4R3SA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with msp2 11-23
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords FV FRAGMENT(MAB6D8) HEAVY CHAIN
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r3sA00
5F1NB 3B5TA 3PGCA 5CIPA 4CBPA 4YHYC 5JA9A 1H3XA 4K7FA 5E2TL 3VRIA 1RZ7L 3EIFA 3RUGB 4AL8L 4GBXD 4FQ1L 1I9JL 2NMSA 4OFYA 4LVOC 4N0YL 3P40A 3O41B 3WFDH 3MRRA 3HPLA 1J1PL 2EDBA 43C9A 5IGXH 1PLGL 1QBML 4XPGH 1A64A 5EN2B 2Z0BA 3FB8B 1FYHB 1VEMA 1L6XA 4HF5H 5JW3L 3ARBD 1OM3H 4MD0A 3O0RH 1MRDH 4Z78B 1RZJC 4PTTB 3QQ9C 4PJCF 3MLVH 1L0YA 3V6ZA 2NNAA 2J7LA 3UTZA 2NY4C 5DD5L 4XC1H 3PGDB 5F1KC 1I3RB 2BSSB 4P9ML 5JZ7C 4M9PA 4K2UH 5EZLA 1PKQA 3WFHA 5CEZH 2ADJA 1QFUH 3BISA 5IG7A 3LEYH 2D2OA 4F9PC 3OKNB 4LOUC 1HKFA 1RU9L 4Y1AD 3FO2B 4KHTL 4YNYA 4AEIL 4L1HA 2X1PA 3VXRB 4DKFL 2IPKA 3VXUD 3LRSB 5IB4B 1O7SA 2Z35B 5L0QB 4UIKL 4DEPB 4Y88A 4NQEB 4NQEE 5DJ2B 1X5FA 1FLTX 1J1OL 1U9KA 1WBZA 1HZHL 1CFVH 1YNKL 3NZHL 3QAZB 3LKOB 2ZUQC 1JYXA 2BY3A 4N1EA 3KWWB 3T65A 4G6KH 3VWJA 1CD0A 3MR9A 1MNUL 5D96B 5FYKE 1QBLH 1UB6B 3FHAA 4XCNB 2W92A 3G5YA 5HHVH 2O5YL 4QHNA 4QXTB 4UT9H 2OXHA 4PJDE 3O6LH 4IS6B 4V1DD 4DAGH 4JY6A 4Z5RA 3C6LA 1IJ9A 4N0CC 4L8CB 5J1TC 3B43A 4LHUD 2VNCA 1F6FB 2KBGA 4X80L 3RA7L 5C07E 4CVUA 4GT7A 3QDGE 1L6ZA 4NJ9H 2FGWL 4NZDA 4F2MB 3QIBA 2B1HH 5CKGA 1NBVL 5E2TH 2VWEC 3NGBB 2VDQH 3UC0L 3IFLH 1KJ3H 3I3BA 1NQBA 2AEPH 4KK8C 5I30L 3RKPA 5BW7C 1LO0L 3CCHB 5J8OA 1RUAL 2N7BA 3BPOC 3OAYH 5BV7H 3M8OL 3CMOL 5JMRA 1EHXA 1G7JA 4JDZB 4MXWH 3OKDB 1FORL 3TF7C 3KPSE 3LQAC 3MRDB 3O8XA 3CX5J 4KQ4H 2P8MB 5E2UH 1KTDA 3QFDB 2EC9T 1O7VA 5GGRY 3Q5TA 4M7LT 4UDUB 5DMGD 3MLUH 3RY5A 1CFBA 2EIZB 3T8XB 1I1AA 3NOIA 3GJFB 3VFSA 3K8LA 1G9NL 3U0WH 3KS0H 3MUHL 5BJTB 1Y6MR 1X44A 2A1WH 3W81A 4IMLA 1MCLA 3C08H 4PB9L 1B0RB 4KJQD 2OJZL 5CJOL 1UEMA 2PW2A 1MCRA 3EUUA 4OD3L 2BOCA 4TNVF 3P0YL 5IFHL 3RWFA 1BM3L 2J2ZA 2H2SC 2DLEA 3GO1L 4NM8H 1OGTA 4Z9KB 3BJLA 1JGDB 5GIRB 5F89A 1FBIL 1IKFH 5HYJA 4YJZL 3NPSB 3EJJX 4NNPH 1C12A 4OB5L 4J2XA 1FL3B 2BNQA 5T3ZE 1FV1B 4ZS6D 1UVQA 3B2UC 4GQPH 1QSFB 3P73B 4H25B 1R5WB 5DK0A 4K23L 5F9OH 1ZA6B 2XG5A 1BM3H 4XCNA 4OSUL 5BS0B 3I9GH 5A2JH 1FFPB 1U3HC 5E8EA 1MLCA 2D03L 3BYYA 4GKSA 3OGCB 1AKJB 1JF1B 3IDXL 1GGIH 4M43L 3CFDA 5A16B 3EFDL 1JVKA 2JIXA 3BZDA 4HS6B 5DJ2A 5F7EH 3GSRB 1HQ4B 1LO3H 5D7LD 3V5DB 1U91B 4BQ8A 4TSAL 1NUGA 2F54D 2ICEA 3VA6A 1U3ZA 1UKSA 5KOVC 4A2LA 2XY2A 4OZFA 3MOBH 3AXLA 4OF8A 2PO6B 5DHYA 1AY1H 1T21B 4NZUH 3WFHB 5JIHA 5DJYA 3TBWB 4PJ5E 12E8H 1ZVSA 5F9WC 1OLZA 3H9SB 1FLRL 3DURB 5TFSH 4PRHE 1S7VB 5E4IA 1CFQB 2H8PB 2JB6A 2R2EB 5GSRA 4LCWB 4NUJB 3UJTL 2OX5A 2P5EA 5E8DL 4ZS7L 2Z92B 4XNXH 5HYIA 4R4FL 3KPQB 4C56E 3WSQL 3HC0B 43C9B 5I2IA 3CVHA 3O8XD 1G9EA 2C7UA 4M3KB 3BPNB 1ZANH 3CFEA 4PJ9B 5IP4A 1DQML 1MOEA 2YC1A 3HTLX 4NQUA 3EKCA 4HFUL 3ZKMC 1ZOXA 5MERA 2UWEA 4ESKA 5DS8B 1WTLA 1MQKL 1E4XI 1OARL 1I9IL 4X7DC 4RGMC 3HNVL 2A0LC 3F62A 4OGAD 3GMQA 4JFXB 2N7AA 3G08A 3REWA 5HTSA 2ZCHH 3FT3B 4UTAL 1QSEB 1QSEE 3CXDH 4JFED 4HPYH 4MQXD 5DEGB 1NBZA 1CGVA 3I9GL 5MEQA 4NZUL 2R4RH 3QCVL 4JQIH 5EUOE 3IU4H 2X40A 2AEQL 1I8LA 2BHYA 3FMGL 3ZL4H 5DJ0A 3MRFA 2R9HC 3BGMA 1ZHBB 3BE1L 5CGMA 2UVEA 5FOJA 1MQKH 3T0EB 2FWOA 4D9QD 2AK4A 4BUGA 25C8L 2VLMD 5DFTA 3QXTA 2PR4H 4FNLL 4Z0XB 4RMQA 2DQDL 1GHFH 3H3PH 4S1DD 3QI9D 1KC5L 1QVOA 4NO0D 2VAJA 1MCIA 4PLJD 3OJDA 3WXWL 5ACZA 1V7NH 2HRPH 1EMTL 4KH2A 2AEIT 2X05A 3VWKA 4U1IA 1CICC 3UXFA 2R69H 4PY7B 3D3VA 3EJYC 1RZGA 1AXIB 1T2QL 5K33A 3IXAA 4GAYA 4Q9QH 4JY4B 1K6QL 3DNKA 1I7TA 1KGCD 5LKNA 4M03A 5I1JH 2BDNH 2ZOKB 1UCTA 4JKKA 1ACYH 5CAYB 1MNUH 1N3NA 2HT4D 3HI1A 1D5MA 4AENB 3TJHC 4Z7VA 4X6BB 5BCAA 4NZRH 3VH8G 3GSVA 3LN4B 1HQRA 4HLZH 4WWKB 2VXQL 3QR2A 3QDMA 5BZDB 5E1AA 1NAML 5KSVB 1D5MB 1MCOH 1KV3A 1SJHA 4L8SA 2V2WB 3VXRE 4NQVB 3BKCL 1GGBH 2W1NA 5D93C 1NFIA 4M6OL 2WM0A 3ZLQC 3CIQA 4JY4A 4P46C 1RJZB 4U4BA 2PYED 3GM0A 5ABDE 4KV5E 1MCPL 2GKIA 3GMPA 2Y1VA 2QSTA 2EE9A 3PWUA 1AFVL 2IQ9H 1FO0A 5ISZE 2IADA 1U92A 2YOCA 3HB3C 2UYLB 3D85D 4X6FB 3SDCA 2E9WA 1IEHA 4DUWA 3X11B 3U9PL 1S7TB 4Z7VE 3L3HA 4RWYH 4WWKC 4FXKB 2ENYA 1MRDL 1S78C 3M8OH 1JNJA 4LQFH 2RHEA 1CT8B 4BQ9A 5D2NA 1KTLB 4K3JL 3RKDD 1BF8A 1Q72L 6FABH 5F96L 2IANB 1YECH 3NACH 7FABL 4X6FA 2DLTA 1U8IB 4MHHI 4QRTB 2AVGA 4OZFG 1FO0B 4UOW0 4ZG1A 4OZGB 4C59B 2B1AH 1TJHH 3GIZL 5C0GA 4FQCL 2GYSA 3TYFB 1IZKA 1U8QB 4ZO8A 4P2RB 4FQIH 3C2AH 3WFZA 4XH2B 4LLUA 5BOZG 4XCEA 3O3AB 2OS7A 1OAQL 2I24N 2BNQE 5CHNB 5DJCB 5GGUB 4K55A 2AJVL 1RIVH 3GSXB 4WNQA 4AEIH 1OAZL 4FFZH 5D71H 4M8VA 1GAFH 1S7QB 2XN9D 3C5ZA 4ZXBB 4LSSH 1QUNA 3DX6A 2GTZA 3QNZB 2PYEE 3P0VH 4DWHA 2EDJA 2MKWA 1IT9H 2ICEB 2FX7L 1EAPB 3V5DA 4QYOB 2VERN 4Y16B 3DXAD 1S7XA 4PJ9A 1RUAH 2VXTL 3O6FA 1FP5A 4IRZL 5F88B 1NC4A 1FGVH 4OKVA 5I9QC 4EJ1C 4JM2B 3WXVL 1GC1H 2E6QA 3H9SE 1L7IH 4BQ6A 1CU4H 1R5WA 2B1HL 4CU6A 5HYSG 4OGZA 3M17B 4OM0H 1FNFA 4JFOA 5IM7B 5DGRA 3ESVF 1NSNL 1LMKA 1DLHA 4IHOB 3H9HB 1MFCL 1MCBA 3QWQB 2PYFA 5I1CL 2F19L 5E8PB 4G7VH 2FWOB 5GIRA 1R24B 1KCRH 1NC2D 3HE6B 4YUEH 2AJZA 3THML 3OHXA 3D6GA 