2IPUK

Pfa1 fab fragment complexed with abeta 1-8 peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule tags Immune system
molecule keywords IgG2a Fab fragment Heavy Chain
total genus 57
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipuK02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ipuK01
4KK6D 2Q76A 4FMFA 5C0RH 3A67L 3JV4A 4R4BA 2CRYA 1UXSB 2R4SL 2P8PA 4GKNA 2NY6B 1T83A 1UACH 5ECJE 3RNKA 5KVDH 1GAFL 5FKPA 1GOHA 4X8XA 3BD3A 4UT7L 4WU5A 4Z7OF 2F8XC 1DVFB 3BT2L 5KVEH 5B38B 1ETZB 1JJUA 2DQIH 1DQTA 4DKEL 1RK0A 5I76A 1F00I 4H20H 3MLUL 4QRRE 5J4MA 3MV8A 5FUCC 3ZKNC 3VFGH 2LV4A 1F6AA 5F21B 4PP1D 1LE9A 1OGAD 4EZMA 4CMMB 3HRPA 1XGYH 3MJ6A 4NZUH 2DQEH 3JWDH 3AS2A 2V2TB 2OSLA 4CDHA 3KWWB 3L3GA 1MH5B 4ZMAT 3KPRA 1FL5B 4TSCL 4YHNA 2UVEA 1S3KH 3X17A 4G5ZH 1CDYA 1GC1C 4LVNC 5HYJB 5E2UL 3HZYB 3CSYB 4PJ9B 2EDBA 2ZOKB 4NQDE 3IETA 4X80H 1D5XA 1FIGL 3VRIA 4F3FB 5SX5K 1HHKA 4LLQB 5I73B 5IFJB 1NUFA 4OZFB 5GRXG 4NO3A 3X3GL 4JEGB 5FHBH 5MEND 1HH9B 3K8KA 1DDHB 4WFFD 1I8MB 4M6MH 1U8HB 4ODHH 3I50L 4I48B 3QAZC 3QI9B 4U33A 2EYRB 1LO3H 4QRPE 2NY3B 3S98A 5ESQA 2RBLA 4ETQB 1I7TA 4PTTB 2Q20A 5IW3A 1XGPB 4L8SB 4EUPG 4NQCE 3F58H 1VGKA 3TJHD 4H5SA 2H8PB 4I2XE 1BM3L 4NBZB 3FB7A 4PRAA 1MAMH 4O9HH 4PB9L 2HJLA 5GGUB 3O3AB 4K71B 2EEDA 2IBBA 4OLUL 1YDPA 3TIDB 1FZOB 5J9PB 5H2BB 5JOPD 3V4VL 2VLJE 5C92A 2YRZA 3U46B 1HH9A 1R24B 4I1NB 4LPCA 3MLUH 2Z8RA 1OLLA 4ODBD 3TJHC 5IHLB 5C08A 3QDJD 4YLQT 1JGEB 1F4WH 4DW2H 4F7CB 1KLUB 4NN6C 5DLML 1E27A 1Q8MA 4KROB 1GHFL 1BM3H 4UB0L 1LK2A 3KLDA 2ZOLA 3C5SA 3TF7C 3ARDC 1IAKA 2R29L 1MFBH 3UTZA 1F4YL 4N9OB 1X5YA 5CMAB 5J89A 4GKZA 5KVGH 3FT2B 2J88L 2R4RL 1YEJL 2EEBA 1S3KL 3ZTJH 3ULUF 2XRAH 3REWB 4XPGL 3CLEH 2AJXL 2BFVH 2C3VA 3UTTD 4H0HB 4KQ4L 1INQB 1MWAH 1IBGL 4L1HA 2YD7A 4M00A 5HYIA 2CLRB 1KJ2H 1YEIH 2XTJC 5HHMB 3HLAA 2X4UB 2W1NA 3DETC 1D9KB 2MOVA 4PJXA 3MGTB 1RZJC 5D4QA 1K5NB 3BWUC 3ARZA 1HCVA 3FMGH 5D2NB 3WIFA 3IU4L 4J1UB 1UEMA 4CGTA 4HK3N 4JG0L 1FQ9C 1TPXB 1DBBL 1C08B 1Q72H 1IM9B 4QRQB 4HS6A 3PWPE 4AL8H 1NL0H 4U1HA 5DUML 1RUAL 2OM5A 3EFDL 1LO3L 3T77B 1VGKB 1A3RL 1Q38A 2ATPA 1MCBA 4HWZA 1PD6A 2V2WA 3ARPA 1ACYL 1U8IB 2KZWA 3TM6A 2P42B 3T2QA 4JCMA 5FA4B 5FO9B 4LHQB 3TO4A 4RAUA 4X6BB 1J8HE 2Z92A 3FONA 5GJSH 3QQNA 4MAUL 4FFYL 2GAZA 4A6YB 1TCRB 1A2YA 3DYMA 4JQXA 4I3GA 4XMLL 2A77L 1FYTA 1RJCA 2FO4A 2ZUWA 1I85C 1OTTD 1YEDA 3QQ3B 5HDLA 1IGIH 1YEGH 3ARDA 3BVNB 2ED9A 3W39A 4NM8H 3OV6A 5E5UB 3GUTA 4YBQD 4CU7A 3L5WB 4HH9B 4HJGB 3CMOH 3DRTB 4PJHF 5C0BE 4U1KB 1G0DA 2XQYK 3EJJX 4P9HH 4QO1A 3H7BA 1YEIL 1INDL 1FFPA 2BJMH 3RY6A 3HC4L 1BAFH 4X99B 5EU7E 3P4OA 3MBEC 1YPZF 1P9MA 3VWKC 2CPCA 3BYYA 4P2RB 1NCCL 4KDTA 1N2RB 1QEWA 3RVUD 5HYQB 4LCUB 1GGBH 4ZDHB 1MVUB 2F54A 5SWSB 4PLNC 3ULUL 4LLUA 2R0KH 5KAQF 5HHPB 1UJ3C 2GSIB 5GZNC 3IDJA 3K4ZA 4LRNL 2J4WH 1MFEL 3TBSA 4NT6B 1Q0XL 4YO0A 3WHXA 5DEGA 4HAFA 5HHNA 1XF4A 2BVTA 2W60A 1AKJD 2NZ9D 4HKZA 3U9PH 1KPUA 5BRZD 1FFPB 3MRGB 3VI3F 1MCJA 4M02A 2R1XA 3R4DA 3H3PL 4X80L 5FYKL 5F1NB 3RVUC 5DO2D 4L1DA 3FN0H 4U1LA 4PY7A 4Y2DD 4YBLB 3TN0C 1OWWA 4HKJB 5L9DH 2B2XL 3BPLB 5MENA 3TYFA 1NH6A 2BSRB 5CEZE 1IAIM 1AGEB 2HMIC 3FZUC 3H9HB 1Z0NA 3OKKB 1U3JA 1WCBB 2EIBA 4QGTA 1PKQB 4ELKB 1KLGB 5KZCD 2CDFA 4M7JH 2D7PA 2X10A 4FQXC 4WI4A 5H94B 5A3IC 5C2BL 3VXTA 2UUDK 4QRRD 4L4TA 4FQJH 3PF2A 3HCVB 1Q9KA 2AK4A 5DHVB 1X5XA 1CD0A 2YKLL 4KKAC 4LPWA 3RI5K 5DSCA 3U1SL 3MNWB 3VG9C 3S36L 4RRPG 5I17B 1NCNA 2Q86A 2NQCA 2VAJA 3W0WA 2Y6SD 5EDXA 5EU3B 1SVCP 2B2XH 4UIMB 4HX1A 4NCC1 3L3OA 1Z9LA 3L95A 5TE6H 3HZKA 5EC2B 4ZFOB 1HYSD 3RIFK 3CVHA 3QDJB 4JFEA 3I02B 4XAWL 3ET9F 1UZ6E 1MJ8H 3QWRA 4P2QE 1EAJA 2IMMA 4J3SA 3TVMB 3EO0A 5T1MA 1H0DB 4KRNA 3HC4H 4POYA 5F9JB 2EIZB 1QFWI 1ZT7B 1AI1L 4X9BA 1Z9MA 2Q8AH 1C5CL 1L6ZA 3O2WH 4PJFA 5EB9A 1RK1A 2CH8A 5IVXB 5I1KH 2EKSB 3D87B 1ZKAA 1U8MA 4E41A 5L0QB 4G3YH 2VOTA 5FA3B 2UZIL 5EA0H 3S96A 2AEPH 2ARJB 4QXGL 4YIQA 4PJ7B 3GMMA 2KKQA 4KAQL 1MF2L 1H5BA 2WIIA 4WW2B 1ZSDA 4PV8A 3TIEB 1XIWD 3JV0A 5LGHL 2D31B 4V1DA 5IM7B 4LKXA 1QD0A 4OLXH 4ZFFA 3TJEL 1F3RB 3UDWC 2F54E 1IGJB 1Z5LB 4HKXB 4QHUB 3X14A 1S9WA 2P8LB 4YPGA 5E8PB 3WNMA 4EDWL 4M4PA 1HHJB 3EDDA 1F6FB 1MAKA 4AT6A 1GZPA 3E1F1 1F8TH 4WEBL 3CFDB 3DLQR 4GUPB 5C0ND 5DZOA 2ARWA 3KS0J 4Q58C 1I85A 4HH8A 5FO8B 1G6RA 3QEQB 4U6YA 2V9TA 5J57B 5L8LB 1H8SA 1MRCH 5BZWB 5T1DL 3HUJA 5HHXH 1BFTA 2P43B 2IPTL 3TJEH 4APQA 4YBHA 1G9NH 1MCWW 4HFUH 3WUWG 3OXRB 3PXHA 4JZJC 3AS0A 2CLZB 2EYTA 1B88A 1S7WA 5GISH 2EDRA 1LP9B 4M1DH 2CLVA 2IG2H 4N68A 4LSQL 4WW1B 4YE4L 43C9B 5DFVD 2AJUH 1BZ7B 4JRYE 1CL7I 3OKDA 5A40E 5E2VH 2XKNA 3RRQA 5B4MD 3D3VE 1TJHH 3D48R 4WWID 1I1AC 5DK0A 1I8IA 4KJQD 1IC7H 4LAQH 2P46B 1QFUH 5C0AA 3UEZA 1GYAA 3GEWB 5C0IA 5K9OB 2EDQA 4ZD3H 4X6DF 4OZ4B 3QEQE 3B9DA 3KYOB 5DVKA 4BZ2L 1TXKA 4K3DH 5DD3L 5FA3A 5DFVC 1E4XI 3E8UH 4TUKL 1GZQA 5EFIB 5FUZH 1BVKA 2X1QA 3G04B 4KVNL 4P5TA 1IC4L 4NO0D 4EN3D 3QWQB 3RDTB 4XWOD 3TT1L 1IGCL 3F8UB 4TN9A 1PQZB 3O6FD 3OKDB 1UM4L 5JHDE 1C5BH 1LEKB 2AK4E 3HAEB 2Q8BL 4UOJA 2GKIA 3AAZB 4R4ND 1NMCB 2JE8A 5LCVH 3GGWA 