IC1A 3D18B 5HVHC 4QRSA 5CZVH 4GW5A 4P99A 3PHOA 4NN5C 5ESAB 5DWUL 5TF1L 2I25N 2ICEB 1V3MA 3D25B 4MMZC 4J4PC 4ONHA 4ZS7L 2KDGA 3VGAB 4S1RL 3C6SA 2ZUTA 3VW3L 4P2OA 3V4VH 1TVBA 1REIA 4TVPH 1XGPA 3UC0H 3HE7C 4JPWL 3GBMH 1QACA 3K4ZA 4WV1A 2OS7A 4EIZC 1ODAA 2EC9U 2NYYC 5IW3A 1G7PA 5EBLB 4R96B 2Y06H 4FQJH 4F7CA 1CDBA 1UH3A 4FG6D 4YDIH 5J3HD 1CZ8L 1YEGL 4OUUB 3VFPA 5KBNC 1BD2D 5IIEA 4TUJB 1ZS8A 5B39B 3AC0A 3KYOB 2BNQD 5D8JH 3QQ4A 4NJAL 3BISA 4TUKH 1INQB 5ILTL 4LSVL 4CVZB 5FK9B 1MRFH 3BP4A 5L0QB 2Y25A 2EEBA 3U7WL 2VDQL 3DV4A 4OFVA 1LNUA 2UYLA 5FM4A 2EZ0D 2F53A 4BJLA 4EXKA 1TQCB 1MREL 2A0LC 5BVJA 1HSBB 1YJDH 3QIBB 3VRIA 1OVZA 3QXDB 4K3EL 4HEPG 5CAYB 2DLFL 1U3HC 4UT7L 2IPKB 4L8BA 4RGOL 1K4CA 1F6AB 4NHCL 1VADA 4OZHE 5I1AB 2EH7L 1FZKA 5KG9B 1IM9D 5K9QG 4OGXL 5J3HC 1GZQA 2QV2A 5CZKA 5EU6D 1FV1A 4JDZA 4P59H 8CGTA 2OTUB 2NXZD 5E2TH 4KRPB 4XP1L 2V2WB 2FRGP 1AH1A 3Q5YA 3OJMB 4G9FE 4RRPG 3DO3A 5D7JA 2ZUSA 5F7DB 4E5XA 2E9WA 4EOWL 4D0DA 4M43H 4XXDA 5EU6E 3DSFH 3ZDXE 2QADC 3CMOH 2BVEA 1T1YB 3SDDB 3UYOD 1NGPL 4IOFC 4NBXB 3HE6A 4I18C 1MH5A 3HAEA 5LXGL 3ULUF 1I3RA 1NC4B 3QIWC 1M1SA 1CFNA 1MFDH 1UWGL 3VRJB 3BIKA 2XZCL 1FN4B 3QXUA 5HGDA 2R0ZH 4XP4L 4YXKL 5I73B 4NZUL 4K9EH 5SWZB 2LE9A 2FBJL 3A0OA 4YDVA 5C6PB 3QG6A 3O41B 3MUHL 5EB9A 5M94B 3KPTA 4OGYL 4XCEB 3UJTH 4J12A 3MRIA 2MWCA 2IPTL 1RUQL 2AEQL 4P23A 2RR3A 3VXPA 2A6IB 4R7DA 5HDBF 4K7FB 3O4LE 2QADD 2NY2D 3IT8D 4QHNB 4E5XB 1SQ2N 2ZOLA 3VFSA 3LAFA 3EO9L 3VFSB 3OKNB 2IANA 2EDOA 3BGAA 3PABB 2PNDA 1CDGA 4PIRF 1CLZL 1YMMA 2A77H 2EDNA 4KPHL 1AHWA 1Z9LA 2DLEA 2XWJB 4N0UB 2DQUH 5H2BA 4NNXB 3DTXB 4OBRA 3RWGA 4QHKI 1AO7E 2AXGB 5DQDL 2OXGA 4LKXA 4ODVL 1XGTA 3PHSA 2AJVL 4EOWH 4Z76A 3O3EA 4OGAD 2L0DA 2Y5EA 2VLMD 3BGFC 4JO4H 5ANME 4DGYH 4FZ8H 3BGMB 5ISZD 1IGFH 4AT6A 4RNRB 5D1XB 1HKLH 5D1QD 