4R3SA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with msp2 11-23
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FV FRAGMENT(MAB6D8) HEAVY CHAIN
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r3sA00
1DQJA 3RUGE 1E4JA 3H9SA 3QPQC 1A1NA 3ARBB 2AJUH 5DFVC 1L4IA 4P2RE 5K59E 5F6IC 2HA1A 2EDDA 2YD4A 3QZWG 2MHAA 2C7UA 1AQDA 1RZ8B 3V9FA 3KXFE 2BFVL 1TZHA 1AGDB 4PRNA 5GQBA 2IBGA 3TBYA 4LAQH 1TITA 3E2HC 2ERJB 2ZUXA 3E6HA 4FABL 4RMTA 4U6VH 5GHWH 5KAQG 4NCC1 4CJ1A 3CVHA 4PR5A 1A9BB 4X8JB 5LBSH 4MA1C 4L1DA 2FYYA 5HPOA 1VACB 4FP8L 1VFAA 3U82B 1G0XA 3TZVB 1H5BB 4N8VA 1HEZA 2R2HB 2IBZX 1FBIH 3C5ZC 5D8JL 4CNIB 2IMMA 1OAKH 2AXFB 4LSQH 1HHGA 3DV6B 3T09A 5DGQA 2M2DA 1S9YB 4WW1A 5DJYB 1S78D 2C1OB 1N4XH 4P5MB 4GW1A 1YUHA 3SKNB 4TTDD 4U1LA 1AHWC 3O6ML 1CL7H 1RJZB 1CI5A 2R0WL 1GOHA 1RZFH 1AY1H 3T08A 4H1LB 2MFNA 2AI0H 3SCMC 1ADQH 1INEH 1RU9L 4HX1A 4RAHA 3SBWC 3WO4C 1DTUA 4C56B 3LOWA 3CFDB 5F7MC 3Q6FA 1J88A 4HS8L 3QUZC 3STLB 3VJ6A 5D7LB 4WU7B 4K71B 4PJGE 4R96A 1PJ9A 5JMRA 5IHUL 1Z3GL 2DQEH 5CP7B 4LLQA 4JAMB 1XH3A 3ARGC 3SDAC 1LEGA 2PW1B 2BVUA 1PKOA 3OAYK 4JFHD 1XF4A 1AO7A 4LPTA 1K6QH 1NEUA 1Y6KR 1ZT4B 4GOSA 1E6OH 4NCDA 4OM0L 3AVEA 1JMZA 3DSFL 4P5TC 4U0RC 4X9IA 3SE8H 2CSPA 4PJ7B 3O9WD 1W0VB 4OF0A 4P2QD 4JREC 4NWUL 4XP6L 4U3CA 4XPAH 4AM0B 3ZKND 3MBEC 4JLRB 3VXMB 3MRGB 1SM3H 1R3LB 1S7VA 2CKBA 4OFVA 4HUVB 4M62H 3E6FA 4IDJH 3SQOL 3AM8C 4P59H 1FFNB 3BWUC 3F5WA 1UT9A 2F54A 5AYUH 4MAUH 3Q48A 2DI7A 1G7QB 3JV4B 3EDEA 3BT2H 2P7TA 1ROWA 4Y2DB 1NSNH 1KCLA 2AV1B 4NYLA 4MD4A 4XCCL 3RL1B 3DX9A 3OKNA 4WHTA 1X9QA 5EU7E 3X11A 1JGUH 3P77A 4JFDA 3UTTA 4GAGL 1KLFA 4Y16B 3JVGC 4PRAB 4DZBA 2VLLA 4I3GA 1CLYL 2ID5A 1R3JB 3CFJB 5K9JH 5EIVA 5FUCE 4NZJA 2BNRD 1FNFA 2BERA 4QTIL 1YQVL 2GJ6E 5GS1B 1PX3A 2VAJA 4D94A 3D2UD 3V5DB 3ZKSD 4JPWL 4RAVA 2YA2A 4JHAL 3D48R 3M07A 1A3LL 2V6HA 5DT1H 1VA9A 2NY2D 2VR5A 3GSOB 4XNMA 5C07B 4MXQC 1UH4A 5I1GH 3DIFA 3IB4A 4FQ2L 4F8QA 4BQ9A 4PJXE 2ITDA 2Y5EA 3KNBA 3RDTB 3N1PC 1IARB 4LHUD 3VW3L 4JFFB 4XCNB 3K1DA 4MSWB 5FUOL 1HHKA 4PJCB 2XZCH 3QDHA 4X7CC 5I74C 1MFNA 4N0CC 4RX4D 5FO9A 4BQBA 1WV7T 4ODWB 2AAVA 4Q6YA 5HTSA 5F70A 4GAJH 5IVZB 5EC1B 3GDBA 2D7NA 4XP9H 4ZXBA 1I8MB 4GUPB 4M1GL 3HUJE 3RQ3A 1VDGA 5DJ6A 2P5EE 5KTEH 4HIHB 2NY3B 3LHPH 4TQEL 4NQCD 3S37X 3RHWK 5C0RL 1XF2B 1T04A 2DJ4A 3L7EB 5SX5K 1LILA 4I2XE 3V5KB 1IGYB 5GRZA 5TJWK 3TT1L 3OF6A 4YHPA 5BV7B 3RKDC 3TBTB 5JW5B 3RGVA 3BN3B 3JV0A 5E5MA 4X98A 4XPHL 1ZHBA 3MRBA 1KPRA 3WXVL 3ZTJG 3QI9B 3VFTB 3BJLA 3JZ7A 5T5NF 4HUNB 1I9JH 3HG1A 5B4MD 4ZPVA 5BQ7B 1LMKA 5DMJB 1YN6A 2EDKA 2W60A 3L3OA 4HUXB 4M6MH 1NEZB 4WWKD 1EJ6A 2X4OB 3Q6GH 1NCBL 3KR3L 1MCKA 4OAWA 1NH6A 1YMME 3KJ4B 3UROR 3SKJH 2D0HA 4HGKC 4NFCA 5DHVB 5B8CB 1G7PB 5IGXH 4JY4B 3LZFL 3RZCC 3OZ9H 5JZ7D 1P5VA 2GTWB 2VC2H 4PJAF 1BD2B 4Z77A 1N6QH 1IAKB 3E8UL 4HCRA 1WBZA 3MLRL 4DQOL 5IF0B 1XF1A 1DQTA 3I84A 3O2DH 2XQYK 3IT8D 4ODHH 2D03L 3ZSTA 3GHBH 2NY6D 3HE6A 5AZEL 1EO5A 1HQ4B 3IAPA 4KQ3H 1BVKB 5EU7C 4Y4HB 4ELKB 3MCKB 1GPOH 2YZ1A 3MO1A 3KS0H 4YHLH 4NQDA 4WI3A 2X89A 4HFWB 1INQA 2F53D 3PF2A 3DI2B 2J6EA 1M05A 1FFOA 1HNGA 3VFNB 1KJ2L 4R6UA 3BISA 2QBWA 5FUCC 3LKPA 2NXYC 2V2XB 5IVXB 3MYJA 4KKBC 2NR6C 4ZUUB 1LK3L 4WJ5A 4Y5VC 4WI6A 1QHOA 1CFVL 2PNDA 3RX7A 5F96L 1MFEL 4B5EA 3DNKA 3BJ91 3LSOB 4CRPA 4EJ1C 4OLVH 1I1AB 4QRUB 2BX5A 4P4RA 3HZVA 2XZQL 4PG9A 1IKNA 3D25B 3QIWC 2X1QA 5A16A 5BVJA 5J7CC 4M6AA 4RAUA 2ZUTA 4D2NA 5I8KL 4J1UA 4OIIL 1QSFA 4AEIL 4LPVA 5D9SB 3QUYD 4IM8A 1Q0YL 4OI9A 5CIPA 2X1OA 2VLJA 3W82A 1I1YB 3MREA 2HLFC 1F42A 4D0CB 2E7BA 3U7WL 4DGVL 5J3HD 1BFVL 3SJVE 4D8PA 5KG9A 3BKCH 1EHXA 3CX5J 3GMQA 1KELH 2DQUH 3B5HA 4RRPG 3TO4D 1KEML 1OWWA 4D3CL 2A6JA 3UDWC 3BPNC 2OQJA 3TWCH 3P4OA 1F8TL 3BH9B 3MOQA 4H8WL 4K94H 5L7XH 2AEQL 4M7LL 2A1WH 5DR5H 4NBZB 4Y4FD 5DI8B 5FDWB 4GKOA 4HWNA 4G9FB 5CSZB 3KPQB 3B6SA 4HS3B 4HBCL 1S7QA 4OM1H 4OGAD 4KI5D 4QY8B 5KBNC 4RGOL 3G08A 3NA9H 4HV8A 4PJ8D 3SPVB 1YMHA 2DQJH 4U7MA 3WEXA 5L88H 3GGWA 4DFHA 2CXGA 5FGCB 2O5YL 2R9HD 2J8OA 2ZCKH 4PJ9C 5FOBA 4KK8D 5IKCA 2CIIB 1JFQL 3D0VB 4JRYD 1QUNA 3ZYIA 4TNWF 5F7EH 3U0PB 3PDOA 2XN9D 2B0SH 5L2KB 2WIIB 2VXSL 4OD2B 1F6AA 3O4LD 4PRID 4IMKA 3EOBB 1P2CA 3B8YA 1EFXD 3ZHLA 3WKML 1KTDB 4E41A 1OP5H 4NKIL 1JRHI 1LDSA 1XEDA 3IFNH 4JO3H 4BFIB 4CGTA 5BXFB 2IPKB 3DUHA 2NY1B 3T0EE 3FQXB 4GG8B 4TTGA 5DJ8A 3AAZB 4KPHL 5DJAA 1KEGH 1E4WL 4XC1L 4K55A 2CO7B 1WFTA 3ZDZF 4MJ5A 2AJVL 1NFDE 3ISWA 4PJAA 3UC0H 5D7IE 4NRYB 2OZ4H 4MJIE 4KJYB 1AGFA 3QDGA 1TQCB 2DQFA 1A4JA 3RL2A 2IADA 5IB1B 4Q0XH 4NZUH 3L3KA 3D85D 4XNZC 1DBKH 3QQ9D 1V3LA 4P4KD 5DUBB 3G5YB 4L3EE 3GUTA 1I8LA 4JE4B 4J2XA 4H88H 3D3VA 3WYRA 2FHCA 3H2WA 1U8QB 3FOLB 5LGJA 5GGSY 3HRPA 5LBSL 5CILH 5BZDA 2B4CC 1Y18B 2FJFA 1QFOA 1UWGL 1IGCH 1FG2B 4B53A 1QHPA 1UVQB 3MJ6A 3KLSA 3H9ZA 1F5WA 1F3JA 3MRNB 1OAKL 3FT2B 3MUGA 3Q5TA 4JDTH 1CT8B 3W2DH 4MVBC 4OI7A 1U3HB 1U92A 4YWGL 4CVZA 2A6IA 3UP1A 1AY1L 3DI3B 2D3VA 5K33A 3MRQA 1KB9J 1MWAB 3MR9B 4PP2A 4MNHB 5SWSA 3GSUA 4HUMB 1JV5B 2X9XA 4X80H 5FK9B 5IIEB 4RGND 1Q38A 1FLRL 2FX9L 3HRZB 