4R3SA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with msp2 11-23
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FV FRAGMENT(MAB6D8) HEAVY CHAIN
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r3sA00
3WIIH 4XX1G 4PY7B 2DQGL 2OXGA 4FQXC 2XIDA 3PHOA 4PD4K 5BRZE 5JHDD 4LPYA 5L2JB 5L9DL 2FEDD 3VXUB 2UZXB 2ICWA 2EEBA 5IB3B 2HTKC 4GKZA 4HPOL 3C09B 3NA4A 5C08A 5T33L 5D7IF 3LSOB 5IMKA 3W9EB 4UTAH 3SDCA 4X6DB 2WM0A 3EDJA 3SDCC 1I8IB 4OJFH 5HGHB 4XMPH 1IFHH 4ISVB 3T0XA 4LHUD 4LAQH 4PJCF 3K1DA 4G6JL 1K4CA 5CMAA 3V4VL 4GXVH 4UUJB 1L0YA 5IVZB 4FQLH 2GSIA 4TUKL 1N59A 2VDQH 1SEQH 4HKZB 3P11L 2H8PA 2MQCA 3NA9H 1S5IH 4MJ4A 2AQ2A 4P2RD 1B0RA 3AFLA 2YRPA 5FO8A 5E5RB 3WLBB 2YRLA 5F89A 4ODHH 4R97C 3FN0L 5DVOA 1VGKB 1JMXA 1IM9D 1FH5L 3HUJE 2P5EB 1B0GA 4GO6B 3BP6A 3QCTH 4IM8A 5LGKA 2BOBA 4U49A 2J2ZA 5GGTA 4RFNC 3VFUB 2JB6B 4PJGA 1FDLL 1JMZA 4GLRI 4IDLA 5SWZA 4Y16A 4AIXA 3FZUC 4B7IA 4Y16C 4PRPD 4YZFF 4OZHE 3PGCB 2V5YA 3SDXA 1HIML 5E7FA 1MCLA 4F8QA 3IU4H 1CGSH 2H26B 3DUHA 4WTZG 5ALCH 3ILPA 1X5JA 3RJDA 1NGXB 3V95A 4PJBE 4OZHB 4PJIE 4U1IA 1FNEB 2E8ZA 4J4PD 4Z7VE 1FL5B 3C6LD 1RK0B 4OCMC 5L8JB 1LO3L 3D85D 4ODUB 3SE3A 3EOAB 3SE3C 5EH1A 2LU4A 1D9KD 4DOHE 4CVZB 2C3VA 3IDMA 4LVHC 2LU7A 2AVGA 5LWYH 1QO3B 3MOQA 4QHUB 4Y5XB 1OGAA 1INEL 2VZ3A 3T65A 2WWMD 3U0WL 5HVWA 1H15A 2ZUQB 3BXNB 4DOHB 5HDBF 1MJJA 4FQ1H 3ZDXF 2R9HD 5D7JB 5SWSD 5EIQA 3VGGA 4FA8A 4Y4FD 1WQVT 2E7BA 5DRZA 4MQ7A 2R56H 1M7DA 5KVFH 4PRNB 1TCRA 1KB5H 4MAYD 1U8LA 5T3ZL 4CU8A 3HB3C 3T09A 4ZUTB 4I4WA 4LVOC 5I1CL 4APQA 1WBXA 3CZFB 4WHYG 2FL5B 4NFDA 4APQC 3MRHA 1EK3A 1R5IA 2FHBA 5DQDH 1AH1A 4Z9KB 2VXSH 1T21B 4JFOA 4ZO9A 2BRRL 1S5HA 4XCYB 1RUPH 4LU5H 4LARH 4UT9H 4EUPA 4WI6A 3UBXG 5KVGL 5E9DA 1QNZH 2MKLC 2NX5E 2C7UA 1ORQB 3G9AB 4XBPB 2BNUA 3ZZ1A 4WENB 4RNRA 1AI1L 4NQDB 3O0RH 4LASL 1F4XL 2ITDB 4NQSB 4XBEL 4XPAH 3TO4A 5J57B 1QSEE 3TO4C 3P0VH 3S37L 1F00I 3ARBA 2JIXB 1KG0A 3ARBC 1KULA 5C0JB 5CKGA 5F7NC 3FMGH 3KPQB 3V8OA 3QJHB 3C8DA 2ZNWA 1Y18A 4GMTH 2ZSVB 3A6BH 1MCCA 3D87B 4PJAB 3D3VA 3O3AB 4RDQF 3QQ9D 3ZDZE 4NRYA 1AXIB 1R3HA 1PX3A 1OTSD 2GK0B 3FN3A 3EFFB 2EO9A 4H8WH 4MXWH 4QYOB 4XPBH 1WWWX 1I85A 3TBVA 2JK5A 1HILA 1I85C 3JV0A 4I2XE 1JPGA 2DI9A 3KPSA 4S2SB 1VADA 4RRPG 25C8L 1J05B 4WW1A 4TULH 2P7TB 4Y2DD 4CADA 4HWEL 3T4YB 5DR5H 5EPMB 3HMWL 4KUCD 4X6BA 5GRUH 5DURD 5LXGH 5BJTB 3E8UL 5L2KA 4PRIA 3S4SA 1DSFL 5T1KA 4BFGA 5ISZB 1TLKA 2CKBA 3VDBA 4WFFD 1R0AL 1MF2L 2O5YH 5KJRH 3DXAE 1G84A 4O2CB 4IOSD 5L88L 4P5TA 3KPRD 1KSRA 1HHGB 4WEMB 1W0WB 4FG6D 4D9RD 4DZBB 1IQDA 2DLFH 1AGDA 2V17H 5SX5H 1IAIH 5EFIA 4G7YL 4JRXA 4RZCB 1OAKH 1LD9B 4RDQG 4TTDC 1I75A 4H25A 1T22B 1ZS8B 1JGDA 2D3VA 2V7NA 2IGFH 4YJZL 1JIBA 1MFCH 3FOLA 1MWAH 2J8OA 4GQ9L 4MQXD 1CG9A 4MNGE 4P23A 5DC0A 5D96B 3FQXB 4P23C 4Y19A 1CLOH 1TTFA 4FMFA 1HZHL 1PYWA 1A7NL 1AGCB 1KT2B 2DIAA 2DQUL 2X1QA 2ICWI 3JVGC 4JFDA 3ARSA 4MNGB 3NIGE 2F5BL 3WNMA 2NCMA 4MVBC 1MRDH 1F42A 1JNHA 2FR4B 1UWGH 4JCLA 4JGJA 2FX7L 2VDLH 5HHOA 5JIKA 3SO5A 1G7HA 1KNOB 3NFSL 4KFZC 3MZTA 4JANA 2ZUTA 3UYRH 4RAHA 4WEBH 2YKLL 1GYAA 1FFNB 3E6HA 5EUOE 5I1EH 2XTLA 5EOQH 8FABB 5HY9A 4U1KA 2IQAB 3RNKB 3OAYH 1W0VA 1UB6A 4U6HB 3TA3C 2YXFA 2IH3A 4R90H 4HUWB 1CK0L 3K2UL 1MJUH 4U05A 1MVUA 4O58L 4EVNB 1T04B 4KVCL 1IZKA 3OPZL 4TPRL 3ULSA 5IM7A 4LSPH 1AY1L 2DQGH 1WIPA 3IDNA 3KLDA 1S78D 3Q2CA 4PJ8A 5EU4B 4YDJB 3W9DA 4PJ8C 3NABL 4MS8C 4GAGL 1AGFB 1K85A 3SKOA 3MLTB 3PIQA 3QXAA 3X17A 4NGHL 4HPOH 5T33H 4JFFD 2HKFL 3LPGA 3I6KA 3R06B 3TT3L 4IHOB 2DDQH 2L4OA 4NQEE 2XPGA 5DQJA 5IP4A 4UOW1 2R8SL 3VXRD 4HFWA 3VXSB 4URTB 3ZKQD 1II4E 3SKMA 3DYPA 1DANT 5FGSA 3EHBC 3AVEA 4TNWK 4OCXL 3V4VH 4D0BA 3VI4E 1N3NA 5C09E 3BAEL 4YWGH 4EKXA 3GUTB 4J1UA 3BPOB 1M05B 2FJFA 4HCRH 1Q94A 4WTXA 4P3CL 1AFVL 1DN2A 3P11H 3MLXL 3HE6D 5EBMA 4S0TD 2YBRB 4NQVB 2ZUUA 3IXTA 4U7MA 3RPKA 4MDIA 1PVHA 3KPOA 1DLHA 5C09B 4Z7OE 4XNQB 5I6XC 1A1OA 3N0PB 1F3JB 2FRGP 4V1DE 3SHSA 1Z9SA 3ARRA 4BFBD 3QNYA 4JM4L 3FN0H 1T4KA 1F97A 5C0AD 1YN6A 2GTZA 1FH5H 3O8XD 4FTVA 4Z77A 4OQTL 2VL5B 5EBLB 1NSNL 1RIUL 3DGCR 4V1DB 2Q86B 1FYTE 1KB9J 3GI9L 1RZJC 3REVB 2DQDL 2VQTA 5GGSA 2ARWA 2OMBA 4UV4L 1FDLH 5GRJL 5GS0L 4X4XA 1RJZB 4GW4A 5DJAB 1M7XA 5CINL 1PEZA 1R3IH 4PGJA 1UVQB 2NY5C 3WBDA 4JG0L 1WCBB 3QQ3B 2I60L 2F53A 1EEQA 1RHFA 1YEIL 1PG7W 3T1WA 1C5BL 3OWEA 3U1SL 3B8SA 4GRLC 1GHFL 1Q9OB 5CLTA 1H0DA 2NY2D 4CJ1A 3I2CL 2GJ6E 2PKDA 5I19H 1N5AB 4R7DB 2ORBL 2OP4L 3SOBL 4WO4D 3WUWG 5IHZB 9CGTA 4PRBA 3P77A 1UXWA 4AQOA 2FO4A 4LP4A 5E2WH 3MNVB 5ITFA 3MJ7A 1MIML 4X5XB 4HG4K 3S5LB 3G5YA 2GJ6B 3PQYE 1MOEA 3V5DA 3OKEB 5KN5B 5IMLB 1XF5A 2FSEB 4LGSB 3DVNB 1R24B 1JWMB 2FBJH 2LE9A 1ZSDA 3WMSA 4RA0C 5K9QG 1N2RA 4G9FE 4M93B 3O11A 3NFNA 2ARJA 2R0KL 1QACA 3B2UC 5GPRA 1OD9A 1F45A 2YPKA 1UKSA 4YGAB 5T3ZH 1OP9A 1SY6A 5FUCE 1S9YB 4ODWB 2VITA 4HIJB 3MTRA 4G6FD 5I1CH 5F7HA 1JF1A 1ZWIA 3WHXB 5J12C 5CSGA 5B22A 3HZMB 4P5KB 3T1FB 3RWHB 3AC0A 5AYUL 3DROA 4E41E 2CD0A 2BRRH 2ZCLL 1K2DB 4U4BA 3BWAB 4B53A 4MNHA 1HHIB 1KELL 4KKBC 1J8HD 4YHML 5KVGH 5H35B 1U42A 5A40E 3EO9L 