5KS9F 1F4WL 3LEXB 5DQ9B 1WWBX 4OZFG 1UG9A 5JW4Q 2HN7B 3OR7B 3U4EA 2OZ4A 5D2LE 1KXQE 3ULSB 1B6DA 4Y4HD 2XG4A 2HFFA 4XWOC 3P73A 5INDB 2QSQA 4MCYB 2B1AL 1UWGH 1MY5A 1IGFH 2PO6C 3ARUA 2V9QA 2X4SA 3IDYC 2ICWA 3L3IB 3R1GH 4LSPL 5KW9L 5CZVL 4WI9A 1BF2A 2ZCKL 4HCRL 3EDEA 5CJ5A 5F7DB 2BVPB 3BP5B 3GNMH 4S1QL 1HXMA 5HYSA 4QRUA 1BVLB 4HFUL 4OI9A 4NRYA 2GFBA 4R3SB 1RHHB 4KV5F 4Y4HC 1BX2B 1MRFL 2FL5A 3MO1B 3SY0A 4NWTL 5F6IB 5LXGL 3D85A 5IVNA 2P45B 2ZOLB 3C5SB 4FNLH 4NN5C 3QNXB 2PTTA 1B4JH 5JDSA 2B4CC 3M1BB 1I9EA 4LSTH 3VXQB 2VR9A 3WV0A 4HMDA 1CDHA 2Z91A 1DQMH 3DUUB 5SWQA 3UTPE 3HN3A 3WCYA 4L9LA 5ESAB 5F8RC 3LSOA 3SKMA 2VTFA 2R23A 2CKBA 3D25A 2CKNA 2E8ZA 3HAEG 2HJLB 4U7SA 3ILPA 4KMLB 2AQ1A 3DX6B 4U7KA 2FECL 4GLRI 5D6CB 4LLVA 5EBWB 4P2OC 4PTTA 1SVZA 3BDBA 2ZUVA 1JPST 1NCAL 5FO7B 5TDNA 1AO7E 2DL9A 3RTQD 2D03L 1NGYA 1UWXK 5I75B 5EZJB 3V6OC 5FGBC 2BRQA 5I8CB 3KJ6H 5E0QA 2UYLB 4AH2B 3QFJD 4OV5A 1QLEH 1QQDB 4OZHF 1J1XH 1BJMA 3IB4A 2I5YL 3SGKA 2ESVA 2CIIB 3P77A 4P2OD 5FKAA 1O0VA 5FYKU 4FG6C 3GSNH 4ORGA 3IVKA 3ZYIA 3N1MC 1NGWA 1K4DA 4NKMB 4WY7H 4BFIA 2PYEA 4WTXA 2VXUL 1EJ6A 3BIBX 1BOGB 3SGEH 4HBCH 3VXUD 1BVZA 1DUZA 4I77H 4NRYB 4HUXA 4I4WA 3SN6N 3ILQC 1I9JH 3SHSA 1MHPH 3P11H 4N1CA 1BD2D 3G6DL 4HWNA 4Z78B 4Y5XC 4XC1H 5JPNA 4FG6D 1JIBA 5EIQA 1V7NH 4L8SA 2UWEB 1OB1B 5I30H 4U31A 2YPLD 5HD8C 5D8JH 5DFTA 2X4QB 4JRWA 3BGMB 2IQ9L 5GS1B 1P4IL 2PYFB 3MRNA 5FGRA 2NW2B 3L7FB 4Y5XA 4HS6B 1DSFH 4NDMB 2BNRA 3J7HA 3T3PE 4J2XA 1CDGA 2VN7A 5E08H 3IDXL 1EUTA 1K5NA 3QEHA 3RJQB 3SKMB 5GIRB 1MELA 3S9DB 4XP9H 4UQ3B 2YEZB 1S8DB 1UM6H 5CP7B 4IRJA 4PJ8B 3MV7E 1NCWH 2V7NA 32C2A 4P23B 3FT3A 3GBLA 4FQ1L 1KT2B 5IR1B 4UTAL 3KYMB 5F3BB 4MSWB 1UM5L 4P2QB 1I3RB 5IB1A 3I75B 4DOHB 5TE6L 4Y5VA 4FXKA 4LLWA 4X5XA 2UY6A 3G5ZA 4M6NH 1CFSB 4N0CC 4K7PH 2YOCA 2FATL 4WEUD 4JFEE 2J88H 1HDMA 5L0QC 4PGDB 1BQHB 4H0IA 3VXRE 5SX5H 2AJYL 2E7HA 1L4IA 4NRZA 3P77B 5L7XL 3DI3B 4NRXB 5M95B 2FO4B 4L29A 3Q1SH 4KXZH 2VXQL 4TULH 1NUGA 4HK3J 2DLGA 1K4CB 3MRHA 4J8RA 1ZTXH 4I3RL 4XVJH 4UIKH 4IDJH 4JG1H 4J4PC 2FYYA 5D7LD 4GQPH 1R3IL 2C1OA 1Z3GL 1YEFL 4K8RL 3AU1A 1CDUA 1FDLH 4F9PC 4MD5A 4Z78A 1DBBH 3GBNH 3B83A 1G1YA 3L95B 2WQ8A 2DM4A 3R06B 4QRRB 5JZ7C 4U6VL 3IDXH 4OF5A 3ZE0F 3RBGA 4QTIH 2X1XR 3MSPA 2NX5B 1LVEA 3G6JB 3GSVB 1I1YB 3MODL 2NY2B 1IGYB 3TESA 3U4BL 1T22A 5LGHH 4XCCH 1CFVL 1UCBL 1E4WL 2JIXB 2A6KB 1BD2A 5K9JH 3DGCR 5L2KB 4JRYD 2AJZA 4MJ4A 3BZFA 4ODSH 2MPAH 3VE0B 3EAKA 3QQ4B 3Q6GH 2DM2A 4O51B 4U0RB 2DLEA 4JO4H 4UDUA 4C56E 3D0VB 3O6KL 4U1JA 4PJGF 1AKJB 4FQXB 4F9LC 3JWOH 1NMBL 1Q9WB 4FFVD 4ZYKA 1I3RA 3F7PC 4FQ1H 5GRUL 2R0WL 4JY4B 3OKEB 2IPTH 4HKJA 5GGQL 2HFTA 1FO0L 2FBJH 3HNSH 4YFEA 2BVOB 2NR6C 2BZDA 3GHEL 3TZVC 5C6TL 4ODSL 4FXLA 4WW2A 5CGYD 2BNUB 1AQDA 1XR8B 1ZANH 5C0EB 3GSWA 1JNHB 4PJAE 5C9JA 5DRWB 2NNAA 3EYOA 4ZS7L 3JBG7 3I6LD 2EH8H 3QQ4A 4R97B 3IGAA 3RVWC 3TEUA 3V5KA 2ATKB 4P57A 1P4LB 5I1IH 2FD6H 1K6QL 4DFIA 1S7VB 4LCUA 4ODXB 3D3VA 1MVUA 2P49B 4PRPB 2X44D 4GUPA 1AP2B 4D9RE 2EDWA 4JFDB 5HDBE 1AD0A 4F9PA 4PJGB 4UIKL 2GJZB 2ID5A 4LLDA 1S78C 4K9EL 1JN6A 5D7IA 3TP4A 3K1DA 2BDNH 4P4KB 1A7PH 5GRJH 3C8HA 1U42A 4U1LB 3HMWL 5L88L 3DTXB 2OJZL 5DGRA 3MFFA 4O58H 2FIKA 3O8XC 4PR5B 3MJ9H 3DV4B 5AUMB 4JM2F 4L4VE 4LSSH 1M4KA 4YZFF 4TPRH 5MHSD 5KTEL 2D7MA 3RWJA 1RZ7H 4JO3L 4LCCB 1PZ5B 1CICD 2KBGA 4N5EC 5IUSA 3DVNB 1IAII 4HPYL 2MPAL 4HIHA 4JQVC 4JM2D 4AEIH 3HNSL 4PRNA 1R5WB 1TENA 3V6OE 1XGUB 4YHKH 3HZVB 4JGJA 3WNKA 1QACA 3UTPD 1IT9L 4FTVA 4NUGH 5TFSH 4JFXA 4JKPL 1CGSH 1YUHB 2WBJA 4R2GD 3SE9L 4XXCA 2DQHL 2E9BA 5ALBH 2QEJA 4JFEB 1X9QA 1XH3B 4M9OA 1KB5L 4Y16D 5C0FB 4OCLC 3ZO0A 1AR2A 2B1HL 2F19H 2LU4A 2I60H 1ETZA 1JNLL 1X3DA 4HUMB 4Y7MA 1EPFA 4MB3A 1UM5H 4KKLD 5KJRL 4NM8L 2VZUA 4MYWB 1LDSA 4ODXA 1J0IA 1XGTA 3TO2B 1CWVA 4PJHA 4G6JH 4NQSA 5IT2H 3L3HA 5DJDB 1U3HC 1SYSA 5ITBL 4WHTB 4K9EH 2DQHH 3QP3A 1HWHB 4B7LA 3BGFC 2VISB 1TZIA 2YPLE 4IBLT 3BYTA 3CFKB 1YY8B 1KN4H 3NPSB 4H1LB 3BX7C 1QSFA 3L3GB 1VFOA 3M8OH 1KJ3L 4U1SB 5L2KD 4O58L 5IGXH 4NQUA 4DAGL 4MJIB 4POUB 1F3DJ 1KEML 3U7AA 1YQ2A 5IM7A 1TJHL 4J3VA 3T4AA 5DJ2A 4OM0H 1TNMA 5DURB 5TGBB 1T0NB 1U3HD 3G9VA 2BVPA 1I3VA 1S9KC 2E7MA 2C5DC 2ZUQC 4ZD3L 3CX5J 1YNLH 3BP7B 1FVDA 4HS3A 4WHTA 5DD0H 3T4YA 2YWZA 4FP8L 1NFIB 4D3CH 5CWSB 4GXUN 2MKWA 4IIQA 2YC1A 3GMRB 4LRIA 1E6OL 1OL0A 5HHQA 1U8LB 1QA9B 1N0XL 5EZIH 3FQWA 3NZ8A 4NJ9L 1XF2A 5DMIL 1WZ1L 2R2CA 3FB7B 3N1QC 4RMQA 1CLYL 3SDAB 1SJXA 1URLA 1NC2D 4MAYC 3GBMH 5D7KD 4FQLL 3OSKA 1WBXA 2B1HH 1K2DA 2PETA 1BPVA 5TGBA 5C71A 2XY2A 5J13B 3STBA 1CICA 4E0RB 2ZUXA 2CLZA 5ID1A 3EJZC 3VA2C 3Q6GL 4IHOB 3UCRA 1SEBB 4YEEA 2IC2A 1RSFA 5CP3A 4MA1B 4GRWF 3T8XB 3FMGL 3ZYJA 3G6JE 1JHLH 5HYJD 1DCLA 1RIVH 4XP1L 2IADB 4OZHB 4PJ5A 3PQYD 3GMOA 3MJGX 3MXWH 1P7QA 3HFML 4OZFA 4WENB 2IFGA 2BX5A 4XRCA 3WEXA 4MB5A 4DVBA 4LLMA 1R3HB 4JREC 2DTSA 1UH3A 1NL0L 1WWAX 4F37F 4PJ9C 2QHRL 3KYKL 1M6OA 1M7DA 4XHQA 1AGDA 3ZDXE 4JY5L 5E99H 4F57H 4AIXA 1KOAA 3FQRB 1FV1B 2FZ3A 5I8CA 2VL4A 2Y4SA 3VFTB 4BYHA 2AAVA 4EQ2A 1WLHA 4BZYA 3VFWA 3O11B 4LVNB 4YPJA 1SEBA 3JVGA 