5JR1L

Crystal structure of 10e8 ghv-maturel antigen-binding fragment.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
b'YELTQETGVSVALGRTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGSASGNRASLTISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10E8 heavy chain
publication title Developmental Pathway of the MPER-Directed HIV-1-Neutralizing Antibody 10E8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1L01
4HIIA 2ZUSA 1IARB 1U3YA 3WUWG 3WFZA 1R0AH 1RUQL 2H3NA 1S7UA 3MLXH 2IADA 2HRLA 5C0CE 1CG9B 1LK2A 1FHGA 3ZYZA 3L7EA 4PJBA 4IJ3C 4XRCA 5FO9A 5F9JA 1VGEH 3IDGB 3Q1SH 5C0NC 4PJIF 2WUBL 4MJ4A 2BY3A 3VFMB 4GSDH 1KF9B 3DMMD 4NQXB 3QIUA 3LS5L 2RAMA 4QHMB 4X7CC 3U7YL 4FMFA 5I19L 5GGUB 3IDNA 1D5IL 3V7AG 2FSEB 1NQBA 1RZJC 1J1XH 4NRZA 4OCWL 3EDFA 3PWLB 1FVDB 4AH2A 1LEKB 1AGFB 3KPNB 1JF1B 3VXQA 1YEEH 1IM3A 3O3AA 2K7PA 3BFOA 2NY2D 5F7KC 4W4OC 4CVXA 3W9EA 4Z95L 2EECA 4G6KL 3ARFB 3QXDB 1NC4A 1U8HA 4G43A 5E2TL 1ZGLM 2F5BH 1NCAH 4J3OC 3AGVA 3ZL4H 3L3HA 1BHGA 4QHUA 1JRHH 1T22A 1WTLA 3B9KB 3GHBL 1RU9H 4FQCH 2LAGB 4ZUTA 3TO4D 5IFJB 3NAAH 1CS6A 1E4XI 1LP9F 3UTSB 4I3RL 1KEMH 4NO0D 4UTBH 1LO0L 1H5BA 5MP6H 4P2RA 2GSGB 2PF6A 3BIAX 3MLZH 1BP3B 5C09A 3UDWA 1CI5A 5EFIA 2DKMA 1IC4H 3QNXA 3HMWH 5K9JH 5FYJL 4XCYB 3U2SB 3K0WA 2OJEA 1IM9D 3UTQB 2GFBA 1VA9A 4XWGL 3MYZA 4DZ8A 4HZAA 4ZS6D 5TDNB 2EDRA 3SPVB 3P9LB 5D93B 2AEWA 1MVFA 1Q9LB 2JB5L 5SX5H 3ARDB 5B38G 2E8ZA 2ICCA 3QHZL 2XY2A 5D2LB 2FR4B 5A3IC 5FOBA 5TGBA 1EBAA 1CZ8L 3CVHH 3IYLW 1HI6A 1NCUA 2LVEA 3G08B 3QZWG 4EDXB 5I1JH 5IP4A 3SKNA 3H9HB 1KXVC 1BD2D 3SOBL 4WU5B 5EH1A 2W9EH 3RL1B 1G84A 1KFAH 1XIWC 2X1WL 1WT5A 1MFCH 5F9OH 4DKDC 4YO0B 4ZPVA 4TTGA 3DLQR 1IVLA 4NCC1 4N0UA 1AKJB 3GIVB 2Q3ZA 1MCFA 3LPGA 3ME0A 5DGRA 4HIHA 5F7UA 4G9FD 4PJIA 5EU6D 2CK0H 5GRVK 2IC2A 4HF5H 3HPLA 4MDIB 1AHWA 3LKSB 2PETA 4Z76B 5C6TH 5ACZB 3C5SA 2OL3L 5FM8A 2R29L 3ARGA 3RZWA 3DHMA 4WTZA 3MRKB 4ENEC 3IDJA 5IG7A 3ARVA 3MRQB 3RWGB 2V2XA 5J6GA 1KPUA 4Y4FD 1YEDA 5MI0B 2YPLA 2GY5A 4PJCB 4Y1AD 4BQ9A 1LK3L 3I50H 1OAYL 1XAUA 1YEGL 1JUFB 1T1XA 2BRQA 3P40A 5KW9L 4KTDH 2E8YA 2CIIA 2Y06L 2EC8A 4TSBL 3TJHD 2OXGA 1DVFD 1KULA 4AEFA 5FHAH 4GT7A 3S5LB 3KAAA 3VXRD 5E94A 3HNSL 1ZHBB 3E3QE 5I15H 4XNMB 1AQDA 1LP9A 3KLSA 2BXZA 1DTUA 4H1LA 2NCMA 1OM3H 4GXVH 4Q9CA 1JPFB 5L8KB 4PJAB 4KQ4L 3MRNB 1D5ZA 4FABH 4LVHB 1A9EA 2A83B 4XP5H 2NZIA 4P23B 3MRFA 5IMMA 3DMMA 1KACB 4ODHH 4HQQH 1UEYA 4AJ0A 5JPNA 4U1KA 5DMKB 3PNWB 3B43A 1LEIB 3U4EA 4PJDA 2IPTL 4L4TB 5E99H 4YR6A 5JOFB 1TZGL 3CXHK 4B41A 2Z91A 5DUPL 1NKRA 4E0RB 1U3HD 4URTB 4LLVB 3ARQA 3QHFH 5LWYH 2OYPA 1D9KC 2E9IA 1ZS8A 2GTZA 4YPGB 4I3SH 5ITFB 3Q48A 2XPGA 4NKOB 3HC4H 4UI2A 2V7NB 4DN3H 3BEWA 4BQBA 3HG1A 4PS4H 1B0GA 1C12A 1KCSL 3D2UB 3VXTA 1BF8A 2NY1C 4I5BB 3BJ91 3TO4A 1U8JB 4CN6A 4NQVB 2A6KB 4M1CC 1ZA3A 3FB5B 3WFHA 1P4BL 4UMGA 4B7IA 4NZUH 4P5TA 1N2RA 4LHJB 3VJ6B 3IFOA 1PQZA 2P5EE 4N5ED 1W0VA 2BP3A 3GBNL 4UT7L 1OB1B 4QXTB 1GGBL 3O2WL 5GRUL 2QLVB 1QNZL 4GW4B 1BOGA 3RVUC 4WEUD 5ESAA 3QA3A 4GAGH 1WWBX 2JE8A 4H88H 4KUZH 5GGRY 1YDPB 4L4JA 1PKQA 2R0ZH 4GJTB 2J4WH 3MRDB 5FKPB 3KPSB 3O8XD 2LABA 4P2YA 4M1DL 1PZ5B 5GGSA 1T21A 5IB2A 2I9LB 2ZG3A 2HN7A 1FV1A 2X09A 4N0YL 2VDPH 1W72H 2QEJA 3N9GH 1LO2L 4IMLA 1G7IA 1H3PL 4G8FB 1F02I 4K23L 4XVSH 2AV7B 1BWWA 1HIML 2HWZL 1NAKH 3WXVH 4PJHB 2C1OB 4PGZA 4NHUB 3L3GB 1ZGLA 1KTDB 3CXDH 3ZYIA 1Z3GL 2VERN 3ZE2F 2BY0A 3D9AH 5BRZA 4Q97A 4NZTH 3S34H 3BDBA 1QO3B 4XCNB 3GMLB 1F4WH 2MTPA 1WZMA 3PJSB 5DR5L 1SJHA 2J88L 2RCSL 2PN5A 4I4WA 4PJAE 1P7KA 3FB7A 4UUJB 2ICWJ 4PGBB 1A3LL 2EE3A 1Q9KB 1S7SA 1QD0A 1PBYA 1HINL 4Q74A 3EOBA 4JHAH 4AQOA 1JTOA 3BUTA 4ZOAA 3RY6A 2DL9A 5F7WC 4D0CB 3EJZD 1WAAE 2YA2A 5C7XH 2ZCLL 3RPKA 4IHOA 4X80H 1NCDH 1CDGA 4HWBA 1JZ7A 3QCUL 3MRMB 2X70B 3QPXH 4Y4FA 4Z7UB 4RMVA 1FLTX 1CR9H 4Z78B 5GGTL 3QRFM 4Y1AA 3RQ3A 5FFLA 4M5YL 1UKSA 1NDMA 4WIQA 3BP6A 1JPTL 3GGWA 4TSAH 1DLHB 4XI5D 1CE6B 1RK1A 1DVFA 1SVCP 3ARBC 4X98A 3UBXI 3LEVH 3FQNB 4R2GB 1YJDH 4WWKC 3KPRB 1F4YH 3QQ3A 4ZPTB 2IEPA 2XTJD 3NN8B 4JDVA 1Y6KR 3BXNA 3E8UL 1IBGL 2OTUB 4AMKH 3L3JB 4FTVE 4TUJB 4U6HB 4F37K 2DQUL 3HUJA 3LDBB 1TXKA 4HPYH 4RDQG 1QLRA 2EXYC 1I8IB 3M07A 1NGZB 4OJFH 2R0WL 4HKBA 4AL8L 3NFNA 4Z0XA 3QXAB 3KWWB 3L5IA 2R56H 3LRHA 4CN1A 1MI5E 5ANME 4ZUWA 3Q3GB 2Q3AA 4LSDA 3AU1B 1LDSA 3UAJD 1JHKH 1WF5A 2APFA 3FOMB 4RFEA 4NO5A 5IEKA 1LO3H 3I6LE 1U3HA 1KIQA 2N7BA 1QQDB 4R4NC 5T5FL 1GYAA 4KVCH 4ODTL 3F7YA 4P4KD 3QIBB 3RVXC 3MRPA 4KROD 1UB5A 2VQUA 4OZFA 1RZJH 3S36H 3BGMB 4S1SL 3G6DL 5TFSL 1MCEA 2E7HA 5ALBL 1IT9L 3G5XB 4Q6IC 4PJHE 2NY6D 1QYGL 3ZYJA 3ZLQC 5MEOA 5FA4B 1UT9A 2EDXA 4ONOA 3RPIB 5JA9A 4WCYH 3BUYA 3HI1A 1K85A 2P7TA 1MY5A 2VXTL 1F11B 1U2HA 4KU1A 4MNGB 5IHUH 3IS1X 3O3EB 1FYTB 5HHVL 5CD3B 4P49A 4OLUL 4AT6B 1S7XA 2UZIH 5BVPH 2I07A 5HYJE 1INEL 2OMNA 4PJEB 4OGXL 2PTVA 3P4OB 4LSTH 3B3IB 1GZPA 5GRYA 1J5OL 1ZAGA 1FFNA 3P9MA 3PE9A 4LKXB 4KGJA 2LAAA 4MX7A 1XR8A 5EIVA 4R7NA 4K3DH 1KLFA 4PRIB 4H1LG 4Z7UE 3MV8D 5GXBB 1GOGA 3U0TB 1XCTA 2FHFA 3WNKA 1RULH 2R0KL 3QAZB 3PGCB 4IS6B 4RGOL 5IHZB 2FB4L 1HHGA 4BSJA 