5JR1L

Crystal structure of 10e8 ghv-maturel antigen-binding fragment.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
YELTQETGVSVALGRTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGSASGNRASLTISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 10E8 heavy chain
publication title Developmental Pathway of the MPER-Directed HIV-1-Neutralizing Antibody 10E8.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1L01
1VA9A 1NBQA 4POYA 1E6JH 5FAAA 4FQHA 3VE0B 2OL3L 1QNZL 4JDZA 3MJ9L 3SOBL 4LEXL 1G7IA 1NC4D 4LLYA 4YHOL 1CLZH 1IGMH 4X8XA 3A6BL 3IDGB 4WHTA 1ZT1A 1GRWA 3MGOA 1C5CH 4Q6YA 3CFJA 3HZVA 2AI0H 3BO8B 3MV8E 1YEHL 1F4YL 4G42A 2B2XL 3S8WA 1NLDL 3MODH 5C0IB 4IOIA 4MQ7A 3SDDB 2LFGA 1FO0H 3L3GB 3VWKC 4OKVB 4G9FB 2G9HA 4PS4H 4GBXB 4P49A 5HJ3A 5C3TA 3G6JE 3OAZK 4LPTA 3D9AL 1T1YB 1OHQA 5JPMB 5F9AC 2BVEA 1PKOA 3SGEI 2J1KA 1CR9L 3MGAA 3ARRA 5L8JB 3LH2H 3PV6A 3ZHDA 4JR9L 1TVBB 2CD0A 2XICA 4FNLL 4GAJH 3RTQA 2F5AL 5ANME 3BPCA 5EZJA 3DMMB 1TZIB 2FX7L 1CG9A 3JV6B 5D1XC 5DMIL 1UA6L 4NN5C 4UU9B 3PP3H 4WUUD 1UEMA 3N0PB 2JCCF 1Y6KR 3RL1B 1S7VA 1KIQA 3GUTA 2H9GB 4KRNA 4TUJB 1Q9WB 3BAEH 4G6JH 4RAUB 2YD8A 1R3HB 1UM6L 5HGDB 1TQBB 2BC4A 1H3PH 4WWKD 1KXQE 4LRIC 4Y2DD 1JTTA 4ZUWA 4ZXBC 2VLME 3JZ7A 3ZE1F 2DJ4A 4X9IA 4OD1H 2C1OA 4RGMB 3GMOA 1JGVL 2DQFB 4K8RH 5D6DA 1VKXB 4NQCE 3MBEB 4LAJH 4P46D 1KJ2L 4LLVA 2EDWA 1C1EL 1LD9B 1A6ZA 3LKPA 4GSDL 1BOYA 1VFMA 3N9GH 1BD2A 3IF1A 4D0CB 1RUPH 4EN3A 1QLFB 5F1KC 2ZSVB 4QHKI 4LSSL 1NC2B 3FTGA 1LE5B 2SEBA 4UQ3A 1KNOA 3SE9L 1AXTH 1FGNH 3RWDB 1GPOH 4HGKC 3NN8B 4BUGA 3N50A 3D85D 2XFXA 4F9PA 5E99H 4KMQA 3P4NB 3VW3H 3GFUA 1LO0L 3QSKB 1J0KA 3JV0A 4JFPA 3WHE0 3LEVL 3V9FA 3HKFA 3TNMB 1CU4L 1UWXK 1L7IH 1HHJA 2B1AL 3MCG1 2J2ZA 2CXGA 4HJ0C 2KZ1B 2HT4D 5IT2H 2P5ED 4ODBD 4HXAL 3FB8A 5T3ZE 4PTUB 1DLHA 1WAAA 2JCCB 2XWTB 1O0VA 3LHPH 1UM4L 1OY3B 4OFIA 5CZXD 2V9RA 1FIGH 3MJ6A 1S7SA 3C2AH 4U6HB 4WFGD 1LO2L 3WKML 3QDJA 2FJGB 4QF1B 1S9WA 4XAKD 1WWCA 3GM0A 2VL5A 2IC2A 3RWHB 4M00A 5FOBA 1KJ3H 4MXQC 5C0RH 2CUIA 3KLSA 3K2UH 4XCEA 1T3FB 2R1XB 7FABH 1KCRH 4FRWA 1TJHL 4NP4H 3IFOB 2DKUA 3QQNA 1A7QH 3B5HA 3H3BC 1YQ2A 4XC3H 2HLAA 2FSEB 4LLAA 1BAFH 3QWOB 4Q7DA 1RMFL 3MLRH 1SEBA 3VXUD 3QPQD 1JNLL 1KGCE 5B4MD 5E6YA 5L9DL 4X6FA 1F3RB 1FL5B 4F9LC 5FYLE 4R4BB 3WFBL 4U6YB 4PG9B 3O81A 1QLRB 5D72L 1I1YA 2RB8A 5A3ID 4FFWC 2VQUA 1AKJD 4RRPG 2R9HC 5EUKB 4JFDA 5F1IB 4DKFH 2P5WD 3HE6C 1X4ZA 3P11H 2IPTL 3GSVB 3IFLL 4MD5A 5BXFA 3GBML 1RIUH 1WGOA 4Z95H 4U0QB 3LKNB 1XCTB 4PY8I 3MJ8A 5CBEA 4M6MH 3U2SA 1JGUH 4KHXH 4PLKD 5AWNH 4NKIH 4RGNC 5HHVH 3VWJD 4U49A 2NR6C 4YFDB 1KB5L 3O41B 1LNUB 1B88A 5J3HC 5E5RB 4WFFD 3BPNB 1A6WL 5DC4B 3STZA 2PR4L 2FD6H 4MNQA 5J1AB 4W6YB 3NIFE 3PIQA 1RJYA 3O3EB 2UYLA 5KN5A 2AQ1A 2VOTA 4R90H 5JXAL 5LAXA 2WANA 3IB4A 4NHUA 2DMBA 4PRAB 4X7SH 3B9KA 2VN4A 4Z77A 3LPWA 3ZE0F 3VFMA 1TTUA 2IANB 1HHKB 4ZUUA 5JXED 4H26A 3MRLB 4MJ6B 4FQ1L 2VITA 4LF3A 4LCIH 1V3MA 2L0DA 2V5SA 1GGYA 4PJCF 1FAIL 2W1NA 4R2GB 4LKXA 4TPRH 5IG7A 3V6BR 3KPQB 1DQML 4AIXA 4Z18A 3L1OL 2W9EH 4X4ME 3N1GC 2BRQA 3QQ4B 5FKPA 1VERA 1J8HA 2JIXB 1ZEAL 3X12A 4CVZA 4GKOA 2ATKA 3QO0B 1KPUB 1MHEB 2ZKHL 4JFED 4D8PA 4TTGA 4QWWC 4WV1C 3ZMRA 1SYVB 1KCUL 1TXKA 5HPOA 5I19L 3HN3A 5LCVH 4K3DL 1EHLL 4TVPE 4ONGH 3CK0H 2N56A 4LHQB 1DQJB 3ZSSA 1LVEA 2Z93B 2P24A 5IMKB 3DHJA 4IMKA 1JHKH 3BKJL 1DBBH 3S96A 2VKWA 2EO1A 1X5XA 5I76B 2WLZA 1DSFH 1UB6B 1UENA 3IJHA 3WFCL 2AQ3A 2V2WB 1TJIL 3RGVD 3TT3L 4PY7B 2O5YL 1FCGA 2X4NA 3HNSH 3RY6A 3QIBA 1HNFA 1IC7H 5IEKA 3GIVA 5C07A 5E8PA 3BP5B 1UFUA 3QPXL 3MRIB 1N59B 3SDAA 3INUH 3V5DB 3TO4C 3MV11 1HHHA 4OBSA 2F53B 4YDLB 1JYXA 2YS4A 1TVDA 2OK0L 1V7MH 3LKSA 4LSVH 3G9AB 5DJXA 1A6PA 4JZJB 4DVRH 1F11A 4OCYL 4PJCB 1A6AA 3T4YA 3UTTD 1J0YA 3MYJA 5C0BA 4HH9A 3D18A 5C9JB 1KPRA 1L6XA 3TA3C 4TNVK 1FHGA 4I0PB 3WFDL 4QNPF 4HAGA 5J0BA 5DQJA 3BPOB 2EYSB 4B7LA 3EO1B 1LE9B 2B20A 1HIMH 3C5SB 4IIQC 4KC3B 4P4KA 1ZGLB 1J5OL 1A7PH 5FK9A 2LU3A 3ZL4H 3V6OE 2GQHA 3QEGH 4I18C 2X9WA 2CSPA 2FDBP 4QXUH 5C0DB 4AY0A 1A3QA 3I02B 2XPGB 3MRQA 3SBWA 5F6IC 5F7NC 2CMRL 3TJEH 2F53E 2OI9C 4ZMAT 1G9MC 3QDMA 3EOBB 3SDXF 5IM7A 3LY6A 4M7LL 1BZ9A 3ZDZE 5L0QB 1JGLL 5IROC 1E4WH 2DQIH 4RZCB 3FO2A 1BM3L 5IB1A 5MEQA 5DD5H 2VXQL 1DVFC 3CX5K 4L9DA 2WWKT 2DWDB 4XVUC 2VWEE 1LEIB 2J4WL 1DQDL 3QUXD 2VLKD 3X3GL 4UZGA 1FGVL 1JHLL 2EKSB 3RX5A 3BZEB 4O5LH 4L8CA 2NXZC 5C0AA 5F97E 2YPVL 3JWDH 4YHNA 4G7VL 2VRAA 2MMXA 3GBNL 4Y5XB 4ODWB 2OTWA 2PTTB 3MRNA 3LN4A 3NA9H 4Y5YB 5ITFB 2FJHA 4XVSL 2YD5A 5IK3B 3WFEL 4YHML 4XZUB 1SHMA 1C7TA 4JY6B 4V2CB 4TSBH 4NO3B 1X6NA 4N0UB 1HSBB 4F2MA 4PJ5A 1M6OA 1JK8A 4R6UA 5E0QA 2NY6D 2NW2B 3SGJA 3VA2C 3OKLB 2IAMC 3DETD 3ULVC 4P5TD 2AABH 4F7MB 1OOAA 1K8DB 3QUMH 2CIIB 2QQLH 1OM3H 4BFBD 4M7JL 1YJDH 2OMBA 4GMTH 3OKNB 3ZKSD 4LLQA 3GM8A 5AAMA 1MRFL 4PJEA 1AQDA 1I75A 5HGBA 1JZ4A 4G80B 1B4RA 4YWGL 3LKRB 1I1AA 2Y6SC 1CFTB 3BUYA 2KQNA 4XAWH 4LGSB 1S5IH 3H9HB 2QQQA 4OV6F 3AAZB 3C60B 2CXKA 2P48B 2PW2A 5D2NA 1SM3L 4YDIL 1JF1B 4UNVA 4N0UE 4HUNB 4PJFF 3HNTH 4HJJL 4KMLB 1T83A 1CGSL 2AV7B 1P84K 1NAKL 5D1ZD 