3BISA 3LS5L 2X40A 1DQDH 2GJ6D 4RISL 4AY0A 1ZT4A 2FJHA 1T89C 3HTLX 5K59F 5C08D 3S88H 3T2NL 4KZDH 5I1EL 3MV7A 3FRUA 4PP2B 1FG2A 4PRIE 2JJTA 3V79C 1VKXA 2AV7A 2FWOB 3BPNC 3HE6C 5DMKB 4YXKH 1OT1A 3DETD 5I0DA 4I0KA 1JHTB 4HUWB 3FL7A 2H41A 4DKAA 4JHZA 1NEZB 3O41B 5IKCB 4OB5H 1QBBA 1VERA 4H25A 3CJJA 3BESR 3HNTL 4JZNA 3VFMB 3NFPA 4N9GA 3OJVC 4KZEL 1FAIL 4YUEH 3BKJH 5GGRY 4D3CL 4LCIL 3B43A 4M6AA 4R0LC 3S6CA 3VCLA 3VWJC 1MJUH 3PG2A 2BRRH 1EIBA 4LHUA 1DVFD 1L0XA 1YMHB 3MV7B 4ETYA 3VWJB 4M61A 4PP2A 2C3VB 4XCFL 4LP5A 2IH1B 3H9ZA 5GRYA 2Q1EA 4D0BB 3NZHH 2HKHH 1K85A 1NKOA 3R8QA 5DK2B 5HYSB 1FNGA 3O81A 3TNMA 3GRWH 5I71B 4TULL 3QWOA 1ND0A 1M71A 2GFBB 3AROA 2DRUA 4EVNA 2UWEE 2WUCH 3W39B 2FO1A 4NGHL 1RK0B 5IQ9A 1R3HA 3F7YA 2ZSVA 3MXWL 1ZVYA 3ARRA 3WS6C 2XY1A 5FKAB 4YHZL 1JPGA 1NLDH 3VGBA 5I1HL 2O61A 1IBGH 1XCTA 1KULA 5DD1L 2ED8A 2F74A 1IAOA 3D1MC 1HZHH 1U36A 1CIDA 4M4RA 4KUZL 1E4WH 3MA9L 3WLWC 4Y5VC 3RZCB 2H45A 3U4BH 3V7MA 1VGEL 1FN4A 1JUFA 3K74B 4L4VD 1PLGL 3UTSE 2R2EA 3TLRA 4Z7VE 3VWKD 3C8DA 2CGRL 4OIIL 3V0AC 4I3SL 3S36H 4JO2L 1ZGLB 4KKCC 1T0PB 1FAIH 5HPMB 2PO6B 4WI7A 5SWZB 3T0AA 1KEGL 2KUTA 2YSSB 1P2CA 5DEFA 4LDLB 3WD5H 3MUY1 1FZMB 2C3GA 4GSDL 1S9XA 3BVNA 1MLCA 5CD3B 3RPKA 4S2SA 4HD9A 5GGVY 4CKVX 1KFAL 4Y2DA 5KVFH 3FQNB 4HC1L 4ZPTA 1D5MA 3PDOB 2NZ9C 5T33L 12E8L 1TTGA 3F5WA 3G5ZB 4IRZH 4OQTL 1ZGLM 2YPLA 2A77H 4Y2DC 1MCNA 5D6DC 1YJDH 3UBXG 4ODUB 3FKUS 4DKEH 5F3BA 2YUWA 1J8KA 1V8HA 4NNXB 4G43A 3VXPB 4QRTA 1A7NH 4NP4H 4Z7WB 3SO5A 5FB8A 3GSQB 3QUZA 3SKNA 3V4PL 2R1YA 3SGKC 3VDAA 3NZHL 1QRND 1AKJA 5I1CL 5A3ID 3UPAA 1A4KB 1XCQA 3OPZH 2G5BA 1KV3A 2R0LL 3I9GH 2GSIA 3HZKB 4KKAD 5HI4D 1DQJA 2D9QB 1EEZA 3ECBB 1BWMA 4NNYA 2PN5A 3O6FB 3ARGC 3AS1A 3TBWA 1T1WB 1IKFL 3RJDA 1A6TB 4O4YL 1LILA 1QVOA 1NSNL 5C0EA 3MMEB 2OL3A 4GT7A 1YJDC 1JPTH 3BPCA 4OLYL 3O4LA 2OR9L 5IFAH 2NY7H 1Y18A 2VDRL 2EDNA 3LKSA 3SKNB 4BFBD 2QR0A 4PJ7F 1W72B 4I13B 1FSKC 4K23L 4P4RA 4XNXH 4AMKH 4HXBH 4XPHH 3V4UL 3CH1B 3NH7L 3ARGD 3E0GA 1QSZA 2UZXB 4YFLF 3V5DB 5HHXL 1RUKL 4F7EB 3H3PH 3DX7A 3D39E 4U1JB 2G2RB 2E7BA 3MV9D 3PP3K 2XQYG 5MP6H 4JKPH 4AEFA 2GJ6A 2XXCB 4OLYH 1IT9H 1XMWA 1WFTA 4K3EH 5D7LA 1N6QH 4OKDA 5C09E 2G9HB 2AJZB 3DOSA 2H6PB 1A6UH 1U2CA 3VE0A 5D7JD 4F58H 4POZC 5JHDB 3BP6B 1S9VB 2PW2A 1MI5B 2IANE 2RB8A 2FIKB 3QDHA 1VFBA 3EBAA 4LKCA 3QIUA 3MA7A 3FONB 4ALAH 3VD4A 2DD8H 3ES6A 3BKYH 3MRKA 1AR1C 1JMZA 5IFHL 4UB0H 5F1SA 1UVQB 4MJ6B 3LKOB 4R7NB 1RY7B 1KJMA 2NXZB 3FFCD 2X9WA 5A16B 3FO0H 3BKJL 3S4SB 2HTKC 3WKMH 4R6UA 4Q2ZA 4F15C 4R4FH 1JYNA 3OL2A 1QZ1A 3NCCB 5ACZA 2EDFA 5FOJA 3VRLE 3VXRB 1T7YA 5DRNA 3UBXB 1WGOA 1F3JB 1YNKH 1HHHB 4WWKB 1JZ4A 3I84A 4ZFZB 2XPGB 2NY1C 3QFJE 2AQ2A 1G0YR 2D0FA 5IG7B 4NO5A 1S9VA 1IGTB 1KJ2L 1AR1D 1G7PA 1RZIB 3MCG1 4XNMB 5IFAL 3PNWB 5IV2A 2OZ4L 3GRWL 1OAQH 5FECB 3WLBA 4H8WC 3ARBA 3W9DB 4IMLA 2Q8BH 4QRPA 3RKPA 5GGTH 2Z93B 4MA7L 4G9FA 4RFEA 3P4OB 3SDCB 1MUJA 3ARFA 2VXSL 2ADGB 3O2WL 4RZCA 5EOCJ 1P1ZB 3X13A 5L8KB 2HKFL 1MFCL 3MFFB 5D72L 3SGEI 4R90L 5C0AD 1HOCB 1J0YA 3GJFA 3KPSA 1L0QA 2VKXA 3PL6A 3F7QA 3BGFB 3AY4A 2H3NB 1ADQL 5ITFB 1MJJA 4QWWD 1A3RH 1TZIB 1N6QL 4QGYA 2CDGA 1YY8A 5ISZD 1QKZH 4YO0B 3KLHD 3TV3H 1R5IB 4OTXH 5TDPB 4N8VB 4NIKB 2W60B 3DUSB 5EULV 5FECA 4PJHE 1BFSA 3ARBB 3W9DA 4CNIB 4XPTH 1EAPB 4G8GE 4XVTL 4KMTH 3FFCA 5MP6L 1OTUD 1EJOL 3TZVB 3S3SA 3MBXH 4MX7A 1Q9OB 1SJHB 2R1WA 2YK1H 4DUXA 2RFXA 2ATKA 4P57B 5MEQA 4QTHA 3G5YA 3TA3A 5GGVL 2Z35A 3LRGA 1H8OA 2P5EA 1QFPA 3FT4B 5HHOD 2FD6L 5GSVA 4FZEL 2F9BT 5DQ9A 5GGRA 5T3ZE 2QSCH 5C07D 4Y1AA 2LE9A 3TNNB 1SM3H 1J05B 3LKNA 1ED3A 1MJJB 4R4NC 4TNVK 4RAHA 5BVJB 1N64H 2VZ1A 3S4SA 3ZDYE 3EJYD 1OTUC 6FABL 1VCAA 3KPQB 4JY5H 5E99L 4KMQA 1LO2L 3U0WH 2LAAA 3TIEA 3Q1SL 4GAGL 4DQOH 1R6VA 5C0BD 1CGXA 3L3JA 3KYOA 2C1PB 2VMFA 2GTZB 3F65A 3GB7A 5I0ZA 1IILE 5IK3B 3LKPA 3W5NA 1UXSA 5IEKA 2HLFD 3QUMH 2MQCA 2JTDA 2OJZH 5HDOA 1YN7B 5ISZA 3LKQA 1NAML 3T4AB 1WVZA 4JPKL 1N7ML 4PUBL 5DQDH 1D5ZA 3RI5F 1TZHA 1RFDL 5DRZA 5EBMA 2WBJC 5LAXB 1OT2A 5C0DA 3UDWA 2OQJA 1RJLB 3QDAA 4DGVL 3NIDE 4WHDA 5MEOA 4YDIL 5BV7H 4RMVA 2BOCB 3ZE0E 4YHOH 5C09A 4UNVA 4M7ZB 3VFVB 1A1OB 1LO5B 1NSNH 1W72L 2CDEA 4UT7H 4RFOH 3SE3C 3PQYB 4HK0B 1R0AH 1I8LC 3SO3B 2VDRH 5INDA 4YJZL 4S1DD 4AK1A 1QKZL 5E2JA 4PUBH 5KSAA 2DWDA 3E6HA 1PGRB 3EZ8A 5EOTA 3TA3C 1N0XH 4AQ1B 5E1HB 5KOVC 4LLYB 1BQLH 3DO7A 4R8WL 4OIAA 4NJAL 1G7IB 3S35L 5B38G 1JMXA 3H8NA 4XNZC 5D2LF 3G6DH 1JI1A 4U49A 1NC2B 3PV7A 1HHJA 5C6PB 4B7IA 3BIKA 1FFNA 4MAUH 3H7LA 5MERB 3KR3H 4S1DC 1I7TB 5HDBF 4DEPB 5C0CE 4HIJA 5KW9H 5F1KC 1U3YA 1T3FB 2RR3A 4YHZH 3TYGH 1QO3A 4O2CB 3CU7A 3RVXC 1YEGL 15C8H 3PGCA 3W9EB 1CL7L 3GSRB 2VJXA 2FZ3B 4WFHD 3PIQB 4MAYB 4A2MA 5DC0A 1K4DB 5FCUH 3SDAC 2DQJH 4BKLB 3I6LE 5IK3A 4YK4B 2CK2A 1G7IA 3RDTC 1U2HA 1FCGA 4LQFL 5FYJU 3IDGA 5CZXC 3N1PC 2BJML 3ULVC 1ZEAH 1NGZB 5ELIA 4ZAKD 2MTPA 3QHZH 3BSZL 1IQDA 5T1LA 4NWUL 1BQHG 4MDJA 4PGCA 2AI0H 5TDNB 4OF6A 5DMGC 5D5MA 5EUOF 3WUWA 1BLNA 1CXFA 4CADB 5I8KL 5FHBL 2AV1B 2NPLX 3ARBD 4QHMB 1G84A 1T2QL 1MCEA 4PJBE 4YR6A 5HD8D 3HE6B 3WIHA 