5KVEH 1G7HA 3QDGE 4QHLA 4GXUN 5FECB 3Q6GL 5KSVA 1NFDE 4PJ8D 4YDJA 5EO0A 1JYXA 1G7QA 5KW9H 5EOTB 4M48L 1G9NH 4JFHE 4X80L 5D9SB 3MO1B 5IFAL 3CFEB 5BV7L 4IOSD 5DUPH 3VMOA 1QA9A 5F44A 4Q6IC 3RAJH 3EJYD 3TP4A 2VZVA 2VLJD 1E4XH 5HDLA 4N1EA 1X5HA 4ZYKB 1R5IB 1PSKL 4JO2L 4CU8A 5J12B 3W2DH 1OOAA 1NPUA 1MRCL 1GGBL 3U30C 3CLFL 4PJXB 1M05B 1KPVB 3F5WB 4RGNE 4TSAL 2R1WB 2XTJB 2BVOB 4U6TA 2RFXB 4BK4A 4KROB 2VDRH 5IKCA 3HRZA 4PJ7B 1GGCH 5D7KD 4AH2B 5J6GB 2COQA 3TNNB 2FD6H 2LFGA 5F89B 1AKJA 4KMTH 5DD3H 1QD0A 2W9DL 4OLVH 2J2ZA 1P4LB 3P4NB 2LTQC 3QEUA 4WEBL 4XPHL 3SBWC 1H15A 4TNWF 1MY7A 1Y18B 4GMTL 4OZHF 4XNMA 4Y4FB 4X7TB 1J87A 3U9PH 4KUZL 4PTUA 4XCCL 5C0CA 4HUWB 1UKQA 3KS0H 3MJ7B 2VE6A 1AXSB 4Q0XL 5BS0E 1U8MB 4N90D 5EZJA 5C7XH 2MQ3A 5E8NA 1QPXA 4JDVA 4DVBB 1KGCE 2VDMH 1A1NA 1CR9L 3QDME 1CIDA 3VXSE 4F7EB 3MRNB 5IGXH 1MUJB 4XVSH 5IR1B 1X5AA 3IDGA 1UEMA 4I5BA 2NY3D 4QOKD 3X11B 4RX4D 4PJ7E 2IQAB 4FFZL 2AI0L 3PWVA 3RY4A 2IGFH 1T83A 4ZFOL 1J5OH 4X80H 1FL5B 4LIQE 4F3FA 4PYHA 5IOPB 4WU5A 3RVTD 4P5TB 1OAKH 5MEND 4JFFA 3MYJA 4IOIB 4P4KA 4Z95H 4G9FA 1EZVX 3EOBA 5EU7C 5T3XD 5INDB 3MNVB 2AV1A 5CP7B 1FVEA 5IEKA 4NIKB 4X8XA 4DKEH 1R3LA 1EFQA 2BVQB 3HLAB 4OI8A 3MBXL 2AABH 3QHFL 4LSPH 1RHHB 1U8LB 4ZDHB 1SBSH 4DW2L 3W2DL 1B4RA 3FO1A 1QRKA 5IW1A 2L4OA 3RVWC 2VH5L 4CDHA 4LHUB 2B1AH 2J5LC 2ADIB 5D2NB 1OCWL 2AJYL 5TDPB 1XGRB 4JFDE 2PO6A 2NY4C 1CGSH 5I1EH 3QDGB 1KLUA 3NTCH 5MEQB 3NZHL 1VGKB 1I9EA 2ADGB 4KZDL 3SPVA 2R0LL 1QR1B 3NFSH 3DGCR 3FT2B 2YPLD 1ZGLM 3U46A 4DOHB 4UUJB 4M7LL 5HXMA 2BSRB 1A6TA 1NCDL 5C0DA 4ELMF 2EYTA 5E4EB 4OF5A 3PGDB 2DBLH 2HFGH 4JHZA 1MREH 3CFKA 5L6YH 5GRUH 1AO7B 1E4JA 2VLKB 4G6MH 3CVIL 4PRIA 3GHBL 1IBGL 4N9GA 2ED8A 5ISZA 2OR9L 2LAGB 2OXHA 2YSSA 2KKQA 1ED3A 4QRPB 2VDOH 3TESA 2D0FA 4UV7H 4Z7OE 1TTFA 4PP2B 3ZT5A 2HVJA 