43C9A 5FYKD 5H8DA 3QI9C 1JWUB 1LO3H 5EPMB 2UWEE 4PB9H 1EZVX 2NY1C 2DYPA 1PFCA 3KPRD 4L4VE 1BX2A 2H1PH 3SHSA 5I0ZA 3TYGH 4WHYH 4G8FA 1LMKA 3MXVH 5CD3B 2R0ZL 2HVKA 4YX2H 4OCSH 4YDJA 5C0JA 4JG1L 5TF0A 3UJJL 3UXFA 1Q72L 3WIIH 3T4AB 1XIWD 5T3XE 5GGSB 4OTXH 4X4XB 3TC9A 1OAQH 2G5BB 5LGHH 4U6VH 4P2OA 4K9EL 1U8KA 2V2TB 4S1RL 5TPWH 4J3WA 1ONQB 3WS6C 1OSPL 1MVUA 1F2QA 3RGHA 5IBUG 1JZ7A 1V3LA 5FKAB 4YAQB 4GRMA 5I16A 4KJPD 4WEBL 5K9OA 4OFKA 3S5LG 5SV4A 2GSIA 2IG2L 4P4RA 4Y4KA 4K3EH 4PJIF 3U4BL 1IBGL 3VWKB 1EXUA 2KZWA 5C2BL 4JY4B 3RKDC 3ZKMC 1DANT 5A2LH 4DVBA 1INQB 3G6AA 4WU7A 1ZHKB 3CFEB 4OJFH 1RIVL 1KN2H 4J6RL 5D7IA 1QRND 1R3LB 3K7UA 4J4PC 4Z7WA 4WW2A 2AKRB 5L2KA 5IWLA 3K4AA 5EO9A 4CVXB 3NFNB 1VFAB 1IE5A 1G9NL 5JO5A 1RZFH 4ZUSA 3X17A 3C8KA 3OGCA 2WBJD 3K80A 1PY4A 2QQNL 3TVMB 2D03L 3TN0A 5D1XB 1DN0B 2XA8L 4NN5B 1EJ6A 1NEZG 4LIQE 2IBGA 4D2NA 2EE2A 4KZEH 1G0YR 4NYLA 2X40A 2OL3A 4QRQA 2VDNL 3BJ91 1KACB 3IAQA 4ONFL 5J1SC 5I15H 4KKCC 2BSED 2D9CA 1XF5B 2PXYC 3TBSA 1MHPL 3OKDB 1VGEH 1LEKA 2Q86B 5HPMB 2P8LB 4O2CB 2G60H 5SX4H 1B9ZA 3RRQA 4G6KL 4JRWA 4P3CH 5DK2B 5DEGB 3MO1B 4V1DA 4FABL 2H32H 3LKQA 4AH2B 3QFJD 3VI3F 2DQUH 5IMMA 4ZFFA 4L9LC 5GS3A 3BFOA 2PYFB 4N9GA 4NM4H 2ILLA 2V7HA 3DVNB 4XP5H 5EO1A 4KKAD 1UGNA 3BRGC 4AEEA 2E6PA 4OM0L 4OT1L 2A38A 4L3AA 4XBGB 4AT6B 3GMNA 4PJIB 5D5MF 3O3BA 3EO0A 3O3DB 3U6RB 2BNQA 3UBXA 2F19L 4Q9BA 3CU7A 4KVCL 1V7NL 3RAJH 3S37H 5MHSD 1M05B 3OXSA 1GC1H 1NH6A 3EIFA 4U1MB 3DECA 1QZ1A 2YR3A 2D9QB 3FFCB 4ZD3H 5BO1L 3T65A 1B4JH 4R7DA 3KXFD 1WWBX 4Y1AB 3U9PL 5FHAL 2OQJA 5D2LF 4P9MH 3ZYOA 1ZS8A 5JPNA 2ATPB 4NJ9H 2R2HB 1RY7B 5DD3H 2WINA 4J8RB 3RVUC 5SWZE 3W0WA 4JKWA 4NZUL 2OL3H 1QNZH 2BCKA 3CCHB 3MJ9H 5EU6D 1XR8A 4G8IB 2AJVL 4YHOH 4X5LA 3WD5L 4K7PX 2Z35A 3IU3A 1KN4L 3S98A 5DHVA 1KCKA 2A0LD 4MA7L 3IS1X 3UDWA 2HFTA 2LQRA 4WJ5A 2ED8A 4DZ8B 3KPPB 4XPBL 4XI5C 2MQ3A 4IEFB 1KJ2A 3Q5OA 4PGZA 1W0YT 5ICZB 3TGXA 4XCNB 3G5ZA 5DA4A 1YEHH 3IJSB 3FFCE 1NLDH 4XH2A 3JWNC 2JJWA 4B7IA 1OPGL 3HE7A 4Y1AE 2D0FA 3B6SA 4BYHA 2HT3D 3QXVA 2BP3A 5FM8A 1UACL 3KPMB 4Y4FD 4LBEA 2A73A 4RNRB 2C3VA 1HHIB 3NCCB 5BCAA 5JOFA 1T4KB 1RZ7H 1NCNA 1H15A 3D9AH 5J06A 3WNNA 5JDSA 3H9SB 2FJFA 1QPXA 1P7QA 1CR9H 3FN0H 4HG4K 4O9HL 5JW5B 5E08H 4JR9H 4FNLH 2F5AH 1XAUA 1XF1A 4Y5VA 1YMMD 2FX7H 4QHLB 3H7BA 1IEBB 1UA6H 1MF2L 2K3TA 3LV3B 2IQ9L 2XWJB 5M94B 3HE6B 5D2LB 2XTJC 3R06A 1AD0A 1S78C 3MUHL 1E4JA 1VESA 3GEWB 3ARDC 5IIEB 2AEQL 5JDJA 1R3KA 1UM6H 1N7ML 1UEYA 4HEME 1UH3A 2FR4B 2FWOB 2KBGA 1NEZB 3O9WC 4KY1L 2H3NB 4G6FD 3ARFC 2NY5C 4F7CA 3H9SE 4TUOA 1NKRA 4DUXA 3SE8H 4GW1A 3IYLW 4QT5A 1JGEB 4ELMA 1KJ2H 1BOGB 1C1EH 1FNEA 4PTTA 3NCJL 1WZ1L 1IM9B 2IBZX 1K6QL 4PLJD 1S8DB 1PEZA 4L1DA 4L3EB 4XNQA 4LSSH 4D9QE 4LVNB 3OJDA 5J9PA 4DQOH 1QFWI 1UXWA 3SE9H 3VXTB 3M1BB 5ILTL 2R4SH 1U58B 1HXYB 5EC2A 2UZIL 3VXRB 3PG2A 2GJ6D 2RQ8A 4C83B 4CVUA 1MH5B 1UKQA 2YPLD 4NNYA 1CU4H 1JHTB 2B1AH 3IDNA 4PJ8D 5AZEL 2F54D 1OTTD 4BSWB 1WLHA 3CDGA 4KI5E 1A1OA 4Y16A 3ULSB 1DQQA 1JPTL 1UQSB 3QUYB 3S6CA 4GAGH 2Y4SA 5IFAL 1S7QA 3VGDA 1HQ4B 1S9KC 1IQDB 3IAPA 1KB5A 3C8DA 2OM5A 5CHNB 2PYEB 1LO2H 3O11B 3H7LA 4TN9A 3MLXL 4L3EE 4OLYL 3FJTA 2ADGA 3FKUS 3TPUA 1RZKH 1Z2KA 1U3HC 4YHPA 2DD8L 2CDEA 2H8PA 1FYTB 3VXRE 4NUJA 1N3NA 1ES0A 2WIIB 5CBAB 1JF6A 4A2LA 4JM2A 1TJHH 2YZ1A 3AU1A 1A9BA 5IB2A 1KLUB 5LBSL 3WL9A 1BBJB 2C7UB 3G5YA 3VXMA 4P23D 2HN7B 3QHZL 3HR5B 3O8XC 4PJXF 1K2DA 2VAAA 1NGXB 4YLQT 1RMFH 1WEJL 1B2WL 1JNLH 1RK0A 4HWEL 4OLZL 4PGBB 3Q6GL 4M7ZC 3KNBA 3SDCC 1P4BL 3D1MC 4GUPA 4FQLL 3HZYA 1RVFL 1BGXH 4LCUA 4DKEL 4R0LB 3TO4B 1N0LA 2I9LB 4UUJA 2PYEE 2EXWC 2Y72A 1YN6B 3WFBH 3MREA 3K8KA 5HXMA 5D72H 3TV3L 2P7TB 1MELA 1AGFB 4U1SA 4XVTH 5KG9A 5BJTB 5C8JB 4EI5B 5F6HJ 4MD0A 4M3KB 5L6YH 4QRPB 1SBSL 2R1YB 5KSVA 5EOTA 1WCBA 4NKDB 3V5HB 3WNOA 1RFDH 3IFLH 1MCKA 5DRNA 3GBMH 3TA3B 1KTLA 1L0XA 3MRCB 2Q6WB 1U8IB 4I3GA 5FB8A 1X5FA 3IVKA 3ULVF 3N1QC 4FQXC 1ORSB 1OL0A 3BGAA 4X6BB 4Z7VF 2ZG3A 1KB5H 4U4BA 1YNKL 4XP6L 3BIKA 3MNWB 2JF1A 2YA1A 1YMHA 4WI2A 3UTQA 1KBGL 4RA0C 3IGAB 4KK5D 2O5ZH 1A6WH 4I5BB 2PR4H 2I60L 1KTRL 4YDVB 2R15A 2P43B 2VXUL 4Z7UF 2VDMH 3NIGE 1F2XK 3L7EB 4GRLC 1JCKA 2A6DA 3FQNB 4OZGA 2OZ4L 3C09C 3QNYB 3UAJD 2APWA 4QRPE 5GGUA 1JL8A 5IVOA 1PX3A 4KVNH 5H35B 1YUHB 1AIFA 1XGTB 2BSRA 4GKNA 5M95B 3MCLL 1K5NA 2NXZB 3DJ9A 3S3JA 4FQ1H 2FATL 4BZ2H 3MJGX 4P46A 1YPZB 1GOGA 3P4LA 3WNLA 2X1XR 1B0WA 1FAIH 3ROOA 5IW1B 1I8LA 2HG5B 3C08L 3UJIH 3HLAA 3HR6A 1RK1B 4PBWD 1LDPL 5C09D 1EVTC 3LDBC 3R1GH 1TTFA 1EEZB 3L1OH 1YEKL 3TP4A 4EBQL 3VGBA 1W0VB 1XF4B 3W11C 1DJSA 3D85A 4BSVB 2ZKHH 1OP5K 1J9CT 3U0WL 3HMXL 1KCUH 1N5AB 5I19H 5TGBA 3B4NA 2DS4A 4Z7VB 1EHLH 5DEFB 1E6OL 4MNQE 1HH9A 3VU2A 3WN5A 3I75B 3FN3A 4NT6B 1RHHA 2P5EA 5DA0B 3EW3B 3NZ8A 2KH2B 3FQRA 4GQ9L 4IJ3C 5D7JD 1YPZE 2VN7A 5CJXA 4PLOB 4R4ND 3WFHB 3PL6C 4Z7UB 1JZ6A 3WFCH 1HYSD 1R0AL 5IVXA 1TJIH 3TT3H 2O5YH 4YIQB 4OD3L 1OF2A 1IGIL 1IGCL 2VERN 2KQMA 4MDJA 2PKDA 1HH6B 4QLRA 3TYFB 3QPXH 4JKPH 1JZ8A 1DDHA 3RU8L 5CSZB 1J10A 5IB5A 3UPRA 1ZA3B 1YEEL 4NQTA 1YC7A 1IQWL 2FO4B 3AMLA 3RFZC 5CIPB 1LEGA 