4R3SA

Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with msp2 11-23
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FV FRAGMENT(MAB6D8) HEAVY CHAIN
publication title Structural basis for epitope masking and strain specificity of a conserved epitope in an intrinsically disordered malaria vaccine candidate
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r3sA00
3PWUA 1DVFC 4ACPA 3QIBC 3BZFA 1C12B 3TBYA 1WT5A 2D03L 4M5YL 4Z5RA 2F8VA 1LEIB 1CD1A 5DMYA 4F57H 1IKFL 3T77A 3VFSA 3SDCC 2C1PA 2Z31D 4Y8DC 1FL5B 4WI3A 4XI5D 4NSKB 2YC1A 4BKLB 2NY6B 3BKML 5MEQA 3CSYB 4QXUL 1TETH 3UJTL 2IMMA 4O51B 3P73A 4IBLT 5J12C 3VE0A 1IMHC 2O5XH 5ALCL 1S7RB 1TVHA 1V7NH 5CEZE 3QA3A 1IC5H 3WN5A 3G5YB 4IRZH 4OIAA 1GPOL 3CVIH 1GC1H 3BH9A 4U1SB 4NN5C 3WFCH 4K7FB 2Y25A 1NC2B 1G6RL 1DL7L 1P1ZB 3VFPA 1MRFH 4O5LL 5SWSE 9CGTA 3NAAL 3MUGB 3OB0K 2CUHA 5E5UB 3KYMB 1RZJC 2OL3B 2P24A 4Y4FD 3LIZH 5F88B 1KCRL 1YPZF 4XVUC 3H9YA 2APXA 2DYPA 5I8KH 1DFBL 1YEFL 1ES0A 5E6IC 5IGXH 3RRQA 2CIKA 1H3WM 3PP4L 2OTUA 4UINL 4MXQC 4C59B 5DEFB 1C5BL 1HXYA 2OS7A 2BNQD 1CXKA 1OSPH 4WI5A 2CKBA 3SDYL 2WANA 1SY6L 1LGVA 4HJ0C 4U4BA 5DLML 3CFJB 3BZ4A 4OZ4B 2EC9T 1KC5H 2Z93B 2XXMB 3SKNB 5C08A 3ROLA 4OV6F 3I6LE 3QEQB 1HKLL 5EUOF 5IFHL 5ANMB 2H3NB 2QQNH 5D7IB 3VW3H 1DN0B 2FX9L 4ODVL 1ND0B 2M8XA 3WFBH 3TH2T 4NO0B 4IOIA 2IANE 2DWEB 4PJCA 2EYTA 4OLZL 2UUDH 4BSWB 4HFUL 5DZNA 4UIKL 3GB7A 5F9WB 3WIHL 2B20A 3OXSB 4MLSA 1P2CA 2YRPA 5I1JH 1FVCA 3K2UH 3TNNB 2VLRB 5TF1H 3QQ3A 3UZQA 3NCYS 2AW2A 1J1PL 1HI6A 3STZA 5EULV 3VWJA 4X9IA 4BQ9A 4CNIA 4JN1L 3VXOA 5EBWA 3RGHA 3JWOL 1YUHB 4LLUA 4PTTA 2ZNXA 3GNMH 5CEZL 4XXDA 25C8H 4MMXC 5KANG 3RZCC 1MJJA 1T2JA 3HFMH 4ZFOB 2NYYC 4KTEL 3QDJB 5C0GB 4JO3H 4Z0XB 3MRFB 1D7FA 1IAII 4NN7B 5C0BD 4XNXL 4CADA 5SX4H 3D0LA 3TC9A 3KPRD 2VXTL 3F8UB 3A6BL 1RZJH 5IW3A 1G9NC 1KLFA 2VLLB 4ZXBA 2V2TB 3EZ8A 1XIWA 1QFUH 1BLNB 3T65A 1MJUH 4M1GL 4DCQA 3PQYD 2AQ2A 3PWVA 3QFJD 1JYXA 3E8UH 3ULUE 1XF5A 2VC2H 5IG7B 1U3HD 3G04B 5D1QC 2AABL 4LHUB 1N6QH 5BRZB 3V4UL 4YBQC 5KVEL 2EKSA 3U4BH 4Z8FL 2O5ZH 3CUPA 3QO1B 5TE7L 5J1AB 1AP2A 4TYUA 2VAAB 1LE9B 1T7XA 2YUZA 2FGWL 4DUVA 4TUOB 3QG7L 3F7PC 3S34L 1U42A 5E9DA 4X9HA 5JUEH 2OTWA 4YHYC 5IB3A 1S7WA 4KQ3H 3RWHA 3UEZA 3WEXB 5H2BB 3MC0A 2FWOA 4WO4A 1FNEB 5KTEH 5C2UB 4GBXD 3HB3C 4TOYL 3C6LA 3WL9B 2XWJB 4FXLA 1AC0A 5DT1H 5EC1A 1DBJH 4DKAA 3I6KA 1AD9B 1DEDA 3O3UN 3BESR 4PGZA 4HCRH 4WUUD 4FA8A 2V5MA 3PNWB 4JFHD 2W07A 2ZJSL 4ODSH 5DUBB 4NQSA 4XNZC 1ZHNA 3DV4B 1SJEB 3HI6H 3CC5B 4EI6A 2AJYH 5CJ8A 2BY3A 5HHNB 1I9JL 2XQYK 1R5WA 5TDPB 3E6FB 1UYWH 4LDLB 5GS0C 3UBXG 2EDXA 5D7JC 1DTUA 3WMSA 3CNKA 3SJVA 2Q7YB 1CI5A 5JPMB 5C0IA 5C0FB 4LPTA 4D2NA 4XWGH 1ZT7B 3AB0C 5DDHA 4EXPX 4Z7UF 1HK6A 4I8DA 1AHWC 2OI9B 1BFVH 2IAMD 2XZAL 3TCXA 3BZDA 4OD1L 2A9NH 5IF0A 5T3XE 5E1AA 2BNRE 4ZQKA 3JWNC 2H2SC 3VD4A 1MCIA 2AI0L 1T2XA 2OP4L 4D94A 4OI7A 2XNAA 4HUUA 1IM9D 4JDTL 4XVSH 1QSFD 4KVCH 4OLWH 1FDLH 5TPWL 3TBTA 5DJ2A 2Z91B 4FFWD 5DURD 3TBSB 5ICZA 1RHHB 1HCFX 2BY0A 3RBGA 3ZDXE 4NZTH 1QVOB 1EEQA 4WU5B 3U7YH 3ULUL 4G80B 3HG1A 4MQTB 5DD1L 3TNMB 1WIUA 5I8CA 3NGBB 5DJ8B 3EYFA 4C83A 4GO6B 3VFGH 5DF0A 2HN7A 1IBGL 1MH5B 2J88L 2B1AL 2FHFA 4LIQH 3KPPB 3O4OB 4K94C 3SHSA 4X7TA 3QDGE 4NCDA 4UQ3B 4EOWH 4GXVL 3L3DB 1P9MA 1WTGT 1QTYT 1CL7H 2KZ1B 4ZNCD 1LEIA 5E03A 1GSMA 3QIWD 5GGVH 4Y1AA 1EJ6A 1JI1A 1H3TA 4OAWA 4BKLA 4NSKA 1NC4D 1CU4L 2XN9E 4PLKD 1CGVA 2Z35B 1T0MB 1WCBB 3Q0HA 4DTGL 2OTPA 4XPGL 5FA4A 4O51A 2QQQA 3VXQB 5L7XL 43CAB 3DROB 5IMMA 1RU9H 2X4OB 1S7RA 4NUGL 4U1MB 1YMMD 1OAYH 2WUCL 1T6WA 3G5YA 2BSRB 1IARB 4GRMB 2DQCH 4K7FA 2OM5A 1TMCB 2Q7NA 5GS0H 1I9RL 5C8JB 1VFMA 4PJHF 4MNHA 1NC2A 5FCUL 1P1ZA 1AXSB 2D9CA 1PX3A 2VDQL 1RQ5A 1NFKA 4KK9D 4N0CC 4LCWE 1SM3L 4R97C 3IFOB 3CD4A 4KHXL 3T8XA 2OL3A 3FB8A 4RMVA 3V4PL 5GZOD 4N9GB 5F93C 5DJXB 5GGTL 3IDXL 3RX8A 2J5LC 1FG2A 3BT2H 2EDNA 2IQAB 2P5WE 2JJWA 5T3XL 5ADOL 5CJXA 3VDAA 4HC1H 2ZSVB 3VMOA 1FO0B 5DEFA 5F9OH 3T0EA 3UTSD 4N90E 5DJCA 1PG7H 2JELH 5JW3L 5AZ2H 4ZO9A 2FBJL 5CD5C 3V0AC 3IS0X 4MZ2A 4NKOB 2HFTA 3WNMA 1F13A 1JNHA 3CFJA 1CDYA 3UTTB 3T4AA 2EIZB 3BP4B 3M1BB 3ALXA 2H32B 3RUGF 3LQZB 2Z93A 3DJ9A 4YAQA 5K93A 1W72H 5J7CC 3T3PE 5AUMB 5MI0B 4XH2B 4U1KA 4X7EC 5HPOA 4KK6C 5ACMA 2I5YH 5ANMA 2H3NA 4E5XB 3VXUE 1DN0A 4G5ZL 4W81A 1JWMB 2NR6C 3LHPH 3P9LB 4XCYA 3JWDL 1A3QA 3KYNB 4BELD 1VGEH 2CLVA 4DFIA 4UBDD 4P4RB 1A7PL 4AIXA 4K94H 1HHJA 3P3YA 2VWEC 4B50A 3NBNA 3TYFB 4YHZL 3TNNA 1TPXC 4JFYA 2VLRA 3OHXB 6FABL 4MNGB 2DBLL 4Z7QF 4M8VA 4KROD 4G6JL 2WINB 1YUHA 3MGAA 1HDMB 3D87B 2IEPA 1AQKH 1FNSL 1CGUA 2Q1EA 1TCRB 4PIRF 4ZFOA 1D3CA 1I75A 3QDJA 2E8YA 3ESUF 1P4BL 2F74A 3MRFA 5FGBC 5D1ZB 4P5MB 4HXAH 3ARGB 3U0PA 4NQEE 3CLEH 3HUJF 1KCLA 3I6GB 3VWKB 1YYLL 2JJTA 1BWWA 1F4HA 2ZP0T 3MJ8B 1EHLL 3MPCA 3CGTA 1MFDH 2V2TA 1BLNA 2VL5A 3AM8C 5I17A 1XZ0B 5ESVB 2B5IB 4G6KL 2VDKL 1XF4B 3OAUH 4CU6A 3G04A 2ZSWB 3KNBA 3ARBB 5BRZA 1X5ZA 4PJ9A 3JZ7A 2R4RL 1VCAA 1FPTH 5HDBF 1I7UB 5J1AA 2OK0L 5EG6C 1A6ZA 3W11D 4TUOA 1BEYL 4PUBH 4LMQI 3CZJA 1IC1A 4OV5A 4LGSB 2QJDA 4E9LA 4AH2B 