4OD3L 1KYOJ 5FO7A 4JFPA 3TPUA 2IJ0C 4RGOL 4YAQB 4WIQA 4X9BA 1WV7T 4XP4L 1AI1H 1SMAA 3RVWC 2OTUB 3BP7B 3OR7A 4XC1H 4XBEH 2DLTA 3S37H 1ZA6A 4UTBL 1NMBL 3ARDA 3KVQA 1I1YA 2JF1A 1UWEL 2COQA 5MENA 1J0KA 2EECA 3DVFA 4C56D 5T1DL 1B4RA 3GSOB 1MI5D 2VDPL 4Z0XB 5IK3B 1GIGL 2DICA 1BVKB 1VPOH 2P24B 3CFIC 4YDKH 3QBTB 4ZXBC 4LK4A 1H3TA 2BY2A 3N1FC 2VLKB 1MCHA 4CN4A 1NGZA 1EZVY 5IG7B 5I1IL 3N06B 4ZFOA 3MV7D 3HLAB 3HZYB 2PR4L 3C60B 3NCMA 3QIBA 3WLWC 1OAUL 4MJIB 3QIBC 5DJZA 2PW1B 4WDIB 25C8H 1Z9LA 2VZUA 3QDHA 4HWEH 1JHLH 1A21A 3HMWH 4M5ZL 5J11C 3NN8B 3OJMB 3E8UH 2R69L 3P0YL 5GGRA 3ALPA 4LSRL 1FZJA 1XGUA 3EYQD 3JV4A 3QDGE 4K07A 3HI1A 1QR1B 1HHJA 4D3CL 1MF2H 1P5VA 1I8LA 3H7BB 3VGBA 2HLFD 2QQNL 1I8LC 2WINA 3IAGC 4JQIL 3RNQB 2VAAB 3S35X 1OWRM 3AS0A 1FAKT 3QDGB 4P49A 1X7QB 1UT9A 1U8KB 5LJYH 3CH1A 4KHTL 4Y5VB 3PXJA 3OR6A 3AU1B 5FECB 5DRNA 1OW0A 2A6IB 1PQZA 2DMCA 3PHQB 1Q38A 4G7YH 5D2NB 1OW0C 3KYOB 4RWYL 3SBWA 2H3NA 3SBWC 5F96L 5IKCA 4N1EA 1OHQA 3B8YA 1M6OB 4X99A 4DCQB 1DVFA 1JFQL 1GJIA 1DVFC 4NJ9H 2YZ8A 4ELMF 3MLZL 3MMEB 2AJYH 5JORB 5KG9A 3QNXA 3VFNA 4Z7QF 4GQ9H 3WDHA 4ZG1A 2GCYA 3HNTL 2XICA 1D5XA 5EUKB 3DETD 3TA3D 5TH2B 3EGSB 3AS1A 3CUPB 4XP9L 2LAAA 5D7IA 4LVNC 1HZHH 1T5XA 4Z7WB 1A7NH 4HDIA 1AC0A 1B6DA 5KZCD 3O6FA 4HJGA 2DQUH 3O6FC 4QTHB 1T1WA 4MQTB 2B7DT 4NKMB 4OGZA 1FL6B 4QCIB 2QHRH 1U8IB 3HG1A 4WTZA 2XZCL 2F5BH 2J7LA 2ZJSL 2XWJA 4PJCA 5DEGA 4RMRA 3C8HA 1F4HA 4I13B 4JDZB 2FX7H 3EYUL 3QI9B 1YMMD 3NFSH 1F6AB 2BHUA 4PGCB 4E42A 4F80A 1KJMA 3SCMD 4FFYL 2GTWA 1JGEA 5FYLE 4QNPF 4YK4C 4XPGL 3BGFB 5GS2H 3ZHDA 1ZAGA 3D0LA 1W8NA 4HS3A 2XWBB 1Z2KA 4S1RL 2VDNL 2P45B 4XCEB 1JI1A 3DTXA 1CK0H 3K2UH 2YC1A 1W72L 2BJMH 4O58H 4XHQA 4KVCH 1S7XB 1DBKL 4ENED 1JHTA 1SBBA 5B3JF 3EYFB 1GC1H 1UXSA 4MD4B 4YDVB 1AY1H 3GMPB 4HIIB 1CDBA 4LRIC 4AENA 1OTUC 2ZOLA 3NABH 5SWQA 1V7NL 1BEYL 4GAGH 2W60B 3GBML 4QRPD 3H9SA 1G7PB 5EIIA 4QRSA 1R5WB 2ADJA 2HKFH 3CX2A 4DW2L 3TT3H 3V0AC 5FKAA 4WI5A 4G80A 3MZGB 2PTUA 4ALAL 3ARFD 3V7AE 3UBXA 4BJLA 2R8SH 4HH9B 1JPTL 1NDGA 1NC4A 2B5IB 5B39B 3MXWL 3OAZK 4OCXH 1HXMA 4YXKL 5IFAL 1XZ0A 5DD6B 3BAEH 1R3KB 4GRMB 4DK3A 2HFEA 3P9MB 4L3EA 3GHEL 1ETZB 4GW1B 4HJJL 1BOGA 4PJDE 2FIKA 4P3CH 1AFVH 1U91A 1XGTA 5E08L 1OY3B 2G2RB 3MRDA 3TJHD 1XGRA 2F9BT 4X4ZA 4QY8B 3MGOA 3ZE2F 3L5IA 1T66D 4KKNA 4PJDB 3VG9C 2VC2L 2AV7B 3U7WL 1G7QB 1MFBL 2NY1B 4JM4H 5DVLA 4NN6C 1QLFB 4JRYE 3CCHA 1I7TB 3GSQA 4OQTH 1RIUH 3V9FA 4UT7L 3PJSA 3GI9H 4LHUA 4FN0A 5JOFB 1S7QB 2DQDH 1X5IA 4UV4H 4JRYB 4P2QB 5GRJH 5GS0H 5DQ9A 2ZP0T 4A2LA 3MX0A 5CSBA 4JKMA 2ESVE 3UTSE 5CINH 2X4UB 4RRPA 2L0DA 3QDMB 3QISA 1T0MB 4P99A 4JG0H 2I60H 4L4JA 4Y4KD 1C5BH 3O9WA 3O9WC 4JAMB 1GHFH 1T1XA 2C1PA 4J3SA 1X5ZA 1C5CH 2CH8A 2Q7NA 4F58L 3UTSB 1SEBA 3SY0B 3QIUA 4PGBA 2OP4H 5IB5B 3SOBH 3U36A 4XI5D 1HE7A 4A2MA 4BH8A 3QEQA 2WBKA 3MBEA 3VGEA 1XIWA 4P59L 3MBEC 2HMIC 1IM9A 5KSAB 1XIWC 1YN7B 3DRTB 3EOYG 1BQHB 4ZOCA 3OKOA 1U2HA 5GGUA 3LN4A 4OZIB 3GI8H 1NCTA 1EJ6A 4B41A 4F7TA 3ZYOA 3FB6B 3CMGA 3MV8A 5E2VL 4TTGA 1BF8A 1BFOB 2PYEE 1I3RB 2Q8BL 5ICZB 1G6RL 2R0KH 1HDMB 1PKOA 4JHAL 3LKNA 4HUMB 5BO1L 1T7XA 3HE7B 4GBXB 5D2LF 4NT6A 2UZYB 2PN5A 2RAMA 4WUUD 4G8EA 5DI8A 1EGJL 3G6AB 4WWKB 4OLEA 4JGMA 5FDWA 2PYEB 3VCLB 3U2SA 3C6LA 5D70H 3SDAD 3BEWA 3TNMB 4JFHE 4HPYL 1I9EA 4U1LB 5AYUH 2B4CH 2YN3A 2NQCA 2W0FB 2ZCLH 1KEML 4NC2B 5C07E 4CVXB 4HBCL 1V3LA 5F70A 2JJSA 1KELH 4YHMH 2JJSC 4HW6A 4ORGB 3EO9H 4HZLA 2AI0L 4LRNH 1MUJA 4NHUB 2MHAA 1EBAA 3BZEA 4RGOH 3QFDB 3BDBA 3MREB 4NQCD 2WIMA 3B6SA 4MB3A 3R8BB 3MRPA 5DJDA 4P2YA 1ZT1B 2ICCA 3UTTA 3LKRB 1PKQE 2P8PA 4UTBH 4R96B 3RUGF 5TJWK 1CXIA 1NMBH 1S8DB 1A47A 1UWEH 3GGWA 1ZLWK 5J4MA 5I75B 2A9NH 2A0LC 4HIEB 5ITBL 2BNQB 4I5BB 2DQEL 2AK1H 1U8JA 4KQ4L 5T1DH 1VDGA 2VDPH 3WN5A 2VKXA 2R2EA 5A2LH 1GIGH 2FCBA 3WN5C 2W07A 1I4FB 2X4RB 4L9LA 4M8QA 4L9LC 2VQ1A 3FFDB 2VUYA 1NFDF 4LNRA 5I9QB 4LFHD 5I1IH 5F44A 4FNLL 3C5JB 3L5JA 4Q6IB 4XAKD 1F90L 2IFFL 3T0EC 3BIKB 1S7SB 2M26A 5F8RC 1X3DA 1I1AC 4PB9H 1A64A 2Z8VC 4M5ZH 1BX2A 3JZ7A 5L0QB 4YHPB 1KB5A 4HWBA 1XR9B 1NGWB 4XGZA 5ANMB 3P0YH 5FHAL 5CEYB 3OXSA 4RGMC 2EIZB 4XC3L 1OB1A 4M6OL 5IIEA 4D8PA 1MCOL 5HI3C 3FONB 4RWHA 3MRCB 5FM4A 3VMPA 2H1PH 2BCKA 3F5WB 3PL6B 2CRZA 4L8DB 4KK8C 2BVPB 1RU9L 4BQBA 5KVEL 1KJVB 4XVUC 3OX8A 2QQNH 4IRZL 2Z8SA 2Z31B 4OFYD 1G1CA 3QUYA 3QUYC 1T2QL 2B1HL 3ARYA 4KHTH 2APWA 4LNVA 3LB6D 2CR6A 3ZYZA 1BLNA 5I2IB 3F65A 3OB0H 2QTEA 4DGVL 4LCWA 4MNQA 1U3JA 5CIPB 4G7VH 3FRUA 5F96H 2BVOB 2PO6B 4KTYA 3WCYA 2NXYB 2HJKA 3QDJB 5FK9A 3QFJA 4OZFB 1JFQH 3FQWA 5D5MB 1CIDA 4G8GE 1I8KB 3MR9B 2CDFA 3LVEA 3MLZH 3U46A 4X80L 5D1XD 4QHNB 4OIIL 1LMKA 3V8CA 3K8KA 4R4NC 5BV7H 3HNTH 2YD2A 4HX1B 5C0BB 5JTWA 5IGXL 4QRTA 3MRNA 1CFTB 4R0LB 4XZUB 4XP9H 2X4QA 1UM6L 4IRJB 5F9WB 2Y36L 5A3ID 3BO8A 5CJ8A 4N0CC 2GITA 4YFLF 4WJ5B 1ES0B 2ZG1A 3MRBA 3UTOA 1GGTA 2XZCH 4M7KL 1B2WL 2ZJSH 3IJHB 3D6GA 1DQJA 2Z93A 4ZUWA 2R29L 1HK6A 1KC5L 1OCWL 4HWUA 3H3PL 3UBXI 4H8WC 5C6PB 5EO1B 1MH5B 4WFHD 3WUWA 4Y89A 1IARB 2XN9E 3TM6A 2IPUK 4FFYH 3SE8L 2X70A 4XPGH 1BWMA 3CLFL 