3EOBA 2B0SH 1YEFL 2VISA 4KPHH 2IPTH 3KLHC 3BP5B 4ZPVB 2NY0D 3X13B 3O81A 3ULVL 3E8UH 2PYEA 2P5WA 5ID0A 1IGCH 4PYGA 5DJDA 3SJVE 3VWJC 1UZ6E 4NN7C 5GGVL 3PQYE 1S9YB 4KY1L 3OR7A 5IKCA 1SEQL 3IF1B 2I07B 4XP4L 4L4JA 4X5WA 2OLDA 4URTB 3C6LC 3E2HB 2M8XA 3VFGH 2ZG1A 4BZ1H 4FG6C 1ZA6A 1X5HA 5HDQH 2OI9B 4N0UA 1JN6B 1T03H 2V5SA 4GW5A 1IGJB 2FL5B 4JFDD 4QXUH 1TJIL 2K7QA 1ZGLM 1MHPL 4J3WA 1QRNA 1FBIH 2C7UB 3ARQA 3O4LB 4CU8A 2Z9TA 5FM4A 4QHLA 1IC7L 2ITCB 4POZD 2ZJSL 3LMJL 2YEZB 2E8ZA 1CTOA 4X0KB 3TNNA 3GMRB 1QFWM 2XZQL 3P4MB 4PD4K 1MH5A 2F53D 3B6SB 3L1OH 2ENSA 5TQ0H 5IB5A 5E24E 4S1QH 4U7MA 4PRIA 3IKCB 4JHBA 1Z9LA 2Q1EA 4NO5B 2JCCF 1NAKL 5DI8A 3TBWA 4TUOA 3MXWL 2Q3ZA 4L8CA 5F6HJ 5GZND 4DN4L 1ZSDB 5KZCB 2DQCL 4LSUL 4JY6B 1HXMB 1K8IA 4NZTH 3DIFB 3SN6N 4PUBH 4LF3B 3DYPA 4IJ3B 4OLYH 5KG9A 1I1YB 4YO0B 1X6NA 4NHUA 5F1OB 4BZ1L 5EORL 1MAJA 2MOVA 4N1HB 2HLFD 2ARJB 4AH2A 5D5MB 1DN0A 1DQQA 4NP4H 15C8L 3CCHA 4XC3L 1MCCA 4LPVA 1INQB 4QF1B 4UQ3B 4KMTL 1ZMYA 4YHOH 3KPRA 1AIFB 4PRPB 3WO4B 2BSTA 3QNXA 4G8GA 5J9PB 3QFJA 2L0DA 4YHMH 3FQUB 5ADPH 1KT2B 1INDL 1FFOA 3FB6B 1FG9C 4JZJC 3BW9A 1PX4A 3BGAA 1S7SA 1MHPH 5F1SA 1Q94A 1B0RA 5F7NC 5IW6B 4IMLB 3WIHA 3MV11 3BIBX 3GJEA 3QBTB 4GRMB 5FCUL 1G7LA 3QJFB 3WS3A 5C9JA 3ARRA 1S7UA 4KAQH 4OCYH 4DTGL 4ZAKA 3QWRD 5I66A 2Q6WA 3L1OL 3PWJA 5CSZA 3SQBA 3T77A 4PREB 1K9TA 3LHPH 4KUCD 4WEUD 5CJ8A 3P11H 2EDWA 5HYSA 1BVZA 4UTAH 3G6JA 4OGXH 2IGFH 3I2CH 4IRSD 4CJ0A 1TPXB 4NKOA 5T1KB 4XNMA 1ZVYA 5JHLH 3MRMA 1G7HB 3EOTH 1QFWH 5DQ9A 1M4KA 3GGWB 3O4LA 4EDXB 5IQ9B 1X6LA 5I17B 5ISZA 4F7TB 1DUZB 5D2LE 1UGNA 4L8BA 3QAZC 1YA5A 2YPLB 4ZSOE 4CUCA 1IKNC 2NXZB 1M6OA 4G8FB 3C5ZD 3FOMB 5JIPA 4DEPC 1PGRB 3KPTA 4ZUTB 5MEPA 3N1FC 5GISH 2VSCA 1RUPH 4KVNH 5T1MA 4KK6C 3IF1A 4D8PA 2MPAH 3FQRB 4MD5A 3UP1A 1NCUA 3OKLA 3E2HC 3IETB 4AIOA 1AO7A 4I0PC 3TVMA 3S36X 3AAZB 1GVIA 3GI8H 3IT8D 1BD2B 3U7YL 5IEHA 5BXFA 4JKPL 3KDMB 3OHXB 3W5MA 4RZCB 5FK9B 5GS2H 3UYRH 3SDXB 2O5YH 3J8F7 2EYTB 2YBRA 3GMRA 3MLWH 2JB5L 1N26A 4U1NA 1FGNL 2K1MA 1GGUA 1BVLA 3V6BR 2FD6L 4JM4L 2FEDC 4Y4FB 4NC1C 4XPHH 2YWYA 3ZE1E 4P3WA 5M95B 3EYSH 4Q0XH 4Y4HD 1NCCL 2LAAA 2Y5TB 1EEUA 2CKNA 2V7HA 3DETD 2CJUH 3H7BB 5LVEA 4Y19A 2F58L 1M7IA 4P9HC 3DRTA 1UKTA 4O4YH 5ID1A 3T0VA 1E6JL 3P9MB 3KNBA 5C6TH 1DQDL 3DSFH 3I6LE 3BEVA 1BX2B 4OM1L 3FT2B 3U0PB 1TNMA 2FECI 4WUUB 2CLVB 3WD5L 5C0AE 5DFVC 3HE6A 3QP3A 5IROA 1AGFA 1CGSL 2DL2A 2HJKA 1T22B 4FXGA 1S9VB 4PB0H 3D85A 3SE3C 4OZGF 1X4ZA 4APQB 3EAKA 2Y5EA 3RIFK 4F7MA 4P3CH 5CD5C 3BD4A 5IESL 5FYLE 5KS9E 4K3JH 4U6VH 4J3UA 2IJ0C 1U42A 4Y1AA 1JZ6A 4WUUD 4LPWA 3NFSL 4PGCB 4Z7UE 3ZKXB 3FFCE 2DQTH 1HIML 3MV9A 4G9FA 1G7QA 1K4DB 4UQ2B 3SDCB 5C0JB 1RY7B 4PB9H 2IADB 4CAGA 4G6ML 2VZUA 4LMQI 3V7AG 4WI8A 2OTPA 2DYPA 2BNQD 3AMLA 3X3GH 5EORH 2XXMB 1EEZB 4LFHG 3RHWF 1XEDA 3TC9A 3W0WD 3TFKD 4KPHL 5CSBA 3K4AA 2XRAH 3VGFA 4KK9C 4XBPA 3PNWA 2V2XA 4U6YA 5D7KD 1AKJD 1JHLH 4PJHF 5JOEA 1IGCL 5DJCA 4JY5H 3OKKA 5E4EC 1DSFL 4R97B 5D8JH 2X4RA 5L2KB 5EWIH 1TDQA 1R3KA 1JYWA 4ZUWB 1XGQB 3RGVB 4FNLH 4KKAC 1GYAA 2DKSA 2XWTB 4PGBB 2APFA 4YUEL 4Y4HA 1AGCB 1DFBL 1XF2B 2JLLA 2X4RB 3F7VA 5HDBF 1YYLH 4WHTA 2NY1B 4XPFH 1WSST 3L6FA 4DZ8A 1C8PA 1J0HA 4M02A 3RTQC 4F8TA 2V2XB 2QQKL 4I2XB 1S7TA 2ESVE 1BREA 4ZQKB 5IHBA 3K2MC 3K80A 1N8ZB 1TVHA 4HXAL 1SY6L 3TBSB 4HK3N 3U0TB 4PBVC 5C0CD 2CGRL 3NH7H 3RX7A 2D7NA 3T3PF 5JNYA 3B9EA 3C8KA 2VZ1A 4LQFL 3DGCR 2DIAA 2WIIA 2V2WA 4OCSL 3ARDB 5IR1A 1YPZF 1FNSH 1A6VH 3PG2A 4I4WB 5DMJB 1KJ2A 1Y6NR 3RY6A 2BSED 1YY8B 4JPWL 3SDAD 1QFWL 4ZUSA 1A1NB 4PJ7F 3FN9A 4Y2DB 2F74B 3CNKA 5B38G 2FH8A 5LG1A 4YK4B 4POYA 4I18A 4DGIL 1MAKA 3LV3B 3MBXL 3GUTB 3BGFC 5EU3A 1OOAA 2AKRA 4R4FH 1UADC 3EO9H 5DD1L 4EN3C 5I8CA 1IAMA 4WUKH 1A0QH 1H8OA 3L5WA 3LN9A 3REWB 1U8HB 4X7TB 2YD5A 5IVZB 4I9WE 5K9KB 4GS7B 3MV7A 2FSEA 3V6OA 5DC0A 5IMLB 4ODUB 5GRUL 3BDYL 2HFGL 2A6JB 3WMSA 3IAPA 1A7PL 5HHNB 1OF2B 3KDMA 1P53A 4TTDC 3DMMA 3BEVB 5L88L 3I75B 2ZJSH 5ESVB 5B38B 3KYNB 1MREL 1IAOA 1NPUA 5AZEH 3WUWB 5DHVB 3MJ6A 1H3GA 3W0WA 5D7IB 1OAXL 3RJDA 1NCAL 1H0DB 4XXDB 1RURH 5MENB 2APBA 3T3ME 3DO7B 3BPNC 2HG5A 3WN5C 5JDSB 4LNRA 3ZL4L 1RVFH 3ZKND 2FX8L 4ZUTA 3TEUA 3UBXI 1T04B 1OTTD 1ZAGA 2GT9B 3HZYA 4TOYL 1LDPL 4HWBH 4YPGA 1UCBL 1LQSR 4EEEA 4PRDB 4LU5L 5DD3H 3RNQB 2ITDA 1YEDB 5DT1L 4Z7WF 4EQ3A 3CC5B 2BFVH 3DXAE 3BRGC 2PR4L 3MYJB 5D7JC 2VITB 3ARYA 1G7HA 1L7TL 3OKOA 1MFAH 2P1YA 4ODTH 1XGYL 4ZFFA 2K9UA 4TVPH 4JGMA 3SEPA 4M6MH 1WAAE 3VD7A 1H3VA 4CN4A 4NRYA 1OTSC 1ZHNB 5EU7E 4HIIB 3RBGA 1XZ0A 4PJFA 1FFNB 4M6OH 5CJXA 2V5MA 5FM5M 4CW1B 3FQRA 3QQ3A 2DQEH 5HHQA 5CILH 3RVTD 2AGJH 2BY1A 4WI6A 4I48B 1RPQA 3T2OA 4X6CE 3Q3GB 4H1LH 4NCC2 5DXWA 1PFCA 1S7VA 1Q9WB 4MQXC 3T0DA 5KS9F 4WGVB 4HULB 1BEYH 4M1GH 2J8HA 5F9JA 2ESVB 3F58L 1XCQB 3LH2H 2R9HD 5DEFA 4JPKH 3RGHA 4K3DH 3GMOB 1OD7A 1CFVL 1YNKH 4GSDL 3MRMB 3DXAA 3ZT7A 4NBZB 2BOCB 1ORQA 3O4OC 1NMAH 3G6JB 3W39B 1D5BA 3BUYB 3H2WA 5HPMA 3QDME 5F7FA 1U91A 2XI9A 2I5YL 1F45A 2DL9A 1K8DB 3DMMD 3GRWA 1UACL 1LE9B 1AQDA 1FIGL 3GHEH 1YMHB 3L5IA 2H32A 4HSQA 3SGJC 3TWCH 