4F7PB 1IAOB 2XA8H 3SPVA 3QZWA 2CUIA 3V6ZB 4TPRL 4WI3A 2VXQH 1FFOA 1D6EB 4JFFE 1EFXD 1BQLL 2FEEL 1TTFA 5IVZB 2LTQC 1FJ1A 3DARA 4Y4FD 3OJMB 2XICA 3C6LD 5E2WH 4PJXB 4HMCA 3AMKA 2A38A 5IMLB 1T7VA 4NZTH 1XF3B 4GBXB 3B5HA 4QF1A 4RFNB 5GPRA 5DRXB 2PTTB 1UCTA 5ENWB 3D2UD 3ROLB 2VZSA 3QCTL 3M1BA 5DUBA 5IW1B 3K3QA 1M05A 3FB5B 3QXDB 4JREB 2IAMA 2ITCA 3O0RH 5IHUL 1LE5B 3BN3B 4R7DA 4G8IB 4MXWH 2CR3A 2XNAA 4M61B 2I9TB 3P4NB 4Y4FC 3KPLA 3C6LC 2ATPB 1T3FA 2JJSC 4P23C 5CMAA 1KXTB 4ZUVA 4RBPH 3FT2A 1DLFH 1NC4B 5CKAA 3RY5A 5HHOA 4MA1C 4JFHD 3L3IA 4KV5E 4GOSA 5ICXB 4XP6L 3T08A 3RAJL 2PTUA 4ZXBB 4UT6L 3C5ZD 4JDZB 1XF3A 1A9EB 2W0FA 3OJ2C 1LO4H 2OL3L 4UQ3A 1M7IB 1PX3A 2GHWB 2J5LB 4Y4KB 5C0AE 5DD1H 2DTMH 2VZOA 4GKOA 1GH7A 1I8LA 5I30L 5D6DA 4YXHL 2GEEA 1D9KA 3IKCA 5F7WC 5I66A 3G6AB 1X6LA 2CD0A 4G7VL 4MQ7B 4J4PD 2XZZA 1OCWL 3NFSH 1JGDB 5T3XD 2H8PA 1INQA 5DJXA 4TYUA 4XI5D 3QHZL 1FN4B 4G42B 1E6JH 1NC4A 5I6XC 3P40A 1CI5A 1E28A 3MGAA 3MV9B 3CDCA 5IJVB 3FQXA 4FQQA 4BFIB 1FH5L 3MRMB 5E24E 4ZG1A 2AJ3A 1G9MC 1Q94A 3C8KB 3MRFB 5C3TA 1MIMH 4NNPL 2ORBH 4L4TE 1OCWH 2EE6A 5JPMA 1NUDA 4CJ0A 5C07E 4G6KL 1CXHA 5GHWL 4ACPA 4R4FL 1OSPH 4S2SB 1KACB 2NXYB 1BJ1J 2IALB 4YWGL 1YEHL 3AC0A 5DJYA 5CCKL 5I75C 3T0EE 1RZKC 5LWYH 2YXFA 2B1AH 4J6RH 4FFVC 2NW2A 3ALWA 3L7FA 5DHYA 4HLZG 3VRJA 1RU9L 1OAKL 2Z92B 3TBVA 5K93A 3OZ9L 1FG9C 4LNRB 4XP1H 2P5WA 2NR6D 4QRRA 3S34L 5EH1A 5D7IE 3TZVD 1ES0A 5DFWH 1HHIB 3VFPB 3F7VA 4RGMB 2X4PA 3B4NA 4OT1H 4LQ1A 3AREB 3ZTNH 3FO2A 3RWIA 4D0DA 5CSBA 1CK0H 4J12A 5CINH 4LKCB 3STZB 1XZ0A 2EZ0D 3OGOE 2R0ZH 3D6GA 1U6AL 4DEPC 3V8CA 2V7HA 5EUKB 4UDTB 4LMQE 1LP9F 2YA2A 4LOUD 1DQJB 4YHKL 3ABZA 1OTSC 5FXCH 1B4JL 4X6EB 1EMTL 1ZLVH 5DSCB 4QTIL 1U9KA 4X7SL 4Y5YA 4PJIE 1XGQB 4YXHH 2D2OA 1CFVH 1UCBH 3QIBC 3ELAT 1B0RA 1Y6MR 4MNQA 3KXFA 1ES0B 1S78D 2DQJL 3MRJA 4JPWH 4OTXL 2ZKHH 4ZPVA 4HZLA 1VACA 3LN5B 1H3VA 3BHBB 5HVFB 1W2KT 4N1HB 4HGMA 4WO4B 1RMFH 43CAA 5EORH 1QBML 4P49A 3ARFB 3PHOB 3O8XD 1UACL 4ONGH 4FHBD 4X4YB 4YWGH 4C57C 4OM1H 3VXME 3HKFA 5L8JB 1CDBA 1RAMA 5KVGL 3A6BH 1F97A 1Z0MA 2V7NB 32C2B 1TITA 4XWGL 1PDKA 5JPMB 4N0RA 2QQNL 2UWEF 3DHJA 3RVVC 1QHOA 2Y72A 1HINH 2EKSA 1ACZA 4FQCL 4WW2F 1QFWL 3JTSA 4UAOC 4W6WB 2YWYA 1JK8B 3MCKA 1H9VA 4LPTA 4DUVA 1BWWA 4PJ8D 1UEYA 4Q0XH 3OAYH 3RWGA 5D93B 5JA8B 4MVBD 1A6VH 4H20L 2JCCA 3LKOA 4R7NA 5DQJA 3MGOA 3HB3D 2Z35B 4NN7B 1JPFB 1MNUL 5I17A 3C60B 1OGTB 3MRHB 4MZ3A 3RWJB 1E4KA 4HX1B 4OSUH 4O2EB 3EFDH 4ZTOL 1DZBA 4EN3A 5F96H 4O00A 1G6RB 3QEQA 4U6YB 2HRPL 2WSKA 1BD2E 3CDGB 2D7TH 5DDHA 1NFDF 4HJJH 1YY9C 3QIBA 4P3DB 2VLLA 5ETUB 4U0RC 3QUKA 1KCKA 2GT9A 1LEIA 2YMXH 5ADPL 3BRFA 1FNAA 4R90H 4UV4L 4XCYB 3WJLA 1ZMYA 3CXDH 1ZLVK 3KS0H 1T1YA 3BHBA 2D9CA 3ARTA 5I15H 1ZWIA 3LEVH 3UJJH 4KHXL 3I3DA 3RWEA 2XG5A 5MENE 4JFQA 1OPGH 1AP2A 2WLYA 3ZKND 4PLJC 1YY9D 4QOKE 4MNQD 3LH2L 2WV3A 1RMFL 4O51A 4XH2B 2LVEA 4QRPD 5H37H 3MLZH 3BH9A 1XGTB 4HZAA 3KJ4C 2YA1A 1XIWA 4NQCD 1VFMA 5INCB 1CLCA 3TYGL 2BXYA 4Z7UB 1TFHA 3HG1E 4MDIB 4MX7B 3PWUA 3RHWK 1HILA 1TVBB 2UUDH 1HQ4B 4HEPG 3KPMB 1OW0A 5E6IA 1Z6JT 4DOHE 3GM0A 1TQBC 4NFDA 4NN7C 1JL8A 1A4JA 4AIZB 1H8NA 5E03A 3WHE1 4P2YA 1OD7A 4G9FD 4WV1B 4HIHB 5DJ0B 2GY5A 1YN6A 4X6FA 1RURH 1MCSA 4F8TA 1YN7A 2ZJSH 1FFNB 4PBVC 1DL7H 2IG2L 3HR5A 1RD6A 4L8SC 4PB0H 5T1LD 4WCYH 3GB7B 3LPGA 2I07B 3PDDA 1FL3B 3P73B 2HFGH 3QXAA 5F7KC 4PYGA 5E9DD 4L4VB 1KXVC 1EHLL 5KSVB 1NAMH 5HYJA 2CUMA 3OGCB 4LCYB 1QR1A 5C8JB 4PJAF 4HXBL 5FYJL 3DURA 5EO1B 4L5FL 5I73C 2RQ8A 4WRLA 3DX8A 1AGFA 1CLOH 4QYOA 4IHOA 5CLWA 1BEYH 3DNKA 1TZGL 2DBLH 3DIFA 5C09B 1AQKH 2HT3D 1H15B 3T3ME 1HIML 1WFUA 2YD9A 1LDPL 5GRUH 3MROB 2ZCHL 1U3HB 3IU3A 4MDJB 2YPVH 3CZFB 1KPVA 1FNSH 4XT1C 1FZJB 3VXNB 2PYED 4JANB 2A6IB 1A3QA 4JCLA 4L8BB 3ARED 4M43L 1KTDB 5JO5B 1ZANL 3VFGL 1P84K 2DKUA 1KELH 5GGSA 2Z91B 3IDYB 4X6DA 1BF8A 4GG6A 1LP9E 4K94L 5LBSH 5CHNB 5IQ7L 3MJ7A 5I2IA 2OX5A 3O3DB 3S97C 4N8PA 3WO4B 2RHEA 1S9YA 3S36X 1DVFC 4D9LL 3VW3L 4NO0B 4M93C 2BXZA 2JLLA 1ND0B 3OF6D 1INDH 1ZLSH 4L4TD 5IBTH 1ZT4B 1U8NA 4NQEA 5GS3A 5JLZB 1RZJH 2QADD 2FLBT 2QQNH 3I6KA 4G5ZL 3QXVA 4U1IB 2XKNB 1UJTA 1DBMH 2ICWI 3AREC 1A4JB 4KTEL 1KIPB 1P6AB 4HIJB 4JO1H 3BI9X 1MCCA 5EU6A 2ZCKH 4RGMC 1JNJA 2WWMC 3P9LB 1GGIL 4FFWC 5KANG 3VH8G 3QB7C 1SYSB 2BK8A 4OD3L 3NFNB 2VITA 2WINA 4L9LC 2DJ4A 3GMQA 1T89A 3MV8B 1NBYA 1UA6L 4JFED 2RIKA 4JN1L 4GRLA 4DTGH 5I74C 2MMXA 5DS8A 3KPPB 4OLZH 4AENA 1CVRA 3RNKB 2H32B 1ZEAL 3LQMA 1GGYA 2Y36L 5DD5H 2VE6B 1A7BA 4IM8A 2HFGL 1A7NL 1KIUA 3O3AA 4NP4L 1NCAH 3DUUA 1FH5H 5SWQB 2WWMD 3NN8A 3E3QE 2MQ3A 4DUWA 4KKNA 3QEGL 1LEKA 1MIML 4NHCL 4UV7H 5EU6B 2ZCLL 4P3CL 3S37X 3GK8H 1QBAA 3OB0K 3V4VH 1HN1A 1TETL 3AGVA 1DR9A 2HH0H 1NDMB 2HJFA 1H3GA 2NLJA 2HG5A 1SY6L 5SX4I 3IDNB 1J5OH 1MFAL 5T3ZL 1GIGL 3O11A 2R23B 5F6IC 4JR9H 3ROLA 1G7LB 1T20B 2VL5A 4NM4H 3RY6C 3SKJL 1JGUH 4OZGB 3L3KB 3WFHB 3B8SA 5A2LH 5DJZA 4G80A 3FJTA 1JF1A 4ONFL 4F3FA 2XACC 4Z7VB 15C8L 4MAYA 4UNUA 2P5WD 2WBKA 5CHNA 4GW1B 4A6YA 1I3GH 1A2YB 4H8WH 3QHFH 4L8CB 3GHEH 4XAWH 4B0MM 1FZOA 4JFPA 4N0UE 1OOAA 3G5VA 2I5YH 