5JR1L

Crystal structure of 10e8 ghv-maturel antigen-binding fragment.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
YELTQETGVSVALGRTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGSASGNRASLTISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Developmental Pathway of the MPER-Directed HIV-1-Neutralizing Antibody 10E8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 10E8 heavy chain
total genus 46
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jr1L01
1CDYA 2OL3L 1QR1A 4OCSH 2R8SH 2IH1A 5KVMC 4RFOH 3VG0L 4OD3L 1RMFH 5ERWA 3FQXB 1A5FH 3F6IA 3WFDL 1MCHA 4QHMA 3B4NA 4YGVA 2AEQH 3OKNA 4HKXA 3M17B 4GOSA 5D1QC 2YA2A 5HDOA 4BK4A 2CUMA 1SEQL 2EKSB 3D87B 4GMSH 3EYOA 3LN5B 2NZIA 3ARRA 5GGRY 4G7YL 4HSQA 4JN1L 4OD2A 5D96C 5E7FA 4P4KB 5L88H 3NAAH 1LO3H 5BVJB 2HT4D 4M43H 2OCFD 1IM9A 4N0FA 5F6HI 2X05A 2Z35A 1QBML 5D6CA 1I7TA 1U93A 4U1SB 4N90D 5H94B 5IJVB 1A02N 5J89A 4U3CA 5ALCH 1LK3L 3U36A 1UH3A 1JGEB 5E2TH 3REWB 4JE4B 1OGAE 3D85D 4OFYA 3T0WA 5FO9B 4OZFH 4UIMB 4HPOL 4XAKE 4XMPL 5D2LB 1FGNL 3U0TA 4OFPA 2C3WA 3QUXC 4U49A 5H8DA 2N7BA 4IRJA 3VGHA 5I8CA 5F88A 1KGCD 2DYPD 3KGRA 1FH5H 3CH1B 1LE9B 3BGFB 5IW3A 3ARFD 3BKML 1YC8A 2YN5A 4L29B 3K3QA 5KW9H 4EI6A 1UG9A 5L2JB 5BOZG 1A3RH 4WVRA 4YDVB 3V7AE 2VERN 1YEKH 3ZE1F 2X4NA 1AGCA 3ECBB 3O2VL 3VWKC 1KCLA 4NKMB 4KZEH 4L9LC 3HZMA 3MRMA 4UU9A 1OW0C 4UTBL 4OV5A 5ISZD 5F96L 4WJ5B 4LHUB 3DGCR 2H8PA 2ZPKL 3BDBA 4WWKD 1F90H 3C08H 1NFIA 3C6LB 3MRJA 3MRHA 2BVQA 4F7PA 2MHAA 2FIKA 5EC1B 3VWJC 2PTTA 2UWEF 1S5HA 1KIRB 2C26A 3M45A 4U1KB 4C59B 1ZHNA 3DRQA 2DQIL 3MREA 1BWWA 4JFXA 2E6JA 4RAHA 1PEZA 5IW1A 2XXMB 3PQYA 5TE7L 3FT4A 3VGEA 2NXYB 3MV7D 3OZ9L 2NY6B 4UB0L 5IEHA 3P77A 4JQIH 1BZQK 4XBEL 2FZ3B 4CU7A 3NACH 2A9ML 1K3IA 5A3ID 3VDBA 1CFBA 1FP5A 1J8HE 2FCBA 5F6IC 3QZWA 2AEQL 4PGJA 1B6UA 3TH3T 1T2JA 1U95B 1FHGA 1DUZB 5CZVH 1S7QB 4GMSL 2Z8VC 5HDQL 1RV6X 4WU7A 2FWOB 4WW2A 4NO3B 4F2MA 3EZ8A 4E41D 1KLGB 4JHAL 3P77B 3HLAA 3TPKA 1G84A 2QQNH 3VXQB 3L5XL 1D9KA 4G8EA 1XH3B 3PL6D 3WXVH 2HFGL 4JHAH 4QOKB 3CJJA 5C0BA 4DN4L 3SEPA 4YDKH 2WUCH 3QT2A 1KCKA 3ZYZA 2G2RB 2VABA 3VG9B 4L8DB 1C1EL 2PTUA 1OCWH 3D2UB 5F7DA 5B3JF 4KKAD 2FL5B 4ZXBA 3DRTB 4W4OA 4NQUA 1EVUA 4NUGL 3PE9A 3QHZL 2OTPA 3SBWC 1KFAL 1AD0B 3QI9A 4UU9B 5HI4D 4Y4KC 3L9RB 2CKBA 3LY6A 3VWKB 2OJZH 5GGTA 1HILA 4NZUH 1BVKB 3BGMA 3UPRB 4Y19E 4WHYG 4MSWA 3EGSA 3CDGB 5KAQG 2AP2A 1U8IB 5JPMA 5I74B 2DQTH 4KK5D 5FECB 2AK1H 3GM8A 1Z9SA 3RTQB 3FN9A 5KSAA 1MRFL 3IFNH 3ZLQC 4F8TA 5CEZL 2M8XA 4JFFA 4OCXH 3THMH 5JXAH 2A83A 4PJ5D 3DSFH 2HH0L 4K94L 4EIZC 1D5BA 4NQDD 5IVXF 5F7LB 1OY3B 3HAEA 3U82B 3UTQA 2MFNA 3GI8H 3PQYE 2B20A 4S2SA 3FFDB 1T89C 1GGIL 3MLTA 5I1AA 2VMFA 4HXAH 2VUYA 5DJZB 1QZ1A 1A7PH 3NCEB 1CZ8L 1F58H 4NQED 2FX9H 3G6JB 4MX7A 1W2KT 1JV5B 5E5MA 2V17L 4S2SB 3K81A 1AJ7H 3HMWL 3FOLA 4E5XA 4AIZA 4U05A 3WUWG 2PR4H 4KDWA 4OKVA 5C92A 1EXUB 3N9GH 3SDDC 4HIIA 4U1LB 1JGLL 4OCWH 4OZHA 3UDWA 4LSRL 3ILPA 5GS1A 3ULUH 1OGAA 4LSUH 4P9HC 4HJJL 4JFDD 1I3VA 3CVHH 2EKSA 4L8DA 3P9MB 3R06B 4QCIB 5KSAD 4YWGH 1JPFB 4OJFH 3LN4B 3O6LL 4AEIL 4QRRA 2WP3O 4PJCA 1GRWA 1YY9D 5BS0A 5JIHA 1OP9A 3FQXA 1BF8A 5JHDA 1BP3B 1RURL 1U8MA 4BSWB 3QQ9D 1LK2A 4Z7QE 4HCRL 3PABB 5IWLC 2Y6SC 4XXDA 2BX5A 5IMMA 3IJHA 3OWEA 5HJ3B 4I18B 1S7QA 4DKFL 1KULA 1PVHA 4WDIB 1RZGA 1CTOA 3MLUH 2OK0H 5IB2B 3TA3B 4G8FA 3VD9A 4KJYB 4YHZH 1C1EH 4I0PD 5BV7B 3TBVB 5D7JC 4LLDA 4HWBA 3NZ8A 4HWZB 1J0ZA 3GMPB 3QNXB 3HR5A 2UZIH 4ZXBD 5DRXA 4LKXB 5E1AA 1TJGL 5IEHB 3OAYH 4JY5L 3C60B 3QDJB 4ONHB 1ZLWK 5KANG 3H9YA 2NY3C 3QIBA 4JFXB 5E6IC 1JHKH 4POUB 3B43A 1JZ8A 5AG8A 5I16A 1IKFL 1VFAA 4G6KH 5KTEL 5KSBB 4XMKL 4OCSL 5EWIL 2ZUTA 5CD3A 4HIJA 5IK3A 2R1YA 4N90E 3DX8B 5M94B 3N1FC 3S37X 3MCKB 3HMXH 2W59A 4KQ4L 3SKMB 2D9CA 5DVOA 3ZE1E 2W0FA 2YBRB 4GG6F 3O3EB 1CDHA 3L3HB 1I8LA 1TVHA 5D1ZA 2CKBH 4KI5D 3X13A 4GG8B 2YMXH 3SE8H 2EE9A 1NBZB 4UIKH 5FYLL 3QUZD 4XRCB 3VH8A 4XVTL 5I1IH 1WC7B 1T83C 3TO4C 4CADB 4ISVA 5JDSA 3VJ6A 4ODVL 2AERT 1H8NA 3FRPG 1TITA 4JPKL 5E6ID 2JJSC 4PJBA 2GITA 2C5DC 3ZYIA 1A1MB 1WICA 1W72L 3SOBH 3KYNB 4H88L 3CIQA 3CK0H 3CMOH 2BVQB 1BPVA 1CLZH 3ZDYE 4PFEA 4RWYH 3TBYA 3W39A 3L95A 4HLZH 3O4LE 4JLRA 3EDKA 3UTPD 4JFDB 2F15A 1KJ2L 3LEXA 2Y72A 4IRSB 2XI9A 1EBAA 3IDGB 2YOCA 1NPUA 1UB6A 2I9LB 1YNTA 2EYSB 4AMKH 1PZUB 1KJ2H 4ZQKB 2OI9B 1HSAB 1EJOH 4HS6B 3BP4A 3QO0B 3VFMB 1JFQL 1FG9C 1ZHBA 3D0LB 5DHVH 5CD5D 5ITBL 1A1NA 1BWMA 5HDLA 1LO0L 3NTCL 2ICEA 3HZKB 1A6TB 1D7FA 3VFPB 1KTRL 2VC2L 4TTDD 3BQUA 3MFGB 3TIDB 1P7KB 4X0KB 1T03H 1J12A 1F6AB 1JWMB 1UQSA 4NQDB 2DKSA 3BP6B 2VXUH 4UTBH 4APQC 3O8XB 2FO1A 2FBJH 2Q1EA 4X6EB 1MH5A 4J3TA 4HC1H 2QQKL 4R4BA 1BOGB 4FQLH 4XPFL 3ZT7A 2Y5TB 3MCG1 3RWEB 3MJ9A 2NW3A 2C4FU 4PJHB 5H35B 4X6FA 4TULH 5TQ2H 3AB0C 4I0KA 5FF6A 4PJHA 4QTHA 5ESVB 2D4DA 4PJ5E 3TBSA 5AWNL 3TA3D 3WKNA 1R3IH 5E03A 1JHKL 1GSMA 3GJEB 3MLZH 1AGDA 3BW9A 4NBXB 1DBBL 3G08A 4PP1D 2DI8A 4BUGA 4PD4J 1F4YH 4X6CB 3VFRA 5FM5M 1OAUH 5IIEA 4GSDH 2MKWA 3HMXL 4TVPL 1EO7A 3ILQC 1TCMA 3VG0H 3OGOE 4GW4A 2OM5A 5DD0H 2VZOA 2VQ1B 2LE9A 4G80B 4LF3A 1CR9H 