3LOWA 3H8NA 2JK5A 3DTXB 3HAEH 4UDUA 3ZDXF 3ULVD 3PP4H 1KTDB 3QFDA 4JGJA 1WTGT 1DVFA 5DD3L 1YEJL 4U6XA 1TZIA 5JO5B 1UJ3B 1U8PB 3FONB 3PWJB 3ZTJH 4M61B 2L7JA 2DQEL 2NX5E 3ALXA 4KKNA 3P30H 4XB8A 1IGIL 1JTOA 1NANH 3L3DB 3ULUC 4MD4A 2HVJA 5HYQB 3IDYB 3QFJB 4XCFH 3IDIB 3S34L 4C54A 3BPOB 4JJ5A 3SDXF 5DSCB 2V9TA 3CUPB 3UTSA 5ADOL 4LSPL 5LGKA 3T1FB 2W59A 4UV4H 3BEWB 5TQ2H 3RVXD 3JTTA 5FUCE 3BQUD 3QO1A 5KS9B 1K2DB 4HHAA 1S3KL 4LLMB 3BWUC 4HC1H 3FRUB 1J0IA 2GFBB 2P5ED 4P2YA 2FYYA 3WE6B 4N0UB 5MI0C 3QUKB 2Q87A 2CGRH 3NH7L 3UJIH 1N7ML 3QIUC 2VL5A 2D7QA 4HUUA 3J7HA 1QFHA 3ARSA 5JXEA 2P8MA 5SX4I 4OD1H 4WO4B 3MLVL 3DV4A 1JHTA 4NP4L 4J4PA 2VO5A 2ZNXA 3MA7B 5DUPH 1UT9A 3L3GA 4DKEL 2YXFA 4MNQB 4KROD 2P5WB 3W9DB 3QPXL 5ID0B 5CBAB 4PGEB 3SE4C 3L7EA 2CO6B 4N0YH 1DBBL 1KCSH 5BVJB 1HI6A 4RBPK 1GIGL 4I77H 2FNBA 4RRPA 2YXMA 1I7ZB 5C2BL 1P4LA 1T6VN 1KPUB 2BVUA 2VIRB 3BESR 3IYLW 1GCFA 3GB7A 1JL8A 5EOTA 1QFPA 2ARJQ 5C6TL 5I1KL 4X80H 4W6YB 3SDYH 2O61B 1XGTA 3KYOB 4ZFOL 4TPRL 4X0KA 2ESVA 4JG0L 1O5DT 4AMKH 4WU5B 4IIQA 3D39E 2X42A 5FHBL 5DJ6A 1AHWC 5KAQG 4RFNB 2NY4B 3T0ED 3QI9A 1NL0H 3RX8A 4HKZB 1DN0B 2D7PA 3QEHA 2XY1A 1IEBB 4UT7H 1YN6A 4YR6B 1KBGH 1EBAA 4M7KH 5CFHA 2ZUYA 5EU7C 4KUZL 3UZQA 1MY5A 1I3GH 2I07A 3FO2A 4PRHB 5T3XE 2GCYB 3C5ZB 5I30H 4EDWL 5E94A 1QSZA 4PS4H 3MZGB 4HXAH 4PGDA 3O9WC 2FIRT 2YD1A 4KY1H 2D0HA 2VLKB 4I3RL 4QHUB 2P5WD 2BZDA 4XBEL 3CMOH 3C5SB 2JJUA 2YKLH 4HLZG 5D2LF 3WNMA 4PP2B 2VLJB 3AVEA 5I16A 3HZYB 4NO0B 5C0CA 2CIIB 4QT5A 1MFNA 4CGTA 4LNRB 3QXWA 4POUB 2ZSVA 4EXPX 1S7RB 1YPZE 2YA0A 1PY4A 4ONHA 2WLYA 1I1FB 4P2QA 1CD9B 4RNRB 5LGJB 2XA3A 1E4KA 1RJLA 5BZWA 1VKXB 4YHPB 3G6JE 3O41A 4Z8FL 1N6VA 3NAAL 4GXVL 3PXHA 1XF5B 2P8LB 5GGVY 3TWCL 1MHHA 1G6VK 3I75A 1RK0A 3QFJE 4OCSH 3MCKB 5GRWA 4LLDB 4J4PD 1JCKA 1C5BH 2BVPA 1SMAA 3PWUB 3V4PH 4KUZH 5FGCE 3H3KA 1BIIB 1JWMA 2YRPA 3SE9L 1IAII 2CDGA 2BNRB 2YD3A 4X9FA 3O2DA 4XWGH 4O58L 4XI5C 4Y0GA 3OXRA 3T4YA 5J89A 3C60B 3DGGB 2OSLB 2AQ3A 4IOIB 5L8LB 1JRHI 4J1UB 2G5BB 3G5ZB 3C09B 4J3TA 1X7QA 4YFEA 2DTSA 4NFBA 4I18B 2C4FU 1Q9OB 5DK3A 4Y16C 2AW2A 2XACC 4HJGB 2DQGH 2ERJC 1F02I 4OCWL 1LO2H 4JO1H 4XVTH 5HHMD 2G75A 1C1EL 2DQIH 1JV5A 2RQ8A 1EFXA 3ZE2F 1U8IA 2QQQA 1YEJH 4D0DB 1GZPB 3HHRB 4YHOL 2Z4QA 4HXBL 3TBSA 4RGOL 1DQLH 1N8ZA 2E7CA 1IQDA 4ZQKA 3MRQB 4F33A 2VABA 3O6FD 1KTLA 3SY0A 4NIKB 2EYRA 4QY8A 4EVNA 3H42H 2CDEA 3BRDA 3PWLB 2QSVA 3GEWB 4D0DA 2R4SL 4GKZB 1A4KA 4WW2B 2NYYD 5J3HC 3F7VB 4G7YL 1DLFL 5FO7B 1A9BA 2FBJH 4PGBA 1NBQA 1R0AH 5H2BA 4L9DA 5E1AB 2IFFL 4Q6IC 2R1YA 4TUKH 1TIUA 1F4XH 4KKLC 3ECBA 3FO1A 3RDTC 5FFLA 2YUVA 4JO3L 2BMKA 2OTWB 3C2SA 4KVNL 3RGVC 3P11L 2OL3B 4G8EB 5IB3B 1FN4B 1NGQH 3F65A 1NAKH 1ZHKA 3OJVC 1S9WB 4OLUH 1X9QA 4O51A 4QRPD 5DHVH 5K9QI 2XZAH 3CLFH 4XGZB 2YD6A 3HI6H 3GSQA 4XTRC 4LDOB 4LLWB 1NAMH 1QLFB 1RZGB 3EDJA 3O4LE 4LSPH 5D2NC 4HBQA 4ONFL 2ORBH 5HYFA 4WFGE 3JWOL 1I9RH 3MNWB 5I76A 2ZOKA 4QRQA 2GK2A 2KZ1B 3C6SB 4P4RA 5IJKA 3S7GA 2P8LA 3ARGC 3KR3H 5FM5O 2BNRE 4W4NA 5I15H 2X9WA 3HR6A 1VSCA 5DVOA 3PWNB 2A9NH 2W0LA 4OFIA 4OD2A 2CIKB 4IMKC 1WZLA 1S8DA 2IH1A 4OCWH 4TNWK 4F7EB 4RWYL 3OJDB 4JFEA 4U0RB 1JFQL 1TQCB 4H0GA 2H6PB 4XP1H 5EIIA 4HXBH 3ZDZE 1MCHA 4JPVL 1XIWB 4R8WL 5D4QA 4X4XA 3G5ZA 2EO1A 4PJ7B 5D6CB 3RFZC 1P4BL 3H3BC 3RJQB 2LQRA 5BO1L 2YA2A 3HE7A 4QNPE 1E27A 3QDGA 5IQ7H 5FDWB 3O2WH 4HQQL 3X14A 3MRHB 4NO3A 2GQHA 4AQOA 5C7XH 3OB0H 4KDTA 5D7JA 5EIQA 1BVKB 3NZHH 1A1MB 2HVKB 1CE1L 4JPVH 4G3YH 3VI3E 2IPUG 1FVDB 4K9EH 2ATKB 1CLZH 3LD8C 2WWKO 5HYJE 1MFEH 2YZ8A 3CVHB 4MYWB 3K1KC 3U7WH 1RU9H 5GRJL 4OUOA 1G9MH 1J1PH 5IGXL 4XMLL 2CR3A 3ROLB 1FNGB 1XGRA 1L9NA 3NVQA 1FGVL 5IMKA 1V5JA 2LV4A 4NNYA 2BNQB 5I74C 1UYWL 1J86A 5KW9H 1TZHA 4U3HA 3GSOA 1NEZG 1UWGL 2IMMA 2O93L 2FGWH 2WNGA 1CE1H 3VD3A 3AY4A 1I1FA 4P2QB 3EYQD 4MNGA 3ULVC 4ZMAT 4FQXB 3L5XL 2E7LA 5KZCD 5D8JL 3UPAA 4M7ZC 2VR4A 4OZGE 4OCNC 4RAVA 1DBBH 1KPUA 2VIRA 5LQBL 4M5YL 4DAGL 3RIAK 1HSBB 3U9PH 4JR9L 2H2PC 2Y7QB 3RNKB 3MSPA 2PTTA 5I1GH 3VFGL 4OGYL 5MEQB 1WBYB 2F8XC 3HFMH 5CZXD 2YD4A 3GSRA 1KN2L 4MVBC 3GSNB 5BRZA 5A16A 1JWMB 4H1LG 2OM5A 4ELKA 3DV4B 2AJUL 2YPVL 1G7MB 4PJAF 1X5GA 3KXFB 4HC1L 4JREC 1CFTB 4GMSL 4NUGL 3P73A 2WBJA 5DK0B 5SX4H 3TPUB 1TFHA 2B5IB 1FV1A 5L6YL 1CGYA 1WWWX 3MUY1 1KBGL 5GGSA 4LLQB 5DMYA 3GBML 3CXHJ 1VERA 5GGTH 3OV6A 1UWGH 2KZWA 3PDOA 2P5EB 2JJTC 4HEPG 1CGSH 3S5LB 4Z7UB 5DD0L 1WZ1H 4ZFOB 5I16B 4DGYH 4FFWD 3GMLA 2BP3A 2JELL 4OZIE 3UDWC 2YZ1A 4KKBC 3L3DA 1UZ8B 2KDGA 5DJYB 1FJ1A 5EA0L 3HNTL 1K3IA 4MNQA 4FTVB 3W9DA 3W5NA 4JFYB 2ED9A 3AXLB 1RFDL 1WQVT 5TF1H 2FR4A 4YGAB 2OQJA 1T1YB 1BQSA 4ONOA 5EULV 3UYOD 3GO1H 4MCYB 1NANI 1WWAX 3KHQA 1JZ8A 4U3CA 1UB6A 1A7PH 4OF0A 3BP4B 3QG6B 1IAKB 5E6YA 5EOCJ 4MJ5B 2VB5A 3U30B 3BJ91 2EDLA 4H26A 2WZPD 2NX5B 2CSPA 3HMWL 1IKNA 2Q7NA 4YR6A 4GG6F 4LLYA 3ARWA 3OGCA 1ZHLA 4M4RA 5DRNA 1QSED 3G6DL 3VFPA 4OQTL 4ZFZA 4HDIA 1HYSD 1UB5A 1JPSH 3IGAB 4NQSA 4R6UA 3CZFB 3QDJA 2IBBA 1BQUA 4QF1A 5EUOB 4QOKA 1UM5H 3LB6D 5IG7B 3S96B 4N0FA 3ULVH 4X4ME 5GGTL 4OFYD 4BA8A 1EGJL 1A6VL 3QIWD 5JW5A 5KSAC 