1VDGA 2OK0H 3QI9B 1ND0A 5E5MB 4LVHB 12E8L 4FXKA 5AYUL 4NHCL 2FECL 3ARPA 4OD2B 4OCYH 4XB7A 4Q0XL 5TDOB 1F90H 4X7CC 3ME0A 3T3ME 3FQXB 3QEQB 3MZGB 5EBLA 1UCTA 1GL4B 3MSPA 5CZVL 5DFVC 2NY3C 3GGWB 4WIQA 3VA6A 2H6PB 1LP9F 3T3PE 3WEXB 1NBZB 4GAFB 1S7WA 3RJDA 1UKSA 3STLB 1NGPH 3IKCA 1N5YL 3SJVB 1J5OH 1CS6A 1UZ8B 2Z8SA 1CFQB 1MHCA 4IS6B 3U0TB 2Y9RT 1OP3H 1Z9OA 1AKJA 5AD0A 5F9DC 3P9WB 5ERWB 3BT2L 2CMRH 3FT3A 4X99A 4NZTL 2PO6D 5BMFL 2E6QA 4IOFD 1G7HA 1JGLH 5EH1A 5IEHA 1BM3H 5C08B 1IAKB 3QA3B 2ZCHL 3Q48A 4HFWB 5T1MB 3O6ML 4BK5A 3NFPA 4XMLL 2J4WH 1DQDH 1K4CA 2EXYD 5TQ0H 4JFFB 3T77A 4TTDC 4U1JB 1JHLH 5C0FA 1VHPA 3W81A 3VI4F 1BZ7A 2EZ0D 1S7TB 3U7WL 4G7VH 3GBNH 1NBVL 3SJVE 2E7HA 1CE6A 3CSBA 4NQED 5HVWA 2O26U 1NL0L 4E0RB 1Q1JL 5C0BE 1YYLL 1RI8A 4XVSH 5LGJA 1RZGA 3WFEH 3DXAB 4YHMH 3HRZB 3FQUB 3C6LD 3LPFA 5CEXA 3GMLB 2AJUL 5E9DB 5GRUL 1YECL 2MTPA 1BQSA 2F74B 1AJ7L 3R8BB 4W70A 2C4XA 4DK6A 5EA0L 2ESVD 3T0ED 1LP9B 3LRGA 5JXEA 1UJTA 4K7PL 2IALA 4YZFF 2GYSA 4JRXB 1MWAL 3PNWA 1BIIA 4L9LB 4DWHA 4M7JH 5A16B 3EYOB 3B9AA 4PREB 4XBPA 3QDME 4NQXA 3TBWB 3L3JA 4FQCL 3RZCB 1UZ6F 4XC1L 1FFNA 4EKXA 1MRFH 1CFSA 2CIKA 2D31B 3QCTH 5D8JL 3TJHC 1CTNA 3A6CL 5TJWK 1OW0C 1P9MA 3D25B 5E2WL 3CFDB 4IRJC 4YWGH 4OF7A 3ZT6A 4FG6C 5ABDE 5GRYA 5EBMA 1UH2A 1FNAA 3DXAE 3SY0A 1SJXA 5DGRA 1R5WB 2DM2A 3GMPB 5E9DE 4F33B 1AR2A 5C0AE 5T1LD 3U36A 5EOCJ 4KDVA 1CGSH 3CH1B 2ITCA 4CRPA 1AO7A 1FL3B 2FZ3B 1LP9E 3BEVA 4HWZB 1G7LA 4PRNB 3DUUB 3I6GA 3GBLA 4JO2H 4QRSA 3D3VB 4XPFL 1DEEB 5E00A 1J18A 1AHWA 5I71B 5HHNA 3QAZC 3RGVA 5J12C 1JWMB 3FRUB 1T5XB 1V3KA 3VMOA 2R0ZH 5C0EA 3CMOL 4KQ3L 4MZ2A 2DM3A 3VD5A 2FX9H 3MJ7B 4JG1H 2VXTL 3QXAB 1NFDF 5HHMB 4DKDC 5I1JL 1Q72H 1CICC 2RHEA 2W60B 3UTPE 5IBLC 2Z4QB 1XCQB 1JUFA 2R29L 1U93A 3VXOB 4QXGL 4K9EH 3C5ZB 2ZUWA 4S1RH 3CFCL 1MFCL 4XTRD 1OSPH 3RIFK 5DQ9B 4JE4B 2ED7A 1FV1B 1TQCC 4Z0BL 1HOCA 3BUTA 4WEBH 4L29B 1J88A 1HKLL 1WFNA 4HJGA 3H0TB 3VFVA 4U7KA 3L3HB 1XGPB 1IBGH 3U4BH 3H9ZA 3ECBB 2E7LC 2NCMA 4JFXA 1W72B 3D3VE 1KT2A 4QHMA 5C2BH 1IFHL 4RMTA 1FVEB 4LPUA 1I1FA 3FCTA 1NGZB 2HWZL 1L6ZA 1RIVH 2P44B 1M71B 1KXTB 3BRFA 5CGYD 1A02N 1ZWIB 1G9NH 5HHME 1FVCB 1GAFL 5JOPE 2NW3B 3RNKA 1RSFA 1V05A 1V3JA 2QQNH 4I48A 3MGTB 2D03H 2XA8H 2CLVB 1QSVA 2WV3A 3TFKD 4N1HB 4PV9A 3THML 3SDDD 3P4OA 1GZQA 3L95A 4WO4D 2VDNH 3ARDB 3X13B 1QR1B 1A21A 2B1HL 3REWA 1OP5H 4ONFH 3UZEA 5IMLB 4NUGH 2L4OA 2BDNL 2VLMD 3QUXA 4S2SB 4A6YB 3FZUC 4PJDF 1BFSA 3NABL 1MHPH 1ZLUH 4BH8A 3O9WB 5DDHB 1VFBB 4G6KH 1NFDB 3O3AB 2VE6B 3ARFB 4WDIB 1CGWA 2GTZA 1TPXC 4NQCD 4FABH 4G5ZL 1T22B 4YBLB 3FB7B 5KZCB 1DL7L 3DMMD 4DN3L 4G6AD 4F37F 3DX7A 1X5KA 1CDGA 3K8MA 1FFOB 3SPVA 5HVFB 4GAYB 3BP7B 2Z92B 4OM0H 4ZSOA 1HDMA 1JMXA 1N6QL 3QXTA 3MRBA 2P8MA 3FHQA 5L2KE 2F19H 4KVCH 1BLNA 3GO1L 3DVGA 3BYTA 4P5TA 3V5KA 3KPLA 1IKFL 1DE4A 3EZJB 3KYAA 1IAIL 1D9KC 3PWVB 2VXSL 3QIWB 3RTQC 5BO1H 2Z8VC 3MV7A 4UOJA 3RWFA 3V4UL 1NCCL 4OB5H 5FHAH 5T3ZD 2HKHL 2X1WL 1KLGB 3KYKL 4AM0A 3MBED 3RWCB 2VZTA 4OCMC 5DRXB 3T1WA 2APVA 3BP4A 4IRZL 4WRLA 3WKNA 3BZFB 1FC2D 3BDYL 2NYYD 4TVSa 4W4OA 4KGJA 1MCRA 1NC2D 2FEEI 2Z31A 4RAVA 2AJVH 1AP2A 5EIVA 4V1DE 1KN4H 1KIPB 3OGOE 4PJDB 5D1QC 1PKQA 5JHLL 4HT1H 5DURD 4WI3A 1RUML 2HA1A 5FEBA 3DURB 3LEXA 2VABA 5D6DC 2DJSA 1VPOL 3PDOA 3L9RB 3WIFB 3KPRA 4NKOB 4GOSA 1OPGH 3MCKB 3VFPA 2HT2C 4KK6D 3UO1L 4QRTA 1UACH 4R3SB 5B39A 1KGCD 1CE1L 2ICWA 4K71C 3EAKA 4EN3C 5BVPH 4M1CD 4JFOA 4YGAB 1Q38A 1DLFH 5KW9H 3TESA 5FYLD 3WO4C 3SDCB 4HIHA 4L3CB 4X5WB 5GS0D 1AGBA 4CW1A 1S9YA 4O9HH 4F9PC 5FO7B 5ITBH 3DNKA 3TZVD 5F1NA 1FRGL 4MX7B 5F7EL 1MF2H 4U1LB 4RGOL 3QJFB 2IQ9H 4JREC 2EECA 1BFVH 1T89C 4J3TA 5JA8B 1CDJA 1DEDA 3RA7L 1XGQB 5GS2D 2AEQH 3BRDA 1AXSA 3WUZA 2ADJB 4LKCA 1N7MH 5JIHA 5EIIA 1SYSA 4FQXB 4KTEL 4JEGB 1XFPA 2DBLL 5C92A 1I9IL 1BHGA 4KY1H 3E6HB 4GG8B 1BWMA 4ZPTA 1P2CB 5CUSL 5I0DA 2V5RA 5CP7A 3PGCB 1TDQA 5FECA 3X14B 4G43A 4KROD 3UYOD 1ZT7B 1JZ2A 3MNVB 4KK9D 4OLEA 5DS8B 3T2QA 4DGVL 5FYKH 4OM1H 4V2BA 2VMFA 4ZO6A 3NCJH 3QXUA 3VFUB 3C09B 3NMEA 1WZ1H 1Q9LB 1D5IL 4K55A 4F7EB 1K6QH 3ARBA 1CLOL 1HSAB 5BRZE 1R3JA 3MR9A 1UB5A 3P0GB 3EO9L 5ILTH 4UTBL 1AR1D 4Z76A 4HUUB 5DO2C 3QFJA 2UZIH 3D0LA 1NAMB 3KS0H 5F88B 3HCVB 4L4TB 4XX1G 2Z8RA 1ACZA 1XH3A 1HHGB 5AZEH 3AY4A 5EC1B 3U0PB 1EIBA 4OIIL 2NX5B 1KEGL 1UWEL 1JPTH 2ZUTA 2EICA 1G6RA 2VLJB 4Y89A 3X3FH 3RWJA 5IFAH 4XMKL 2QR0B 3KPOB 1EBPA 4Y2OA 1F8TL 3F7RA 4TVPD 4UAOC 5E8EA 3GJFB 2QHRL 3QIUA 1B0RB 4LSTL 5H94A 1A6TB 4Y4HA 4ZAKC 1DBJL 3ARTA 3N85L 3ARGC 1WT5A 2VQ1A 4FP8L 3QUZC 1EDQA 5E1AA 1EEYB 4ELME 2DD8H 4Z9KB 1YN7A 5GGVY 4EOWL 5IV2A 3TCLB 4IJ3B 5I1AB 2C1PA 1EFXA 3M17A 2OZ4A 2J88L 2OMNA 5LBSH 4U1NB 1AD9A 1ZHLB 1I85A 4TSAL 2NX5E 3CX5J 3QHZH 5EU6A 4HQQL 2X10A 2A6IB 3SCMA 3MNZA 2IH3B 3UTSB 3VD4A 4YQXH 1WEJH 3LN5A 1T03H 1B2WH 2VLJE 4OLZH 4HWEH 3PQYA 2W9DL 4IMLB 1OGAA 3HAEA 4GKSA 1P4BH 4FQLH 3O2WL 4LGPB 2AXGA 1RVFH 1I4FB 1YQVH 3AVEA 4OCRL 4BM7A 4APQB 1RU9L 4WHCA 4RFEB 5IQ7L 5E56A 3TV3H 4EI6A 1E0OB 1CL7I 1HILA 4GRWH 3JTSB 1AGEB 3VGFA 1SBSH 4Y4FA 2X4RA 2X9YA 4AL8L 2GY7B 1MCHA 3QEHA 5JMRA 3MC0A 