4R4BB 5H2BA 1T0NA 2FIRT 3GKWH 1QLEL 3WL9A 2ZUVA 1Q1JL 4QHKJ 3KG5A 1AO7D 4EIGB 5FUCC 3FT2B 1WWCA 3CVHH 1ETZB 5HYJE 3VD5A 3PNWA 4NO5B 5ITBH 1NEZB 4AK1A 5J9PA 5FEBA 5AG8A 5C0CB 3IDGB 4ISVA 4PJXE 5HHMD 1ZWIB 3DV4A 4PJAB 1SJEA 3CC5A 4J4PA 1F02I 1GOHA 4WEUD 1CE6B 1F6AB 5HHNA 1BQHG 3KJ6H 5TDPA 4PP2A 1QG3A 1I8MB 1QSED 2Q7YA 5DTFB 1F45A 5JPMA 4D9LH 1CLZH 4LARH 4PRBB 4OFKA 4NKDB 2C4FU 4QRRA 3EJZC 4D9QD 1YEGH 3OL2A 2EZ0D 1W2KT 4X9FA 4XAKE 3JTTB 4F9LA 3DO3A 5FA3A 1T5WB 3QUKB 4GLRH 2VO5A 5C07E 1R5VA 4NFCA 3MTRA 3AS2A 1DUZA 3MV7D 3S5LB 4TUKL 2H2PC 2Z91A 4Y4HB 3WJJA 2NX5A 3GO1H 1NBQA 5T3ZE 4F37F 3K74B 1P84J 5GGUA 1OLLA 2DIBA 1QVOA 1I7ZB 3WXVL 4YXHH 5C2BH 4G80A 3ZTJH 1LO4H 1HH9B 1L7TH 4A6YH 2R56H 3EZJB 1RIUL 1N6UA 4L3EA 3RVVD 4LNVA 2IFFH 3X3FL 5D2LB 1J5OH 1DUYB 2MNUA 3VCLB 3UC0H 2HVKB 3MJ7B 2LU4A 3IDNB 2EDJA 3NCEB 1NCDL 1GVIA 2CSPA 1OARH 2OSLB 3N1GC 1UKSA 2LE9A 5IBUG 1LK2B 2FLBT 1CGXA 5EO9B 3AY4A 2YD8A 4LHQB 3O0RL 4IRJA 1NGWB 3NCCB 2R8SL 4Y5XC 4OFVA 3GJFB 2D4DA 2EDDA 2AK1L 1X5YA 1T0MA 3O3DB 3WO3B 1V05A 2UZIL 3VFTA 1IL1B 5HHXH 3VXQA 4MAUL 5DD5L 1OM3L 4JO2L 1NGZB 4XVTL 1A7RH 1QBMH 2X4OA 3SKMA 4GSDL 1INQA 3SDAD 3U7WL 3WNLA 4LVNB 4TSBH 1DN2A 1XGRB 4DVRH 4BSJA 4GRMA 5JHLL 2P8MB 1CLYL 4H88L 3QB7C 1T5XB 3HKFA 1Z5LB 5ISZE 3FB7A 3SE9H 5C8JA 3ZMRA 2F8XC 4JRXE 1G9ML 1MCNA 5FYKH 4UUJB 5H94B 2YK1L 3C9NB 5KSBA 1N5YH 4X5XB 3IFOA 1JF6A 4M00A 1Z9OA 3L3JB 3UAJD 1E4KA 2JCCE 1F3RB 4N9GA 4E42B 5DJXA 1MJ8H 2ICEB 1YEKL 4GH7B 2IQAA 3GI9H 3O9WD 3VXRB 4MD4A 4ODHH 5KVFL 4WWKC 2ZSVA 4JQIL 1FO0A 2VXSH 1P4LA 1ODAA 3G6DL 5DO2D 4JJHA 4AJ0A 4N5UA 4NKOA 4E0RA 3U0TB 3UTTA 3VXPB 1CFBA 3BP4A 3H3KA 3M1BA 2H32A 4FABL 1M05B 4M7ZB 3SBWA 4XH2A 2F5AH 1SJVA 5IK3B 2Y7QA 4TULL 1E4XI 3F7VB 4BA8A 3PHQA 4E5XA 3D25B 3X12B 4GS7C 4WGVB 1JWMA 5TJWK 4S1SH 5C9KA 4JRYD 4PJFE 4P23C 2QADB 4NIKB 3VI4E 1GAFL 3KYNA 1QYGH 5GS2H 2X9WA 1D5IH 1J0IA 1A2YB 3V8CA 1K2DB 3PF2A 3ALPA 4H8WC 2ENSA 2J12B 5I1IH 2ZZUT 4OGYL 1U8KB 2MQCA 3L95B 4H26A 4OZFA 4Y16A 3TYFA 3S97C 2BVQA 4PJBA 5B4MD 4OZIE 5E2UH 1PSKL 5D1XD 3OHXA 5EOCJ 5I74C 4MNGA 4YFLF 1Z9LA 1M6OA 2W65A 4HK0A 5E24E 4JHWH 1KEML 2BVUA 1HDMA 5TDOB 1BFOB 1RSFA 2ERJB 1FFPB 2R0LH 2R0KH 3KR3L 3VGBA 4P2CG 4I3SH 1TCRA 2EH8H 3BGFC 2F54E 4PRIE 3C09C 3H42L 1AGEB 4ELKB 3HI1B 4RFNB 5D1ZA 1CLOL 3ARGA 2J6EL 1VADB 4P3CL 5LBSH 3I6GA 4U1IA 3VWKA 4HIXH 3LN4A 3MJ8A 5HHVH 3WN5C 3BP6B 3D69B 4PS4H 3WNNA 2B4CC 4FZ8H 4P0DA 5IB4B 5CJOL 3AU1B 3WFDH 2FEDD 2YPVH 3CFIC 5GRVL 5FF6B 4DW2H 1XF3B 2UWEE 1GL4B 4X7CC 5C09E 3Q5OA 1XZ0A 5KW9H 5ESVA 1XF4A 2AXGB 4KRMB 5DJYB 4L4VB 2ZSWA 5HHOE 3ARBA 3MOAL 4ZAKB 4LCCA 1P4IH 1I7UA 3W9DB 3G08A 2HTKD 4XWOC 4PJ5B 1KEGH 2OXHA 2WUBL 2YSSA 3RNQA 4MWFB 1I7RB 2A77L 4MQ7B 5E2WH 1KCVL 4Y2DD 4HJJH 4RZCA 2BOBB 4ODWB 1OD7A 4AH2A 3E2HB 4R4BA 3J8F7 4PRPA 4IHOB 1IC7H 3GSOA 3MLYL 3UCRA 4OZHE 5C0DA 3IF1B 4Q6IB 3S96B 4DKFL 1LVEA 3BVNB 1WF5A 5E8DL 2EDLA 3LRSB 4ONFL 5IJKA 3FT2A 3LKPA 1ETZA 2PO6D 5JXEA 4NO5A 2VLKE 4H8WH 2DKMA 3SE8L 3Q48A 2Y06L 5C0CA 4KJPD 3IDGA 4O58L 5LKNA 4N9OB 1ZWIA 2D3VA 1PY4A 4PJAA 3OR6B 5HYIA 4NWTL 3IETB 1HILA 5F1KC 2WWKO 4K7PL 3S37L 1CE6A 1F6AA 3CMOH 3MV8E 3TN0D 3KHQA 1JUFB 4HDIA 4ONGH 2YMXH 1I8MA 3L5XH 3GMLA 3ZTJG 5DTFA 4JKPL 4LF3B 4X6BB 5TE4L 2AKRA 1NCBH 5T5FH 4CUCA 3QXAB 2ORBL 4PRBA 1F4WL 1QBLH 2GJ6E 3VRJB 4RISL 5DK0A 3JTTA 3T3ME 2CXGA 3NCFB 3BP5B 3FRUA 4LKXA 1CBVH 4PGCB 1T5WA 3QUKA 2DLEA 4BUGA 2DQTH 4URTB 4QHUB 4KDTA 5IBLC 3VXSA 4EN3A 1EIBA 4QRUB 4PJ7A 5FOJA 3WO4C 2MPAL 4NM8H 3QEUA 3TBVB 3S5LA 1CXHA 2B4CH 2FB4H 4G7YH 4KMQA 4JM2D 3SCMD 2F19H 2GTWB 4X4ZA 1K3ZA 1QO3B 3A67H 4CW1B 4KY1H 2HLFC 1HH9A 2ZG3A 1KXVC 4GAJL 4XPHL 4I0PD 4QHNB 3VGAC 3G5ZB 1XIWC 3PIQB 5F1NB 1CGSH 3Q6GH 4JFQB 4R4FH 3O6KH 4X6CA 5I76B 1PEWA 3RGVA 3VCLA 2HVKA 3IDNA 1RIHL 3G6AB 1A1NA 4I77H 4KHTL 2OSLA 3LN5B 1M7DA 2JB5L 2CKBH 1SYVB 4XAWL 1NGWA 3GRWL 3GJFA 2PR4H 1GOFA 3O3DA 2I07B 4XBPB 4P5KB 4OCSL 1JN6B 1NEUA 2WP3O 2HLAA 4G6FB 4YX2L 4WO4C 2XQBH 3FRPG 5F72S 3C6LC 3VI3F 1XGRA 1WQVT 1ZTXH 5C0EB 3MLZL 2P8MA 1Z5LA 3SGKA 4HQQL 4BZYA 3MRLA 5DVOA 4UUJA 1Z9MA 5H94A 3C9NA 4XPBH 4AG4H 1XGYL 3L3JA 3KWWB 1KCSL 2IANB 4E42A 1G7MA 5KSAD 2AP2A 1FL3B 1QRKA 1EHAA 3FFDB 3VXRA 3LOWA 3I6LD 5FO9A 3F7RA 1BREA 5CCKH 5F89B 3RL2A 1A7OL 4OI8A 4PGDB 1SVZA 5E8EB 3KLHD 4KTDL 4RGOH 1CTOA 1DBKL 3DOSA 5EA0L 3U0TA 4TNWF 3VXPA 2ICWA 4WWID 2XACC 3RX7A 1M05A 4ZSOB 2RGSA 4ZTPL 5IEKB 3S3PA 1NCCL 3NFSH 4QRPA 1E6OH 3F7VA 5GS1C 1OAQH 3D25A 4NCC1 1PDKA 4U6HA 1KB5L 1C5CH 5L88L 2DN7A 1NUGA 2XPGA 1KIPB 4ALAH 5KVDH 1HZHL 5F1IB 1K2DA 4HWBA 5MENE 1GHFL 3TJHC 4N0UB 3HE6B 1OOAA 3L95A 1MRCL 1HHKA 2PTTB 1I7TB 2RR3A 1OAXL 3RBSA 5I1GL 4IIQB 4M6MH 2AJVL 4M48L 4ZO8A 5IQ7H 4Y4KD 4F7EB 1SMAA 2DIAA 3WFEH 2Z31C 1MIMH 5L8JB 4XI5C 3TZVD 4LP4A 5I9QB 5FOBB 1PG7X 1A22B 1TXKA 1I1AD 4G8IB 2V7NB 4ZFGH 2A9MH 1QQDB 1BFOA 1M1SA 1FFPA 3EYSL 2VN7A 3UZEA 1L9MA 4HFWB 1VKXA 1B0GB 1U8OA 3B5HA 1H8SA 3O3EB 1E4WH 1MNUL 2Y6SD 2E9BA 4XMKL 4R96B 5HVHB 2ZPKL 1NMCC 4OZGE 1AGEA 3ULUD 1S78C 4G6MH 4JFDA 3RTQB 2WWMD 4DGYL 5D72H 3QUML 3E3QC 4G9FD 2LU3A 3BP6A 1T7ZA 