3VXME 1G0YR 3ZO0A 1NCWH 4OLXL 5F89B 3VI4E 1RQ5A 3GK8H 2OMBA 1MFCH 2FECL 1UM6H 4ZAKC 2KUTA 2WW8A 4QOKB 4HUWA 4O2CB 3CZFA 1CDHA 3QDJB 1WFTA 5TDOA 3QG7L 2IAMC 2VDNH 2YD2A 4PJHB 2C4FT 4HS8H 3QDMD 3MJ9H 3RWCA 4PJ8C 2EEAA 2M1KA 5TGBB 4ZD3H 2B4CC 1JYNA 1U8PA 1OAKH 1U6AL 1WLHA 4PRIB 2AXHA 2XA8H 3QG6A 4XHQA 3MA9H 3VXRA 2JK5B 3DTXA 1ZS8B 3LKOA 1W72L 1YMHA 5T1DL 3O6FC 3IFOA 2DLIA 3ZHKA 2A6IA 1MFBL 5BV7B 1ZANL 2C3HA 3CC5A 3LY6A 4FQJL 1U8MA 5DEFB 1YEDA 4JFPB 3EO1A 3UTQA 2YN5A 4GW5B 4G6AD 1NEZB 3CFIC 4PV8A 3BH8A 3V6ZB 3MGOA 3QXAA 4QXGH 3BT2H 4WI4A 4MA7L 4Z7UA 3V2AR 3UTSB 3DX8B 2XQBL 3VXUE 4Y7MA 2PKDA 4F2MA 2OL3H 3UAJC 4PJAA 3IDIA 1I9JH 4D3CL 1IVLA 1DQLL 1F4AA 1A3RL 4XWOD 4PJAE 4FP8L 3MLWL 1XF3B 4O5LL 43CAB 1AGBB 4H0HB 4UAOB 4P23C 1FO0L 4M1GL 4C55A 3RUGA 1WFUA 3DPBA 5IJKC 3CH8A 4QHKI 2WBWB 1PD6A 2DYPD 5HHQB 1P9MA 3KPOB 3GMNA 3AS0A 4K7PY 1NCWL 4OLXH 4P59L 5BMFH 3VRLE 3ET9F 3QYCA 2P42B 4ZNEE 3V5HB 4HUVB 1DQJB 5DD1H 2FB4H 4X83A 5CJOH 1DR9A 2YKLL 4Y5YB 3RWHB 4F7CA 3UBXG 1AD0B 3ABZA 3P9WB 5D2NE 2AJYH 1KF9B 2WQ8A 3W39A 1GGYA 4OLUL 1XMWA 2HMID 3BKYH 1B3JA 3B8YA 2XN9E 4NKDA 1RV6X 4Y2DA 1GOGA 4XXCA 5DWUH 2ZPKL 4PG2A 1N4XL 3VFVA 1F90H 3WN5A 1A7RH 2LAGB 5FV2A 1ODAA 4U1SB 1EA9C 5F72S 1DBAH 3PWPB 2AJUH 4BUHA 4Y16A 3PF2A 4NNYB 5FB8A 2X4SA 4Z18A 3FB7A 1D6EA 1OL0A 4UILL 1D9KA 5GRUH 3ROOB 4GRLC 3LZFH 3V52L 3VGAC 3ZTJG 2CXGA 5HHNA 4IDLA 1BGXL 4ZUUA 4Y89A 1B4JL 4N5UA 1ZEAL 3IFPA 2BX5A 2W07A 3ZYOA 2XN9A 1KB5B 4NT6B 4U2YA 3PIQB 4NFCA 2HWZL 2GJ6A 3VGHA 4M48L 3DMMB 1TJHL 2R29H 3WEXA 1RIUH 4RGNB 2ATPA 1P2CA 4MAYC 5C2BH 5IB1A 3BMVA 5C07B 4D9LH 3GKWH 2G2RA 3ARBC 4BFEA 4I4WA 5LGHH 1ORSA 1RK1B 3S3JA 5GS2D 5E56A 5DWUL 5JQ6H 5INDA 1HDMA 4ZTOH 1P84J 2AEWA 5EO1B 2PCPB 3BXNA 5JIKA 1FYTD 4M00A 4C83A 1QOKA 2FJHA 5E08H 1KJ3L 2DYPB 2P44B 3TPKA 1R3LB 3LEVH 2H2PD 3MJ9A 4MNGE 4CN1A 3OKEA 5GJSL 1FVCA 4R3SA 4P23A 3BI9X 4KGJA 4OGYH 4NQVA 2BVQA 1HDMB 4JDTL 4X5XB 3ORJA 2NY6C 2XPGA 4ZUVA 5C08D 5ECJE 4PGCA 4TUJA 3V9FA 3VFUB 3V5KB 2A77H 4C57C 3CVHH 2OTUB 3HC3H 3ZZ1A 3V4UH 5C6PB 5GRVL 4LSUH 2X10A 3K4ZA 2XWTA 3S35L 5GGSY 3OR6A 4WW2F 4M48H 2BJML 2R0WL 3RTQA 3EYFA 1ONQA 1NJ9A 1VGEL 4PY8J 1R3HB 5TH2B 4A2MA 1Q0XL 2MQ0A 5IBLD 4HKXA 4NUGH 1OPGL 4DZBB 2JCCA 1JPTL 3S34H 4NRXA 3PIQA 3LRHA 3C08L 3V5KA 2VWEE 3WXVH 1MI5D 3T4AB 2HJKB 2NY2B 4JVWA 4CMMA 2G9HB 3S3SA 5DA4A 2HFEA 4H88H 4F8QA 3SE3A 1D9KB 1QRND 5HVWA 1SM3L 4M62L 2J8UA 1T5WA 4KRLB 3CPLB 3P0VL 3HNSL 2NY5H 3QDAA 2YPLE 4ZSOB 4Z7WA 2A6KB 5E6ZA 4PRIE 1NGZA 4LPTA 1A6WL 1GGCH 3O3DA 3SKMA 3WL9B 4BSVA 4NWTH 4I1NB 4QWWD 4L9LC 2FEEL 4QOKE 2VDLH 4D9LL 2VLRE 1T1ZB 4WHYH 2B2XL 3MLSL 4KVCL 2V7HB 1BZ7B 3EOTL 4MDJB 4P3CL 2HFEB 3ALWA 5HJ3B 4LKXA 3VG9B 3C5JA 4X6EB 5E5RB 1WV7T 3QPQD 1PBYA 3KPMA 4HS8L 5H37G 1CLYH 1RMFH 3MREB 4YH6A 2IBZY 3RWHA 1KPRA 4HV8B 2AABH 3G08B 2MHAA 3RI5F 1CXEA 2LE9A 4XNYH 1G7PA 1KJ2L 5FYJE 3LIZH 1BJ8A 1ONQB 2YBRB 4KJQC 1I7UA 5E5MA 3T2QA 1JNHB 3O2DH 5FF6A 5C0IA 4I5BA 4RGMB 3CFCL 1ZT1B 1S9VA 2P47B 4BFIA 2N56A 3TCLB 2CRMA 1M71A 1UQSA 1T83A 2R15A 3AAZA 4D0CA 2HH0H 3BQUB 4GQ9L 2VZSA 2MKLC 2PUQT 3L95A 4PLJC 3P9MA 4CDGC 1BQLL 5ID1B 2GUOB 3KLAA 1ZVHA 1Z9OA 1BIIA 1G9NH 1MFEL 2Z92A 2RCSH 1RUKL 5TQ0L 2DDQL 2VZ3A 1MHEB 1JNLH 3DX8A 5DTFA 3DETC 3E6FA 3P4OA 4LSVH 4RWHA 3MGOB 2VN7A 3QXAB 4OD1L 3MV9B 4G9FB 2D7TH 1VHPA 3SPVB 4L8BB 3MLRL 3N1MC 5HY9B 4Y4FA 2CMRH 4F7TA 3MV8B 4GAJL 4GJTB 3KYMB 4OQTA 5IQ9A 2XNAB 3P4NA 5C7XL 3NN8B 3CDGA 5FGSA 1YQ2A 5E99L 5GJTH 4RGND 5EUOF 3UYPA 2Z31D 1JHKL 4QRRE 2ATPB 2HFFA 2PXYB 3BPLB 1NGYA 3U7YH 3HZVA 2AJ3B 1BJ1J 1KB9K 2XTJE 5IK3A 3RY6C 3FQTB 1TETL 2CKBA 1MRCL 5C8JA 4PREA 4ZODA 2ZNWA 4JZNB 1I8IB 2HN7A 1KB5A 2X2YA 3RL2B 5J3HD 2XKNB 4F7PA 4P46D 5CZKA 5IHUL 1PVHA 4YWGL 5CJQL 1FFPA 4YHLL 3FHQA 4GUPB 1AQKH 4MJ6B 3QUXC 5IEHB 2FBOJ 1BD2A 3N9GH 4JPIA 4JFQA 4O2CA 3FO9B 4LIQL 1AD9A 4IRJA 4DN3L 4G43B 5ILTH 4TNVK 1CDYA 5C6WH 1RIHL 4JCLA 3FQUA 2VXUL 2AI0L 4Q6YA 3DI3B 1DQTA 5E9DE 4O5LH 2EKSB 5D1XA 5ELIA 4M93B 1MWAB 1TJIH 5D6DA 3EDEA 1PSKL 1A7NL 4JDVA 2R4RL 1HZHH 2EXYD 3U46B 3TBYA 4MJIE 2LU7A 3DROB 3TFKC 4Q9QL 1JPFA 4FQQB 2DQTL 3GRWL 2VZTA 4PFEA 4WEBH 5DMKB 1SMOA 2Y07H 2XKSA 2Y36L 4DQOH 2HKFL 2R0LH 3X3FL 4DCQA 1TCRB 1MVFA 4LLYB 3VFSB 1T80A 1XIWD 1XH3A 1T4KB 1NDMA 2X4NB 1CK0L 2HKHH 4P5TD 2X6MA 4RQQA 2O5ZH 5JZ7D 4KMQA 1VFAB 2NPLX 2R1XA 3D0LA 2P48B 2JIXD 4HUNB 2AV7B 3O3BA 3UPCA 1QG3A 3QDGD 4CVWA 4N8VG 5DYOB 3R0NA 5F7EL 5GS3A 5D7SL 1JF6A 43CAA 4E42A 5I71B 3JV4B 2Y36H 3IETA 3U7AA 4NC1E 4QCIA 1AE6L 4G6KL 1ERNA 4K3EH 4FQLL 2UY6A 1P7QD 5GZOD 5JW5B 4U05A 3P4LA 3S4SA 5I8EA 5HDLA 4OI7A 3UAJD 4O9HL 3M45A 3QUZC 2R39A 2DQFB 1N5YL 4RAUA 4K9EC 3CDYA 4TVPL 4BZ2H 4IRSB 2GFBA 4M7LH 1U8MB 4FABL 5H8DA 3P77A 4OUUA 4HHAB 1YDPA 4UINL 1N4XH 3GSWA 3T0AA 5DQ9B 1IGJA 2FL5A 4EI5A 5LAXB 1DEEA 1XR8A 5F3BB 4HIJA 1ZTXL 4Y5VC 2GITA 1ZS8A 3RVVD 4ZFZB 5C0EB 4GRWF 3VGBA 2A0LD 4NSKB 1AFVH 3OKMA 4OD3H 4ORGA 1KCVL 1P84K 2DI7A 2F5AL 2VLME 3O8XC 2XIDA 5I66B 3IDGB 2AJXH 3O6MH 3SKJL 4CMHC 5JW3H 5DR5L 1WWBX 4JG1H 5KG9B 1MVUB 2G5RA 2QADC 1OP5H 2V5RA 