2BJML 2OI9C 5FM8A 2OP4H 3H3BC 5EFIB 3IJYB 5EZLB 4XHQA 4KGJA 3IVKB 1K6QL 4X9HA 2R0KL 2B5IB 3QIBA 4G6FD 4JCLA 3QXDB 3HAEG 2BVPA 4I13B 1Y6MR 3U1SL 2ICEB 5D6CA 3TBSA 4XPAL 2W91A 1WIPA 3BGFB 5DD5L 5HVGB 5F7LB 5DEGA 3FB8B 1D9KC 4P59L 5AYUL 4MAUL 4NRXB 4ODXB 4LIQH 1P4IL 1IT9H 1MCRA 3DO7B 1K2DB 4GRMA 1M7XA 4OD3H 3V6ZB 3VXUA 5HHQA 5GISL 4Y5YA 3DXAE 4NKOA 5C09E 3T0EC 4GRLC 3SDYL 3BX7C 3HR6A 1CDHA 4HZLA 4OTXL 1AQKL 4JY5H 1Q94B 2AJ3B 4CADB 3I50L 1FYTA 3VXSA 4YFDB 15C8H 1PYWB 4K3GA 3LEYH 3RWCB 5A40E 3MFFB 3KYAA 5K9JL 4LK4A 5LQBL 3TBVA 4ZAKA 3PP3K 1XGYL 4K23H 5BRZA 3MLVL 5CBEB 4O2FB 5HDBE 2X4QB 3S36X 3U83A 3HE7A 5I1GL 3S37H 1U8PB 3WIHL 3G5XB 1CWVA 1KUMA 4JHWH 1JNHA 1ORSB 2Y06H 4MD5A 1H3GA 3SDCB 4EUPB 4GXVH 5FV1L 4ODTH 3DURA 4OCWL 1RHFA 4UAOC 2XZCL 4Y5XA 5IMKB 3NN8A 3HMWL 3DROA 3MLWH 4M6OL 5HGHA 5HSFA 5F7DA 5IOPA 4XAWL 5IMMA 1EFQA 2V9RA 4OCSL 3CSYB 3KPMA 4WY7H 2CDGA 5ID1A 3PGDA 1WCQA 3QCTL 3TF7C 4HT1H 4PLKD 4GRLD 5C9JA 5DDHB 4JKWA 1J05A 1WBXA 3QO1B 2DL2A 2G75B 4WI7A 2J4WL 5DRZA 4XH2A 4LPYA 1JPSL 1FCGA 4L8DA 3QBTB 1BQLH 5E9DA 5AZ2L 4ODSH 2F8OA 2EEDA 4EBQL 5I1AA 2FLRT 3D6GA 5I1HH 1RVFL 3FQTA 4NM4L 2IMNA 3BH8A 2UUDK 3SHSA 3GO1H 4WU5A 4ZSOB 1U8IB 5EOQH 2QSQA 5JDSA 1OP3H 4JVPA 1YEDA 5DLMH 5KANG 5IW1B 4KAQH 1GC1L 4IRSD 4BK4A 3QP3A 1CFNA 3B5GA 1MJUH 4P2OB 3KS0J 2ERJC 1BECA 4U6YB 3C08H 5I19L 5C0CD 4YXLL 3NCJH 4S1DD 4GO6B 4OZHF 3QNXA 4CUCA 2C1PA 1I85C 1YEKL 4PBVC 4JFFE 3O41A 1OSPL 4X0KA 1EA9C 1MRFH 2YA0A 4OV6F 1NCWL 2MTPA 5AAWA 2VC2L 4DVBA 4OB5H 5KVGL 5HDQH 4DUXA 3ZT7A 1FZKB 5DEFA 3NA4A 4LMQE 2NY7L 4RDQG 2HT4C 4JM4H 4PBWD 1MCWM 1SYSB 1PQZA 4JKMA 1HSAB 1DQJB 3SE3A 1A7NH 5IB3B 1ETZB 1N7MH 4G43B 2ESVD 5F97E 4QLRA 3ARBD 3QEHA 4TUOA 4PLNC 2VLKA 4UT7L 5GS0C 5C86A 2ED9A 2EECA 1LE5B 4K71C 2XQBH 3VFVB 4U6TA 3VMOA 3RWEB 4LCWA 3IXAA 1K3ZA 3KPLA 1HIML 3IKCA 3QAZB 5E0QA 1JZ4A 1NLBH 2CK2A 3CVHB 4M93B 4Y4KB 1HI6B 3FFCA 1LO4H 4KU1A 5FCSH 4PUBH 1WZMA 3C6SA 3OX8A 5IFAL 4AMKH 4JO2H 4RIRA 4P9ML 5KSAB 1HEZB 4OJFL 3T3MF 3TZVD 1VSCA 5E2JA 2CK0L 1VFOA 2AXGA 3VFWB 3PWJB 1RURH 3QUXB 5ITBL 1UZ6E 3K8MA 4U6HB 1ZHNB 5I15H 1JNLH 4NOBA 2IG2L 4LSDA 3TFKC 4YIQA 3V4VH 4Z7WE 4Y2DC 5GGRA 5IHZB 5KSBF 3DLQR 3GJFH 4UBDD 3UPRA 5FDYA 1A5FH 1T20A 3F65A 3BW9B 3W0WE 4HX1B 5TE7L 1DJSA 4FQCH 4PS4L 3UMTA 4KK6C 3GSQA 2ZCLH 3WNLA 5F9WB 1PG7X 3Q6FB 1G9EA 3GRWH 1S5HB 3VJ6B 1BVZA 1FPTH 5F72S 3U4AA 1T80A 1KF9B 5D7LD 1OPGL 4NUJA 1JL8A 3M1BA 3S3SA 5A2FA 2FGWL 2HFGH 5BZWB 3A6OA 4MDIA 2NW2B 2XNAB 1IEBA 5DMIH 2IPUK 4N0FA 1A6ZA 3CVIL 4JN1L 3TJEH 4XWGH 2OTUA 3QEQD 4MD0A 3WL9A 4X5LA 5E8OB 1VKXA 1VHPA 3UZEA 1NGPH 1JYNA 5I76A 1F3DH 1KCUH 3VXQA 1UM6L 3VXMD 3R0MA 1QOKA 4G6JL 1A6TA 5CINH 3F5WB 2F54B 3B8SA 4S2SB 3KPOB 3VI3E 5EU5A 2V2TA 5E2TH 1MHHA 4OFYD 2P7TB 4LSUH 3MRFB 3RTQA 4HWBL 4NYLB 3V0WH 1IFHL 2FZ3B 4Y2DD 4HWZA 1ZGLA 4F7CA 5E2WH 1TZIA 4WO4D 3WFBH 3PHQB 4HF5H 4TVPE 4PREA 2ZNXA 4JO3L 3VU2A 3H9HB 3QDME 4JFQB 3UTTB 4OZHA 4BSJA 4C58B 2NY0B 3WFEH 5D70H 3LN9A 4RQQB 3P11H 2DKUA 3HPJB 3P4NA 1ZLUK 1JRHL 4Y16D 3KPNB 4ZO9A 5BV7C 4GT7A 2PW2B 2Z93A 1DQML 3S35X 4K3EH 1OGAD 1WQVT 2OMBA 5DQ9A 2EDLA 1X7QA 2OZ4L 3NIGE 3OJDA 5FB8A 4OSUH 2VLRD 5D2NE 1JCKA 3QI9C 2HYMA 2QADC 3O2DA 2VXUL 2P5WB 4G9FE 3QUML 2F8VA 1Z9LA 1R6VA 1W0WA 2F5AH 1P84K 1DBKL 4M8VA 1FORH 1N5AB 1LP9F 1OF2B 4O02H 5F21B 4QTHB 1QRNA 4H88L 3UYOD 4I0KA 2Q6WA 3RDTD 5E6ID 1QLFB 2EH8L 5IBTL 5FGCE 3RIFK 1H3WM 3V6BR 3MRKB 5B8CC 2P8PA 1ZANH 4MQ7B 5C0NC 1AC0A 1D5XB 5L2KE 5BS0E 4X7FC 3QCVL 2BDNH 2JJTA 2DQDL 4P46A 3IJSA 3HS0B 2I26N 2AKRA 3LN5A 2NY3D 2ED8A 3JWNC 4XAKE 3H6JA 4J8RA 4N1HB 3U0WH 3EFFA 1GL4B 2EH7H 4Y4HC 4YHPB 4PRPD 3BP6A 3T1WA 1R24B 2ZUQC 4HIIB 1RIVH 1EHLL 2Z31D 4GBXB 3QUKA 5D7JB 4FQJL 3MTRA 3UBXB 3PP4H 1DEDA 3MRBB 2XA3A 3MRIA 3T0XA 3FQNB 3HG1B 1L7IL 4N8PA 4JFZL 1CBVL 4GLRI 2EYRA 4JM2D 4S10A 3BYYA 2WWKT 1T03L 3L3OB 5KSBA 4GAFB 4Z76B 2VDLH 4MNGA 2OP4L 2PO6A 3KPRA 1TVHB 5IW6B 3QXAA 4ODVL 1A7OL 1FFRA 1VGEH 4KRMB 4OAWB 4F58L 1G6RH 1I1AC 5EZOH 4JHZA 2V17H 3VRLE 2H3NB 4QXGH 1DQLH 3STBA 4X6EA 3CXDL 1U2CA 2HJFB 3ZKXB 4OCRL 4KVCH 4MA3B 4MS8D 3H7BA 1BD2D 3EYQD 3ZE1F 2B1HL 1NAKH 1G9MC 2VDQL 1CR9L 3PWPB 2OR9L 3E1F1 1SJXA 4XPTH 1UWXH 1QA9B 3HE6B 2JELH 2VDOH 1G9NC 3LN4A 4AY0A 2DN7A 2LE9A 3K74B 3S36H 4OD3L 4CVXA 5JW4N 4EI5A 2DMBA 4OD1L 5EOTB 5T3ZD 2CDEB 3B2UD 3KPTA 1INQB 4OKVA 4M7KL 5EH1A 2A2QT 2ATPA 4KUZH 4U1JA 4G8GD 1FNEB 2CQVA 4HWBA 4YHNB 2L7UA 2Y07H 2LVEA 2R0ZL 3LEXB 5GRUH 1NAML 2ZJSH 4G5ZL 2WUCH 4HAGA 4OQ1A 1MFCH 1T83A 1V8HA 4F7MB 4QCIB 3JXAA 2L4OA 2OK0H 4PG9B 1ZV5A 4JHWL 3VWKB 4J3SA 1WT5C 2HT2C 1MFDH 4R4NC 4NN6C 4ODTL 2OZ4A 1YEIH 4RCAA 4XVSL 5CZVH 3OKDA 4H26B 1UJ3A 2VLJB 2GK0A 4RZCB 2A9NL 1GZPB 3NFNB 3QUMA 1ND0A 1WFUA 3ZTNH 5GXBB 1LP9A 4JZJC 1P7QD 1ZS8A 4LHJB 3OKMB 4OLUL 4D8PB 4APQA 4S11A 3GMQB 3OKEA 3RBGA 2NY1C 1KJ3L 3NCYS 4CN1A 1QSVA 32C2A 3BKYL 4PRDA 3RFZC 4C83A 3VD5A 5DYOA 4NO5A 5IEKB 4IOIA 4MJ6A 5HHOB 3CDGA 1IKFH 1BQLL 1J1OL 4NO2B 2AV7B 5ISZD 3VG9B 4NZTH 4X7DC 5IESL 4KROB 4PGJA 3ULVL 1TQCC 3GMPB 3MRMB 3BAEL 1LD9A 2F58H 4YBQD 4GXUN 