3C9NA 4KK5C 3GSRA 5INCB 3UBXA 4X6BB 3V8OA 3PV6B 4ZQKA 3D39B 5CWSA 1AH1A 1CXFA 1OAQL 3HC4H 4Y0GA 4RBPH 4XH2B 1KPRA 3L7EB 5I8KH 3CPLB 3HNTH 4E41B 1KUMA 2LQRA 4DN4H 1A6PA 3QHFH 5AAMA 4I4WB 1BIIA 3AAZA 3RL2B 1UXWA 1PY9A 1TENA 4XC3H 1PKOA 2AKRB 1DLFL 2ZOLB 1N6UA 4PREB 1OTUD 2NTSP 4ZO9A 1NLBL 3BSZH 5J1AB 4OZHE 1DLFH 1G6RH 2G9HA 2KKQA 5JW5A 2ZCLH 4PV8A 2QQQA 1OTSC 1FDLH 4LEOA 1KYOK 4RQQB 2OJZL 4PJ5B 4EUPB 1VEMA 4OZ4A 3H9SA 1IQDB 2R4SL 5F93C 3NA4A 3RTQD 4KV5F 4MHHI 5C0AD 1TIUA 2YXMA 2R9HD 4PREA 5DD6A 2X1PA 1B3JA 1I1FA 4X9BA 3WIFB 1FFOB 3ARYA 4YHYC 5GS2H 3MV9D 4FG6C 1S7TA 4Q9RH 4GRWE 1TJHL 3PHOA 2FECL 2HT2D 4PJ9C 3PXJA 2EDWA 3G6DL 3B9KB 5KVEL 2JF1A 1K2DB 3HZYB 1J18A 1MREL 1S7UB 4M5ZL 1U3ZA 1DQDL 4RSVA 1J8HA 3HCVA 4X8JB 3T0BA 4NQTA 2D9QB 3WV0A 5LVEA 3MRCA 3RWCB 3LPFA 3QFJA 4XP4H 2WK2A 5ILTH 2FX7L 3LH2L 2KQMA 1EBPA 2OTUA 4C4KO 5EC2B 2YR3A 5IQ9A 3RVWD 3V2AR 2Z8SA 4ZD3L 2V7HA 3PG2A 4XC1L 3ARBC 4D9QE 3CC5B 4NNPL 3T04D 4H5SB 2RAMA 3MSPA 3MLRH 3TBSB 4PLJD 1H5BC 4XVSH 4Y5YB 4MAYC 5SWSE 3E6FB 4JKLA 4M03A 5TE6H 3SDAA 4YAQB 3ZKMD 5F7KC 3B8YA 4R96B 4UBDD 3U2SA 4NO2A 3GBNL 5BS0B 2JIXB 1TZIB 3H0TA 1ZSDA 1P4IH 4G7YH 4L3CA 3WUWB 5F7FA 1LO4H 4CVZB 4L3CB 4NQEB 3QULB 5F7EH 3FQRB 5F9AC 4XGZA 1NUGA 4NM4H 4V1DE 3RPKA 2EDTA 3B6SB 3WXVL 3OF6A 5J8OA 1ND0B 3KLAA 4JHZA 2VE6B 2R2HB 2DIBA 3QUYA 5I1DA 3BPLC 3LS5L 4BFIB 1K4DA 3A0OA 2DBLL 5D7IA 5DA4A 4LSPL 5BV7H 4BQCA 3IDMB 2HFFB 3EKCA 5D9SB 4ZTPH 2K3TA 1NC2B 3O0RL 3UJJL 4FQXA 3OG6B 2YD5A 1HQRA 4V2BA 5LGHH 5GRVK 2PXYA 2YZ1A 4XBGA 3KYAA 3GMMA 4Z8FL 4Q74A 5TQ0L 4NHCH 1JNJA 1FZMB 5DUML 1F2QA 1K8IA 5J6GB 1I8IB 3CD4A 4KUCF 3OQ3B 4PB9H 5JOPE 2VIRA 2N1KA 5DUMH 3R8BB 4NQSA 4PYHA 4XRCA 1YNKH 1X7QA 4YH6A 5FUCE 3L3JB 3RA7L 3OGCB 2R1XB 4LPVA 5IEKA 3QQ3A 1U8KA 4L9LA 4DZ8B 3M07A 4K71B 4TSAH 3DETC 4NZDA 3CZJA 2CKBB 1XGPB 3PV7A 3DMMC 4MJ5A 1FFOA 3BWUC 3LEXB 1K85A 1FGVH 4GKNA 4QHUB 1D5IH 2EIZB 4R2GD 3BPLB 4K94C 4QOKD 1OLLA 3DX8A 3GI8L 3TBYB 1QSEE 4HKJB 3CX5K 4HIJB 3IFOA 4PGDB 3EOTH 5DRNA 4JO3L 4JM2D 3O9WB 4HJ0D 4M4RA 3VU2A 1EA9C 4HLZG 2HTLC 4GMTH 3B9VA 3GMNB 1JHLH 1LWRA 4HUUB 3GHEL 4O51B 1ZA3A 3I75B 5IQ7L 3WNOA 4BK5A 2LTQB 2VLRA 4YC2C 3ZDXF 5F9WC 2J8HA 5CEZE 3MLRL 3LQMA 3VXQA 3F5WA 3HE6A 4TUOB 5DRWA 5AEAA 1W72B 3U1SH 1ETZB 1IARB 1P5UA 1LEKA 3DI2B 3X13B 1G7HB 3QWOA 3CFKB 5I0DA 4N68A 3QJHA 4WI7A 4GFTB 3U1SL 4XNYL 3W9EB 3QB7C 2YC1A 3QZWB 2VC2H 5C0GA 2BSSA 3NCFB 2RCSH 3KWWB 1T7ZA 2IBBA 3OAZH 4PG9A 1SBSL 1NCBL 3PV6A 4XXDB 4UTAL 4Z7VB 5JA9A 3DVIA 1UM6L 2NY6C 1VFAB 2EXYD 2YUZA 2DLGA 3B2UC 3B5HA 2C3VA 5IB4A 4LBEB 3MR9A 3B83A 2EXWC 2ZSVB 3HNVH 3P9WB 3RZCD 3DRQB 5F1SA 5F3HA 4XHJC 2FEDC 3MRKB 1U92B 4PJDA 1KEGH 4LCWA 4L8BB 5E8OB 5JW4N 4MCYA 3EDFA 4XCEA 4ZUUA 3TT1H 5J3HD 3DIFB 1FYTB 5CP3A 5L9DL 4FTVB 3MRGA 4I8DA 3QI9C 2ILLA 3LQAL 4Y4KA 5CBAB 4M6NH 5DMKB 4Z78A 5HYJB 3S4SG 1T1ZA 1OAUL 3BE1L 2RHEA 4J6RL 2ATPB 4TVPH 5CJ5A 4LNRB 3A6CH 3NCCB 5JHDB 1HXMB 1T5XA 1NCNA 1R3KB 5HYSB 3DTXB 2Q8AH 3SDAD 1RZIB 4OLVL 1X5JA 4U1GC 4QRRB 3TVMA 4Y5VB 3ME0A 2MQCA 2AK4D 1QO3B 3DV6B 1NSNL 4OLXL 3P9MA 3R06A 2JJWA 4QCIA 1CL7L 3RWHA 1F00I 4C56D 4X4YA 5J13C 3TZVA 3DV6A 2VXTH 2EZ0D 4OZIA 2WBKA 1NGYB 2VLKB 1WAAA 4Y5VC 3BO8B 2P7TA 4R26L 3TBTB 2XIDA 1RZJC 2BVUA 4TYUA 1C5BL 2V5TA 3U83A 1HK6A 4RX4D 5T33H 2A6KB 3A67H 1T89A 4MLIA 4JY6A 1KSRA 5EZOH 1UH4A 5C9JB 4JRYD 2ZUYA 2PETA 3HMWH 3V9FA 4OLZL 2IALB 3EAKA 4H88H 2IANA 4FXKA 4Y7MA 1UYWL 4HZLA 3SDDA 3MYJA 1XIWB 5B8CB 3IDIB 1YEGL 3KPSA 5HI5C 1ZGLP 5E95B 1Q38A 2H3NA 4LARL 3OR7A 4TUJA 4YWGL 4PJDB 3OPZL 1H8SA 3REVB 3BIKB 2GK2A 2XRAH 3RWHB 4X7TA 5DJCB 2OZ4H 2EYTB 5F3HB 1WJ3A 3BGFC 3FFCB 3S34H 1JGVL 4WO4B 5KW9L 1QPXA 5EORH 1JF5A 1CLOL 5HGHB 1LILA 1LE5A 3O2VH 2C3XA 4MD0B 4V1DA 1NBZA 3D0VB 4HEME 1S7XB 2XTJE 3EJZD 3P73B 3MROA 4WU7B 5DEZA 1OOAA 2P24A 4UT9H 5HHOD 1AHWC 1H8OA 5LGKA 4LCWE 2ARWA 2QLVB 4NSKB 3K1DA 3UO1H 1DQDH 3GMRA 2V2TA 3UTSA 2PO6A 4ACPA 4P23A 3ARTA 5HVWA 1IT9H 1IGYA 3MNWA 4NHUA 5LAXB 1TDQA 1EHLL 5D6DA 1YC7A 3ZTJG 1NGPL 4KHTL 3WYRA 3V6FA 5HI3C 3EJZC 1T1WA 2YSSA 4PJHF 1II4E 5HGAA 2VH5L 3ZSSA 1XF2B 2XYCA 3QDJA 1NGPH 4KHTH 4OCNC 4CDHA 3HZVB 2MQ0A 5DWUL 1YPZE 5E1AB 5JHDD 4U33A 4PV9A 4HIXH 4RAVA 1GC1L 5DWUH 4HD9A 1XMWA 1MIEH 3EJYD 3QEQE 5GGTL 5CIPH 4YXKL 5LCVL 3UTSB 4XCYA 4WJ5A 5FB8A 2VDKH 1KNOA 4PGEA 2NY4B 4KXZI 1MAML 5FM8A 4O2FA 2O5XL 4QHNB 5IMMB 3CSYB 5D71H 1INDH 4OB5L 4JVWA 5K9QG 5B39B 1EO8L 2NY3D 1KIQB 3WEXA 5CJ8A 1MOEA 4U6XA 1C5BH 5I15L 2AQ3A 2O5YH 4YHKL 3CK0L 5HYEA 3LN4A 5I15H 4YBLC 3QCTL 4PJXB 1H3TA 1CG9A 5I1EH 4PJEF 4LLYB 5SWSD 1OGAB 3GMMB 4OM1H 4KTDL 4EZMA 3RWDB 1LGVA 4H0IA 3DUSA 4DAGH 2ZCLL 4JRWA 4XI5D 3PP3K 4H1LG 3H9HB 5DS8A 1HSBB 1DUYB 5GRUL 3HZMB 3MRMB 2DQFB 2Z31D 2L7UA 1AQKL 1Q9WB 5JW4R 4KROD 4Q2ZA 5BJTB 4R0LB 4GKSB 5HI3D 2V5SA 2QQLH 1CLOH 5IBTL 3ROOB 1Q0XH 1WBZB 4QRTA 1Q9LA 4QRQB 2BOBB 1OAXL 2DLHA 3TYFB 1G7QA 2ADIA 3DSFL 4K94H 1FL3A 1S7SB 5MEPA 1QSZA 4Z7UB 3MQIA 1YEIL 1YPZB 3D39D 3SJVB 3OF6D 2IFFH 2FEDD 2G60L 1E4XI 1HQRB 2W0LA 1I7ZA 3TZVD 1KPUA 3V0VB 3QEHB 4JPWL 3R8QA 4TPRH 4L1DA 1HYRC 4OZFG 3SDAB 1T0PB 2DQHL 