3MCG1 3M1BA 1AD9B 5SV3A 1E6OH 4ALAL 3HS0A 1F11A 2VISB 1T1YA 4B50A 3EYOA 4MJ6A 4M5ZH 2Z91A 4P5MB 1YC8A 2OYPA 1SHMA 3D5OF 4NKQB 1WAAF 2P24A 2NY3D 2DWEB 2WWMC 5C71A 4HJ0C 5L2KE 4KKLD 2HN7B 3ZSSA 4JRYD 4GAJH 2QQLH 4R7DB 1N59A 3O4OB 1PYWA 1AIFA 4ETQB 1FG2B 5ENWB 3CH1A 3ZTNL 4AIZB 3S96A 2X4OA 1JPFB 4FQQA 5C9KA 4Y4KA 1F97A 3BT2L 1RHHA 3IGAA 1D5ZB 4NQSB 1H8SA 2FCBA 3MRBA 1TZGL 1ZA3A 2LU3A 5C3LD 1ZHLB 1FRGH 1QRNB 4DGIH 2ARJA 1NGWB 3HB3D 1A6PA 5FECA 4JO3H 5I1HL 2HJFB 4NN6B 5D7JD 1OCWH 1I4FA 2F15A 5IFJB 5F1NA 3MRLA 5F3HA 3RPIB 1VACB 1EAPA 3MFGB 4KUCF 1G7MA 3QIWA 3R8BB 4XNZC 4N9GA 3D3VD 4DJMA 4JFQB 3IJYB 4MCYA 4UBDD 3QQ3B 3N0PB 4Z95L 3LEXA 1ZKAA 4XCYA 2X4TB 4NGHL 3N1QC 1S7WA 5J56B 4YXLH 4IEFB 2M2DA 2RJMA 1SVCP 1MJ7H 4PJCA 2AXJA 2UZYB 1NSNH 3C2AL 2DIBA 5CHNA 2CQVA 3O3UN 2Y7QA 1AGEB 3FQTA 2HT4C 4UI2A 4BH7B 1OP3H 1VPOH 3GHBH 1LEIA 5LJYH 1DFBH 4RDQF 5HHXL 4Q2ZA 1A5FH 4NQCA 4KI5E 4AMKL 2BHUA 3H9HA 4HIHA 3NN8A 5DD6A 2PO6D 5HHMB 3F5WA 3CAFA 3OWEA 3S35H 4Y5XC 4XMKL 4YPJA 4FXKA 4CADB 2IQ9L 1CL7I 3MNWA 5GGRA 5GS1C 3TP4A 4OIIL 5L8KB 4L4TD 3TNMA 1J10A 4BFGA 5IKCB 1HH6A 1DL7L 2VUOA 2Q86B 3GFUA 2C1OB 3MLSH 4LEXL 3BAEH 2GUOA 3RZCC 1VFUA 1XGYH 5L7XH 3BZ4A 4WO4D 3SKMB 4BSVB 1CXIA 1CQKA 4UT6H 1AGDA 4EUPH 4XPHL 1X5YA 5BOPA 4GSDH 3NCJL 4JAMB 5D1XD 3WUWA 4U0RC 1LE5A 3TH2T 1IAOB 4MGXA 3DRQA 3QULB 3QNZA 1R5VB 1EIBA 2PTTB 3SGDI 2OMNA 1UKQA 2DLHA 3EOBB 1YEGH 3MJ7B 1N5AB 4K8RC 3RUGE 4KK8D 5JHDA 1FDLL 3K74B 2VXSH 2R1YB 1FVEB 4HH9B 4X6BA 2X4UA 1I8LC 5CP7B 3O2DL 2DJUA 1FFQA 1QRNE 3MBED 4EN3B 2IPUK 3ZE0F 1NGPH 2XTJB 4X4YA 2W65B 3BD3A 5FV1L 3N1GC 4G6AC 4Y4KC 1KPRB 4M4PA 1TZHB 3FQNA 3K4DA 4X6CA 3VA2C 1OW0C 3PL6A 4OV6F 4ZDHA 5IVOA 4U1JA 2DLFH 5J7CC 3QDJD 4LVNC 4ODHH 4KMTH 1NFDB 3SDDA 5E2JA 1F2QA 1IQDB 4U1HA 4L9LB 1WC7B 5EZOH 3ARFB 5J1AB 3SKNA 2Q3AA 3VFUA 1LWRA 3PWNA 4ZDHB 3VXUA 1NFIB 2BNUA 2NY0B 1DQDH 1MCOL 3CJJA 4UV7H 3TIDB 3NA9H 3W11D 3QIUA 2UYLA 5ETUB 4WFHE 1ADQA 3U2SB 3OXSA 2GTZB 1KIQB 4OV5A 1R3IL 5EU5A 5FYKU 4AEHH 2PCPA 2HT2D 4O2FB 2ZCKH 1ZE3C 1QFOA 3TN0D 5MHSD 3PHSA 3ULVF 1A6AA 1N2RA 3MBXH 4TSBL 5DLML 4DZ8B 5I1JL 1QLRA 4X4MA 5AEAA 5CINH 1IGTA 3VXTB 3G5XB 3HPJA 3QDMB 1F8TL 1CYGA 2Y72A 3DO3A 4FQLH 4LLUB 2CDGB 4HK3J 2VDPH 2VJXA 1LO5A 1V7MH 1MQ8A 3U2SA 4A6YH 4ODBD 1SJXA 2J5LB 4GMTL 4JLRB 5C0RH 2R0ZH 1SY6A 4MSWA 2OTUA 4NZTL 3GIZH 5E8NB 5LXGL 4CADA 1KJMA 4OZ4B 3TJEH 2CIKA 5EWIL 2VRAA 4ZPTA 3SGKA 3UTTD 4PY7A 1JI2A 1T3FA 3ES6B 4N90D 4NCDA 3PV7A 4JKPH 5CEZD 4RA0C 4YHPA 5E8NA 1YUHA 4EZMA 4OCLC 1N64H 4QRSA 4ONHB 3VH8A 2EDTA 3S88L 4GRWB 4NHCH 5D1QC 5DRXA 3LDBC 2H8PA 2JB6B 4TVPD 5GSRB 5C0JA 1MRFL 5IFAL 12E8L 4P4KB 3BVNB 2F5BH 4Y8DC 4WI7A 2VLJA 4OZIF 1FSKB 1JI1A 2DM7A 4U7SA 4YFLI 3RWIB 4Z7QE 2AK4B 1BJ1H 3SHSA 3FRPA 5KSVA 5EFIA 1BFVH 3EO0B 5IF0B 1SBSL 3HRZB 5C07A 3AROA 2VXUH 4MB3A 4APQC 4HEME 5H2BB 3PL6D 1T1WB 2B20A 2OR9L 3I6GA 1A9BB 1S5IL 4APQA 2XV6B 2D9CA 3NIFE 3P0GB 1PG7L 1AGDB 4BZ2L 2HP4A 3MODL 4YX2H 1DQJA 4E41E 1T22A 4JN2A 2Q86A 4PJHE 2V17L 4NQXB 3T1WA 1BIHA 2DF3A 2W9DL 4G80A 3MFFA 1QR4A 2X9YA 3UCRA 1ZA3B 4HWNA 4XNQB 3MCKA 2YUWA 4HKJA 1H3WM 1L9MA 3IJHA 1D5ZA 3N06B 4K7PL 5CZXC 2PW1B 3V6OC 1CLZL 1T20B 4LCWA 2A6DA 1GZPA 4NKIH 1D5XB 3KJ4C 1DBKH 1X4YA 4ZTPL 3RWEA 4X4YB 4U1SA 4MXVF 4EN3A 4CVZA 2ZSVB 1JIBA 4F9PA 5C08B 4MZ2A 5HGHB 4FA8A 2A77L 4NRZA 4LFHD 5ESAB 2F54A 2EH7L 3FB5A 1PAMA 1HKLH 3KVQA 1FZKB 1SBSH 1HE7A 2OSLA 3G9VA 1ZVSB 3JV0A 5HBBA 2HYMA 4GG6A 4KJWC 4ODVL 5CZVH 3L3GB 3VXMD 3IFOB 4FQJH 4OIIH 3GJFA 4G6MH 3QA3B 3V5HA 2GCYA 4EI6B 1WJ3A 4NKMA 1B6UA 4YDIL 3I84A 3UMTA 1KFAL 3QJHB 4Y16D 5LGHL 5E8EB 3WLWD 4MQTB 4PJ8B 3HNVH 1HQ4A 1G1YA 3MRLB 5DJAA 1J8KA 2DOCA 4JB9L 2DMKA 1KEMH 3FN0H 3LS5H 5B3JE 5HVHC 1SQ2N 4P2RD 8FABB 3JWDC 1JGEB 4PIRF 5I15L 1R3JA 3VG9C 5FUOH 2VLRD 4HIHB 1YY9C 2AJYL 4NQCE 4PJAB 2VQTA 2L4OA 4YDJA 1ZLVK 2DQCH 1HEZB 4I8DA 5IVXA 3JZ7A 5MEPB 5ERWB 2HMIC 1U3JA 1C12B 1NEZA 3QPXH 4Z76A 4EXKA 2ZUSA 3H9ZA 3MOQA 1KG0A 3MBEC 2VLKA 1KENH 4UDTA 1J0KA 4J3OC 4KTEH 3F7RA 4Y4FD 2D9QB 3IU4L 2WWMD 3D25A 4X4ZA 5GRZA 2OP4L 4TYUA 1G6RB 2VL5B 1F3DH 1AC0A 3G6AB 3RGVD 1KN2H 4LHQB 4HS6A 3ZT5A 2XRAL 4WFFE 1OAZH 4FFZL 1MCKA 4U7KA 4BFBD 1YN6B 2A74B 4P23D 3RIFF 2YPVH 3QEHB 4XTRD 4GRMA 3INUL 1IC4L 1Y6KR 2VOTA 4TRPL 4P2QD 1QKZL 5IW6A 1ZGLA 4BSWA 5AZ2L 1MCJA 1Q94B 5KSBB 4LSDA 3QO1B 3WIFB 2YR3A 4XAKE 5FIEA 2DM3A 1QSFA 3T1FA 1FL5A 3GSWB 3HFML 1Z3GL 3CH1B 4K23H 4R7NA 3QRGL 4WJ5A 1P4IL 2D4FA 4OAWA 4WU5A 5I19L 1DVFC 2LTQB 3PGDA 3DARA 1YEFH 3IB4A 5KS9A 4K94H 3O0RL 1UJ3C 1A5FL 4P2OB 3U1SL 5C09E 3LKPB 1K6QH 3KPRB 1Q9WA 5H37H 3JWNC 4GLRH 1V3LA 2GY7B 5EU6A 2YHGA 3L5XH 4DGYL 1IILE 1HEZA 5I1IH 2WP3T 3LAFA 3PDOB 5BRZD 4DOHE 2PW2B 2EKJA 2NXYB 3DUUA 4QCIB 1CTNA 3IRPX 2MWCA 1VGKA 1D5IH 4MD4B 4WWID 3A67L 2X4QB 4PGEA 1FIGH 5JXAH 3ARFD 2J8UE 3KWWA 1KTKE 1MJJA 4PBXA 5F7LB 2XKNA 5IBTL 4F7PB 1MCNA 3AU1A 1F4WL 5F7DA 4IS6A 3UTPE 3MQIA 5F44A 4AT6B 7FABH 4QTIL 2ZKHL 3LKNB 4JZOB 4M1CC 1A22B 1ND0A 4ZFFB 3NCFB 3D25B 3CMGA 4GG8B 3QUZD 1A6WH 1GGCL 1T4KA 2FX9L 3BRFA 1AQDB 5GJSH 3UEZA 4P5TA 3T08A 