5M94B 5F9JB 5EOQL 4KHTL 4ODBD 4B0MM 2XXCB 5EIQA 3RWJB 3QEGH 3X12B 3HN3A 3EO1B 1T66C 3WEXB 2EKJA 1DUZB 1ZLSH 1BHGA 3TH2T 3VWJC 1MVUB 2NX5D 4PJHF 1FE8L 4DCQA 1L0XA 4ZTPH 5FKPB 3NCJL 3NZ8B 3L5XH 3NMEA 4LLYA 4I48B 1HXMB 3VDAA 3LV3A 3BIAX 2WBJB 4LSSH 4G80B 3MACL 2EDTA 4IOSD 1IC4H 4UIKL 4XVUD 1OSZA 2DWEA 4Z5RA 5F1KC 1A0QH 1J9CT 3I75B 4OB5L 1R3KA 2FATL 3G6JE 3KJ6H 2R4RH 4M61B 3ALXA 4NNPL 1EO8L 3L3JB 3ZTJH 5IJKA 3P3YA 3AGVA 1J0JA 2WW8A 5JPMA 1CD8A 3O0RL 3MFGB 3VXTA 4WFFE 1E4KA 1U3HC 3FONA 5J13C 1CFSB 1BP3B 1ZHLB 4WDIA 4PJ5E 3PDGA 4TSAL 5CUSL 2X1XR 3GBNH 3OMZA 1UZ8A 3CX2A 3IF1B 4OGYH 1MJ8L 3B2VL 2XQYG 2DQFB 3F7YB 1A4JB 3IFPA 4FTVD 1S7UB 5T5FL 4GG6B 4R7DB 2XY2A 4NWTL 1OAUH 4K7FB 2KH2B 1A7PL 2QQQA 2Q7YA 4HSQA 4TUJA 3ZHDA 2YMXL 5C0BE 5B39A 4NQVB 3O2VH 4KRPB 5KS9B 4PB9L 4PJEE 4UUJA 3OHXB 4X5WA 4V2CB 4YZFF 1KB9K 1PLGL 3OR7B 2BOBA 1NLBL 2B5IC 2J8HA 3D39E 3GMLB 1FNSH 1PG7H 3INUH 1KJ2B 4LSTH 4HW6A 1U91A 4N0YH 1KNOB 3C6LB 4XWOD 1T89C 4N0UE 3BGFC 3SKUD 4GW4B 4KY1H 1M71A 4N90E 1MJ7L 1UCBH 1NJ9A 1AJ7L 4QGYA 5HI5C 5CJXC 4WGWB 1MRCL 2IBBA 2H8PA 4PTTA 1NBZA 3ARZA 3MRJA 2JLLA 2O5XH 3EOTH 2E8ZA 4CVZB 1X5ZA 3JUYA 1BBDH 1F3DJ 5GGVL 4YR6A 4Z7VE 5C70A 5MEPA 3ABZA 2GFBA 3VFOB 2VQ1B 1BFTA 4LASH 1CDCA 4GKZA 3T0DA 3BUTA 1OGTA 2EYSB 3GSUB 3T0VA 2OS7A 1V7MH 5ADPH 1A47A 4IRZH 2ZCLL 3PWLA 2EC8A 1FPTL 1T5WB 2IAMA 5TGBB 2ZUVA 2E6PA 5J6HA 1A7QH 2H26B 1RUKL 4C4KO 4EUPG 1U8HA 4DEPC 5JOPD 2ZG1A 4ZFOL 2NMSA 1HH6B 1AI1H 2CIKA 3GMNA 4UDUA 2EC9U 4L3CA 1LK2A 5KZCB 1LO3H 5H35A 3VFSB 1KJVB 3MQIA 3QO0B 4EI6A 2FSEA 3HTLX 3ARVA 5C08B 2LU7A 5FGBC 3S35H 2WAHA 5DO2C 3G5ZA 2F15A 3K4ZA 2N7AA 5DD6B 4QF1A 5DEGB 5CINL 1K4DA 4EVNA 1R0AH 4QHUA 2UYLB 1DVFB 1A6WH 2CLZA 5BS0D 1YY9D 3K2UH 3VXUB 1F2XK 3BGMA 2R2EB 3WLWC 4CMHB 4Y5YB 4I0PC 5C0AA 5E2WL 2DQHH 1AGCA 3IS0X 2UZIH 5CEZD 4LVHB 2PYFA 5EZIL 2YPLE 3C5SB 1KB5L 1AC6A 3WFEL 4HUWA 2WQRA 3VDBA 1KIPA 1KC5L 4HWEH 3GSWA 4O4YH 3PJSA 1JPGA 2YD7A 5TQ2H 3NFPA 5JQ6H 4HAFA 4M43L 2XKNA 3BZ4B 1SJVA 1NCUA 1GAFL 4ZMAT 4R8WH 1TETL 2NTSP 5T3XL 4LCUB 2V2WA 5I9QC 4I0CC 3T2NH 3CCHB 4ZAKB 2QR0A 4K8RD 5CGMA 2JJSC 3QCUL 4NBYB 2X4UA 1OARH 3VI4F 1TZGL 2DBLH 4DN3H 4GKSA 4P2OC 1JNHB 1RUQL 1EV2E 1NKOA 3GJEA 1S3KL 4WFGD 3W11C 1T4KA 1K85A 5EN2A 3SDCD 5GRXG 1F2QA 5GGUA 5I6XB 3T2OA 2BRRH 5T1KB 4U2YA 1M6OB 3WE6A 1FL6A 1YNTB 1A1MA 3FN0H 4KVNH 1EK3A 1DBBH 4NO3A 1U42A 1JGDA 4A6YB 4OZIB 3OJ2C 3O6LL 3MXWH 3WLWD 3A6BH 4LARH 7FABH 2BDNL 4YHZH 4QO1A 1IVLA 3RPIA 5J57B 2PCPB 4KKLC 2ADJB 1UB5A 5MENB 4UQ2B 1IAII 4O2CA 1X4YA 3VGEA 4YDIH 5I1AB 1FVEB 5AYQA 5EUOF 3FQTB 2X41A 4U3XA 4Q97A 1GGIH 1FL5B 1KCVH 3QIUD 4ORGA 4HJJH 1QLRB 5D72H 5C0JA 3BEVB 4BSVA 4XP5L 3BZFB 1RZJC 2P5WE 3SGKA 5GGQH 5K9KA 1UKQA 4POZD 3GJFA 5E8EB 2IWGA 5KN5A 2D0GA 3TCLB 3VRJA 1PZUB 3U36A 3S3PA 1XF3A 1NC4A 4CW1A 4AH2A 4HJ0C 4M93C 1Z6JT 3K4AA 3N06B 4Y4KC 1GVIA 1RMFH 5EZOL 5EB9A 3G9AB 1ORQB 1DQLL 3ARSA 5IWLA 1S9VB 1SVCP 3O4OB 4ZFFA 5KSAC 1BJ1H 2R1XA 3IRZA 4OFDA 4S1QH 1GZQB 4X4YA 1X5AA 4YDLB 3U9PL 1WLHA 3QUXC 4IOFD 3HR5A 2DTMH 2Q87A 3CGTA 5C0DA 4BJLA 4YHYC 5I1IL 4V1DA 3FTGA 3BE1L 3U4EB 5GSVA 1MELA 2CLRA 3O45A 4X9BA 3DGGA 8CGTA 3SGJC 5E4IA 5HI4C 4ISVA 1BFOB 3HMXL 3SOBL 3HAEH 4QHLB 2I9LA 4MNQA 3GSVA 1VERA 4XPFL 1A7BA 1A2YA 3GMMA 2UZXB 2HKFH 3IXAB 1NANH 3AXLB 2WBWB 3J8F7 4K3JL 3IDYB 2DQCH 1C7SA 1G1CA 4XCFH 2ZJSL 2YRLA 3BOVA 4TYUA 1WEJL 4HLJA 5K59F 2AXHA 1BQHA 4LBEB 1MY7A 4O51B 1Q72L 3WDIA 5C0FB 5JHLH 1MCBA 4PP1D 4H20H 3K2MC 4RGMB 3VCLA 4U1MB 1OVZA 2G2RA 3FB7A 4WV1B 4LLMB 1MFDL 5CKGA 3SE9L 1T3FB 2M26A 3IDGB 3SGEH 3QH3A 5DUPH 1J5OL 3MMEA 1YEFH 3QNZB 2FX8H 2D31B 4WNQB 3K80A 1U6AH 5EOCJ 3LB6D 3EOAA 4XVTH 4LVNC 3UYRL 3ZYOA 2VLME 1OHQA 5I17B 1YEEL 4FQ1L 3UTPE 3VFRB 4HDIA 4CU6A 1WIOA 4JDVB 2PTUA 2NY0C 3X3GH 5MEOA 5C92A 1UQSA 5I0DA 3C5JA 2BVTA 3RA7H 4OZFG 4U1KA 4K7PL 2X42A 3QQ3A 3M1BB 2FDBP 4P23B 3MRPB 3ZT6A 5F7KC 3FQRA 4GKNB 1A6ZB 3OTTA 5ANMA 2FGZA 1B0RB 2I07B 5JORB 5HJ3A 1VKXB 1TDQA 4W6WB 3BEWB 1F00I 1I9IL 3IDUA 5EOCL 4YX2H 5BJTA 1CGSH 2GJZB 1KPVA 2EDWA 4PTUB 3WS3A 1ZLSL 2NY5C 1OAQL 4ZTPL 4HC1L 2PF6A 5DQJB 5EUOA 1HDMA 3MV7B 5CSBA 3QWQB 2RHEA 2F54D 5IK3B 1AHWA 1F90H 2J12B 4YHKL 3QSKB 5I1DB 1IC4L 1SEBA 5MP6L 2VIRA 5F88B 3CFBA 3UBXG 3V8OA 2YXMA 4P5KA 4RMWA 5KANI 4XXDB 3SBWA 1NMBL 4OZ4B 4JZOB 4LL9A 2X1PA 1P1ZA 2DDQH 4XNXL 3QUZA 1PZ5A 5C0EA 4LLDA 4HIEA 4XGZA 5E6YA 3UTTD 5FYJD 1G6RA 4JVWA 3P4NB 4WVRA 5EUKB 2HJKA 4JDZA 3I02A 1WWWX 4O2EA 3ARGA 3W9EB 1KTLA 3SDAA 1HKLH 5J4MA 1B0GB 5IQ9A 3FRUA 4JZNB 5D7JC 1X7QB 4JPIB 4Z8FH 3RJDA 2FR4A 1T2XA 3QDJA 5F1IA 4PV8A 3L5JA 4P5TA 5DMKA 1A4KB 1AXSA 3Q5OA 5I66A 2BVQA 4TNVK 1V3JA 4BELD 1BF8A 5LG1A 2ZCHH 4H1LH 3S96A 5HVHB 5DTFB 2FECI 3MBEA 4PJFE 5KOVC 4LHUA 5GS0H 5SWZA 5D7SH 3AM8A 4GJTB 1UXSA 3MUY1 4HULB 3RIAK 5KSUB 3BPLC 3EYUL 3DO3A 4G7YL 1SBBA 1XT5A 3G04A 2JB5H 3HMXA 3QULA 3KYNA 2P8PB 4N5ED 5DF0A 3MLXL 3ZKXC 4LKXA 1FZJB 1HHHB 3HNSL 1R5VA 4NT6A 4ZXBD 5DURD 4YGVA 3TN0B 4DVRL 1W8OA 4F7TA 3PGFL 2LQRA 4LFHD 1J1PL 2XIDA 2D7TL 3DVGB 1JZ7A 3JVGA 5JXAL 2C4FT 4JY6B 2YBRB 4P0DA 