4YWGH

Crystal structure of 830a in complex with v1v2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
224
structure length
210
Chain Sequence
QVQLQQWGPGLLKPSETLSLTCAVYGGSFGRYYWSWIRQSSGEGLEWLGQIDHTGSTTYNPSLKGRVTISIDSSTNQFSLKVTSVIAADTAVYYCARAPSGYPGVSLYQYYGLDVWGQGTTVTVSSASTKGPSVFPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Light chain of anti-HIV-1 gp120 V1V2 antibody 830A
publication title The V1V2 Region of HIV-1 gp120 Forms a Five-Stranded Beta Barrel.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 210
sequence length 224
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ywgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ywgH01
1U3HB 2DQUL 1OTTC 5E94A 2O5YL 3K1KC 2E5EA 1YEGL 5BRZB 4LPTA 4YHNB 5IK3A 5IQ7L 1H0DB 1EVTC 4LVEA 3FB6A 5EG6C 3BMVA 3VW3H 3B5TA 4WI4A 5I1CH 2FWOB 2A77L 3RWFA 5FA3B 1DEDA 3V5DA 2F53D 1XR8B 5H2BB 2VTFA 1LO4L 3ORJA 3QQ9D 2OLDA 5ILTL 1FNEA 1S5HB 3O2DA 3CFKA 4WFGD 4M8QB 5KBNC 1T89C 1B0WA 5E00B 2E9WA 3FCTA 1LQSR 3RNKA 1HKLL 3T09A 1KULA 1GGCH 2BVOA 4YBLB 4P2QA 1FVEA 1J0JA 5IMKA 1U95B 1A6AB 5D7LD 3DPBA 2Z0BA 3DXAB 5TQ0L 3GM0A 4NKDA 4S1SL 3MREB 4HBCH 1FQ9C 3SQOL 3MV9E 1OCWL 1WFNA 5EORL 1CZ8L 4YNYB 2MTPA 2OP4H 2HN7A 1R3LA 5CCKH 5EOTB 2GHWB 3MV8E 1T1YB 1C1EL 1IEAB 4TPRH 5D1ZA 1DE4A 3C09C 4N68A 5A16A 1PFCA 3G9VA 5I8OL 1A1OA 3ABZA 4PGDB 4YXLL 1AR1D 4ENED 3U79A 2EDFA 3LQMA 1IAOB 1NBVH 3O2DL 4ZXBD 1CE1L 3EDDA 1TTFA 1ORSB 2C3WA 5IFAL 5DJYB 1XGPB 4YFLF 1ZHKB 1Y18A 4DGYL 5DUMH 2BOBB 1MIEL 3I6GA 3PG2A 1I8LC 3SY0A 4JQXA 3CZFB 4YGVA 3RGVC 1FGVH 3DV4A 3MACH 3V95A 4WNQA 2R69H 4KPHL 4D0CB 1IGCH 1MFEL 3WE6A 1E4WL 3QPQC 2Z92A 4WV1C 4Y1AA 4PJXA 4OLYL 4LBEA 4N9GA 1FNGA 4UTBL 2PO6A 4ODWA 4IDJH 3ZTNL 3RWGA 5KVMC 1BFTA 2BX5A 2XZCL 5EC2A 5EN2B 4PJCF 1ZLWK 5T3XE 3RIFF 3VJ6B 3F7YA 4PP2B 5C0RH 1HSBA 2DL2A 2YSSB 3IVKB 3GO1H 4PJ8C 4FXKB 1HHGA 3QZWB 