4NC2B 4NC1E 3WLBA 1EHAA 2YKLL 3RL2A 1KYOK 2YD3A 1IT9L 4EDXB 3CAFA 3P0YL 5DEZA 3UTSE 4XP6H 1YNKH 2HMID 1RUQL 1FZJA 2F53D 3GK8L 1YMMA 2YC1B 2VZUA 3DIFA 5CEYA 5TF1L 1HK6A 4OAWB 1KBGH 3O6FD 4G3YH 2VDPH 4ZO8A 1CK0L 5T3ZL 1OD7A 1RQ5A 4HIXL 2VISA 2MPAL 2VXUH 4IMKC 1C5DA 1TENA 3OJMB 3VXME 3LS5L 1HXMB 2Q1EA 2OZ4H 5F7YC 1IZJA 3RY6C 3QIBC 4G6ML 5I18L 4IHOA 4RBPH 3C8HA 4Z5RB 4RFOH 5F89B 2GUOB 4ZUVB 3FO9B 1WCQA 3DYMA 3JWDC 1OQXA 2NNAB 4EQ2A 4FZEH 3BYYA 5F3HB 1I7ZB 3JWOL 5KJRL 4FQ2H 1P84J 2FATH 3G04B 4OGZA 4HK0A 3DOSA 2H2PD 4PJHF 3OXRB 5E94B 2OJEB 3D39E 1D3CA 4FXGA 4NCC1 3C08H 4ALAL 1WISA 2DQTL 3VH8A 4JANA 3EKCA 1YEKH 4NNPL 3WDJA 1EAPB 1NGWA 2E7CA 4NNXA 1RJZA 3PWNB 1FFPB 4HS6B 3U0WH 3HMXH 4XWGL 3ZYJA 4P4KC 2V2XA 1YJDC 4G8EA 5GS0L 4OZIB 2YN3A 3IXTA 2R2EA 4IDLA 5DUML 2ZCKH 4PJ8A 5D96C 1E6OH 2F54A 4YGVB 4CU7A 5I74C 4OGAD 3DRQA 4NKMB 1YEDA 3SBWC 3HC4L 1CD1A 5HGAB 4GQ9H 3EJZD 4UT7L 3O4LA 4OZGE 4K7FA 1PEWA 1SBBA 5E6IC 2LVEA 5T1KB 1NMAL 4M3JA 1R0AH 5HHQB 4IRJB 3SO3C 4H0IA 1OTSC 3EFDL 3WO3B 1F6AB 4L8SA 5T5FL 1IGIH 1IGCH 5HGHA 4NBYB 3EOAA 4HPYL 2A9NH 4LHUD 1QSEA 1S7XB 3QH3A 3MZTA 3RU8H 1CDCA 1CN4A 4R26L 4MA3A 1YEEH 1IQWH 1WK0A 1JFQL 4CADA 3BW9B 2NTFA 4L4VD 4OZIE 1A5FL 3KYNB 3QNXA 2VAJA 4XPGL 12E8H 3MLTB 5AYUH 2CLRA 2V5TA 3QAZB 5EU3B 1QO3B 4P23A 2O61A 5FUZL 3NZHL 1BECA 4KAQL 1D5XA 5I8CB 2MQ0A 5T3XD 3VGAC 5JLZB 5CZVH 4ODUA 1DQTA 3DUSB 1CICB 5CGTA 5KS9F 3WLWC 4OLVL 4CJ1A 1MWAA 3MROB 2A1WL 4M5YL 1IARB 4N0CC 1ZSDA 3MRHB 5C9KA 2I5YH 5FDWA 1MFNA 1MJ8L 3KWWB 1N5YH 1I8MB 1FJ1A 4QRRB 1UXSA 4NN7B 3RPIA 2WBKA 3FRPG 4JQXA 2UUDK 1K9TA 2YRLA 1TQCB 2BNRA 1FO0B 3QCVL 3BT2H 3ILPB 4M9OA 1EO5A 4NZTH 4TYUA 2HRPH 5IVXE 5BMFH 2EIZB 4D9RE 4KUCF 3DO3A 4NRXA 1I1AC 3F7PC 3IXAB 1FLTX 3W9EA 5FCSH 3O6MH 1JV5B 4XMLH 2BHZA 2WLYA 4I2XB 5DJ8B 5D2NC 4TVPL 4LEOA 2XYCA 1P69B 3GSXA 3MMEB 4PV8B 1JPFB 2F8OA 4ZTPH 3U7WH 5DRWB 5ACZB 2JLLA 1T20B 3V52L 1NL0H 4HX1B 1Q1JH 1QPPA 3MXWL 1YYLH 4P3DB 4M5ZL 3WNPA 4JKMA 5IW6A 1JZ5A 4OZFH 4Y8DC 2YUWA 2F58H 1Z5LB 2GY5A 1FE8L 2YPKA 2A77L 2AJUH 3CJJA 2NXYC 1YECH 3NCYS 3U4EB 4O2EB 5D7SL 1AJ7H 5EA0H 5H2BA 1GHFH 4MAYA 3W9DA 1A9EB 4P3WA 5KS9B 3F7YA 1MWAH 3V0VA 4LNRA 4P5KB 3FB5A 3TVMD 3SKJL 3P3YA 5GGRY 1EUTA 2ZUQC 4JB9L 4Z0XB 2OS7A 5C09A 2M26A 5ELIA 4L8BA 1QEWA 3ZDXE 4IOIB 1KF9B 5EO0B 5LXGL 4FFYL 5D8JH 4IRSC 5I73B 2EYRB 1GC1C 3A6CH 4XNMA 5DD6B 5E2WH 1BFOB 2XG5A 4Q2ZB 1H3VA 5JIPA 1YC8A 5EFIB 1W0WB 5IWLC 4JRYB 1LO5A 4U1IA 3RDTB 4HG4J 3DSFH 3OKKA 5HDBF 4HV8B 5DK0B 1D9KB 4HMCA 5HYJB 5JQ6L 1H3GA 4CMHC 2C3HA 4LLWB 3DBXB 3UJTL 2A6KA 3TN0C 5KS9E 2XN9B 5D7JA 4NOFA 4XPFH 5SWZD 1I3VA 3ARXA 4MQXD 1HCFX 4KPHL 1KIQB 3ARYA 2V9QA 5TE4L 1QOKA 3R4DA 1U8JB 3WS3B 2VXTH 5A2FA 5TQ2H 4WW1B 4P57B 3RUGA 2AJSH 2DQCL 3VD3A 5D1QB 4QXGH 1K4DA 3VFGL 4YH6A 3PGFL 2PTVA 5B3JF 3CFCH 1MFCH 1ZAGA 3DUHA 3CZJA 4N90E 4RMRA 4Y1AD 1OTUC 2XOTA 3P4MB 4ZODA 1CBVL 4XCYA 3O4OB 4NDMA 4ZS6D 3RWEA 3MLUH 2HKFL 2XN9E 3OHXA 3ILQC 2AEPL 4HIIA 5EBWB 1FNFA 1HZHL 4R4FL 1ZANL 4N5ED 4EEEA 2H26B 4DUWA 5ICXB 2Q7NA 5J11C 2HWZH 3LRSB 4RQQA 1QBBA 5DHXB 4ZFZA 2B0SL 4F8TA 2PN5A 1QSFA 5GJSL 3BESR 1IGYA 4PGJA 2J7LA 4GFTB 1GAFH 5C1MB 1AO7E 3C6SB 2VQTA 1BIHA 1VACA 4KU1A 2OSLB 4HUVA 4JREB 1MLBB 3HG1A 1X44A 4N68A 4UDUB 3THMH 4WI5A 4PIRF 4P2QB 4OZHB 2HVJB 3T0WA 2B1HH 1NFIA 3QUKA 2A74A 2LU7A 1LILA 2FYYA 5IMOB 4K23L 2BDNH 1IGJB 1JNNH 4EUPB 1CFVL 5BV7B 2IFFH 2DTML 3H9SD 1NJ9A 2AERT 1XGUA 2YUXA 5BZDA 2DQGL 2FNBA 3U46B 2BVQA 4XXCC 4P99A 5E2TL 1KB9J 3F6LA 4G5ZH 1J05B 4NQEA 1DL7H 2CKBL 3NCYP 4DN3H 4HPOL 5I1IL 2X4OA 4LPXA 4WNQA 5GSRA 3K8LA 1E27A 5HHOB 1TVHB 3I2CL 2W0LA 1E4XL 1TITA 3I3BA 5HDBE 4XB8A 3PXHA 4HW6A 4D9QD 3PWPA 3C6LA 1T66D 1IC5L 2WWMC 4LCCB 5T3XL 4PPTA 3GSUB 5FO8A 3WUWA 3DROA 4OZHE 4ELKB 3T0EA 3GO1H 5FO9A 1PYWA 4D0BB 2D0GA 1XGRB 1NUGA 2BSTB 3B3IA 3MLWL 2IGFL 4ZNEE 1IKFH 3BWAA 1U91A 2YXMA 1EBAA 1IAIH 1NUFA 4HHAB 2VXSH 4JN2A 4XNYH 4KI5D 3QISA 4F3FA 1DP0A 3V4UH 1NCCH 3ZKQD 3LIZH 5GGRB 3LRHA 2HKHH 3KYKH 4YO0B 3V4PH 1MY7A 5C0NC 4IRZH 5HHOE 1NQBA 4YR6B 1KIRB 1AY1L 1IM9D 4OZ4B 3C5JA 3QO1B 3AREA 4WU5A 5KSBB 4L3ED 1NLBL 1NDGB 5CJQH 1FZKB 2AAVA 4MXVF 5IKCA 4D0DB 3V7MA 1E28B 4UAOB 5E8NA 5A43C 1ZT4B 4OGXL 5T1LA 1MI5B 1PDKA 1UCBL 5F93C 1RZKC 3VXRD 3FQWA 2XQYG 4ZAKB 3ARGB 3D87B 4LIQL 5JHLH 4GXUM 3K81A 3QUZB 4MHHG 4YHYC 3EYFA 1BD2D 4JG0L 2Q8AL 1RUMH 5IHZA 2ZG2A 4LMQE 1JN6A 1VPOH 2ENYA 3ARSA 2EEBA 4MDIB 4ZSOE 3CFKB 1T1WB 4NO5B 3AXLA 5K59F 2R56L 3UO1H 3QUYD 3ESUF 3CXHJ 2FGWL 3MV9B 1CE1H 5C0CB 4B53A 4ODHH 1NCUA 4WHYG 1RURH 5HDOA 4KZDL 2J5LC 3OR6B 4Z77B 1IL1B 3PXJA 4GG6A 2PYED 3Q3GA 3MV8A 5KSBE 2K1MA 2Y5EA 3RBGA 4B5EA 5CCKL 5FUOH 1I3UA 3MV7E 2BVTA 4JGJA 3MYZA 1I7RB 4X6EA 3GB7A 5INDB 1FRGH 4I1NB 2ARJA 5F7EH 5JQHC 3IETB 5IVNA 5I6XC 1CZ8L 1EO8H 3ORJA 4Y16C 3R8QA 3VE0A 3WDHA 5FKPB 1J8HB 1U8MB 4Q58C 3E3QC 4CMMB 2ZPKL 4KTEH 3IDGA 3REVB 2CO7B 2DBLH 3ZT7A 1I9IH 2FCBA 2YMXH 5C0CE 4CN6A 3PHQB 5J8OA 1FNHA 1I8IA 3ARUA 3ZDYF 3EGSB 2H41A 5CUSH 4R97B 1U8LB 5DMKB 3OKOB 3BO8A 4QTHB 3KG5A 3VGGA 4GQPH 5C0IA 4EI5D 5GSVA 3SDDA 1G7MB 4DGVH 5JORB 1DBML 