1FC1A 2XPGB 1MCLA 2O5XL 1Q9LA 3F12A 1J0HA 2H2SD 2A73A 3V4PH 1X6LA 4KJPC 5DS8A 1IQDB 3OF6D 1KN4H 2EC9T 5H8DA 3T8XB 2DJSA 4GBXD 5HBBA 5DD3H 2DRUA 3KXFA 1T7ZA 3LQMA 3FT4A 2X1WL 4OV5A 3NFSL 4YHML 1IAMA 3MOAH 1JPFB 1C5BL 4OT1H 3UJJH 3HG1D 1RJYB 1CXEA 5FA3B 4PIRF 2H9GA 1BLNA 4MWFA 3WUWB 5C6WH 1QFWM 1RUPH 2V5SA 4CVWA 5JW4R 3W5NA 5TF0A 2B1AH 2AQ2A 5FYKE 3OAUL 2ORBL 3VWKC 3L1OL 3AREB 4FQLH 5FYLD 4F7EB 2IPUG 4XCYA 2OJZH 3HLAA 1OT2A 1QPXA 1C08A 5TQ0L 1X5FA 3HCVB 2HRLA 3I85A 3UTQB 1BAFH 2A6DB 3HE6D 1RFDL 4DUWA 2P46B 1T0MB 4K9EC 3K2UL 1CDIA 1LO0H 1JZ8A 4XXCC 4EZMA 1FZMA 1RJLB 2OXGA 2DQHL 2E7LA 2UZIL 3GNMH 4LMQI 2YD8A 2BY0A 5ADOH 4NQDD 1TJGH 4JFEB 2X89D 4NN5B 5ECJE 1BZ7A 3GSXA 2HRPL 2X4TB 4ONFL 1CFTB 4HWEL 3IJHB 5I0ZA 4Z6AT 2VZSA 4CBPA 1X4XA 3VG9C 5J11B 4YFLI 4R8WL 3FOMA 4BH7A 4KROC 5KVDH 1T7XA 3VXPB 5I1LA 4L1HA 5BV7H 5IM7B 4ZD3L 1OQXA 2NZIA 4L8CA 1YY8A 3SY0B 1BM3L 2IQ9H 3WV0A 3S7GA 3CMGA 1DQQA 2Y5TA 2HLAB 1QSFD 2BRRL 3OKDB 1U8NA 3BD4A 4NKMA 1UJ3B 3WFHA 2IPTH 2VLJD 1IBGH 3LVEA 4KVNL 3QUMB 4QEGA 3O3EA 1RZKC 1FVCB 3R1GH 5KW9L 3JTTA 3BN9C 5IBLD 4LARL 5DHVH 5HVFB 4YNYB 2B4CL 2VITA 1J18A 3VD4A 1JHKL 3STZA 5EU6E 4X7SH 1MPAH 3BWAA 4Y4FA 1HH9B 4PJDB 1BJ1J 4MJ6B 5LVEA 1N3NB 3U6RA 3JWDL 4KQ4H 1UB6A 2EXWD 1MVFA 1X5JA 4ZNEE 5IV2A 3NIDE 3T3PF 3FQUB 3IFOA 5E8NA 1IAIL 2P47B 2ZWLT 4ZOCA 3MA9L 5CKAA 43CAA 1OP9A 4GQ9H 1FC2D 3L6FA 1RK0B 5GJTH 1MUJA 4PYHA 1DQDL 2NY4B 1IAOB 4LSPL 1U8JA 2YD6A 5FO8A 3IDIA 1IL1A 2XN9A 5EBMA 3CFIC 4P48A 4Z7UE 3LV3B 5E94B 1FNLA 3FMGH 5HHXL 1EFXA 3HC0A 2WBJD 5D2LF 3EDKA 3SKMB 3QG6A 3KDMA 2YEZB 4QHNA 3TYGL 3QWOA 3WNNA 4C59B 4KZDH 5FYKU 3C6LC 4PGBA 1JUFB 3VD9A 2GKIA 5DK3A 4C57C 1CDUA 1WZ1H 4I2XA 3OXSA 3ULSB 4HG4K 1CN4A 1I3GL 3WIFA 4KKCD 3UDWA 2W65A 2BVOA 5JPMB 4BK5A 3DBXA 3FONB 1N2RA 5JW4M 1DN2A 4M4PA 2W9DL 5FO7A 2YPKB 4AYFA 1RZGB 2Q1EA 3QHFL 1ZLVH 3V6OC 3CPLA 1ZEAL 1QTYT 1IGML 2WBKA 2GSGA 3O11B 3S4SG 1G9NH 2UVFA 3TA3B 3O3DA 1ACYH 4LOUC 4BZ1L 3QDGD 1UG9A 2AJZA 4RRPA 5GJSL 4TUJB 4IEFB 4MHHG 4PJ9A 1W72L 1G7HA 1YMMA 4KRPD 5E08H 1Y0LA 3GZKA 5HGAB 3D3VD 3OAYH 2XZZA 3SDDB 1PKQA 3WN5B 3WDHA 4PJBE 3ARTA 1A3QA 4R26H 1XGTA 3V5HA 5D7IF 1RK1B 4U2ZA 1FGNH 5DMGC 1T2QH 4L8SB 1T2JA 2YKLH 5HHNA 2DLIA 1G0YR 4FN0A 3TV3H 4UDTA 3O8XB 1EGJL 1OLLA 1VGKA 1XGQB 5LXGH 1NAMB 4N9OB 3GK8L 4XC1H 2FX8L 3T4AB 3LKRA 2IQAA 1DVFC 1QSEE 3BSZH 4JO4L 5CWSA 3HZMB 1TNNA 5D1QB 3MOBL 4FG6D 3ROLA 4DKAA 5TPWL 4HH9B 3T4YA 3MBXH 2B20A 1T1WB 1H8NA 4FXLA 1ES0A 5J1AB 1WVZA 1J86A 1OGTB 3DETC 5SWSD 1OD9A 3PWLB 3PL6C 3F7PC 5DJ0B 3X3GL 4GS7B 1GSMA 3IDMA 4PJIE 2G9HA 4J7RA 2IAMB 3FFDB 1UXWA 3O3BB 2AS5M 2DYPA 4OCLC 2FJGB 1QFUL 4LNVA 3TNMB 1Q9KB 5FECA 2VAAB 3BFOA 4KJQD 4F57H 4M3JA 4GXUM 1FVDB 1JZ6A 1I8IA 1UCTA 4QRRB 2Q7NA 4L3CB 4PYGA 4CJ0A 4RMSA 3QIBD 2VDPH 3ARDB 5H35B 2A6KA 4H25B 4OIBA 4EI6B 4J3TA 3NIFE 1C5DB 1K8DB 4FS0A 4KTDH 5DC4B 5C08D 5CLTA 2X4NA 3EO0A 3P0YL 4RBPK 3V52H 5I6XC 1FLTX 3NACL 2NYYC 5FUZL 1O7VA 3AB0B 3BP7B 4X8XA 3EO9L 1SEQL 3A6CL 1DVFD 3SJVA 5E1AB 3PIQA 5D1ZB 4YEEA 3EZJB 3VXUD 1I7RB 4DUVA 5MEQA 5ISZE 2R1WB 4YC2C 9CGTA 4OCXH 3KPPA 2J3SA 3UCRA 3H0TA 3VGHA 3O6KL 3T0AA 3UTSB 2HVJB 4XMPL 3P9MA 1T0NA 5SX5H 5IR1B 1FYTD 1KIPB 4GMSH 1JF1A 4NC2B 5DWUL 2CO6B 1FSKB 2MCG1 4HJGA 5HYSB 4M9OA 2A9MH 3DRQB 4TSBL 4Z8FL 1WWBX 1A3RH 4Y1AA 1WSST 4ZAKD 1RZ7L 1VEMA 1JTTA 1G7JA 3EYVB 1MWAH 5HYJE 1P9MC 4NPYA 3U2SB 1GCFA 1KJMA 3DUSA 2IH3A 1D9KA 1MI5B 5EN2B 1MCOH 4M48H 4XNQB 3F62A 3PQYE 5EZJB 2FECL 1FL6B 3OV6A 2R1YA 3S3JA 2P8LA 4MDJA 3HAEA 4QGTA 1JNNH 3O4OC 4EN3B 1CTOA 4W6XB 3UO1H 4FMKA 5HDBF 3T0EA 4FQXC 4GRLA 1D6EA 1T7WA 4OLWL 2PTTB 4TULL 1MAKA 2JKXA 4YDLC 2XWJA 3OG4B 2DKMA 1HYSD 1CDJA 4MLSA 4PJ7F 1QBLL 3UX9B 1M7IA 1ZT7A 3HZKB 4L4VA 4DGYL 1IC7H 4FTVE 3MLTA 3ULUE 1HINH 1RAMA 1QR1A 4XMKH 4NZRH 5D7IA 2ZUWA 5GGRY 5HHMD 5F7FA 1UB5B 1E4XH 2HFEA 5E4EC 4EEEA 1T1YB 3F58H 2J8UB 8FABA 5E9DD 2C9AA 1KN4L 2OL3B 3Q2CA 5F3HB 3Q5YA 3BKJH 6FABL 4AEHH 2WK2A 4L3EA 4IRSA 2QJDA 1F4WH 4UMGA 4QXUL 3MOAL 4OT1L 4XI5C 2P48B 3WJLC 5EBLB 3TNNA 5CEZH 1CK0L 3WUZA 5C7XL 1F4YL 4X4XB 1FAIH 2XWBA 2H1PH 5K9KB 5C0CA 2RFXB 2R23A 5BO1H 3IDYC 5BVPH 1TTFA 5KN5B 3QWRA 3MLSL 2P4AB 4Q2ZB 5TE6H 1M7DA 3IDXL 3LKOB 4M3KB 4OCYH 1WFOA 2E9IA 5EDXA 4AH2B 3TVMB 4LCIH 5TFSL 1OAYL 4LDEB 1EZVY 4G9DA 4ZYKA 1MIMH 3QJHA 1B4JH 4ZFZB 3RWFA 2DI9A 4JR9H 4OGXL 3BI9X 4K8RH 1QBML 5B38G 5ICZA 5IJVA 1CLOL 1BREA 1R3IH 4JGUA 5C9KA 2BNQB 1C12B 4DKEL 4ZFOB 2BY2A 5EO9B 3EDJA 1BAFL 5FKAA 5I73B 2FO4A 3RI5F 3WFDL 1IGJB 5CEXB 4EUPH 4HEME 4PJCF 3O45B 1NMAH 3VXRB 4JFOB 3V6FB 2W0PA 5ADOL 4NGHH 4FQQB 3MV9E 1N64H 2HTKC 5DJDB 1RZ8A 4DAGH 3DYMA 3NZHH 4UQ3B 5IT2L 4P23C 5J6GB 1OQOA 1P4LA 2VZ1A 1AKJB 3H7LA 1Z2KA 1N59B 1P69B 1FL3A 2F19L 1NBVH 2QSCH 4X7EC 4X8JA 1A9BA 1S7TB 2ICWI 1CGTA 12E8L 4QRPB 1VACA 3KPSB 2K7QA 1KB5B 3FFCD 4X6FA 4JANA 1H5BA 2WNGA 1I1CA 4OF7A 2IQ9L 2R2HA 5F7UA 1CF8L 4CNIA 2L0DA 1QKZL 5JHDE 2AXFA 1MCEA 4K2UH 4UIMB 3MRHB 4G7VL 3DV6A 2PR4H 1EX0A 3ZL4H 3EYSL 1S9YA 3BUYA 4W4NA 5DJYA 5F1NB 2C1OA 4P5MA 3SKNA 1FRGH 4O9HH 3RVTD 1XR8B 3CK0H 5C09A 