1YEFH 1WWAX 2V17H 2ESVD 2Y7QB 4NM8H 5B38A 5FYJL 1I9RL 5DHVB 1MI5D 2JJVA 3O3BA 1ZS8A 2R0LL 1YEFL 1A6UL 4JQXA 5KSVA 5FYJH 5GS2D 4RBPK 3HG1E 4XGZB 1V3KA 1IGCH 2BFVL 5JOFB 4L8SC 4ZUUB 4ETQA 3CH8A 4EXKA 3HE6D 1A4KB 3WNLA 4XNZC 4LPXA 4G7VL 4PJCE 3VFWB 2EC8A 2R1WA 4MLSA 4JFHD 4EOWL 4ZFOL 3R1GH 2ZKHL 1FJ1A 1JPST 3CLFH 1FGNH 3GIZH 5FOJA 4YHIB 5IROC 1IEBA 5DJ6A 1F2XK 3GBNH 1PZ5B 4CMMA 5ID1B 4WTXA 1RZJL 2NY7L 5AUMB 2HAZA 4OFYD 4EKXA 4QRRE 5BQ7A 5D71L 5A2KH 3KJ6H 2J4WH 2GW5A 3UBXI 1QRNE 1P1ZA 3BGAA 4YHNB 5B21A 1ORSB 2NZ9C 4UAOB 2D7OA 1QNZL 4EVNA 1P53A 3FQNA 4PJAE 3T2OA 1MJJA 3HC3H 4JHWH 2B1AL 2I07A 2V2XA 1CS6A 1MCIA 4TRPH 1DE4B 1QHPA 4FS0A 1A8JH 3CFKA 5ACZB 1RUAL 4KGJA 3IXTA 2A77H 4OM1L 1C5DA 2DJSA 2GYSA 2NY1D 3QG7L 3DJ9A 3WHE1 4J1UA 3TT1L 3FQWB 5I1JH 3TO4B 3PL6C 3K4ZA 3S36X 3FT4B 4Z7WB 1RQ5A 2W9DL 1J05A 5JNYA 4X6DA 4GH7B 1YJDL 5GGSY 1G7LB 4YC2B 3UC0L 5FUOL 1G7PA 4RGNB 4PJDE 1QEWA 2FIKB 1KJ2A 5HYJE 2OP4L 3QDMB 1P2CA 3CFDB 3MUGB 4HKJA 4K3HA 1HQ4A 5FA4B 1JYNA 3BPOC 2ADFL 2BVEA 2YEZA 3MLSL 1KXQE 2VXSL 1C5CH 1BMGA 4WEBL 5HDBF 2RR3A 5L0QB 5B3JE 2XQBH 1N64H 1OW0A 4FFWD 4WHYH 2YRLA 3MBEC 3VFOA 4NDMB 2HH0H 1G7PB 4LIQH 1M7IA 3VXPA 3ULUC 4HV8B 4RIRB 2Y5EA 4NZRL 3AS1A 5FYJU 1ODAA 3A67L 1J05B 2YD6A 4OQTA 2AEPH 4L3ED 1GGIH 3SOBL 4Q6YA 4M9OA 1NGXA 4LK4A 1YUHA 2FSEA 1MRDH 3I3BA 4ZS7L 3JTSB 4LSQH 2DWEB 5D2LA 4HK3J 4OLEA 4NNPH 4JRXA 3VRIB 4CNIB 1QSFB 2HJFB 4J3VA 2IQ9H 2BC4A 4QRPE 3STLB 3MV9B 3JXAA 1JGLH 4AMKL 1MJJB 4U1IA 1JN6A 1JWUB 4HK0B 5FUCC 3U46B 2HKFH 4HIEB 1QLEH 4NT6B 4J7RA 5EOQH 3TJEH 4KI5E 1G0DA 2A6JA 5C0RL 1UB5A 5ACLA 2O5ZH 4HX1A 3BZEB 4UBDC 1UVQA 2AJZA 2VE6A 3GHBL 1KENH 3N50A 1JGVH 4QY8A 1CU4L 3FHAA 2OR9L 2Z35B 1JRHI 5GRZA 3W9DA 5I1KH 4O9HH 2CGRL 2KZWA 4PJAA 5T1MB 4DVRH 4GW4B 4MZ2A 5IUSA 1FNLA 1NAMA 3ALPA 3AREB 2XN9D 4NCC2 2B2XL 1A9EB 1Z5LB 2R56L 3OKMA 1NLDL 5HTSA 2J88H 3TCLA 4MA7L 4KZDH 3F8UB 3W81A 1D5ZB 1YMMD 1A6ZB 2BOCB 3GRWH 4EQ2A 5IHZB 4HT1L 4K7PX 1QFHA 3VRLE 1ZSDB 4Z7NF 5TPWH 1TPXC 4NN5B 1CFNA 1ZT1B 5F70A 4NJ9H 3BN3B 5ESVA 1I7RB 4Q2ZB 4FQHA 3VFMA 3IXAA 4IMLA 3D9AH 5GPRA 3BP4B 3QBTB 1JMXA 1PG7W 2JJUA 4O2CB 1Q9WA 3WLWC 3O0RH 5ENWB 2XWTA 2P47B 5I75C 4JFOB 4PJ9D 3FOMB 1HHHB 4OF0A 3JV6B 4FG6D 4WUKL 3QUMB 2FECI 4HIXL 3P0GB 3BP6A 4DUWA 4RNRB 1A14H 1ONQB 2Y06L 2ADIB 5EB9A 3H3PL 1JP5A 2K7QA 5TH2A 3RWGA 3D3VE 2J8UF 3OKDB 1DBJH 4RDQF 4YHOH 1RK0B 3ESVF 3QUXB 1MAMH 3STZA 3BWAB 4IRZL 1YN6B 2D0GA 3AC0A 5B39A 1F13A 3T4YA 4WEMB 2J8UE 4LVNB 3EIFA 4GS7C 4OZGA 4Q58C 1NBVH 3JV4A 4EI5C 1A7NL 3IJSB 3V6OC 1UKQA 1WCQA 2XZCH 2CR3A 4BUHA 3SGEI 1CDBA 4ODXA 3T09A 4M5YL 2EDQA 1PY4A 4M1DH 3L3OA 2QJDA 3GO1H 4FQIL 3GHEH 5JHDE 2BY2A 5IHUL 1IQDA 2B8OT 2V5RA 2XKUA 1CVRA 1GXEA 5INDA 2VDQL 3V4UH 1MHEA 2XICA 1DANT 3DVNB 5GS1C 2WMPA 1VFBA 2GTWB 2ZOKA 1AQKH 5C71A 2VKWA 3H2WA 3SGKC 3QNXA 4DQOL 3MV01 4HKBA 5HHMB 4PJEB 5GS0L 1DBML 1A7QH 2AKRA 1C7TA 2N56A 4HF5L 1HNFA 1UZ8B 4G6FB 5IW6B 1INEH 1T6VN 1SBSH 5JUEL 4RGOL 5IWLA 2NY2C 5C0CD 3MRPB 2P8LA 1YNLL 3IJHB 5HJ3A 3P73A 4BZ1L 3W2DH 4M5ZH 1F3DJ 5HHOA 2XOTA 4EDWL 1A4JA 1BX2B 1U8MB 4UT9L 2CLZB 1ZE3C 5E6IB 4KI1A 2XG4A 4O5LL 3M8OH 4NNXB 3I2CH 1DR9A 1J1PH 2VL5B 4CL7A 1YN7B 1A0QL 3QIWB 5IOPA 3IAGC 5DQ9B 3W11D 1EFXA 3CFIC 3KYMA 4APQD 4B50A 1VACB 4K7PL 3LEYH 4OFIA 3QR2A 5JLZB 3HS0A 2NY1B 3C09C 3P4OB 4M6NL 4XWOD 4LVOC 5DVKA 3CMOL 1LP9A 3MV9E 3OHXA 4ZFGL 4AM0A 1D5XA 4Z5RB 2Q6WA 3X3GH 1K4CA 5LBSH 3U7YH 3GZKA 3ARED 1G9ML 4B0MM 5FKPA 2Y5TA 3X11A 3P0YL 4GAYA 4JDZA 4JKKA 1WZMA 3KPPB 4HWBH 5DMYA 1A7OL 1HWHB 1I7ZB 4OLXH 2PYFA 3KPLA 3G6JF 2ICWI 3WFEH 3ZT5A 4OCYL 4C4KT 1I9IH 3RZCA 1BD2B 3T77A 3WFEL 4MA1B 5GS1B 1FZJB 4Y5VA 1MCOL 3VXUB 1QLFA 4FMFA 1MF2H 1ADQA 3AS2A 5D7LD 2H2SD 1ACYL 4C55A 3RIAF 1R0AL 5ETUA 1A1NB 1ADQH 2EXWD 5FXCH 4LLWB 3VGAC 5B3NA 3MNVB 3CCHB 4OGXL 5EOTA 2VDRH 2G75A 2Z0BA 5CILL 1GIGH 5DJAB 4ZTPL 1ADQL 1KF9B 1CD8A 1WZLA 4BFEA 4UV4L 4XCFH 1OTUC 1FPTL 3TT3H 3VGFA 2H9GB 5TQ0H 1OWRM 1WISA 2XRAL 3NA9L 5FYLD 4PJFB 4YK4B 3T0AA 3DO3A 4MD5B 2R4SH 4U6HB 3WHXA 4PP2A 2AK4A 2CJUL 3PL6B 3QXUA 3RTQA 2P44B 2YN3A 4XWGH 3LVEA 3C5ZB 1JZ7A 3T0EC 2ZG1A 4RMUA 4JFED 1EEZA 3DGGA 5IBTH 1LO5B 1AD9A 2BNQE 5IF0A 5GGVY 1T5XB 1UKSA 1L6ZA 3QJFA 3AU1A 4RX4A 3OXRB 1FVEA 3AXLA 4MDJB 3NIFE 4GG8A 2W92A 5D93B 2Q6WB 2WSKA 4I77H 5KSBF 2I9TA 3ULVE 2XPGB 4CW1B 4Z7WF 2GUOA 5I19L 2PO6C 3C09B 3SN6N 4AT6B 4OZGE 1K9TA 3RY4A 1D6VL 4MXVE 3BN9D 3LZFH 4KFZC 5TE4L 5IK3B 4M48L 1SJVA 5I19H 4J8RA 3I9GL 2WZPD 5GSRA 5F1NA 5ICYB 2ESVA 3IETA 3MRBA 5D7SH 5C09A 4M48H 1J0HA 3SQBA 1XF4B 2ZUQC 3OZ9H 4UB0H 2Y6SD 5CD5C 3IAQA 1G9NC 1V3JA 2MWCA 3CXDL 5J6HB 1D9KB 4XVSL 3U0PA 2DM2A 4KMQA 2AJYL 3RUGA 4UQ2B 2WWMD 5EC1A 3GMPA 3VFUA 4HWEH 5TE6L 4Z7VA 1CIDA 4DKAA 2YK1H 1G9NL 3FT3A 3PUCA 2Q7YA 4E42B 3MRPA 2B0SH 1O0VA 4PGCB 1YA5A 2AJUH 2ZKHH 3PWJA 2CK0L 4JZJB 3O6KH 5SV3A 3ELAT 4Z7NE 3U7WH 4M7KL 1QFPA 1BQLL 1CFTA 4OV5B 4DN3L 1CGSH 2NY4D 3RKDD 3T3MF 1WFUA 1TZGL 2YPLB 4PJ8D 2DJ4A 5C3TA 4EI5D 3L5XH 4JGMA 1GCFA 3ARFB 1MCOH 2XNAB 4Y2DD 3VE0B 3VXRB 2QKIA 3H9SD 2A74A 2X4TA 2D0HA 4WIQA 5E5RB 4MA3B 5E4EB 5FIEA 4ZOCA 4CU8A 