3VFGL 5MENE 3L5XL 5IQ9A 4XBEH 3ZE0E 4LVNB 4PJ9A 5E5RB 1T4KA 2ICWA 3RPIB 3BAEH 3TH2T 3OKMA 2DWDA 1F8TL 4YX2H 1D5IL 2HWZL 3QBTB 4QRRD 4X6CF 1OF2B 5FF6A 4Z95L 4Z7VB 1KB5B 4C58B 3JVGA 1N4XL 4OCRL 4YHYB 3TVMB 4N0CC 4U1LB 1IC5H 4OQTL 3RDTD 1ADQL 1DE4B 1YYLL 3VCLA 1BD2B 3IAQA 2QR0A 1LILA 2Z31B 32C2B 2DD8H 4N90E 3BZFA 4R7NB 2CJUL 3MXWH 5TQ0L 1G0XA 1HDMB 1NGQH 2R39A 5MI0B 1P5UA 1WITA 2GUOB 2IFFL 3ROOA 2VZUA 4G8FB 3F8UB 2RCSL 4R0LC 1FZOA 3B83A 2R0LH 3TBYA 3VI3F 4BQBA 1EEYB 3AREA 3MBEA 4MJIB 4ISVB 4GRLB 5CP3A 5FM5M 4Y8DC 3KG5A 4EI6B 1N8ZA 2NXYC 3MTRA 2YUVA 4LDLB 4NKIL 1HCFX 5IB3A 4XX1G 5FOBA 3MRPA 2WSKA 1AGBB 1ED3B 4D9QE 4PY8J 2CLRA 3FL7A 5LGJA 5C09E 5DJYB 5A43C 3OR7A 1S7UB 1I8LC 4ODWB 4HKJB 2C3HA 3A6BL 3IJYB 1MFEL 3LHPH 1ZLVH 4JFYA 4KPHH 5INCA 1NCBH 1A7RH 1ND0B 2DDQL 5E0QA 4OLXH 1PKQA 1RZJC 2MQ0A 1IC7H 2RFXA 3FFCE 1HXYA 2RAMA 1CDCA 2PXYD 1QFHA 4BA8A 4PJ5D 1ZVYA 1V7NH 5JORB 5T33L 4ODTH 3L3JB 2FATL 1J10A 3IGAA 4WNQA 3BHBA 3VFVA 3IFPB 4PGCB 1FFPB 2FWOB 4G6JH 5IMLB 3CFEA 2NY1D 1Z3GH 3GFUA 5C0CE 3VDBA 1W0YT 3BKML 1N2RA 1QBAA 3GB7B 5C0BE 1AXTL 4G43A 2NY7H 4B5EA 2ZUVA 5E2VH 3QDMA 5GGTL 1U95B 4NM4H 3ZE2F 1G7HB 4I3RH 5DJ2A 2H8PA 3O3AB 3LMJL 4FABH 1AGCA 5I76B 4PJ7A 1YC8A 4AH2A 5J6GA 4QT5A 4FTVA 4X5WB 2V2XA 3MC0A 2R2EA 2OSLB 2NTFA 2CUHA 4XGZB 4JO3H 3D2UA 2BNUA 1L7IL 1JYNA 5EFIB 5BV7H 3VI4E 1S7TB 4YIQA 5D70L 2YXMA 4KDWA 1B2WL 3CVHL 4X6DA 2DI7A 4YHMH 5C2BH 4WFGD 5BV7B 3G5ZB 2OK0H 4X6CA 3MNZA 2XWJA 4JDTL 3THMH 1H9VA 3MJ7A 4RFEA 3WUWB 1FNEB 4NCC1 1BECA 3PABA 4WRLA 1A6AB 1N59B 4BZ2L 3PHQA 1H8SA 4Q9CA 4XHQA 2FSEA 1FFNB 3FZUC 4PREB 3BJ91 4JQXC 2XN9B 1NCCH 1AHWC 2FGZA 3HFMH 4U3HA 5GHWH 7CGTA 2ESVE 4JFYB 2CKBA 1KLFA 1BFVL 3WIHA 1DBKH 5I30H 2QHRL 2CLZB 3NOIA 5D5ME 3ULUH 1OLZA 1K5NA 5JMOC 5H94B 1RUML 2AJXL 1HEZB 5FHBH 5CJQH 4ZXBC 4TQEH 