1ZOXA 1IBGL 2M8XA 4H1LA 4R4FL 2G5BB 2VKWA 4ONOA 4ETYA 1EJOH 3CMOH 2OR7A 5ELIA 3ULUC 4C56A 3CFDA 1A7RH 4EIZC 2IFFH 3J7HA 5CZKA 4HUUA 3STLA 5D7LA 4WU7A 3LQAC 5EORH 2V7HB 2WWMC 1UZ6F 1D5IH 5CP7A 4M5YL 1LHZA 4JAMA 2IJ0C 4AZ8A 2PW1A 4Z7WF 1MCQA 2I60H 1JN6B 4JRXB 2P44B 4FFVC 4JQVC 5EA0H 5JMOC 4MA1B 4PJ7A 3RVVD 4D9RE 1W0VA 3QZWB 4Q9RH 1QYGH 1HHIB 4AM0A 4YE4L 4JLRA 3VXMA 1R3LA 3C5ZB 3ZKMC 1MHPL 4WUUB 1D7FA 2E7MA 1LO5B 1EH9A 2EDOA 3JUZA 5CHNB 1FFNA 4KC3B 3VG0H 4RFEB 3LS5H 7CGTA 4GMTH 1G7QA 3JV4A 5J8OA 5IVXF 4IIQB 2FWOB 3LPWA 1RZJH 1A6UH 5I18H 4Y2DA 1AIFB 4ZQKB 4PB0L 2AV1A 4X6DE 3N50A 1CFQB 1SEBB 1KFAL 4Y19B 3RTQD 1CICC 3RL1A 2WWKO 1MLBA 1OCWL 3CFBB 3SCMB 1AXTH 5EU4A 2IGFH 2O5ZH 3WO4B 5GGTH 3TN0C 3H42H 2IFGA 5CAYB 4TUKH 1WZ1L 1YECL 2UY6A 3MXVL 1FDLL 1T5XB 1PZ5B 2GJJA 4Y16A 4G3YL 2W9EH 4PRAA 4X7TA 4MA8L 1VEPA 1R3JA 2HJKB 3CFJA 2F74B 3WFCH 3EAKA 3JTSB 1IZJA 3H3KA 3OB8A 3SDAB 3MV8B 1G9ML 1I3RB 3MLUH 2XRAH 4PJDE 5JXEC 1AFVL 5I30H 2RCSH 3V5DA 2JCCE 5F1IB 1N0XH 4FFYL 1G9NL 4WUKH 1BGXH 3I2CL 4U0RB 3HFMH 4O5LL 3GSOA 5C07A 3K0WA 1OTSD 1ZVSA 4TVPL 2WIMA 3EHBC 3S96B 2XI9A 3ZDXF 3F6IA 5IG7A 4J3UA 4WW2C 4W6YB 4JFFA 1QRND 4NQEE 4XCNA 1UXSB 4PJCA 2YA1A 2QL1A 4O58L 4HQQH 2C3WA 5EWIH 4Z18A 5ID0B 3NIGF 4ODWA 1CLZH 3P4MB 3QULB 4OZGB 5IVZA 5EC1A 1I8MA 2N4IA 1S9XB 4GUPA 3TV3L 2AEWA 1PDKA 1B88A 4M1DL 5DJCB 2DS4A 3H9SE 4HBQA 4XHJD 2IBZY 2DMKA 3TBWB 4P46D 2DLFH 1XF2A 4KK5C 3L7EA 4L8BB 3RUGB 1UJTA 1FV1B 3V5KA 1IGYA 3FB6B 4P2RB 1QFHA 1J11A 5JOEA 3TBTA 5JW5A 4U7SA 3IU4H 1N5YH 5DS8B 3MBXL 4NP4H 3QI9A 5CBAB 1JYVA 3KXFB 1LEKB 3OKKA 5C6TL 4WFEE 1GH7A 3N85H 2B7DT 4P57A 1B9ZA 5SWQB 1HZHH 3UAJD 1D6VH 3LY6A 4NO0B 4HUXA 4ORZC 1NEZA 1I9EA 4NFDA 4LPXA 3KHQA 3KWWB 2C3VB 5CJ5A 4MWFB 5J11C 2X4OA 4F57L 4OGZA 4UINH 5I74B 2PO6D 1SBSL 3KPRD 4FZ8H 1UACH 5B8CA 3L95A 2X6MA 3PP3H 5DHVA 1G7PA 1CIUA 4P3WA 3QYCA 3ZE0E 4J4PC 3EJZC 4KV5E 4HKZB 5HDOA 3P0VH 1IAKA 5DD0L 3ARED 5IB5B 4KTDL 4MXVF 4Z7WA 4UILL 5DZLA 4XCYB 4NCC2 1S7SB 1KGCE 2Z91B 2WANA 4F9PC 3BVNB 1HQ4A 1BVKA 4ELKA 4Y4HA 2KZ1B 3MCKA 2NXZB 3MV11 3VRLF 3X17A 3ILQC 1FZMB 1G7MB 3C60B 1A64A 1I75A 3RPKA 4HFWA 2KQMA 4PJGB 4OCXL 4KMLB 2EIBA 3HC4L 4OF5A 4RISL 3VFNA 5E00B 3GIVB 4C55A 1AO7E 3RHWF 2V2XA 1JI2A 4L3AA 5IVXA 2LTQB 3C87A 2PKDA 3RX8A 4ZUUA 4ZOBA 4NFBA 5GRJH 3DMMC 3IRPX 3P2TA 4FABH 2JE8A 4NBXB 4HKBB 2WUBL 3MODL 5EPMB 3LSOA 3PWVA 1MQKL 1I1AA 2UUDH 2IH1B 5GZND 3N1MC 4QRUA 5I1LB 3RZCB 4PRHB 3MJ7B 3D25A 1TPXB 5D8JH 1AGBA 5D9SA 2NY4C 3U9UB 2E9JA 1KXQE 3BPCB 1EHNA 3AS3A 1MCOL 2DTSA 3O6MH 4JFXB 4U05A 4PGDB 1ZA3B 1I1YA 5ACMA 3CDFA 2R0WH 4JFDE 1WCBB 4MMXC 1JGVL 3DYOA 3KLAB 4K3DL 4D0CA 2VXVL 1JNNL 4MQXC 3UJIL 2A74B 5HHVL 1RU9H 3OXRB 5SX4H 3ARFB 3GSNL 2P8MB 1MCFA 4HS8H 1G6VK 4ZS6D 5BW7C 4APQD 3STZB 1EEQA 1CZ8L 4U1GC 1IC7L 2FIKB 3BWAB 3CDCA 5IHUH 1HINL 1X5IA 2NXYB 4DK6A 3BH9A 2GJ6B 1Z3GH 2COQA 2GITB 3LEVL 3UTSE 4XRCB 5DI8A 1YEJL 5FDWA 4Y5VB 3F58L 5FM5M 3VMNA 4G9FA 2Y7QB 3HKFA 5CSZA 3FO9B 3KPQA 43C9A 3VA2C 1UA6L 4FZEH 4G6AD 4OM0H 4QY8A 1YDPB 3DSFH 2NQCA 3HNVL 4PJXB 4QRTB 3SPVA 2MQ0A 4HPYL 4NWUH 3QIWB 4XP6H 1AGEB 3GKWL 4ZUVB 3L6FB 1V5JA 2VKXA 1NGWB 2C4XA 1LDPL 2DIBA 4XBEL 5TE6L 2PXYC 1U8JB 3SDDC 3WN5C 2APBA 3IDIB 3BD5A 2X4SB 5EBMB 3U0PA 2HTLC 2H45A 5L2KA 2WIIA 4LCIL 1MI5E 4OD2A 3VDCA 4L8SC 3HUJB 3EOBA 4KUCF 2P5EB 4PLJD 4XCCH 2WZPD 3PWNB 2Z9TA 4JZJA 3O8XC 5J56B 5CD5C 4TRPL 1F4HA 4XCEB 4Z0BL 5BXFA 4YDVA 2BVYA 2IPKA 1R3IL 4GAGH 3FQXA 1WC7B 4GG8A 5DA0B 1I3VA 3AAZA 4R9HA 2WP3T 1ZTXL 5D1QC 2R56H 3MROA 1PG7W 2K7PA 4OFKA 2ICWJ 4NRYA 4QTIH 1YQVH 1DL7H 2VH5L 1OAXL 2YSSB 2GSGB 3ZSSA 1IMHC 4JPWH 4NGHL 3OPZL 4JHAH 3O3DB 2BCKB 5IB1A 1A3LH 1WBYA 3TA3D 2AJZB 5F9DC 4GS7C 4FQ2H 5DMYA 2AJYL 3RWIB 2HFFB 5DUBA 5ENWB 3VXOB 1DDHB 1DE4B 3VWJA 2HKHL 3WNPA 3VW3H 5SV4A 2MKLC 1U8QA 2QSCL 5FUOH 4R2GD 3CLFL 1V05A 4M5ZH 4LSVH 4ERSL 4NQTA 3IETB 3V5HB 4YJZL 1CD1B 1XCTB 1F11B 2APXA 1JWSB 1CCZA 3ARDC 3QPXL 4FA8A 5HHNB 1KLGB 1JHTB 1H3PL 4MAYB 1UVQA 2R2BB 4M1GH 3LS4L 3MRNA 1I9RL 3FT2A 1CT8A 1G1YA 3ZL4L 3MZTA 4I9WD 4JN2B 5CD5D 2CLVB 4TQEH 2EKSB 3E3QE 5C0RH 1FRGL 1U3HA 3AB0C 3LKRB 1NFIB 1ZMYA 5I75B 3KHOA 1UEMA 3TT1H 3LQZB 5HYSG 4ZUTB 4N68A 4XPHH 1P53A 1JV5A 2NLJB 5FK9A 2IFFL 2VL5B 3VXRE 2O26U 4XNZB 3HRZA 1ZLUH 4FFZH 2IAMD 1FN4B 5CJ8A 4LVOB 2Q3AA 4KK9D 4U1NB 5EFIA 3IJYA 5EZLA 3UJTL 3ORJA 1CG9B 1NCBH 5IMLB 3IVKA 1CXLA 3PHOB 4LLAA 2BOCB 4I77L 1RSFA 2OCFD 4F8TA 3LZFH 3QXDA 1XF5B 4RNRB 1T22B 3LDBB 1KACB 1JGLL 2EZ0D 5DXWA 3RWDA 3IFLL 2ICEA 3SGDH 1WAAE 2YS4A 2CRZA 1T89A 3MLRH 1BIIA 4DQOH 5IMOB 4GW5A 4W70A 4PFEA 3P30H 4H0IA 3FB8A 4NRXA 3VG0L 2D03H 3U30C 1FFPB 5CJXA 5AZEH 2Y6SC 5I18L 3ULVD 1YYLL 4PPTA 3V6ZA 3DVIA 4QOKB 3RGVC 3RVWC 1AXTL 5D1ZD 4ZODA 5FYKH 2F5BH 5GGTL 1Q9OB 4YO0B 1Q94A 2AJ3A 2FHBA 4CADA 4LAJH 1KJ2H 5T1DL 1PYWA 2W9EL 1MCDA 3P9MB 3RWCA 3BD3A 2DQIL 3HB3D 1II4E 3MFFA 1LK3H 3OAZK 5KSVB 4HJGB 3MJGX 2VSCA 5F96H 1CTNA 5I30L 4DWHA 1CD9B 1N0XL 2AK1L 4WUKL 5CBEA 4O2FA 1KLUB 2X4QA 5E1HB 3UTZB 1TTUA 1U8PA 2XZQH 3G5XA 5A2KH 1OLZA 1ORSA 3MGTB 5I8KH 4OIIH 