3HUJA 1HYSC 1RU9L 5IM7A 4TVPD 1I7UB 3MFFB 3D9AL 3FB8A 4X7SL 2PTTB 4X7TB 1I1AA 5DJCA 1BBJB 4K8RC 1U8LA 4NN6B 5E1HB 3MC0A 2F58H 4EXPX 2EIZA 4LHUA 3LHPL 5A40E 3WNPA 4S1QL 1AY1H 5E99H 5TE7H 2P8PB 3N1QC 4Y4HD 1J11A 4Y5XB 1K4DB 1MRCL 4LCCC 1X5YA 1N3NA 4LLMB 3DUHA 4PB9L 3SE3A 5HHME 1V7ML 4EN3B 1ORQB 4CVXB 1DBJL 4MQXC 3RI5F 4GRLA 3WD5H 1P7QA 2BVPB 4MAYD 4NKOA 1FZOA 1A6AB 1WZ1H 3A6OA 5GIRA 3EOAB 4D0CB 4OD1L 4XNQB 3WNMA 3D69A 4GBXC 1DQQB 2ORBL 2XACC 2VDLL 1XR8A 5I8CB 1I8IA 2IFFL 4WFHD 5FA3B 1F4WL 3BDYH 2Q7NA 1I1AD 5F7HA 4PUBH 1WVZA 2D7NA 3OKEA 1T3FA 1MCSA 1HHKB 2DTML 3JV6A 1FORL 1CD9B 3TC9A 5KS9E 4WWID 1GGCH 3OB0H 1SHMA 3PDOA 5L88L 2HFFA 2FX9L 4M7LL 5FYJE 2ZJSH 4JDVB 3HMXA 4KKBC 1UYWH 4RZCA 5C0DB 1J86A 3IF1A 4G42A 4ZS7H 1R24B 3QRGL 1YY9C 5JW4M 2BFVH 5T3XE 3GK8L 2CMRL 5GGSA 4LQFH 4JQVA 4J4PD 5DJ2B 4L8SA 2IADB 4MAYA 2V7HB 4U2YA 3GK8H 3P4OA 5F8QC 1J8KA 5IB5A 4OCRH 4ZUTA 2DYPB 4GLRI 5DK3A 4HWEL 2WV3A 3BT2H 2GKIA 2HMIC 4NZUL 1KEMH 5C2BL 2O5ZL 2VLKD 3QH3A 3S4SA 2WQRA 2FJFA 2CLRA 2E9IA 1DZBA 3MRQA 4K3EL 1AP2B 1XZ0B 2IAMB 4PRAA 4QHKJ 1BQHB 4RGOH 1DBAL 4QWWC 3KJ6L 4L4JA 4WFEE 2W0KA 4R96A 4GAFB 3V4PH 4R97B 1MCDA 3I6LE 1LDPL 4QY8B 5FKPB 1E4XL 1SBBA 4NUJB 1PDKA 3VXMD 1NFDB 3KWWA 3I3EA 1G7MB 4GW1A 4S1DC 3EFDL 3V4VL 4MNQE 4UI2A 2GFBA 3MO1A 4GAJL 4U1IB 3OHXB 2AXGB 5CUSH 3SDDD 2VXQL 3HI1A 3K1KC 2WBJD 3S35X 1AFVH 4ZS6D 3H7BA 4OUOA 2UZIL 5IQ9B 3ZKXB 5BXFB 4R6UA 5TFSL 2R4RL 2VLJD 3ARDB 3QIUC 1WT5C 5DRWB 4OZIE 2NYYC 4W6XB 4JO3H 4NYLA 5CJQH 1T7WA 1ZK9A 3PQYB 3OAUL 4HPYH 2BCKA 1S9YB 5KJRL 5DGQA 4ZNEA 2NY6D 2NXYD 4ZUSA 4HUUA 1BX2A 4Y19B 4Y4HA 2ITCB 1DEDA 1N2RA 2N4IA 3ULUL 3IDJB 4OLUH 3BUTA 3C5SB 4R3SA 3TFKD 5JW4Q 3H3PH 5C0JB 1NFIB 3MGTA 5LKNA 3ULUF 1H0DA 3ZE0E 5F8RC 1S78C 3BP5A 1ZGLA 2J8UB 2LAAA 3DX6B 1MCQA 1HZHH 5C0JA 2DMKA 1CXKA 4TOYL 1LDSA 4ODUB 4YZFE 1VSCA 3PWLB 3RU8L 4JRXE 3MV7A 4PUBL 4Z6AT 5D70L 3L3JA 1JF6A 1MHHB 2NY0B 4FFZL 4I3GA 1TMCB 4P57B 3DX7B 4LAQL 3N1GC 3L5HA 1FORH 3CXHK 1ERNA 4HG4K 1MWAA 4KKBD 4DGVL 4ZYKB 2BCKB 3JWOL 4KVNH 4JDTH 1G6VK 2GSGB 2WWKO 3C6SB 3O2WL 4GKOA 4X7CC 1WWWX 5JW5B 3MXVL 3FQUB 2VDRL 2G9HB 2DL2A 3HTLX 2IG2H 1N5YH 1I3UA 3KYKL 5E6ZA 4DAGL 4LCYA 5ACZA 2CMRH 1S78D 4D9RE 2BNRE 3O81A 1FPTH 4ZOEA 1JWSA 2HKFL 4QXUL 3HE6C 4LCCB 1U8HA 1RI8A 3BPCB 5A2LH 4PYGA 1AQDA 2DQUL 5L9DH 1CU4H 1OB1A 4QXWA 2C1PB 4YJZL 4Y1AB 3QDAA 4ZAKA 1IGFL 5EBMA 2W65A 4UQ3B 3TIEB 1NKRA 5EO1A 3BE1H 5HD8C 5EUOB 5BVJA 2ITDA 4KQ4H 4M3KB 1X4YA 4JFQA 5C6TH 2EDJA 4P4KC 1S7RA 3C5JB 2Q8AL 3BZFA 1YNLH 4JB9L 1KCSH 3KR3H 1MY5A 3OKMB 2IBGA 1TCRA 3CDFA 4GRMA 5E5UB 4JKWA 1UM5L 1QYGH 4MXQD 4K8RD 5CLTA 5HPMA 1MRFH 3IFNL 4LFHG 2NX5B 4IJ3B 4LMQI 2BHUA 1T2XA 2Q8BH 3DV4A 5DJ2A 1RJCA 3PGDB 3BAEL 5GGSB 1RHHA 4WHDA 2R0LH 4H20H 4PBVC 1R24A 2AABH 4N9GB 4KPHH 3VXOA 4Y4FB 2Y7QA 5H35A 5D1XD 1I7RA 4PJ7E 2VLME 5FK9B 2I9LA 4HIEA 3IFPB 5JPNA 1TJIH 1MLBB 5F7YC 4R4BB 1IC7L 4UUJB 3SGJC 4AQOA 1NGWB 5BO1H 3SDXE 4QYOA 3CXHJ 4JY4B 2D7TH 4ELKA 1J10A 5L2KE 4LPUA 2FHCA 1TCRB 2L4OA 1EGJA 1GC1H 3GIZL 1NEZA 1Y6MR 5DFWH 2FJGB 3HNSL 1N0LA 2VQUA 5AD0A 1RZJH 3S8WA 1JPTL 3BKJL 4CADA 2JKXA 4OF5A 4JR9H 1R5IB 1KLUA 1TVDA 4KJPC 1HH6B 1A7OH 2V5YA 5I9QB 4HFWA 4OLYH 4ZFOB 1KCVH 5GGUB 1QRKA 5DLML 4KRNA 1MNUH 4ZAKB 5FGSA 4KRPB 3KPSD 4KK8C 5D70H 2NY0C 3GSVA 3CVHB 4EI5A 3PWLA 5D2LE 4FFVC 1J1OH 4HQQL 5CSZB 4YXHL 1GGUA 4DK3A 3E0GA 3JWOH 1S8DB 1JK8A 4LOUD 3NPZB 4P46C 3MJ6A 5C0FA 1BFSA 5KSUB 4PRPE 3SGDI 3KPRE 1E27A 4IDLA 3QCTH 3W39B 1ZHKB 2A2QT 4LSSL 1U8LB 2XKSA 4UOW1 5D2NA 4LSSH 3FO2B 3VJ6B 2J8OA 2R29L 5D5MB 1FL6A 3TT3L 5IVXB 1R3IL 5DJ0A 3W5MA 5F1IB 2OP4H 4Q6IC 4EDXB 2JCCE 2E7BA 2ZZUT 5IFAH 4HKZB 1J1XL 2A6DB 1MFAL 5DK0B 3S96B 3JTTA 4ZUWB 4CN1A 1D5MA 1PAMA 2DTSA 1INQB 5MI0C 4RRPG 4Q0XL 3O3EA 2CO7B 2V2XB 3WFHA 4PJGA 2ZUSA 4GSDL 1PD6A 4S0TD 5HVGB 5I18L 2YEZB 3RGVD 1XF5A 3QP3A 5LCVH 4CMHC 2H6PA 1KPRB 3VXUE 1U58B 2P45B 3ZYJA 4JAMB 3BKCH 4ALAL 1RZ8A 1EX0A 4GKZA 3WHE0 1BFVL 4BH7B 1YEIH 1KJMB 4ONGH 2C7UA 2XZAL 2MPAH 2O93L 1ZVHA 3GSNL 2Q8BL 1CICA 4CVWA 4N5UA 4KKNA 3OBAA 5D1XB 4XZUA 2VWEC 5FYLH 4D8PB 4H1LH 6CGTA 3NCJL 5IMKB 1W0WA 2ZSWA 1I9RH 2IQ9L 5FCUL 5KN5A 3TN0B 1MEXL 4WUUD 5C0BE 1P69B 3MNWB 4NHUB 5LAXA 4MCZA 3T0EE 1G6RL 5GRVL 1FNGA 3HG1B 1RJYA 2BNUB 4MAYB 3TBWA 3VFVB 1I8MB 3NMEA 4WDIA 1ITCA 3RL1B 2I9TB 5L8KB 1YECL 1FNEA 1GL4B 1QFWL 2LU3A 2Z91B 5ADPL 2YXFA 3D0VA 4N0UE 1LQSR 2F53B 4N5EC 4RRPA 4XB7A 3AU1B 4JR9L 3UTQB 2XKNB 4WHTA 3TO2B 4RISL 4JFPA 1D5BB 4LGPB 2NY7H 2J88L 4CN6A 2EIDA 2DM3A 3O8XA 4Z7UE 5DFTA 4LGSB 4X99B 4JKMA 3GJFB 4MXWH 3SCMD 4PJFA 4KKCD 2H3NB 4KKAC 5CUSL 4P2RB 4OGXH 1AGEB 3HE7B 4K23H 4FQ2L 1RIUH 2FBJL 5BRZD 1MWAH 1ZHBB 3D0LA 1TFHA 4HC1L 2UWEB 4NNYB 1I3RA 5E0QA 1QFOA 4FQ2H 5TDOB 3WS6C 5EUKB 3GI9L 5EOTB 5CCKH 2XWBA 1FYTD 5ILTL 3FFDA 3RWFA 3OXSA 5E2UH 3NA9H 1AD0A 4Q9CA 4GXVL 4PRBA 5DR5H 3ZTJH 3DUSB 2P7TB 5IFAL 2CJUH 4WW1A 4S1QH 1RULH 5DR5L 3ZE0F 3I02A 2Y07H 3MJGX 3PWNA 3VA2C 2J3SA 2VB5A 2VZVA 4YBLB 2DDQL 3ARGC 2ADFH 4IRZH 1RZIA 5C0BB 5JPMB 3EOAA 3O4OB 3PIQA 1RZ7L 3BMWA 3KLDA 4J3WA 4D3CL 5CZVL 4HUXB 3QDME 1FN4A 5HDQH 