3L3GA 4QRPD 1MCWW 1NSNL 4OKVA 4G9FA 1S3KL 4GBXA 5F8RC 1T0MB 1D5IH 1T1YA 5JPMA 3ALXA 4BK4A 3B8SA 2DMKA 4X7FC 3SN6N 1TVBA 4UTBH 4K2UL 1ED3A 3WYRA 1FL6B 5LQBL 2Y06L 2C5DC 3DMMA 1TZIA 3JV6A 1A2YB 3KYMB 4UU9A 5AG9A 2QKIB 1JNHB 1NMBH 5EWIL 3RL1A 1AE6L 1AFVL 2H9GA 4TUJA 1Q9WA 1KEGH 1X5ZA 1UWEH 4RAUA 1R3HA 4MJ5B 5HGDA 5EU7E 3BKCL 5TDPB 1IEAB 2GCYB 4QHUB 3OR7B 3QUMB 4MNQD 4LSTH 5BZWB 5FK9B 4GXVL 5HI5D 1DBJH 2IADB 3N85H 1U8QB 4FP8H 3WCYA 2DQFA 1VKXA 5I74B 3MBEA 5CMAB 3ULUE 1DQLL 1LD9A 2J8OA 1TMCB 4KRPB 1J1XL 4U0RB 3B9KD 4GXUN 2VLRB 4D0CA 2J88H 4N0RA 5IFHL 1QLFA 4X7TB 2ZSVA 5E6IB 4BQ9A 4Z7NE 4RWYL 1I8KA 1NC2A 2X05A 2IH1B 1M7IB 2K7PA 1LE5A 1RD6A 1IAMA 1K8IB 3QBTB 3QEUB 1YEGL 3BD4A 3RWDA 3DLQR 3VMNA 2J3SA 3NN8A 4O58L 4WWKC 2MKLC 3UEZA 4EJ1C 4Y2DC 1ORQB 4KKBD 2W9DH 1ADQL 1CFNB 3P4NA 1NBYB 4Y88A 2CDFB 3EYSL 5HHXL 3SGKC 5IQ9B 4OCRH 3TNMA 4KQ4L 4KUZL 1RU9H 6CGTA 2DLIA 2R2BB 3RNQB 1ITBB 4P46C 4TULL 2UVEA 3EDEA 1FFQA 5DRZB 4AJ0A 4PTUA 5GXBB 2AVGA 2JCCA 1F58L 5F7LB 2XWTA 4NO2B 1D5MB 1UVQB 2VH5L 1G1YA 4U6HA 2B5IC 1MFDL 1YEJL 2FJGA 2GTWA 2YKLH 4QF1A 2FL5B 4NWUL 4PJBB 3V7AG 1IT9H 1G7JB 3PJSB 3RWHA 1BMGA 1WV7T 3CU1A 1NGYB 4HKZB 3U9UB 2AJ3B 3GK8H 1T3FA 2R1XA 2HT4C 3TBVB 3IFOA 5T3ZH 2MPAH 3CUPB 1CYGA 5CJ8A 5C07D 5CJXC 1TJGL 3LS5H 2FSEA 3QWOA 4P48A 3SDAD 2LV4A 4Z7WF 5CZXC 3VDAA 4H1LH 2VNCA 3BMVA 4G6MH 1OGAE 4X4ZA 5I18H 3T0BA 4POZD 3CC5B 3KLHD 1FL5A 4R4BA 3J8F7 1HQRB 4U6YA 4ZDHA 3DO7B 1CGUA 4FN0A 4PG9A 1QLRA 3NCEB 2XNAB 4PJBE 2ICWJ 5KJRH 2VO5A 5MI0B 5C0BD 5EUKA 5F1IA 2EO9A 4BZ1H 3RVTD 4WTXA 3GSVA 1LDSA 5D70H 4ALAH 3QFDB 2CQVA 1GZPB 3LKNA 1XCTA 2DQTH 3ZHKA 2XXMB 1K85A 2YWYA 1XF2B 4HIEB 4NNPH 1ULVA 4HZLB 5I2IB 3I6KB 5D6CB 3QPQC 2NXYB 4NQUA 1CWVA 1T0NB 4JCLA 2MHAB 2BY3A 5B4MC 2H32B 4AK1A 1IC1A 1KJVB 2HP4A 3NPSC 4M61B 1UH4A 3O41A 4PRIB 1I9JL 5FYLH 1LNUA 4LOUD 2JB5L 4OQTL 3QDMD 5GS0H 1A1NB 5DUMH 1YNTB 2ZUQB 5A3IC 5J1AA 5C3LD 4JHWL 4KRLB 3O3EA 4M48L 3F5WB 3HC4H 3LD8B 4UT7H 4I3SL 5IJKA 1JP5A 4IRSB 3DXAD 4PRAA 4J1UB 1NMAH 4FXLA 1T04B 4MS8D 3SDYL 3KPSB 8FABB 5EZOH 5GS2H 5E9DD 3BISA 4PLKC 4R8WL 3CGTA 5ALBH 5C0AD 5T5FH 5AG8A 4MD4B 3QR2A 3VWJC 3GMQB 4HPYH 3NIDF 4WEMB 3AROA 1HHKA 3IDXL 2NY0B 3MRLA 4MJ6A 4CMHB 1VGKB 1JFQH 4PG2A 1MCOL 4HGMA 1N64L 2DQJL 5EZLB 1A5FH 3KPQA 3RX7A 1FFRA 5HYFA 4XPGH 4U31A 4KJQD 3RZCD 5IFJB 4NBZB 4J23A 2OL3B 1MNUL 3QQ4A 5FUZH 3NZHH 2JIXA 4KAQH 1WBZB 3FHAA 1EJOL 3UTPD 1OVZA 4LLDB 1Q0XH 3KJ6L 4ZQKB 3QO0A 2ITDB 2W65B 1KPUA 1MHEA 3ZKND 4H0GA 2ID5A 4HSQA 4K9EC 4X6DB 1SYVA 4OLVH 4ZFOB 2BY2A 2IFGA 4M5YH 3KPSE 3SKOB 5JXEC 4O4YL 3O2DH 4YBQD 1DQJA 4X6CB 2Z93A 4X7EC 5IMKA 5DC0A 4JPVL 3IU4L 5E03A 3LMJL 1IEHA 3O4LE 4JO1L 1WZKA 1UB6A 4RIRB 5SV3A 4CL7A 4GLRH 2V2WA 4PY7A 3Q5YA 1WZLA 3SQOL 1L4IA 4OCXL 3ZYIA 1P9MC 3FT2B 5J11B 3BP5A 2NY7L 3MRIA 4M02A 5JOPD 1G9NC 4M4RA 2DKMA 3ARQA 3HS0B 3V5DA 4TVPH 3DX8B 2F53A 4X6DE 3PDDA 3E1F1 4R7DB 3TWCH 3ZHLA 2D7OA 4JZJA 3EDJA 3KYOB 5EOCL 4X6CE 4PJCA 3V52H 3ZYZA 1WFUA 2ARWA 4PJAF 3BKYL 3MXWH 1AHWC 5JIIA 5C9JA 4FTVB 1TNNA 3RGVC 5BS0B 4I0PA 4P2OD 1PLGL 2C9AA 4DCQB 3PE9A 3VG0L 2EYSA 3EO1A 2YEZB 2A77H 1LE9A 4JN1L 3C5SA 5D7SH 3S4SB 3Q1SL 1MCSA 2EE6A 4I9WE 1ZGLA 1RUAH 4NFCA 4F80A 4Y4KD 3ULVL 4UQ2B 2WK2A 5C0DA 2N4IA 2ADFL 2BNRE 3I02A 2XPGA 1S9VB 3SKJH 4OUUB 4JB9H 2X1OA 1A6VL 3TIEB 3EOBA 4FQJL 4JO3H 1IZKA 2QLVB 3S7GA 5MEOB 1QQDB 4RZCA 1BVZA 1U8HB 1SVZA 5L2KD 5LXGH 5FOJA 2X4PB 4LNVA 5K9KB 4FFYH 4NQVB 2DWDA 1TCRB 3RX8A 1LEIA 2R69L 3DVFA 4U1GC 1G6VK 2EKSA 4QXWA 3GSNB 5TDNB 3BZEA 1P7QB 5GS1B 5A2KH 4GW4B 5JQ6H 4Y5XA 5KZCD 4NKQB 4ODWA 1WBYB 1ZE3C 3UJTH 3FOMB 5BW7A 2PTTA 1CXEA 4Y5YA 4BUHA 5ITFA 5GRWA 4S11A 4HLJA 4TNWK 1P6AB 5IK3A 4XZUA 4JY6A 4NO3A 5TE4H 4N0UA 1HSBA 4PJAB 3AMKA 2DQEH 4V1DD 4Y19B 3WV0A 1A7RL 1GIGL 3QUXC 4UB0L 4PRBB 2NW2A 5FXCH 5E7BA 3OKLA 2N1KA 2P1YA 3GMMB 3I84A 3OKEB 2DQCH 2CGRL 2YSSB 5E95B 4F7MA 3MA9H 1K8DA 2CIIA 2RFXB 3VFGH 3ZKXC 3PGFH 3QIWD 2PW1B 1P7HL 4HCRA 3HPJB 4HH8A 4N0YL 3EYQD 3FONB 1QFWM 4S1DD 2HFFB 4XWOD 2D7PA 1CBVH 2RR3A 5E4IA 1DUZA 4YC2C 1K3IA 1U9KA 4PJGF 2HKFH 2DDQL 2MCPH 4G80A 2J8UF 3LKRA 3KLAB 4I77L 4PJ7B 3DGGB 2AEPH 5C7XL 4R4FH 1ZANH 3H9HA 5IB4B 1PVHA 3G08B 1I1RA 3AAZA 3D48R 2J5LB 3C60A 1KSRA 2Q76B 3CLEL 3L5JA 1JF1A 2NY6C 5AUMB 2AK1L 1CL7L 3DETC 5I1KH 4P5TC 5GJSH 5KOVC 2AV7A 4FFVD 4HUXB 1BP3B 1JWUA 4JO4L 1WFTA 5EPMA 3L7FB 1LO4L 3IRZA 5EU4B 1OAXH 1PG7H 1WWAX 4U7SA 5FGBC 3W82A 5CZKA 2M8XA 5KANG 5CD3A 1RZJH 1F45A 4OIAA 3T4AA 3DYOA 4DOHB 5GGSA 4PJ9B 4X4XA 4AQ1B 2G5BA 4PJ7E 3S36X 2DTMH 2IJ0C 1VSCA 3FO0H 2V2TA 3QDGB 1QP1A 2IPKB 1ONQA 2ADIB 3HE7D 5D1ZC 5FKAA 4YAQA 1YYML 5L7XL 1AC0A 5J56B 2CKBH 5C0GB 4PR5B 4HPOH 5I1IH 1GGCL 4HWBL 3VWKA 3VRLE 1E4XH 3KHQA 4HEPG 4QCIB 4R96A 3C2SA 4JY4A 3UTOA 5BRZD 4DTGL 3M07A 1INQA 4QHKJ 2IMNA 3CFEA 2ICEB 1IC5H 4BKLB 2VAAB 4PJGB 1NC4B 4ORGB 5T3XH 4WI9A 5KAQG 1R3LA 2J8UB 1XIWC 2AKRA 1QSFE 4CVXA 3NFNA 3T0XA 1VFAA 4M93B 1FZMB 4DOHE 2EC9U 1R5IB 4GUPB 2W07A 3MLWH 5DJYB 2IGFH 3TVMA 5HYSG 2AJZB 5D1XA 1DN0A 4KJPC 3CVHH 3HG1E 1J12A 1JRHH 1OAUL 2FH6A 4BQBA 5F71A 5EUOB 1BQUA 1GJIA 