1QFWH 1VEOA 5I1IL 1J12A 3C6SA 5ICZB 3BHBA 3R1GH 3SDXE 5CCKH 1TQCB 1BGXL 5CKGA 4KRNA 1FC1A 1KNOA 5IF0B 3ULUH 5FYLH 4J3WA 3RHWK 1A1OB 2DYPD 2G5BA 3SGDH 4PLNC 1YEIH 3PL6B 3VWKD 2DTML 2WINB 1I9IL 5KTEH 4Y4HA 3FFDB 4P46A 3H6JA 1RZ8A 3LKQA 2NW3A 4D9QD 4X6DE 3BN9C 3MACH 4IDLA 2V5YA 3MLVH 3NACL 4HXBL 2BVOA 5DD6A 3U79A 1A6WH 4K2UH 4M8QA 1VFAA 1KJ2A 4X8XA 3WNPA 1KT2B 4U2ZA 3T2NL 3DX9B 3O9WC 4XP1L 4ERSL 5HI4D 4ODXB 1EZVY 4TRPL 2VQ1B 5C2BH 4GRWH 1YPZF 3MBEC 4NSKA 4CGTA 4MJIB 1H9VA 1XZ0A 5DS8A 5T3ZE 1BBJB 3WXWH 1KN2L 1T0MB 2GAZB 1EEQA 3MCLH 4GW5A 1MJUH 4YDVA 1L6ZA 1OQXA 3ES6B 2PW2A 4QLRA 4HCRA 2XN9B 1KCLA 3PABB 1S9VA 3DBXA 4I77H 5EUOF 2XWBA 5HPOA 1GZQA 4YDIL 2MJWA 3W39B 1JV5A 4D9RD 5F7LB 3PDGA 5LCVL 2IAMC 5JW5B 2IPKA 1DUYB 1KBGH 3S88H 4PJFE 2B39A 3UJJL 1Y0LA 5J11C 2WP3T 4N90D 3TCXA 1FH5L 2ZZUT 4O4YH 1NDGA 3O3BB 2QTEA 1MCDA 2QSCL 4MD5B 3BO8A 2UV3A 2WMPA 2FRGP 2ORBH 3VD9A 2ERJC 4PJEE 4U7KA 3KYAA 1MCWW 1ZOXA 1JP5A 4EI5D 2CDGB 2ED9A 3CFJB 5ICYA 4NQSA 1BM3L 5IM7B 4YEFA 5B22A 4PRIE 4M03A 5L7XH 1A4KA 1ED3A 5DC0A 1H3VA 4OQ1A 4P4KA 1AGDA 2AGJH 5KSBF 3T65B 4L4VD 4N0CD 1FIEA 3VD3A 4JPIA 1JBJA 1D5MB 3MXVH 5HGAB 2VDLH 1ODAA 4IOFC 1MCNA 5MENB 4X4ME 1G0YR 3RIAF 4GQ9L 1Z9MA 2HKHL 1RD6A 3LQZB 2O61B 2P43B 1FG2A 4TOYL 2AEIT 2CLVB 3FTGA 4YFLI 3REWB 3OX8A 5DD3H 4OV5B 5DK0B 5EU7C 5F93C 5DA4A 5EA0H 3KXFD 2H26A 2YHGA 4Q6YA 4JREB 3BIKA 3IVKB 4OLZL 1XGYH 3G9AB 3MLRL 5C9JB 4MMXC 4K7PL 2OJZL 2X4QB 4R0LA 2AXFB 3PQYD 3DI3B 1C5CL 2AK4E 5E1AA 5EB9A 1AR1D 3V4PH 3WN5C 1G1CA 2VXQH 5DXWA 4MVBC 4IIQC 3MJGX 5H2BA 4I0PB 3QI9C 4MB3A 3GMMB 1XMWA 2X1PA 2XRAL 1TENA 3B4NA 3RZCD 4KXZH 2Z8SA 2F9BT 5LJYH 2GT9A 3MRGA 2P1YA 1SJEA 5DQJB 3JTTB 1DLFL 1SMOA 4NQTA 2R8SL 4OQTA 2XN9E 2P4AB 5EUOA 1NBZA 1OARH 1FGVL 1FYHB 1IGFL 2ADGB 2R15A 3BD4A 4GW1B 2F54B 4U1HA 2F53D 3UYOD 3GMNB 4HFUH 1YECL 1AFVL 2NXYC 3LV3B 5JO5A 2GCYA 4MS8C 3BQUB 4XNQA 4J1UB 1QSFD 4Z7VB 3EDKA 2BCKA 2ILLA 1VKXA 5TE4L 1R5WB 2J8UE 1PZUB 3IJSB 3ZT6A 3WKML 1FZMA 2F58H 4H5SA 1KGCD 4IBLT 4ELKA 1G7MB 3QUZC 5CJOL 3MRHB 4BKLA 2B1AH 1I4FA 1T20B 1T89A 4XXDA 2PYEE 5C0GB 3V5DA 2PYFA 1EXUB 3VRJA 4WEBH 3LMJH 3NIGE 2A73A 2X41A 3WJLC 5D5ME 5EULV 2X40A 1UJ3C 5KSBA 4PJ7B 2ZCKH 1DN2A 3GSNL 2R69L 3FRUB 5DHVH 5CBEB 1TVDA 1TPXC 2QQQA 5A16B 2H2SD 1N0XH 4P5MB 2NXZC 2XNAA 3Q5TA 3GSXB 2D7MA 2VLKD 4KJWC 1RUQH 5E1HB 1MRFL 2PO6D 3ARTA 2JCCB 3KYMB 1I3GL 1WWWX 4NN5B 2QJDA 3C2SA 4OZHF 4J4PD 4KRMB 2CUHA 4QHNB 5JW4M 4Z7QF 5AD0B 4QGTA 5KVGH 4UNUA 3OGCB 4ODUA 3U9UB 3SGEH 1A7OL 4W4NA 2CJUL 3JV5A 5C0AB 3RU8H 3LS5H 4MSWA 3BH9A 2OXHA 2OZ4A 3ZSTA 1O7SA 2VITA 3DYPA 3PWVB 3T0DA 4HS3B 2IALA 1IEAB 4OCWH 4BZYA 1K8DA 4XX1G 4TUOA 4F9PC 3V6BR 5IV2A 1BREA 3MV9D 3B8SA 2IBBA 4G9DB 3P0VH 3RTQC 2PW1A 2VH5L 3BP5A 4NT6A 1Y18A 2HT4D 4Z95H 4G6KH 4NQDA 4MQSB 3CVIL 3WLWD 4QRPD 4LRIC 1SMAA 2ZSVB 2MNUA 5E2UL 4NZRH 3IS0X 3S37X 3K8MA 3GHBH 4KZEH 1E28B 5EBMA 4BH7A 1CVSC 4NHCL 2Z31B 4ZNCD 2IBGA 1X6LA 3NIDF 3CK0H 5DLML 5JOPD 5T3XE 3VFSB 4FQXC 4ONGL 5AG9A 3EOAB 3QUMA 4ZFZA 3DO3A 2I60H 5C08D 1XGTB 2FX7L 5HHXL 1V3LA 5FYJH 1J9CT 1OAKL 3V6OC 4D3CL 4PJ5A 3PQYA 3BKYH 3CFEA 1TNMA 3WYRA 2MWCA 4L5FL 1BQSA 1IJ9A 2JB5H 1E27A 1DSFH 3MA9L 4NYLB 2V9QA 4YAQA 3STZA 3IETA 5HY9A 2DL2A 3MA7A 3RIFK 3MFFB 5A40E 3MRCA 5HHQA 1I3UA 3B2VL 4QWWD 1S7TA 1WISA 1VDGA 3SOBH 1KELH 2WQ8A 2OTPA 2F53A 4WW2A 3SKUD 2Q76B 4WTWA 4JRYA 2JCCE 5D72L 2BVPA 1KIPA 4OZHA 4ZXBC 3PHOB 3DX7B 3RX7A 5I1AA 3D25B 2Z35B 5FYLE 1IQWL 4TNWK 4DJMA 3SO5A 1KJMA 4AIOA 3HB3C 5J3HD 2NY1B 4TVPH 4ZFOB 4WNQB 2OL3H 1VFBB 4L8DA 4LEXL 5E2VL 3TNMA 4OKVB 5C0BB 3IT8D 4PJ8C 2N7AA 3KR3L 4NJAL 3TBTA 1YN7A 1U2CA 4YDJB 2W0FB 3DOSA 3T1FB 2A74B 3ARFD 4RA3A 3VDAA 2FL5A 1MPAH 1YNLL 4OI9A 1O5DT 3RKDD 4OF0A 1W0WA 5GZND 1FAIL 2WBKA 4LNVA 4ZDHB 2B1HL 4G6ML 2Y06H 1ZA6A 5EZOL 3D1MC 3B9KD 3SEPA 3G5VA 4PYGA 4XP6H 3FQUA 3MYJA 2DQEH 3NCCB 3BPNB 1JGVH 2VLKA 3UTSD 5D1ZB 3S96B 2VR5A 1NBYB 3GMQB 4JFQB 4HKXB 1V3MA 1YQVH 4Y19A 3TPUA 3I9GH 5D7LB 4N9OB 1QSEB 2XZZA 1Z5LA 1AD9B 2FWOA 5E9DE 3VFTB 4KQ4H 3TT3H 1CXKA 4JZJC 2ESVE 4D0BA 4L29A 4PREB 3UP1A 4XNYL 4F15B 4OUUA 3FMGH 3OKLA 5FDWA 1U3JA 5DEGB 1EVTC 5C6PB 5INDA 5JNYB 3ARDD 2IPTH 1TZGH 4U7SA 5ALCL 4IRSC 4W70A 1HQRB 3MV9A 5DUPH 2UWEF 3AAZB 1Q9WA 3RUGB 2A38A 5FYJU 5DGQA 1KCRL 1F3JA 2APVA 3EO0B 1JRHI 3QG7H 1HQ4B 4FQJL 4CVZB 3VE0A 5DD1L 2Q86A 3LHPH 4ZG1A 2DQIL 1R24B 2FX8H 3IGAB 1G7PB 2ADJB 1AKJD 2HTKC 5KN5A 2KL6A 4EEEA 2BOCB 4ZSOE 4HUKB 4L1DA 5AZ2H 4YC2C 3L7FB 3JZ7A 5KBNC 1CDHA 1J8HB 1JE6A 1G7LA 3C2AH 1YEKH 1GGBH 5C08A 5GGRA 3O4LB 3WIHH 4LGSB 4KV5F 1J7VR 5IB1A 4ELMF 2DQFB 1AXSB 3MUGB 4M9PA 4XT1C 5TQ0L 3UPCA 4WHCA 1EFXB 1AI1L 5CIPA 1CIUA 2AKRA 1BECA 3WFBL 1QVOA 1PG7L 5CEYA 3QWRD 4G6JL 1S9YA 3KG5A 4M1DH 5I8CA 1A6AA 3S37H 3BH8A 4YUEL 4N0YH 4KQ3L 2X4SA 1LO2H 4K71B 5HHOB 4DFHA 1HIMH 2HWZH 2WBJB 3GJFK 5I18L 1T5XA 1X4YA 3U7WL 3CCHA 1PJ9A 1UM6L 2VC2L 4J3SA 2BNUB 1YMHA 4FFVC 3VXPB 1CG9A 4Y5XA 4I2XA 1DR9A 1Z3GH 4P2QE 4OIAA 1NUGA 2Z92B 2AJZB 1MVUB 3G6JF 4O9HL 5GS1C 1YY8B 3G9VA 2C3HA 4I0CC 4P23D 3VFMA 5DR5H 1A7NH 1GPOH 4NQXA 5D7LE 1U92A 1MFEL 