3BQUD 4IOSD 4Y4FC 4YDVA 3TVMD 2FDBP 4DK3A 4XP5L 1H15A 5ADPH 4X80H 4K23H 3ZHDA 3AU1A 2VLME 3K1DA 5CZVL 2VAJA 3BSZL 4PV9B 4R90H 5FF6A 4C4KO 1N59B 3D9AH 1J05A 3QCVL 1L6ZA 2X89D 1WBYA 2AXGA 2R23B 5DQJA 4WTZG 4ERSH 1S7SB 1NFIB 5DUPH 5LGJB 3HNSL 1LO0L 2KL6A 3BUTA 3M17A 4NQDE 4X99B 3F12A 4XNQB 1BZ7B 5CJXC 4MWFA 2NY1C 4JFXB 1I7RA 1L6XA 1G6RA 1MF2H 3OJ2C 2DBJA 4N0FA 3T0EC 4NO3B 5IFJB 2YN5A 3TA3A 2AXFA 1CDBA 2BOBA 4ODWA 3U1SH 4FXKB 3MGOB 4XP9L 2WQRA 1NPUA 4IHOA 3PL6B 1A14H 2IPTH 3ZYJA 1BAFH 2HFGL 4Q6IA 2GQHA 3S96A 1ZA6B 3BVNA 2BNRB 1C7TA 4F37K 4ENEC 5IVXE 3LRSA 4OKVA 4L9DA 4LQFH 1XT5A 2DM4A 5LGHH 2Z4QB 1XF1A 5I71C 3G5VB 3IKCA 3B2VH 3OKKB 4JDZB 5EIQA 1IGIL 1SY6A 3IETA 1FNFA 4MJ5B 2BZDA 4N0RA 2FBOJ 3ARDB 5EORH 5F9WC 4HKZB 3BD4A 3W0WE 5ICYA 4J1UB 4LF3A 4JM2F 4X6BA 3CFCL 1N0LA 1OW0A 3QXAA 3VRJA 3PV7A 5CMAA 4BFBD 1NBZB 4NC0B 4NRXB 5JA9A 5K59E 3QDGB 1T2QL 4XMLH 3UJJL 3P30H 4HUVA 3SCMA 1DZBA 1DDHA 4PGCA 2J4WH 1X5LA 1A6AA 3K4DA 4GKSB 4P9HC 3BEVA 5M94B 4QRUA 1UWXH 4UI2A 4R7DB 3TBVA 3SOBL 2VDNH 1S7QB 2GTWA 2Y5TB 4MVBC 4PR5B 7CGTA 2CXKA 1ZSDB 3QUYB 5SV4A 2JJTC 4CW1A 4PJ8D 4PJCF 3O6ML 2D31B 4LASH 2DLIA 1KULA 3MXVL 2OL3H 3OGCB 1CIUA 4KH2A 1LO3H 4ONOA 5HJ3B 4L4TE 3U36A 3ZZ1A 4JFQA 4K8RD 1OLZA 2MCPH 1JP5A 1B2WH 2IG2L 3HZMA 5A3ID 1Y0LB 3SY0B 3HCVB 2DQGL 5SWSA 3DI3B 4ZPVA 5FGRA 3LS5L 2ZCHL 3G6AA 3QISA 3VXNB 1S5IL 5GRWA 1P69B 5AD0B 3QEQD 4PJ9C 4KVNH 1SYVA 2VB5A 3RWEB 3GBNL 4GBXC 4PG2A 1K8IA 4NO0D 1ZEAH 2VITA 1T3FB 3EYOA 2P5WB 3JV6B 4WCYL 4OLYL 2IALB 4I4WA 4LOUD 3ZO0A 5GRZA 1CR9L 2I07A 2XA8L 3TO4B 1JN6A 4M03A 3JV4B 4NKIH 1MVUB 4OBSA 3BUYB 4U3CA 1L4IA 4HSQA 2YRZA 5ACLA 5C0EA 3MLVL 4KPHH 4KRPB 1HXMB 2QL1A 1YEIH 5GGQH 5B21A 2FLRT 4L5FH 4KI5E 4HS6B 4PRHB 2VJXA 1N26A 2EEBA 4MAYB 3SDXE 5IIEB 1CZ8L 4KV5E 3BEWB 5H35A 2JLLA 4PB0H 1FRGL 3ETBF 3U83A 2DQIL 2GHWB 3KWWA 1KCKA 4J4PC 2IANA 3KPQB 1TJHH 2HMID 1MHPH 5BS0E 2IAMC 3FFDA 2HT2D 3QDME 4KZEH 1W0WA 1JMZA 1CICB 4UT9L 2J8UF 4JKKA 4MGXA 5F89A 1UWGL 3I02A 1KPUB 2A38A 5AWNH 5EUKB 4NQXB 5E8EA 3T2PA 1EGJL 3DGCR 4JY6B 4FFWC 2H6PA 3LZFL 3LH2H 1PY9A 3RDTB 4F9LC 4K07A 4WY7L 1J86A 1N7ML 2CDFA 5IEKA 3D39B 2IQ9H 4LHUD 4UAOB 3AXLB 4JAMB 2DQUL 1FAIH 4XVJH 5J11C 5DD0H 5FYJE 4JY5H 3RWFB 4FHBD 3WJJC 1XMWA 1KLUA 2M2DA 3O6LL 2XZCH 4JO1H 5E8NB 4NQEB 4GAYB 1KIPA 5FM5O 4LFHG 4NN6C 3TYGH 4HV8A 2DQJL 3NGBC 3BKYL 3U9PH 1KBGL 3HE6A 1N64L 2PTTA 2WBJD 2AV1B 4RAVA 1A0QL 5JOPD 1W0VB 1I7TA 5LWYH 1MRDH 3DECA 4I18B 3HC3L 5DRNB 4Z18A 3MNWB 4F7EA 2CGRH 1KIUA 3V7MA 5FOBA 1FIGL 3MOBH 4MA8L 2F58H 5C0AB 3V52L 4P59L 4G8IA 3MNVB 2Q8BH 4H25B 1QQDA 1KPRA 4P5TB 2WWKT 5J6HB 1OP3H 2X1PA 4UNTA 4HFWA 5I19H 1IGCH 4EKXA 4IRJC 3MA9H 1SHMA 1XFPA 1MAMH 2YPLD 2ARJB 1FYTE 1E0OB 1LP9E 1FSKC 4GMTH 4GMSL 4R96A 2YUWA 3NPZB 2VIRB 1CVSC 1ONQB 1BQSA 3P9WB 3GGWA 1DBBH 4BZ2H 4ELME 5DGRA 2DLGA 3C08H 3RTQA 3HRZB 4YQXH 2N7AA 1WWBX 4D0DA 3M8OL 3ARFD 5E2TL 5GZOC 3SGJC 5BO1H 4RX4D 5D71H 4PV9A 4Y5YB 3QUZB 1PGRB 4YDLC 1GH7A 5CILL 4G8GB 2GI7A 4PJXB 1E4KC 3QJFA 5JPNB 1PZ5B 4UDTB 1S7SA 1NFIA 5HVWA 1UGNA 5GISH 1U93B 1JPSL 4UB0L 3UTOA 3MREB 1JRHL 5HYJD 1H3UA 1U95B 2EDOA 4R9HA 1BZ7A 4N68A 1NGYB 3QWRA 2A0LC 2HFEB 4KKCC 2YUXA 1NUFA 1F6FB 4K3GA 3QH3B 1PZUB 1RUPH 1YNKH 3FT4B 3T0WA 2E9WA 5FYJL 3UZVB 4GRWH 4NJ9H 1T1WB 3WE6B 4R0LB 4Z76A 1EFXD 3U48A 1Q72H 3GHEH 1OF2A 5DRXB 1N6VA 1ZA6A 5CZKA 8CGTA 4YHML 4JHAH 2BNRA 4JG0H 5EDXA 4UBDC 3QEGH 5FUZL 2OCFD 5FUCE 3ALWA 2P7TB 2Z4QA 2QKIB 4NP4L 4X5LA 5E7FA 3KPLB 4I3RL 2JIXB 4NZUH 3G5VA 3OKKA 4M9PA 5SX5K 4JDZA 2VZTA 1YEHH 2V17L 3QP3A 4O2FA 4TTDD 4KDVA 2VZ3A 3UTPD 3WYRA 3QUXB 4MJ5A 3ARDA 2LVCA 4HKZA 4KROC 3I9GH 4I9WD 2IADB 4Y16C 3V95A 2FD6H 4OLVL 4QF1B 2C3VB 2V2XB 1MHHB 3OKDB 1CDHA 3U0WL 4HT1H 1ZT1B 3QIUB 1IQDA 1NMBL 4HWEH 1IKNC 3PDOB 1PAMA 1NBZA 2QR0B 4NRXA 5TH2B 5I15H 1NLDL 3QDGA 1HINL 4PLJC 5CFHA 3HI5H 3JXAA 4J3XA 3MRBB 4NKMA 1CFQA 4JM4H 4OQTA 3B2UC 3O4LB 5IW6A 4FFZL 1S9VA 4FQXD 5D8JL 4LCUB 2DM2A 5E56A 4R7DA 3LRGA 3PWPD 1JHLH 2QQLH 4F7TA 5D1ZC 2XN9A 1KCUH 1QPXA 2YKLH 5KN5B 2E27H 5E00A 2X4SB 1S7QA 3ZTNL 5HD8C 2Y5TA 3CXHJ 3QUYA 1PW3A 3UYRH 1QLFB 4HIHB 3RP1A 2D31A 1LO5B 5MHSD 4YHNB 1UM6H 3OGCA 3ECBB 5FO8B 3C8HA 2ADJB 4G3YL 4HAGA 1VEPA 3PGFH 3UMTA 3IFPA 1HN1A 1AJ7H 3PXHA 5ISZB 3OAZH 2BVOA 4XNUL 4JRXB 4RWYL 2DQEH 4ZD3H 1WFNA 4LCWA 1FO0H 3VXNA 2DD8H 2OQJB 1UJTA 3ES6B 4LCCC 5J13B 5AD0A 1M7IB 2JCCB 4PY8J 2R0ZL 4JE4B 1DE4B 4CGTA 2NY4D 1T3FA 3SPVB 2P5WA 2ED7A 2IALA 2H32H 5DSCA 2XZZA 1E6JH 1JCKA 4TNWK 5L0QC 1MLBB 1BWMA 3JV4A 4HEPG 1MVUA 1U8PB 1ZANH 2JJSC 1RJZA 4KGJA 4RFEB 1FNLA 3D2UA 3PDGA 3O81A 3QPXL 4QOKB 4P4KB 3UO1H 3OKOB 5IJKC 3ZL4H 3PHSA 2A73B 4WHDA 3O8XD 4HS6A 5L8LB 1VFBB 4KC3B 3SE4C 4MAYA 4GQ9H 4Z7VE 3SDDB 2YD9A 3BEWA 4OZFH 3VXUA 2ZWLT 3ILPA 4ZG1A 2ICWJ 5KSVB 4M8QB 1MCFA 3KPQA 4ZS7L 4FQLL 1ROWA 1MJ7L 3FFCE 1MCHA 1O0VA 3WS3B 1WICA 1CICA 1NGPL 2XTJB 3QCTH 2BDNH 4IM8A 3THML 1KPUA 3OR7A 2ZUYA 1PEZA 3BDBA 3LVEA 4LHUG 4OCNC 5EUKA 4OZIB 1NMAH 4NQXA 5HI3D 5DYOB 4FFYH 4C4KT 2FJHB 3CFBB 3GZKA 5CUSH 5FAAA 4XP6H 5E5RB 1PKOA 3RDTA 1ZS8B 2VZUA 1F4YH 3BFOA 1FJ1B 