3HC3L 3OB8A 1XF5A 5IBTL 3OKDA 3LQMA 1NLBH 2Q86A 3B2UD 4H20L 5HPMA 2P8LA 4O2CA 5MENB 4LRIA 2B8OT 4IBLT 1KYOJ 5DK2A 4DGIL 5DEGA 3MO1A 4OGXH 1T7ZA 5FUCC 4AH2A 1MAMH 1BQHA 2L7UA 1A4JB 5K9QG 1FP5A 4KKLD 4LIQH 2PYFA 3BIAX 4H5SB 4WUUB 4JG0H 3DVNA 2Q8AH 3CSGA 2FO1A 3GSRB 5KSUB 2NX5D 3PWPE 1H8OA 3GZKA 2OR8A 3O6LL 4XBGA 1U92B 4AT6A 4PJIA 5CP3A 3O3DA 1YY8B 2FGWH 2VLJD 5GHWL 3U6RA 2X70B 3J7HA 5ESQB 1JGDB 1M05A 4YFLI 5EUOE 4WWKB 1J0IA 4Y2DB 4U1MA 5DUBB 4M9PA 5JMOC 4KK8D 3FFCA 3L3DB 4CBPA 3BOVA 5MENE 3BP6B 4HKJB 4Y1AA 4Y16D 2QSCH 4PBVC 5KAQF 4Q9QL 3RPKA 5B22A 1JVKA 3WXVL 4ZS7H 3KGRA 1RV6X 3W39B 1Z9SA 3E6FB 1T1ZB 2ATPA 1KG0B 4KKAC 3ROOB 4J3VA 3AY4C 2R2HA 4UV7L 1QFOA 1CZ8H 2Z8WC 3F7VB 4J8RA 1U36A 2MFNA 4U6TA 4M6OL 5E8DL 1KPVB 3CCHA 4PY8J 1WBXB 1P7KB 1KIUA 4G8IA 2I24N 4E42B 1N8ZB 3QULB 4HFUL 3UTSD 5JW4R 2ZPKH 2HTKD 4NJAL 3RIAF 2BVYA 2NZIA 4DZ8A 5I1DB 1MVFA 3KPPA 5E4EC 4JM2D 2OBGA 4APQD 2NY5L 5ICZA 5KBNC 4XCNA 5KVFL 2EE3A 4O00A 5DI8B 2XA3A 5SX4I 3IJSA 2QHLA 3VXMD 4K94L 5ENWA 4GMSL 3KPMA 3MPCA 5ICYB 4KXZH 3FQTB 4RNRA 5IJVB 1S5HB 1DBKL 1HHIA 1S3KH 4U3HA 1I85C 1T4KA 4BFIB 4GG6E 1ADQA 3H9SA 5CP3H 3BHBB 3QRFM 5HDQL 2FH8A 4WTWA 3BGFC 4EIGB 2Q87A 2A0LC 5JW5A 4F15C 3U48A 1YY9D 4K2UH 4JZOB 2VC2H 5LQBH 3UPRB 2X1PA 3D39D 3EOTL 3SO5A 3DGCR 4QHLA 4MNGB 3RQ3A 1IEBA 5DHYB 1LEGB 3U82B 4PD4J 3LV3A 1IM3B 1UJ3B 2EEDA 2XWJA 3HE6A 5D2LA 4N0FB 2HT3C 4JHZA 3V4VL 1AFVH 4D9LL 4Y4FC 4YEFA 5IIEA 5KSAB 5EBLB 3LQAL 1FDLL 1S9XB 4PGDB 3VXUB 2AJXL 1AH1A 1UADC 5HYSB 1OGTB 3BKCH 2FWOA 2FR4A 3ZSTA 1NEZA 3BPLC 1HYRC 2H3NA 1L7TL 2QADB 5ADPH 3NAAH 3IKCB 5HY9B 1MCCA 2EYTA 2BY1A 4GXVH 3HC0B 5CINL 1JGEA 5FGSA 3PABB 2P5WB 1BOGA 1DQLH 5IR1B 4U3XA 1A7OL 1J1XH 4MNGE 1JWSB 5FCUL 3TH3T 4G9FE 4LASL 1IM9A 2VDOL 3P73B 5IFHH 1S8DA 1I9RH 4L3EA 4ODSH 4RWYH 5CLWA 3IDMB 2BXZA 3VXTA 4IOSD 3M1BA 5HI3D 4O58H 1U58A 3VWJB 1EH9A 2GHWB 2GK2A 5ISZE 1HXYA 3D2UB 3VXRA 4C83A 2EDNA 1MH5A 3EYSH 5HHXH 5SWSB 2GKIA 3B9EA 4QGYA 2XZAH 1JHTA 4NQDB 3VFTB 4BSWA 3JSSA 3I50L 3TIDB 3L6FB 1Q9KB 4XP1L 2E3VA 2UZXB 4YPGB 3ULSA 4LDLB 1UQSA 3QUYA 2WUBL 2P5WE 3NFSH 1F58H 1T2QH 3B5GA 1EGJL 4PLJC 1FQ9C 1HQ4A 1IQDA 2ORBL 2VH5H 3RKPA 3MOQA 5GIRB 5CHNA 2PYEA 2IPUK 3O11A 1MFDH 2FIKB 5I9QB 4OQTA 3FAXA 4NWUH 2H2SD 5DGQA 2IMMA 4BQ6A 3HZMB 5LWYH 3VCLB 2APTA 4PJ8C 2WIIA 1OTTC 5CBAA 2DQDH 4D9RD 2JJSC 5EIQA 5SWSE 2R0WL 1KLUA 4NQDE 1BBJA 3PWLB 1ACYL 3RJQB 2HN7A 3HR5A 4ORZC 5DK3A 4GW5B 1NDMB 1TJGH 4XHJD 1NGXA 3WIHA 1N6VA 4PGBA 1N26A 4JFEB 1E4KA 2LVCA 1H3UA 1GGBL 4R0LA 3TO4A 2I9LA 4YXKL 2JB6B 4JFHE 5ESAB 4AG4L 1YN6A 4JFYB 1F4XL 4P5MB 2R0LL 4LCWB 4WI8A 1NAML 2P7TA 1AGFA 2LE9A 5BJTA 5C8JA 4EI5A 4QYOB 3EJYD 5K33A 4QRPA 2R1YA 3DHMA 2JCCE 4UOW1 4NKDA 3V5HA 2XWBB 1MIEH 3JV4B 1QUNA 4JDTH 3C87A 4YHIB 4P23C 3TA3A 4WEUD 4N8VG 3MRCA 2Q6WA 2X2YA 1U8IA 4WTZA 3GSOB 3IFNL 4YK4C 1OWRM 3T09A 3GHEL 5JZ7D 2Z91B 4EVNB 2L7JA 1ORSA 1I7UB 4X6BA 2HFEB 4XP4L 1WIOA 5B39G 3MNWA 1I9JH 3U7YL 3ZE1E 3HZKB 3H6JA 1PG7W 1UKTA 2R1WB 2AGJL 4AIZB 2JB5H 4OQTH 3IGAA 4I5BA 4YUEL 5FM4A 2FLRT 3E8UL 4YDVA 2OLDA 4JQXC 4J2XA 2X4QB 4JHWH 2BOCB 4LCWE 3L7EA 3UTTB 2W0FB 3FQNA 4I3SH 3QNYA 2YZ8A 4LCYB 2W9LA 1PY9A 3RHWF 1VFUA 4KWUA 3SDYH 1QYGL 2ZJSH 3WMSA 5H35A 4R8WH 1YUHA 1OAYL 1X9QA 1XGTA 4OLWL 1I3RB 1FSKC 3IDXH 4K8RD 1ZOXA 1IC4H 1YPZA 2D7QA 4KK5C 2Z0BA 5IW1A 1MCOH 1N64H 3VG9C 2HG5A 4HS8L 1RZIB 1MUJB 1RK1A 4QKXB 4CNIB 4EDWL 1EEZA 3P4OB 2DF3A 1I3GL 3S97C 3L95B 4X9GA 1MNUH 3IJYB 3UAJC 1W0VA 1BVLB 1EJOH 35C8L 1XF4A 4OCWH 3KJ6H 3QUXB 2VLKB 3NCMA 4YNYB 4BSVA 4ENED 3MRGB 4MA1B 1N5AA 4N90D 3JTTB 3QQ3B 2WW8A 4Z7VA 3RDTD 3S36L 2YD7A 5DEFA 3ZKXB 4O4YH 4Q97A 4X80L 3I75A 4NT6A 3BQUD 1R3IH 4JGUA 4JPVH 1MCPH 3IU4H 2XN9D 2D7TL 3QRGL 4JO1H 3QWRA 1Y0LB 5CJ5A 4AQOA 1F97A 3WFHA 4Z7UA 3KPNB 2B4CH 4YIQA 1TZHB 3SQOH 4OCXH 1J0ZA 2MKWA 1HH6A 3TYFA 2BVPB 4ERSL 2NY6B 2IANE 1AO7D 4UDTB 2G2RB 3WBDA 1ZHBB 4Q6IC 5CSZA 1FNLA 4LSDA 4OLUL 2DLEA 3OAZH 1ZA3A 2FO4A 1FLRL 5B38G 5CIPA 1J1OL 1FIEA 2ZOKB 4MCYB 3QI9A 5E5MA 4JDVB 4HXBL 2XZZA 1GVIA 3BKML 4AM0B 5EOCH 5D7JC 4ZNCD 4OD2A 1IGFH 3ARWA 5IVZB 5TDOA 4R4NC 4RCAA 1Y6MR 3FQXA 3QEQA 3BKYH 5ESVB 5J13B 1HYSC 3GGWA 1PZUB 2H6PA 4FMFA 3AB0C 3BE1L 3OAYK 2NY4B 1PLGH 3P0VL 3CLFL 1NBZA 1YNLL 3VG0H 4JN1H 1ODAA 3STLA 4QOKB 3SJVA 5B8CB 5F7DB 3S88L 1UZ8A 3WS6A 1CFQA 4IS6A 3U0TA 3DI2B 5D1ZB 5IF0B 1O7VA 2ADFH 4N8VB 4UBDD 5ERWA 5DD0L 4CGTA 1A6VH 1MQKL 2BMKA 3DX6B 3KPRB 3OL2A 4I13B 4XXDB 1CXHA 5C08A 1AGDB 4NQSB 1IAKA 3QA3A 4DEPC 2VTFA 5GGTL 3UC0L 2W59A 2AXFA 4HFWA 5T1MA 3OV6A 2WMPA 2EC8A 2GITB 1XIWB 3CDCA 2R69H 4POUB 4IDJL 4JFFA 1W2KT 4U1JA 3LKOB 3ZE0E 4GRWF 4KFZC 4ISVB 4HUWB 1S7TA 1ETZB 2X5PA 2D0HA 4M1GL 2RGSA 2EH7L 4QOKE 4CUCA 1Z0MA 4MNHB 4E0RA 4PJCE 5CIPH 2CR6A 5EG6C 5HHOD 2PO6C 4M8QB 4JM4L 4IOFC 1UWXH 2LTQC 3DXAA 3HRZA 3FQUA 5INCB 3GMLA 5E9DA 1CLZL 2F74A 1QRNB 3PDGA 1A7RH 1GIGH 2EXYC 1LP9A 1OSZB 1U8PB 2RAMA 1C5CL 4JRXA 2CGRH 3H2WA 2WBJB 2X7LB 4L9LA 2EZ0C 4M7LT 3OZ9L 5A16A 1XR9B 5FECB 4G43B 4HWBA 4PREA 3TBWA 3MODL 1QBLL 1YDPB 4N0YH 3QXDB 3ZZ1A 2EEAA 2HLFD 3RZCA 4M6NL 4HMEA 3OPZL 