2J88H 4PBVC 4QHMA 1I8KB 1OWRM 4XCFL 1P2CB 1A3LH 5ACMA 2FSEA 3MREB 4WFED 4KVNL 1GXEA 4L4TD 2Y07H 3OWEA 4G8EB 5JHDB 1LEKA 5F96L 4UU9A 4P9HC 1ZTXL 1NFDB 1OY3B 5DJ6A 1JF1A 1N8ZB 3CZFA 2FJGA 3AMLA 3P77B 5E8DH 4LLMB 3QCVL 1VEMA 1WFNA 1CXHA 3ARFA 5E4IA 1LMKA 3NCJH 4M5YH 1ADQA 3PGDB 4K3JL 5JR1H 3U46B 1SEBA 1J8KA 1T1YB 4R4BA 1JPTH 1QFUL 3OZ9L 3D2UD 3DX6B 5IB4B 3V8OA 2DLEA 5IFJA 4KDVA 2X4NB 5GGVH 5F9DC 1I1CA 5BO1L 3DURB 1FNFA 3FHQA 2VWEC 4GRLA 1ZLUH 3E8UH 2DQUH 3LKOA 4OGZA 1UEMA 3N1FC 5LQBL 4XCYA 3IDYB 4RGNB 1QACA 4ZO7A 2R0WH 4AL8H 1UQSB 5ISZE 3O4LE 4E41A 3OAZK 4MA8H 4CRPA 4ELMA 2A9NL 3P9LA 4HV8B 5DUBB 3KPSD 3I6LD 3WS3A 3QEUB 1A7RH 4PJGB 3QG6B 1I7TA 5DA0B 3PXHA 4F37F 1UKTA 5D2LA 1MOEA 3VXMA 3OJDB 4HWBL 3FFCE 2ED7A 3D18B 4FQ2H 4PJ9B 3KPOB 1BFOB 5T5FH 4LSSH 5TPWL 3HZMA 1LHZA 5F44A 2CRIA 2PUQT 3G08A 3O3UN 2X1QA 2ZUWA 5FUOL 3M8OL 5L9DL 5EZLB 3QDMB 3NCMA 5ALBH 5LGJA 1IT9H 1TLKA 3PHQA 3JWDH 5EU3A 4YO0A 1QYGH 4P3CH 5FGCB 3AVEA 2W0LA 3GIVA 4CMHB 4F58L 3G6JA 3V6FB 2VXTH 4J8RB 3RVVC 3QIUC 2VXUL 4PLOB 5HHVH 4K3HA 4MDIA 2VJXA 1U8QB 3LKSA 1IAOB 3V4UH 4Z76A 2DBJA 3DX8B 5ACZA 3ESUF 3C09C 3MRKA 4BSVB 4YK4C 3GI9L 3MRQA 4XPFH 1ACYL 3RWGA 1NGXB 5FYJE 1NFDE 1MHPH 4QF1A 3MSPA 2C4XA 4PJCA 5IQ7L 1CGUA 5J11B 1KOAA 2EDFA 5D2NB 4R97B 4OZ4B 2NX5B 1RZGB 4CL7A 3T8XA 4R2GD 3A6BL 2JJTA 3KPRD 3KPQB 3S5LA 3JV0A 1S9WB 1DANU 3ZHKA 4P99A 2VAJA 2CSPA 4PJXE 4OLYH 4M62L 1CD8A 1U41A 4XNMA 3IDMB 1R5VA 1H5BC 1QFOA 2B0SL 4OFKA 3MJ9A 1JPFA 2Y36H 3MGTB 1BGXH 3MRNA 4ZOEA 3QULA 2A83A 3VW3L 4P23A 4AEHH 2I9TB 2IH1B 1IQDA 2VZUA 5KVFL 4RAHA 4CBPA 1KCVL 3PNWA 1I9IH 1HILA 5GS0D 1LEIA 4L4TA 1EIBA 2FGWH 3NACH 4HXBH 3RI5K 1ORSB 5E8PB 1C16A 32C2B 5F70A 4YFDB 1KCUH 3UTPD 4E0RA 4LLVA 3T2NH 4XP1H 3I2CH 4PJGE 3DI2B 5T3ZD 3QUKA 4RMTA 3QIBD 1UM5H 5ITFA 1I8LC 4JM2B 5T5NG 1YNKL 3TA3B 4NKOA 4MD0A 3T09A 4HLZG 1U95B 1KN2H 4XP9L 4PTUB 1WT5C 1X4ZA 2IQAA 3PV7A 3TFKD 4CDHA 1CFQB 1RI8A 4I5BA 1CFBA 2A6KA 3I75B 3FB5A 2BSTB 3V52H 1WZ1L 4Y7MA 3VJ6A 3CDCA 3MGOB 1M05A 1T7VA 1FYTD 1KTLA 1M7IB 3LN4B 2FO1A 4FZ8H 1EHLL 4QXTA 1AHWC 3TYFB 3UJJH 4OFIA 2AI0L 4GW4A 5D7KE 1KLUB 5F71A 5F1IB 1YDPA 2QSCH 4NN7B 2DI8A 3HRZA 1S78C 3SO3C 5FCUL 2XG5A 5GQBA 1X5ZA 3MRDA 5FKPA 5CGTA 4JQXA 4PP1C 3KPSA 5KVMC 1PZ5A 3HC3H 4PRID 1MHHA 3BZEB 1KIRB 4H20L 2I9LA 4X7FC 3MOBH 5HTSA 1WIPA 4LOUD 4L3CA 4G8FA 1BM3H 3GEWB 3N1MC 3LD8B 1B0RA 1I75A 1VACB 2AV7A 4P57B 3U4BH 1KC5H 4U6VL 2NX5E 3BPCB 1XGRA 2HFFB 5FKAB 5GRJH 1IEHA 2C1OA 5DHYA 4NHUA 1HSBB 3L3GA 3NTCH 1KTDA 2HLAB 1H8NA 3EJYD 1QO3A 3H3PL 4HGWB 4NN6B 4HCRL 2W65B 1MCOL 1U6AL 3T08A 4B0MM 3W11C 2HJKB 4KMLB 2DQJH 2BNQA 1YEFL 1GAFL 2ZUTA 3DMMC 3EYOA 5D8JL 1OGAE 1CLCA 2BOBB 4UUJA 4X6FB 4PGBA 1T3FB 1DQML 1IC5L 3PL6D 4QRQA 1Q9KA 1K2DB 3TBVB 3O3DB 1OAZL 4CVUA 4D0CA 3VGAC 2D7QA 5K9OA 3D5OF 2NTSP 4DOHB 4OGAD 4RAUB 3CIQA 3KVQA 3C87A 1PYWA 1F3DJ 1L0QA 2OJZH 4DQOH 2DWEA 1MCLA 2X70A 3EDEA 4HUWA 1P4IH 1V7NL 3CH8A 4MJID 5EU7E 3WNNA 1UWXK 1A8JH 2AABH 4H0GA 1GGUA 3QNZB 4G6AD 5I17B 4K7FB 1DLHA 4LVNC 3EIFA 1QFWI 3IRZA 4WGWB 3PV6B 1CFSB 1WBXB 2XN9D 5C0RL 3KPRA 3TO4C 3EGSA 2QQLL 3NN8A 3HZYB 4F9LA 4BA8A 4HFWB 4P5TC 2H2PC 1DDHB 2OTUA 4U1LB 1VENA 1KPRB 4U6HA 4RGMC 2OI9B 1IGFH 2YC1B 4WW1B 4Z18A 2Q7YB 4ODWB 2H9GB 1I8IA 1YECH 1NGZA 3OV6A 3VH8B 5IOPB 2RHEA 4XVJL 4F7EB 5D7IF 1RK0B 3KWWA 3STLB 3ALXA 4JRXE 1Q0YL 4ZS6C 5E8NB 3Q3GA 3HE7B 3MNWB 5ID0B 5IR1B 1U8PB 3AU1A 3WKMH 4ZUVB 5DEZA 3FOMA 1JGEB 5I2IB 1MWAL 5ILTH 1FQ9C 3CFBB 1O7VA 3O2VH 4R3SB 3ROLB 2VZ3A 4YXLH 4QHKI 3OB0K 3U6RB 4FQXB 4PGCB 3BGMA 4IRJA 4XZUB 5EOQL 2FBJH 4NQCA 3NPZB 3G5XA 4MZ3A 5MEND 2XKNB 5L8LB 1EZVX 4ALAH 2R69H 1OHQA 3FCTA 2XA8L 3TWCL 4RNRA 4X9BA 2ARWA 1HDMB 2NY5L 3MRIB 3ARXA 3W0WB 1MQ8A 3FQTB 4WFFD 4AG4L 1ND0B 4S1QH 5I6XC 1F11A 4MNGA 1T83A 1NC2B 3O3EA 1FYTA 1MRFH 1PAMA 1RUAL 5CJQL 4AY0A 5K9QG 1FNGB 2EDQA 1KYOK 5CP3H 3BD3A 4N0FA 2UUDK 4AT6A 4KK8D 2EYTA 2V7HB 5IW1A 3GMOB 4C83B 4WGVB 5T1MB 2BNRB 1E4WH 3P4OA 4EUPH 5HI5D 4L9LB 3S5LG 3B3IA 2XIDA 4YXKL 3MRBB 5EPMA 5F6IC 2CJUH 4C54A 4YE4H 4Y4FC 1KG0B 3GK8L 4QRUB 4L3EB 1J1OL 5I1KL 5IVXB 4I0PD 4PB0L 5SWSE 1MHCB 2ZNXA 3S3SA 1ZSDB 3TJHC 4IS6A 4RA0C 1DVFC 4Y2DB 4NUJB 3W9DB 4RWYH 5IHZA 2X42A 3TIEB 4DTGL 3H8NA 3CMOH 4F7CB 4GKNB 3CVIH 3D85A 3QH3B 1MCBA 2F54D 1IL1A 2VUYA 5E2UH 1CU4H 3G5ZB 4Q9RL 1A1OA 2Y4SA 3BQUD 4NM4H 5DD0H 1A2YB 3OXSB 4NHCH 4LEOB 3GNML 3FFDA 4GG6E 3HI5H 3BGAA 1AXTH 5D7IA 3ZKNC 4O2FB 1S5HB 3RL2B 3TBSA 3T2PA 1YYMH 3SQBA 5DQDH 1OQOA 3QFDA 1U3HC 3IXAB 1AJ7L 4ODXA 2VQ1A 4D3CH 1A6ZB 2OZ4L 1F6AB 4LCWB 4MJIA 2IFFH 4G8GE 1DCLA 2ZUYA 5E70A 1BBJA 4HS6B 5LAXB 1T0MA 2GAZA 4LLDB 2YR3A 3ES6A 3IJYB 2E9JA 4Y5YC 5BS0E 4Y8AA 3BDYL 4BH8B 3N50A 2E7BA 5TE6L 3V6OE 4WUKH 3VXOA 5E5MA 3VI4E 4MD4B 3FONB 3LN5A 3B2VH 2VZSA 4I18C 4U3XA 3W0WE 2KKQA 1BQHA 3GBMH 5GSRB 3K81A 1A1MA 3T0EB 1DBKH 1A9BB 2YD2A 2IQ9H 4ZFFA 1HKLH 1L0YA 5D72H 1OD9A 1YUHB 2DI7A 5GRZA 4XAKD 3BJLA 2CRMA 3RIFF 2VDQH 1P1ZB 5C0AD 1U8IB 2R4SL 3LEXB 5L6YL 3FQXA 3ARUA 3O8XC 5LG1A 1QR4A 3QUML 1P5UA 2YXMA 1F2XK 2IANA 4YHZL 1WIUA 4HIXL 5IM7A 1EX0A 4XBEL 2NW2B 4RZCB 