2Q87A 4KRPB 4FQHA 4L5FL 4NO0B 4U1MA 1RZ7L 4QRRB 4X0KB 3TZVA 5LQBL 2VDNH 1AKJA 1N6QL 1AR2A 3TZVC 5IMMA 2K1MA 3GSNL 3WS3A 4J8RB 1W72H 4RGNC 5I1KL 4IMLB 1FVDB 3OKDA 5D6CA 2W92A 2GAZA 1DBKH 3KXFD 5BXFA 3MLSH 2VLRE 4J3XA 3VD7A 2AJ3A 5LAXB 1CGUA 4AMKL 5ESVB 8CGTA 3QA3B 1DANU 5KOMC 2P4AB 2R15A 3RKPA 1SVZA 3FT2B 1GRWA 1KEGL 1V7NH 2BXZA 2K9UA 5FF6B 1B90A 1BEYH 4NM4L 2SEBA 5I16A 2VLRB 5I8CB 4X5WA 1DFBL 3TCLA 4KHXH 4UOJA 3DSFL 4DW2H 5HGDB 1AO7B 4BQ6A 3LEXA 3O3DB 3D25B 1KPVA 2X9YA 1FPTL 4ALAH 4ZUSA 3SKNB 1JPTH 3TH4T 1FO0L 2IANB 1YY9C 4LAJH 2YZ1A 1MWAA 2AJXL 3P9LB 3MXWH 1UQSB 5D1ZD 4YXKH 3WXVH 5DA4A 5IFAH 2O5XL 4RMUA 3CFJB 3GHEH 4PRHB 4WRLA 3QG7L 1EEUA 4HJJH 5GHWL 5CJXA 5E08H 4I9WE 5CJXC 5EZLA 1FFOB 4M7JL 4JGUA 2CJUL 3KJ4C 3S7GA 1MFNA 4U6XB 1QOKA 4PJ5E 1CFSA 4I8DA 2DJUA 3VH8B 2ILLA 1Y6MR 1VGEL 1SVCP 5DD3L 3BEVB 2KBGA 2VC2H 5IQ9B 3U7WH 1MFBH 2A6JB 1EHNA 1XF4A 3BVNB 1F02I 3O4OB 4U0QB 1AIFA 4NO3B 2RJMA 4PJ5B 1KIPB 1X4ZA 5DHVH 4XXDB 1BP3B 4LLDA 4UT7H 1IEBB 4G8FA 4RAVA 4O2FB 1RIVL 3JTTB 3PWNB 3IDGA 1D5BB 1IGIH 1DN0B 3QH3A 2V2TB 4X98A 2YUZA 1G7JA 3AXLA 43CAB 3MROA 4F7MA 3SKJL 5T1MB 3V7MA 1BM3L 4FQQA 4HLZH 3HR5B 3WNOA 2AK4D 1H5BA 4PJXB 5C86A 1H5BC 2HVJA 3U30B 1RUML 2FGZA 4FFWC 3W81A 4N8PA 4GG6E 1Y6NR 4F58H 2VLJA 4U1HA 3DI3B 1AQDA 2HRLA 4CNIB 5AUMB 5ACZB 4MCYB 4P46A 5BZDA 1U8NA 2ZG2A 4P46C 4H20L 4P59H 1CL7L 5TDNA 4XWOD 4OFDA 4YPJA 5JDJA 1UJ3C 1AC6A 2YPLE 4AEEA 2J8UB 3B2VL 3BHBA 4ETQB 1IILE 3QZWB 1WZ1H 5D7KE 3TEUA 4GG8B 2J6EH 1D3CA 3QPXL 3RL2A 1L9NA 3FB8B 4DKFL 1P2CB 3IKCA 4PJHE 1HWHB 5E2VH 1FZOB 3QAZB 2Q8BH 4XCFL 5JIHA 3NZHL 3W2DL 3L95A 1YEEH 1A6TA 1G6RH 4HCRA 4JHAH 3LS5L 1QSFA 3UTPD 4P2RB 5C3TA 1DQQA 1BVZA 1RUKL 5GIRA 1EHAA 1XT5A 4HPYH 1G7LB 1FSKC 5D71L 3SE4C 1D5MB 1KEMH 3ABZA 4HBCH 1EERB 2QLVB 2LTQB 2QR0B 3QQ4A 5D4QA 4LDOB 1JL8A 2JJVA 2KQNA 2X4TB 1YPZF 3PWUB 4ZUUB 1FFRA 3MUHL 4P3DB 3BQUB 1LP9E 3CFCH 3T0ED 3Q3GA 1G7MA 3MRIB 1I1AD 1XGPB 3TNNA 3BKML 3L3DB 1IGJA 1NBYB 1CICD 1LP9B 4BSVB 5ITBH 2H6PA 1JE6A 4YNYA 1U8HA 4AEHL 4KQ4H 2AKRB 1T20A 1BF2A 3KLAB 3D85B 2QQKL 3VGAB 1WLHA 4G43A 5HHPA 5E8DL 4GFTB 4KJPD 2PETA 3P4MB 1MCQA 1D9KB 3ULUE 4ELMA 2VZOA 4KXZH 4W4OA 2VERN 3IFPB 5C0GB 2DQFB 4W4OC 4QT5B 4U31A 2OQJB 3DX6A 4F9LC 4YEFA 4FNLH 4LGRB 5HI4D 2IFFH 5F3HB 4JQVC 4FHBD 1E0OB 4MX7A 3FKUS 5SWSB 4R7NA 3T0VA 3UZQA 5D93B 4MAYB 1S9XA 4M3KB 2EDJA 3KS0J 5FCUL 2MOVA 3VFPB 4N8VB 5FHAH 3GO1L 4R4ND 4XC3H 4M6OH 1MCOH 2QKIB 4K3GA 3VWJC 4I3SH 4Z7UE 4L4VA 1ZOXA 1RU9H 4FXKB 1H3PL 5KVEH 3RVUC 2CGRH 2EDDA 2XOTA 4Z5RB 1TVBB 3RL1B 3I75A 3UO1L 1T2QH 2B1HH 1EFQA 3RWDA 4Z7UB 2EICA 3I3EA 5E6YA 3DVGB 4DGVH 1RUAL 4JFYB 4H1LH 3KYKL 1TZIA 2R1YA 3P3YA 1KLUB 2AS5M 3DIFB 3KHQA 2PTTB 3DO3A 4U3HA 2ERJB 5K9QI 1BBJB 1IEAB 4XB7A 2Q6WB 4MWFA 4X80H 1FVEA 1JNNH 4MD5A 4MLSA 2DIBA 1A4KA 1JGLL 2R1WA 1YEJL 4HV8B 1N8ZB 3C6SA 3IFNL 3CGTA 2OBGA 3D39D 2Y36H 4Z76B 3ROOA 4XCNA 1WIUA 4ORZC 3F12A 1IAII 1KPRA 3ARZA 5JDSA 4M7KH 1B2WH 2YUWA 5T1LD 1ZT7B 1FV1A 1NBQA 1D6VH 2EE9A 3H3PH 5TF1L 3CNKA 2ZZUT 1E6JL 1SM3L 2DM7A 5DS8A 5K9OA 1UCTA 5KSBF 3CVIL 1T7WA 2X6MA 1M1SA 3CLFH 2IPKA 1FLTX 4L5FH 1RZ7H 5DA0B 5DURB 5LQBH 5EC2B 4KH2A 2X4NB 1N6QH 4K8RC 3WL9A 4NQUA 1UADC 3GSNH 5J6GB 3WO4B 4F9PA 1QA9B 5GSVB 2YD6A 4F9PC 4X6EA 4X6FA 4L3CB 4K3DL 3GMRA 5D1QC 5LBSL 3KPRB 1P7HL 1QQDB 4NNYB 3FL7A 1KEGH 2ITCA 1NEZB 2M8XA 4NM4H 2VXQH 4X4MA 1U8OA 5D7LE 4XP1L 1VFAA 1YYML 3O81A 2P43B 4LBEB 3DSFH 1JGVL 3DYMA 1DEEB 2QBWA 1G7IA 3ULVC 4NC1E 5EO0B 3G5VB 1WTGT 3RIFK 1FPTH 1WGOA 5D7LB 1U0QA 3TN0A 1FO0H 4ONHA 3TN0C 4IIQB 5HYFA 3W0WD 3U0PA 2IAMA 2AJXH 4KV5E 2VYRE 3OGOE 2O5XH 4RAUB 1FJ1B 1A3RL 2HA1A 3QO1B 3QO0B 3H7LA 1XFPA 5IVXF 5ESQA 5GHWH 1LDSA 1BZ9A 2FYYA 4JZOA 2G9HA 3A0OA 1UEYA 4M7JH 4RMSA 1HINL 1F2QA 5EU5A 2K7PA 5C08E 5K59E 4QHMA 3LQZB 4FQXB 3OJDB 2FEEI 1QTYT 5I17B 1VGEH 3PHOB 5DD3H 3K1KC 1ZHBA 1C5DA 2QADC 3SDDD 3X12A 4YXLL 1JGUL 2MMXA 4NQXA 2VWEC 5DRWB 2OZ4L 3WIFB 5C08B 1R3LA 5BS0D 2CLZB 4E5XA 2PCPB 3MRFB 5D2LA 1I1CA 5GRWA 1RIVH 3S36H 3VXMD 3QEHA 2OSLA 5C9KA 1XF3A 1QEWB 1CDCA 2UWEF 2W65A 4TOYL 4EN3D 2HN7A 4O2EA 3QNZA 4UBDC 3L3OB 3JV6A 1BM3H 4NYLB 1OPGL 4OIAA 4DGIL 4KY1L 4M7LT 1OF2A 5BZWA 2X4SA 2Q8AL 5L6YL 2XY1A 2BRQA 4IRSD 4L29B 2RIKA 4M6ML 3BD5A 1GC1C 5AD0B 2K3TA 1J87A 1A9EA 1T3FA 3EDEA 1SJHB 4DQOL 2IF7A 4F2MA 5DRXA 2OM5A 4FS0A 5I1HL 2V7HB 1QHPA 2IBZX 1MFAL 2BSTB 1BWWA 5FFLA 5FO8B 3P4OB 2B2XL 1DQLH 4JFFB 5ACLA 1CL7H 3RUGA 5SWZE 1B0GB 4JDTL 2XQYG 5ELIA 4MA3B 3VXRB 5I8EA 3IS1X 3B2VH 3SDXE 3FTGA 4XVTL 5JR1H 4RFNB 5KW9L 2MKWA 4JRWA 3K80A 3QWQB 4KJQC 3QPXH 3QUZD 4K94H 2ID5A 3LIZL 3V5KA 4Y16B 3G6JF 5JO5A 1NH6A 2CLVA 4XCFH 4POYA 3NZHH 4V2CB 1HH9B 3SDXB 4JLRA 4JDVA 4ZODA 1IAIM 3LS5H 4XNXL 3EZ8A 4MLIA 1AE6L 1C12A 3VXUD 1EVTC 1NFDA 1U92A 3ILPB 4OKDA 5C0NC 3HS0A 1RUKH 1JZ7A 3KYAA 4H1LG 5BRZD 1Y0LA 5CEXA 3JWOL 2D0GA 5C0AB 3T77A 5J3HD 1OGAE 1NCBL 1O7SA 3O8XB 2X1PA 1Z9OA 4OGAD 2XY2A 4FQCL 3L3KA 4M7ZB 4OQTA 1EXUA 4RX4A 2C3VB 3RZCC 1Q9KB 2VLLA 5B4MC 3B3IA 1Z5LB 1HQ4A 4PS4H 2HH0L 1HWGB 4W6WB 5KSUB 2GEEA 3BKCL 5GS0C 