2D31A 3H42L 1ZXQA 1ERNA 3D25A 2DDQH 3CFDA 3C6LC 4I77H 5KANI 5GPRA 4WHDA 1RPQA 2VDRL 1KOAA 4HC1L 2CRMA 1T7WA 1R5WA 3MV7D 1SY6L 3GMPA 3T0EC 4F33A 1JI2A 3LH2L 2AK1H 1ROWA 5D9SA 1A7NH 3ZE2F 3CH1A 1FL3A 2FZ3A 4HWZA 4GRWB 3DUUA 4PRNA 3SDXB 1LK3L 3D3VA 4NPYB 1DEEA 4JO4H 4LLMB 3PUCA 5KVEL 5DTFB 5DVKA 4BFEA 1H3WM 3MQIA 2VDQL 2Z31D 5L88L 1A1MB 1JWMA 4WY7L 3FRUA 1T5XA 3MRMB 4BA8A 4DW2L 3GMRB 4DZBB 1X7QB 3MJ7A 3HI1B 3QXAA 5B38B 5C0CD 4QNPE 2W60A 5JTWA 2Z4QA 1XCQA 3CZFB 4ZTOL 4MCZB 3VXOA 3C5ZA 4NRYB 2YD1A 1BBDL 5DQ9A 4OD1L 3KXFB 3LN9A 3UTZB 1INDL 2XKNB 4K8RL 1FV1A 5L7XH 1S7RB 2Q7YB 2X4TB 2ERJC 5DYOB 3H0TA 4X9HA 3L3HA 1XGPA 4TSCL 1GGCH 4HWBH 3SDXE 3ECBA 4KMTL 4LSRH 1W72A 1RUPL 3LEYL 4JHAH 1FVEA 4DTGH 1XGYL 3JV5A 1NGZA 2FIRT 4X4YB 4MWFB 1GPOL 1M71A 2I07B 4JHBA 4K7PY 4OZFG 4Z7QF 5E5UB 9CGTA 32C2B 2CUMA 1ZWIA 2DLGA 5HHPB 1FVCA 2NW3A 5DLMH 1KELL 5ISZB 4XTRC 3MGTA 3IS0X 5F8QC 4HDIA 3S35X 2CLVA 5K9QI 3L3IB 2BK8A 2ZUYA 3BZ4B 1OAUH 2DN7A 3ARDA 3X13A 2ZNWA 1QR1A 3O45B 5IMLA 4DGYL 3HC3H 4S2SA 4A6YA 5IBTH 2FBJL 2NY2D 3O9WA 4PJFB 2VSDA 5DDHA 1NFDA 3O3AA 2VE6A 1QFUH 3ARFA 4WDIA 5CGYC 1KTDB 4DGIH 2XZCL 3RP1A 3U83A 2W91A 1KJ3L 4N8CL 4YHKL 3ULUD 1T22A 3QXWA 1G0DA 2WQ8A 3FB7A 4F57H 4ZG1A 2GIYA 5A40E 4JAMB 1KCRL 3NCFB 1FFOA 5AEAA 5JUEL 3DYPA 4GAYA 3TFKC 3WHXB 5F7HA 5I66B 2DOCA 3ARBD 3BP7A 3U4AA 4NGHL 3GJFK 3SDDC 1A7QL 1WWWX 2Z92A 2XT1B 2C4FU 3O6LH 1B0GB 4I8DA 4WO4C 4ZXBB 5MEPB 3S37X 5JOEA 1TFHA 4RDQG 1BAFL 5GHWH 5EULV 2F5BH 4YJZL 1B3JA 4G6FB 3Q6FB 3PWVA 3QIWA 4PJFE 2E9BA 4HIJB 2VIRB 2OR7A 3DMMC 4G6AC 5F9OH 4Q9QH 1G7QB 1CI5A 1KLGA 4WI6A 5E2UL 3WXVH 4DKFL 3RWCA 1JZ3A 5DRXA 5T1DL 1CGTA 1OCWL 1AGCB 2YD9A 1UYWH 2PNDA 4J3SA 3BZFA 3S34L 4M6OH 4LSUH 5E1HB 5E8DH 1TQBC 3QIUD 1JGUL 4JLRB 5GRXG 5JW4Q 3DARA 4KHXL 4Y4HD 4CN1A 3W5NA 3FO1B 4HFUH 4NJAH 1KIPA 4PJDA 1J1PL 5BV7L 3A67L 3Q0HA 2R2CA 2GJ6B 1EFXD 4ZOEA 4XRCA 5DMJB 2YPLB 4LDOB 2FD6L 1H5BC 5KVFH 3DURA 3KHOA 2OJZL 2XV6B 3L9RA 5BOPA 2UZYB 3MBEC 4I4WB 5CWSB 4NKOA 3SOBH 3WIFA 5JNYB 4LEXH 3MCKA 3SCMD 3WJJA 1U6AL 4PJIE 4R90L 4GMSH 4R3SA 3A6BH 5HYEA 3PQYD 4OFPA 2NYYC 1OGAD 3IDUA 1HI6B 3DV4B 3F12B 2JK5B 3T2NL 5EOQL 1D5BB 3K3QA 3SDCA 3EHBD 1T6WA 5HDQH 4L3CA 3QWQB 1F4YH 4X5WA 2B2XH 3JWOC 2XTLA 3OBAA 4RDQF 5FO7A 1W8OA 4XGZB 2V7NB 4B0MM 4MX7A 4TPRL 4U1LA 2HJKB 3QJFA 5IBUB 4X5XB 2LABA 2RCSL 1EGJA 5D5MB 4P2RB 5BRZA 4OZFB 1XGQA 4KK6C 2W9EL 4KJYB 5ACLA 3V4VH 4D9LH 1ZHNB 1F3JB 4YK4B 4M43L 3S5LB 2ADJA 3I3EA 4M1CC 3BX7C 2ENSA 2P8PB 2A9ML 4R9HA 1FDLH 4FQXA 4L5FL 3WSQL 1NUDA 2AJXH 4OFYA 1NANH 5DMIH 5SWQB 4WI4A 3E6HA 4GG8A 1L7TH 1P2CA 5GS0C 2ZG1A 3PGCA 3TBYB 3X14A 3VI3E 3TZVC 1ZT7A 3MNVA 4QHNB 5DS8A 3P9LB 1JHKL 5IGXL 2PUQT 1DSFL 4RGNB 1A7OH 3OTTA 5FCUH 1PGRB 3VFUA 1Q9LA 4F7EA 5L2JB 2VDOH 3HNSL 1HSAA 5D5ME 1MFBL 4P2RE 4OSUL 5DJ2B 3BEWB 1FPTL 3SE4C 5DHVH 3U79A 1JGVH 1QKZL 1FSKB 4HUUA 5EZIL 2ARJQ 1NAMA 4LEOB 2DAVA 3FAWA 5H37H 4C56B 3HCVA 4FOMA 1QHPA 4GSDH 2NZ9D 4QY8B 5DJCB 2M2DA 4KROC 4EIZC 1HHGA 3F8UB 5C6PB 5EC1A 3U0PA 4KK9C 5D2LE 5GQBA 3VG9B 2NX5A 3MFFB 3MOAL 2A83B 4XP1H 5I1EL 1OLZA 1CDUA 2VLJA 3O0RL 1KEML 4HZAA 1EGJH 3FB6B 3L3OB 3VMPA 2QR0A 4RGNE 5GRZA 3KPOA 1LO0H 3KPSD 2ORBH 2CDGB 1MJJB 3LEVH 2I9TB 2P45B 3GJFA 5EN2B 2LAAA 1AR1C 1B0RA 1BFTA 1A6TA 4FQIL 2DI8A 2NY0D 4HXAH 3EJJX 3MRJB 1VENA 4QXUL 1XMWA 3O4LD 1EEYA 3WUWG 4PFEA 1VEPA 4C56E 3TCLA 1UM4H 5I1AA 3OG4B 4NSKB 3W2DL 2R0WH 1RZ8B 3WKMH 1X5AA 4U1NA 1RJCA 1ZHLA 4WV1B 1OD9A 1EHNA 2MSPA 3PHOB 2A6IA 2DWEB 1QSED 2IH3A 1KB9K 1BJMA 2VZ1A 3UTSA 3MUGB 3RVWD 3VFSB 4IMLA 3GHBL 4R7NB 5JA9A 4Q6IB 1GGBH 4DUVA 1I4FA 1FG2B 4O5LL 4Z8FL 4APQA 1EEQA 2QBWA 1ZLSL 4LARL 3ULUL 1F4XH 2R0LH 4RFEA 4CKVX 4PG2C 3JTSA 1QVOB 1AGEA 4KDTC 3RWGB 3VXNB 1F5WA 3G9VA 3EZ8A 4QRUB 2DI7A 1KTKE 1JBJA 4TSBL 3PP3K 5L9DH 3AS1A 1T1XB 5D93C 3AB0B 3BH8B 3IFNH 1L9NA 4UNUA 3I3DA 4EDXA 3TBTB 5A2IH 4Z7OF 5DWUL 2BNRD 1U0QA 5F3BB 3BIBX 3D39A 2D4FA 3U7YH 2X1QA 1FYTE 2YC1A 2ZCLL 2IPTH 3HB3D 2AGJH 4OAWA 2Q3ZA 1LQSR 5FIEA 2X44D 4E41B 3T8XB 2Y7QB 4GMTL 2BX5A 4G8GB 3E8UH 5DJAB 3BVNB 1DUYB 1UT9A 3VXQB 1G6RL 5I1LB 4F8QA 1HXMA 5CEZE 4IIQB 2QTEA 3BMWA 1Z9LA 1EERB 3OF6D 3V0WL 4I18B 2N7BA 5ALCL 4Z5RA 5F89A 2GUOA 3V6OC 4ZUVA 2AW2A 3GIZL 5F6IB 3EYVB 3FO9A 2OI9B 2EDOA 4OLWH 2BNUB 3GJEB 5F3HA 1I7ZA 2X4UB 2HMIC 5BQ7B 3G04A 4PGEB 3IFPB 2OXGA 5JXAH 3OXRA 3CXHK 3O6FC 1DVFB 5E94A 2OJEA 1LO3L 1CT8B 2PO6B 4JZJC 3EFFB 5FF6B 1FVDB 2H45A 3HPLB 4PJXB 4E41E 2H1PL 4MJIB 4EDWH 2VWEC 4G8GE 1I3GH 5CSBA 4YX2L 5CGMA 2A6JA 4MAYD 1D6VL 1EAPA 3MLPA 1SJHB 1R5VB 3PWNA 1OAQL 1T2JA 1FFPA 3QQ9D 4HS6A 4U6VL 4ODVL 3TNNB 4OZIA 3SKNB 1DQMH 2VSCA 2ZSWB 4FZ8L 4J3OC 4YGVA 3BN9D 5F9JB 2X89A 4MSWB 2EDYA 2H2PC 4X80H 4NKMA 4NQEB 2P42B 1ZEAH 4HS3B 3T1FB 5HGAA 4WENB 3GI9L 5DJZB 2R4RL 5EORL 2ZOLB 5GGTA 3F62A 3WJLC 5L0QC 1WTGT 2AK4B 4MB4A 5T1KA 1OW0A 2IAMB 5HHQA 1R24B 4IRJA 1GGUA 3BI9X 3ES6B 3QHTC 4OJFL 4PJXE 1F6AA 4K3DH 4NIKB 4MJIE 2D4DA 3BXNB 1A6UL 4ERSH 2ESVB 5FO9B 1BF2A 1S7XA 1H3TA 1RZFL 4MYWB 2VR4A 2XG4A 3BKJH 1CDHA 1FLRH 1F42A 1P4IL 1S7UB 3K46A 2OTUB 1J11A 3BW9A 4FFZL 4U2ZA 3QDAA 