3VE0A 1NFDE 4NQXB 5EPMA 4F57L 4WW2B 1S9XA 1AE6H 3AM8A 4FFZH 4NWUL 2VLRD 1DVFA 2QQNL 3H8NA 4EN3D 3FONB 2W9LA 1OT1A 4JZNB 4AM0B 3U4EB 4P5KA 2NR6C 4S1RH 3RWIA 1CFTB 3C8KB 4M1CD 5CKAA 5FO7A 3I3DA 4H26B 3I9GH 2I5YH 4HUMB 4YBHA 1OVZA 1IC1A 1B4RA 3T08A 4G6AD 3RNQB 3G9AB 3RVUC 5DZOA 4EBQH 1JHLL 3KYKH 4L9DA 3KPSE 2CRYA 4YPGB 3CZFB 4PY7B 3V4UL 1NCDH 5L2KA 4NC1E 3KXFD 3PDDA 2P43B 1UJ3C 3OG4B 2ZSVA 2F8VA 5DA0B 5E2TL 2AJYH 3LPGA 4BZYA 1NBYB 3C5ZD 5GJSH 2DQGH 4CKVX 4FOMA 2R39A 4KUZL 5D72L 3ARFC 4EUPG 2UVFA 4RGMC 4ZFFA 3CSBA 3NZ8B 4HWZA 1KENL 3DURB 4KY1L 1KT2B 5T5NF 1KEML 4CMHB 2DIAA 3KPOB 5ACMA 5C0NC 5DFVC 1BZ7A 5MHSD 5FO7B 5CAYB 2ENSA 4NQVB 3PWPA 2Q76B 5E9DE 2EEAA 1OAYH 1CFQA 3UTPE 2Q7YB 2IBZX 5ALBL 1A3RL 1LP9F 1Z6JT 1RD6A 3O41B 3RA7H 3GEWB 1CFVH 1HH9A 3E1F1 1BOYA 1W0YT 4YXLH 1FSKB 3UTTA 3MLVL 1FL6B 4I3RH 4QF1B 4P5TC 1ZA3B 3I75A 4IRJB 1D9KD 3C5ZC 3WDIA 1RJZB 1J0YA 3JUYA 3GI9H 3BKYL 3PL6A 3C60D 2X4PA 3OB0K 5F9OL 4L4TD 5L8JB 4KAQL 3FQTA 4OZHB 5BMFL 3BKYH 1IC7H 5L7XL 3PGCB 3LEVH 4QHUA 3TH4T 4UILL 5C0CE 1EUTA 5T1KB 3TGXA 3U7YL 3OXSB 5BMFH 4XVJL 2BMKB 4RMVA 5KG9A 4J6RH 5JIKA 2IALA 3GBML 5KVDL 1CGWA 2UWEE 4H0HB 4OIIL 3NCBB 3UPCA 5H94A 4YEFA 4HWBL 4HUWB 3BXNB 4OLUL 1I7TB 2GK0A 4FNLL 4HFWB 1B6DA 3ULSB 5C0EA 2BNRA 5K9OA 4OUUA 3MOAL 4GBXA 1EEZB 5E94B 2JK5A 4BH8B 4JREC 2UV3A 4FFWC 4XP6L 5KZCD 1T4KA 2ADJB 1Z0MA 1P4IL 1EFXD 3C2AH 2DRUA 4LPWA 2HA1A 2P5WA 5EBLA 4ELKB 2EKJA 1Q94B 2CDEB 3CSPA 1A7BA 3MLUL 4M7LH 4N1CA 1N0XL 1DDHA 1NGWA 1IFHH 5CILH 3L7FB 3KPQB 3IDMA 4NRYA 5TPWL 3QRGH 1JNNH 1WTLA 5IG7B 2DQDH 1IFHL 1RHFA 1U8QA 3H9SE 3MGOB 5IV2A 3BEWA 4JG0L 3IAPA 3GSNB 1U93B 4U1SA 4Z78B 3MBED 2DQDL 4OLWL 2GJ6D 3VFVA 1AGEA 1HEZB 3HE7A 2DBLH 1ZLUH 4DEPB 1CD1A 4D94A 2NY1C 5DO2C 4BZ2L 4JJ5B 3VFWA 3C60C 3BJLA 4P2OD 4YBQC 1P4LB 3Q6GH 5DMIL 4AEFA 1IGFH 4LKCB 3B9KD 4FABL 3SCMC 3NCYP 1TTGA 3V4PL 2ZP0T 5DJDA 4JFPB 2IMNA 5EUOA 3WLBA 3Q6GL 4PJAB 3I50H 4XVUD 4UQ3A 2X4QA 3L6FB 4JM2A 1CDUA 4KRMB 1RUML 4M02A 3W2DL 1EEYB 5F7NC 4GAJH 3UO1L 4OAWB 5I71B 4W68A 3BP7A 3AS0A 1ZWIA 4MQSB 1WZKA 5C0GB 4XVTH 4X6DE 4NQVA 3I2CL 5TE4H 4NC1C 3UTTD 4R90H 5K59F 4LCIH 1OD9A 3JVGC 1QSFA 4Z95L 3HG1A 1W72H 4TSCL 1VACA 5C0ND 4R90L 4L3EB 2YPLE 5MENA 2EYRA 5J1SC 2YWYA 1U36A 4OFDA 5SV4A 2DLFH 2X1QA 5F72S 4APQB 5KBNC 4LRNL 2GSGA 2NXYC 1I4FB 4G8IA 2MTPA 3WN5C 3BVNA 4Q6IB 4W81A 3IKCA 3QIWD 3VGDA 3VMOA 3O45A 3DBXA 1A4JB 5CBEA 4OCWL 3WFCL 1FYHB 4KDTC 4OIIH 1BEYH 3DYMA 3FMGH 4PY7A 3OPZH 1MUJB 5IFHL 3HUJF 3O9WC 4PG9B 3CVHL 1U3HD 3LRHA 2X41A 4DN3H 1NGQL 4F7MB 2VLLA 3FAWA 3OL2A 4AG4L 4WGVB 5C0CB 3X17A 3KPTA 2OJEA 2DQJL 4M7LT 1IAMA 4KC3B 5H2BB 4NQXA 5DJYB 4CJ1A 2A6DA 1NCBH 4HLJA 4YBQD 1R0AH 2EXYC 4HHAB 1UM6H 1EV2E 2DIJA 2OK0L 1B0GA 4P2CG 5EIVA 4G8GB 1IC4L 1GIGL 5IR1B 5J1AA 1ONQA 4Y19D 5BXFA 3K8KA 4R0LC 3IU3A 3QXAA 1UM4H 4WW1B 4PY8J 1KN4H 4PRBB 2BRQA 3G6JE 4M1GH 4RFNC 1XGPA 3PNWB 4Z0XA 3TEUA 4I3SL 4YDIL 1IKFH 5KTEH 4WV1B 4ZAKC 5INCA 3WFDH 1NL0L 1S9VA 4U6YB 3TYGL 2WW8A 4QRPD 1KXVC 3X3GL 3STZB 4NQEE 4LHQB 2VDLH 2Z31C 5JO5B 3RY5A 3R4DA 1AXSB 1FBIL 4XP1H 3SDCD 2XWJA 4P4KA 4PJ7B 3SO3C 1YMMA 1I1YA 2X9XA 3QUXD 3MUY1 2FJGA 3FO1A 5C3LD 5SWQB 3JWDL 4KHXL 2DTMH 3UJTL 1K5NA 3IVKB 1Y0LA 2PXYB 1N7MH 2APFA 4F7EA 5GRXG 3JWDH 3GSUB 1MJ7L 3FO0H 4H20L 3RVVD 2IADA 1FLTX 5I1IL 5ERWB 5SWZD 4EBQL 1MLCB 4HS8L 1NDGB 5TJWK 4DUXA 2W60A 2BY0A 3LV3A 4JPKH 3I6LD 3ZMRA 1N8ZB 4OFKA 3MACL 4IMLB 5E9DD 3F12B 4HS3A 3SKJL 5HYQB 3OSKA 4JCMA 4L5FH 1ND0A 3RL1A 1QFUH 1UA6L 3HI6H 1KB9K 2D7QA 3V0VA 3BPCA 5J11C 4H5SA 1XGUA 2F53D 4YIQB 1G7IB 5D72H 4FQCH 3QDMD 5SWQA 1T80A 2IWGA 1CK0L 5DZNA 1IC5H 5IMKA 4G6FD 3STBA 5DLMH 1SY6L 1CK0H 1YYLL 1XCQB 2WUBH 4BKLB 3S34L 5IKCA 4NO2B 1YPZF 4ZO7A 5DEFB 4URTB 3G6AA 4NBZB 5EU6A 3AY4C 1JTTA 3RHWK 1CFVL 3MV7B 4M4PA 4HX1B 4EJ1C 3ZKQD 2Y4SA 5F21B 4FN0A 2VXQH 1F4XH 4RFNB 3QDHA 3QISA 3QXDB 5DS8B 2VLLB 1CXIA 1CDGA 1ZLWH 2VDPH 2AI0L 2A77L 3DECA 4FQLL 1QRNB 1MWAL 3P30H 4HDIB 4TNVK 4IRJC 4WWKB 2X70B 4Y19A 3MFFA 4K55A 5SX4H 3RBGA 4PRNB 5E56A 1YJDH 1J8HB 3IYLW 1ZTXL 1VENA 4X6DB 1MCPL 5E2UL 3H3BC 4RIRA 2X4OB 1LD9B 4JANA 1FC2D 4J1UB 1YMME 5B8CC 4WI8A 1FG2B 5FHBL 3EFFA 5DQJB 3MYZA 3L3HA 3MLSH 4P48A 5CEXB 1F4YL 4CBPA 4ZSOE 1RK1B 3DX6A 1I1RA 3N1MC 3F7PC 2AJXL 2EO1A 4JM4H 1BIIB 3B9DA 5DMGD 2YD2A 3EOBB 4IEFB 3SDCA 4PIRF 4ONGL 4XH2A 5D7KD 3V95A 4E42A 5I2IB 2QEJA 3U7WL 3CVHA 4EI5B 2DWDA 1G1CA 5BZDA 5EZLA 1DVFD 3EYUH 1DSFL 1T04A 2CDFA 3GB7B 4UOJA 4RQQA 5J13B 4IOIB 2CUIA 2PW1A 3EYUL 5CMAB 5BCAA 2EH7L 5JDJA 1BQHA 5ANMA 5FCUH 5KVGL 5FGCE 5IIEB 2EECA 2CR6A 3VFRB 4ZAKD 1CLYL 2HFEA 3T3PE 1X9QA 5DDHB 2VITA 1CE6A 3PHQA 5F1NB 3Q6FA 1MHCB 3MRFB 4M93B 5GSVA 2GY5A 4OI8A 3GFUA 4ENEC 2PO6B 3RVTC 5I1EL 1VDGA 2BP3A 1RZKH 1T21B 3EJYC 5K9KA 2GJ6A 3S37L 4FA8A 1XGRA 2X4RB 5KSVB 5MEOB 1NUNB 2VZTA 3O3BB 2PYED 4L3AA 3JWDC 4AZ8A 5FF6B 5EU5A 5I8OL 4WUUB 4P2RE 1A7RH 4WNQB 5I8OH 2XTJB 3KPQA 3A6BH 3L6FA 2X10A 2BJMH 3QJFB 4MD4B 3U0WL 1I3GH 3TN0C 1DDHB 1JRHL 1KPUB 4LCWD 1L7TH 1FFNA 5I76A 4PJCB 4ZPVB 3KS0H 1T3FB 4PGZA 3U0WH 3MMEA 5CGYC 4OIAA 3U9UA 2AEWA 2ED8A 2V7NA 