2WP3T 4XNYL 1HHKB 2PF6A 1OL0A 1QFHA 3BSZH 3JUYA 2CIIA 1KFAL 3BKMH 5GRXG 3ZYIA 4BQ8A 2HJFB 2FD6H 2PYFB 3UROR 1FN4A 1TCRB 2FNBA 1U8LB 3DX7B 4WUUA 3VFMA 4I4WB 4AEHH 1WBXB 4WI4A 2FDBP 4OTXH 3BOVA 4GRWB 1FLRL 3MRHB 4WO4B 5E9DE 3B9KD 1R5IB 3VWJD 1JPFA 1AP2A 4HAFA 1J1XL 5E8DH 5JA8B 5F7DA 3ZE0F 4X6CB 3B5HA 3CX5K 4HF5H 4HGKC 5F88A 2JCCA 1MNUL 5HVHC 4X7CC 5FOJA 3L3JB 4TSAL 5IB2A 4OZGF 2DWEB 4HS8L 1UGNA 3MRLA 3O6ML 3E6FA 3LRSA 2C7UB 2AGJL 3MFFA 1A4JA 3BP4A 3MLPA 4CJ0A 3EDKA 1EAJA 1JP5A 1VENA 1X44A 3TO4B 1PSKH 3LQAC 2B0SH 2I5YH 1RFDH 4OF7A 1KPUA 2W9EH 3MV01 1PY4A 1PX4A 3D3VE 1OTTC 3TBWA 4G8IA 3OF6D 1WFTA 3HC4L 3SPVA 1N4XL 5ACMA 3GO1H 3L9RB 3WJLA 3WJLC 1Y18B 3HHRB 2EE6A 4LLQA 4YEEA 2EXWC 3OKLA 1WAAF 3ARED 1UA6L 2H9GB 3D3VB 1H3PH 2B4CC 3EFDL 3GSWA 3KPSE 4UDUB 3CPLB 5FGCE 2V2XA 3BP5A 4H26B 1RK1A 1RUAH 4X6DF 3ME0A 1XCTA 3KYKH 2VKWA 1HILB 5DJ6A 3IF1B 3Q0HA 3KPSB 5MERB 4LCUA 4JPKH 4MZ2A 5ID1B 5L2KE 1VADB 4PRIE 4LF3B 1BVLA 4WW1B 1F3DJ 5C0CA 3U4AA 3VG0L 3PV6A 1N0LA 2X10A 3D48R 3HPLA 4UIKL 4X6BB 5DEFB 4KMLB 4QOKB 3RWGB 2YMXL 4NO2A 1JGLH 4PRIB 1KACB 1YEJH 3F7VA 4Y7MA 3MA9L 1CGWA 2VDOL 4JPIB 1MI5B 1MCDA 3IFNH 5IBUB 1OM3L 4N0FB 5MP6L 4HULB 3WFHB 4Q9QL 3SQOL 3ROLA 4OFYA 2AQ3A 4JRXE 4RQQA 5I73B 1NEUA 2Y72A 4HBQA 4M1CC 5EDXA 3MV7B 3Q1SL 1G9EA 5TF1H 4MJ6A 3VDCA 4UQ2A 1AGDB 1YJDH 1WTLA 1L7IH 4P4KD 1EUTA 4D9LL 5J56B 5EFIB 1IM3B 1E6JH 1SM3H 5HGAB 4UDTA 4ODVL 1OP5K 2YWZA 4H25B 4KI5F 3CVIH 2XTJC 3QUXA 4Y19E 1UC6A 1A6UH 3QUXC 2P5WA 4U6VL 2V7NB 1QSED 1JK8B 3GMQB 3ZLQC 3NPZB 3STLA 5CS7A 5T3XE 4DEPC 2BY0A 3E3QC 4HK0B 5K9JL 3MRKA 2DKSA 2GHWB 3K4ZA 2X5PA 1A6VL 4M4PA 3VXPB 1ORSB 1PYWB 4K3DH 1B3JA 2YEZB 3H9YA 5HHOE 2ZNXA 4GUPA 1IC1A 1A9BA 5LBSH 1L7TL 1JPST 5DO2C 1ZXQA 3P2TA 5ICXB 2EE2A 2GJZA 2P1YA 1T1YB 1BQSA 5DEZA 4JREB 3I50L 5MHSE 1JV5A 4NFBA 1JNHB 5DMGC 4GJTB 1J1OL 2NY6C 4KRNA 4XP1H 2QADD 3V5HA 1YYMH 2J8HA 2QV2A 5EN2A 3BN9D 3H9ZA 1JGVH 5FEBA 2DYPA 4N9OB 5FOBB 2UZIL 4JANB 1C08A 4L4TA 1J86A 4OGYL 3VWKA 5CZVL 4H5SA 3VWKC 3E6HB 5JNYB 4OV6F 4WCYH 5HPMA 5DHYA 4NNPL 4MSWA 2P48B 3TIDA 4OI8A 5FYKH 1RHHB 5IBLC 3TA3B 1UB6B 5AAWA 1N7MH 3H0TA 2IH3B 5BV7C 3QCUL 5IEHA 1A3RH 2BFVH 2CIKB 3I02B 5KZCB 3IJSA 5CEZH 1ACZA 3GMNB 5GRVK 4S1DC 1K5NA 3MJ9L 3FOMB 4ZS7L 4G9DB 5CBAB 4P5MA 1F5WA 3DXAD 1G0XA 4HT1L 3IDNB 3HZKB 3GFUA 2OR9L 5C0FB 2R0LL 4NKOA 3JWDL 3FCTB 3MA7B 3RWCB 1YMMB 3ZT5A 1NLBL 3SKOB 3TH2T 1QFUL 1FZKA 4JKLA 2ATKA 1T5WB 3SCMB 3ZKXB 3ZO0A 2VE6A 3I6KB 3ORJA 5C0IA 2W0LA 3VD9A 1CLYL 1OP3K 2XPGB 1VFOA 4OF5A 4DKEL 4MJ2A 5FYLL 3VFRB 1S9VB 4TOYH 5KS9F 1KCSL 5C9JB 3JTSA 4KROD 3X3FL 5EIVA 4HWNA 3LKPA 4M9PA 4DGIH 1W72A 1MCNA 4NSKB 4A6YA 2Q8AH 2FJHB 4PP1C 2AEQL 3LMJL 3NCBB 4M6MH 4FQIL 4Q9BA 5F1NB 4WWID 3TVMD 5EBMB 4DQOH 1DP0A 3OL2A 1YPZA 3IXTB 4K7FA 5E03A 4FTVE 1NC2B 4MDIB 4RMVA 5EZIL 5I1HH 4PJAF 3K46A 4QRPB 1MFAH 2B2XH 4X8XA 1F4WH 5D72L 2O26U 4EQ3A 3MRQB 4QGYA 3RWEA 4U1SB 4YC2C 4BUGA 3RP1A 1CQYA 5F1SA 1KJ2B 3FJTA 3G08A 3ARFB 5B3NA 1AXTL 1T2XA 1X4YA 2HJLA 1MHPH 3BDYL 5J9PB 4XVTH 4ZDHA 3G04B 3ZDZF 3DUSB 2P8LA 2F53E 4OBRA 1P7QA 2IBZY 3LIZH 4NPYB 1WF5A 4PJFB 1YEHL 2AABL 3WNNA 3VXTA 5JZ7D 1DTUA 3M07A 1RIHL 1AE6H 1U95A 4BM7A 1IT9L 2F53B 5E70A 4GRLB 1CFQA 4DKAA 1H0DB 3DRQB 2VR4A 3HTLX 4CVWA 2D7MA 2D7PA 2E7LA 1VA9A 5JPMA 5ID0B 2YD1A 2E7LC 2DWDA 5IR1B 1OAZL 4HKJA 4PRBB 3P77B 1UXWB 3RKDC 4FQCH 5ITFB 5DHVA 3E2HC 4MDJB 4CVUA 2JJWA 1MCPH 3RIAK 4YFLI 4NQED 1DDHA 1XF5B 4BSJA 2HH0H 4BA8A 5EU7C 1LO5A 2A83A 5GS1B 1HI6B 1HSBA 3BKCH 1AGBB 4KU1A 4H88L 4KTEL 4XNYH 2F19L 4XCCL 3CDCA 1S7RB 2ARJB 5C09D 4JVUA 4OLUL 4QWWC 4Y4KB 1CI5A 3T4AA 1NGYB 3MCLL 4HAGA 4WU7A 1WUNT 1JF1B 1FLRH 4JY4A 4UNUA 1ZGLB 2F5AL 5ERWA 2XZQH 4V1DD 1J1XH 1VCAA 5DGQA 1LDPH 5BMFL 5F3BB 3RDTA 1MNUH 3RDTC 3ZTNL 3WUZA 2BVTA 5F71A 4TSAH 4HS8H 3O6MH 5MEQB 4F7EA 4I0PA 2AGJH 1FYTD 2J6EA 3WNPA 4I0PC 3TPUB 2EXYD 2IADA 1JWUA 5DVMA 5MENE 4UINL 4HWZA 1L4IA 3OR7B 3AY4A 1G6RA 3AY4C 4NWTL 4XVSL 2BVEA 2HLAA 4QRQB 1DL7L 1U8QB 2ZKHH 3GJEB 1I1YB 2C3XA 3HC4H 1N4XH 3MV11 5IFHL 3BPCA 5IB1B 5E8EA 2VN4A 4LCCA 2FJGA 4L8CA 4KDTA 4LCCC 1LGVA 3SDAB 1N0XL 3HI5L 4KDTC 2GT9A 1K8DB 1UKQA 4XX1E 2R0WL 2GJ6D 1WBYA 1UA6H 5D8JH 5CBEB 5KSBA 5DFVD 3EFDH 3F58L 3VXOB 2UVEA 2OJEB 4ZXBB 3MXVL 1BIIA 1IL1A 3TT1L 3UPRA 4NN5C 3PQYD 1I8MA 5EU6E 2BSSA 1NQBA 4ZFOB 4OZ4A 3DOSA 3OMZA 3AGVA 1UM4H 1K4DA 2VTFA 3GIZL 2Y5EA 1E4XH 3LH2L 1NGPH 4G9FD 1O7VA 1D6EA 3VG0H 5EU6B 4UIKH 2P8MA 3PGDB 5JXED 4N90E 2YMXH 5JW4M 1WWAX 1Q0XL 4HUUA 2A74B 3TIEA 3MA9H 2VDOH 3BZ4B 3PWJB 1OM3H 1FZJB 5MP6H 3WFCL 4TNWF 4CU6A 3C08L 5HYJA 4Q9QH 4PLNC 1G0YR 2DD8L 3RVVD 1FL3A 2AV1A 1FP5A 5GSRB 3TESA 4NCC2 3NMEA 4E41D 5E6ZA 2BVUA 3P4NA 1XCQA 1OQOA 1MQ8A 1MHEA 3Q1SH 1OGTB 2WBWB 3ECBA 4D9LH 1IGTA 1WWBX 5IVXA 5H94A 1MSPA 5F7UA 4ODVH 5E6IA 1FBIL 5FYJE 5E6IC 1I7UA 4RIRB 2DQTL 2EC9T 4MGXA 4X99B 1LHZA 3IJYB 5D7IE 4U6VH 5CZKA 3DECA 5DUBB 1RULL 3PP4L 2B39A 5KG9B 3VFNB 5FAAA 1CFNB 3REWA 4Q97A 3HG1E 4XNMA 5K9JH 1D5XB 2EYSB 1EDQA 2YD5A 1ZVSB 1X5XA 1BREA 4MD0A 2HKHL 4PJCE 1V3MA 4OUUA 4R4BA 4ZUVB 5HHNA 