1MFBH 5H8DA 5IT2H 1K4CB 5J13C 5KANG 3V9FA 4O51B 4XMPH 4YIQB 4MAYB 1LDPL 3BAEL 4Q0XL 4TNWF 4WUUB 5DRWB 1GSMA 5ENWB 4ENED 5MENA 4B53A 1SM3L 3GSRB 2C3GA 3LQZA 2IH3B 1FAIH 3FT3A 4G5ZL 3K80A 4L8SC 5GS2D 4KK5D 4CN4A 4WU7B 1TETH 3IRPX 1ONQB 1UVQB 4OB5L 4BFEA 1OOAA 3DJ9A 3OKEB 1JPSL 4OV5A 1C1EL 2Z31D 3LZFL 2DTSA 2FD6L 5HJ3B 2W59A 4DEPC 4BSWB 4HWUA 2H6PA 3SKMB 3V7AE 4PD4K 3EJZC 3IVKA 4K94L 5AZEH 3BKML 4O58L 2NR6D 5C9JA 5KS9F 3MOQA 5DHXB 2X4QA 3E6HB 3LPWA 1J1PL 2AXFA 1YQ2A 1D6EB 4S1RH 3L5XL 2FH6A 5IVNA 2CD0A 1QSZA 3O11A 5I75B 1IGIL 2C26A 4JGMA 3BPOC 4LCWE 4MA1C 4X6CB 3RWIB 4I0PA 3NOIA 1NUFA 3K3QA 4XI5C 3SJVB 4C4KT 1KJVB 3L3OB 3LEYH 4MJ5B 2ZUXA 4HEPG 1EGJL 4U0RC 3SDAB 1CBVL 5DQJA 3JTTA 4QEGA 3GSUB 2XTJC 1AQKL 3VFVB 1PY9A 1ZT4B 2OR8A 4YGVB 2ADGA 3HS0A 4GW1A 2F54A 3GMNA 4X9IA 3HLAB 5E6IA 2DQIH 4HPOL 4CVWA 4XPHL 1UH2A 5SWZB 3BQUA 2OR9L 4J1UA 4LHUA 3JWOH 4Z7VA 1F2QA 3CDFA 2P47B 4WTXA 4BK5A 1R5WA 3BYYA 3IJSA 4JAMA 1G9MH 2NY1D 1OP3K 2CKBA 2I5YH 3TH4T 3UAJC 1G7MA 4LP4A 2PCPB 1T20A 1EHAA 2H32H 2XZCH 1U8NB 2AEPL 1QZ1A 3QO0B 5C0BD 5TQ0H 1EAPA 3D0LB 2Q8BL 1EXUA 1AI1H 4P4KC 4S11A 5EZIH 2Y72A 4HIJB 3WFBH 3CX5K 2FLRT 4G6JH 2B2XL 2ICWB 3QB7C 1NAMA 3FRUA 5CBEA 4DZBA 1NCTA 3TNNA 2NY6C 2VO5A 1QRNE 1DBMH 4HUUB 1N5YH 1BJ8A 4WUUE 2VDNL 4P5MA 1HHJB 2MQ3A 1XCQB 4JPVL 3GSXA 4FP8H 5D1ZD 1RZ7H 5DJ2B 3KYMA 2P48B 3QCTL 1UM6H 2VC2H 3H7BB 3OR7B 3IFLH 4I48B 3W81A 1CDIA 4QHNA 2B4CH 1A6TB 5D7LD 1QSED 2R2BB 4A2LA 3OGCA 1VB9A 5D9SB 3U9UA 5CZKA 2EYRB 4LSQL 1IGCL 1MCKA 3QUXA 1S7UB 3TBWB 2G60H 5C0AA 2V2WA 5AUMA 1LK2B 3UYRL 1YMMB 5KS9A 5E24E 2JJUA 1NEZB 5FO9B 2DM4A 5JIKA 3TYGL 3PWVA 4LPTA 4KVNH 1NCNA 4LLQB 3S9DB 1ZTXH 5EIQA 2XYCA 3KPMB 4G9DA 1SY6H 5HVHC 3QXUA 4M93B 3SJVE 2NY5C 5KSVA 3QCVH 4DAGL 3U1SH 3C09B 3RA7L 1IC1A 5KSUA 2OS7A 1L7IH 4YK4B 1A3QA 3NA9L 1HEZA 3VXQB 2ICEB 3O3AB 5I30L 4M7LT 1S3KL 3IAQA 3WFEL 4CVXB 3W9EB 2JB6B 4NQEB 4PRDB 4U1IA 4PGJA 4JHWL 2NNAB 3QDJB 4M7KL 5EBWA 3LRGA 4LCYB 2Z31A 4V1DB 1UM4H 4JFPA 5BO1H 4X4XA 4G43B 4L3AA 3P30L 4WVRA 3L3HB 3VFSA 3RNQB 5LBSL 1NPUA 1GGCH 3ILPA 3EOAA 1J8HD 5AAMA 1BZ9A 1XGTA 1AE6L 3H9SB 5ISZD 3O4LD 4ZS7L 5LQBH 1T89C 3O6FA 1I1RA 3S98A 1NCBL 3UZVB 4ODBD 5HI4C 1N4XL 1G0XA 3RWCB 2E27L 4P2RB 1JIBA 5JXAL 3Q6FA 5IKCA 2CR3A 4TUKH 2A9NH 4UT6L 2VWEE 5C09B 4WEMB 4CMMB 5L2KE 1J0JA 1CXLA 1BBDH 5CP7A 2LE9A 2OJEB 4X0KB 2GJ6B 3SDYL 5HHOD 4DZ8B 3H3KA 4MA7L 4QKXB 5TDPB 2WBJD 3Q5OA 3PP4L 4HX1A 3O6LH 1S8DB 2YUVA 4UBDD 1ADQL 35C8H 3M8OH 2Z8RA 5DVLA 1WCBB 5GGQH 5IBUB 5BMFL 2X4UA 4D9LL 5FOBB 5TGBB 3OF6D 1R3JA 1EMTL 4EN3A 3PHOA 4HD9A 3D25A 3NIFE 4F58H 4P2OA 2WZPD 2BHYA 2FIKA 2XT1B 1XGQB 2VXUH 5I74B 4ZPVB 5T33L 4ZFOA 1EEZB 5C0IA 1A7BA 4N0UB 5JHDD 4ETYA 1T04A 4PJBE 1VFBA 4EOWL 3OKKA 4OKVA 5C0BA 3T2OA 1CFVH 2NQCA 3BIBX 4PJIB 3GI9H 4YDJA 1K4DB 1ACYH 1ZEAL 2W0FA 3FKUS 3NA4A 1MAML 3T1FA 4N0CC 1CTOA 5IJVA 3ARGB 4X5WB 5IG7B 3A67L 4ZDHA 4UINL 3KHOA 5E56A 2V2XB 5J6GB 2BHZA 3PF2A 1YEDB 4LARL 4BZ1L 1X5YA 4I9WE 4JFFB 5HYQB 4OZGB 2RJMA 3EDJA 5D1ZA 3S96A 3C9NB 3DUUB 1T1XB 3GMQA 4XAWL 5EC1A 4JFQA 4HKXA 2CIIB 1WK0A 2D31A 3BKJL 4DGIL 2B0SH 1F4XL 1QSEA 1AD9A 4I3GA 3VFTA 2BDNL 3SBWA 1FGNH 5FYKD 2G9HB 2P5WE 1EFQA 4RGND 3GDBA 2D7TL 1DL7H 1FZJA 3PDOA 3QIWA 4YFLF 1UWGH 5DJXB 3V7MA 4LCCA 1LP9B 5TF1H 1KCVH 4OGYH 5JNYA 1AR1C 4DGVH 1OAQL 5DJ0A 4QY8A 1BJMA 2UYLB 5DT1H 3MRFB 5IMMB 3SDCA 1FN4A 3KPTA 5C09E 2CLZB 4RFOH 3AAZA 4PJ9D 4X4ZA 2VXSL 4U1KB 2DBLL 3U4EB 2VTFA 4YR6B 3VGAB 2VLJA 4Q2ZB 1YNKH 3QDMD 2Z91B 4YBQD 4XP9H 4PGDB 3RWDB 3EYQC 4WW2C 1R24A 3RI5F 2FECL 4GXUN 4Z7OE 5B8CB 3CUPB 3IFPB 1ZS8B 2GTZB 3IGAA 1G7PA 2ADJA 4MWFA 4ORGB 5HI3D 1I3VA 3EDDA 3V0WH 4K94C 2BOCA 3MRLB 3OPZL 1NMBL 3HG1B 5C0CA 3HE6B 4ZO6A 3L7FA 3MJ9L 4HMDA 1EHLH 3DSFL 5D7KD 2NY7H 1J8HA 3WFHB 2DQFA 2AI0H 3IKKA 2HP4A 4P5TB 1LQSR 3F58L 1KB5A 1EFXA 1N2RB 2R2EB 3QNYB 4N0UE 3L3DB 3QJHA 3X11B 3B5HA 4PJIE 4JEGB 2HRPL 3NABH 4BJLA 1FSKC 1K6QH 5E4EB 1BOGB 2KPNA 2NX5D 5ESAB 5CZVL 2WWKO 4Z8FL 2DLGA 5HHOA 5JW3H 4XBGA 3MODL 1PKQB 1MCHA 2WBJA 2Y25A 3Q5YA 2A2QT 5GGSB 3ULVF 2EIDA 1A6UL 4YDLB 3VXPA 4P9ML 2YPLE 1G7IB 3CU1A 4UDTB 3OF6A 4J4PC 3O2DA 2Z92A 1KEGL 3MOAH 5DVNA 1DQTA 1YY8A 3H3PH 4HCRH 5DHVB 3KYNA 1U6AH 4DVRH 5IJKA 1ZGLB 3BW9B 3GUTA 2GITB 5BRZB 2XWTA 3HNVH 1IC5H 3NCYS 4BFGA 4GAJL 1OAZH 1OW0A 4G8EA 5JHDA 4M61A 1LP9E 3P4NA 1JJUA 4OT1L 1SJHB 5GISL 4I4WB 5T1KA 1N8ZA 3ZE1E 3FB7B 4FQHA 3P77A 4ZAKB 4APQA 4J2XA 5E2WL 2WIIB 3EOBB 4JM2D 3TA3D 4KKAD 4KAQL 3WLWC 4TPRL 3U46A 1T1YA 4PJDE 1PY4A 2XOTA 5I0DA 1S9XA 3ALWA 4IM8A 1ZLSL 5F6IB 2V6HA 4EQ3A 1BJ1H 4HH8A 4QXGH 5C0RH 3CD4A 4PRHB 4KKLD 4Z9KB 2HG5A 5CILL 4HK0B 5BQ7B 3SE9H 4MNHB 1NDMB 3VXNB 4AIXA 4MXQD 3PWUA 1JZ8A 1UH4A 3HG1E 3INUH 3NCFB 1NLBL 4PB9L 3CZJA 5L88L 3QQ3B 1MF2L 4O02L 2EDLA 4R4FL 3BXNB 1XGPB 3AXLA 1UQSA 1LNUB 3TH3T 1GGTA 5TE7H 5DUBA 1T1WB 4KJQD 1CLZL 3WO3B 3F5WB 3QEUA 4X6EA 2DQDL 3QG6A 5SX4H 4F57H 1MWAH 4XVTL 5D6DA 4HKBB 4PJ9A 2BJML 4ZUWB 4HIEB 1ITBB 5FA3B 1CXIA 1EEUA 3TPKA 3ZDXE 1TZIB 2WSKA 4QWWC 1PKQE 5EZLA 5FHBH 2ENSA 4NO5B 4LQFL 3UC0H 1KIQB 3GKWL 4Y5XC 3H0TB 3UTOA 