3FO1B 4G5ZH 1ZT4A 2ERJB 4MZ3A 2VDOH 1AGDB 4JZOA 1UADC 5E2JA 3G6DH 4NC2B 2IFGA 4DVBA 4XNQA 2NMSA 5JO5A 4H25B 1GJIA 3OJ2C 1FO0A 1AFVL 2AABL 5JZ7D 1P7QB 3V0AC 2W65B 1U3JA 3FOLB 4HBCH 5CCKL 4JRYB 2VR4A 3G6JA 2PYEA 4HS6A 1ZLVK 2C1PA 4JPWH 3HE7D 4NPYA 3GGWA 4LSQL 2DQIH 3RDTD 1DFBL 4B5EA 3V5HA 1FAIL 1WFTA 3W0WD 3MV8B 1QLRA 3MV8D 1QTYT 1REIA 2Y06H 1NCWH 1A6UH 3RDTB 4XWOC 5E6YA 1QG3A 4JVUA 1OSPH 3MJ7A 5E24E 1FQ9C 4I0CC 1BD2A 3QWRA 2GITB 2J6EA 2SEBA 1P7KA 2X1WL 2GCYB 2NLJB 1MIML 1TVBA 8CGTA 3KPLB 1NGQH 1CF8H 4WCYL 1KIUA 5HYSA 5IVXE 4U6XB 2BVPA 4K3EH 3UTZA 4ZO8A 3HKFA 4EN3A 1DBAH 4K07A 2NQCA 2HVJA 1B90A 3LQAC 4XMLL 1QA9B 3BGMB 3UPRA 3KJ4B 4GUPA 2VLMD 5EOCL 4D9QD 5D1ZB 5DSCA 2FEEI 1JTOA 2CIIB 5EU6D 4WY7H 5I17A 4YHZL 4LLQB 2BNQD 4HIHB 4XCYB 4NM4L 3QEUA 3RIAK 1XCTB 2X44D 4KJWC 4NJ9L 3K80A 2HN7A 3SPVB 2DM4A 3G5VB 4L1HA 3MRKA 4AIOA 5IVZA 4PJIB 2R29H 4PV9B 1IGJB 1L6XA 1NC4A 3F58H 3B3IB 4IMKA 5I16B 4PRPA 2VZUA 1RUAH 3X14B 4DFIA 4UZGA 4OFVA 1SJXA 4MA3A 5MERA 5IBUB 4YDIH 1HYSD 4PRPB 3HLAB 4HPYL 3LMJH 2F74A 1MHPL 2EYRB 4J8RB 2YPLA 2F8OA 5MENE 5JUEH 3Q3GB 3F7YB 1TNMA 4KJYA 4PJCF 4H8WH 4FFVD 1F4HA 2DQTL 4PRHA 1G7JB 3SKMA 4LLQA 4MVBC 3OKOB 2HT3D 2V9QA 5HYSG 1WBYB 3U4EA 5DVNA 4MYWB 3QFJD 4LLUA 5GRWA 4UOW0 2EDLA 1SJEA 3NIGF 2WQ8A 4KHXH 1D3CA 4I18A 3MROB 3FKUS 4YXLL 2L0DA 4G6ML 3PABA 5JXAL 5KS9F 5KSBA 1WEJH 1KCUH 2ESVE 1ES0B 4KGLA 3RU8H 5FDYA 3WJJA 3QIBC 4QNPF 3IDXH 1LVEA 3O4OC 4LAQH 1JPSL 4HK3N 4LVEA 3C5ZA 2ICWB 3WSQL 1XF4A 5AYUL 2LVEA 3ARGB 4Z95H 1E4JA 5C08B 5CP7B 1YZZA 1JPSH 5AYUH 5A1AA 3FB5B 3KPNB 3IJYB 1M71A 4WFFE 4Y16B 1XIWA 1YY8B 1MPAH 3RWFB 2XPGA 3BH9B 1I8LC 2HLAB 3FONA 5D1ZC 3GSXA 4J4PC 1CE1H 2FBOJ 3BEWB 1U8KB 3VXNA 1F8TH 1NMAH 1HHJA 3HNSH 5IJKA 1FAKT 3O6LH 4JDVA 5IFHH 4I13B 1QRND 5I6XB 2YUXA 4FTVE 5MEQA 4XNYH 3BFOA 3SJVE 4P2RA 1QUNA 3T4AB 4DVBB 3CH1A 5EIQA 1VPOH 1JYVA 4JZOB 4X8XA 2JJSA 4O9HL 5CIPB 1B2WL 1ZT4B 1K8IB 3E3QE 1FVDA 3HA0A 1N6QH 3RZCB 3WHXB 1NC2D 4EEEA 4PG2C 3DMMD 1T1XB 5T3XD 3O3AB 1BIHA 3OMZA 4JFDE 4GG6B 2Y23A 3GIVA 2PYFB 4JFHE 4D0CA 4NQCD 5ISZA 4JCLA 1NQBA 3GRWL 5DFVD 3D1MC 4GRLB 4F8QA 5D9SA 1MCRA 1JYWA 3QUMH 4YLQT 1JGEA 1OP3K 2Z91A 3FRPA 1OM3L 5HYJA 4S11A 4U6VH 1QACA 1CYGA 1AXTL 3OX8A 4G3YL 5DMKA 4LLWA 2BMKA 1OM3H 1EZVX 5J12B 4X4MA 3HE7C 4OGYH 1FC1A 1YQVH 3BPNC 4YFDB 1RULL 4PRIB 5EBWB 5D8JH 3BQUC 3PQYD 5HGBA 3SE4C 1OTTC 1MHCA 3FQRA 2X4UA 3EYSH 1A3LH 1UACL 3U30C 4CJ0A 3GJFA 5CP7A 3TCLB 4D9LL 2D7TL 5C08A 3RVUD 4A6YB 1QO3A 2BRRH 5B22A 3C2SA 4H8WL 3TVMB 1NL0H 5T5FL 4AJ0A 3OKNB 1F3DH 3D18A 3ZE2F 3MV8E 4PTUB 5D1XC 4IOIA 4JGUA 1F3JB 3SO5A 2ZUXA 1KJMA 4G6MH 3LKPA 2H2PC 1WEJL 1M6OB 4Y5YA 4UAOC 1U58A 1RUPH 4LLUB 4JFYB 4LU5L 3JBG7 1Q72L 4LPYA 1XF5B 2O5YL 3OKOA 1EHXA 2NY4C 3RKDC 4R26H 1NLBH 1ACYH 4MNHA 4JZJA 1WV7T 1G0YR 4LP5A 3S5LB 1FG2A 3QFJB 2MOVA 3Q5OA 4M1DL 3SGJA 3QIWA 2LVCA 1TPXB 5IOPB 1KN2H 2DMCA 3E6HB 5ANME 4O4YL 4HZAA 1N4XL 1VGKB 3V6ZA 4JFEA 1BEYL 2B7DT 2HLFD 4PBWD 2X4SB 1ACZA 2OTWA 4KDTA 1N4XH 2X70A 4NRZB 4YR6B 3MRBB 1A7RL 2AJUL 1DQMH 4MGXA 4PJIA 3SE9L 3ZO0A 2A6IB 4RWHA 3IFOB 1E28A 3VCLB 4E41E 1EO5A 3MBXH 3L3OB 1M1SA 3RNQA 1LO0H 5D2NE 1VESA 4PP1C 1QBBA 4H26A 5TF0A 4AEHH 4AQ1B 3UYRH 3MBXL 2VRAA 3ARSA 5GS0D 1GOFA 2OL3B 4ZNCD 5CZXC 1V5JA 4WI4A 1CT8B 2BERA 2R2CA 3MUGA 4POZD 3WNNA 4GUPB 4BQBA 3QEQB 1KJ2B 1ETZA 1Q9KA 4P46A 5HHVL 4LRIC 4ZFOA 5HBBA 1HIMH 2F8XC 5I9QC 1IC4H 2XN9A 4NN6C 1P9MA 1B4JL 1C08B 2VLKE 4ENED 1A64A 2GAZA 3O2DH 4O5LH 1D6VH 2HLFC 3EYFB 1S5HB 4K9EC 4PGBB 2FGWH 1DFBH 3T1FA 5EA0H 1BGXL 1A0QH 1ZHKA 3I85A 3CMGA 4FQXB 5FO9A 3QFJE 3SKOA 2C3GA 4P2QE 2VZ3A 2E7HA 3EUUA 1MCPH 2ZG3A 43CAB 4PLKD 3LKQA 4A2MA 4G7VH 3EDEA 3F7VB 4EQ3A 4M8QB 4FQJH 1RMFL 4GAGL 1ZHLA 1ZVSA 4DOHB 7FABL 5IJVA 4X6BA 3IXAB 4F15B 2ICES 3UMTA 3ABZA 4I5BB 3BESR 3C9NB 3JV5A 4M7JH 3WMSA 2CRIA 3MOQA 1EIBA 4MAUL 1FO0B 5DJ6B 4CMMB 2WM0A 2B5IC 4PRDB 2X7LA 1WLHA 1X44A 3I6GA 1PSKL 5JMOC 5GRJH 2K1MA 3VWJA 3C2AL 3O4LB 1FZJA 1LNUA 1AO7A 2J4WL 2NCMA 2OXHA 3G5YB 4MJIA 4GQPH 3MODL 4D0DA 2ERJC 3LPWA 5GRJL 1UXSB 2ENYA 4PPTA 1I1YB 4S1RL 4FTVD 3GJEA 4NIKB 4HGWB 4L4VA 4FHBD 5F6HJ 5D7LB 4XBPB 4TSBL 1EEQA 1PKQA 2V9RA 3W0WE 1RUQH 5J57B 4TRPL 3U2SB 3X11B 2KZ1B 1YDPA 4U0RC 3IDYB 5AZ2H 1QR1B 3L3GB 1WBXB 1SYVA 1ZT7B 3LB6D 3QO1A 3PXHA 4QWWD 5EO9A 4U3XA 1DP0A 3GMOA 5EU7C 4PRPD 5T1DH 3EJJX 3ILQD 2F58L 2FLBT 2D0FA 1Y18B 1ZT1A 2VDNH 3ZT6A 2EDFA 2GJ6B 2DQGL 1RZKL 4AL8H 4XCFL 2HMID 1EJ6A 4QXTA 5C2BH 4NBYB 2QSVA 5I1HL 2VQTA 3S5LG 1FL3B 5MEPB 1NGZB 4IS6B 1N59B 2P5WD 3BYYA 4QRTB 2PO6D 5ANMB 4ERSL 3BRFA 1E4XH 1MVFA 1S7UA 1S9KC 4XWGL 1WZ1L 4PJ8C 3F6LA 2XQBL 1ZLSH 2C7UB 2UZXB 4MNQA 4DKEL 2IH1B 5KAQF 4EUPH 4BH7A 4MVBD 1ZVSB 4MB5A 4KK6C 1F4WH 5ICXB 1YNTB 2EYSA 1BD2E 1CL7I 1SMOA 3KJ4C 3U7AA 2ARJQ 2J8UA 4UNTA 4OI7A 2BXZA 4PJGB 2WIMA 5DD6B 3V0WH 3VXMB 1Z2KA 4HBCL 2OQJB 1R3LA 3QDMA 5IQ7H 4DW2H 4OBRA 3LIZH 4PGBA 5DK0A 3S96A 3EYFA 3WL9B 3QEQD 2IEPA 4ZD3H 2FD6L 4QEGA 1QQDA 4LHUG 1S9YA 2VZ1A 4YGAB 4TNVF 4XB8A 5D5MA 3WFBH 1AGFB 2Z8WC 4PRNA 1DBKL 4RA3A 3WL9A 1DEEA 3BN9C 2ZCHH 4R4FH 4ORGA 3QIBD 3T0XA 4RDQG 