1A3LL 3TV3L 4XCCH 5D1XD 3EJYC 4ZFZB 5SX4H 5FYJE 3FB5A 3CLEH 4HS6B 1AD9A 1VGEH 3DBXA 5DTFA 1DLFL 2DRUA 1AXTH 5HHME 2D4DA 4JJ5B 1KYOK 3QUYC 3X3GH 2R9HC 4JFZL 4DN4H 1TVDA 3R1GL 1C5CL 1FZOB 3KJ4B 4NQCA 3M17B 2VZ3A 1S78D 4IMLA 3QQ9C 4OM1L 3UJIL 1HYRC 4LLYB 3O45A 4N1CA 2VL5A 4KZEH 5I16A 5HPOA 4DFIA 3GRWA 3QWQB 3UXFA 3C60B 3ULVH 1H5BA 1AI1H 3RFZC 1QSED 2AXFA 4MS8C 1OP3H 3LKRA 3BDYH 3L3OB 4LQFL 5I9QB 3UTQA 4I18B 3TN0C 5DRNA 4NQVA 3MUGB 4GRMB 3G6JA 4R3SA 2CGRH 4ZS6D 3SCMA 3EFDH 4HPYL 5EBGA 4UBDC 4L5FH 4YQXL 4I3SH 1EJOH 4JG0H 2F19H 3K8MA 1MCJA 2AQ2A 1H8OA 8FABA 2O61A 3QNXA 3IDXH 1NCWL 4KKAC 1CGUA 3BP5B 1FJ1A 5EO1A 1L0XA 1CU4L 5AZEL 3MV9B 2BY1A 2NXZC 1WTGT 1MAJA 2B1AL 4KRPC 1SHMA 5IP4A 2X4NB 5BZWB 4WFED 3QXAB 2R0KH 3KLSA 4RQQA 1ONQA 1P4IL 1NCNA 1RZIA 1IL1A 3MA9H 5C9JA 3WS6C 4XVJH 5KSAD 1ZT4A 3FN0H 5C0FB 4ODUA 4PRPE 1S7QB 1YEEH 4PJFB 4WI5A 5JW4R 1CFSA 1KFAL 4O5LH 5HHXH 1C7SA 3UAJD 3EGSB 2X42A 1RZ8B 5E94A 3P40A 4M1DL 4CNIA 3HC0A 3RVTC 3PWNA 4ZOBA 2ADJB 4IOFD 4NFDA 5FHBL 3L7EA 4XNQB 2CDFA 5L7XL 4HXBL 3GMNB 2GKIA 5D96C 6FABH 2OM5A 2A74B 1RZGA 2VABA 1QLFB 2I9TA 1ULVA 4O51B 3SDDD 2PYFA 2VDKH 4ZODA 1K85A 4GKSB 4M00A 2VAAA 4ODXB 4ZUSB 1MFCL 3DYMA 3K0WA 1N0XL 5BZDB 2QSCH 4Y2DC 3OGOE 4Y5VA 4PLNC 2P49B 4YUEL 3GIVB 3SO3B 4XBEL 3I02B 4PJ5E 3IF1A 4LQFH 3BT2L 4OSUL 5SWZD 4I2XA 4AYFA 3RWFA 1P1ZA 3HAEB 1UC6A 5FOJA 4LHUD 2QQLL 3LZFH 1S5HA 3TPUA 3MRDB 1MAMH 1YEGH 1CFQA 3RVXC 4PJDB 4HH9B 4JFHD 5KTEL 4LLVA 3VWJA 5I1CL 1I1YA 5E8PA 4LSUH 2IFFH 3HC3L 1CG9A 4YFDB 3DMMB 1BF2A 5HGHB 1XGUB 4ZQKA 1IKFH 4GRWB 3S37X 4CUCA 3MLUL 4KKLD 1JGEA 2IANE 3GNMH 5GRVL 1IGYB 3V4PL 1FFRA 1MNUL 5CEZL 4WW2A 2BSTA 1KCLA 3OGCB 4JFED 3P3YA 3L3JA 1V5JA 2NQCA 1KJMB 4NQXA 5GGVH 2GCYA 4YPJA 3QH3B 2Q87A 4OT1L 5EU3A 4PRBA 2B0SH 3MBEC 1TPXC 3BD4A 3CFKB 1IGTB 5DD1L