2DQHL 1YNTB 4MWFA 4KRNA 2XNAA 3QT2A 2BSSA 5D7KE 3RU8L 1J8HB 2A73B 4Z76B 3IVKB 1IL1B 3HNTH 1FZKA 5DJZA 4XP5H 4XPTH 4ELMF 3U46A 1IAIH 3S88H 4Y2OA 4KK5C 1FSKC 4QRRA 4CDHA 4K94C 3D18A 1A14H 4Q9CA 2DI9A 4KK9D 5DD0H 4MX7A 5D7IE 4WFGD 1NFDE 3UTZB 5BRZE 3KLAB 1S9KC 4XP1L 1FQ9C 5D7IA 4Z78A 1E0OB 3WFCL 2M26A 1T20A 3MYZA 4WV1C 2AI0H 5HSFA 2VMFA 3SCMD 3FO9A 2QLVB 4UV7L 2QQNH 3NPZB 5DVKA 1FFNA 3TM6A 1T03L 2IEPA 4HIIA 1K3ZA 4HQQH 3BH9B 5JORA 5AUMA 1IMHC 1AHWA 1PZ5B 4NRYB 5CEXA 2J5LC 3L3IB 3GRWH 5DJDB 4TSBH 1K8DA 2YK1H 2VDOH 3FFCB 2C3WA 4L4TE 2IPKB 2AJ3A 4PLKC 4HWEL 2QADD 5EU3B 3OKNA 3G6DH 1GHFL 3H3PL 3TBYB 4ERSL 3X14B 5IW1A 5DFVD 3UPRB 5FKAB 5DC9B 1HNGA 1NGQL 3KPLA 4WY7H 4L3AA 3BWAB 4JHAH 1PZUB 5E8PA 2A2QT 3TO4C 1XCQA 3ULVE 2NNAB 3BKYL 5JW4Q 1G9MC 4LQ1A 4RMVA 1EJ6A 4N9OB 2R2BB 3SDAC 3G04B 2WLZA 2VLJD 2GY5A 3KYAA 1INEL 4RGOH 3PABB 4C56B 2QADB 4D3CH 5MENA 1JNLL 4LSTH 4PG9B 2OJZH 1DL7H 3MFFB 3MO1B 1PLGH 1QBMH 4KHXH 1CXKA 5K9KA 3PHQB 1I8IA 4Z0BH 1U3YA 3C6SA 4P4RB 4KWUA 2CKBB 5C8JB 1IKFL 3L5WB 1OF2A 3MV8E 1QBLL 4ODWB 1EZVX 3S5LG 4LRNH 3IDNA 4J6RL 1UJTA 1UXSB 5CD3A 3U36B 1R3KB 2R1WA 5FYLH 4ZNEA 4HWUA 2V7NB 1MFAL 2NR6D 1XIWC 3I85A 5FUZH 1QSVA 3G5XA 3SDXE 5HDQL 2DQGL 1EBPA 3MRPB 5IHZA 1X5ZA 2FJFB 3UBXA 2WUCL 4HFWA 1MJ8L 2Z8VC 1QP1A 3B9KC 3C8KB 3KGRA 3ILQD 1T04A 1H5BA 3IFLL 5IVNA 4R90L 1PQZB 4AIXA 1OTTC 5JDSA 3DV6B 2NW2B 1EH9A 1EJOL 2HG5B 3TVMD 4CU7A 4HMDA 1HHGA 3TIDA 4B41A 4F58H 1YUHB 3HUJA 5TPWL 2B1AL 5E2VH 3O3DB 1K4DA 3RVWD 3WL9A 1A4KB 3BIKA 5JW4N 2GEEA 2A6KA 4M8QA 5L8JB 1MIMH 3VXSA 1VDGA 1M71B 2HLAB 3SBWA 4YXKH 1ZXQA 4Q58C 4G6JL 1EO7A 2VSDA 1RJYB 4G8GD 5I76B 3TZVB 1U92B 5HD8C 1P4IH 1TITA 5HHOB 5I19H 3SDYL 2A6JA 2NY3B 3W9EA 4NPYA 5T3XL 5IMLA 1EERB 1P7KB 2K3TA 3HG1D 5E6IB 2DB8A 2X09A 3ELAT 4NC2B 3ZHDA 1F3JA 1PDKA 3SKOA 3VXQB 4N0UE 4HK0A 2HKFH 2R0LL 3X3FH 2Z31A 3INUH 2AKRB 4WU7A 5EU6D 5EBLB 5HHOA 3F8UB 2VXTH 1C08A 4XPBL 4XVTL 5KVFL 4F37K 5BQ7A 5IOPB 3HLAA 1B88A 4G42B 4L4VE 2KH2B 4J1UA 3R0MA 3MBEB 4EN3D 3NIGF 3HI1B 2BCKA 4HCRA 4ZOBA 1W0VB 3DGGA 3K3QA 3C60A 1I1AD 3WHE0 3V0VB 5A3ID 1R0AL 5SWSB 3KPRD 1Y0LB 4Y4KD 1G7IA 1UWXK 3DECA 1EO8L 3KAAA 1ZLVH 4NN6C 2AGJL 3SKNB 2I9TA 1TVHB 5LWYL 3R06A 4F57H 3KG5A 4GRWE 3PUCA 5CINL 3IAQA 3BXNB 1FNLA 1MUJB 2VKXA 1T89A 5EBLA 2UUDH 3IDXH 1EMTH 3QUMA 1RZ8A 2YPKB 4LPUA 1NBYA 1CL7H 4TN9A 5J11C 5SWZD 2RFXA 2XFXA 5E2WH 5E6IA 3U36A 1YMMB 3EDDA 4N90E 1P7KA 3ARGA 3W0WE 5CP7A 4YXHH 1N6QL 4NQDD 3C9NA 1I85C 1FVEA 2V6HA 1RZFL 2LVCA 4PP1D 5J11B 5F6IB 3I6KA 4WUUA 2VLRA 2A9NL 2W0FB 5FO8A 5BXFB 3FFDA 4Q9RH 3RVUD 1RULH 3TV3L 2AJXL 3O6ML 3SKJH 3HI5H 5I0DA 4NZJA 4JCMA 4P9HH 3KS0J 4JFDB 3I02B 4KQ3L 1KIPA 2P5EE 3IXTB 5GHWH 4Z7OE 1TZGH 2EDQA 5DMIH 2GAZA 4TRPH 3JTSB 2VQUA 4N9GB 4H0IA 4Y5YC 1XFPA 4V2BA 2Q20A 4FG6D 3LCYA 5D72L 2EE2A 2J6EA 3F7YB 3PJSB 3BQUC 3CFBB 3MXVH 4JZJA 1RK0B 1AR1C 3VFRB 3V8OA 1A3LL 3VE0A 4RIRA 2VDLL 1A6UL 4LASH 3LVEA 1AP2B 2YMXH 4AEEA 4OBSA 3BWAA 3N1PC 3UJIL 3H0TA 3P9LB 3LPWA 1F6AB 1F90L 1SM3H 2D0FA 1OSPH 4L3EE 4LPYA 5GSVB 3MJ8A 4MMXC 3S35X 3UTTA 3VFMB 1S9XB 1BMGA 4X9IA 5M94B 4PJDB 1CF8H 2EC9U 2AXFB 3D85B 5GGVH 4JANA 4LCCA 1G0DA 1CXFA 3VXRD 1M7DA 1CLOL 2VR9A 3ZHLA 2QHRH 4TVSa 3SQOH 3T0BA 1F13A 1G7LB 3WS3B 2NXZC 3QCUH 4XCYB 3OG6B 3LH2L 3B9VA 5DQJB 4XB7A 2VAAB 3KPOA 4KK5D 3EYUL 3I3DA 1YECL 2LTQC 2ADGB 1HH9B 5F7YC 3BKJH 4L4TA 4F15C 4QXUL 4OCRL 5F9AC 1WCQA 4YXHL 4YAQA 4XHJC 3DSNA 2JIXB 4QKXB 3PQYB 1FZOB 1PEZA 3PWVA 1DJSA 3MXVL 2AABL 4G8GB 3U7WL 1AH1A 3Q5OA 1OCWL 1NAMA 2AV1B 3R4DA 4O4YL 4EDXA 1SY6H 1T83C 5T3ZL 1KCLA 3RWGB 3IS1X 1INEH 4NO2B 3JUYA 2D7TL 4XNMB 2BC4B 4WDIB 5CWSB 5DJ8A 5T3XD 4DVRL 5E6ID 2E7LC 2Y9RT 1UH2A 4KQ3H 4N5ED 3HRPA 1UVQB 4HDIB 4ZTOL 2GW5A 3F7PC 3KXFD 1EO5A 5I17A 1U3HA 2WSKA 5DRNB 1FG2A 5ENWA 3RVTC 1OWRM 1ZT7A 2Y4SA 1FNSL 1YPZB 1QZ1A 3ZT6A 2J4WH 4NWUH 2RAMA 3IDJA 4YHNA 4HUVA 1OP3K 3QUYA 4ZAKB 2ADIA 4NZRL 2GJ6D 2R0KH 2XXCB 1IAKA 4FQHA 2JJSA 4X6DA 2ZG2A 1T0NA 5T33L 4UT7L 3GKZA 1INDH 4YDLC 5B3JF 3HZMA 2ICWJ 1SYVA 2OJEB 3MCLH 4JRWA 5SWSD 2DKUA 3LS4L 1LILA 5BJTA 1ZSDA 3NCCB 3N85H 4HS3B 5H94A 4E0RA 1KIRA 4LCUA 2DD8H 3QNXB 4JGUA 1CDJA 1JHTB 1GGTA 1U8OB 1JHKH 3L3OA 1ITCA 5EU6B 5KVEL 1M7XA 1FFOB 1RZIA 5EUKA 3PP3K 4XBEH 2DBLH 4Z7QF 5DJZB 1XH3B 1AY1L 4U49A 1T0MA 4XPAL 4ZFGH 3BPLC 4JFPA 1ED3B 4X9BA 1NKOA 1EHAA 2XYCA 3NIDE 5D5MA 3P77B 4P57A 3NCJH 2A6IB 4WFFD 3D9AH 3LKSB 3T0EE 2FX8H 4OCRH 1E4WH 1M05A 2CK0H 5HHOD 3WV0A 3JTTB 1K5NB 3K8KA 4LIQH 3BEWA 3ARDD 3MX0A 3RRQA 3IDYC 4JDVB 2J8OA 3ARED 5B39A 1JJUA 1OAQH 3LKNA 1YJDH 2IG2H 5F9JB 5J57B 1HXMA 2HVJB 5CUSH 4YLQT 3L3KB 4M7ZB 3TIEB 2PTVA 1FORH 3C87A 3WNKA 2OJEA 1YYLL 2ZP0T 4JVPA 3LZFL 2A9MH 4P48A 3ILQC 5SWZB 3V52H 3FONA 4QHNB 2VAAA 5K93A 5A2IH 3KJ4B 4MJIB 4R96A 3CLEL 1FJ1B 1E4JA 2CUHA 4M62H 2H32B 1A0QL 3BN9C 5E2VL 4LCCB 2VDQL 5KSAD 3VCLA 1CK0H 1CG9B 5IB5B 3OAUL 4I77L 4XRCB 2X89A 4JKLA 1MH5B 1FL5B 4S1SH 1FNGA 1E28A 4IIQC 3HI6L 3N85L 2KL6A 4O00A 5KSBA 4P99A 2XICA 4Y5XB 2IBZX 5TE7L 2UZIH 3B3IB 3EOAA 2EIDA 4X5WB 1CDUA 5D9SA 5J13B 2K7PA 2ED7A 