5H2BA 2NY3C 2EDYA 1I8KB 2FL5B 2W38A 5GGTA 3CMGA 1FC2D 1NDMA 5GZND 2OLDA 1S7UB 2R9HC 4Z77B 4OD3H 5EIIA 1Q0YL 1RULL 1P4IH 2JK5B 4LU5H 4OCRH 5EN2A 1DLFL 3O2DH 4G8EA 2X4NA 3VGFA 4APQD 2V2XB 5ALCH 3C6LB 1KIRA 2VDNL 4EBQL 1KLUA 4X7SH 3IU4H 1IM9A 1ORSA 4QRQA 1MJ8L 5JA9A 1P69B 5HI4C 3G6AA 3H9SB 3N1GC 1NCDL 3TN0D 1CYGA 2O26U 5DURD 5L2KE 2C3XA 1JZ5A 4JPKH 1JGVH 1RFDH 4Y1AD 2HMID 2X4RB 3GMLA 4BK4A 3IF1A 2YUZA 4Y5XB 4L29B 3QUYB 4FQXD 3T0DA 1QBMH 1GSMA 2VQ1B 4U1MB 4OCYH 4FP8H 4ZO8A 5E95B 3OX8A 2DMBA 3ARXA 2FCBA 4NCC2 4NQTA 4XWGH 1OM3H 1BECA 5GJSL 1EGJH 4HWBA 3LHPH 3QRGL 4JRYB 1EH9A 5T3XL 1M05B 3FB5A 1JV5B 4I8DA 4NN6B 1O7SA 1RIUH 2KH2B 3CUPB 5D7JA 5F1IA 3DMMD 1MREH 3KLAB 2VB5A 3WKNA 3WIIL 5I6XB 2BY1A 1UB6B 1QR4A 4K55A 4F7MA 2COQA 2ZG1A 1A6TA 1J18A 4JQVA 2FX9L 5E5RB 5D7JC 4KVCL 1CZ8L 3L5XH 4IRJC 4ZSOE 5J9PA 1YEEL 5L2KA 2W0FB 4YHIB 4GFTB 3HNVL 1ZGLA 5HYJE 1NBZB 1ZHLA 3A0OA 4X6CB 5ANMA 5AAMA 3RGHA 4P5MA 5H8DA 3W5MA 1S5IL 5JW5A 3K8MA 4ZUSA 2W65A 2AJUL 2OL3H 5E6YA 5KAQG 2A73A 1EK3A 1FRGH 5CJ8A 3T65A 3VXRA 3I3EA 1G9NL 4H1LG 2P5WB 2DF3A 1VEPA 1A14L 1CBVL 2G60L 2IBZY 2FYYB 1ODAA 2SEBB 3EYVA 4YBLC 1XIWC 2C1OB 3TN0B 2XKUA 2XFXB 3VG0L 3QIWB 5CLTA 3ZKQD 1K4CA 2V5MA 3BZDA 4BSJA 1DBKL 4FA8A 5L2JB 1IGML 3FAXA 5F9WB 1XF5B 2GYSA 4BH8A 3BP6A 5DC4B 4U0QB 2AEWA 3B9KA 3IF1B 4YH6A 3BQUB 3PP4L 1JWSA 3LH2H 2D4DA 3QI9D 4PJFB 5GGQH 2Q6WA 4ELME 4ZO7A 4PJAA 3LEYL 2H3NA 1RUPL 1J12A 2P8MB 4W68A 4OGAD 5HPMA 2VDOH 4P2RE 5DYOB 5E8OA 1A7QL 3STLB 5CAYB 1QLFA 4WGVB 3QA3B 4TNVF 1F6LL 4S0TD 4FQXA 4HUVA 1JZ7A 3INUH 5D7IB 3OJDA 5E7BA 2DQIL 1WSST 5CUSH 2FGWH 3WHXB 4KVCH 3O4LB 2AEPL 1XF4B 5C0BB 1G7HA 3P0GB 4ALAL 5MEQB 3FOMB 5EU5B 3G5YB 3GBML 3QG6B 3LEYH 3GMPB 3ZSTA 2I26N 4OGAC 1TCMA 1JYVA 1Y0LA 4DCQB 5B4MC 2UY7A 5HGAA 2NNAB 3EYOB 1I1AD 1T4KB 3WYRA 2V7HB 5EUKA 4UTBL 3VXUB 2PKDA 1L7IL 5E4IA 4RA0C 1OAXH 1W0WA 2EE9A 4TUJA 1YEEH 4YAQB 3CVIH 2X41A 2HT2D 2X70B 2YD3A 4PRHB 4HULB 5D1QC 2OTPA 2BVOA 1KLGA 4YGVA 4AIOA 4Y8AA 1EBAA 4RGNE 3MUGB 1P84J 1X6NA 1S7SA 3X3FL 4M03A 3KG5A 3OG6B 4J3WA 1DFBH 1ZT1A 4LSVL 5J11C 1FRGL 2C9AA 2A74B 1VPOH 4I0PA 3EYUH 3NGBB 2F8VA 3DRTA 4HZLB 5IOPA 3UYPA 3GMMB 4UIMA 5HHMD 5ETUA 1ZLWH 4LARL 5IESL 3BPLC 5ISZB 1EO5A 2GT9B 1LEIB 1SEQL 2HLFC 4PRPE 2OTWB 4HAGA 1MCLA 3IJYB 3RKDC 1WTGT 2Y06H 1WEJH 4PR5A 1LDPH 5FDYA 3QEUB 1PKQE 5C0AB 3DV6B 3C2AH 3SE9H 1G6RL 3QULB 5F9JA 4X7CC 3PP4H 4UBDC 1F3JA 5TF0A 5DXWA 3SDCD 3VFNA 2A74A 1G0XA 4HK0A 3QPQC 3O9WB 2NCMA 4X8JB 1QBLL 1I1AA 1ZXQA 5I1LB 2W9DH 1A47A 1BFOB 3RKDD 3C09B 5A2FA 4MJ2A 3RL1A 3RWEB 4N0YL 3L9RB 5C08E 1RZ8B 5DD3H 4O2FB 1WTLA 3CFBA 1IZKA 3DURB 3E6FB 4YUEL 5KOMC 5AZEL 3UAJD 4KK8C 1B3JA 1GRWA 3U30C 2J8UB 5TFSL 1FYHB 1OM3L 4UBDD 3SJVD 5D96B 1ROWA 1VFBB 4TTDD 1EEQA 5AZ2H 1HH6A 1MHCB 3LD8C 3PWLB 3C08L 3BP7A 3QULA 2VWEC 2NXZD 3CX5K 4C59B 4BSWA 1QSEE 1ZHNB 1NGXB 5JQ6H 4JKKA 1U8MB 1A6AA 3UC0L 3U6RB 5J0BA 3PABA 1X4YA 3CFDA 2JJVA 3HPJA 2HP4A 3BEWB 3MLTA 2VWEE 1YN6B 4U05A 4XCCL 1Q9LA 1I9JL 2HRPH 4Q9CA 2VDKH 5F6HJ 3O45B 1I1FB 2DLFH 4X7FC 2ADJA 2DJSA 2Z31B 1ZT1B 4K8RC 4P4KA 4YC2B 2EC9U 3QHTC 4LARH 4LKXB 1G9EA 2A6JB 4I0PB 2J8OA 3HR6A 2YN3A 5B39A 3MOAH 1MCOH 2FR4B 4AIZA 2YMXL 5ADPH 5ID1B 3ULVL 5IROA 1HXMB 4AEHL 4NQCB 5BOPA 4CVZA 4QRUB 3E8UL 1A22B 3TWCL 1CFTA 4QRPB 5GGRB 4RFEB 3Q3GB 3P2TA 4LLYA 4MJ5B 4LHUD 2C7UB 5IIEB 1NEZG 3F12A 3DO7B 1EXUB 4XRCB 5CZXD 3SDXB 1RJZB 1MSPA 5IVXE 1RZGA 5FYJH 4NWTH 4KTDH 5LXGH 1WCQA 2XWBB 4HDIB 2WW8A 4K3EL 4BELD 2HN7A 4KGLA 3HC3L 5E08L 4X4ME 3O9WC 5DMGD 3MV9E 4OFYA 2EECA 5E7FA 4Q9QH 1IFHH 3D69B 1D6VL 2FR4A 3ARBC 3PWVA 4LSTL 3RAJH 2DLHA 4Y1AE 1P5VA 1OSZB 5KSBF 4M6NL 1OP3K 4HT1L 4QXGH 4QXTB 5EZIL 3M45A 3U0TA 1FVEB 1BBDH 1S7RB 1JRHH 5J8OA 5EUOE 1AE6H 4EI5C 4P2OA 1FIEA 1MFDH 5CEXA 2XZQH 1D5ZB 5TH2A 4PRDA 2VLME 1HI6A 4LVEA 3EOAB 3RUGA 2CK0H 3T3MF 4EIZC 5C70A 1I3UA 3VXMD 4ZTPH 3HE7B 3NFSL 3QSKB 4KDWA 3N50A 4G6FD 4PJEB 2E27L 2HLAA 3VFMA 4KROC 1F8TL 4WEBH 3HMWH 5ICZA 2NY5C 4XPFH 3LVEA 5JQ6L 2ADIB 4OLVH 4JFFA 3BXNB 4HIIB 1JYWA 4Z76B 4NUJB 1CQYA 2A83A 1JHKH 4CMHB 4WUUB 4CMMA 4I0PC 3OPZL 4QHNA 2EC9T 5GGUA 3ULUH 1JE6A 5KN5A 1CIUA 5IWLC 1KB5A 1PVHA 4YC2C 3EDJA 3FCTA 1PYWB 4KHTH 3VWJA 3VRLF 3SPVB 2X4OB 2WM0A 1GJIA 1T5XA 5KSUB 4JB9H 2RGSA 1S7WB 4GRLC 2CXKA 2WANA 3FB6B 4P5TD 1K9TA 3ILPB 3CPLB 5D6CA 4PY8J 5D7LE 3LS5H 4NUGL 1TJIH 1EXUA 1DDHA 5ICZB 1RUML 4I0PD 4WO4D 1OAKH 4ZOBA 1JHKL 1U8LA 3F7YB 3TV3L 4N0CD 4Q9QL 3MODH 1O5DT 1UADC 2H32A 1JHTA 4HUWA 4NQDA 2QQQA 1NEZA 2ZCHH 3U0PB 3U30B 2B39A 2O5ZL 3DX9A 3LV3A 5E2TH 4NOFA 4OZ4A 5K9JL 5J12B 1EJOH 3TVMC 3ARWA 4FQJL 3QBTB 4F7TA 1KTLA 5KSUA 2EXWD 4L3EB 4ZSOA 4AG4H 1JI2A 1ZS8B 3QO1A 3ETBF 5JW3H 3QCUH 4NHUA 4XZUB 3A67H 4FFYH 1I7RB 1CT8A 3T8XA 4QXTA 3U0TB 1A3LH 4D9LH 5GRWA 4E42A 5JLZA 3VMOA 4JHAH 3MRDB 4V2BA 4MSWA 5I1IL 1NLDL 4QOKD 2X7LB 2RCSH 5BV7C 3DX6A 3T2PA 5T3ZD 3TVMD 2Y7QA 4TOYH 1OGAA 3WFCH 1C08A 3DROB 3V7AG 1JGEA 3AB0C 1HYRC 1DUYA 1TJGH 3QXWA 5F89A 5HYEA 5D7IF 4RIRB 5AZEH 1MH5A 4XCNA 4K3JL 3ARGA 4OIBA 1U41A 3RZWA 3N9GL 1JWUB 3FO2B 1WJ3A 4R26H 1KYOK 1MI5E 