2EH7H 2XA8H 3TWCH 1MRDH 3F7YB 3HNTH 4M7LH 5EO1A 1IC7L 4TNVF 4OZFB 2DIAA 4J8RA 1KXQE 3KS0J 1CFTB 3DHJA 4JN2B 4U6YA 5DJ8B 7FABL 5MEOB 4BFBD 1U8QA 4BUGA 3DX8A 2GK2A 3BUYB 1DUZB 3HI1B 4OF7A 4NIKB 4BSVA 1TVBB 1I9EA 2LU3A 4O2CB 2YN5A 4WFHE 4HAGA 4YXKH 4K9EL 3C6LB 1RFDL 1T7ZA 4G9FE 3GK8H 4I8DA 2I07B 5IB3A 1FNLA 3ARFC 5D2NA 3MLTB 1ITCA 5HHNB 3RKDC 5GZNC 1GC1L 1ZHLB 1GZPB 1FFNB 2VLRB 3MCG1 3CMGA 2VRAA 1OPGL 4MX7B 4QTHB 1S9WA 1KJ3L 3V5HB 2ZJSH 5GSVB 1EPFA 1JYWA 1XCTB 2P8PB 2QADB 3BT2L 5EBGA 4Y1AE 3IDMA 4H25A 1ZKAA 2VDRH 2J6EA 2DLHA 3QUYB 4ZOBA 5J13B 4FFYH 2MCG1 2I9TA 3BHBB 3S4SA 3K1KC 4Q9RH 2X7LB 4GBXB 1H3TA 3O45A 3GNMH 3HE7D 4TN9A 5IFHH 1BVZA 1IGJB 5D93C 4JPKL 3ARDC 1ORSA 3IU3B 2IBZY 2XKUA 2B20A 32C2A 3QEQB 4NWUL 3HUJE 3X3GL 4JFEB 3IU4L 5CBAB 3VU2A 3GMPA 4Y4HB 4NWTL 4P46B 3LKQB 1RZ8B 1D5XA 4C56B 4JM2A 4W6XB 4FQXD 3TA3A 3D39B 2X4TA 3WMSA 1KJ2B 4WI6A 1MIML 2AJXL 4PTUA 3H9YA 1CFQA 2DQTL 2YKLL 5CUSL 4NSKB 3W0WD 3BDYH 5ADOL 3I75A 5TE6H 1SJVA 2BSTA 5DS8B 2YS4A 3BPOB 4MA1B 1P53A 2GJZB 1NC2D 3MGOA 3BGFB 1G7QB 1M7IA 4LU5L 4YDVB 5AWNL 5HDQH 1XF1A 5C0FA 1WEJH 1QKZL 2PW2B 1R3KB 4HC1L 4U0RB 1S9VB 2ARJQ 2HKFL 1GZQB 5F7YC 3PXJA 2F5AH 4HS8H 2BNRD 3HAEB 5DQ9B 1EO5A 5IESL 2WLYA 1BAFH 4M6NL 2VZOA 4ETQA 3C5ZB 3HFMH 5CEZD 2HVKB 1JFQL 2GW5A 3GJFH 4XNXL 3I84A 1HH6A 1LILA 1TVHB 5MI0C 4Q7DA 1Y0LB 4L3ED 1KIRA 4HK3J 3MQIA 5A43C 5IWLA 3HHRB 3U0PB 2YD1A 1HNGA 4R7DB 5DDHB 3BO8B 3THMH 1A7QH 2Q1EA 4P57A 4QNPF 5FCSH 1JZ3A 2JJTC 1A22B 5BOPA 1HSBA 3HI6L 3EYFA 3OJVC 3BAEH 4Q0XH 4KDTA 1JWMB 4GLRI 1PFCA 4HGWA 1A4KB 2D4DA 2W65A 3GRWA 1FNSL 1M4KA 1T03H 3SDXF 4OB5H 4P23C 5FIEA 1JPSH 2BOBA 4X6FA 4I13B 1T3FA 3LZFH 1GH7A 2FD6H 1UB6A 4EDWL 1K2DA 3DVFA 4K3EL 3TBVA 2HFGL 4DN4L 3O3DA 3O4OB 4CU8A 1FCCA 1QBML 3VFGH 1RURL 5FM4A 2NY0C 3FTGB 5B3NA 4JKMA 4K94H 1YC8A 4RAUA 4X6DF 4XX1E 2EDEA 3VXUA 5E6ZA 2XI9A 5I71C 5HBBA 1J1PH 4LCWD 2ICWI 1R6VA 2R2CA 4FHBD 3BIKB 1MUJA 3RNKB 2QHRL 3L5XH 3QNZA 4KKCD 5I17A 4K7FA 3T77B 1VPOH 4WHYG 3RJDA 3SQOL 3QR2A 4JFXA 1IEBB 5ERWB 4R0LB 3PV6A 1Z6JT 1CFSA 1S5IL 2BHUA 5FOJA 4JM4L 1EGJH 5E1AB 1MCRA 5F1SA 3WEXB 3MUJA 2NY3B 2AV1A 3OAZH 4HFWA 1YPZB 1AQKH 5H2BB 2B8OT 3MV11 4YHYB 2VABA 1KPRA 2MHAA 3KLAA 3T0ED 4WW1A 2Q7YA 1FE8L 2GT9B 3MRGB 4ODWA 5HVHB 1AR2A 1U93A 1MFDH 3VDBA 4XPHH 4DW2H 3VH8A 5IOPA 5HYEA 3VDCA 5EUOB 1NBZB 4JZNA 4PJFF 3STLA 3GFUA 4X8JB 5C86A 1OAXH 2DJUA 2WV3A 2XTJE 1PVHA 5ID0A 5K9KB 5IR1A 4JQXC 4ZUVA 2G2RB 5JO5B 2HTKD 4UOJA 5IIEB 4XNQB 5D1QA 3P4MA 2WAHA 2BCKB 1VKXB 3ROLA 2AEPH 5GS3A 1FZMB 4PGCA 4XZUA 4H5SB 3KYOB 4ELKB 3F7VB 2FX9L 4MAYD 1HHKA 4WENB 4WUUD 4X7TA 5HHPB 4G6FB 2E5EA 3MGAA 3RFZC 2M26A 1ZHKA 4KZDL 3CLFL 2VDNH 2A73B 4LCIL 3OKNB 3CVHA 2DJ4A 2BSSB 4JPVH 4R8WL 5DJZA 5KSBB 1NC2A 1B4JL 1IAIM 2EDWA 4HWZB 4UILH 2V7HA 2L7JA 3GMOA 5T1MA 2BNRA 3O6KL 4JPWH 4L9LA 4WO4A 5FGSA 1IGCH 4FFVD 3HRPA 4UV7L 5CSGA 1T0NB 5DD5H 2YD5A 1RUMH 4JO4H 2VSDA 4QRUA 2DLIA 4L3EA 4J3VA 4HLZH 3TYGH 43CAA 4OLWH 5IVXA 1MHCA 5FUZL 3SJVD 1CYGA 1ZSDA 4OFDA 1OCWL 4TVSa 3W5MA 5B4MD 4Y2DA 4NUJA 3W9DA 1KTKE 2DKSA 5E0QA 3TIEA 4R2GC 3BH9B 2ADFL 3VFRA 3SDAD 2VITB 4G8IB 4IRZH 2IG2L 3RWJA 4ZQKA 3FJTA 3VXSB 2D0GA 1NAML 4DAGH 1JNNL 4NUGL 4KUCF 1T7WA 1F45A 1K8DB 4GKNA 1MCSA 4F7CA 5ACLA 3RA7H 3ZO0A 2WNGA 4TUOB 4X7SL 1J05A 2EC9U 3NA9H 3B9VA 5L0QB 5I30H 3UTTB 3BP5B 3G5ZA 4UNVA 1Y18B 5SWZD 1EH9A 3QRGL 4JHWH 4NQDB 3B2UD 1A2YA 3OXSA 1TDQA 1XF5B 4N1CA 2YD3A 4LEOA 1MEXH 3VGHA 4K9EC 5EUOE 4L8CB 2Q20A 4PJFA 5FO7B 3RL2A 4MXVF 3OBAA 2OBGA 4B50A 1PG7W 4BH7B 2AJSH 2J8UF 4AENB 1GC1C 4DCQB 1N4XH 3LS4H 3O6MH 2E27H 5JXAH 1QR1A 4IRJC 4HS6A 4UT6H 5LAXA 3LVEA 3QUMB 3QJFB 4UB0H 4S2SA 1S7QA 1ZANL 2MKLC 3RGVB 4YX2H 3S35L 3IJYA 3TFKC 5D5MF 4PJ5B 4BH8A 4KY1H 3SDYH 1ZLUK 4MA7H 5F88B 1GGIL 5F7HA 2LFGA 3PP4H 1X4XA 1E27B 2Q8AL 2V17L 2WBWB 4HKZB 5ADPL 1INDL 2AXGB 5BMFH 3T0EA 2D9CA 5KSBE 4FZEH 5C71A 3DVIA 1HSAA 3E2HC 3MRCB 1YUHA 4LF3B 3GSVA 1KPVA 1I3RB 4ONFL 1P1ZA 1F58H 4XMKH 1U8IA 3U9PL 1SQ2N 3LEXA 3KLHC 4JRYB 2FZ3A 1BLNB 2BVPB 1KIPB 4KMTL 4OZHB 5T33H 5SWQB 3P73B 5E5RB 4LSRL 1YEJL 3QAZC 3SCMA 1Q1JH 3QIUD 4PLJC 5E8EB 3FB8B 2AJVH 1SEQL 3IDIA 4LMQE 2A6JB 1KJMB 4O51A 2GHWB 3I3DA 1MAMH 2QSQA 4KKNA 4YIQA 1K8IA 4KHXH 5KG9B 5ENWA 5DRWA 4L8DB 3GSRA 2IH3A 3DROA 3EJYC 1I7UA 3A67H 1YN7B 4WU7A 1W72A 4J3TA 4LSPH 2YZ1A 1UVQA 5HDOA 2JJWA 4LARH 2HT3D 4GKZB 4N8PA 4NQED 4BZ1H 3OKEA 5I76B 1P4LB 4YHIB 1QFHA 1FSKB 2FL5B 1XR9A 1DBBL 4V1DD 3G6AA 5HJ3A 1UGNA 1W0WB 3LIZL 4OF8A 5FDYA 4NQDE 1ZA6B 3BKJH 4OAWB 4DGIH 3L5WA 3FQUB 1F4XH 2VL4A 1SVZA 3H9SD 5IGXL 1QEWB 4QXUL 3ULUD 3E6HA 4MNQB 2D7TH 2R0LH 4HJJH 3U7AA 2W9LA 4P2RD 4C59B 5CMAA 3ZYOA 4Y19B 4ZFOL 5I8KH 5C09D 1WZKA 2BY2A 4JJ5B 1Z5LB 3SGJC 2GUOB 1HXMA 1OL0A 4X6CA 3RWIA 1KB9J 3QDGA 3VD4A 4D0BB 4G6AC 3NCBB 3FHAA 2DQCL 4U1JA 3NFPB 3WFCL 4MJ5A 2GJ6D 4OUUB 5ELIA 3SDAA 5JQHC 2VXSH 5GIRB 5INDB 2DBLH 3PQYE 5DEFB 1JWUA 2HFEB 4YGVA 3RDTA 4W6YB 3T0XA 2WP3O 1Q9WB 2AJYL 5C2UB 5F1OB 3H42H 3VWJB 1BF2A 4RMRA 2HT2D 1BFVH 2YD4A 4Z7WF 1CDBA 3IAGC 1YEHL 4GOSA 2Z0BA 3DXAB 3VE0B 1ZE3C 3OB0H 3OPZH 2Q86B 4ZTOL 