4M7JL 4IRJD 3FL7A 4AY0A 1IGTB 1EZVY 3ZE2E 1JHTA 5LQBL 4JKPH 3CLFL 2Z92B 5D2LF 3SDCC 1S8DA 3MCKA 2DB8A 2Q87A 2CK0H 2J2ZA 1VEPA 1DSFH 2A6IA 1FLRL 3RP1A 3QA3B 3UBXB 4KXZH 4DZBA 5KS9B 1DEEB 1GC1C 1TZGH 4YDKL 1UEMA 3HZVA 5C0AB 1QNZH 3FTGB 3AMKA 3CFCH 5JNYB 1VGKA 5FCSH 3IGAB 1JNNL 3MGAA 1ZV5A 5T3XH 4Y1AE 1VFUA 4ZOBA 5DRXB 2OLDA 4YNYB 1AXTH 4QXUH 2JCCA 1RU9H 3G08B 5TFSH 2YHGA 5T3XL 1OGTA 5JR1H 5HI4C 1YQVL 4PLOB 2DI9A 2H32A 4F9LC 2V2TB 2AXGA 1XGUB 2BK8A 3V5DA 1Y18A 3FCTB 4NSKA 3EDJA 5E8NB 4QTHB 3LHPH 1ZT7A 1SYVB 3A6BL 1JVKA 4YHNA 1EFQA 4N9GA 4XVJH 1JRHH 5DMIH 2NW3B 2OR7A 5FYKH 3EO0A 4XHQA 2BVOA 5DJ8B 4AK1A 4BSVB 3T1WA 3GSWB 1TNNA 4OF6A 4XBPA 5EUOF 4JB9H 1AP2A 1XZ0A 4F7EB 5D7JD 4LKCA 3WD5L 1N59A 1D5ZA 1N7ML 1RJLA 1NBVL 3C5JA 3B9KC 3EO9H 2V5MA 3BQUD 3VFNA 2P4AB 4GRWB 4MJID 3NABL 3CFBA 4U1HA 2DAVA 4OIBA 2VYRE 4PRDA 3AREC 3CVIH 3MYJB 3HB3D 4KPHL 1OAKL 1S9VB 3QO1B 4PLKC 1QFUL 4X80H 3BZEA 4OV6F 4X6FB 1HHIA 2HJLB 1SEBA 1RIVH 4ZTOL 4LRNH 4NRYB 4QNPE 5IMOB 1JWUA 4C58B 4X4XB 1PKQB 3DROA 4ZTOH 3WBDA 3QI9D 3WIHA 3O3AA 5J9PA 3FRUA 5C0IA 2A83B 2Y25A 2X89D 4OJFL 4AEIH 1UXSA 2F9BT 4LLYA 3TZVC 3MV11 4Z7UA 4X4YB 3VXSE 1SY6H 2UVEA 1F6AA 43C9B 4WWKC 4D0BB 3T0EB 5LWYH 1A6TA 2RBLA 1KCVL 4ETYA 1UKTA 4XVUC 1KACB 3CAFA 2R0KH 3C6LC 4U7SA 3LKNB 2QKIB 6FABH 3VWKD 1HH9B 3VMPA 1YMHA 3K8LA 5DRZA 2GHWB 3CSYA 3I50L 1N3NB 1UWXK 1KV3A 1JZ6A 3ESUF 4FQQA 1IEHA 3ULVH 1KB5L 4IRSA 1ZLUK 2M2DA 4U7KA 5JQ6H 1BZ7B 3V4VH 2AS5M 4I2XA 4MCYB 5GXBB 3FQTB 3CLEL 3FB5A 3KPNA 1E28B 5HYJD 4RAVB 4IMKC 2ED7A 3OAZK 5E7BA 3DBXB 2Q20A 2YUWA 3HC0B 3ALXA 4FQPA 2HWZH 1F3RB 4G6KL 2FYYA 5BO1L 2DLFL 5D8JL 2A74B 3FAXA 1JIBA 3K2MC 5FGCB 2DQEH 3EDDA 1PBYA 1FL5B 5J11B 1Z9LA 5FGRA 1G9MH 3NCYS 4NO3A 3O41A 4ZFZA 1SQ2N 4ZMAT 5EU4B 1A9BA 2DQEL 2E3VA 5CINL 4P3WA 3H7BB 5E08H 3R0NA 3FMGL 3OKYA 3RUGE 4GT7A 2E9JA 4BQ8A 3V6BR 1JPTH 5FB8B 1PSKH 2VLRE 3NFNA 5HVHC 1U91B 3O2DA 4PGCA 1FO0H 4M00A 5DMGC 3CX5J 1KBGL 3FN0L 3FT3B 1KG0A 1I85C 1IZKA 2HG5B 2PYEE 4WFGE 5CD3B 2FZ3A 3RUGF 4UNUA 4ZSOB 4YHKH 5IHBA 1M7XA 1RUPL 4LU5H 3JWNC 3NCJH 1IEBB 3S36L 2XZCL 3B5TA 4XPGL 1LO2L 3OAYK 3P4NB 4M5YH 3MREB 3QDGE 4YDJB 4L8CA 4KTDH 2AJ3B 1P84K 5DUPL 4Z9KB 3T0DA 3REVA 3SKJH 4PGDA 4MD5A 4U6HA 5DRNB 5IHUH 2CRMA 2CLVB 5A2FA 3WKML 4FQ1H 1FNAA 1CE1L 3MCLH 1DLHB 1OP5H 4X83A 5T1LB 4K7FA 3IFLH 4JFYA 5L0QC 1JFQH 4MX7B 3MCLL 1DVFB 2P24B 5EUKA 4M1GL 3H6JA 4PJ7F 4XAWL 4X6CE 1Q0XL 3B9EA 5FYJD 4B53A 3WO3B 3L7FA 2A6KA 1HNGA 1W0VB 1NFKA 5C8JA 1LO5A 2AW2A 2X40A 1HHKA 1GGYA 5I18H 1AC6A 4MXWL 2IAMD 25C8L 4UINH 1QFWI 3CFJB 1CGTA 1JPFA 4IIQA 4MA8H 3BKCL 5HGDA 4NN7B 5C6TL 1BFVH 4GJTB 4K23L 3OR7B 4NJAH 4XPFH 3QUZA 4P9MH 5GGRA 3KR3L 5K9JL 1MCWW 5GIRB 1HIML 5BOPA 1NCUA 2Q3ZA 4JHBA 4NKOB 1HXMA 1P7QD 2PNDA 1UWXH 1MJ7H 1KB5A 3FO0L 4K8RL 4MSWB 4R0LA 5F89A 4G9FE 4QTIL 4M43L 2X5PA 5DT1L 1J87A 5HHNB 1HHIB 2HJLA 4ZODA 2R2HA 4M61B 3VGAB 4K8RH 5J4MA 2HWZL 1H3WM 4TUKH 3GJFK 3H9HA 4N0FB 3MACH 3VDCA 1WAAE 2QR0A 3RJQB 5FOBB 2A73B 3RVVC 4X5WB 3T77B 1P84J 1RJLB 1PX3A 2EICA 4LGRB 5CINH 3MUJA 5E08L 5GGQL 4NP4H 5AZEH 1CD0A 5FECA 5D1XA 1EUUA 3GSWA 3UTTB 1DQLL 3WLWD 2YA1A 1R3KA 4NO0B 5DMJB 1MAKA 5DJ8A 1AE6L 4X4ZA 1KIQA 3BKJH 4XCNB 1AO7D 3FHQA 3BKMH 5I8KL 1FFQA 2AXFA 4Z76B 1JGDA 2QHRL 3QHFL 1AR2A 3ARBA 4R7DB 2I5YL 3AFLA 4JQXC 3MLWH 2IPUK 1F45A 1BJ1J 3PWPB 4F58L 1MF2L 4XPGH 3M1BA 3Q5TA 3V5DB 3CC5A 4TSBH 1T1YB 5TGBB 2PCPA 1FE8H 1K3ZA 2GJZA 1CLYH 4PJIF 1K8DA 4I0PB 3L3DB 2APBA 1U8PB 1NMBH 5I8EA 3QIWC 3VXRE 5D1QA 4WO4C 1FL5A 4NRXB 3WIIH 1RIHH 3ULUE 1YN7A 4FQ1L 4LNVA 1NMBL 4YDJA 4L8CB 1OQXA 4UV4H 5F1IA 3HUJE 2GY7B 3DX9B 4AENA 5A2IH 5HXMA 3HB3C 5IB4B 2F5AL 1MHEB 1O7SA 1DQML 4G8EB 2CD0A 2PXYD 3TNMB 2AGJL 2E9WA 5JOPD 3MBEB 5EUOE 3X3FH 4F2MB 2B1HH 3QA3A 5DEGA 1UFUA 4NFDA 1KG0B 2AVGA 1J9CT 4KTYA 2HN7B 2P8LB 3SPVA 1SJEB 3CGTA 5KSUA 3QEUB 3UJIH 1WBYA 5C0FB 3SDCB 5H37H 3NFNB 3RBSA 1G7JA 3DI3B 4CGTA 1UZ8A 2IF7A 5IMLA 3FFCE 3QUYC 2FATL 3W9EA 4CW1A 4HUVB 3IJSA 4OI9A 3N06B 3TVMD 5E00A 3QDJE 4N0UB 4BQ9A 4P9HL 4G5ZL 3UTTE 3ZL4H 1IM3B 5IBUG 4C56A 4F57H 1GPOH 2QL1A 4NWUH 2AEPL 3DUUA 4FQXC 4HKZA 1U3HC 3DVGA 1XF1A 4U1JA 1AGFA 4I77L 4P2OC 2BDNH 4YFEA 5E2WH 2MPAL 5IVXA 3WFZA 2VLRB 2HRPL 3FZUC 3GSNH 2VIRB 3S3PA 1VFOA 1QSVA 4QO1A 5J6GA 1IRAY 3PWNB 2I60H 4PJGF 3ZDZF 1QPPA 5E2VH 3WNKA 4Z77B 3LEVL 1RIVL 1HKLL 4RCAA 2E5EA 2NNAB 2I60L 5J9PB 1UWGL 2QSCL 4JPVH 3D85A 3AAZB 5C0RH 1N5AB 1JK8B 1XFPA 3MV8A 2IBZY 4XNUL 1F8TL 2D03L 3IFPA 1QKZH 1D6EA 4L4TB 2PTVA 1B88A 4NPYB 4OZFB 4FNLH 1PEWA 3DMMA 3GJFH 3OGCA 3QXTA 4MAUH 1KPVA 2P5EB 3G6AB 1E4WH 2NXZD 3DV4B 4HG4J 3QAZC 2NX5D 4HH9B 4KKLC 2GEEA 1E4WL 3KLSA 3L5JA 4J3OC 3NFPA 2Z4QB 5ESQB 1U8OA 2A9NH 2AK1L 1IM9D 3BEVB 5DHYA 1IKNA 1KB5H 3ZDYF 5E8EA 4QKXB 1NFDF 1NANI 5AZ2L 5KANI 4JDZB 3UROR 2BVOB 5D7IE 1IBGL 1IEAB 4LAJH 4U31A 1C12A 3TNNB 5GISH 4O2CA 1UGNA 5I1JL 1D5XB 2BHYA 3S9DB 5CJOL 1IVLA 3STLA 2NX5A 3RJDA 1M7DB 1U42A 3GSUA 3X3FL 4U1HB 5E8EB 3LMJL 1D9KC 2YD3A 1A6ZA 4MCZB 3P0VL 3N9GL 4CVZA 3E8UL 2CUHA 1NDMB 3GBMH 1T0MA 4GXUM 4Y8DC 3IDUA 4YX2L 5ESQA 3TN0A 3TPUB 4YHOL 3IDNB 1UJ3B 