5E5MA 1MCIA 4HDIB 2WIIB 4QKXB 4DVBA 4EI6A 3MJ8A 1L7TH 3F7YB 1WICA 3CZJA 3O4LA 3HG1B 1IGYB 4AM0A 3C60D 5L8KB 1HQRA 2UWEA 4PPTA 3I50H 2ED8A 5DEGB 1INQA 3C8KB 5FCSH 5I1GH 1BQLH 1J1OH 1WC7A 1QVOB 1RJYB 5JW4N 5ECJE 4H1LA 2IMMA 1NL0H 3CDFA 5IF0A 3VRJA 2UZIH 2Q20A 3BRGC 4OGYH 5CZVH 4OCSL 3D18A 4NNPH 1NFKA 4QO1A 3D0LB 5D1XB 3WFBL 4DK6A 4F15B 2NTFB 2G75B 4JN1L 4Q2ZA 4M61A 1AHWB 1BD2A 3QCUH 3UPCA 3DTXB 5DFTA 2XG5A 2D0FA 1Q9LB 4LIQE 1KUMA 3CFBA 1A7PL 2ZCKL 3QDGD 5E4EC 4ZS6C 1JTPA 3H9SE 5MI0B 4YZFE 4ZS7H 1UXSB 5HGBA 3CLEL 2XYCA 4ZFFB 4Y5YA 1QFPA 3L3HA 4DAGL 4Y5YC 3DBXA 3HNVH 2ZOLB 2R0LH 5FO9B 3FO9A 3G6JA 1Q0YL 1A7RL 1V3JA 5K33A 1MY5A 1QFUH 1BJMA 2ADJB 5I0ZA 2ICEB 3TBSB 3L7EA 4P57A 2VXVL 4Y1AE 3U6RA 2J4WL 4LPVA 2R23B 1TJHL 4H0GA 1CLYH 4JCMA 5FKAB 4HGWA 1JZ3A 4DKEH 4L3EE 1KOAA 5EBWA 1DCLA 3UBXB 3PDOA 1KCSH 5IJVB 2C4XA 3N9GL 1ADQH 2KPNA 1KN4L 2D7NA 3X3FH 1LK2A 4Y1AB 3DPBA 3GSNA 1HXMB 5TE6L 3S5LG 1UWXK 1XZ0B 3N85L 3KXFB 2AEQH 3KPMB 5GXBB 2CUHA 3LMJH 4HJ0D 3MO1B 4U0RB 5TQ2L 2DKMA 4FQIH 4F7PB 5EZOL 5HDBE 3ZDXE 2BNRA 3UDWA 5INDA 1MAML 2FZ3A 3GMMA 1J5OL 3U4EA 5EZIH 2X1OA 3AS3A 4PRAA 4PR5A 1ZHKA 3QHZL 3VG9B 1A02N 2XT1B 5D72H 5T5NG 3TF7C 5GZNC 4NN6B 1OSPL 3RPIB 2X1XR 1QG3A 1ACYL 2DTML 3GSQB 1JCKA 4OD2B 1AXTH 4XXCA 1KLGB 3BDYH 4PJEB 1FG9C 3BH8A 4PLOB 1Q9WB 4JFEA 1FO0A 5FYLD 5JLZB 3TV3L 3IFOB 5D1ZB 1LEGA 4PJ7F 5DSCA 3OAZH 4W6XB 3V6ZA 4K23L 4AIZB 2NNAB 1X5HA 2AABH 3RVXC 4X4YA 2JE8A 2OYPA 2I9TA 4WHTA 3DX8A 4DKDC 2Y6SC 4CW1A 1IT9H 2G5BB 1VEPA 2YOCA 5F1KC 5I8OL 3QEQE 5JIPA 3HNSL 4OZGA 5DJYA 1T80A 3I84A 1QSVA 1UB5B 2XKUA 2VN7A 3UYPA 4JZJB 1KTKE 5DF0A 3F8UB 4PLJD 1C16A 1OAZH 4BH8B 3PWPA 3QEQB 3KLHC 1FZMA 1ZLSL 4OAWB 3FRPG 3MV8E 3OB8A 1A6WH 2JJTC 5IMOA 4NO5A 1NAMA 2E6JA 1ND0B 5CGTA 4H88H 2AK4B 4HXAL 4KTEH 4F7TB 1WAAA 2F19H 4HFUH 4XCCH 3MV8B 2CDGB 5KVDL 2EDYA 4OLUH 2QSCH 3H9HB 1D5ZB 5C1MB 1LNUB 3KDMB 3SGDH 4Y4HA 4LGPB 5IB3A 4Y4HC 3LSOA 4Z7WF 3W9EA 3MCLH 3KYMB 3P40A 5FDWB 3CVHH 4X6DA 4BFIB 1I8IA 2F5AH 5HGHA 5J0BA 4O51B 3HKFA 3BEWB 4ISVA 3HFML 4DZ8A 1K8IB 1CD9B 4JRYD 3ZTNH 5F9OH 4N0UA 1U8MB 5AG9A 4U7SA 4I1NB 4UUJA 3UTTE 2XWTA 5IVZA 1KIRB 5GS3A 1EHXA 3S35H 3QDMD 3BZEB 5DMIH 4K94C 1T0NA 4HKZA 4LSVL 4UINH 2EDFA 4ZPTB 1F3DH 2I07B 1IAKA 3UTTB 4NWTH 4XVSH 2ESVD 3UTSD 5JW4R 2OTWA 3L5XL 1DL7H 3GGWB 5EOTB 2V5SA 3O3EB 1VGKA 4G6AD 4KXZI 5KSAD 1N0XH 3HI5H 2P5EA 3B43A 4JM2D 5J8OA 3IAQA 1WISA 2R0WH 4PGEB 2R2EB 2WBJD 2NMSA 3OAUL 5GZOD 2Y9RT 2CRIA 3GB7A 5FUZH 3F58H 4KI5C 3ZKND 2QSVA 2JB6A 3VFUA 5CD3B 1MCFA 1WEJL 2VQ1B 2VIRA 3MXVH 3TP4A 5DUMH 4YHZL 1CDIA 1HXYB 3TT1H 4LSUL 1TMCB 3PGCA 5LG1A 1T2JA 5HVGB 2BY3A 3LN5B 1CS6A 1RJLA 2H26A 5IESH 3T0EB 3GIZH 4GBXD 3LH2H 1NGXA 1CR9L 1GOHA 1I1AB 3VU2A 4PLKD 1BHGA 2PYED 1RK0A 5IV2B 3HPJB 4HMEA 1ZLWH 1WZKA 5E5UB 1Q0XH 2EZ0D 3UAJD 5DHXB 5I1AB 3EOAA 3U48A 3MUZ1 3WFCH 1CDGA 3QHFH 4CVZA 4PJ9C 2BCKB 3C08H 5ETUA 3LHPL 1JYXA 2DD8H 1EFXD 5LGJA 1QO3A 4QHUA 5DK0A 4OCWL 4Y5XA 4LCWE 4MNQE 4JFHD 1EO8L 1JTTA 4Y5XC 4MMXC 2Y06L 4QXTB 3KG5A 3QUYB 2CMRH 4JO3L 3BXNA 3ULUL 1VESA 3QFJE 2QQLH 4UV7L 5D7JA 4NOFA 4K71C 5D7JC 3IETB 3QWRA 2W91A 4MNQB 2EKSB 3FRUB 4W4NA 1FBIH 2GY7B 4AY0A 2BVQA 4ZUTA 3QFJB 1FE8L 2Q7YB 1MFDL 3CZFA 2FL5A 2E5EA 2CDFB 3PP4H 2VUOA 5CGYC 4JY6B 3U46B 3NACL 1T21A 1YECL 1MEXL 4HQQL 3JV5A 1IKNA 5IW6A 3QUKA 4GKSA 4QRTB 3MRNB 4XCYA 1JUFB 4CAGA 2HKHH 2Z92B 3U82B 3CDGB 5C0EB 1E4JA 3QIWD 1EJOH 1ED3B 5ESAB 1CVRA 4XP5L 5B8CA 5B39G 1ORQA 2OMNA 3JUZA 5B8CC 3ZKMC 4ZMAT 3CX5J 4JO4L 3DHMA 5KS9A 5CIPH 3R1GL 1U41A 4Y88A 3ALXA 4NNXA 4NQDA 4ZUWB 4NQSA 1SJXA 4KJWD 3RGVA 3CIQA 4OZFH 4EJ1C 4GAJL 2JB5H 3RGVC 1MFEL 2JIXA 1EEYB 4P4RB 2APVA 5DMKB 1QFWL 4RGNE 1SYVB 5MEPA 32C2B 1S7UB 3QJHA 2E7HA 4OCSH 5ENWB 4OZIF 1YEDB 2BVYA 1HKLL 3WFBH 2ZSVA 4U1MB 4PJAA 3THML 3TZVB 4TRPH 3CFDB 1AKJB 5C7XL 2CDEB 3O3AA 1JZ4A 1NKOA 3HC3L 3D39B 2YSSA 1QRNA 4Z0BL 4F57L 2O61B 1A7PH 2ZCKH 2GK0A 5BXFB 3EFFA 4DAGH 4L8SB 5I74C 2J88L 4S2SA 4U6TA 2GJJA 2NXYD 3DO7B 3KPPA 2C3WA 1J05A 1A7RH 2P7TA 3T4YA 1RURL 1YJDC 5EPMA 2CUIA 2APFA 5HHME 2VDRL 2VXVH 3PGFH 4BKLB 3QUMA 2J4WH 3RTQD 1TJHH 1F8TL 5BJTA 3LEXB 2CUMA 4OCYL 5ISZA 3S34H 4G8GD 1D5IL 3BYYA 4ZQKB 1KN4H 5HHMB 1Z9MA 3VMOA 1FORL 1WIOA 3EJZD 2VH5H 1T6VN 1BQHG 5F7FA 5TE6H 3S6CA 4O2CA 3H6JA 1S9WB 1MRFL 2MJWA 3RVXD 2HT4C 5I8KH 1HHGA 5IFJB 1L6ZA 5TQ2H 1W0WA 5EZOH 4DZBA 4N9GB 3KJ4B 1MAMH 3TBYB 4TNVK 2VDML 4RZCA 3T3MF 1LD9A 5C2BH 3QHZH 3F6IA 5SX4H 5TGBB 1ZS8A 3OKKB 4ZAKA 1ZT4A 4ZAKC 1UM5L 4KRPD 1C7SA 4KTDL 4NO0D 4EBQH 5I76A 3QXUA 1AIFB 1ACYH 2DTMH 1V7ML 3FFCA 4R26H 2XN9D 5CJQL 1UG9A 4FFVD 3BW9B 3FQXA 3GK8L 4G8FB 3UJTH 5CILH 4K3JH 1HH6B 3PABA 5IHUL 2EO1A 3TV3H 3W0WB 4NDMB 3M17B 3IDGB 5E4IA 1AGCA 3IFLH 5I1LA 2EDXA 3AXLB 3MROB 3Q6FB 1RZFH 1MJ8L 5LVEA 1KN2H 4K23H 5E8PB 4P9HH 4MNGA 2VLJE 4LSQL 4B7LA 3VXNB 2PUQT 4B5EA 3D1MC 5BOZG 1PD6A 1WJ3A 2VXUL 2NY0C 5MEOB 5HD8C 2NR6D 3O2VH 5I8OH 2HFGH 5J7CC 2FR4A 2VLRD 3FQRB 3LD8B 3ZSTA 4DVRH 1KNOA 1A1MB 3WNLA 4B50A 1RZIA 3GMOB 3MRGA 8FABA 4P46B 5BZDB 5ADOL 4X9HA 1QYGL 2IQAA 4HUXA 5TDNB 