2IANB 4IIQC 5TQ2L 4N8VG 5EZLB 4D0DB 3ULVF 5I1KL 2IQ9H 1PYWA 5EBWA 1R3KB 2WQRA 5EO0B 1KBGL 4EXPX 3VXPA 4KI5D 1UT9A 1J0HA 4RMWA 5LJYH 3EKCA 5JW5B 1O7VA 2DDQL 3QDGE 1PSKL 1A5FL 3QI9A 3QXDA 4R9HA 3TBYA 4HFWB 5F89B 1OTSD 3WIFB 2FEEI 2FX7H 3NPZB 1KTRL 2IH3B 1ZE3C 3E3QC 5D5MF 5ANME 1T20A 2VL5B 4RX4D 2BNQD 4XNQA 1GIGH 4B50A 4AEHH 4RAVB 1ZA3A 4Y8DC 4KI5C 3NA4A 2APXA 3KWWA 1MLCB 2B5IC 1FL5A 2VLJB 1V3JA 1AO7A 4RGOH 1CF8H 3UMTA 1FE8L 4EDXA 1D6EA 3DSFH 4D0BA 2XZCL 5BQ7A 1KPRB 1E4XH 2ICEA 3GJEB 5DGQA 1ZVSB 5LGJB 3QNYB 4Y4KD 1VEMA 2YR3A 3GSXB 2AK4D 1HNFA 3KLSA 1ZLWK 5CP7A 2UVFA 5ESVA 4XNYH 4HJJL 1QFOA 4K94H 5L6YH 1KYOJ 4NT6A 4P5MB 5GISL 5B21A 2DS4A 5DD6B 4NQEE 1WFOA 2PYEE 3RU8L 2O61B 4JG1L 2VXVL 4N5UA 4UZGA 4OCSH 4I5BB 4BH7A 3SBWC 5KS9E 3EYUL 3O8XA 2XRAL 2FNBA 1BGXL 1DN0A 4JFDE 3QUZB 1J1XL 4D9QE 2EDDA 2EDTA 4S1SH 4FABL 4EI6B 2XI9A 5E6ZA 1MIEL 3QNYA 3D2UB 3L5IA 2Z8VC 3GSXA 1A4KA 1RUKH 2DWEA 1WCBA 4LIQH 4N5ED 5I1GH 1WITA 4WTZA 2CRMA 1FGVL 2PCPB 3KYNA 1BOGA 3TCXA 1G6RH 4TUKH 3C5ZB 4K94C 1DQQB 2AVGA 3PWPB 1WEJL 4M1CD 2AP2A 3D0VA 4YHML 5CD5D 5JNYB 3QISA 3WE6A 1WF5A 4BZ1L 2V5RA 4KXZI 2AJVL 3O4LE 5HGBB 5CEYA 3QUKB 1T1ZB 4RMSA 4PJDE 1XFPA 1BJ1H 5CJBA 3ARSA 1F2XK 5DJAA 1D5MB 1WZMA 5CP3H 2YD2A 1HXYB 2KL6A 3AM8A 3RGVD 4Y16C 4NYLB 4OKVA 2F58H 3TO4D 4NDMA 3MLWH 3LMJL 3U79A 5ILTH 4I18A 4B53A 4AZ8A 1A1MB 3OTTA 1IRAY 2VLMD 2BSRA 4QXWA 4HPOL 5FM4A 1G7HB 3KYNB 1LO0H 2W92A 3QFDA 5CSZB 5EC1B 4XVUC 5C0JB 3MGOB 1A7RH 4YDLC 4DKDC 5M7QA 3B9VA 2A73B 2HYMA 4HKZB 1S7TA 4OGYH 4HUVB 4HJ0D 3A6OA 4MNHA 1RZ7L 3QIUC 3MRKB 2D0HA 1NFKA 4NJAH 3ESUF 1EHLH 3ZKMC 5D1XB 4KJPD 2ARJQ 5JHDA 4XGZA 2Q86B 1WAAA 3H9YA 1MI5A 1T1WA 2VXSH 3MNWA 4H1LH 1OWRM 3ZDYF 2VDML 2VLKB 4G9DB 3WSQH 2Z8WC 3LOWA 3RL2B 3RTQA 1A7OH 4WUKL 4M8VA 3CXHJ 4IRSB 3VG9B 1CFQA 1NMAH 2AABH 1FC1A 2FLRT 5DT1L 1YYMH 5H94A 3K81A 4JHAL 3HZMB 5HGDB 2CO6B 4NZRL 1MAML 1CE1H 1VDGA 4BSVB 5IOPB 3U9UA 4C4KT 4YPGB 2DN7A 4ZS6D 2ITDA 5C0GA 2DMKA 4WIQA 2X9XA 4OD2B 3VXUE 3C6SB 2YUVA 3DGGA 4ZYKB 2W59A 2NW3B 3EIFA 5H37G 5DJ8B 4M5ZL 5I19L 5FAAA 3WNNA 4MA7H 1N8ZA 3MRIA 4J4PA 4MAYD 3DBXA 4LK4A 5DEGB 5JQHC 1N5YH 5T3XE 1AD0B 2J6EL 2A6DB 5TJWK 1HHGA 2GJ6E 2BVQA 3C2AL 1ZOXA 1IGYA 4LCCC 5CBAB 2D03H 4Z9KB 2IJ0C 2ZUTA 4LF3A 1ZHKA 1EBPA 1EAPA 4G6KH 3TPUA 1PFCA 1CXEA 1L7TL 3CFBB 4EUPB 1F58H 1H15A 5T5NG 3UPRA 1MCPH 1L9MA 1OARL 2BNRD 2J7LA 1J86A 4XVTH 4YFLI 2CK0L 5E8PA 5B3JF 2EE3A 4P99A 3MRIB 4ONOA 3KPNB 3O9WA 2B4CH 1CVSC 5I1LA 2HVJB 5T1KD 3LRSA 4OF7A 3MX0A 2QLVB 3W0WD 4CU6A 1MWAB 2IPUG 4JKWA 2CMRL 4HUNB 1YMMB 5FYLD 4XPFL 4Z95L 4E9LA 1A6ZA 5IEHA 2Y36H 5DD5L 5D9SB 2FJFB 4ONHB 5AZ2L 2P5EE 4XCYA 5LG1A 3MRGA 2DQGH 1GZQB 5EFIA 3HPJB 1CQKA 1SY6A 1NAMB 1GC1L 4GRMB 1F58L 4P5KA 1KB9K 3QCVL 3IFNH 2DKSA 5CINL 5EZOH 4S1QH 3BMVA 4BSWB 4PJ5B 2VUYA 4LVOC 2VABA 2GTZA 3MRLB 1NGQL 1CG9A 1A7OL 4WUKH 1CLZH 4LEOB 3EOAA 3RUGB 1MCIA 1A9BA 4WU7A 1FO0A 2Y06L 3IFPA 4DKFL 1REIA 1OP9A 1XEDA 3SKJH 3PXJA 4JO2H 4U1GC 1FORH 1IQWH 3FQTA 3DVGB 2O5ZH 3KPRE 2OJEB 4K7FB 1Q1JH 1U8PA 3TCLB 3K2UH 4PG9A 1JZ2A 4OFKA 5MEOB 1HQ4A 4WFGD 3BOVA 3NA9H 4OCXH 5EC2A 1E0OB 3V7AE 3H3BC 1SJHA 2DIJA 1OLZA 2R1WB 2Y07L 3MRCA 1QSFD 5E8DL 4PJBF 1BZQK 2O5XL 4R4BB 4NO3B 4EJ1C 3RIAF 1JYXA 3PWJA 2Z9TA 4JRXD 5DVMA 3BWAB 3HG1A 1R3JB 1OW0C 4AT6B 5K9OA 4OUUB 2AJSH 5IVXF 3DYPA 5ALCL 4LVOB 5HJ3A 3D85B 4CN6A 1P7QB 2BHYA 4LSSL 2QHLA 4HF5H 3GSNA 5JIPA 3OKOB 3CFJB 1VADB 4IRZL 1GHFH 5EBGA 1S7RA 2FH6A 4PREA 3T0WA 1GAFH 1IL1A 3OXRA 2ESVE 1P4BL 3AVEA 4M48H 1LO0L 2ICWB 4JM4L 4D9QD 1U8KA 3MOBH 3MLPA 4R26L 4A6YL 3MC0A 5GXBB 1NC2A 3GI8L 4KRMB 4OUUA 4UILH 4XMKH 3FOLB 2VXUH 4L4JA 4X9IA 1CL7H 1YNTA 1Z9SA 4U6VH 2C7UA 3S88L 4XNUL 1RJZA 3K7UA 4AM0B 1FAKT 2MWCA 1EERB 5I1DB 2DQEL 3JWDL 3TBTB 2F5BL 5KJRH 1NGYB 4NKQB 3VFRB 4KQ3L 4KHTL 4D9RD 3Q5TA 4ISVB 4X4XB 3CPLA 3IDIA 3MBED 2QBWA 4MGXA 4H5SB 1IL1B 2CDEB 5FYJE 4K3GA 5HVWA 3DVGA 1IQDB 4RA3A 3WL9B 4GLRH 1U92A 2JF1A 3SDDA 1IARB 1QNZH 3BDYH 3DVFA 5D5MB 5C0CB 5GS0C 1TVHB 3MXVL 5D2LB 5IWLA 5D70L 1EHXA 1RJYA 3L5JA 3H3KA 3LSOB 3RDTA 4IJ3C 2D3VA 1SM3L 3OX8B 4MWFB 4JPWL 4ODHL 4K3HA 1A9EA 3KJ4B 4MQTB 3T1WA 5FUOL 5JDSB 4HIXL 4PLKC 3DXAE 3J8F7 3DRQB 3RIFF 5FEBA 1OAUL 3LZFH 1S9XB 3RPIB 1JV5A 4O02H 3IRZA 3JWOC 5GS2H 5GS1C 3MROA 4HXAL 4GS7C 1D5IH 1HSAB 4ODVL 3GSNB 1ZS8A 3QO1B 4Z7WE 2YD6A 5D2LA 4XZUA 5E4EB 3GSUA 3MOQA 3DMMC 2VLRD 2NY6D 2UZIH 5KVFL 3C5JA 1IGFL 1DQLL 5FUCE 1DEDA 5IF0A 5F7DA 2O93L 4P9HL 3PWNB 4HIXH 3I6GB 3LN4B 1GGCH 3MJ8B 4DZBB 1NBZA 3MBEA 1N26A 3ARGB 5B38A 1Q0YH 1RULH 2FB4L 3V9FA 5I1GL 5JOFA 3ULVE 1DVFA 4HHAA 4LL9A 5EBLA 3U7YH 4J1UA 4YDKL 1N6VA 3MUJA 2WMPA 4X9FA 4BQCA 1ONQA 4FZ8L 3MRRA 2CRZA 4EDWH 4CUCA 5GRVK 1P6FA 2NY5H 3MOAL 3OR6B 3NMEA 4BFGA 5KG9A 3GSUB 4Y5YC 2E9IA 3GMNA 3IAPA 3PHQA 5IB2B 3KPRB 4TUOA 3ZE1F 3TBVB 1EDQA 3RWHA 2V2TA 1YMME 4WI5A 5E2TL 4GRWB 2AGJL 2CSPA 4PIRF 4L3EA 4GKSA 2HTLC 3AS3A 5ILTL 4QHLB 3HPLB 5DF0A 5DEZA 2MCG1 4G42A 4JFPB 3F5WB 2GJJA 3BQUA 2YPKA 1C1EL 2VIRB 3IAQA 1KCUL 2C26A 3LDBB 5GZOD 1SYVA 3LN9A 2BNRE 1IZJA 5KS9A 4GQ9L 5E6ID 3ZTJG 