5F3HA 2CDFB 4NRYB 2VDKH 4OV6F 3MJ9H 4D94A 5I1GL 3DSFH 5KVEL 2F53E 2PCPA 4JRYE 5KOMC 5GRXG 4RWHA 2X4RB 3KLDA 3QO0A 4OZHE 3F58H 4D0DA 1B88A 4NC2B 2PR4H 1QSFE 4HIJA 4Z7QE 3AY4A 5IW3A 1TJIH 8CGTA 4AEEA 4JDTL 5GGRB 5KSAB 3ARGD 2R4RH 4M6ML 2UUDH 1KGCE 1JGUL 1OGTA 4M48L 3JV4B 4FQQB 5CZVH 4Z8FH 4HUUA 5F7EL 4W6WB 4GRWF 4PP1D 4RX4A 1XCQA 4JFFD 5CEYB 1S9YB 1CF8L 1A7PL 2QV2A 2UVFA 3AMKA 2GKIA 1A6AB 1NGYA 5DJ2A 3BH8B 4HUXA 3H7BA 3PG2A 4I48A 4KK8C 5JMOC 2JELL 1KEGH 2R2BA 4JREC 2H1PL 5D9SA 3F7PC 1T5XB 2EYRA 2YSSB 5GJSH 5HI5C 1NBVL 3FOLA 3CCHB 3WS6A 3TBWA 1YMHB 5IFAH 4LSVL 2FO4A 4I2XB 4Y5XB 1YMMA 5HVGB 2VLKE 1NEZA 3WJJA 2XQBL 3BZFB 5DJCA 2EDDA 4GAJH 1S7RA 3W11D 3WKNA 4LLQA 4OT1H 1JTPA 4I0PC 1C7TA 4Y19E 2J12B 5GISH 1U92B 3GSQB 5K93A 3KPMA 2QQKL 3FL7A 3WSQH 1CE1H 3LQAL 2GSIA 2YPVL 4EUPB 2ATKB 4XPTH 3BD5A 5E2WH 1ES0B 3ETBF 2FATL 4M7ZB 4UU9B 5DJ6B 2ICEA 3CZFB 2FJGB 4OZGF 4OLVL 4PV8B 1ZLSH 2BX5A 5E6IC 2JB6A 3L9RA 4NQEA 4PRDA 2UWEB 3MV9E 4Y5VA 3NH7H 1ZK9A 1VSCA 2NNAA 1F97A 3QDJA 4LCYA 2EIEA 3BQUC 4V1DA 1UACL 4IEFB 3CFKB 1D6VL 3O0RH 5CILH 3HG1D 1SEBB 4Z7WA 3HE6D 4R4BB 3TJEH 3MV7B 2LTQB 1LO5B 5D7SL 1L0XA 4QRPE 3RNQA 2CKNA 3WV0A 3H9SA 1NLBH 5L88H 1MF2H 4P5TD 1NCWH 2Q6WB 2H2PD 4HWEL 4R4FH 3ZTNL 2V2TA 4GRLB 3RWCA 2P8MA 4YHNB 1MIEL 4DWHA 4DKEL 4JN1L 2EIZA 4U1MA 5DSCB 2QSTA 4CMMA 3LKOB 1T2QL 4XTRD 5F9WC 1QP1A 2P42B 3MRRA 3CPLB 4RISL 5DMYA 5JOPE 2R1WB 4XMLL 2DQDH 3I6KA 4XVTH 4X0KA 5C08E 2GJ6A 5IK3B 4E41B 3OB8A 5TDPA 4ELMB 2GQHA 2R2HA 3WL9B 2BJMH 2QKIB 3WS3B 1S8DA 3FT4A 1AIFA 3RWHA 1WCBA 1I7TB 4OCYL 4XB7A 3VXMB 4LQFH 4NN5C 3WHXA 4NZDA 3BKCL 1QFPA 2YD9A 3BSZL 3HZMB 1A4JB 1I85A 4ZUSB 5EOCH 1IC7H 4X83A 1KN4L 2BRRL 4XWOD 1K9TA 3QUXC 4XVUD 1BEYH 5LGJB 4TQEL 3BDXA 5BRZD 2AS5M 1XGQA 3JV6B 3PHQB 5EU3B 5FUCC 1JNLL 5IVZB 5HVWA 1EEZA 7FABH 4I2XE 2PTTA 4WFHD 5FYKL 5CJXA 2ESVA 3G6JB 4OLXH 3VMOA 2FJFB 2VSCA 1IE5A 4UNTA 2K1MA 4ZAKD 1K4DA 5JZ7D 1A6VL 2APTA 2W91A 4KTYA 5GS0H 1PEZA 4FQLH 1RFDH 5IBLD 3PWJB 1V7MH 5BV7B 4X5WA 5EN2A 1L9MA 3N0PB 2HYMA 1XEDA 4KK5C 3BMWA 5T3ZH 4JY6B 4J7RA 4JFFA 1WITA 4QF1B 5HYQA 4OZGA 1OPGH 4PRHD 1HKFA 4I0KA 3EFDH 1KJ3H 3C9NA 3DUUA 2Z31C 3LH2L 4OF5A 3OHXA 4PGEA 3KJ6L 1HOCA 4QRRB 2H45A 3T8XB 3R06B 2EE2A 2G9HA 2NR6C 2BZDA 1RUKL 4ZSOA 1RIUL 2DQGL 5DJXA 3S36X 1R5VB 1BZ7A 3UTSE 2Z9TA 2ZSWA 1VFUA 3UPRA 2UYLA 3QULB 4FA8A 4E42A 2HA1A 4NWUH 1IQDB 1FVCA 3CLEL 2CLZA 1S9KC 2YA0A 1J0ZA 4WWID 3FQWB 1HILB 3ZKND 1ZGLP 1CFNA 5F1KC 2NY0B 4JFDB 3M1BB 2DQHL 4Q2ZA 4KV5E 3C08H 1C16B 3UYPA 4HMCA 4K7PY 2AVGA 5H94A 2OR7A 4PGDA 1OP3H 1T7XA 3RWDA 4LDEB 1N64H 4IDJL 5I71B 5B8CA 1U8OB 3CUPA 3IFPA 3QUKB 5C1MB 5D2LE 3VXME 4ORGA 5ADOH 5KJRH 4MD0B 1ZVHA 3MRLA 2WWMD 2WQRA 4P2OC 2D0HA 3HE6A 5I1EH 1NEUA 1G7JB 4OD3L 1VESA 4RRPA 2J6EL 5I8EB 3K46A 2IQAB 4OCLC 5AWNH 3RVWD 1JNHA 2ITCB 4HC1H 4NBYB 1X3DA 4YQXH 2AXHA 5JW4N 1G9NL 4UAOC 3NCEB 3PGFH 1CIDA 2R2EA 3QNYA 4M6NH 3EOTL 1M05B 3F62A 3JBG7 1KTLB 3DNKA 3L3DA 3G6JE 1GRWA 4PLKD 5SX4I 3C6LD 3X11A 4H8WL 2E3VA 4LLAA 1MCPH 5C6WH 4Y89A 3R4DA 3WD5L 3AB0B 1FP5A 1KENL 2MKWA 3CU7A 4TVPD 3IDXH 5LGHL 1CLYH 4UTAL 4RAVB 2SEBB 3HRZB 4R26L 4DKFL 1DJSA 2VLRD 1NMAL 4FG6C 1FPTL 4N8VA 1DBJL 4FQIL 1NEZG 1MHHB 1N6VA 2B5IC 3BPNC 1KTRL 5D1ZC 2QADD 1N5AB 1MH5A 4L3CB 1EJOL 4PJCE 4UDTA 2MFNA 1UKQA 1W8NA 3QUYD 5KZCB 3CFDA 1B0RB 1LEGA 4PJXF 5DHVA 2OQJB 1XGRB 3W82A 4BZ2H 3JVGA 3SBWC 1UZ8B 2ZCHL 5DHYB 2NY4C 3BWUC 3EW3B 2V5TA 1DFBH 3BW9A 2GITA 3QIWC 3HN3A 3TZVB 4NKMA 1G6RH 4F15C 4GBXD 2HFGH 1JF6A 1U0QA 4NNPL 3MLSH 1EUTA 1EJ6A 3QEQD 3UJTL 2BNQB 1WZLA 4JFED 3SDCC 3EYOB 4TULL 3N1QC 1N6QH 4MHHG 4ZAKA 4LRNL 4QRQB 1WQVT 4Y4HD 1MLCB 4P46D 3I85A 2WIIA 4GKOA 1EHXA 2YMXH 3ZKXB 4C56D 3QEGL 4F7TB 3D39D 5CINL 4BFIA 5K9OB 2JIXA 2QHRH 1HYSD 4WFEE 3D3VB 4L4TE 5DJAB 2FYYA 3SQOH 1PYWB 2DWEB 3HKFA 2EH8L 3OAYK 4HUWB 4R90L 4JQIL 2O5YH 4DUWA 4PRHA 1S5IH 3K74B 5ICXA 4HK0A 5BQ7A 4MNHA 3P9WB 3VXNA 2HH0L 4U3CA 1E6JL 2XXCB 3WIIL 5IEHB 1EEYA 4Q58C 3GRWL 1FE8H 2ARJB 1H3WM 2BERA 3EGSB 5JOEA 4EI6B 1DQLL 1XGPA 2DMBA 3X13A 3ZDYF 1MQKH 5H37G 1R0AL 1LNUA 3TT1H 3LQAC 5IBUG 2N1KA 3MLXL 1RAMA 4PUBH 1T1WA 4LMQI 4XH2A 3F5WA 1CGSL 3Q1SL 1E4KA 4HSQA 4K71C 1NMCB 5I66A 4HIEA 5FA3A 3ZDZF 2DAVA 3WUZA 2WBJC 1FL6A 2IBZX 1TZIA 1CICB 2DM2A 1CLOH 2DD8H 1C08A 1I9RL 1DQQB 2FX9H 4UBDC 5T1DL 4A2MA 4UQ2B 3QHTC 3W5NA 2Z8WC 1J1XL 5KVDL 5BCAA 2D0FA 3KPSE 1Z0MA 3H0TA 3VGDA 4MDJA 4KZDH 4IRJB 1B4RA 4LCIH 1EO8L 1RIHL 5D6CA 4NQCB 3ROOB 4PJXA 4OIBA 3M45A 1CFTA 4R8WH 4Y0GA 4JN2A 4OBRA 3FCTB 2XZAL 4MYWB 4WTZG 5DJ8A 4HKJB 4RNRB 4XCEA 4OCRH 5EDXA 3QXVA 1NCAL 1OW0C 4WJ5B 3ZL4L 1DUZA 1TVBA 1RU9L 2W0KA 4O2CA 5HGHA 3E1F1 2EEDA 5DFWH 5T3XH 2MQCA 1WUNT 1HXYB 1H3UA 1Z9LA 2BNQE 3FN0L 4N0FB 5CWSA 3C6LA 4UTBL 4ZNEA 3E2HB 2EYTB 4K8RD 5IW1B 2F8VA 3VGBA 1NCCL 3MLTA 4ZODA 1EDQA 5HHNA 1DZBA 1P6FA 4NOBA 3MLZL 3X17A 4E9LA 5J57B 4JG0L 1IC4L 1ZHLA 1KIUA 4MB5A 4HUVB 5FUZH 3HMWL 5K9JL 5EPMB 2OL3A 2VLRA 5BW7A 5C0JB 4QTHA 1XF3A 3V5HA 1TMCB 4QHKJ 4ORZC 5GSVA 2IG2H 2XZQH 2BSRB 2MPAL 5JUEL 2NY3D 2P8PA 2YK1H 3VMNA 1RZFH 4NUGH 3LRSA 3U0WH 5LKNA 3QUYA 