1NFIB 1UJ3B 4OCRL 5CZXD 3IDYC 4LLUA 4PV8B 3UCRA 1DLFL 4Q9RL 3VXMB 4HUWA 1NAKL 1T7VA 4EVNA 1T04A 3FT3B 1QSFE 5E24E 3O6LL 4PUBH 4PY8I 5D5MF 1IZJA 5KVDH 4LLVB 4JPWL 3VFWA 4QEGA 1AGFA 3MLTA 2CLRA 4I9WD 3S9DB 3QXVA 3MLVL 2X9WA 1WVZA 3R06A 3STZB 4IHOA 4PJ5D 4GT7A 5F1IA 4O5LL 3TH3T 5JIIA 1LILA 2DL2A 4HXBL 3HFMH 3VXSA 5GGTL 5E8OB 3HCVA 3VFVB 2VZ1A 3QQ4B 5DZOA 2H32A 3D2UD 1A6AB 3O45A 4H0IA 3QUZB 1P6AB 4FQPA 3GUTA 4JHZA 3EW3B 1UENA 1M05A 3W11C 2HRPL 4KK6C 5ALBL 4LSVH 3FHAA 4FOMA 2YBRA 4NQVA 3WKML 4PRDB 4KGJA 1DBJL 2LABA 3ETBF 5C09A 1C8PA 3BGMB 3HZVB 3L5XH 1F3JA 5JHLL 5IEKB 1T7YA 1YNTB 4ELME 1IC5H 4YNYB 1U8HB 5BRZB 1JN6B 5EBLA 4Z7QE 1T20B 3CD4A 1MCWW 2Q86A 2EDWA 4G43B 3OKMB 1P4IH 3REVA 4LMQI 5HYSB 4EI5D 3BPNB 1WEJH 2HTLC 3D69A 1F58L 1RJZA 5M7QA 1XGYL 5DJAA 4YHZH 3BH9B 4LSUH 3T3PF 5C6WH 1AGEB 1MHCA 1PLGH 1UVQA 2ADIB 3S88L 3ALWA 4OLZL 6CGTA 2YD4A 5T3ZE 1WCBA 3QQ3A 1NCCH 1DE4B 3AM8A 5D7KD 3AM8C 1N6UA 5JUEL 2YD9A 1Q9OA 2GFBB 1N5AA 4R7DA 4FXGA 4L4VE 4QHKJ 1S9XB 1KCRL 1NLDL 5IHZA 2XZAL 1UYWL 4AL8L 3MNVA 5HDQL 3B9KB 2H2SC 3VWJB 2DIJA 2OL3A 3S5LA 3V6BR 3MYZA 3LHPH 4L4VB 3OKEA 1FNGB 2FSEA 1ZVHA 2IPUG 3W82A 1N5YL 1CFVH 1EO8H 5JW3L 3DVNA 2HG5A 1R24A 1TJIL 3HUJB 2Y06H 5B38B 1JWMA 4HSQA 3BQUD 5E8NA 4OCLC 4JO3H 3BIBX 5CD5C 3ULUH 4WFEE 4YHNB 4UV7H 3KPLA 4M93C 2DAVA 4NKIH 4MJ5A 1BFVL 3QWOB 4BZYA 1MY7A 4FZEL 4Q0XH 5CCKL 2CK0L 4U1JB 1RZ8B 1JRHL 1S7VB 1TZIB 4HS6A 1CD1A 5DJCB 1S9YA 4ODWA 1FE8H 3T8XB 2H2PD 1AR1D 5I15L 1UFUA 4YO0B 3WHXA 1KCVH 1FVEB 3HZMA 3NACH 4P5KA 3T1FA 3BJLA 3RWHA 4F33A 5EB9A 1XR8B 1MEXH 4MD5B 4PJXF 1HKFA 1LEKA 5HVFB 4XPFH 4PJBB 1K2DA 1RY7B 1T03L 4PJIB 3BWAA 1NGQH 4Q9CA 2WV3A 3C6SB 1VB9A 3AREB 4Z7VB 1BPVA 3UP1A 3AB0C 5FYJU 3EBAA 2MNUA 5H35A 3ZHKA 1IQWL 1IE5A 4XP5H 2W1NA 3BJ91 5KSVB 1KPRB 5JDSB 2AJVL 4JO4H 2GKIA 4YAQA 2DM2A 3R1GH 5C6TL 3ULUD 1CDJA 1FV1B 2OTUA 2XNAB 3BP7A 4LPCA 1A0QL 2C5DC 4GAJH 2X89D 1MFEH 3DV6B 1E6OH 3VH8G 3IGAB 1QFWH 2J8UF 3NTCL 3DMMD 5A2IH 4OLVL 1NANH 3A6CL 1HKLH 2IPKB 3FRPA 3GSOA 5IW3A 4Z0XA 5H37H 3THMH 2WUCL 5GISL 4BH7B 1ITCA 4KRLB 4UZGA 1U93B 2P24A 5E1AB 1LEIB 3HC3H 4Z0BH 3V6FB 3JXAA 2VLKA 4X4ME 2WANA 5IG7A 3BESR 5D1QB 2NY3D 3HLAA 3HZYA 4GAYB 4KK5C 4YDLC 4YUEL 2NW2A 3UXFA 3ULVE 3EYOB 4MJIA 2J88H 1VKXA 2P49B 2PW1A 4WDIA 1B88A 1TETL 4PJ7A 1U8OB 4P4KB 1RURH 2NX5B 4I48A 1QKZL 2R4RL 3W39B 4R8WL 1EZVX 2A6KB 4YBQD 4XH2A 2VDRH 5INCA 3NN8A 3C9NA 1F8TH 2BSED 2G60L 4YX2H 1D7FA 1QSEB 1AJ7L 3KYNB 4OCYH 5DTFB 3BDXA 5E2UL 1I9JL 3I3BA 3GSXB 1QR1A 1TENA 3H7BA 1F4YL 3PV7A 5BVPL 3QPQD 4JJHA 3RNQA 2VAAA 1MRFH 1YDPB 4K2UL 4LHUG 4DGYL 5DT1L 3SKUD 3LEVH 1X7QA 4MB5A 1U8KA 4JZOB 2VWEE 4Y5VA 5FECA 4Y5VC 3PHQA 5D2NA 2VDMH 3KYOA 4MXQD 4U1GC 5D2NC 5F6HI 2OTPA 4MB4A 5D2LE 4X7SL 2QADB 1C5DB 4DCQA 2N4IA 1UM5H 5H2BB 2F8VA 4KTDH 3QRGH 3MMEA 4DFIA 5AZEL 2WLZA 3GSRB 3FB5B 4I2XB 4M1GL 3FO0L 2J1KA 3RBSA 4E5XB 5CJQH 1DZBA 1E27B 3GK8H 3EGSA 3CUPA 4Z7WA 5AWNL 2W65B 2AXJA 2ENSA 3ULUF 2DF3A 2HN7B 4QTHA 1MJ8H 2IPTL 2VZTA 1JVKA 1CU4H 4NKMA 4RMWA 1FL6A 3L3IB 4QCIA 1U8IA 4HKBA 2PTVA 4CMHC 4LSQH 4P5TC 2NXZC 1NDMB 2X4SB 3CSBA 2IH1B 4KKAC 3X13B 1DR9A 4J7RA 2VXUH 5GRVL 4JDZA 3QI9A 4F7CA 5DD0L 3DXAB 1TJGL 3QI9C 1KV3A 2C9AA 5DRXB 3C5ZD 3RUGE 4ODTH 1F6AA 4PGCA 2DI8A 4POZD 5C8JB 4FQJL 1CGYA 1TIUA 2B8OT 5ADOH 1QYGH 5D7LD 5IWLA 2W38A 2XWBA 4Y8DC 5IWLC 2Y7QA 2PW2A 4LOUD 3VXQB 4OCRH 5CP3H 4Z7UF 1NAKH 5I8EB 4I3RL 2D4FA 3FTGB 4Q7DA 4KROB 1MREL 3KJ6L 1ADQA 1S7XA 3UPAA 2HT2D 4UIMB 3EYFA 1NFDE 3O6LH 4HD9A 2CLVB 1AXSA 4HC1L 4YDVA 3GMPA 4QLRA 4HIIA 2IC2A 1RUQL 2GSGB 4FQXD 5AG8A 4JPWH 5ADPL 2ADGB 3HC0B 4G6KL 2W60A 3TVMB 2B1AL 3H2WA 3N50A 1G7PA 3FQNB 1ZANL 2HTKD 3MLVH 1R5WA 5C08D 4AIOA 2UVFA 1I9RH 3SDCD 1KJ2L 1M7IB 4U7KA 5L8LB 1IGCH 5CEXB 4HXBH 4PGDB 4HH9A 3MODL 4N8VG 5GRZA 1X5AA 5AZ2L 5FB8B 1EXUB 5FM8A 5B39A 3RZCB 3V4PL 5DD6A 4MA1C 5EUOB 2MSPA 1R3KA 2XFXB 1NCWL 3IT8D 4GKNB 1ETZA 4X83A 1HQ4B 1YY8A 2NY5L 2ZCHL 1RSFA 2CRMA 3VGHA 5DVNA 2HRPH 3AMLA 4DWHA 2G2RA 2X4OB 4QY8A 3WKMH 4KUCF 5HJ3B 1DBJH 3FB7B 1F11B 4FXLA 5L9DH 1J7VR 5JHLH 2AV7A 1G7QA 2YHGA 2NY1C 1QLFA 1S7WB 5F8QC 3TGXA 4NN7C 2JCCE 1I7TA 3VW3L 1P1ZB 2HT3C 1JPFB 1QR4A 4CKVX 3NCEB 5BOPA 1ZE3C 4BYHA 5JOFA 1S7QA 1CQKA 3DARA 5IHBA 3LKOA 4LDLB 4G6JH 4XMKL 4OM0L 4P2OA 4P2QA 5I1DA 2JCCB 4JZNA 4P2OC 3FZUD 1XGYH 2XKNA 5SWZD 4Y16D 3M8OL 3T04D 4ZFZB 4NQEB 1PY9A 5JPNA 3P73B 4TUKH 1J0ZA 2X4UA 2R1XB 1G0DA 4LLYB 3QDMA 1T0MA 4YBHA 4OLZH 2BY1A 3MCKB 1H9VA 5JUEH 2PXYA 4JAMA 1XGQB 1SYSA 2PXYC 3MRMA 1JYWA 2H41A 1SY6L 2Y4SA 3SY0A 1NUNB 4WV1B 3FO1A 1BECA 4CU7A 4GRWH 3RIFF 3TBWB 4ERSL 1KCRH 2XZAH 1UYWH 3C87A 4AL8H 3ZHLA 4M43L 5HDQH 5KSAA 3CVHA 3DGGB 3DRTA 2FH8A 1RVFL 1BQHA 4XWGL 3OKLB 3ZT6A 4LEOA 2WWKO 2Q1EA 4XAKE 4U1NB 1N5YH 4OZIA 5JW3H 2C26A 1TJIH 1OGAD 4DUXA 1G9ML 3O3BB 1YEKL 1E4XI 4MZ3A 5KVMC 1CXKA 2V6HA 2MQ0A 3FB6A 1HIMH 5C0CE 1BFOA 43C9A 1FYTB 1I3RA 5ICZA 5IB4B 1BFVH 1KXVC 4FZEH 1HDMA 3F7QA 5CCKH 2XI9A 2CK0H 1XCTB 1A22B 1JRHH 3HE7A 4LEXL 4GBXA 3HB3D 3NPSB 4JVPA 1NEZG 1MIEL 1I1RA 2AJZB 4WWKA 3C2SA 5I15H 4APQD 