3QQ3A 2YPVL 5I8OH 4PJDB 3QAZB 3QI9C 5FF6B 5H35A 4KKBD 2N1KA 5IKCA 1OP5K 3VDBA 1R3LB 3G9AB 2AEIT 3IDNA 2MHAB 1KIQA 2YSSA 1WWWX 2D0GA 3WIHL 1UYWH 5FV2A 4PY7B 4M6OH 2YA0A 2SEBA 3EYVB 5GZOC 3N0PB 1BQSA 4PRAB 4LPUA 4BUGA 5E6IC 5C0NC 4LCIH 3O2VL 3BQUC 4XNYL 4BQ8A 5KVEL 5IHZB 4Y4HB 5SWZD 2AKRA 2R69H 4XCEA 4OFYD 1KJ3H 1NBQA 4JO1L 1V5JA 3VXUA 2BVYA 4V1DD 3QFDB 1I9RL 3OZ9H 5CSZA 3T09A 1KBGH 5SX4H 4NRXA 5JW4N 1IAMA 1VSCA 4J3TA 2QL1A 2CR6A 2VERN 4OCMC 1N7MH 1KCVH 4RDQG 4MS8D 5D1QD 3U36A 4PGDA 3KPRD 3M17B 3WBDA 5LCVL 3KLAA 2MQ0A 4WUUD 4QXUH 3U4AA 4S10A 1BAFL 4YDIH 2H9GB 4OF8A 1YC8A 1F2QA 4U1GB 1DL7L 2YHGA 4NZJA 5IW6B 2WUBL 3QG7H 4TNWK 4WHYH 2R56L 5F1NA 3A6BL 4IMKC 1NANH 4U3CA 5F97E 1EUUA 1T7XA 2PCPA 3KXFB 4YHMH 4GKSB 2EDHA 4GBXC 4K7PX 2KQMA 4G6FB 3MYJA 4OCWL 4IRJB 3SQBA 3R1GL 4UT9L 3BPCB 4PJBA 1QP1A 5IB3B 1NAKH 4Y5YB 4MXQD 5DI8B 4Z0BL 1GCFA 1CLOL 4R0LB 4G7YH 3AFLA 5D1XC 2F54B 5C07A 4JR9L 2K3TA 4OLWH 4Z6AT 5GQBA 4EN3C 2AXGB 5HHPA 4O9HL 2H1PH 4PB9H 5E8NA 5ACZB 1OB1A 1NCBH 3D0LA 5D1ZD 4CNIA 4LASL 5ALBL 1BHGA 3L9RA 3V52H 4X99A 3QPQD 3GRWA 1K8IB 3S37L 2ESVD 4LSQH 4YE4H 2XWTA 5EU7C 4MXQC 4XTRD 4S11A 3MYJB 3I02A 3DSNA 1KCRL 1J7VR 5BV7B 1JVKA 3MLXL 5F88A 3FHAA 3BDXA 2Q6WB 4FFZH 3QH3B 3O3EA 2YKLH 5CIPH 3OG4B 4LIQL 4DN3L 3U6RA 3FT3B 4BSVA 4ZUUB 1DFBL 4LSVH 4NO2A 3V52L 3EO1A 5C0CD 4DKFH 4K71C 1PY9A 3N85H 4G9DA 5IVXA 5CJOL 2EDJA 3RL2A 5FYJD 3FFDB 2JCCE 4M5YL 3U2SA 1FBIL 4FMKA 4N0UB 3SGJC 5ICYB 4OI8A 1CFSA 2FJFA 2V6HA 1GGIH 4LRNH 1AE6L 3MLXH 4X4MA 3QUMB 3TN0A 5DRNB 3UBXA 3HMXA 2A9MH 2K7PA 4K2UL 2FB4H 4GG8A 1A21A 1JN6B 3KVQA 3ZHLA 4OFPA 4KI5F 5F88B 1IAIH 4WW1A 3GM8A 5IMKA 4P2RA 1RZ8A 4LSRH 4R96A 2X4TB 3G08A 5J6HB 3FO9B 3PUCA 1WC7A 4AJ0A 3JXAA 5EC1A 3UTSD 1MJ7L 4KI5E 3O3BA 3LKSB 3TA3B 1T1YB 4YGVB 1X5KA 2P5EB 4WU7B 4X7TB 2CIKA 3SE8L 3MYZA 1K3ZA 1NQBA 1X7QB 4EUPA 1JP5A 4N0UA 1IEAB 5TF1L 1FE8H 1T66C 4X4ZA 3UJTH 4YFDB 2Q7YB 4YQXL 1FL3A 4F2MB 1D5BB 4L4VA 5FGSA 4JB9L 4RQQA 3SDAD 2FGZA 4XC3L 5BO1L 5EO9A 4JFQB 3RVTC 3X11B 3QDME 5LGKA 5FYLH 2AXHA 5IEHB 3CZJA 2WBJB 1JNNH 1T0NA 4ONHA 3MOBL 5F1OB 4Z18A 1RIVL 4GH7B 4RX4A 3ULVD 4EI5D 2XWJB 2EH8L 4DGYL 4DN3H 4NC2B 3L3DB 1B0WA 4G8GB 2HVJA 1GGUA 4YNYA 4XP6H 3DXAD 1R5WA 4ZFFB 1T66D 3ZE1E 1BZ7A 5DC9B 3C6SA 5AG9A 3ZKSD 1AO7D 2FJGA 3JWDC 1TTUA 1S7QB 1I9IL 3CSBA 3EHBD 1UYWL 3NIDF 4YIQB 2ZKHL 3NPSC 5CIPA 3SEPA 3CDGA 1MCRA 2C3HA 1XF2B 2E7LA 4MCYA 4L8BA 2Q8AL 2LVCA 3UJIL 1F02I 4GG6F 2A0LD 5CEZH 5HY9A 4XX1E 1KTDA 1BBJA 4JLRB 4XP5L 5CBEB 2VLRE 2PW1B 3P4MA 3QNZA 1UH4A 4GMSL 1B0GB 1V3MA 2QQKH 4U1NA 3RY4A 1FCCA 2FDBP 3DTXA 1QPPA 4NC1C 4NO5B 1U95A 2N7AA 2P8PB 4GKNB 4RMTA 5BRZB 1E6JL 3DJ9A 4PRBA 1J1OH 2G75A 3KDMA 4ELMB 3FB6A 3EO0B 1EFXA 4QCIB 3EHBC 2N56A 4DK3A 1KB9J 4GRLD 4PYHA 4JDTL 1J05A 5GGSY 1WC7B 5JW4R 3G5XB 3AAZA 3BFOA 4P46D 1MRDH 2A0LC 4OLEA 3HAEA 1GPOL 3Q5OA 2DYPD 3PGDB 4EQ3A 3DV6A 1T5WA 1KJ2A 2XQBH 1TZHB 3QJHB 3HNTH 4P2RD 1MFBL 1B0GA 5FGBA 2YZ8A 1YMMD 4R2GB 2AI0L 1F11B 1QYGH 1HQRB 1ZGLP 5C0IB 3BO8B 3ULUE 3WJJA 1NGPL 2ZOKA 4F2MA 4JQIL 2GCYA 2QTEA 5F7LB 3V4PH 2YN5A 1XAUA 2MNUA 3I2CH 1K8DA 4P46C 4UT9H 5IHBA 4FQ2H 5JO5A 4JJHA 4NQXB 2H2PD 3OKYA 3IFNL 5K59E 2IQAA 4KJYB 3V0VB 1T2JA 2J8UA 4HQQL 3F6IA 1BX2A 3MO1A 4OQ1A 1HEZB 2V17H 1BVLA 4NSKA 3UZVB 1X5LA 4ZUTB 1JPTL 2NYYD 3RGVA 4QY8B 2F53B 5IJKA 1WBXB 4TVPD 2XZAH 5CEZL 3LKNB 1TIUA 2EH7L 3OKNB 3VMNA 3MJ7B 5I2IB 1NMAL 2AABL 4AM0A 3C09C 3D69A 5EWIL 2H2PC 2Y1VA 4P4KD 1OF2A 2L0DA 4LEXH 3TC9A 1B9ZA 1NDGB 4PJ5E 5HY9B 2EICA 3U7WL 2JJWA 2PW1A 3P4MB 5FYKD 1T6WA 1HZHL 1NBYB 1NJ9B 1YA5A 5EOTB 4C55A 3DVIA 3FOLA 4GRLB 1HSBA 4L9LB 2NYYC 5C0FA 3I6GA 3LN4A 4L8DB 2BCKB 4U6HA 5FGCE 3IETB 4G6AD 1PG7L 4UTAH 4PRPD 3NVQA 1FG2B 4OZHE 2IBGA 1VKXB 2GI7A 2H2SD 4LFHD 3NFNA 2FSEA 2BNQB 5JZ7D 4NM4L 4GAFB 2J1KA 5EBMB 1N3NB 1RUQL 4R3SA 1RJLA 4HIEB 5B8CB 2EYRA 3NCJH 3CFJA 3QQ9C 2NY0D 2NTFB 3LQAC 3CAFA 1BP3B 4E5XB 2WK2A 4M7LH 4G6AC 3SDDC 3BE1L 5IFHH 4GG6B 1AXSB 4LLQA 5I18L 2VDOL 1MIEH 1CFNB 4K7PL 1MFAH 4PJEE 5T3ZH 3WKML 5DJCA 4UINL 4DW2L 1Q94B 3C8KA 5DVLA 1AJ7L 4D8PB 1UWGL 3B2VH 2E9WA 4C56D 5DK2A 5EOCL 3SJVE 4BUHA 4HWEH 4P9HC 1YEFH 4O5LH 4ONFH 1YEJH 3WS3A 4TVPH 4XB8A 4Z5RA 3CK0H 3RUGF 2HFEA 1QSED 1I7UA 2HWZH 5IJKC 4LLVB 3NTCL 5EWIH 1LE9B 4ZODA 3S35H 3RGVB 1CD1A 2E7CA 5A43C 5FFLA 1TMCB 2NX5D 4U1HB 3KHOA 2MHAA 3SGDI 1MLBB 2F58L 1CN4A 1P5UA 3VFWB 1OAZH 1SHMA 2ADIA 4A2LA 2P5ED 2R56H 4Z76A 1Y6KR 3KHQA 1ZA3B 4Z7UE 5EOCH 4JDVA 5IBLD 3MXVH 1D5XB 3VRIB 3SCMA 3BZEB 4OLUH 5IMLA 1FYTB 1IKNA 2LFGA 3V95A 3TT3L 4HKBA 3T2NH 2NZIA 4AMKL 5F7HA 5DZNA 4KZDL 3QUXC 3X12B 3HPLA 3GMOB 1ZVSA 4JVPA 1OAZL 1IVLA 2HG5B 5CJXC 5IB2A 4JY6A 5HXMA 5BW7C 4DN4H 2I9TA 5GJTL 4P2QA 1JGLH 2H1PL 3S35X 2EDKA 5IB1B 4OCYL 5FM5M 4IOIB 4MD4A 1BLNB 2AEQL 4HT1H 2FECI 5BW7A 1JGDA 3MFGB 4PGZA 5HHME 3FQNA 5EZLA 4XMLH 4Y2OA 2VH5L 1VHPA 2R0WH 1EEUA 4PD4K 3S37H 3QUZC 4OFDA 3BZEA 1MCKA 5A2KH 4UQ2B 3DWTA 1QLEL 1DN0B 5C6TH 4HWEL 3HE7C 2YRLA 5SWSA 5JOFB 2KQNA 1FJ1B 1GPOH 5FF6A 1KEMH 5HYQA 2J12B 3U0WL 5I19H 5GJTH 2G60H 4HHAB 2OMNA 4ZDHA 3STZA 4GG6E 