4X7SH 4HBQA 4XCCH 3PWPA 5D96C 2F19H 3IDYC 3GBLA 4RGNC 2X2YA 3QRGH 3KPRE 2X7LA 3MROA 4NQUA 5I1JL 4X9HA 1HCFX 4KC3B 3D85B 1A5FH 4GBXA 1IL1B 1KFAL 1IGJA 5JTWA 2A0LD 4LIQE 3NCYP 4JFOA 3IU3A 4WY7H 3QEQA 1MJJB 4JFEA 4NNXB 4XBPA 5EC2B 1F8TL 4FFZH 5CEZL 5CBAA 4PJ9C 2M2DA 4W81A 2ZP0T 3L5HA 1C5DA 4C56A 5D7IB 4RRPG 5CGYD 4YPJA 2CK0L 3TBSB 2IAMA 3D39A 3DUHA 4HF5L 4AEIL 3AFLA 2EXWD 2K7QA 2VE6A 4G6FD 4YBQC 1EHNA 2CQVA 3QFDB 1ZANH 5HDBE 4F7MB 3ULVC 1BQUA 1QA9B 3UTPE 2B7DT 1TZHA 3CDGA 4WV1B 5TH2A 4A6YH 5HI3C 4CMHC 1UXWB 3P0GB 2N56A 2GJZA 4JR9H 3F6LA 2IGFL 1JMZA 1G7QA 2Q8AH 2V17H 2L4OA 2YN3A 4NQCE 5GS2H 1R3KA 1A0QH 2AJUH 3SN6N 4DUVA 5FAAA 4ZFGL 1OD7A 1YY9C 3VXOB 5E5MB 3HAEA 5DQ9A 3LN5B 4NFDA 1NLDL 3C5ZA 2HVKA 5IMKA 1BQHB 4ONFH 1A1MB 1TVHA 4MNGE 1PSKL 2LVCA 3FB6B 1GGYA 3U30B 3DSNA 5I15L 4CU6A 1FYTE 3IFNL 3DGGA 1BIIA 4ZFFB 3IXTA 4KMTH 1WWAX 5D2NC 1OM3L 3U0PA 4R97C 4R7DA 2E7LA 5DDHA 4EQ2A 4W68A 4LSRH 4XP5L 3WIHA 3WLBA 3FZUC 4YEEA 2CXGA 1SEQH 5AG8A 3FQXB 4ODHL 2MQ0A 3LKNA 3VXSD 1J0IA 4XPBH 2IANB 1JWMA 1PX4A 4JZOB 5E99L 1JK8B 3P11H 4F3FB 1RIVH 4P48A 3ARYA 4PRNB 1UXSA 3EYUL 3CSBA 2DOCA 4NQDD 1ETZB 4ACPA 4I3SL 4U1NA 1G9NC 2CDEA 3T4YA 3FT3B 3LIZH 1ZT1B 4DN3L 4PS4L 3DV6B 3QI9A 4H8WC 5CLWA 4QRTB 1AD0A 4BYHA 4GG6F 1BX2A 1NGQH 3OKMA 4WI7A 2H6PB 2P44B 4N1EA 1AP2B 4OD1H 4JM2C 3X14A 3TA3C 3RNKA 2R9HD 4KKAC 5D7IE 3T77A 4BQ8A 4ODVH 1Q72L 1IEBA 1HWHB 5ERWA 1B9ZA 4PJ5D 4KI5F 3MLWL 4GAGL 4KUZL 4KKLC 3O11B 5KAQF 3WEXA 2GYSA 1FO0H 2L0DA 3L3IA 4POZC 1YPZA 1EO7A 3OAUL 4MJIE 1H0DB 4F7PA 1N7ML 4MXQC 4XXCA 3NMEA 3UPAA 4NCC2 1OTSC 4ODSH 5GGSY 3OR6A 2DJSA 3ARZA 1NAKL 3WXVL 2N4IA 4X8JA 1BVKB 1V3KA 4NN7C 4PY7A 3HS0B 2OTWA 3EYQD 4YHOL 4LPUA 4ZTOH 5K9KA 5DMGC 3BE1L 5HD8D 4JRYD 1FZOB 5E6IB 5AYUL 1LE9B 2G2RA 4KJQC 4NZTL 3S34L 4NGHL 5I1GH 25C8H 5IWLC 1F4WL 1ULVA 5IIEA 4UDUB 4OZFG 8FABB 4LHUB 3BP7B 1G1YA 3D0VB 4NRXB 1FORL 2EDKA 3LD8C 1BFSA 3VMPA 1NFIB 5HHMB 5AAWA 3ZZ1A 4JAMB 1IAMA 3KYOA 3F7VA 2CKBB 4QYOA 4P59H 1DANT 4JHAL 5HHPA 1YNTA 1UC6A 4KDTC 1J11A 5C7XL 5SWSA 2ZUVA 15C8H 2Z93A 3MJ7A 2HLFD 2WM0A 1EAPB 4M48H 4NN6C 4M5ZH 2IANE 3EO9L 4X80L 1NCDL 1IGML 3T3PE 1FLRH 1WTGT 1ZLWK 4ZD3H 3OKNA 4LP5A 4L1HA 4YBLC 2EICA 1B3JA 2BSSA 5DRZB 1MRCH 4P9HL 3KPLA 1CR9L 4UIMA 5F9WB 1CF8H 1A7PH 1NAMB 3MNZB 5FXCH 2XG4A 5EU5A 3V95A 3T0VA 4DZBB 3TNNB 5BXFA 2M1KA 1G7HB 4HWZA 5MENE 5JDJA 4X5XA 4RSVA 2UZXB 4JRWA 3LEVL 4NC1C 4WHDA 2BC4B 1IAIL 1YJDL 3EYSL 5DJDA 2DM7A 1NBVH 2VQTA 4MLSA 4MNQD 4WFFE 1T0NA 4LSVH 3N06B 5IB5A 4RBPK 3K8KA 4JHZA 4Y19D 2XQBH 5K33A 4O5LL 2HAZA 4HPYL 2WUBH 3CSPA 1UZ6F 3QUXB 3GM0A 2V2WB 4MCYB 4OJFL 5AUMB 5HXMA 2QQKH 3U7YH 5KS9B 2D7NA 5I19H 1JN6A 3T0WA 5FGBA 1D5IH 4G8IA 1OP5K 4G8GA 2R56L 1NJ9B 4EBQL 2OCFD 2VAAA 3VXSA 2FATH 4P5KB 1T2JA 2K9UA 3VRLE 5C07B 3V79C 5MEPB 3MBXL 1JHKL 4IOIB 4FXGA 2YWZA 2OI9C 1LO3L 4F2MA 3UTTA 4OLVH 3VWJD 5KSVB 3V6OA 1CVRA 1W8OA 3MPCA 5KSUB 1XF5A 1D6VH 3DXAD 1HEZB 5E2TH 3HE7C 4L8CA 5FO7A 2ID5A 5D7SH 4U1IB 1M7DA 2F54E 5FB8B 1BWMA 5EBWB 2UY6A 5D1QC 1QOKA 4I3RH 4AENA 4JFPB 5B39B 1BVLB 4WCYL 4X4XB 3SE8L 3UBXB 3ZTNH 4DCQA 1LO0H 1A47A 4Z7VE 4DKEH 3MTRA 1CT8B 4JG1L 5CZXD 3ILPB 3QJFA 1T2QH 1WICA 4KHTL 1BZ9B 1CL7L 5KSAD 1RY7B 5JXED 5LVEA 1I1FB 5BVPL 3FT2A 3RGVA 2YZ8A 3O6FB 3HAEG 5EO9B 3MLUL 4OM1L 3QFJB 3F8UB 4XWGH 4CKVX 3Q6FB 5F88A 5IKCB 5K9QI 3DGCR 3SE3A 4K3DL 5CP7B 5CLTA 1T1ZA 1M6OA 4HKZA 1SYSB 2FECI 2AXGA 3QHZH 1OTUC 2HTLD 4JO3L 4B7LA 1A64A 2Z8VC 4PJ7E 4WI3A 1RULL 3L95B 1CZ8H 3BSZH 4GG8A 4WHTB 4HX1B 4LF3A 4PJ8A 3U82B 1TFHA 3DTXB 4L9LC 4WO4C 1I3RA 4LLYB 4JGUA 2J1KA 2X4UB 4Y4KB 2W0PA 2ZUUA 3LB6D 3R1GL 4GKSB 4TQEH 3TVMA 4F33B 3J7HA 1R3JB 1BLNA 5CCKL 2V5RA 3MMEA 1TNNA 5SWQA 4EN3B 2MMXA 3P73A 3ZTJH 3ULUL 4P2OB 5E8EA 5BOZG 3FB8A 4Y2DC 2FIKB 4XAKE 5DWUL 2A6JA 3SDDB 3JSSA 2V9RA 4N5UA 5C0AE 1PD6A 5C0IB 3RVTD 1SBSL 3GJFB 5KG9A 3IAPA 1T04B 5FUCE 5FO8B 3MACL 1T0PB 2R29H 3OKKB 3ZKQD 4RIRB 5D1XB 2BXYA 4UAOB 1A6WL 2ENYA 4JZJA 3GSOA 2ZG2A 4YLQT 3SE4A 3QO1A 1TJHL 1B2WL 2L7UA 5I76A 4GKZA 3EZ8A 1JYXA 4LLUB 1P4LA 4PR5A 4YHIA 5IJVB 5C2BL 3PWNB 1IRAY 1LK3H 1OAYH 1ZHNA 1YEGH 5I73C 5KW9H 2DI9A 5EIIB 3MV7D 4TSBH 3MCLL 3KJ6H 4PYHA 2G75A 1CGXA 1MJUL 4OAWA 4P2CG 1TQBB 5FF6B 5TDOB 2RFXB 2B5IB 4Y16B 1QEWA 4MNQA 5EC1B 1RUKH 4GRLD 4LVOC 3HNSH 2DF3A 2DWDB 2D31B 4PRPB 4JJ5A 1A1NA 2GUOA 3S88L 2NY4B 4KKCC 1JTTA 1CD1B 1L7TL 1K3ZA 1FZJB 1XGUA 3NFPA 3PDOB 3QIWB 4IMKA 5F7FA 4O4YL 3HC0B 4PY8I 4E41D 4LCCB 3VD5A 2ORBL 5GIRA 5TF0A 2OSLB 1A21A 2D3VA 5H35A 5DEFA 5DJ0B 4QY8B 4GMSL 2HFEA 3RIAK 3SDCB 1FN4B 1H8OA 3VXMD 1G6VK 1OAUL 3T0EC 1QRNA 2JJSC 1FFQA 1X5FA 4LFHD 2VIRA 3BISA 3VWJA 4IDJH 4MLIA 5E00A 4KK6D 5L7XL 2AEQL 2VLJB 2W07A 1AO7A 2AGJL 3UO1L 4KRPB 2JTDA 2R1XA 3DXAA 4QOKB 2RB8A 3MXVL 1WWCA 3MLYL 5DRXA 2CDFA 2ZKHL 4NRYA 3VRIB 4OD3H 1X6NA 1U8KA 1KCSH 3NIFF 4X9FA 3I3EA 4MWFB 2NLJB 3WNOA 1CDCA 5KANI 5J8OA 1HNFA 3H7LA 2X4RA 1P4BH 1NUNB 3F12A 4GS7B 3SCMC 5C0CB 2CXKA 1XFPA 5A2KH 1OWWA 4PJBF 3GBNH 2VLMD 4UT7H 5DUML 2DIJA 3RY5A 1ORQA 4MAYC 5KSAA 3O2WH 5IVOA 1WC7B 5GRUH 5JXEA 3PIQA 1T5WA 1QNZH 2GJJA 4NNYB 3KPPB 