1JBJA 3OTTA 1WIPA 3OAZH 5IJVA 3B9DA 2C5DC 3OJ2C 3EFFA 3MOBL 1DVFD 2D31A 2JJSC 1KLGA 4TUKL 3VFRA 3VRLF 5HI5D 3ZDYF 2NW3B 3O11A 5BW7A 2FX9H 1A3LH 1BBJA 1JTTA 1KENL 4GMSH 1GZQA 1IZJA 4ELKB 3RIAF 3O6KH 3DX6B 4XCCH 3MPCA 2FR4B 5EO9B 3GSNA 4DKFH 2XTLA 3MV7D 2HTLD 4FFYH 2FATH 4YDVA 5C92A 1M7DB 2APWA 3E6HB 3VRIB 1XGPB 4L8SC 4PJ7A 1T89C 4JANB 5D6CA 3V0AC 3X12B 4X4XB 2HH0L 3U4EB 3B4NA 1KXTB 5FYKD 5J6HB 3DVGB 2OL3L 4GS7C 5CCKH 2VZOA 4YC2C 1CD1A 4NRZB 5JQHC 1NMBL 4S0SD 1KXVC 5LQBH 5A40E 4FZ8H 3OKOB 2ARWA 3U79A 3KPRE 3S36L 5BV7C 2DS4A 3PV6A 1S8DB 4I0KA 2IH1B 3MYJA 2YPLD 5IESH 4KTDL 3RKDC 1T2XA 1VPOL 3LMJH 3KPMB 2PW1A 4PRBB 2Q7YB 5I18L 5D1ZC 7CGTA 3VE0B 3L3HB 2YWZA 5DJAB 3C5JB 4HUMB 1DBAL 3FZUC 3X11A 3T3MF 1TTUA 4Q7DA 5BVPH 1C5DA 4X7SH 5GS0C 5LBSH 3B9AA 4XNXL 3QJHA 1FVDA 2E7MA 1MLBB 4YZFF 4KC3B 5E00B 5BRZB 4XGZA 5SWZE 1WITA 4JFDA 1NLBH 2XQYK 4P49A 4D0CB 1F5WA 4BK5A 1FZJB 1JWSB 2OL3A 5IB3A 4LLVA 2XQYG 1T5WB 3PWPD 4BZYA 5BZDA 4UNUA 4ZS6C 4I5BB 4G6FD 5T1LA 4PJIB 2BVYA 1JMXA 3RZCB 4P2OC 1QBAA 1W72A 4WWKA 4YQXH 2NY4D 5I71C 4LPXA 3H9SD 3SBWC 2NLJA 4GBXB 4F15B 2BSRB 1U3HD 2XFXB 1U8HA 3HE7D 3SKOB 3VXQA 1KCSL 2C4XA 3MREA 4YK4C 4XMLH 5IBTH 4JRYB 1XCTB 3WIHL 2FLBT 2X1WL 1YZZA 3OR6B 3ROLA 4JFEB 5J13C 3DSFL 1UM5L 1ZK9A 3JUZA 2WUBH 4R90H 1KB5L 4FS0A 5FYKL 1JGVL 2F74A 3BP7A 3HMXH 5JOFB 2P46B 1RUMH 2A38A 4LNVA 4OZIA 3UTSD 1Q0YL 1V3MA 4OKVB 1LEKA 4ISVA 3ZDXE 4NQXA 5EU6E 4ZPTB 2XPGB 4I9WD 4ZUVB 4HGKC 3BKML 2D3VA 5ADPL 3K8MA 4GLRI 4F37F 1GIGH 4ZSOA 4B0MM 5B8CB 1WUNT 4L8SB 5T1KD 1SJHB 2R23B 2VZVA 4F3FA 5I1DA 3GJFK 3R1GL 3ARUA 2J8UB 3BUTA 3TBVA 3HLAB 1H5BB 5B39G 5FCSH 1KFAH 3U6RA 4UQ2A 1E27B 1FL6A 3VW3L 4RFEB 4XC3H 2HWZH 3E8UL 2NR6C 4W4OC 1LVEA 1PY9A 4G8IA 2X70B 3WO3B 4K07A 2OZ4L 1ZT4A 1HIMH 2CDFB 1U6AH 4HIEB 2G2RB 3T2NL 4RFEA 1KNOB 1RUKH 4N8CH 2E9BA 3KPSA 2R1WB 4X98B 4DK6A 3GM8A 1R3HA 3QO0A 4PRPE 4S1SL 4AENA 1GL4B 1OAXH 2DICA 4BYHA 3ME0A 5E70A 4YHZL 4TSCH 2QV2A 4HD9A 3ARZA 5TQ2L 3ES6A 1JF5A 3VGGA 4NM8L 3A0OA 3D2UB 4O2EA 4QRUB 2EYRB 4EVNB 4X5XA 3ZKSD 4GMTH 1A6TA 1CIUA 4U1IB 3I50L 4PV9A 5DDHA 1QO3A 3EJZC 2XQBH 4QRRD 1QLEL 2WBJD 5ACZB 4ZAKD 1NLDH 4OIAA 4XCCL 2IQAA 2ADFL 2CIIA 4QT5B 3CSGA 1OSZB 4M6NH 1Z5LA 5EO1A 4LGPB 2OZ4A 2CRYA 5CBEB 3DURA 3RA7H 3MLXL 3H9SA 1ORSB 1RK1A 3H7BA 4NNXB 4OF7A 2V2TB 4WWKD 2BMKB 2OTWA 1YEIL 3ETBF 3STBA 1T7XA 4Y1AB 4NBYB 1ZHBA 5FKAA 3MRCB 5E94B 1HQRB 3UZVB 4MAYD 4YHIA 4YDLB 5MP6H 2AK1H 1N3NB 1MCSA 2B39A 4WEMB 1LO0H 5IEKB 2UWEB 3OXRB 1J05A 1QEWB 3JWOC 4U1GB 4UB0H 1BVLB 3CXDL 1IM9D 1UYWH 2UZXB 5E00A 4PJIE 1A7NH 4OZHA 5DUBA 2E6JA 4WW1A 2QKIA 3MTRA 4S11A 1MELA 3EZ8A 2MFNA 3VWKB 2FATL 3SDDB 6FABL 2I60L 1HHKB 2DJ4A 4EBQL 3OL2A 1HK6A 3STZA 1OGAD 5C09B 3PL6B 4X6CB 3TVMB 3LIZL 4FHBD 1FZMB 2MCPH 1NUDA 2QEJA 3PV6B 4PTUA 1LP9E 4RNRA 5LGJA 4NFDA 4MD5B 1IGFH 1EFXB 1MFBH 1TJGL 1XGTB 3WLWC 2CR6A 3HUJE 4NUJA 5C08E 4HLJA 5EOTB 1YYMH 2W9EH 3MXWH 4HH9A 5C0RL 3HCVA 2NY2D 5J0BA 4OM0L 2YRZA 5IW1B 3VI4F 4YGVB 4D9RD 4GBXC 1A8JH 1BWWA 4QRPA 3VFWB 4KGLA 4MA7H 3UTQB 1VENA 2CKBL 3VGDA 1X4XA 4Q0XL 4XP4H 3QI9C 4Y19D 5I0ZA 1U93B 4WVRA 3OX8B 1NMAL 5DHYB 4A6YA 4OLYL 4CNIB 1P6AB 3GMQB 5CEXB 2GI7A 4X8XA 1AJ7H 3D48R 1AHWB 5CGYD 1WZMA 3HMXA 5HGBB 2GTWB 4Z7VF 3KYKL 5DS8A 6CGTA 2YMXL 2CMRL 4MA3A 3EFFB 4AT6A 5EOQH 1V3KA 1D9KD 3ARFC 1DLFH 1B0WA 4HH8A 2ZSWA 1MJJB 2WP3O 3VJ6B 4GKSB 2RCSL 3JSSA 1SEQH 1QQDB 5C0DB 4S1QL 3MRBB 4DTGH 2NTFB 4MX7B 1BOYA 3NCMA 3Q0HA 3QI9B 3OAUH 2A83B 5CEYB 5CUSL 4Y4KB 2XZCH 5IB2B 5DMGC 1VA9A 1T7WA 3VXOB 4J3SA 4U1LA 1W0WA 4XCFL 1KT2A 4NHCL 1LK3L 1FL3A 4GRLD 2Y6SD 3DVGA 3MODH 1IC1A 1H15B 2IH3B 4GW1B 1QACA 2XZAL 5F8QC 5EPMA 1DUZA 2BSTB 4DGVL 1XGPA 4YC2B 5CEZE 4AYFA 5INCB 4MWFB 3OZ9H 4Y19E 3PQYD 2Z91B 5E2WL 5EUOA 2C9AA 4KDTC 4OFDA 1D6VL 2MCG1 3MLTB 4QXTA 1HI6B 1FIEA 3HNSH 4DK3A 1A3RH 1YEGL 3T77B 5HHOE 1KCVH 4YBQD 3AMKA 4KROC 4QTHB 3CFDB 4FFYL 2EIZA 3T8XA 1K85A 2Q76B 1AKJA 4J8RA 1NGWA 5HD8D 4LP4A 4LCYB 3OKMB 1MLCB 5FGCB 3L9RA 4LVNB 4LAQL 5TE6L 2Q8BL 3QUKA 3OF6A 1TMCB 1S7SB 5JUEH 1E28B 2FHFA 1CFSB 2NY6B 3GMOA 3WJJC 2JB5H 4OUUB 5DHXB 3DVNA 3DX9B 5C0AD 5BV7L 4ENED 5IMOA 1KIUA 2EICA 4Y8AA 2P24B 3S5LA 4DUVA 2AAVA 3T09A 1J12A 1B4JH 3EBAA 2IAND 2Q8BH 5EG6C 5JLZB 3DBXB 1I9RL 1CR9L 4LCIH 3DI2B 5H94B 3BZEB 5ANME 5F6IC 1YJDL 2IG2L 4JREB 3GI9L 4L8DA 1MVUA 5C70A 1ZHNA 4WTXA 3IDUA 1WBZB 3MROA 1WEJH 1JN6A 1BWMA 2BOBA 4I3RH 3PHOB 4KHTH 3QUXD 2Z35A 1C5CH 1WT5A 4M6AA 5ITFA 1I8KA 2B4CH 3OPZL 1BOGB 1U8KA 3VWJB 3O9WA 5F6HI 3MRDA 5JOPE 5HPOA 1E6OL 3QNYB 4EI6A 1B4RA 3OZ9L 3RWDA 1BZ9A 3PP4L 3BD5A 1ROWA 4JEGB 5FGBA 3V6FB 3SDAA 5DD5H 3OX8A 2HLFC 5CS7A 4R4BA 2HJLA 4ELME 3G9AB 3BZEA 5DK2B 1OWWA 1X5JA 1HOCB 4QGTA 5JR1H 1YEKL 3CDFA 4QRPB 3VFWA 4KROB 2VLLB 4X5LA 3HN3A 3QDJE 3EGSA 2FO1A 1NC4D 3AY4C 4PJBA 2WIMA 2B0SL 4UIMA 3QIBB 5HHPA 5JIIA 5TFSL 2IANE 3MLYL 2NXYC 1KIRB 3HC4H 3OGOE 2VYRE 4EKXA 3VJ6A 5AAWA 1HHHA 2ZSWB 1I1AC 3TPUA 4RSVA 4MXQC 2J88H 1M1SA 2ADGA 5DZNA 3QHFH 3SGDH 4EDWH 1KLFA 4CL7A 4U2ZA 3HPLB 2RBLA 5E6IC 3V0WH 2JELH 2H3NB 2P43B 1LP9B 3O2WL 