3GFUA 1UH2A 3S5LG 3LKRB 4XVUD 4CW1A 1ZAGA 4KK5D 5D1ZB 5D7JB 5F1IB 1CDCA 1IEHA 1MPAL 1J10A 4IOIA 4NGHH 1LEGA 4HJ0C 4ETQA 2XTJB 1QLFB 3HA0A 3HG1D 3NBNA 4LBEB 4HUUA 3QA3A 4K9EC 3HE7D 2IAMB 1Q72L 2ITCB 1H3TA 5IMOA 5TE7H 4H88L 2VR5A 4CN1A 3QDMD 4U1KA 3MV8D 4MNQB 5DHVH 3SGDH 2GUOB 4UV7L 1CU4H 2VR4A 1DJSA 2L4OA 4KUCF 1W0VA 2X1WL 35C8L 3CFCH 2VDKL 1S5HA 3GKWH 4ORGB 5AWNH 2HKFH 3EYSL 3ULUC 1WICA 4PLJD 3MLVH 1Q0XH 3ARDB 1A6WL 4G9FE 4FS0A 1R24A 1SYVB 1PKQA 3GIZH 4KK6C 4ELKA 2VAAB 1AXIB 5FDWB 1SQ2N 2PXYB 3FTGA 5HI5C 3F58L 5F7YC 5SWSE 4NFBA 3GIVA 5SWZA 1G7MA 1G7JA 3B5GA 1EZVX 1OQOA 1FPTH 2A1WL 5JIIA 2APTA 4GKZB 1MAJA 4G7VH 3WJLC 5DJXB 3ULUD 3VFPA 5CGTA 4Z7WF 2ZNXA 4XC3H 5BO1H 1DTUA 1JGLL 4PP1C 4KTDL 4KWUA 4JAMB 2YK1L 5BXFA 5HI5D 1X5IA 1ZHKB 4XB7A 3V5HA 1RHFA 2QV2A 3T0EA 2HT4C 1DP0A 4UQ2A 3LD8B 1FGNL 4HEME 4UDTA 3IGAB 3ORJA 5GGVH 2RCSL 5D96C 1P4LA 1I1CA 4M9PA 1MHEA 3ZYZA 1YPZA 3P9MB 1UKTA 1XCQB 4M62H 3ZE2F 1FO0H 2FBJL 1MQKH 4QRSA 5HVHB 4KTEH 2GIYA 5D9SA 3I75A 1BIIA 2CDGB 5D7KE 5IMMB 4ZTPL 1ZHBB 1N8ZB 3B9KD 5HI3C 2BHZA 4KDTC 1LO2H 3TYFB 4Y5VB 3RZCC 4LBEA 4Y89A 3VGHA 1YEKL 2C4FU 2OR7A 5DWUH 4LP4A 3EZJB 5HVHC 3SJVB 5E6IB 3CLFL 1FDLL 5FUZL 4OLZL 4WNQB 5KSBA 2VABB 2UZYB 3GIZL 2CKBH 3LRHA 3UYRL 1W0WB 4O5LL 1G7PB 1RZIA 3PQYE 1RQ5A 4G9FB 4D2NA 3EO1B 3HI5L 3WLBB 1MHCA 3ALPA 1PSKH 3P9MA 2EO9A 3EOYG 3WNPA 3BD5A 4GXVL 4KRPB 2VKWA 3RZCD 4YHPA 1ZT7A 4WHCA 1MF2H 3E2HC 5D1XA 1JPFA 4OJFH 2GQHA 3WN5C 4FXGB 4C83B 4OAWA 2WAHA 1DSFL 3LRSB 2X5PA 1C16A 2BNUA 4JJ5A 5F71A 4JM4H 2X4TA 4RFOL 4WV1C 3ARDD 1K8IA 1NCBL 3FO9A 3I2CL 3KPTA 3VFNB 5ERWA 3O6MH 3H7BB 3HNVH 4UI2A 5B39B 3ZT6A 4WTZG 3HC0A 1UM6L 3UTQB 2BSSA 2D31A 4PRBB 4YX2H 3FRPG 4LSDA 1KN2L 4JQXC 1KCSL 5D5ME 3MA7B 3NCYP 4I18B 4UOW1 1J87A 3GNML 2W9DL 3X11A 4UDUB 1HE7A 5HJ3B 1MQKL 5HPOA 1VGEH 2VLRB 5EG6C 3DV4A 1CG9B 4FFWD 2PXYC 3S96B 3L3HB 5DJDA 3VWJD 1Q9KB 1QRKA 1R5IA 2H26A 3K8LA 2GSGB 4W4NA 2K1MA 1CTNA 5ADOL 4EKXA 5F9OL 3ULVH 3GSOA 3P0VH 2YD8A 4LEXL 2G2RA 2E5EA 1Z2KA 1EO8L 1AY1L 2F19L 3WD5L 1NCCH 1P7HL 4MJIA 5F9DC 3T1FB 4C54A 1JNLH 2XWJA 4U1SA 5BZDB 1EEYB 1B2WL 3L5HA 5GSVB 4HC1H 5LBSL 3RWGB 3G08B 4KC3B 3UPRB 3TNNA 3PDGA 1ZK9A 3O2DL 1KCVL 1AGFB 3OKLB 4PRPA 2CKBL 4L3CB 1NFIA 2X6MA 2XTLA 2R8SH 2VXTL 1BBJB 3THMH 3MRBA 4YHPB 2AJXH 4W4OA 3OR7A 3U4EB 1KNOA 2NX5E 3WLWD 6CGTA 4DAGH 3QRGH 4ZTOH 1C5DB 5E94A 2P48B 5GHWH 2R4SH 4PJIB 1XH3A 1AHWB 1A1OA 1LO5A 3BD4A 3PL6C 3UJTL 2O5XH 2R0LH 1EEYA 2N4IA 5J13C 2JKXA 3BE1H 2FJHB 2VSDA 4WGWB 3HAEH 1CXKA 4QHUA 4XNZB 1LQSR 4X98B 3OXSA 4HPOH 4YBQC 4ODTL 4X0KA 2QJDA 1J11A 5E1AB 2VDQH 2VN4A 2Y23A 2YUXA 5IBUG 4BK5A 3L6FA 1A6PA 1RHHA 4NZTL 2WIMA 5HDQL 2Z31C 4RZCB 4FQHA 4LCCA 4X7EC 4HF5L 4ELMF 2OR9H 4PLOB 4Z7NF 3QUXA 3VFOB 3VXOB 1M6OB 1VA9A 4HV8A 3EOBA 4LLMB 1RK1B 3WIIH 1QSEA 3IXAA 2F8OA 4KPHH 3RUGE 1KUMA 1JFQH 4RSVA 2OSLB 4Z8FL 5CEXB 1FZJA 3VXNA 5JHLH 2EYSB 2IH1A 1QHPA 3MUZ1 2GTWB 4E41D 5K9KA 5BZDA 5F7FA 3X3GH 1GGTA 4OGZA 4ZFOL 4QHNB 1A6UL 2OXGA 4GAYB 5DO2C 3D18B 3NN8B 3KYKH 3QRFM 1E4KC 5E00A 4ZQKA 1QRNE 1LO4L 3FT4A 3LIZH 4LEOA 3IDGB 4Q74A 5HHQB 4NKIH 1DQML 4I48A 1NGZA 1SJEA 4HUKB 4WVRA 3K80A 3O41A 4GS7B 1YYLL 4MD0A 2Q76B 1XCTB 4JVWA 2ILLA 3LB6D 1M7DB 2YBRB 4YHOL 2AK1L 3MV8E 3JVGC 3Q2CA 2CJUH 4UU9B 4EXKA 5B8CA 1U8OB 4GSDH 3QR2A 1X5ZA 1J0JA 2IPKB 1CGWA 4OFVA 4PJCB 4Q7DA 3VGDA 3VXMA 3L3JB 2EDXA 5KSAD 1YNKL 2EDEA 4JVUA 4DZ8A 1L7TH 2HTLD 2IPUK 4NKIL 5E00B 4N1EA 4TOYL 1NFDA 5B8CC 12E8H 5E1AA 1N3NA 1X4ZA 5DLMH 4NBXB 5SWSD 5KZCB 3AB0B 2XXMB 1EGJA 4HWBH 1HWGB 1X5AA 3LB6C 4CVUA 1I3GL 2NY4B 5J1SC 3OQ3B 5FYKH 5EBLB 3W2DH 3O4LD 5C2UB 3D39D 2V5TA 4P0DA 3EGSB 1MJUL 5D72H 3HFMH 3MRRB 1XGRA 2HFFB 2DQGL 5HBBA 3FRPA 5C1MB 5FYLE 5DJCB 4JANA 3VI3E 3GBNL 3IDUA 3DROA 4OGYL 1RJYB 1ORSB 1UB6A 3DHMA 5FA4A 5FO9A 3QDGA 4JM2B 4KPHL 4F37K 1SBBA 2BNRB 4OT1L 3RA7H 3TPKA 4EOWH 5IHZA 4JPIB 3GKZA 3CFCL 3S34H 2IMNA 2CLRA 4CVWA 1RVFL 5C2BH 1CU4L 1CICB 4LVHC 2VYRE 2EXYD 1KC5L 3TH2T 1KPRA 4XP4L 3GJEA 3QXUA 2IANA 1V7NL 3REVA 3UYOD 2B7DT 2WLZA 1U8HA 4NQEB 1H3WM 1T04B 4LQFH 4L8CA 2NY1D 1YYLH 3ZHKA 4ZXBD 4LDEB 1VPOL 4U2ZA 3G5VB 3Q0HA 3QIWD 3X12A 4PJDA 4ENED 4EI5A 4OV6F 3LIZL 4WFED 4LRIC 3VFTA 4WTWA 1QFUL 2P47B 4MD0B 4MS8C 3WFHA 5I1JH 3DX9B 3LV3B 4JDVB 1T03L 5DJZB 2KZ1B 4XP9L 4ZPTB 4HFWA 5HTSA 2D7NA 5CD3A 1HKFA 4N90E 4P9ML 2XZQL 2NY4C 3UO1L 1LK3H 2J5LC 5DR5L 3PGCB 2R2BB 3GSRA 3U82B 3CFIC 3TNMB 2DD8L 4DTGL 1IM9D 3QWOB 5FOBA 4XMPL 1FGNH 4DN4L 1QSFE 3QIWC 3H0TA 2FWOA 5DMKA 5E9DA 3MV9A 4ENEC 2DWEB 5IJVA 3CH1A 3UP1A 2AKRB 4IRSD 5FO7A 5JPNB 1JUFB 1JF6A 5EN2B 4XAKE 3KLHC 3P30H 3WS3B 4OF0A 2FATH 2GITB 3WFEH 5CJOH 1GL4B 5ESQB 5B39G 2NY4D 1CGTA 1LWRA 4ZUSB 1BMGA 4I77L 4U3HA 4NZUL 5E8NB 9CGTA 3KNBB 4Q6YA 4PJFE 1I4FA 4PJCF 1AO7B 3NFPB 4BA8A 1SBSL 1TPXC 1XGRB 1IC5H 3B2UD 1P4BH 4M48L 1JTOA 4G8GD 5DJ6B 3IVKB 1EEZB 1F4XH 4IRSC 4PGEA 4CL7A 5KSBE 5F8QC 1WIUA 3HRZB 3DO3A 3CLFH 4PRIA 4XP4H 4G80B 2YPKB 4UILL 4XMKL 5J3HC 3H9HA 4U6XB 5BS0A 1JZ8A 1PY4A 4XTRC 1K3IA 3EJYC 2JB6B 3KPOB 5HHOE 1PEZA 1KGCD 3MJ9L 4LCWA 3TO4B 3QUYD 1DBKH