1WZKA 4YBLB 2R4SH 4KDTC 4S2SB 2VNCA 3GMOA 5CP7B 4EN3C 5L2KB 5I1EL 4JAMA 5D96B 2F54B 4NQVB 4UV7H 3UDWC 3RVVC 4XCFL 1XGTA 5DJ0B 2X1QA 4J6RL 3AREA 5E8NA 5CSGA 3MJ9H 4NQEA 4YPGB 1SEQL 2IMNA 5I1LB 2VKXA 5FGCE 5JTWA 2G60L 2APTA 1B4JL 3SN6N 3V5KB 2NY2B 2XRAH 2AV1A 1W0VA 1QKZL 4KJQD 3RGVC 4KJWC 5DRNA 4D0BB 4LEOA 3FO0H 3MNWA 4NC1E 4Z78B 3I3EA 1I1FA 2UWEB 3UBXB 4X5WB 4J2XA 4P3DA 5C09B 5C0AA 1LK3H 3QO0B 4JFFE 4H25A 1RURH 4P5TA 2NXYB 2EEDA 3OKNB 1T80A 4G7VH 2CJUH 5CINL 4EZMA 1G0DA 2ARJA 3QJHB 3SDAC 1J0HA 4XB7A 3B9AA 5FV1L 4MDIA 4TVPH 1DSFH 4LCIL 4U1JA 1CFSB 1CN4A 4GRWF 3LKNB 1ONQA 3V9FA 3OJDA 5I1HL 1MI5D 3FN9A 4JFEE 4OF7A 4Z7UB 1QRND 5KBNC 5GRJL 3I2CL 1OAKL 5SWZD 4ZFFB 3UAJC 2R29H 2EE3A 5ITFB 2NY0C 3GK8L 2VSDA 3SGKC 4NNPL 1YNLH 4MA1B 3OZ9L 1YC8A 4Y5YA 2PXYD 5D4QA 2DQDH 3ROOA 1P7HL 1CXIA 2FATH 4KUCD 4WW1B 4PJXA 4GXUN 5JPNA 3U4EA 1PZ5A 1CDIA 3HMXA 4UDTA 3RKDD 2CMRL 3MRJB 5DO2C 4Y4HD 1CFVL 4KJYB 1QD0A 4F7PB 3TT3H 3HHRB 1IGJA 3BDXA 5DRZB 1U95A 1NGYA 4AIZB 2HFEA 2FX7H 5HGDB 4J23A 4Y19E 1RVFH 2GCYB 3CXDH 4NHCL 1KXTB 3OPZL 3WS6A 3RA7H 3MV8D 3QHFH 4XNMB 3WE6A 4R0LA 3BO8B 1FG9C 1YQVL 3C60D 4IMLA 3T2NH 3G5XB 3NMEA 5DRXA 5L9DH 4BK4A 4UT7H 2NXZD 4YDKL 2XZQH 4QO1A 1MEXL 1R0AL 5C07A 5I1AB 3CDGB 1OAUL 2P7TA 1KN4H 4MYWB 2BNUB 2FO4B 2QKIA 3KPLA 1Y6MR 1OWRM 5KOMC 2BVPB 3BAEH 4LSQH 1WEJL 3HC4H 3RWIB 3EO0B 3GIZL 4HUKB 1IGMH 5D6DC 4QT5B 2P5EE 3ESVF 2HT4D 1UB6A 4N1EA 2IADA 5IT2L 4UTBL 3KS0J 4QF1A 2XG4A 2G75B 2V2XA 1MHHA 1RZKC 5LXGH 1A6WL 1KB5B 4HXBH 4PJHB 4R7NA 5AAWA 3GJFH 1UZ6E 4LHJB 2BHYA 2VRAA 4OF5A 5TH2A 4XPAH 3BDYL 1MIEL 2W0KA 4NRZA 5B3NA 1DVFB 3QIBB 2CDGB 2XXCB 4LGRB 3QHTC 1WVZA 4LCUA 1A9EB 2FYYA 5EZOH 2EDFA 1CXFA 3U6RA 3O2DH 3BE1H 2UY6A 3T2QA 3B8YA 1MFEL 3PG2A 5E95B 5KN5A 5ELIA 2FEDC 2X4SA 4GAFB 4X6EB 1OL0A 5C0JB 3CX5K 3CZFB 3VFUB 1R3LB 4WDIA 5J12B 1LO5A 3E6HB 5FO8A 1ZV5A 5F6HI 1EO8H 2ADJA 3KXFE 5GS3A 2HTKC 1RPQA 5CAYB 5ISZA 4NN5B 4PJBF 5F44A 4PY7A 4JZOB 4JRXA 3BHBB 1JGVH 1NAKH 4UILH 4Z7WE 2DB8A 4MB5A 2NW3A 1U3JA 2OQJA 2HVJB 3QCUH 4OZFG 3WNPA 1M7IA 1IAKB 2JCCA 3DX8B 3QI9D 4APQA 1PG7W 1BBDL 2X1WL 4QHLA 3VFMB 1JTTA 3V7AE 5BVPL 1DE4A 4OB5H 2QADD 3N06B 4AENA 1KELL 4MS8C 5E6IB 2E6JA 3VFRB 3TA3C 3WXWL 5GHWH 3TFKD 1MLBA 1S8DB 2PO6C 1U8PA 3D3VE 4ORGB 4OJFL 2OR9H 4WUKL 3UYOD 1FORH 3MRPB 4ZYKB 3ELAT 2ZG1A 3X13B 4U7KA 5K9JH 1JWUB 1R3JB 3V0WL 1NGXB 3OKOA 4LAQL 3TN0C 2A73A 5M7QA 4HWBH 4E41E 1VFBA 4RDQF 3K4ZA 4HIJA 1X4XA 2VXQH 3RVXD 3FB6B 4FQIL 4ZS6D 5C6TL 4KAQH 5KSVA 1RZKH 1MCPH 4M8QA 4PJFA 5D2NC 5BZDB 3HUJB 4AEHH 3MRCA 5KG9B 1GGCH 2VLJD 4OCRL 4RDQG 5JQ6L 2XI9A 1AFVH 3WS3A 5DFTA 2LV4A 4PBXA 3CSGA 3ET9F 4MA7L 1BF8A 3ZE2F 4OZIA 5DMGC 4AEIH 5D7KE 4DGVH 1J7VR 5DYOA 4YR6B 3MROB 4OM1L 1K8DB 3CFBA 4MQSB 4L29B 1ZVYA 5TE6L 3AMKA 5MEND 2RB8A 3OKEB 3SCMC 1ZS8A 5MEOB 4N1CA 5J1SC 1FJ1A 4M93C 5EOCL 5HBBA 2OR8A 1EEZB 1ZLWH 4OFIA 5FYLE 1E28B 3BISA 4S2SA 1Q9LA 2D03H 4L4VD 1ZA3B 4ZAKD 2F54A 4NQVA 4PRIA 4I0PC 4WENB 1IKFH 3RKPA 4JDVB 5GGSB 5DJ0A 3RZCB 1ITCA 4OZGB 3JTSA 1A64A 4PJ5D 3BKMH 5SWQB 3JWOC 3MZTA 4QXUH 5AYQA 3S3JA 5EU6D 4PJAF 1IEAB 4HW6A 5T1KB 1Q9OA 3IJSB 5IVOA 4POUB 5ALCH 1BQLH 5BJTB 3V5KA 4QGTA 2WBKA 4X6FB 3X3GL 1HEZB 4FQHB 4NQCD 4TTGA 1GPOH 2DWDB 3IJHB 3L3KA 4D0BA 4XTRD 3ARRA 2UWEA 5CSZA 3RPIA 5C09A 1G6RH 4ZO7A 3CH1B 3TF7C 4QXTB 4LBEB 4O5LH 3NAAH 3QO0A 5HHOA 1D9KB 1QFHA 5D1QB 3MLSH 3OKNA 2QTEA 4NQDB 3QJHA 4PG2C 1KCRH 5I1CL 1R3IL 3HAEB 4CKVX 1DFBH 1YEFH 3V4VL 1UEMA 4KTYA 1WTLA 2XFXB 3PABB 3LKNA 5I0DA 3PP4H 4UINH 2W9DL 1MWAL 1QNZL 1K85A 4DZ8B 4BFIB 4YHYB 3IFNL 3CX2A 3IAQA 4P2OB 4G6AC 3WDIA 3SDYH 1YMHB 4OZHA 3S5LG 1SY6H 3E3QE 2HG5B 4OT1L 4WJ5B 5ITFA 4NOBA 5DLMH 4D9RD 5IVXB 2Y9RT 5FO7B 3N1PC 3BD3A 4HBQA 4X6CF 2VLKA 5D2LF 5CIPA 1U9KA 3CAFA 5IFHH 3VXMD 2UVFA 1QR1B 1A7QL 2FX9H 4JREC 5DWUL 4K3JL 4ODVH 3KLHC 3DO7B 3MRJA 4XNZB 2X1XR 1CD8A 2BNQE 4X9GA 4JY4A 4KJYA 3WDHA 4F7PA 4MCZB 3EO1B 3W0WB 2F5BH 4AIZA 5FYLL 5D7JB 5HGDA 7FABL 1QEWA 3DHJA 1ZHBB 2GCYA 4H0GA 1I8LA 4Q9QL 5KS9E 4K3EL 2EXYD 2GJ6A 1V7ML 2UY7A 1J1PH 1ACYL 4XNMA 3AB0B 3GMQB 3BO8A 3KS0H 4KI1A 1FGNL 3T08A 3A0OA 4JN1H 5DXWA 1AHWB 1RUKH 1RD6A 3JWOH 5DJZB 5I1KL 3Q1SL 1Q9WA 3NZHL 4YFDB 1JPTL 5D7LD 5I1AA 3CDGA 4ETYA 1TETL 3I3BA 5CEZH 1KPVB 4I2XE 1DP0A 2BNUA 3QULA 1HHIB 4KTEH 1NFDE 3BPNC 2BVPA 3RWIA 2XWTA 4IRZL 2BC4B 1CXEA 3LEXA 3HR5B 1GC1L 3TZVC 4QT5A 1N8ZA 3WFCL 1AGBB 1OT2A 5FIEA 4X8XA 1ZLVK 1I1AC 1I3GH 4C54A 1EA9C 1N2RB 1XGUB 3IS1X 3A6BH 4JQXA 1MFAL 4L4TB 5B3JE 2KDGA 2NY3B 1KB5A 5HGBB 2BXZA 3L1OL 3LIZL 4M1GH 5DK2B 3ULUC 4P2QD 5BV7L 4M4PA 5I8KL 3QXTA 4XZUB 2BHUA 3CFKB 2AABH 5C0BE 2VR5A 1DVFA 3V4UH 1NKRA 4BSVA 5KVEH 5DVKA 4B7IA 5TE7H 3BQUC 1A9EA 2WNGA 4FMKA 2FGWH 2B1HH 3QG7H 4Z7QE 3GSWB 1WISA 3OBAA 5GSRB 3S34H 4BZ1H 1JYNA 3RTQC 3PQYE 3KLDA 5C0JA 5JOFA 1UH2A 2BVYA 1R3LA 3QFJE 2CRYA 5HGHB 1GZQB 3IAPA 5IFAL 3MGTB 1NAML 4M9OA 4KKAC 2DJUA 5B8CC 4JZOA 3U30B 1TQBC 3SDXB 3PHOB 2ZJSH 3WFZA 5K33A 2FX8L 4Z7NE 3IKKA 3QUMA 3RY6C 1B0WA 3GEWB 4R97B 1CFNA 1UH3A 5HPMB 3MLXL 5I1JL 4GJTB 2LAGB 4B53A 1AD0A 4M1CC 1I9JH 5KAQG 5E1HB 