4OFDA 4Y5XC 3KYNA 3G6JF 4OGAC 4U1KB 2XQBL 4OF8A 3MLTA 3BKMH 3HFML 3S35L 4Y5YC 1JTOA 5EU3A 3EJZC 1QO3A 1ZVHA 1P53A 4GO6B 5I8CA 1RZJC 5JLZA 4DAGL 3PWUB 2VLLB 1SMOA 1D5ZB 3DUSA 3K1KC 4XMPL 3BE1H 1CICA 2DKSA 1PQZB 2AK4E 2VZ3A 1YNLH 3KR3L 3ULVE 4KRMB 3OJVC 1LK2B 3MROA 3LS4L 4Z7VE 3MRHA 4KJWD 3KWWA 4H1LG 2NY1B 3S88H 5GJTL 1I8MA 4QRRA 4CVWA 1AI1L 1FO0A 5DD0H 4XP5L 3UPAA 3ILPA 2ERJB 1DCLA 3WFDH 2Z9TA 4Z7UE 1MQKH 1FN4B 1MPAL 2EIZA 3GRWL 1A3LL 4HC1A 1QSFD 3UC0H 5GGTH 3S37L 3IXAA 1SY6A 1JV5A 1GC1L 4L8DB 4PJ9D 3P9MB 4I2XA 5DJ8A 5C6WH 2BERA 5ID1B 5GRVK 3VFRB 3MMEA 4PV8A 1B4JL 4M7LH 3HG1D 1JPFA 1BQLL 5DRWA 5ACZA 3IDIB 1OAKL 1T20A 4P9ML 2VXQH 2IWGA 3UYPA 4MVBD 4LQ1A 4HX1A 4NJ9L 3QEQE 5DD3L 3G6JB 4P3DA 4JM4H 2VZSA 3X3GH 1KJMB 2FBOJ 1FGVH 5FFLA 3WNKA 4BH7B 1Z5LA 1B6UA 5MP6L 5F7KC 3U4EA 1UG9A 4O2EA 2YPVH 2FECI 5ANMB 3CNKA 1A9EA 3NA4A 4JPIA 5KS9A 2BVOA 3S3PA 4ZFOL 1I8IB 2DBJA 4P5KA 4E5XB 3OZ9H 4FQPA 5DZNA 4W81A 3PWPD 4Z0XA 3GSWB 2PXYB 4UNTA 3V6ZB 1QBLH 2YD2A 5GSVB 5EO0A 1OP9A 5C08E 4M6NH 3EYUL 1GGIL 4WO4B 3OPZH 4QEGA 3H42H 1J0JA 2EYRA 3P77B 3IT8D 5DD6A 1NCAL 1BFOA 1RZ7L 4Q2ZA 2JJTC 3CSYB 4JFFE 1UWGL 3AUVA 2VDRH 1IILE 5MEND 3MRPB 4HC1H 4GS7C 5EFIA 1W0WA 4RWHA 3MRDB 4JRYA 2BOBB 1SY6H 1T5WB 3FN0L 3PWJB 3RDTA 3VJ6B 4HV8A 4JKLA 5DK0A 1D9KA 5E08L 4NQCB 4ONOA 5HYJA 1ED3B 4LLWA 3DBXA 2IQAB 3HUJF 3TVMC 3BQUA 2XN9A 5DFWH 3HA0A 3A6OA 1LK3H 3F65A 2ZUVA 3ARED 4BQ8A 5ID0B 4PP2B 5KVEH 4WFEE 2VDQH 5L88H 4WY7H 1SM3H 4YDIH 5IB3B 4EZMA 4JY5L 4DW2H 2YRZA 2OR9L 3H3PL 1U8JA 4Q9CA 1CQKA 5E24E 43CAB 3WS3A 4HJJH 4NM8L 4S0SD 1NAKH 1Q8MA 4WW1A 4YEEA 4P57A 4OV5B 4PYGA 4ZTOH 4JRXE 1P4LB 5D1QA 3QG6B 1KCLA 4M62L 3T2OA 2XACC 4NO0B 5HSFA 1BBDH 2AXJA 3SE8L 1H5BB 5E8OB 2Q20A 1INDH 3P4MA 2EDQA 4G9DB 1L0QA 4PGCA 1MIML 3UJJH 3QZWG 4MQXC 4TSCH 4KMTH 3LEYH 5EBWA 5DMYA 5E2VL 1X5IA 3VD7A 3P2TA 3MV8D 2H26A 4H1LB 1I8KB 5ICXA 1XGYH 4DQOL 3B2VL 5GZND 3LRSA 3FRPA 4XNZC 2R4SL 3QNZB 1IJ9A 3NIFF 3ETBF 3AS3A 2MCG1 2IG2H 3GSNL 3C6SA 2YN5A 5ETUB 4Y8AA 1MLCB 3VI4E 1KELH 2OSLA 5DURB 4OCLC 4MB3A 1A47A 5DJDB 4NRZB 2GFBB 4HBCL 1MLBA 3G5VB 3HUJB 4ZS6C 3VXPB 1T89A 4UDUA 1N0XL 1RULL 1X5HA 4J6RH 1JPGB 2GAZB 4P2QA 4OZHA 2HVJA 1AQKL 3QDHA 4GAGL 5IMOA 4N5EC 4DGYH 1IGJA 4ZNEA 4EUPA 2FBJH 1VADB 1Z6JT 2EE9A 4OQ1A 4RA3A 2GTWB 4UIKL 4ZYKB 4XPTL 3U46A 2XZCH 2XTJB 4LP4A 4JFQB 4YZFE 2C3XA 4N8CH 4YHKH 1MRDL 1J05A 1RZKL 3TZVB 1JMZA 4GKZB 4ETQB 4KI1A 1T7VA 5KVMC 4G9FD 4X8JB 3ARVA 4GBXD 5HHOA 3LSOB 1TVHA 5GZOD 5JUEH 3N1MC 4ZUTA 1BJ1J 2WM0A 4NGHH 4HKBB 4JZNB 4U33A 3VFNB 1FZOB 1UZ6E 1F4WL 3HUJE 5KSAD 3ET9F 4PLNC 4LCCA 3GSUA 4MMXC 3H3KA 4ELKA 5FYJE 1A64A 4CDHA 1L9MA 5C71A 4D0BA 1XGRA 2BSTA 2ZNXA 1BGXL 3CFBB 2QADD 3DV6B 4HHAA 1IAOB 1HEZB 1GOHA 4ZDHB 4OT1H 4KROB 2XQYK 3V8CA 1PSKL 5GGRA 4XVTL 4JPKL 1WUNT 2XTJE 2G75B 5E2UH 1X5JA 4YO0A 3L3KB 5L6YL 5T1DH 2MOVA 3D0VB 1V7NH 1P1ZB 1OCWH 4N5UA 3QHFL 1RFDL 1NCTA 4AENB 5SX5K 4YR6A 1KIRA 4QTIL 3IDJB 4OZ4A 1U2HA 3QO1A 2VL4A 4X0KB 1T66C 3S34H 5KSBA 4LPCA 1NDGA 1FZKA 3B83A 4KKNA 4D0DA 1DZBA 1E28A 1NFDE 3VD9A 3U9PH 1ZT4A 1MI5A 2V5YA 2FHFA 4EUPH 1J1PH 3D2UD 5BV7H 3A67H 4ZAKA 3ARGA 1BWWA 2BJML 4H8WL 3QUZA 5SWSD 4KI5C 1WC7B 2O5ZL 1FG9C 4NQDD 3IDYC 4U1HB 1Z3GL 2OJZH 4NZUH 2VDML 4CAGA 4GH7B 4MDIA 3CFKA 1T1WA 4NO5A 1PZ5B 1QHOA 1U6AH 1N2RB 3WD5H 2BHYA 3X11B 3MV9A 3WHE1 2VB5A 4MA7H 3SGDH 5C0CA 5F72S 4UILL 3OR6A 4LVNC 1IL1A 4XPBH 3T2NH 5EOQH 3LB6D 1U3HB 1U8OA 1KV3A 4JFHD 4KVNL 3GNML 1C12B 1QFHA 2F8VA 4F7TB 1C5BL 1GH7A 1D6EB 3V95A 4KTYA 3ZDZF 3QZWB 3FOLB 4BZ2L 4HBQA 4LHJB 1I7RA 4ZO9A 5INDA 2HJLB 3O8XB 3V6FB 5J6HB 1M7DB 2BXYA 4FQQB 2BSSA 4LHUG 3IETA 3UJIL 5GGQL 3PGDB 1IAII 2RCSH 4M7ZB 3R1GL 3MUZ1 2V9TA 5HGGS 3QUYC 5D93B 4M43H 1SEQL 1U8MA 4G7YL 3GKWL 3JVGA 3I9GL 4CMMA 1A4KB 2NMSA 4YPJA 1CLYL 2HTLD 1QTYT 2A9MH 4ODXB 4L5FH 3WSQH 3REVA 4PJDE 3PHQA 3EGSA 1U8LA 2XIDA 4U6XB 5DMKA 3OKOA 4QTHA 1QA9B 4RMWA 1KENL 4LCWD 1ZGLP 1ITCA 5LGKA 1Q9OB 3MA7B 5LVEA 1G7MA 4JJ5B 5JORA 5IGXH 1MHHB 3SE3A 4D94A 3ALPA 2DQHL 1T0MA 4EXPX 3VRIB 1AXIB 1Y18B 5DSCB 4DK3A 1MFBH 2Y25A 3MRRB 4OSUH 5JHDB 5GGSY 3WE6A 1CD8A 1FPTH 2ZP0T 2APFA 1E4KC 4JKPL 3VXSB 5DJ0B 5AAWA 4WFHE 1NFKA 1QKZH 2JELL 6FABL 1FL6A 1XT5A 5EZIH 4R0LC 3RVXD 3OB0K 4GRLB 1A2YA 3KYMA 5DMGD 1NCWL 1JYWA 4JCMA 2QKIA 3O6FB 4N1EA 1JNHA 2FEDD 2R39A 4RMUA 5DJ6B 3P40A 4PRHB 4EI5C 2YA0A 3MOAH 2GT9B 5I1EH 1C16B 2FRGP 1F90L 1NMCC 4MJ5A 2DJUA 2DM7A 3TO2B 2XZQL 3RVVD 1ZVSB 3O0RH 1KEMH 5TDPA 2AS5M 1IEAA 2GCYA 3GI8L 5CKAA 4QHUA 3BWUC 4U7MA 3OR7A 1FORL 3QUMA 2C3GA 1NGPL 2UWEF 3LQZB 5JHDE 3ZTNL 2GJZB 5BZWA 4FQIH 5I17A 3LDBB 3FT4B 2IADA 1U8QA 4MA8L 3VXSE 3O3UN 1CTOA 2O5XL 5CMAA 5B21A 1JF5A 1Y6NR 5I1HL 5BVJB 1KFAL 5CS7A 4HKXB 2VLRA 1G1CA 3W2DH 2B4CC 4X7TA 4HGWA 5E6IA 4KTDL 3DX9B 3MLXH 4PRHE 2IH1A 4OLYH 5EU5B 1M7IA 3OX8B 1OB1B 1K8IA 2IAND 3QEUA 1CGYA 1T7XA 2YD6A 3HHRB 1MOEA 2F15A 1ORQA 5TQ0L 2Q8BL 1KC5L 4R2GD 1CFNA 3GHBH 1NBYA 2GW5A 1MCQA 2CDFA 5IQ9A 4L4TE 3B5TA 4Z8FH 5C2UB 5HI5C 3DTXB 5TH2B 3PL6B 4PB0L 1ZLSH 4LARH 2R2BA 3MOBL 3RI5F 3RNQA 3ULUH 1Q94B 5HYQB 3GSQB 2JIXD 2R23B