4AEIH 5DHXB 5HI3C 4EUPA 4KJWD 2BNUA 1Q0YH 3K1KC 4E41E 5IMKA 5LGHL 3TVMC 2WINB 3FZUD 1Z0MA 1AR2A 1KT2B 3U7WH 4C4KT 4DGVH 3CU7A 4I0PA 3MLYL 3CSYA 4EN3D 1BFVH 4XX1G 2AK4E 1W72B 4FQHB 5AWNL 4XZUB 4Y19E 5DDHA 3TP4A 4YHIB 2OJEB 4PJAE 4D3CH 3QO1A 2G75A 1QFWI 2DLFL 4MCZB 5HPMB 3MLTB 1NFDB 3QDGE 1T6VN 1QR1B 5D7IB 5I73C 1F8TH 1GYAA 1URLA 4MJIB 2AEQH 4M7LH 4L9DA 3ARPA 3F7VB 4RA0C 1MFAL 2HVKB 4HPOL 4HBCH 5DZOA 3C8KB 4RGOH 4ZSOA 4ENEC 1U8IA 1XMWA 5C0BA 3BDBA 2V9TA 1J8HB 2JJSA 2XKSA 5D5MB 5IW1A 2FIRT 5JA8B 2NW3B 4UNTA 2ED7A 2MWCA 3UZQA 4P2OA 1BFSA 4U6YA 1ODAA 3TIDB 1JFQH 2HT3C 2CMRL 4PV9B 2AP2A 3OB0K 4D9QD 4DN4L 3N9GL 2VXSH 4HS6A 3CFCL 5DUML 4N0UA 1IE5A 4ZYKB 2UV3A 3WKMH 4PLOB 4LEOB 1X5LA 3QJHB 1K9TA 2Z4QB 5F9AC 3ZDYF 4NKIH 3VGAC 4FQIL 4OZGE 1FZKA 1NBYB 5IJVB 1VENA 3WMSA 4X4ZA 4MCYA 1DSFL 1R5IB 2BNQD 4KPHH 4R0LC 4XB7A 3HHRB 1U58B 3GSRB 1W8NA 2H2PD 1SYSA 3BKML 3VFGH 2NY5L 1HSAA 2EXYC 4X6CB 5D1XB 2AJVH 5DC0A 1ETZA 4V1DD 5ABDE 5IB3A 4IRJB 4G43A 1LQSR 1S5IL 1JIBA 1VPOL 5EO0B 3TEUA 4OLYL 2Y1VA 4MZ2A 5C0IB 4YXKL 1LE5A 3RY6C 1RZIA 3VFVA 1XIWB 3RWEA 1H0DA 1INDL 4MNQD 2GTZB 4L9LC 2MPAL 2EDFA 4A6YH 1YJDL 5GRJL 3KVQA 1P4LB 3MNWB 2C3XA 1FL3B 2ADFL 5GGTA 4Y4KA 3K8LA 2YD5A 2XTJD 1HI6A 3K4DA 3U7YL 5HD8C 4B50A 5I1KL 5F6HJ 1EIBA 4QRPD 1OAZH 1UWGH 4X6FB 3KPSD 4IMKC 4JANB 4X99B 5KSAA 2CDFB 3W39B 2E5EA 1YEHL 5I16B 3LKQB 4MX7B 3VFWA 2NNAB 3PWJA 3QUXA 4JPVL 3BUYB 4U6HA 3NGBB 1ZHNA 4BQ6A 3EJYD 4IIQC 1PSKL 3L5HA 4JO1L 3DXAB 4YWGH 5IHZA 5C09B 1K4CB 4Y7MA 1HK6A 3MC0A 2WV3A 3VXSE 2VN7A 3BW9A 3QPQD 2APFA 1S8DA 5DFVD 1BEYL 2FEDC 4HUUB 3TIEB 1S5HA 1OT1A 4LQ1A 1FLRH 2FX9H 2GUOB 2Y23A 4ZDHB 2BJMH 5BRZE 4HK3J 3RY4A 1OTUC 5BZWA 1S7RB 1JHLL 2NW2A 1X5XA 2XNAA 3K3QA 2X05A 2ATKA 1KTRL 3ALPA 2R0KH 4FZEL 1JVKA 4JQXC 2E7HA 4NKQB 5E8OA 4ZPTB 2N7BA 1FFQA 3AS2A 3U1SH 2IANB 4LRIA 1MF2H 3WNMA 4PRHE 5DD5H 5B21A 2MCPL 3C5ZD 1MY5A 3PNWA 2EE3A 4WUUD 4S2SA 3KPOA 5IB4A 1P4IH 2MNUA 2ZOKB 4AENB 3MRFA 1YNLL 3TPUA 2FZ3A 2HG5A 5GISH 1MEXH 3SQBA 1P7HL 1MLBB 5EU4B 4YFEA 3PHQA 3SDYH 3SCMD 1KPUB 5E9DE 4OTXH 1AQKH 3Q3GA 4YK4B 3H9HA 4M7ZB 4JFQA 2VB5A 1JNJA 3I50H 5J06A 1X5KA 2YOCA 5IB2B 4OLXL 4RQQA 2LFGA 3HPJA 1FQ9C 4X7TB 3QUZD 2VISA 1G7LB 2R56L 3KPNA 2PW2A 4Z7NE 4I18B 1EAJA 4E0RB 5LQBH 3ARGD 2LAAA 1IQWH 2Q8AH 3CD4A 3SDAD 3LRSA 1DL7L 3MLZH 3VXNB 3P4LA 1Q9WA 4ONGH 1XGYH 1BQSA 1Q1JL 2P5WA 3MLVH 5DK2B 3QDJD 4TSCH 2A0LC 3Q1SL 1KCRH 3CC5B 4HK0B 4P5TD 1EEUA 1QLEL 4NQSB 1ZVSB 4K9EL 3WIHH 3F6LA 3TH3T 1FNGB 1N5AA 3C2SA 1OF2A 2YC1A 3HA0A 5J89A 5JUEH 4RMRA 4QTHA 4OZFA 3MRLB 4PY8I 5IG7B 3MBED 5ACZB 3ARRA 2VN4A 1MH5B 1QLFA 2QEJA 4OCWH 5SWZD 5EU3B 2ZG3A 4M5ZL 3HMWH 3MRKA 4M6OH 2EDHA 4LSVL 4HFUL 4XAWH 3DGCR 3NPZB 1NC2B 3S34H 4MQ7A 1LVEA 4OCSH 1D5XA 2RB8A 3QCTH 2ZSVB 4AIXA 3HS0A 2QHLA 1QRKA 3S5LB 5IW3A 2HP4A 2GW5A 4WFHE 3AS1A 3BDXA 4BQCA 1GOGA 2J4WH 2VLKE 5FIEA 1JPSH 2JB6B 5FHBL 1P84J 5AZ2H 2Q76B 3I3EA 1RY7B 1PGRB 2NXZC 1C1EH 1R24A 1U93B 4HIIA 4EBQH 3K46A 3JV6B 4GBXA 3C60C 1RVFH 5D7JA 2LU3A 4LCWE 2L7JA 4NM4H 3UBXA 1CE6B 1NGZB 2QADB 1Q8MA 3OKKB 1RIUL 3FQNA 3KXFD 4JG0L 4P57B 5LCVL 3CXHJ 1GC1H 3HE7C 1FNAA 2LTQC 4MXQD 1RZKL 4FFZL 4Z76A 3NH7L 5I19H 4JB9L 4YXLH 5DHYB 1TVHA 5IW6A 3PGCB 5GS2H 1BWMA 4WCYL 3LQAH 4YLQT 4Q6IB 4U7KA 4Y5XC 2ARJB 3CUPB 1YEKH 3L95B 3DPBA 5LAXB 3KLHC 1MRDH 1OSPH 2H3NA 1IAIM 3ET9F 1L6XA 5GIRB 3IS1X 4N0CD 1NCWH 3CZFB 2HJFA 3GMOB 1TPXC 4MA3A 3BQUB 5KVGH 3ETBF 3PV7A 1RIHL 3VFPB 4GG6F 3A67L 3SN6N 3P30L 4JFPB 3PWPA 4Z7WB 3OBAA 4NJAL 3RIFF 1T21B 1QA9A 2NY7H 3KG5A 4NC1E 3AUVA 3VFUB 1JF6A 3ZYJA 5KS9F 5C8JA 3W0WB 4KKAC 5DC9B 5JNYB 3UXFA 4L5FL 5F9OL 4ZFGL 4UTAL 2ZUQB 4HGMA 2R0LL 5EC2A 3RKDD 5EOTA 1WJ3A 2CDEA 2Z0BA 3ARFC 5FYKL 2F5BL 4UT7H 3OG6B 4Y8DC 1B2WL 2YUWA 4EDXB 2VO5A 3GBLA 5KVEH 1MIEL 1FNEA 3BP5B 4YHNA 1CDGA 2KKQA 4ZO7A 1HIMH 3LH2L 2FO1A 3LEXA 4P99A 3PWVB 4F7MA 3WHE1 4QCIA 5IFAH 3ILPB 1LEIA 3RZCD 2H32B 4P9MH 3VWKA 4OJFH 1AGBB 5IQ7L 2WSKA 2CK0H 5J9PA 1UH2A 5ITBH 4WI5A 3X3FH 1T1ZB 3WJJC 4H26A 3DRTB 5ICXA 2IG2H 4M8QB 4RZCA 5MHSD 1GZPA 1OM3L 4N9GB 2FD6L 5IROC 3NFNA 3I9GL 4RMQA 3RX5A 1T1XA 5F7WC 4Q58C 3QDMB 3SE3C 3OSKA 5TE7H 5INDB 3OKMA 4PS4H 5GPRA 4QHMB 4LGPB 4QOKE 1N8ZB 1CGXA 2R39A 4U1IB 5JIKA 4XTRC 1OPGH 5IEKA 4AIZB 5HHOA 4U1SB 3RVXC 2NXYD 2FX7L 2FGWH 4KKBD 5D2NB 2GJ6D 2NR6D 1MCWW 2AV7A 4NO2A 4JJ5B 3CVIH 1QFWL 1IJ9A 43C9B 3REVB 3GMPA 2QQNL 3MRMA 2BSTB 1QRNE 4JN1H 4KHXH 3M8OH 5F9JA 1UYWL 4LLWB 3UPAA 3RWJA 3X12A 2VDNL 3EO1A 1U3ZA 1PY9A 5I1CL 4JVUA 5JIIA 3L3HB 1DUZA 3QIWD 5JO5B 1UM6H 1MVUA 1OY3B 4G6JH 5FKPA 3NZ8A 4NN6B 2XACC 4I48A 1HXMA 1A14L 2WBJA 4G80A 2J5LC 5BS0B 2VNCA 4HWBH 5D71L 1IFHH 2YD1A 3W5MA 4UB0L 4MAYC 2HLFD 2P5ED 3I75A 4JZJB 4M61A 3A0OA 4NC1C 1BPVA 3L3JA 4BYHA 1HILB 4YDVB 1IGFH 4P2YA 1CFSA 4M9PA 5I75C 1JRHH 5DVOA 4JPKL 1ZHLA 4HZAA 2KDGA 1DQMH 3MROB 3VFGL 1VADB 3QFJE 3IF1A 5KSBE 3F7YA 4GG6A 1S7UA 2VXUH 1MLCB 4R7DA 4K7FA 4KTEL 4MNGE 3KPRE 1WBYB 1ZK9A 3QUMH 4H0HB 3UEZA 4X6BA 1DBAL 1ZSDB 2X40A 4ODUB 1TCMA 4NQVA 5KS9A 4OZIF 1J8HE 4A6YL 2VMFA 4X4ME 4QHKI 5D5ME 3OHXA 