4XMPL 3BP6B 5GS0H 1HN1A 4JDTH 2E7BA 1EUTA 4JFFD 3CDCA 4LEXH 1QEWA 4V1DE 5ICXA 2AXFA 1J05B 1S78D 1U93A 3CVIL 4M3JA 4G3YL 1MJ7L 3UTTB 3HE6C 3QEUB 2XTJC 4O58H 2ZCKL 1ORQB 3MLTA 1KGCE 3UTSE 3C8HA 4WI3A 5K9OB 2O5XH 4OLVH 5ICYB 2F54B 3ULUH 3HRZA 4MCZA 3EJYD 3V6OE 2E7HA 4HUXB 3RNQA 4PJBE 1CE6B 1OGAA 3BE1H 5F7KC 3Q6GL 1Z0NA 4BKLA 4M7KL 1DLHB 4PTUB 4MS8D 2GK0B 4RMSA 4XH2A 1N6UA 4L3EB 2GT9A 3NCYS 1DANU 4P2RA 5BS0D 3MJ9L 5GHWL 1QRKA 1U95B 3S37X 1NBVH 5I6XB 3FB8A 3RPKA 3NCYP 3LQZA 5HI3D 1MI5E 4N1CA 2ZCLL 2QSCH 1MFDL 4HCRL 4JE4B 1A6TB 1F3DJ 5KSBE 3D2UA 1F8TH 5MEOA 2C3VA 2E27L 3O6FB 3V0WL 3QEQD 1IAIM 1KJMB 4OZ4A 2B2XH 4MNHA 4GH7B 4LSTL 4Z7OF 4ZXBC 2APTA 4LL9A 1AGCA 4TPRH 2O5ZL 2DRUA 3BYTA 4FMFA 1AXTL 3TVMC 1L0QA 2VLKD 5HGBA 4KQ4L 4S1RL 4YQXL 4KMLB 4LLWA 4W4OA 3MV7B 3OBAA 1JGUL 4CNIA 4X7TA 1KNOA 1BAFL 1F4YH 3MV01 4ZOCA 1A7QL 3GIVA 2GJZB 3O2VL 3FCTA 2CRIA 5B22A 4NNXA 4PY8I 4WEBL 3MA9L 1RZ8B 2YPKA 1A3QA 3U0WL 2H26B 2Y07L 4DQOL 4G9DB 1QA9B 4RIRB 3O3AA 4D0BB 3PNWB 3BZFA 4O2FA 5D1ZD 2EH8H 5HJ3A 5EU5B 3E3QE 5DRXB 5DTFB 3TBVB 3MUJA 1EZVY 3K2UL 3REVA 4AG4L 4HPYL 5CP3H 4PJEF 5EIVA 4N0CD 4ODHL 3DO7A 2WIIB 2EECA 3VFTB 2XG4A 1QO3B 3AS3A 1ZWIB 1Y0LA 4PV9B 2BNUB 5SWSA 5IWLA 4DFHA 1CT8A 1RZJL 4KZEH 1WBXA 2CPCA 4TULH 3QUXB 2BDNL 2YUZA 2E9JA 3DLQR 3SY0B 4OKDA 1CGTA 4N8PA 5DFWH 1Q9KA 2E27H 1T5XB 1HSAA 2C26A 5C0IB 5FF6B 5EZJB 5E4EB 1I7UB 4L3CA 5E5MB 2Z4QB 1EGJH 1MY7A 3ULUE 1RJZA 3QO0B 4UOW1 4LP5A 3T04D 3KPSB 2NZ9D 2QQKH 3SDDC 4GRLB 4Y5VA 4YE4H 3WHE1 1AR2A 4FQCH 3HE7C 4U6HB 3VXTA 2CH8A 1AGFB 1T66D 4YHIB 4X6EA 2ZOLB 4FN0A 4H8WH 3MRCA 1GH7A 4K9EL 4U1GC 1IBGH 3GSVB 3LN4A 5HHVL 2MSPA 4FFVC 5DO2C 5I1DB 2VC2L 4HT1L 1A2YA 3WHXA 1LE5B 2OR8A 2AEQH 3FMGH 3BFOA 1HYRC 4LSSL 1Z5LB 1DBMH 3VXUB 1LDPH 4HWBL 2FBJL 1PX3A 3HR5B 4X6CF 2IQAB 2CDEB 5ITBH 1W8NA 4GRWH 3AC0A 4KTYA 3VD5A 5KSBF 3UJTH 3QWOA 1CVRA 2EDKA 4XMPH 4FQIL 1NUFA 1H5BC 4JQVA 4NWTL 5EO0A 2XZCL 3GMMA 2CLRA 4IOSD 4DZBA 1LEGA 4GOSA 3TA3D 1TVDA 1BEYL 2G75B 1NJ9B 5KW9L 4P2OD 4GBXA 2PF6A 5GS0D 4G7YH 3R8QA 1FYTE 2R2EA 4ODWA 3UO1L 3BGMB 1RJCA 1N5AA 3QUYD 2Q8AL 1BD2E 3G5VA 3PHQA 3QHZL 3QULA 1CXLA 3C5SA 4ORZC 4BM7A 2MMXA 4MQ7A 2BVQB 4UZGA 1XR9A 5E9DB 3PE9A 4N68A 3VD4A 3PABA 3U4AA 5I8KL 3VXSD 1JRHL 1GZQB 2WBJC 4MXQD 3G04A 4X99A 5EU4A 2NY7L 1PG7W 2X4SB 3FO0H 4R26H 5JQ6L 4G8FA 1WT5C 4UINH 2YPLA 2ZZUT 4JFFA 5CKAA 3GNML 1I7RB 2ICES 4PJ5A 3ARPA 4ERSH 5CSGA 1EV2E 2VH5L 4RFNC 5B8CC 3STLB 3LEVL 1CQYA 1VFOA 5KTEL 1NDGB 3WFCH 3DOSA 4ELMB 1AI1L 1DBJL 3QZWA 1UXSA 5CD3B 4H25A 4LSVL 4OFKA 3IDNB 2X4OB 1OD9A 4PRNB 5L7XL 3BX7C 3SE9H 5HYSB 4WGWB 1JGLL 2BXYA 5CJXC 3VFOA 4P59H 5BMFL 1HKLL 2Y23A 1KSRA 2D4DA 2H9GB 1U0QA 2R56H 2GHWB 1DUYA 3UC0H 5DEZA 3TZVC 4K8RH 3GSUA 1UEYA 3IFPB 1AC6A 4FZEH 3BP6A 4K2UL 3C60D 4CVXB 2AK4E 2CLVA 2PO6A 2DMCA 1AI1H 1DBJH 4PG9A 4OBRA 3QHTC 4Z8FH 1UWEL 4BJLA 3PP3H 1I1CA 2YSSA 3FB7B 1W0YT 5I1AB 4U33A 3D69A 5K9JL 4KI5C 3WNNA 5FYJD 4B53A 1IM9B 5C07D 4P4KD 5I6XC 3JVGC 4R26L 1I1AB 4CKVX 2VL4A 4Y19B 3WS6A 3D18B 1AXSB 1Q8MA 1RMFL 3D1MC 2RIKA 3B9KB 3N50A 3KPLB 1YEKH 4UUJA 2ZCHL 5HVHB 3FT4B 1JZ2A 4HIJB 3A67H 5C0CE 4EQ2A 5KOMC 4ODVH 5KSAA 4AK1A 3B83A 5FEBA 3R1GH 2QHLA 2N4IA 4MXWL 1EFXD 4KDVA 5KVDL 1NC2B 1RAMA 3CFCH 5ICXB 1CGWA 3UTPD 2PXYD 3LQMA 5IBUB 3RAJL 5EBWA 1Y18B 4U1NB 5F96H 4NKOB 1BFSA 5T1KA 2R8SH 5D71L 4NQTA 3ILPA 2DQFA 4LARL 2WK2A 4H1LB 4P5MA 5DSCA 1G6RH 2ILLA 1JK8A 3O45B 3QXDA 5CSZB 3NZ8B 1B90A 3SGKC 5I1HH 3WO4C 2BOBB 1LP9F 3CSYB 3AU1B 5FA4B 4HS3A 3CFJA 3SQOL 1OTSD 3SOBH 1KCUL 4L8DB 4HMEA 4QGYA 5C09D 4DKAA 1KJVA 4D8PB 1WIOA 2ZUQB 5FCUH 4HUWB 4L3ED 4LCCC 4WTZG 1TZIB 2EDXA 3WNPA 4H1LA 1SJEB 3EGSB 2E3VA 3MLZL 5IMOB 4K3DL 3QIBC 2W60A 4S2SB 3PGFL 2SEBB 1G7JB 3CK0H 4JDZA 4HKBA 1MHCB 3MMEB 5TDPB 3IVKA 4MB5A 1E6JH 1YPZA 1D6VH 1YNTA 3JV5A 2EZ0C 2D7MA 2VXVH 2I5YH 3PXJA 5SX5H 3KJ6L 1CS6A 5IIEA 1BQHB 3VXSE 5ALCH 3U82B 4UUJB 3VFPB 1BOGA 1U8KB 5CMAB 3L3OB 3TH3T 3VRJA 1RSFA 4JJ5B 4OZFH 5ITFB 5TDNA 2A74A 2PNDA 1FAKT 3MMEA 2EKSA 1BLNB 2ZCLH 3PHOA 5TDPA 4QXWA 1BAFH 4E0RB 3W2DH 3WIIL 4XWOC 4BH8B 5F8RC 5AZEL 1A02N 5LCVH 1Q0XH 3K81A 1X5IA 3D87B 2XTJD 4PJHA 3HZKA 1MRCH 4OTXL 4GG6E 4C58B 4V2CB 4Q74A 3BP5A 4OI9A 5IT2H 4WV1B 3THMH 1VFAA 2R1XB 1LD9A 1OTUC 1K8IB 5SWZA 1UJ3A 3QXDB 1UZ6F 1JK8B 1KXQE 3QXUA 4U6XB 1XZ0B 4NDMA 4OCMC 3GI8L 1LO2L 3HZKB 1D9KC 4JO1L 4JKMA 1Z0MA 3RVVC 1KG0B 1MCWW 3QUYB 2QTEA 4U31A 1NDMB 2P5WE 4RDQG 2H9GA 4K7FB 5C86A 3C5ZC 3OG4B 5J9PA 4R9HA 5DT1H 4DCQB 3GJFH 5HI4C 4WJ5B 4RISH 4I3SL 4ZFOA 4MAUH 3IS0X 1CR9H 1CDCA 1CFSA 2E8YA 4YDKL 5IB2A 1E4XL 4UQ3A 1K5NA 5T3ZH 2A83A 1F6AA 4WFED 3FT4A 4OJFH 1NGPL 1IAIL 3BGFB 4BSWB 4HZAA 4KKAD 5EZLB 3U4BH 1NAMB 2AV1A 4JHAL 3KYMA 2ICCA 1I7RA 4WFEE 1PSKH 2ZUXA 2BVTA 1EXUB 2DM4A 4POZC 5EUKB 5DQDL 3K7UA 4J6RH 3F7YA 2J8UF 3PJSA 1SJVA 1EJOH 3CK0L 3Q3GA 1RZKH 4PJ9D 3GSNL 2GTWA 1JPGB 2GAZB 4KKCC 3NFNB 5EN2A 4PJGA 1H3TA 1VEOA 2WUCH 3CFJB 3GSXA 1MF2H 1DUYB 4NYLA 3HZMB 5B38A 4LCWD 4GKNB 1A7BA 3A6OA 3WJLC 2EC8A 3PWPE 4R4NC 4YGVA 1T0NB 1IRAY 1TQBB 3VFOB 3I6KB 2AJZB 1JE6A 3P4MA