5BS0B 2J5LB 3RAJL 1OP3K 3DLQR 2J2ZA 3K7UA 5E6IA 2CPCA 1S8DA 1FNGA 1KIQA 4ORGA 4WUUE 3WCYA 3GNML 4P46D 4JQVA 2W91A 4JFHE 3MRPA 4ZYKA 5EU4B 1UFUA 2Y36L 3AMLA 3KYOB 3X13A 4M7LL 1JZ7A 1JWUA 3ILQD 1MCDA 4KQ4L 5F7DB 1NGXA 2EKJA 3MACL 4OD1H 3R8QA 3ARZA 4U05A 1DR9A 1P7QB 2AK4D 4HJGB 2AEWA 2AI0H 2OP4H 1S9YB 3EIFA 2NCMA 1TFHA 3FB6A 4Z77A 5I2IB 4JDTH 1OAZH 5IM7B 1EHNA 1GGIL 1P6FA 5TPWH 3MCG1 1SBSH 3EYUH 5KG9A 2H41A 4PGBA 3G6JE 4XHQA 1QFUL 3W2DL 3A6CL 3ULUH 5DFVD 1G7LB 3CVHB 1O7VA 5DD1H 1RZ8B 3I50L 3EDDA 5BOZG 3EDFA 2VC2L 4N8VA 3F5WA 1QFWL 4OGXL 2P8PB 1IBGH 3JWDC 35C8L 4YR6A 3MROA 1N6QL 1TPXB 3NCJL 2B1AH 3QXVA 3U4BL 1PLGH 2O5ZL 4K7PY 1RIVL 3HE7B 1QSFE 2NZ9D 1F3JA 5CEXB 1K5NB 3LV3B 3TPUB 4QXGL 1DLFL 1KTLB 2P8LB 3UBXI 2EDHA 4GXVH 1E28A 1EPFA 1A1MA 1ZA3A 1LP9B 1WWWX 5LG1A 4JDVA 4U33A 4OZGA 3ARUA 1CU4H 1ZOXA 4PGEB 5ILTH 5SWQA 3DUUB 3WUZA 4DTGH 4H1LA 4ELMB 4XPGH 1DBAL 3WLBB 5DT1L 2FH6A 3C8KB 5T1KA 5IB2B 2CK0L 2GEEA 2FJGA 5DUMH 1G9EA 2O5YL 4NUGH 1ZLSH 4X6FA 3RY5A 2WUCH 4FQHA 1FBIL 2W92A 5HY9B 3DARA 3PL6D 5C7XL 1I9RH 4LOUC 2EO9A 4YWGL 1VHPA 4NFBA 5FCUH 1YEDB 1JTPA 3MRDB 3CH1A 4G43B 4QXTA 2VDQH 4LBEA 3MRIB 3L5JA 1SM3H 2DTMH 1D9KA 4TQEH 4A6YB 4KHXH 4JHZA 3V4PH 1HE7A 2G5BB 3H3PL 4NQDA 5GGTH 3IDXH 1PVHA 3UROR 4XWGL 3HAEA 1YMME 4V1DD 4LVOB 1FFRA 1WZ1L 5T3XH 2XFXA 5ADOH 2I27N 3PABA 3GSVB 3HZYB 4EEEA 1HSBA 4FQCL 3FQWB 4DZ8A 4BFIA 4LCYA 4P2RD 2Y23A 3PGCB 1I8IB 5JW3H 4P2OA 1JNNL 1YMHA 2HG5A 4XVSL 4KVCL 1AGFB 2AEPL 4QWWD 4XX1G 2MMXA 4RFOH 5IVXA 1WZLA 2A6DB 2X4NB 2ICCA 5FO7A 2GIYA 5T1LD 4MAYC 2BRRL 3V0VB 3U7YL 3QNYA 3DURB 1FGVH 4U6YB 1XH3A 1QR1A 1J8HD 4G5ZH 4Y7MA 3DO7A 3UTSE 3LDBC 3JWDH 3VFGL 1U2CA 1G7PA 3OG4B 4F8QA 4ODBD 4EQ3A 4MCZA 1A7PH 3EO1A 4S10A 3W0WA 5D70L 1SYSA 2QQKL 5D7JA 1UXSB 4OQTH 1ZHBA 3B5TA 4HBCL 4U49A 1UCTA 4FG6D 4YHZH 4KWUA 2HAZA 6FABH 5IW1B 3GMQA 4PPTA 3ZSTA 5EZLB 5KZCD 2DBLH 1AHWA 1J1XL 4PBWD 5DR5L 3TM6A 4G6JH 2DICA 3TT1L 5FHBL 1G0YR 3N1FC 4HC1A 4MDJB 2KQMA 4ODUB 1FNSH 2YN3A 1WAAE 1F8TL 4LGPB 5I8OL 2XKUA 2WBJC 3VFVA 4EI5D 3RVTD 1HHIA 1RU9L 1EGJA 3BRDA 3AREC 1P4BH 1DQLL 2R0WH 2Z8VC 2BC4A 2V5SA 3VG9C 1FFNB 3HR5A 4L1HA 5HDLA 1AGBA 4NM4L 5GS0L 1TTFA 3HTLX 3INUH 1MCBA 1N2RA 1XGUA 3EOTL 2XWBB 2BXYA 3MOQA 5FM8A 5ERWB 1EHLH 3GM0A 4U0RB 4L4TA 4WFEE 4XCNB 3ZT6A 3L5HA 1ORSB 1RZIB 1OCWL 5DK2A 4KRPD 2C5DC 4PRHD 1F4AA 4G6KH 3FQNB 4XZUA 1ZT4A 5IJVA 3WUWB 3NABL 2R4RH 4OGAD 4CDGC 5JHDB 3H7BA 4G8FB 2YWZA 2GUOA 2OK0H 3ARFC 3GSNL 1V5JA 4X4ME 4Y5XB 3QQ4B 5FYJU 1A7BA 3GSWA 5GSRA 3T1WA 4O4YL 4HZAA 5DA4A 1W72L 3QQNA 3C6SA 5HGHA 1GZQA 5FKAA 4M61B 3P2TA 5F9JA 2BX5A 1QLEH 3L3IB 1AIFA 1Q1JH 1BJ8A 4JG1H 4DOHB 4GKZA 4Y5YC 5DD3L 3FZUD 3NIFF 3SDXA 3PHOA 4KZDL 2A6IA 3QZWB 4HH9A 4RRPA 4Z7OE 5GZNC 5HPMA 4OCMC 5F3HB 3FFCB 1OB1A 4Q9RL 2BSED 5BS0A 3QDMA 3V6OE 1EO5A 5ECJE 1G9MC 1KYOK 5DMKB 5IHLB 5E5MA 2O61A 1HH6B 4WWKB 3WS6C 1AO7E 2EYSB 5F7FA 4D0CA 2WIIB 3S36X 5EU4A 1S7VB 3D18B 1U0QA 3SKOA 4M6NL 5HHME 3NACL 1ZLUH 4WHTB 3B6SB 3LSOA 5F7DA 1XGPB 4YC2C 5DHXB 1KJ2B 1QFOA 4HXAL 2H26B 4HJGA 3VMPA 1YN7B 1DANT 1S9YA 3CLEL 4M62L 1D5BA 1F11B 1QSEE 5AG9A 4GRLA 4FTVB 5INCB 4YEFA 1PKQE 4GS7B 5CGTA 1NCWH 3GUTA 4P23B 5FGCB 1DBML 1G6VK 3OKYA 4D9QE 3WXVH 5DGQA 1SEBB 1RZ8A 3WIIL 5ESAA 4XHJD 2AXHA 3DGGB 3OAUL 4HPYL 5IMKA 4JCMA 2P8PA 1AKJB 3AS1A 3C2SA 3X3FH 5EIIB 1MQKL 1IQWH 5JZ7C 1FPTL 3HE7A 5CEXA 1K5NA 3LV3A 3TPUA 3MV7E 2P8LA 4JFFB 1A4KA 3QUZD 4L8BB 1NCDH 1NSNL 2ED8A 1RAMA 8FABB 4G8GD 3AUVA 1IGTB 1FYTA 4Z5RB 1LP9A 4NBYB 1BZQK 3O0RH 5LJYH 3D1MC 3VFSB 1CDUA 2R8SH 3BGFB 5MP6L 3FN0L 1Q38A 1WBZB 4YHKH 3C09B 1L0XA 4KK5D 2AK1H 3WSQH 1A8JH 4PGEA 1YJDH 1FVDA 2X42A 4EDXA 3DUUA 1J18A 4ELMA 3WLBA 4MAUH 5DD5H 1OM3H 3C8KA 4JO2H 3ZDXF 4XVTH 5IB2A 3V5HB 4GSDH 3HMXH 3U7WH 1CL7I 5ITBL 5HY9A 3BH9B 3NA9H 5FYKU 1YDPA 3OB8A 3C5ZD 3VRLE 2NY4C 5E08L 2R15A 1BFSA 1YEDA 3VFPB 5C0NC 5J3HD 3MRIA 2YK1H 5EFIA 3GJFK 2A6JB 4A6YA 4APQC 2JIXD 3OF6A 4LEXL 1TNNA 1IT9L 2P48B 5DEGA 1D6VL 2C3XA 1YEKH 3IDYB 3QUXD 4GG6E 3FOLB 4CVXB 5KVFH 1ZVSA 3O8XC 3HZYA 3RL1A 2AEIT 2GJZB 2D4FA 3FQWA 1X44A 2ITCA 3G6DH 1KJVB 3QIUD 3QHZL 5GGVY 2DKSA 1B0RB 5T3ZH 2P45B 4C56E 2ZUUA 2EC9U 1AGFA 1X5FA 2CK2A 4LSUL 4FABH 4OI9A 5IVZA 3OG6B 1LD9A 3V0VA 4TULH 4YGVB 5CGMA 5FM4A 5C2BL 3DURA 1ZGLB 4U6YA 1LO4L 4JVPA 3O4LD 3IRZA 1L7TL 3ZYOA 4MX7B 1OGAD 2HJFB 3AROA 5JW4N 1GAFH 2MFNA 1SJXA 2P5EB 2MCG1 4X7DC 4RAHA 3S4SB 1EH9A 4YBHA 1UXSA 4JKWA 4OGYH 3H9SD 3SE3A 1OARL 1PSKH 3BH8B 1NCTA 3RVUC 3JUZA 1HI6B 1WSST 3RNKB 5EZLA 4CNIB 5AZEL 4JRYE 5EBWB 1KEMH 1B9ZA 3LQAC 3IRPX 1I1CA 4MDJA 4ODUA 2X4RA 4BH8B 4XXDB 3T3PF 3BIKB 1MJJB 3WO4B 1A7RL 3RIAK 3O11B 2CKNA 4NHUA 4HIIB 3H42H 1P5VA 4DN3L 2IWGA 3ZT7A 1FFNA 3CLFL 4P3CH 3KPSD 4DFHA 2VDRL 1HCVA 3D0LB 2W9EL 4F58L 2XWBA 2E7CA 3WBDA 3KDMA 3KXFB 4OD3H 5CS7A 5DQDL 3VGAB 3LKRA 2A6KB 4XCNA 1N5YL 3DUHA 4X4XA 3IDJB 3T65B 1RZIA 1U8NA 2V2WA 3FOMA 5CJOH 4CL7A 1T22A 4P4KD 1RJYB 3PWVB 1MJ8L 2OMBA 4Z7WB 5C6PB 3FQNA 1U91B 2QEJA 4JVWA 3SDDD 1JPST 2EKSB 5JHDA 4QRSA 1AP2B 4NZDA 1ZLWK 2WUBH 43C9B 2AV7B 3QQ4A 3MLPA 4AQOA 2A77H 1KCVH 1S9XA 