3VCLA 4WWKC 3ZKSD 1LO3H 2UY6A 3TYFB 3HPLB 4UT6L 3TNMA 4U1LA 4NO2B 2Z8WC 2W0FA 4L3AA 4PTUB 3T0AA 1W8OA 4CVXA 1T03H 5IJKA 5IJKC 3LN9A 2NY4C 4KZEL 4ORGA 5E9DD 4WHDA 4NHUA 4PTTB 4QF1B 1INEH 4ODXB 2F8XC 3CSPA 5FUOL 4ZFOL 2AJVH 4WVRA 3QFDA 3MREA 3U0WH 3WNKA 4DFHA 2XTJE 1HOCB 3PQYB 1HNGA 5KTEL 5I18L 3RBGA 1A0QH 2P5WE 4CN1A 3TO4D 4UQ2B 2QHLA 1OAYL 4R96A 3ARBD 3UC0L 2YK1L 1YC8A 3PNWB 3G5XA 3E3QE 4LSDA 3NTCH 4OLVH 1P7KB 4G9FB 1U3ZA 4HIEA 2A77L 5I75C 2DI7A 3A6CH 1FVCB 2BNQA 4I5BA 2NLJB 3NCCB 2WUCH 3CFEB 3D3VD 1EPFA 4DEPB 1I4FA 3S3JA 2X4RA 3TCXA 1CWVA 1IRAY 1DQTA 3LKSA 1G6VK 3VMNA 3I6LE 3ARGA 3ARGC 5I9QC 3LV3B 1QLRB 4YUEH 4E41B 1TPXC 3C5JA 3BD4A 3ZSSA 4L4TE 4RCAA 5TE4L 4LASH 1TETH 1F4XH 3KPSD 1FFPB 3BIKA 2NY6B 3EO0B 5DJ2B 3V5HB 1QKZH 2R4RH 2LV4A 4BUHA 2C1OB 4R8WH 3ARDC 4BSWA 3CFKB 2QSTA 4YHPA 1P4BL 4EOWL 1U3HA 5L0QC 1C08B 1XR9A 4QOKD 3I9GL 1OP5H 1NGWA 1U3HC 5ANMA 5CEYA 3IDJB 1HN1A 4KAQL 2G60H 5EA0L 1UCBL 3WD5L 1AJ7H 4H5SB 5L2KD 4PRID 3BKJL 3FONA 3MRCA 4MSWB 5T1KD 3M45A 1I9JH 2KDGA 3F5WA 3PL6A 2EDRA 4L8DA 3PL6C 2BVPA 4G42B 1PZ5B 4P48A 5BV7B 4N8CL 3UYOD 5BVPH 2NW3B 2Z31A 4IJ3B 4K2UH 2Z31C 4DGYH 4P5TD 1VHPA 5DT1H 5EC1B 3I85A 2R0ZL 3RU8L 3V0WL 5DJ0B 4KKAD 5EO9B 3T0BA 4GXUM 5I2IA 2WQ8A 4GRWF 5CIPA 4JRXD 1XH3B 2BVOA 2PO6A 4TTDD 4X7SH 2PO6C 2YN5A 3QDJA 4X6CF 4HUKB 1UH2A 2VABB 5D5MA 3L5WB 3LS4L 1I8KA 2ATKB 5AZEH 4KKCC 4M1GH 4QHNA 5C0IB 3FO0H 5C0BA 1DSFH 2R2HB 4P23D 4WU5B 1J1PL 1TVHA 4Y19D 4IRJA 1R0AH 2F74A 4IRJC 3GRWL 2IPTH 5L88H 2Q76A 3MC0A 4WJ5A 5F6IB 1YPZE 2AXHA 5T3XD 2QJDA 2YPVL 4A6YB 5DDHB 4OT1L 5TDPB 5JMOC 3IJHA 4MVBD 5FHBL 1IBGL 3RAJL 4CBPA 3GZKA 5DD0H 1TJGH 2AJSL 3VD5A 5HHOD 3B83A 5K9KB 2JLLA 1YPZB 1MH5A 5EO1A 4D0CB 3IKKA 4P9ML 4FQJH 1ZLUK 3KHOA 2XA8L 2WK2A 2V5TA 5MHSD 3V6OA 4YC2B 4NO0A 3V6OC 1IJ9A 4QRRA 4X0KA 3LZFL 3WXWL 3G08B 1OP3H 3ZYJA 4IOFC 3RVTC 3GSUB 4JJ5B 3ZE1F 4IMLA 1FVDA 1JNLL 2ZWLT 4XBGA 3TFKC 1CDYA 1MREH 1KTLB 4GXUN 4YPGA 3RQ3A 2V9TA 5LAXA 4D0DB 5ESVA 1MRCL 4NRZB 5CHNB 5IUSA 4YIQB 4HC1H 1CIUA 1X4XA 1RUQH 2DB8A 2CXKA 3FT2A 5M94B 4OFPA 5ADPH 4PJ8D 5J1AB 4G6KH 4MS8D 4HUVA 2Z0BA 2B1AH 5I8CA 1DUYB 3X14A 2DQIL 1VFBB 3LRHA 2YKLH 2ZUWA 4YHYC 3MV9A 5HGDA 5HI5C 1J0IA 1FHGA 2J5LC 1AO7A 2FHCA 1OAQL 1KJ2H 3O3DA 3RWJB 5JPMB 2EDEA 3AAZB 3DI2B 3Q5OA 5EU7E 3SKNA 3IDIB 3MODH 5E94B 1ODAA 5DD5L 2IANA 4R2GC 5FA3A 3EHBD 3P9LA 3DHJA 3V4PH 3CU7A 5F1OB 3L7FA 5CJ5A 5DYOB 2VSDA 1NCWH 3CFJA 3OPZH 1OARL 1DDHB 4PRHA 4TPRH 3NGBC 5GGQL 3V4UL 2ZCHH 4YBLB 2A83B 1HSBB 3Q6GL 1ZKAA 2VDKL 2C3HA 2D9QB 4U6XA 4P9HC 3TO2A 3H42L 3VH8A 3HRZA 4JFZL 1NC2D 3G5ZB 4HZAA 5D7SL 1A14L 5EZJA 5TQ0L 3BEVA 4JFQA 5IQ9A 2ZG3A 4NGHH 4M9OA 4XT1C 4PV9B 5CWSA 4KK9C 3EDFA 3T4AB 2DM4A 1Z0MA 4NO3A 3O4OC 1KIPA 3VW3H 4FTVD 4WEUD 1H3GA 4KKLC 1IEBA 5ERWB 1M71A 4O2FA 4XMPL 4AT6B 1IFHL 1WBZB 3PWNA 1MHHA 1D5BA 3RY4A 1DN0A 3QG6B 4XMKH 5C2UB 4OM0H 1RZKL 2X44D 5I71C 43CAA 2HVKB 3S98A 3RI5F 5T1MA 3NCYS 1LE5B 3M8OH 5C70A 2QL1A 1ZGLP 3HR5A 4KJYA 5A16A 3MNWB 4UQ3B 4PJXA 3SJVA 4FQLL 2YA2A 4X9IA 1TQBC 4F7EB 1GZQB 3MLXH 3U30C 1SHMA 1SEQL 2IADB 2F53D 4GRLD 3NA9L 3GHBL 3FO2B 2KL6A 3KGRA 2E3VA 5JHDA 2ATPB 1NBZA 2FEDC 2HLAB 4ERSH 1HHHB 5KSBE 4CNIA 5AUMA 4MCYA 2VL4A 3BPCB 5E8EB 1E28B 2H45A 2FJGB 4J3UA 4I0CC 2E6QA 1NSNH 1XEDA 3MFGB 1RVFH 2GT9B 3QEGL 2J8UA 2NY4D 1MPAL 4ETQA 4R3SB 1PZUB 1CD8A 4OLYL 3RRQA 1G9MH 3MLWL 1YEKH 3FB8A 1GOGA 3OGCB 4NZRL 2RGSA 1T1ZB 1R3JB 1FZOA 3CMOL 3HAEB 1U9KA 3B2UD 3QAZC 5DJXA 3IU4L 1YEIH 4LEXH 3U1SH 3UZEA 1ZEAL 3I2CH 1MIEH 2ESVB 4OSUL 4P2RA 5EBGA 3U9UA 1FG2A 4NKDA 2ORBH 3X3GL 3QIUC 5HYJE 4UT6H 1HYRC 1SBSL 2VJXA 2BSRA 2R2BB 1G7LA 3MRJB 2CXGA 1MIMH 4JM2B 1AD9B 3DX9B 2WBJB 4KKBD 2XRAL 3CSGA 4KZEH 3WV0A 4PREA 3NCYP 2X4TA 2CSPA 3PWUA 3QJFB 4ZUUA 1RMFL 5DVKA 5LWYL 2FX8L 3WYRA 5IVXE 5DK2B 3RGHA 4PRPA 2MTPA 1XCQB 4WI3A 4UMGA 3RVWD 1GSMA 4M6NL 2V2WA 2I24N 3LQMA 3MRIA 3ECBB 1WT5A 1XGPA 4JVWA 1OAYH 3QEUA 4BELD 1FQ9C 4OKVA 1WT5C 3UC0H 2YK1H 4E0RB 2R56L 1BAFL 3ARDD 1NBYA 1GGIL 5J89A 3U79A 2A77H 4HWBL 1ZHLB 4BSVA 5MEND 1F3RB 4J4PA 4J4PC 3UTQB 3C6LC 5HTSA 3KWWA 2AKRA 3BZFB 2Z4QA 3D85A 3VI3E 4PJFF 4PG9B 3SO3C 3O4LE 4XNMB 2ICES 3P4MA 3OG4B 2UWEE 1D9KA 4ZXBD 1RUPL 1D9KC 4UT9L 1E4KA 5HHNB 3IFPA 5E5MB 1E4KC 5C0GA 1EFXB 4Z7NF 1CT8B 1WFNA 4OD3H 4QT5A 4AZ8A 1O5DT 1SJVA 3U7YL 4LKCB 3KPTA 5C07B 3WLWD 4XP4H 3EOTL 2WWMC 3QIBD 5F3HA 2EE3A 3VFSB 5IOPB 5SWSA 1INQB 2R9HC 4Y4FA 1SQ2N 2N1KA 3O0RL 1I9IL 4Y4FC 4XPAL 3EIFA 5EU6D 1EO7A 3PP3K 3CSYA 4MAYA 3VFTA 5IF0B 3DV4B 3FT4A 3VRJB 4EOWH 4MAYC 1BD2E 3I9GH 4N8VA 3AMKA 4P3WA 4KAQH 5EA0H 1UCBH 3WD5H 3QDAA 1PJ9A 4XNZB 1PKQB 2QKIA 3BKJH 5HHQB 1YUHB 1VEOA 3A6BL 2GW5A 5F7MC 3MSPA 4FXKA 4J3OC 3RIAF 4N8CH 1P84K 2UYLB 2BOCB 3QIWB 1H8SA 2ZSWB 4Z5RA 1TVBA 3RU8H 2R0ZH 5E4EB 1IEHA 3G6JE 1CCZA 2BZDA 2PR4H 1OAUH 3DVGA 4XPBL 5DC9B 5I66B 3WKNA 4AQ1B 2UY7A 1LO0L 4F3FB 1MCEA 3BPLB 4U3CA 1KLUA 3FO9B 3CDYA 1CBVL 3DIFA 3SGEI 4NKQB 3LS4H 1BBJA 1DVFD 5DR5L 3CK0L 2ERJC 2Q6WA 3GMLB 4OBSA 1KTDB 1F6FB 2R69H 4I0KA 3LKQA 4YGVB 4ZOBA 1S7TB 4W6YB 4LSRH 1J1PH 1ITBB 5CFHA 