5BZWB 3WD5H 1KB5B 4LAQL 3JV4A 1KENH 1XGYL 4FQQA 4UTAH 3OSKA 4GAFB 4KRLB 4DKFH 3QJHB 4JCMA 5FYKU 5C0BE 1NMAH 1FPTH 3SY0B 1LGVA 3V4PL 3OJMB 1H3PH 2VXQL 1EJOH 2D7OA 4K23H 4XBGB 4QRRD 2YSSA 3AS2A 2XKSA 4QO1A 5F1NA 3B5TA 1TCRB 1DE4B 1RJLB 5DFTA 4YZFE 2WW8A 3BZFA 5FK9A 4FNLL 4JY4B 3KYNB 5I75C 4NNPH 5CP3A 3QISA 1QSEE 2RCSH 3GSQA 4JJHA 4EXKA 3GUTB 5B4MC 4TULH 2XWTB 3GHEL 2ATKA 4EUPA 4FQPA 4X4YB 2XICA 4JY5L 3SDAC 4PV9B 1ES0A 1HINH 4PP2A 5B3JE 2NY0D 4JFDD 3QEGH 4M61B 4ZYKB 3P4NB 5J0BA 2F58L 1I1AA 2VL5A 2ZCLH 3VA6A 5T1KB 4FQHB 4KKBD 2B1AL 2APBA 2C3VB 4APQB 5I1CL 4PV8A 1Q0XL 2CLRA 3QCUH 2PKDA 2UWEA 1MNUL 5GGTH 2FEEL 4WEBL 2YUZA 3RUGE 3LMJL 4YGAB 3B2UC 3HCVA 3CFKA 4JLRB 1YJDC 2DMKA 3TN0B 1UH3A 1MJ8L 4Z7OF 2VLJE 1S9XB 1D5BB 2ZWLT 3MV7A 4RDQF 1LO5A 1E6JH 3WIIH 1FIGL 4EVNB 3I3BA 2JK5A 2X6MA 2HG5B 2Q6WA 2Y6SC 5FV2A 1DQLH 4NO3B 5FECB 5ITBL 4YHNA 2AQ1A 4OBSA 1IBGH 5L2JA 5J12B 1JYVA 5DSCA 3PWUB 3OKDB 4M8VA 3AY4C 5T1LA 4JE4B 5D96B 5EBLA 3T3ME 4J23A 2LU7A 2VZTA 3CPLA 4JKLA 3QEHA 2R1WA 1CGSH 3D48R 2EE6A 3B5GA 5KVGL 1J8HE 4H26B 3AXLB 3X12B 3FO9A 5IK3A 4TYUA 4O2EA 3WL9A 2QKIA 3EFFB 3HR6A 3RU8L 3SGKA 4XNUL 4X6EB 3DETD 3F65A 1I9RH 1UJTA 5T1DH 1UENA 5DMIL 5KVDH 3L3KB 5LXGL 2NYYD 5KZCD 1A4JA 4ODTH 5M7QA 4ZUSA 4DKAA 1T80A 4K7PX 1J86A 5HHOE 3P0VL 4S1SH 3G6DH 1JHLL 1EO8H 1RIHH 2A6DB 5TFSH 3WS6C 3LKRA 3TZVD 3I02B 3JV6A 4YWGL 1FRGL 3E6FB 2XZAH 5IVZA 3WJJC 1V5JA 5EO1B 1CD9B 3C8KA 4M02A 4NZRL 4U6TA 3OKYA 2EE9A 2BNQD 2W9DL 2P5WA 3KDMA 3QYCA 4KZEL 4HW6A 2FJFA 3S3PA 4LGPB 4U6YB 4GFTB 4AIZB 1QHPA 4M93C 5HPMB 3FN0H 4OLUH 1K5NB 3G04A 4OFVA 3CK0L 3AREB 5JPMB 3PWJA 1V3JA 3ZE1F 5ESVB 1INEH 1J10A 1NCCH 1UWEL 1H3XA 4OGXH 2IJ0C 2O5XL 3D3VD 2I60L 3V4VL 4JG0H 4P3DA 5JHDE 4JFZL 5HSFA 5IQ9B 1Z9SA 4OI8A 4JY6A 4M7JL 1J5OH 3D6GA 2HT3C 4Y5VC 5IB3B 4C55A 4PJDF 3BKYL 5IBTL 2MPAH 5JUEH 5F6HJ 1NGWA 1DSFL 2R0KH 4L9DA 3L6FA 3GI8L 4QRRA 4RGOH 4OKDA 3R06A 2FB4H 4GRMB 2VLLB 3TESA 5I1IH 4ONHB 3ULUC 1I8LA 5F7NC 4H25B 3C60B 4KH2A 5JHLL 1AGBB 1PLGL 3UTZB 1KELL 4QGYA 1ZVSB 3UDWC 1UFUA 3S4SB 1REIA 5EORL 3B9EA 4U2YA 1OSZA 1F8TH 5CEZH 5FYKE 4RGNE 2P5EB 2DTMH 1UA6L 3O45B 3FQWA 1CICD 4JFDA 1QBBA 3M1BA 4AEIH 2ZOKA 1FJ1B 1TITA 5CGMA 4TVPL 4M3JA 4HK3N 3ZDXF 3GMPB 4ERSH 5E95B 3RHWF 3TF7C 1U8OA 4TRPH 1I85C 1D5XB 4H0HB 2HT2C 4IRJD 2UZYB 5IROA 2X4TB 4NQCD 2A1WL 1WSST 5HDLA 5D7JB 1G7JA 2IGFH 5I8EA 1MPAL 2J3SA 4KTEL 3QDME 5I74C 2O26U 2ITCA 4NBZB 4ZFGH 3RP1A 2P8LB 3ULVE 2C7UB 2M8XA 5CJXC 4YDIH 3DVGA 4G80B 3KNBA 4XP6L 5FGCE 5LCVH 1G0DA 1JZ6A 2DQEL 4JKKA 5ABDE 2A6IA 1NLDH 2X05A 1JGVL 5C0FB 1JGLL 1EERB 2KBGA 2WIMA 1KXTB 1PSKH 1ZLVK 3HMXA 3MR9B 4KFZC 3IFNH 4HXAL 1YQVL 4KJPD 3ARGC 1FH5H 3I9GL 3K2UL 3LSOA 4OUOA 3TT3L 4U1GC 4RAVA 2FGZA 2SEBA 4ETQB 5A2JH 1HH6B 2H32A 5IHLB 4B5EA 3KLHD 1TIUA 3K8LA 3KHQA 3FMGL 2VZ1A 1T4KA 1KJ2L 1FFOB 4FFWD 3GIZL 1N5AA 3NGBC 4PLJD 2CRYA 3ORJA 3MJ6A 5D2NE 4U33A 2XY1A 2OQJA 4JO1L 1OTTC 4EUPG 1UZ8A 4F8TA 3EYFB 3EYUH 1KCKA 3TZVA 4PPTA 3M17A 3D85D 5J1TC 4GQ9H 1NGPL 4M3KB 2X89D 3QG7L 4YHKL 2HKHH 1JPGA 2Y7QB 1RZKL 3LHPL 3MO1B 4YBLB 4OF3A 4OIIL 4TOYH 2PTUA 2DMCA 1RHHA 2FX8L 3IKCB 1XF4B 1UB6B 1YN6B 1MLCA 4FTVB 4NO0A 1JWSB 3DVNA 5AZ2L 3HUJF 4F7TA 1X5AA 2E7MA 2CO7B 4OLZH 5A1AA 3D3VA 2XTLA 1YEKL 3MLRH 3C2AL 1E6OL 4K7PH 5DJAA 5SV4A 3WIHL 2C5DC 5GJTL 3VXUB 3PP3K 1Q72H 5TJWK 4YJZL 5B8CC 1MI5B 1EK3A 5ANMB 5JIIA 1IM9A 3MLWH 1C5CH 1MUJB 1FNHA 1SY6A 1T66D 3HE6C 3OAUH 1N0LA 4JFXB 5IEHA 3S37L 4S1DD 2XRAH 1N7MH 4HMEA 2ARJA 1OT1A 3BZDA 4PG9A 4EI6A 4AZ8A 1DLFH 2R8SH 5F8QC 2CUMA 2AV1B 3C8HA 1FGVH 5EG6C 2VABB 2MHAB 1BD2A 3KLAB 4AM0A 1R3LA 4YHOH 2VDOL 3BE1H 4LFHG 1U93B 4XTRC 2Y5TA 5AYUH 5I0ZA 1AFVH 4NGHH 4Z77A 4POUB 5E4EC 1NUDA 2AQ2A 4JZNB 3EAKA 1U8MA 3VGFA 1A7NL 1GPOL 1FORH 1V8HA 1XH3B 4X6BB 4MA3B 1A3RL 5TE4H 4K8RL 4G9FA 1CICA 5AYQA 5EU6A 5HYJB 4JKWA 1DQQA 4UQ2A 4YDLC 2IAND 5CJOH 5D1QB 2Y07L 3AS0A 4MJ2A 3P4MB 5E7FA 2X4OA 1FNAA 1FVEA 5C3LD 3EO9H 5DO2D 1IGMH 5E8DL 3JVGC 3MLPA 3KJ4C 2GTWB 3ROOA 4D8PA 1HHKB 1DEEB 1JZ5A 4P9HH 4XWOC 4X7TB 1FZKB 4XVUC 1CD0A 1T6WA 3GSNH 3REVA 3CXHJ 5BVJA 4HKJA 3NCJL 5JR1L 1ZHKB 4WJ5A 4GLRH 1QG3A 4OQTL 3CVHB 5DJZB 2CIKB 2DRUA 4HT1L 4OSUL 1IAIH 3EYSH 1HXYA 3SDXB 1I3GH 4ZAKC 5GGVL 5JZ7C 3VXRA 1FAKT 5IBLC 1MELA 3RY6C 5D71L 3AS3A 4GAYB 5I16B 2RGSA 4O5LH 1WIOA 4WO4B 3MNVB 4HUVA 5DRNB 1A7OH 5J9PB 4U05A 4NC1E 4DOHE 5C0JA 2VKXA 4YNYB 4X6DB 4PRAA 4NZJA 1MFAL 4JFYB 3V8CA 3DV4A 4MA8L 3VXUE 2ATPB 2BSRA 2YD7A 3OQ3B 4EBQH 43CAB 4XHJC 1BPVA 4LK4A 3T1WA 3MBXH 1A7RL 2PXYB 5JORB 3L1OL 4M9OA 3QDHA 5BZDB 1N59A 3VFRB 1Q94B 4MAUL 4FQ2L 4YHML 2VH5H 3RWJB 4ZQKB 4NPYB 4LSSL 5J1AA 1Q8MA 4NKIL 4N9GB 3L5JA 1EVUA 1PDKA 2A9ML 4PRBB 2OP4L 1J05B 1PG7X 2X89A 4J3XA 3ARRA 3BRFA 1I9JL 2EDOA 5E6ID 1QLEL 4LLWB 2MCPL 2EDBA 4HDIB 5J6HB 4HZLB 3JWDL 4YHPA 4P3CL 1MJJA 4NNXA 4Y5YA 5EC2A 2ZG1A 4LHUD 3S6CA 5I73B 1E4KC 1P9MA 1INQB 3SE8H 3HZVB 4LBEA 2ADIB 4AQ1B 5DLMH 1U91B 5HHMD 4I18A 4PJFB 2ICES 4XNZC 1JHTA 5E6YA 2X1OA 4JG1H 3RWEB 4YXHL 4ONGH 4KHTH 1CL7H 3V4UL 2QHLA 2FX7H 3F7RA 5HHXH 3K4AA 2FEDD 3EBAA 2V9TA 4F7MA 4LVOB