2XTJD 4RA3A 3RPKA 4POZD 4XGZB 4U0QB 4PFEA 1BZ9A 4WO4B 4KKBC 4M61A 3MLYH 4HZLA 3L3IA 4QGYA 5KJRL 3STLB 5J57B 5EC1B 5DC0A 5E8DH 5EZJB 4ONFH 4E41B 3MLTB 1NUDA 1RUQL 2X40A 5DMIL 4X6DE 4Z7VA 3B3IB 2X4PB 3BN9D 3RWDB 3SE8H 1FLRH 5L2KD 4LSSL 3QZWA 2Y06H 1CG9B 3PP3K 1ZHNB 1MVFA 5CEYB 4K7PH 5F3HA 3S37H 1I3UA 3FFCA 2H1PH 2ITDA 4L4JA 2OXGA 1IAIL 2NXZC 2QSQA 5DMKA 3SJVB 4JKPH 1I8LC 1G7JB 2BOCB 3LQAH 1BBJB 5TE4H 3ZYIA 3W5MA 2EYSA 5D6CB 3BKCL 1FZMB 1UCBL 2ORBH 4IDJL 4M3KB 3I75B 2R0LL 1F4WH 2R0KL 4I3SL 1S7VA 3D18A 2EH8L 2RFXB 4RISH 5F8RC 4JPWL 4WHTA 3B6SA 1MELA 1XGPA 3NCBB 3DPBA 1NL0L 1KJ2A 1FVEB 1RZFL 2H26A 2MPAH 2XKNB 2DLTA 2HKFL 1F11A 5GS1B 5INCA 1AXTL 1WGOA 2K9UA 5DJ2B 5HHVL 2DKUA 3LAFA 4PS4L 4NCC2 2VN4A 4PJXF 1MFCL 3IDIA 5D2NE 2W59A 3DETD 2YUVA 1SEBA 1ACZA 4GAJH 3JSSA 4XPHH 1KJMB 4GLRI 3BGMB 4HG4K 5JORA 1YNTB 1LWRA 5C3LD 3EFDL 5KOVC 1JK8B 1V3JA 1X5XA 3DIFA 2Z31B 2I60L 1Y18A 1IZKA 1RIHH 2HRPL 4JFFA 1EBAA 1KB9J 4MJID 1XR9A 4KHTH 8FABA 1X6NA 1JGEA 1FN4A 1EMTH 1IGTA 2JB5H 2ZCLL 4JCLA 1L0YA 1TENA 2W9LA 4LVEA 4XAWH 4HS3B 4Y1AB 2BSTB 1WBZA 3B8SA 5GJTH 4OAWB 1FL6B 4JGMA 3FCTB 1NMCB 1ZAGA 4Q6YA 4OCSH 1JBJA 1SBBA 5FA4B 4JFEA 3O6FD 4YUEL 2AXJA 3T0BA 5CIPH 3B9KD 3V5HA 5IMMB 3SKUD 4MNQD 2CIIB 3A6OA 1EUTA 4YPJA 3QI9C 1S7XB 2WMPA 4UNUA 4Y4FB 3MLZH 1Q8MA 1LMKA 3D48R 2EIEA 5IHUL 4MNHB 4PJCE 2YD3A 4OIIL 2E7LA 2YMXL 2A6JA 3T8XB 3FB8B 5L6YL 2BNQB 2BY2A 4HH8A 1A5FL 1KCSH 2WAHA 1NCBL 5T5FL 2WQ8A 1FG2B 3NTCH 1UADC 1QBLL 1BIHA 3P77A 3FOLA 3ULVF 4CVXA 2NY1B 3P11L 4O2EA 4Y19A 1A7OH 3T0EB 3O3AA 2GJZA 2VDLL 4JQVC 4LPCA 1CBVL 4LDOB 5DJCB 3RVXC 2I24N 4KTDH 4ZS6C 3T1FB 1KJVA 2D7MA 2VISB 1G0XA 5EU7C 1B0RA 5IHZB 1T21B 4XBEL 2Q8AL 1Q9KB 4WV1A 1JNHB 4LK4A 1CGYA 4JANB 3T4AB 2IBZY 3DRTA 4OCXH 4YAQB 4ZTPH 4RNRA 2F19L 4U1KB 1RJLB 4I2XB 4LSPL 4S0SD 1NCCH 4YGVA 3P4LA 3QIBD 1ZGLA 2LABA 2EH7L 1JFQL 4W68A 1U8LB 4MX7A 5I71B 2J8HA 2HJFA 1KB5H 4XCYB 4M6AA 4WTWA 3SDCD 5L88H 2ZKHL 2P5EA 2CLVB 2JCCF 1HZHH 2VOTA 4NNXB 3S4SA 3RU8L 4YHIB 1HHJB 3IXTB 5F1OB 1GHFH 1MRCH 1AY1L 1OAXH 5I1GH 4LLVB 5HI5C 1Q0YL 2AJVH 4JFYB 4M48H 1KOAA 3BH8A 4AY0A 2GITA 2NMSA 3LD8C 5FDWB 1VERA 3RNKA 3GIVB 2WK2A 1FYHB 4WI7A 2J8UE 5C0BB 4S1RL 4BH8A 3BIKA 3OGOE 2C9AA 3KPRB 2VTFA 2ESVD 5TQ2L 4HF5L 4U31A 3O11A 3ABZA 2RBLA 4HIIA 1G7QA 2AERT 2F74B 1CVRA 3U0PB 2GKIA 4PJFF 3PQYB 3VI4F 5E70A 3M07A 4DGYH 2FZ3B 3QUMH 4NWUL 1S7UB 1U3HB 4NGHH 3KXFA 4UDUB 4ZUSA 2HH0L 2A6KA 4WI4A 4HWZB 3OXRB 4XP5H 3IDJA 5CJQH 2VL5B 4ZOCA 4OZIF 5CZVH 2RCSL 3BSZH 1RJYA 1MCKA 5I17B 4QHMB 4Z7WA 3QCVH 4DN4L 1D9KC 1U91A 1ADQA 3L6FB 3KNBB 4KMLB 3VH8B 4QEGA 4PJ9B 1LO0H 3HNSH 1QHOA 1A6ZB 4G9FE 4GBXB 1FE8H 43C9A 2AV7A 3EO9L 4NNYB 3NVQA 4OV5B 4Y5VA 3D3VA 1Z3GL 4WUUB 4L8SA 3S88L 5IEHA 4XGZA 4P2OC 1CGWA 2XKSA 1T0NB 4WEMB 3LKOB 4RIRA 1OAQL 2HFGH 3STLA 3PGDA 5EZJA 4E41A 3MLTA 4NOFA 3B3IA 1MWAA 2X4PA 4ZDHA 4YE4L 5KVDL 3RWDA 2UWEF 4OTXL 5J9PB 1CG9A 4ISVB 1FZOB 5TDNB 5CBAB 1IGIH 3RZCD 5CEYA 2VXVL 2NYYD 3G6JB 4YZFE 5FHAH 4PP2B 1JYVA 3WFEL 1H9VA 5F7YC 4JFZL 2IAMB 4OF3A 4RGND 5JR1H 3MV11 1G7JA 2BOCA 1BBJA 4XXCA 1FFOB 3TLRA 5D6CA 3AS3A 4QCIB 3UPCA 4MZ3A 1KUMA 1FZMA 2GAZB 1MCQA 3I75A 3P0YL 5DHYB 3FTGB 4JFPB 4PRAB 5GRUL 4QRRB 1IM9B 4MSWA 1QSFB 2RFXA 1FH5L 1T2QH 3BIAX 4H1LH 4W4OC 4OZHF 1BECA 3B9DA 4JZJC 2CDEB 5FA3B 1FVEA 4G6ML 4UZGA 1OP9A 2GT9A 1R5VB 1EAJA 1FLTX 5D1QD 2XKNA 1GXEA 5GS1A 4GRWB 1DUZB 3QWOA 1RFDL 3SOBH 5J11B 4JB9L 1G9NH 1JNLH 2NX5B 5ACZB 1LEKA 5GGUB 2MQ0A 1MFNA 3DXAD 2YWYA 2AS5M 2HTLC 1QBAA 1SVCP 1XEDA 2E7BA 4NN6B 4L3EB 1KJMA 2NY3C 3BGMA 1X4YA 4WU7B 1YNTA 3HAEH 4ERSL 2HFFB 2IG2H 1JK8A 2Z31A 4B0MM 4IRSD 2DQGH 2VE6A 4WI2A 1NC4B 3LS5H 2ZCHH 1S5IH 3R0MA 1T83A 4ZUWB 3MUHL 1VESA 1U8HB 4IRJB 4HS3A 2BSTA 3CDYA 4LL9A 4WCYH 1FSKB 3IU4L 4OLYH 3WNOA 1FL6A 4QKXB 3FCTA 3F65A 2H45A 4LLDB 2BERA 1CR9H 5GS0D 2KH2B 2XA8H 2IPTL 2P4AB 4XNYL 3VFTB 3MXWH 1AE6H 2CIIA 3SKMB 5FCSH 1INQB 2DMBA 4X0KB 1S7XA 2EO1A 2PF6A 3QEQE 3MLVH 3DVGB 4Y4FA 3B2VL 3R06A 5D7IE 4KI5C 3KAAA 1JGLL 3U30C 3FB7B 1EV2E 5HYQA 4X7SL 5IVNA 1CZ8H 5EORL 4YDLB 5K9QI 3FMGL 5KSBB 1FRGH 2H2SD 2DQIH 1RUAL 4P46C 2BNQA 2YZ8A 1NAMA 4UV4L 3ZKQD 3IB4A 2VUOA 4MD4B 3MBED 4PTUB 3J7HA 5TGBB 3D0VB 1UM4L 3NPSC 4XMLL 5KS9A 1N0XL 1YECH 3O3BA 1P4LB 2ATKA 2GSIA 2J4WL 3T1FA 4PJGE 1EGJH 2GSGB 2VISA 2EDWA 5IHZA 1T21A 5JOEA 4CAGA 2OJEB 3LZFH 3N85L 4Y89A 1Q9KA 4E0RB 4WY7H 1T7VA 4JANA 1N7MH 2NW2B 4CDHA 4U7MA 4OM0L 1GGYA 1RJLA 2E9IA 4I2XA 32C2A 2Y7QB 4GRLC 2EE6A 3HZKA 3PHQB 3BWAB 3FL7A 1NFDA 4OFPA 4LASL 1U8LA 4FXGB 2EDQA 3O6LH 2OL3L 4TNVF 2NZ9C 4WIQA 1B88A 4NNXA 2MCPL 4PG9B 1B2WL 4YHIA 5F6HJ 2Z0BA 3IXTA 4KROB 1VPOL 2X5PA 4OD2B 1KBGH 4OZFB 4Y16B 4H26B 4OCWH 1A0QH 5EO0B 2BVQB 4LLVA 4PJBB 2IH3B 2ADFL 3HC3H 2VDOL 2AEQL 5EZIL 5IUSA 5A43C 3HE7C 4RA0C 1X6LA 4KVNL 2PKDA 5FDWA 3GIVA 1FIGH 1M6OB 2W65B 4K8RL 4XBGB 4HK0B 3V52H 4MXVE 4YIQB 4P59H 4DEPC 5C0BA 4WFED 1SMOA 4ZUVB 2YD4A 4N0CD 5FECA 3MNZA 3KPRA 2W0LA 4Q97A 4GMSH 3RZWA 2BMKB 5JOPE 2HKHH 4S1QL 1H3VA 3PQYA 1JZ4A 1YEIL 3QFJA 4U1IB 5ETUB 4L5FL 2FZ3A 1BD2D 1S7UA 1U3HA 2O26U 3LN4B 