4KI5F 1AO7B 4FZEL 4X0KA 4NZJA 4FXLA 3VWJB 1OSPL 2FHFA 5EN2B 2XWJB 1NAMB 5I76B 1T6WA 2VXSH 4BSVA 3TO4D 1ZEAH 2FJHB 4NGHH 4P2QB 1M7IB 1IMHC 4DZBB 4YAQA 1YEEL 5E8PB 3VFOB 1NKOA 1UVQB 2DWDB 2GIYA 4QHKI 3QHTC 5EIIB 2EDBA 3ZKMC 5EU3A 4X5XA 2BDNL 4LCIL 4IOFD 4M3JA 3FCTA 4QT5B 1FZKB 1CXLA 5SWSB 1LP9E 3MV9A 3MXVH 5F6IB 4JLRB 1KCRL 5FA4A 2HJFA 1OP5K 5GSVB 2OTUB 2MKLC 4MMXC 5GJTH 3IT8D 5IESH 3KHOA 3SGDH 1JGUL 1VGEL 2F54A 4LQFL 4QRUB 1YQ2A 3LRGA 1QKZL 3DO7B 3HAEG 3DX7A 1T04B 2CDFB 3GB7A 4O58H 1NMAL 4K9EH 3BPNB 5B4MC 4O02L 3VFGL 4YHML 2EEDA 2OR9H 4OTXH 4HJ0C 1EGJH 1KC5H 1Q1JH 5I1KL 3WE6B 3LKOA 2VR9A 2FHBA 4EN3C 2HT2C 5IMLB 2FR4A 3BP5B 3Q48A 4P2RD 5L6YH 5HHOE 1F6LL 4E41A 1H0DB 3UCRA 3O9WD 2R56H 4PJGE 3ZDZE 2VN4A 4MNGE 3MRNA 4O2EA 1P1ZB 1KCSL 4OZGB 1E4KC 3GSVB 3EFFB 2DKMA 1QEWB 3D3VA 3MJ8A 5AUMA 5CP3H 2EIBA 1X7QB 4YHLL 5T1KD 1RK0A 3RHWF 4QRUA 1EPFA 3PP4L 4I48B 1QQDB 4YHLH 4NYLB 3L5IA 4K7PH 2IPKB 1TXKA 1OTSD 3QFDB 4M6OH 3EHBD 3GRWA 4XPHL 4JJHA 5BV7C 1PYWA 1WK0A 3LQAH 2R4RH 3BHBA 1T1YA 2DD8L 1IAOB 3V79C 5D4QA 1FZKA 3OAUH 3QDJD 2XG5A 1DN2A 3B8SA 1PG7H 4GW1B 5E70A 3P0VH 5D7IB 1ORSA 2WBJC 5JOEA 3J7HA 3MOBH 4PB0H 1IJ9A 2NR6D 3RWJB 4MDIB 4POZC 1FNSH 5D7JA 2X4QB 4NO5A 4Z7VF 5SWZA 4OCYH 5JIIA 1NJ9B 15C8L 1MH5B 4ZPTA 5HGGS 3ULUD 3FN3A 1ZANH 3MTRA 3MRQB 1T0NA 3QH3B 4MXQC 3S4SB 1S7SA 3RPIB 3KS0J 5FA3A 1G7QB 2XZZA 3NFPB 2JB5H 4DEPC 1BFOA 3RAJH 4N1EA 3BQUB 5T33L 1B2WH 3C8DA 1P5VA 3AREA 3S35H 3S3JA 5EZOL 2ICEB 2QR0B 2BSTA 1H3GA 1KCRH 3O6MH 2R2BA 5D7JB 3ZTNH 5GGVL 4Z7UF 3GMOB 4MJ6A 3B5GA 2OZ4A 3P2TA 1HSAA 1UA6H 3HI6L 3QIUD 4OT1L 5B38B 4RZCB 2VR5A 5TDNA 4WV1C 2P8PA 3RWEA 2JIXD 1PFCA 2VZSA 4TULL 1XR9B 1BOGA 1BF2A 3WKMH 1N5AA 2I25N 4JFDA 1DQJA 3LRSA 3SDYL 2DN7A 4L4VB 5GRYA 1CGXA 2OZ4L 2UY6A 4HFUH 4P4RA 2P5WB 3RZCC 5F1KC 1T7VA 4HAGA 3T1FB 3FZUD 5FDWA 4ODSH 3KXFA 1T4KB 4Q0XH 2Z4QA 5HHXH 1MSPA 3MRDA 4PJBB 3LAFA 4QRQA 5BZWB 5JDSB 1DN0B 1INEL 2AJVL 4Y89A 5HHXL 5T1LD 4HGKC 1K2DA 5DXWA 3VI3E 4QRPB 4ODWA 3BXNA 4PJXF 2XZAH 2QSTA 4M8QA 3MRNB 4O2EB 1U6AL 1TVHB 4KK9D 5HHVH 1SM3H 1HINL 4CAGA 2DQFA 4IRSC 2AI0H 3QI9B 1HSBA 3U48A 1OAQH 4LMQE 2YPKB 4M6OL 2EC9U 4C56E 3VCLA 2L7JA 3EHBC 2ZUVA 1MUJA 3V5KA 1MJ8H 3VFUB 5IR1A 5DEGB 4N0YH 3T2QA 4OCMC 2VL4A 4DJMA 2X4SA 1MFBL 4WTZG 2HTLD 3QIBB 4N0YL 8FABA 5EULV 1JPGA 4K3JL 1PG7L 4WO4D 2LU7A 4PR5B 1WCBB 1P4BL 4XPTH 4ZSOA 5JTWA 1Q8MA 4FQCL 1JMZA 1KLGA 2F54E 1J0IA 1FDLL 4MNQD 4NOBA 5I8EB 1IGYB 2AJXH 4JM4L 3S5LA 5DD1H 2VDKL 2FIRT 3BDXA 3NGBB 1TETH 5IVNA 5ADOL 5FGBA 3QDGA 3FQNB 1INDL 4OB5H 1QSED 5C07D 1YEJL 4Y5YC 3KPOA 5LJYH 1R3HA 1YJDC 2P1YA 5CSBA 3U9PH 1MJUL 1S5IH 3RNKB 1KTDA 3SKUD 2AV7A 1JGDB 1YEJH 4ZFFB 4Q9RL 4YR6A 4PJIE 5CBEB 4MD0A 5E4IA 4BSWA 4LSTH 3O45B 1F4XL 3NIFF 1LE5B 3DGGB 3D3VD 2C9AA 3HC0A 3X14A 1JF1B 3EYVB 1DANU 5C09B 1B4JH 5K59E 2AK4B 3CZFA 5ICYA 2X4UB 3L3DA 3CNKA 2YPVL 4A2LA 4B7LA 5HGBB 4P23B 4HIIB 4U1LA 3TA3A 5EA0L 4L8SB 3NIGE 5MP6H 4JRXD 4NCDA 4HZLB 1MFNA 1DJSA 1KJVB 3MA7B 5J12C 4ODSL 4M61A 3PWPE 1Q0YL 3ARBB 3LS4H 1J1XH 2Y07L 5IVOA 3L3IA 1I3GL 2QTEA 5EPMB 4MNGA 4NWTL 5C9JA 1FVEB 5I1CL 4P5MB 4U0RB 1RZ7H 3BMVA 5HGHA 2RJMA 3T65B 5ITFA 4QGYA 3TYGH 3BO8A 1LE9A 2R2EB 1XGYL 2ZCKH 3NVQA 1YPZA 3MRLA 1Y6KR 2GSIA 2MSPA 1FBIH 4P2OB 1U6AH 4XP1L 1UQSB 4NQDA 4HWNA 4P9HH 2WP3T 3N85L 3TIDA 3CDYA 2CDGA 3BIBX 1NH6A 4F9PC 2JK5B 4GBXB 4HH9A 3DROB 1ZVYA 3QNZB 2KUTA 5MEQB 4QGTA 4PLNC 3CDGA 1FFRA 5E5MB 4GKSA 4E5XB 5KVGH 1MELA 1IAKA 1SEBB 3PP3H 3BPOB 4LLMA 1FAIH 3VXNB 2PYEB 3FJTA 3QQNA 4JFZL 2UWEA 2HLAA 5F89B 4GRLC 4K7FB 2Y36L 3VW3H 2FB4H 4OCRL 3WDJA 2A38A 4DGYH 3D85B 4FTVA 3CU1A 4L4VD 1UWEH 3ULVD 3L95B 5HYIA 2HTKD 3QEGH 5GGQH 3VFNB 2XTLA 4G9DB 5KOVC 4NN7C 1BFTA 3KYNA 4AL8L 2FL5A 5AZEL 1DTUA 1CG9B 4XPBL 1UWEL 1IGIH 1ZXQA 2PN5A 3G5ZA 4IIQB 4HCRA 1GVIA 3QCVH 4G6AC 4NFCA 3U79A 4XPBH 4YGVB 2NXZC 5E94A 4QHMB 2C3VB 4HMCA 3VXSA 1P6FA 2ICCA 3SY0B 5EOCH 1FSKC 1FH5L 4JVPA 5J1TC 3BH8B 3G04B 2ZNWA 3TP4A 1TQBC 2EDRA 2VAAA 4MNGB 2FX8H 3GUTA 1U3HB 3EFDH 1VFMA 2KDGA 4ELMB 4KROB 3L3IB 3PJSB 4GO6B 1KTDB 1NUFA 2FNBA 4F80A 1CDCA 1JTPA 3GSQA 3GSXB 4LSVL 5E8NA 4DKEH 1IAIH 1A1OA 2ZWLT 3MRGB 2DS4A 3DIFA 5FO8A 4XCEB 1ZA6A 5I66B 3NFSH 4K2UH 3DURA 3EZJB 5TDPA 3EYQD 4YNYA 2EDYA 3QG6B 2KQNA 1W0WB 4TVSa 2WWMC 1S3KH 3LN9A 5JIPA 2VL5A 3IGAA 3TJHC 5HVFB 5JZ7C 1XH3A 3BOVA 1AY1L 2B1HL 4WI2A 3JZ7A 4OSUH 4O51A 1BAFH 2Z9TA 4W6YB 3WFBL 4N8PA 4DFHA 2O26U 4ZDHB 1SY6A 2AV7B 1RZ8B 2E7MA 1QBAA 5I66A 3ARBD 1TTUA 3FB6B 1NCCL 4IDJH 4Z0BH 1B0RA 5FHBH 1GOGA 1NCAL 3SBWA 4GKNB 2C4XA 1WIOA 2OI9C 3ULVC 3BISA 4NFBA 2EZ0C 3QXWA 1A21A 2GTZB 1RURH 2B4CH 1G7HA 1H5BB 1AGCB 2ID5A 1LEKB 3AXLB 4CUCA 2PXYC 3JTTB 4ZUWA 1ZMYA 3L3KA 4AH2A 3NN8A 4KVNL 4ZOAA 3OXRA 1OPGL 2YKLL 4OZIF 3DHJA 4ZUVB 3SY0A 32C2B 3ZKND 2FYYB 4XP5H 4NQSB 5DJ0B 1B0WA 3O6ML 3GNMH 3Q1SL 5DC4B 2IG2L 3DVNA 3HAEH 3ZTNL 3MLXH 5SX4I 4FFYH 2ZJSL 4XPAL 4JFEE 3MRIB 1IGJA 3KXFB 1FZMA 3OJMB 3BIKA 2E7CA 5IBLC 4TUJB 1YEDA 4XNUH 4GXUN 3LSOA 5CGMA 4ODXB 3O3DA 4LFHD 4HFUL 5K33A 3H3KA 4FQQB 4K71C 4JZNA 2I24N 2NY0D 4KUZH 3BT2L 4LQ1A 5ENWA 3S37H 2XWBB