1JYNA 4HEME 1N8ZA 4UB0L 4D3CH 2Z35B 1IAOA 3GRWH 4Z76A 3O6FD 4JQIH 2E9JA 2BNRE 3QQ9C 1EO5A 4PB0L 5E00B 2YPVH 3HG1D 4M48L 2Y1VA 1OTSC 4OT1H 4MYWB 1ZT7A 1FNAA 1IBGH 4IS6A 5SX4I 3P0GB 4C55A 3RAJH 4D94A 4OFKA 2X7LB 1A1NB 3MUY1 4RWYH 1GH7A 5J13B 1TTGA 1P9MA 5INDB 2RFXB 2ZOKB 2FZ3B 1P9MC 1ZLVK 1G1YA 1OAKL 2AXFB 4P9MH 2FHFA 3VDAA 5HI5D 4Y2DA 3QXDA 4Y2DC 4JFEE 4XRCA 3K4DA 3RTQB 3V0VA 5EC2A 3GSVB 2X4NA 3LZFH 1MFCL 1MWAL 1URLA 2EDLA 5J6GA 1QA9A 4PIRF 4G8GB 4QXGL 1JNLH 5GSVA 3B4NA 1QBLL 4FP8L 1FNSL 1IGML 1MLCB 4OZGE 5DSCB 1BZQK 1MRCH 3I6GB 1I7RB 3KPRA 1UWXH 1QQDA 3U7AA 5TF0A 1OTUD 4GS7C 4NNYA 4ZNCD 4WHTB 1BJ8A 1NEZA 3EYUH 3SDYL 3N1MC 1YMHB 1WK0A 3PWPE 4EZMA 2DQIH 3H9SD 5B21A 3O6KL 5EULV 5DJYB 2IFGA 4LBEA 1DEEA 1I3GL 3EYVA 4I3GA 3FQTB 1I1FB 1OAQH 5EO0A 3G5VA 4GOSA 4UAOC 3BE1L 1C16B 5FGBA 5I1EL 3OJVC 2D9CA 3PWPB 4S1RH 5DD5H 5A2JH 4EDXA 3BI9X 4IIQA 2RR3A 4GKOA 1NC4D 4NQTA 2XN9B 1OLLA 1WAAE 5J1SC 4MQXC 3KAAA 4Y1AD 4R90L 1FC1A 2VLME 4FRWA 3QO1A 3QO0A 2CPCA 5IMOB 1G9NL 1OARH 3V4UH 2GYSA 5I30L 1JWSA 1OT1A 4L3ED 5GGQH 1NAMB 2KKQA 4J23A 4C4KT 2FB4L 3Q6GH 6FABL 3IXAB 4WNQA 5CGMA 2VDKH 2CR3A 4HIXL 3H42H 3LQZA 4JFZH 4FQXA 3OJDA 4X6DE 5I17A 3GBMH 5D7SH 1A14H 5FA4B 5TQ0H 3MRRB 4NC0B 3WHE0 3EUUA 4Y4HB 2D03L 3LOWA 5DRWA 1MCRA 3WIFA 2WLYA 5GGVY 1J8KA 4N0UE 2CLZA 4NZTL 5DUPL 1EAPB 2FEEL 2PCPA 3MRFA 1FAIL 2DDQL 1QBML 3LAFA 3FHQA 2D7TL 3HI6L 3WIHL 1QEWA 4DZ8B 2I9LA 1RZKH 2UV3A 5CP3A 3IVKA 2F8OA 4MXVF 3L3OA 4JFXB 4NYLA 4N0UB 3OKNB 3H3KA 2IEPA 1RZGB 2F54E 2XWTB 4MHHG 2L7JA 4YWGL 4YHLL 3MNZB 4L29A 1X5FA 1KXTB 4HCRL 1T0NB 5AD0A 4FFZL 2PNDA 3O9WD 4LFHG 1SJHA 1HEZA 3C5SB 3GHBH 1VEMA 3UTZB 1S78C 5K93A 1JF6A 2P5EE 1IAKB 2F54B 1P53A 2V7HA 4N1CA 1AQKL 5TPWL 2BSTA 2Z91A 2OTWB 3P4OA 4PP2B 3QIUD 4KI5E 4KRMB 1EA9C 4JFFA 4S11A 4RFEB 3QEQD 3MBED 3DURB 2HMID 1XIWD 4GQPH 1NUGA 3QEGH 4MA3A 3VXRA 4E9LA 1MPAH 3MPCA 4EIGB 3GB7B 3OXRB 4KDVA 5TDOA 1YEGL 4WGVB 1TZHB 2X4PA 4OLYH 2OI9C 3MLWH 1EBPA 2EH8L 3GIVB 3EYSL 4NZRH 2VIRB 3D2UB 1JNJA 2GQHA 3CMOH 3D0VB 2KH2B 3MV8D 1HH9A 4HIHB 1R3IL 1YQ2A 1K3ZA 3OHXB 1RJLB 3BN3B 3HE6A 2AEIT 5BW7A 3HE6C 1CGVA 5BW7C 1ZEAH 4OSUH 4O9HL 3PWVA 1QD0A 4JN2B 3X3GH 5I19L 3VRIA 3PUCA 3KPNA 1SBSH 4HMDA 3TBTA 5C0AA 4GG6B 1C1EL 3O8XA 4LSSL 3U0TB 3O8XC 5E2WL 4EXKA 5A2KH 4TUOA 4M7ZC 1UZ6E 4PJ9B 2XRAH 2VOTA 2OR7A 4QRUA 1DUZB 5D9SB 5ETUB 1Q9KA 1U6AL 1Z5LA 4EI5B 5LGJB 4LMQE 1RMFH 5DK0B 2FX8H 4WW2B 5KSUA 2OCFD 2BC4B 2FBJL 2YUVA 2YPLB 1U3YA 1HHKA 4M6NH 3WEXB 4K71B 2BMKB 3DYOA 3UTTD 2GIYA 5BO1H 5CKAA 2X41A 2HJFA 4TVSa 4XAWL 2PYFA 1BAFH 2A6DB 4S10A 3MLYL 1GGIH 4PJEF 2X9XA 3L3GB 4PJHB 2BVQB 2D31A 1EGJH 2A0LD 2LFGA 3DX7A 4HWBH 3QHTC 3S97C 2NY2C 2HFFA 3TPKA 4WO4A 4WO4C 1GZPB 5LCVL 2VISB 4ZTPL 4X6CA 4RISL 4GW5B 5IW6B 3QUKB 4GKSB 5KS9E 4DUWA 5F9JB 2BX5A 5F9AC 4NQDE 2AI0H 3Q5TA 3L3JA 1PEWA 3RY6A 3IAPA 4J6RL 1MLBB 2DWEA 3DLQR 3RY6C 4N5EC 5B8CB 3U7YH 4WY7L 1UJTA 4JR9L 3EOTH 4CN6A 3OZ9L 4G6ML 1QFWI 5KS9B 1NANI 4NNXB 4PG2A 2DLEA 1I9IH 4XC1L 4PG2C 4OCNC 3Q5YA 3RGVB 3ES6B 4PJAE 5CSZA 5I1JL 3NAAL 1FGNL 1SMOA 3FAXA 3L9RA 2DQEH 5MEPB 1I7ZB 1QRNE 5HI3D 4S1QL 3EOBB 3KNBB 1RAMA 4NUJB 2H9GA 4KK8D 1JZ8A 4PBXA 4XVUD 1A6PA 1XMWA 3X11B 1VPOL 1J8HA 4OLXL 3WJJA 4UDUA 4YDKL 2YSSB 3CPLA 1QRNB 3WJJC 3QUYD 2YA1A 5JXAL 1EEZB 1BGXL 2BDNL 1LK3L 3QP3A 4IOIB 2X09A 1F90H 4H26A 5I74B 5JQ6L 4CDGC 4LCWD 4MNQD 3IF1A 3BRFA 2XXCB 1LO0H 3GM8A 5MERA 5ID1A 3KPPB 4LF3A 1CBVH 3QFJD 3RWFB 5ISZE 15C8L 3CK0H 2YD8A 1WSST 1JHLL 3B9DA 3MUGA 3DMMB 5DEFA 1Z6JT 3QUMB 4QOKA 4K8RL 3RWGA 4C56A 5KAQF 1H3VA 4HLJA 4JPIA 1MI5A 4JY5L 4UB0H 4N0FA 3O41A 3WFHA 4IRZH 4N0YL 4N0CD 1IKFL 4PB0H 4M48H 1GGUA 1CLZL 5I73C 3VFOA 1KLFA 2P47B 4YHIB 3MV7A 2NY3B 1CE1L 2GK2A 2X40A 2APXA 1OVZA 1IM3A 5HGAA 3FFCE 4PBVC 3ULVL 4ZAKB 3VE0A 1ZT4B 5FYKE 4JQXA 4NIKB 1JK8A 3GMQA 4NJ9L 4OIIH 4JQXC 5HXMA 1WFUA 5I76B 4MAUL 2AJYL 5J6HB 3TZVD 4G5ZL 1MCJA 3FFCB 1AKJD 5IGXH 4HK0A 3SEPA 4RGND 1J88A 1UM6H 3EYQC 5CEZE 4QXGH 3PABB 3VXPA 1QBLH 1ORSA 4FP8H 4F37K 1FNSH 5I1LB 2YEZA 3JVGA 1IGMH 2HLFC 3PWLB 5HBBA 4TSBL 4V2BA 2QHRL 4NRXB 5ICYA 7CGTA 5ICXA 1IC7L 3K81A 1T1YA 1REIA 2R29H 2Y25A 5KAQG 1KC5H 1OCWH 3GDBA 3SDYH 4JREC 2NY0B 4QHLB 2EYTB 4MCZB 4HLZG 4CMMB 2GUOB 4Z78A 1IC4L 2QQQA 3O6KH 2RQ8A 1I3GH 5FOBA 5C3LD 2D7OA 4UU9B 3SE8H 4NFCA 3BE1H 1JJUA 5JNYA 1RZIB 3DUUB 3MRGB 4TUJA 5IBTL 1ZHNB 1YY9D 1XF2A 1VACA 4HUXB 1RHHA 3B5GA 3IDYB 3TA3A 5HHMD 4LLUB 3DETC 2IG2L 3R0MA 3ARTA 5I1KH 2YXMA 4C83B 2CIKA 3I02A 1G9NH 5I30H 2BJML 4AMKH 3K74B 5BQ7A 4NBYB 3GMNA 2FB4H 6FABH 3NIFE 1WZLA 3FOMA 3NCFB 1GC1L 4G9DA 1N64L 3K8LA 5CBAA 2VRAA 4ZPVA 4HIXH 4PBWD 3HMXL 3HZKA 3MUJA 2YWYA 5C0FA 4X8JA 3FCTA 3MA7A 4WI9A 1YMMA 3RWCA 3VFWB 1DFBH 1R5VB 3C5ZB 3AROA 2D03H 2CLRB 3VXSE 3RWIA 1QFWM 1T5WA 3SCMA 4X7TA 3SCMC 3ZKXC 1V5JA 3MOAL 4NZTH 5DUPH 3J7HA 3GJFH 1FAIH 1P4LB 5F1IB 4R4FL 1QBMH 3K2MC 2D7TH 3HI6H 3WIHH 3VFRA 1S9VA 3L5HA 4XP6L 5EWIL 5C9JA 2IAMC 3HCVB 4QGTA 1I3UA 5F72S 3MACL 4HKXB 1KCLA 4U6YB 2I25N 3QG7H 4NSKA 2FECL 2H32B 4YHLH 5CAYB 2FJHA 3O45B 4YR6B 4ENEC 4WFGE