1T1YA 4UDUA 3OQ3B 3QDHA 5E2TH 1IC4L 4HWZA 3OXRA 3HNVL 1OTUC 5BZWB 4HLZH 4PD4K 4QRTB 2YPLE 5CD5D 4CU7A 1DQJB 4Q58C 4M5ZL 4UOJA 5DI8B 1TJHL 4QHMA 1P7QD 2KPNA 2UVEA 4RWHA 3L6FA 4CN6A 1I4FB 3VH8A 1E4XL 3O2WL 4LCCB 4F15C 2ADGA 4N8VG 4KK6D 2D9QB 2IPUG 1JGUL 5AWNL 1GGBL 1JPSH 3G08B 4UB0H 4LVOC 3BRGC 4ZFOL 5EWIL 4GBXA 1QFPA 2YSSB 4RMRA 3RNQB 2VERN 4NNYA 4OZGF 4XPFL 1AO7B 2HYMA 4R3SA 4RZCB 5L0QB 4FQJL 4WUUA 5FYJH 3DVFA 4XP4H 2IQ9L 4PRPB 4M7JH 2FJFA 3GSOB 3LKOA 4TVSa 5C0DB 4JY5L 1U3ZA 4YHMH 2OYPA 2XZCL 3REWA 4H1LG 4OSUL 4R8WL 3LKPB 4LAJH 3MFGB 5EC2B 5FUZH 3L3HA 4PB9L 5JMOC 4BQ8A 1H0DA 1JI2A 3TGXA 3U9PL 4YXLL 1FZOA 4TSCL 5TDNA 5CBAA 1HILB 1WJ3A 4YK4B 3G6JA 5LWYL 2WV3A 1BX2B 3OV6A 3ZDZE 4HDIB 3S7GA 3H7LA 1BQHA 2D7QA 2IAMA 3DTXA 3GMLB 4N5ED 2ZUQC 3SE3C 1FFOA 2AKRB 4QCIA 5I1DB 4F7CB 3U0WH 1YEJH 1I1YB 2GAZA 5CJBA 1NMBH 5DHYA 3FTGA 4EI5C 4JFPA 2PYED 4I5BB 1KGCD 4OLEA 4PRAA 1IM9A 1QR4A 4FZEL 3WLWC 1QSFA 3HAEG 1WFOA 3MV7B 15C8L 1Q94B 3MV9D 6CGTA 4XRCB 5DK0B 1NLDH 1KFAH 1HINH 1RZ7L 4M6OH 4Y88A 1NJ9B 3FRUB 2CDEA 4LKXB 3S35X 3UTPE 5KVGL 5GIRB 3EKCA 3ARXA 4W70A 5IVXF 3VXSB 4EN3B 4PJ7B 2EDKA 4FFZH 1QLRA 4I9WE 3QEUB 4U6XA 1VSCA 4FNLL 4AMKL 3I85A 1S3KH 2M1KA 4X98A 4YDIH 4RMSA 5B22A 4YGAB 5ACZA 3DMMD 4U1HB 2VDML 4HX1B 3ZTNH 3QNZB 5BO1L 3BP7B 4DQOL 4HS8H 4K7PX 1YYML 3S37X 3QAZC 2ZOLB 5FB8A 4U0RC 3W39A 3V6FA 3MRHB 4I13B 3REVB 3FAWA 2R9HD 4OGAC 1XGQB 4WU7A 2P47B 1HQRA 5DD6A 1WK0A 4X6CB 3QIWA 2HFFA 3RGVB 1B4RA 4BQ6A 4XNUH 5GISL 1PQZA 3PWPE 1G84A 3H2WA 4RWYH 1NC4A 3MFFB 1J88A 4OUUB 1A1NB 5HGAB 5E4IA 5GSVB 3OX8A 1CCZA 3BZEB 4ZUWA 1IEBA 1M7DB 1FZKA 4JVUA 1U6AL 2R0ZH 1U8HA 1JL8A 2Q3AA 5MHSE 1YMMA 3QPQC 3SDAB 1IZJA 3OJVC 5IROC 3BJLA 4GG6B 4K9EL 5EU5B 4LLDA 1Q72L 3BPLC 3LEYL 2I26N 4U1GC 3FZUC 1Q0XL 2HLAB 4HUWB 5FYKD 3DSFL 4H5SB 4MMZC 3B43A 4M7LT 4X0KA 3GSNA 3QPXH 3QYCA 4NZUL 4F2MA 2OBGA 3DVGA 4FFVD 3SGJA 4XCEB 2NY0B 3VG0L 3EJYC 3MX0A 3MRLB 4C56D 3BI9X 3UTSA 1HSAB 5E8PB 3TCLB 1YY9C 4X83A 4ZS7H 1G7MB 5CKGA 5FDYA 2EYRB 1MJ7H 1QHPA 5FO9B 5C0RL 4PTUA 1NGPH 4WFGD 5TGBA 4WHCA 3ZDYE 2Z8SA 2JTDA 3D0VA 1HQ4A 5IKCB 3RL2B 3THMH 3QBTB 4ZOAA 2QHRH 4O02L 1UACH 1J12A 1S5HB 3MRKB 4OFYD 4A2MA 2GSGA 2A2QT 2EDRA 2OJEA 2G2RA 3H6JA 5GS2D 5CZXC 2ICWB 1FC1A 2NW2A 3D85D 2AQ1A 3TO2B 5LQBH 1KCUL 1NBYB 2YKLL 1WAAA 2BY1A 1IGYA 5I1EH 2F53D 2KUTA 4QRPB 3QSKB 1LO2L 3BWAA 4XCFH 3SDXF 4KV5F 4J6RH 4FXGA 1KTKE 1UM6L 2IBBA 3QQ9C 4H20L 4U6HB 4TRPL 4JPKL 1D6EB 2FECI 1SEQH 2XPGB 3PGFL 4CVWA 1NCNA 3IU3B 4PG9A 1X3DA 2G60H 5E2VL 4J8RB 1B4JH 4OD2A 1UA6L 1HHKB 2GY5A 1FO0L 1QKZH 3DVNA 4NC1C 5EO0A 1CS6A 2DD8L 2IH3A 3DI2B 1INDH 1JVKA 1MFBL 4FQQA 1IKNA 4X8JB 3E0GA 4XBGA 5F3BB 3KPOB 4YIQA 1OP5H 1KENL 4ZUVA 4DWHA 4TPRH 3ZKXC 1VKXB 5CINH 3P4MA 1U8OB 4HAFA 1CD0A 2YD1A 1JPFA 1ZANL 4X4MA 4J3TA 2BMKA 2ZUXA 3C5ZC 4LCIH 4ZNEE 2R2HA 2HA1A 3P0VL 5DZLA 4JFDB 2VXUL 2FHBA 3QRFM 2IPKB 4WWKD 5ETUA 5GRJH 3TIDA 1OAKH 4KK8C 2P1YA 2E9JA 1QSVA 4YDVB 1E4JA 5AAMA 1H15B 3CK0L 5BZWA 3GK8H 4QRTA 3KLSA 4NNPH 3MRRA 1DQJA 3MJ9A 4X6DB 3OZ9H 5DI8A 4M43L 2E7LC 5LAXB 1J05B 3GBMH 1KG0B 3RVWD 1WBYB 1I4FA 5DQJB 1MI5E 3EJJX 1TTGA 4FTVD 3M17B 1QRNE 1NMAL 4LPXA 3IDYC 4CJ0A 3F12B 4LPYA 5SWZE 1LP9F 3ZKMC 4NUJB 4P23D 4AL8L 2R2EA 3W9EB 2XY1A 1G6RB 1YC7A 4N0FB 5CUSL 1KJ2H 3H0TA 4CMHC 5DS8B 1AO7A 3TA3B 2AXFB 3SQBA 3OPZH 1CQKA 2PO6B 1J9CT 2AQ3A 4W6WB 4ELMF 4DAGL 1UZ8B 1B6UA 2JJSA 4LRIA 4NYLA 1YQVH 1AKJD 4NT6A 4WV1C 4UV7L 1AI1H 4U2YA 4YDKH 4OKVB 1MEXH 4XP1L 3TN0B 1R0AH 5EC2A 1YN6B 4MHHI 1DEEB 3ARPA 1OAUH 1MOEA 4MJ2A 3SE4A 1QSEA 3CSPA 3GMRA 3IKCB 4ZTOL 1WEJH 2WBWB 2XRAL 1J10A 3GIZH 5D2NB 4HGWB 5JW4M 1BX2A 2XTLA 3WFHA 3FO0L 3IXAB 3PWJA 4FQ2H 5D2LE 5HYSB 5ICYB 2ZNWA 5IT2H 4UTBH 4LU5L 5C9JB 2A1WL 4KKLC 5L8KB 1EO7A 5I1DA 5TF0A 4F7CA 1EVUA 2C1OB 1I1YA 2YHGA 1A6WH 1F58L 3LCYA 4I5BA 4G7VL 3LMJH 2X4UB 12E8H 5CMAB 3MV7A 3SGDI 1Q94A 3TWCL 4KUZL 4XRCA 2R69L 5F70A 4HUVB 2APVA 1NJ9A 3SCMB 1DDHB 3SO3B 1DQTA 4M93B 5DVNA 4HHAA 5GIRA 1A6AB 4KRNA 3BEVB 4YO0B 3BPOC 4I0PB 4QTIH 3UDWA 1MFEH 3Q2CA 5D7SL 2DYPD 4J3VA 4U1HA 4HX1A 4PJEE 2R29L 1GCFA 3QNZA 3BP7A 4P57B 3FAXA 4M1DL 3QEHB 5AYUL 4XT1C 1KF9B 2ZOLA 3AVEA 3SQOH 3MYZA 5CBEA 1JZ8A 1WITA 3MRHA 3REVA 1XGQA 4Z0BL 4B7LA 2UUDK 3U36B 1UM5L 3F7QA 1IRAY 3NCYP 4UU9B 3BMVA 3HZMB 1OSZA 2OX5A 2PYFB 5IB1B 5F7NC 5SWSB 3MFFA 4ZPVB 4OUUA 5C08D 2VZVA 5HGAA 5GSVA 5IMLB 4PJIE 3BZEA 3ZLQC 4POZC 1TIUA 1RVFL 1BBDH 1PD6A 5DC4B 3GHBL 5BVPH 3RA7L 1K8IB 3SDAA 2VITB 3OTTA 3EYOB 4GG6A 4I4WB 1KELH 5EU5A 3T2NL 1S9WB 4Z95L 3WXWH 4Y5VC 2FL5B 4L8SC 4HUWA 2Z9TA 1H8NA 2G9HB 4H5SA 4OJFH 4I48B 3VGDA 4UOW1 4C56A 5GQBA 3GJEA 3O2DA 3VWJD 3V0WH 4LAQH 3L9RB 4XCEA 4TNVK 2LAAA 4R2GC 3UTZB 3O9WA 4K71C 4F7MB 5H35B 4JZNB 4FQIH 1N4XL 3KHOA 5C6TH 2DI7A 5CGYC 4JREB 3T04D 2EIDA 1HSAA 3HS0B 5E8PA 3TCLA 5KSUB 1EZVY 2EYRA 3AS0A 3V6ZB 4HXBL 3FQRB 1W0WB 3FJTA 1INEH 4XXCC 1UWEH 5IKCA 2ZCKH 3I02B 3WUWG 2HLFD 5HTSA 1S5HA 3DX6B 3MRKA 4ZXBD 4OM1H 4DUXA 1EAPB 1XIWD 5IOPB 3IVKA 2OZ4A 1KACB 3ZKNC 4O2CB 2H6PB 4JRYA 5EU7E 2D7NA 2Q6WB 1FV1A 5EOCH 3TO2A 2VLJE 1NBYA 2CDFB 4RGMC 