3VWJB 4LVOC 1FJ1B 3C8DA 1NCCL 4PJ9D 5IBTH 2EH8H 4PG2C 3FO0L 3JWOL 1YMMD 3OR7A 4Z78B 1MCSA 2FLBT 4G6KL 2AQ1A 3X13B 3GMLA 4Z7OE 3LDBC 1KJ2A 1OAZL 2A38A 5BOPA 1BVLA 3MX0A 2Y72A 3I6GB 2ARWA 1KNOA 3C6LA 3QCVH 4GW4A 3TT3L 2DQDH 3JWDC 4Z7QF 4HXBL 3G6DL 3I6LE 1FH5H 3CAFA 5CS7A 2JJVA 3HPLB 5J13B 3ARQA 1KENL 5FV2A 1DBML 3VFOA 4CU7A 2VQ1A 1EHLH 3V6OA 2YN3A 3RVUC 2P43B 4FQJH 2LABA 5F3BB 4YUEL 2EYSA 4X6CE 4BUGA 3O9WB 4P2QB 1L7IH 3QRFM 4JFZH 1CBVH 1T5WA 5TGBA 5J12C 1KYOJ 5T3ZL 1T03H 2H26A 1EEYB 4BFGA 2R29L 3AROA 1J10A 4NHUB 2DYPD 2V7NB 3NCYP 4G8IA 4ODVH 1HH6A 1A7OH 2BY1A 3LRGA 3FRPG 4FFWC 4F58H 3GSNB 3V0VB 5C0GB 3VFSA 3CXDH 2DIAA 3CFKA 1KJVA 5L8JB 3RWDB 3QO0A 4OCRH 3V79C 1MF2L 5C08A 1DLFL 1MAML 1BIIB 2B1HH 5DD6A 4GW5B 2VDQH 1CR9H 3V95A 4YHOH 2OR9H 1MCPL 4HKJB 4DTGH 3QA3B 1LP9E 4S1SL 3QEUB 1SYVB 2UYLA 1EXUB 1DUYB 1DVFA 2EO9A 4QNPE 4MVBD 3GKZA 1Q0XH 5CFHA 1NDMB 2VUOA 2BNRB 2R2EA 1MEXL 4ZS7H 4OD1H 3SJVD 3D2UB 3B9EA 5FF6B 4CDGC 5FA4B 5GRWA 3RWGB 1ACZA 4M7KH 2VR9A 3C5SA 3SKOB 2D9CA 4XP4H 3PL6A 1CGWA 4LCYB 5IFHL 4ZNEA 4M4RA 2R0ZH 3L9RB 3BZ4A 1OWRM 4DEPB 1NAMH 4G5ZH 1CXKA 2X7LB 1IQWL 2Q8AL 1S9WB 4LCUA 3MLZL 3OKLB 5IEHB 3CCHA 4ONGL 3ESUF 3LKNB 2P42B 4TSCL 1U8LB 4EIGB 1KCRL 4F37K 2ENSA 4Y1AD 2R2CA 1FO0L 1KBGL 5JUEL 1JZ5A 4K94C 2IANE 3QXWA 3U46A 2BNUB 4KDWA 4ZUSB 1IGIH 5H37G 5T1KA 4XVSH 1M6OA 1D9KD 1I7ZB 4FXKB 4ZUWB 1YNTA 1KCSL 3MRCB 2DOCA 2A9NH 4AK1A 3T65B 3DX8B 3S34L 3G6JB 4I3SL 1A6VH 1LNUA 4ETQA 4I0PB 4A6YA 4EI5C 4OZIA 4NIKB 3T0ED 2W59A 4OLUH 3CZJA 2VE6B 4UNVA 3FN3A 3TESA 4X83A 1KJ3H 4YGAB 3BKYH 4PJ5B 5INCB 4L4VD 2PCPA 1ZAGA 1YNKL 2ADJA 5MENA 4UQ2A 1NMCC 5K9OB 1J1OH 2ZZUT 3HZYB 5D1XC 4I3RL 4LIQE 1C1EL 1FVEA 4IRJC 4U31A 5IESH 3ULVH 5JLZB 5I9QB 2BMKB 2ICWB 3BAEH 3HI1B 2E6JA 5C0BB 4KHTH 1FL5A 1T83C 4IMLB 4PJEB 4NDMB 4RFNB 1QLRA 4LU5L 3BEVA 2FB4L 2JIXB 1XIWC 2QSVA 3I3BA 4L3ED 5TDOB 3BZFA 5LGKA 5E8EA 4X9GA 3GIZH 1UM5L 3TCLA 3ULUL 3D87B 1FE8H 5JR1L 3D39B 4TOYH 3L3GA 3QWRD 4M1CC 2NY6B 1XR9B 1JPTL 3LQAL 3MACH 1MRDL 4K7PX 1ORQA 4HS6B 4UIKH 1RPQA 1QO3A 4N0UB 1S9VA 4ZNCD 5L6YL 5ESAA 1GZQA 2FATH 2F53B 4ZTOL 2K1MA 4NNPH 1EO8H 1HXYB 4XBPA 5HY9B 4CAGA 3NGBC 3DX7B 5C1MB 3O0RH 4MCYB 3DWTA 4HIJB 2VABB 4Z7VB 4GRWB 4UI2A 1S7WB 1LO2L 3NCMA 3U4EA 4TSAH 5CUSH 4YDKL 1HQRA 1DEEB 1MJ8H 3B2VH 4IHOB 2N56A 5T5FH 3M45A 1BFOA 4NWTH 3TJHC 3VRIB 4QHLA 2DD8L 2HN7B 3EJJX 5T33H 1A7PH 3WJLA 4S1RL 1RZIB 5KVEL 3EBAA 3AY4A 1H0DB 2YMXH 1CYGA 3AXLA 3SO3B 1XIWD 2CGRH 4PB9H 5T1MA 3QUYB 2HWZH 2JJWA 4YAQB 1UEYA 1AE6H 5FEBA 1PLGH 1HHJB 1NCNA 4HWUA 1EEZB 3GB7B 2IALB 3MGOB 1A6AB 4LBEA 4O51A 5C0FA 2WLZA 2DM3A 5E2VL 3S8WA 2CRYA 4U1MA 2OL3H 4WV1A 4LLMA 1KXTB 1TTGA 4NUGL 1T3FA 3IDGA 5JOFA 3TO4B 3GBML 1VFBB 1MJ7H 3QNZA 5IJKC 3X3FL 2D31A 4WNQA 1AJ7H 2E9WA 5C0AE 1MRCH 5B39G 4WI4A 5ITFB 3TO2A 4JHBA 4PJHE 4YHYB 1NGXA 2HT4D 5GGVH 5C09D 3WIHA 3X14B 2I25N 1NQBA 3D69B 2YPLB 5I17A 4UZGA 3VFRA 2Z8WC 4JDVA 1S8DB 4YK4C 4M7ZC 4PJ8B 1T7YA 2DQTL 4QWWC 4C56D 1GHFH 4OUOA 5GS0D 2X9YA 1KIQB 5IBUG 5D7KE 5CD3B 1BZ9B 3AMKA 4WHYH 1RUKH 3OGCA 4P23A 1HOCA 3MRPA 4I18C 2EDYA 4XP1H 3O6FC 2ATKB 1MNUL 4GKNA 1XGRB 1NUDA 4Q9BA 4LRNH 1B0RA 2BHUA 4KHXL 3M8OL 2I07A 5JORA 2GYSA 3O4LB 1YEGL 2PYEE 4PRIB 5F1SA 4F7PA 1I1RA 3BEWA 4LF3A 5DA4A 5HGGS 1RUML 2P49B 5F7HA 2GJZA 4MA7H 4BH8B 4PTUA 3FT3B 2JK5B 3S5LG 1OTTC 2D9QB 3PNWB 4KXZI 4W4OC 2J2ZA 5DQJA 2AABL 3C09C 5IB4B 5FHAL 3MV7A 2BSED 3BHBB 5IK3A 5I1DA 2NZ9C 4YZFE 5F88A 3TFKD 2BP3A 3TPUB 4G8FB 4U4BA 4LVNB 5DJZB 1NDGB 4XXDA 3MRDB 4HH8A 2BC4B 4OZ4A 2DB8A 4JZOA 3Q3GB 3IYLW 5EZIH 4I4WB 1KB5H 3QB7C 4KK6D 3UYPA 4QHKJ 1R3HB 3IU3B 4DGIL 2W1NA 1IGFL 4P4KB 1KC5H 4OUUB 5EUKA 2VISB 3W9EA 4M43H 4MMZC 1B0GA 1GAFH 4JZNA 1TETH 4JPIA 1DFBL 5T3XH 2GCYB 3CNKA 3LRSB 4JQVA 1Q9WB 2ZP0T 1PAMA 1A4KA 3B3IB 3MV01 1I7TB 4L4TE 3ZZ1A 3QCUH 1JZ2A 1DLHB 4D9QE 1TZGH 5DTFA 5C07D 3O2WH 2YC1B 1RUQH 1S3KH 4OZFB 1PX4A 5GZOC 2VZTA 4DKFL 4NOFA 1J0YA 4JFFD 4Q6IC 3FO2B 5KSUA 4UV4L 5A3IC 4PJDF 1K8IB 3CXHK 3NCFB 3CJJA 5EULV 3WLBB 4QT5B 1FZJA 3BQUC 3L3IA 1GGBL 3U79A 5J1TC 1HHHA 2W0LA 2X10A 3O6LH 3TN0A 1JI1A 4RBPH 4RGNB 1IZKA 5L2JB 1CD0A 2G60L 2HMIC 4E42B 3DVGA 4XPGL 1CIDA 4YH6A 1FH5L 4JY6A 2YBRA 2XPGA 3BDYL 3RNKB 1IQDA 4MNQE 2VQUA 5BOZG 3T8XA 1CE1H 1EMTL 4G6FB 2YUZA 5HXMA 1RD6A 3QI9D 2QADD 3W9DB 2X4PA 1JPFA 5CEYB 1RJYA 4XP5H 3HI6L 5FA3A 1WTLA 5IHLB 3T0WA 5MERA 2OM5A 5KVFL 4WW2A 3VGBA 5T1LB 3WUWA 2YD3A 3FCTB 4NM8L 1CVRA 1W0YT 4BFEA 4GLRH 1TIUA 2AQ3A 2DAVA 3BPLB 5JHDA 2VZUA 2Q86A 4TNVF 3M17B 4AL8H 4YXHH 1MHEB 3TYFB 1NBQA 3AREA 4KRNA 5C0ND 2HJLB 2FL5B 4UOJA 4F7EA 3U9PH 5CZXC 3QRGL 4YHOL 1P4BL 1DANU 4DTGL 4GQPH 4KMQA 3RIAF 3HCVA 3MZGB 3UTQA 3K7UA 2A6DA 5I1IH 5C8JB 1Q0XL 1T0MA 5E7BA 3BE1H 5I8CB 3NTCH 2I27N 4ZS7L 3MA7B 1QQDB 1RJLA 4Y4HD 1XCQA 2W92A 5EC2B 1Z5LB 5DSCB 1AP2B 4HHAA 4JFHE 4JFEA 1RQ5A 3HMXH 3SOBH 4XP4L 2X4TA 4XPFH 1CFTA 3MRRB 4GAYB 5ANME 4LNRB 3IJHA 5TF1L 1Z0NA 2RBLA 4P2QE 5D2NC 4K3JH 2C26A 2QHRL 2OBGA 4ELME 4LLVB 3RBSA 4NNXB 3TM6A 1WEJH 3LKSB 3VXPA 5HHPB 2Y25A 1I1AD 1Q72H 5IM7A 4J4PA 3EUUA 1LEIB 