2BVTA 4EXKA 4Q9BA 1GGTA 3CPLB 3S36L 4Z7VF 1UQSB 1QUNA 1U8QB 1KLUB 3BPNB 1EO8L 5D1XA 1K4CA 2AAVA 1D6EA 1H5BC 3NIDF 1PFCA 4MLIA 2IPUK 3IU3A 5D6DA 3TZVB 5E9DD 4HV8B 2X70B 1ADQH 1I1AB 4J8RA 2NQCA 2IC2A 3QZWG 3X3GH 4UILL 4RAVB 4QNPE 4WO4D 3TBWA 2QSTA 1ZGLM 2MKLC 4L4VE 1TJGL 3C6LD 3CU7A 3IT8D 4Q2ZB 1ERNA 4DKEH 4X8JA 5F3BA 1QA9A 4PJ5E 3KPOA 4LFHD 4MB3A 5GRYA 1T83C 2X7LB 1A6VL 1RK0A 1KPRB 5EU6E 3B9KC 3E1F1 3N9GL 5I1CH 1R3IH 3BQUB 1RUML 5TFSL 3LY6A 3TVMB 3V4VH 1GIGL 5BV7C 4NQCE 5JIHA 3LEVL 2FEEL 1VGKA 1Z9SA 1HYRC 3GGWB 3SJVD 3TV3L 1MWAH 3MLRH 1QNZH 4EBQL 2IPKA 1H3GA 2EICA 3LKQB 4EQ2A 3VD9A 1SQ2N 3QT2A 1G7HA 4D0DB 1LILA 4OT1H 1F4XL 3ARTA 3IGAA 4NZRH 3MO1A 3ISWA 4Q0XH 4HKBA 4X6DA 1VACA 5B8CB 2IJ0C 5LAXA 1TQBB 1KG0A 5ICXB 4Y2DA 4S11A 1CF8L 3QJFB 5DWUH 3VFNB 1IFHL 5BVJB 2NNAB 4NUJA 1MREH 3W9EA 5FYLH 5BMFL 7FABH 3WD5H 2E5EA 2EC8A 4D9RE 5DS8A 3HG1D 4Q9QH 3K3QA 4K2UL 3RJQB 1XCQB 1LEGA 2PO6A 3AAZB 3P40A 4K3EH 1SJHA 3TJHD 1EX0A 1V7MH 2X41A 1UZ8A 1ACYH 3L3OA 4Z76B 1JE6A 3VXME 1FGNH 1NH6A 1OF2B 5I1KH 3Q1SH 1VEOA 3NZHH 3ZE1E 1JPTH 4LLMA 3TN0A 1A7NL 4XX1E 4AM0B 1YN6A 5TQ0L 1DEEA 1P53A 4W6YB 4BJLA 3DX9A 1T1ZB 1BQLL 5A2JH 4Y1AD 4O2FB 1HIMH 1HNGA 5D2NA 4HGWA 5EBGA 2NY6D 1S78D 3IXAA 1H3XA 5I30L 3SO5A 5IV2B 5HYSA 3MUZ1 1A47A 3ZKSD 3W81A 5C9JA 4OKDA 5DRWA 1MCOH 3MODL 1MFAH 3GKZA 2C1OA 5D7LE 1IQDB 3MLSL 2X4UA 3B4NA 3L1OH 2VR4A 4NJAL 5BV7H 1F90H 4JM2A 3FQTA 1NC2D 3WIHA 4NKMB 3JVGA 1CFQB 2B0SH 4L3CB 4HPOH 3TP4A 4PJ8B 5IW6B 1S9VB 2I9LA 4YO0A 1U92A 4CMMB 4I0PA 5CHNA 4F7TB 1RMFL 1I3RA 2XN9B 4FS0A 5C3TA 1MHCA 5E00B 1EJOL 1BGXL 3ZSSA 4LDEB 4P57A 2NY1D 5K9QG 3QEHA 2KBGA 4P2QE 3T0ED 1U3HC 3RY4A 3KPNB 1UVQA 4J7RA 5IFAH 1NAMH 1F42A 3DYMA 4L3AA 2MHAB 3IFPB 4UU9A 4ETQA 2BVOB 2PYFA 5IB1A 4HMDA 3S4SG 1KTRL 1UZ6F 3HMWH 4PY8I 4ENED 4LCWB 2FX8H 1R3KA 5C70A 2F5BL 2V9QA 5IMLA 2DDQL 4MA3A 2Y07L 4OIBA 3U9UB 3C2AH 4OLXL 3MLXH 3GSXA 3EOBA 1CK0L 1U2HA 4P9ML 4ONHB 4LLQA 3QXDB 4JPIB 3X11B 3QXUA 5ALBH 3RAJH 2W1NA 2O93L 1A3LL 5DSCB 1S9WA 3VA6A 2FL5A 3O45A 1RUKL 1QBBA 5H37H 3SKJL 2G9HA 1C1EL 4I48A 1OVZA 1XR8A 4PJGB 4WNQB 1T04B 4ZSOE 1RJZB 4YH6A 2VLRD 3GSUA 2Y36H 3D2UB 5EBLB 4M7LH 5ID0B 1GZPA 2JB6B 4KQ4H 4HK3N 3P4OB 3MACH 3NZ8B 2F9BT 1UG9A 2QBWA 3L9RA 2ATPB 5KSAA 4XC1L 2D7PA 5CLTA 2ICWI 3CIQA 3UTZA 4RGNC 4R26H 2HWZL 4F7MA 3D6GA 4JZNA 3VXUB 3ILPB 1I3GL 1GGIH 4Z7WF 2Z92B 3HS0A 4N0UE 3QDJD 5KSUA 4LSVL 3LDBB 3RWJB 5EO1B 3W2DH 2B2XL 5E4EC 3A6CH 1YEEH 3V6ZA 5JW5B 3FQRA 2Q76A 3NIFE 4MVBD 3I50H 4KXZH 1P7KA 3OR7B 1JHKH 2AK4E 4P9HH 2IBZX 1QFWH 3V7AG 4OGXH 2DQHL 35C8H 3DX6A 4LRNH 3NCJH 2ENYA 1EAPA 1FP5A 5IOPA 1RIVH 1M71B 3AFLA 4IOFD 4O2CA 4WW2B 1QP1A 1DLFH 2C3WA 1RJCA 4QXGH 2J8UA 5T33L 2Q6WA 2B1HL 4GFTB 4KU1A 3UP1A 5D93C 3GMOB 4WFFD 1OY3B 4BZ1L 5BRZD 3U2SB 2VH5L 4PJ9D 1HNFA 3CPLA 1XGTB 1UQSA 2WBJB 3EUUA 1U8QA 1UJ3C 3AREB 4JPVH 2PNDA 3H3BC 3TJEL 2AVGA 4Y4KA 2GY7B 3VG9B 4IRSC 1DBAH 3TZVA 1U58A 4DUWA 1OWWA 2CK0H 2X70A 1I1AA 2O5YH 3UPAA 4JO4L 1FBIH 3QIWC 4PJDE 5BXFB 2YPLB 1KSRA 4LEOB 5C7XH 5I6XC 4Q2ZA 1I1FB 5IESL 4YWGH 4P3DB 4PLKC 3KPTA 1IGFL 1KLGA 2X7LA 4FP8L 3H3PH 2R1WB 1U8JB 1T89A 1DQQB 4P49A 2CUIA 4G9FA 3BQUA 4MDIB 4EDWL 4PGJA 1BOYA 1VFUA 3ARFB 4J4PD 1L9NA 3TVMA 1WZ1H 3GMNA 4U1JB 1CE1L 3NFNB 4XCCL 4NO2A 3OJDB 2EEAA 4FQCH 2V7HB 1TJIL 1CIDA 4IMKA 4KK9C 2X89A 3LKQA 1JNNH 4MQXD 4NRYB 4QRRD 1I9IL 1OAZL 1QFWM 2AEPH 2IGFL 1SBSL 3EYUL 5HYJB 3MBEC 4XMPL 5B8CA 2BRRH 3VDBA 4V1DE 4YHOH 3ROOB 5I73C 2X44D 5ICXA 5K9OA 3U4EB 3RY6A 2HJKA 3VFNA 5BVJA 4P2RE 2NX5D 2NNAA 1EFXB 1IGJB 1RI8A 1URLA 3BOVA 4JLRA 1JZ3A 5D70H 1PLGL 3QR2A 5HYFA 2QQKH 4HBCH 2K7PA 1XCQA 3AAZA 4L3ED 1C12A 5GGTA 4IMLB 1X5AA 1J8HE 1J1XH 1K6QL 5DR5H 5JXAL 4L9LB 1IAMA 1FL5A 3TT1H 5FHBH 4YC2B 5ILTL 5DHVB 3CSYA 2GW5A 5C07B 4AM0A 1GRWA 1AGCB 3WKMH 2BHZA 1F8TH 5I8OH 2BSSB 5F6IB 1MHEB 5DUML 1T1ZA 4IRJD 4PYGA 3SGDH 1ZLSL 1JHTB 1R6VA 1DQLH 4K3DH 2WP3T 1W8NA 5IBTL 3BJ91 4U1SA 4NM4H 1UB6B 5IV2A 3EOTH 3EDJA 2E7MA 3MUGA 4RSVA 1CFTB 2DTML 4TQEL 3GI8L 2WLYA 3KYMA 2GFBB 3MBXL 4FQXB 4P99A 4R7NB 4PRDB 1OCWH 5KS9F 3PWLB 3PWPB 5F88A 1M7XA 2CH8A 2WLZA 4YNYB 5A40E 4NRZB 4OCLC 3IDMB 2AJSL 1NCAL 3FO2B 4L3CA 3NABH 2XV6B 3MCLH 3VU2A 4PJ8A 4PLOB 4P3WA 2FYYB 2OJZH 3QRGH 4CMMA 3GSNH 4WFHD 1TITA 3U6RB 2DLFL 3GMMB 2PTVA 1NFDF 3PWNB 1A6TB 2CLZB 4O4YH 4NBZB 3NH7H 4RFOL 2A0LD 4OZ4A 5E99L 4KKCD 5H37G 3SKNA 4WDIB 2WM0A 1ZGLP 4PRHE 3KPNA 1I3VA 4DGIH 4Y2OA 3QEQA 4LSTL 1FGVL 5D7IA 1KT2B 1ORQB 2MHAA 5B3JF 1ND0A 3W11C 4QXWA 4NO0A 4X7FC 2NY4B 3EDKA 5DD3H 4PY7B 3UTTD 2DWEA 4KZDH 3HLAB 4KMTL 4BSWA 1NBVH 2NW3B 3OXSA 3U9UA 4OQTL 4APQB 4QHLB 1OP5K 4ONHA 3V6OC 2BFVL 2NY7L 3QXDA 4Q9RH 4JPIA 4U6VL 3UXFA 3X11A 3BXNB 4AENB 3BKJL 3NIGE 4NQTA 1MCLA 1O7SA 2HRLA 3O8XB 1N5AB 2YD5A 3MLUL 4Y16D 4PJGA 4WNQA 4LRIC 1T04A 2C3HA 4OLUL 1I85A 4HWUA 4WVRA 3KYKL 3D39E 5BCAA 3Q5TA 4I1NB 5I75C 4M6NH 5EBLA 3NACH 5ID0A 4GW5B 2JB6A 1BF2A 3P4OA 5C0GA 3NZ8A 4Z0XA 5I8EB 2X05A 2ATPA 4YHLL 3ZE0F 2R0WL 3OKLB 2AGJH 3MZGB 4PLJD 3K8MA 4HIJB 4N5EC 4M62H 1LDPL 3INUL 1L7IH 3B2UD 1DQML 5HVGB 4Z7NF 4PJFB 2Z92A 5D5M