2WP3O 3SY0A 1DBJH 2BSSB 4Z0XB 3OJMB 3SE9H 3R06B 5BMFL 2BXZA 2HLAA 5JW3L 1J5OH 5J9PB 5JTWA 4R90L 1TJIL 1IGIL 2E7CA 4F9PA 4XC3H 4OLEA 5LWYL 5ICXB 3WKNA 4PLKC 2VQTA 2YPVL 3BP4A 3UYRH 2CKBL 4WIQA 4UU9A 1RHHB 5C3TA 1T1XB 1YQ2A 1A6VL 1FVCA 2YWYA 4NQXB 1YEEH 4FQ1H 3IGAB 1C16B 2BNRE 2V5TA 4YNYA 2XG5A 1KV3A 3PUCA 2OYPA 1QEWB 1FCCA 4U6XA 5TDNA 1HH9A 4K7PH 4PJDA 4IBLT 3LMJL 3DMMA 1D5BB 1N3NA 4N8CL 1I1FB 4M6NL 1YZZA 2EIDA 5L8KB 4QXTB 3DJ9A 3ULVF 4G9FD 1WGOA 3FQUA 1MHCB 1PVHA 5SWZE 4PJFB 2D0FA 2EEAA 4R4BB 25C8L 3WS6A 2VERN 1I9IH 1ITCA 3CSPA 5CSGA 4YBLB 5EOCH 4WEBL 1RK0A 2E27H 1WIUA 3P9LB 3RWHB 1E28B 4J6RH 1IAOA 3GIZL 1OAQH 2HT2D 1S78C 4TOYL 2CXKA 2Q20A 4HC1H 3ZO0A 4TTDC 4R4ND 2OTPA 5E94A 4YHKH 3N0PB 2NTFB 4NQCE 3GHEL 3GI8L 5MP6H 3MJ8A 3SKMA 5L2KD 4H5SB 2YEZA 4QYOB 3WD5L 1CFBA 1FYHB 1JYWA 2ESVB 2VRAA 3V4UL 3QNYB 1NMBH 1JUFA 1GGCL 3ULSA 3OWEA 4C54A 4XAKD 4XNXH 3IXTB 5BW7A 4YEFA 2NY1D 3H3PL 3MCG1 2OTWB 4AT6B 2R69L 1JJUA 2YPKA 4XNUL 1RZGA 1Z9OA 1ERNA 3R4DA 1H15B 3O11A 3TA3A 3SDXB 1AXIB 4DJMA 4JG1L 3O9WC 1ZLWK 2MOVA 5T33L 4X6BB 5I8EB 3TCXA 3ZKNC 2ADGB 4NZDA 2CGRL 1T66D 1CL7I 2HWZL 1F58L 1U8MB 4F9LC 1AE6L 3EYFB 3VWJD 5HGAA 2KZWA 2PXYA 3ECBB 5BCAA 3SDDA 3WN5A 4YQXL 4HG4J 4Z95L 1G0DA 1D5ZA 4G8EB 3EYUH 4G7YH 1RK1A 4L8SA 2K3TA 2J8UF 3MLXH 1KYOK 2CJUL 4LSRL 1BVLB 3G6AB 3QR2A 3HNSH 1ZLVK 2OL3L 3O8XA 1JTPA 1KTKE 4DVRH 3VGDA 1XGQA 3PGFH 4U1HB 3ROOB 1HSBB 3BRDA 2VSDA 1NAMA 1NL0L 5DRWB 1BX2B 1J1PH 2D7TH 3T4AA 2F53E 3DVFA 5JXAH 4XVJL 3MUHL 3HZMA 4LHUG 4ALAL 5D1QA 1U3HD 5FYLL 4ONHB 4HCRL 4GRWE 4HH9A 1HYRC 1T1WA 3HC3L 3QFDB 5J1AA 3NABH 3QEQB 4LEXL 2NY2C 4OLZL 5HYIA 3NFSH 1GHFL 4YHMH 3OKOB 1EAPA 5DJ0A 1C5BH 4NKDB 4Q9QL 4L29B 3FFDA 3O3BA 1XGUA 2FJGA 2D4FA 3TNMA 3CLEL 4D0BB 3DX6B 1Q9KA 4YPGB 4XP1L 2VAAA 1FIGL 3B5TA 4G8IB 2J6EL 4WI2A 4I5BA 1FVDA 4LRNL 5DVKA 4QRRA 5KVMC 4DZ8B 3S4SB 3ARDA 1RUAL 4MJ2A 2DWDB 3CFKB 3LAFA 3OAUH 4H25A 5MHSE 2ORBH 3L1OH 4WO4B 4MA7L 5L0QC 3E0GA 1C5DA 1K8DA 1U36A 4WI9A 3SE4C 5TQ0H 2QQLH 3B43A 3CH8A 4CL7A 3BP7A 5HI5D 1RFDH 4WGVB 2UZYB 1OGAB 5E1AA 5D1ZA 3FHAA 4G6ML 1I7RA 5ETUB 2VLRB 2X70A 1KG0A 2VDRL 2KBGA 5EU6B 2R1WA 2YRZA 2MKWA 1WAAF 5B4MC 3DUUB 3I6KB 4QKXB 4D9LL 3UTSA 4FNLL 1JK8B 4KI5E 5TH2A 2HVJA 2HRPH 3PL6B 4ONFH 5I8OH 5IR1A 4WWKC 1CU4H 3N1QC 3DSNA 1SMOA 1ZVHA 5HYSA 5E6IB 3ZLQC 4EDWL 3RNQA 3DRQA 4KUCD 3WSQH 3D5OF 4JRYE 4BSWB 1FAKT 5JZ7C 4KZEL 4RFNC 4ZD3H 2XN9E 1BM3H 3EYVA 4GFTB 3O2WL 3O4LE 4PRIE 3U2SA 1LE9B 5GSRB 2V5RA 3LCYA 4PRBB 4Z7UB 1K5NA 1GRWA 1MI5A 3U46B 5DO2D 4P3CH 2NY6C 2BXYA 4XNQA 2R4SL 4Q74A 5D6DC 5EZJA 5H94B 1F3RB 1WTGT 4PRPB 4EN3A 1GOFA 1UH3A 1PEZA 2Z31B 3VE0A 1LNUB 3GMRB 4ETQB 1KIUA 5KW9H 1MJJB 1L7TL 2PTTA 3G5VB 4I0PD 2E7LC 3DVNB 4YC2B 2EO1A 2ADIB 3PV6B 3RU8L 2B4CH 5E6ZA 4WFFD 3HZKA 1JHKH 3BXNB 1VFUA 4JM2B 5ICYB 2XA8H 4PJ5D 4XBGB 5IVNA 2EDNA 1FZOB 1T1YA 1ED3B 2J8UA 3JWDH 3D1MC 1YYMH 2OL3A 2VOTA 4UT6L 5F3HA 1CE1L 3D0LB 5KAQF 1J8KA 2VDKL 5K9QI 1IAIH 4PGEB 4E5XB 1PKQE 5C0BD 3U0TB 3MA9H 5EBLA 4X4XA 5I1JL 2AW2A 3GI9L 1I8KB 2JIXD 2Q8BL 3SO3C 2RFXA 3QUYC 4PJBB 1DQDH 1DANT 4Q2ZA 4P2OD 1A6PA 2E3VA 1ZT1A 4LSPH 3LKOA 2VXTL 5EO1B 3VFMB 3W11D 3L3GB 3D39D 1U8OB 3TVMA 2O61B 5HHXH 5MI0C 3BRGC 1BMGA 1PW3A 1QO3B 4M7JL 4AL8L 5J3HC 3TYGH 4Q7DA 4ZFZA 4YXHL 1OB1B 4FQXB 5ESAB 4N90D 3EGSB 4TPRL 1WISA 3NVQA 3ALWA 3TO4C 1QSEB 1WWCA 4XBPB 2BNQA 1I3GH 1AD9B 1C12A 5DJXB 4ZFOA 2W0FB 4G8GB 4BQ8A 5EO9A 2OXHA 1R5WB 2D7PA 3MNVB 4KMTH 3MGAA 4NRZB 4RGNE 2W9DH 1J12A 1JGEB 4Y4FC 5CP3H 1IGJA 5E4EB 2AJXL 5CEXA 3FO1B 4KKLD 3NTCL 1HQRB 3QHFH 3D18B 4OGAC 4JFOA 1ZEAH 4KI5C 3VXRA 1IGMH 1CVSC 3V6FA 1LGVA 4QRQB 4BZ1H 3WIIH 4PJ8C 4PJIB 4GSDL 4FQQA 4OZGF 4WTZG 5DJDA 1P6AB 5GJSH 3BZEB 2ZSWB 1BBJB 2AEPH 2R9HC 1WZKA 4UQ3A 2Z92B 4KK8C 1W72H 4BUHA 5J6GA 2EDQA 5T1MB 4J3OC 2CD0A 1AKJA 1N59A 4NN7B 2DM2A 1S7TA 3RUGF 4QRPA 1WAAA 5ILTH 3K81A 3KPSA 1I7UB 4HJ0D 1HCVA 4Y4KD 1KB5A 4HIXL 4PY7B 3GM8A 1NGQL 4QRSB 3WXWH 2YR3A 3RRQA 1DBJL 3T3PE 3ES6B 2XZAL 1P7QB 2EIZB 1EGJH 5KSAD 1C5CL 4UIMA 3MRHA 5JOFB 3B9KB 5F1NA 3GK8H 3THMH 3B9AA 3QUXD 5DRNB 4XC3L 1XR8A 4R0LA 2Y36L 3NAAL 1YPZB 4JO4H 1NCAL 4D0DB 2X9WA 5HYQA 3TO2B 3MOBH 1NGXB 4Y0GA 5TDPB 1NGYB 5ISZB 5TPWH 3L7FB 1FO0B 1IGTB 1I4FB 2G5BA 2FEEI 2J88L 5D2LE 2Z35B 2YPLD 4PGZA 3EFDL 1WUNT 5B38B 1NUFA 5GRVL 3RY6A 5D93B 5HI4D 1OW0C 3S88L 3V7MA 3QQ9C 4P4KC 2V7HA 2GEEA 4F2MA 4L9LA 4Y1AE 3FQWB 1QFUH 2NX5B 3OGCB 4MQTB 4R7NB 1HOCB 1JN6A 4JRXA 2VDML 2QKIB 5CCKL 5CMAB 3ZE2E 5H37H 4MXWH 3CSGA 5HYJB 3PXHA 4F7PB 1A21A 3WHXA 5HVWA 3QZWA 5C71A 1U41A 1WZLA 1HHIA 4LF3B 4R3SB 3C5ZA 2E27L 4WUUA 3PQYB 4PJGF 2VZOA 4J6RL 1LO5A 4UT9L 5CHNA 3P0YH 5ERWA 4J23A 4RFEA 3NACH 3T1FB 5FUZH 4IIQA 2FWOA 4IJ3B 1AIFA 4ZQKA 3EO9H 1SEQH 2AK4A 2BVEA 1CFQA 3QXUA 3A6CH 3NCEB 4Y19A 4L4VE 2ZKHL 1TENA 3LD8B 3SCMA 1NKRA 2CH8A 2AJUL 1N6VA 1YJDC 4FTVB 3U48A 1UKSA 4RGNC 4X5XB 3REWB 1T5XA 3O6KH 5EBWB 4JKKA 4XMPH 1P6FA 2H6PB 2NY0D 2GK2A 1F6FB 2F74A 5DWUH 3JTSA 4N5UA 4LAQL 2DBJA 3MV8A 1I3RA 4RMUA 4TSBH 3L3DB 4U6VL 4JQXA 5C0CE 5GHWL 4OIAA 3PWUB 1RZ7H 3CFEB