4HXBL 2QTEA 5F6HI 3QO0B 5HPOA 2JJSA 2QADC 4RX4D 5J06A 3MCLL 5CJQH 3IDIA 5C09E 4JLRB 1TZHA 2W9EH 1TQBC 1LMKA 1VERA 4M7KL 1WIUA 5DJ2A 3TF7C 5BZWA 3TBSA 1HYSD 2CDFA 2R1WB 3WCYA 3MYJB 4OSUL 43CAB 2X4UA 5B39B 1GGTA 1J87A 4OJFH 1KEML 1FJ1A 3IXAA 3BGMB 4M1GH 1U8PA 1S7TB 1YEFH 5EPMA 3S3PA 3FONA 2XN9D 2UWEB 2MKWA 4XNXH 5D1XA 1QVOA 1N5AA 1UZ6E 2V7NB 4NP4L 5DJ0A 1VADB 4D8PA 5CD3A 2JIXA 3MRFB 2Q6WB 3HE7C 4L3EA 4FG6C 2IPKA 3MRRB 2BVTA 4OCXL 1XCQA 3BKMH 2JJUA 4DK3A 2MQ3A 3UC0H 4YHKH 5L88H 2AJVH 2PYEB 4XCYA 2ADGB 1X5JA 4M4RA 2ICWJ 3BT2L 5IR1B 3OGCA 3BE1L 5DD3H 3P4MA 4PFEA 4KI5F 2Q76A 1CQYA 3E6HB 1G7PA 2NX5A 3VXRA 3MRBA 2E9BA 4G8GB 4ZYKB 4BELD 3CUPB 1KLUA 4UILH 3WKML 3FKUS 5I15L 5D9SA 5J1AB 1U93A 3GK8H 2AQ2A 1DN0A 4X6EA 4HUXB 4EUPH 2GIYA 3NFPB 3CVIL 2WM0A 4JO2H 3BX7C 4B7IA 5FCUL 3WUZA 2GT9B 5HVHC 4ODSH 2ARJB 3R1GH 4IHOA 2FSEB 1I7RA 4FZEH 3QDJE 4M62L 4GKSA 1NC2D 1LHZA 3P0VL 2E6JA 1BM3L 3PWUA 2CSPA 1BOYA 3TT3L 3QR2A 3OR6B 1UVQB 1IZJA 1D5BA 4IS6B 5EOCH 4YJZL 3S88L 4Y16C 2XTJC 3O2WL 1FVCB 2UUDK 4NJAH 4M93C 5IHUH 4NC0B 1E28B 1C12B 1FGNL 3HAEA 1E6OL 2VN7A 3ARBC 4FZ8L 5TDPA 1JUFA 2BSSB 3IDYB 1FO0A 2JCCA 3MLRL 1OAUH 1AKJD 4Z7UB 5HGAB 4NN6C 2P42B 4CVZB 2ZUXA 4XP6H 2AI0H 3RP1A 1HQRB 2Z91A 2IPUK 5GGSA 3X3GL 3GHBH 4LIQH 4NIKB 5I1EL 1NMAH 1TITA 5E8NA 4WTXA 3EYVA 5I16A 3S4SB 4D9RD 5JIIA 4J3SA 1JRHL 3JZ7A 3VWKC 3JUYA 5CZVH 4DVRH 4RMQA 3PWPD 3O3AA 3VFSB 4DGVL 3KS0J 3V7MA 4IRZL 4DW2H 2APWA 4JDZB 4EN3A 5DD6A 1T7YA 1SY6A 3BQUB 4P59L 1PGRB 4F8TA 1CGVA 3PL6A 4O58H 5EBLA 5EO0B 3P4OA 3PDOB 4JVPA 1FO0L 3LMJL 1JZ3A 3DJ9A 5IGXL 3ARUA 4OUUA 1IKFH 5EFIA 1DBAH 5EA0L 1ZHBA 3O8XA 2R56H 2NY4D 4WEBL 4MDJB 1I9RH 4MD0A 3PQYA 7CGTA 1TZGL 3G5ZB 5B8CA 4OLVL 2HJFB 5CEYB 2VZ1A 5EZOH 3UROR 4N0UB 2BSTB 2IPUG 3FOLB 3U7WH 4PJEA 5D7JA 3EZJB 2CIKA 2EDEA 4CW1A 4N8CL 3DV6A 3GJEB 3PUCA 2CK0H 4R2GB 4UT7L 4BK4A 1SY6L 4QF1A 4V2CB 3FRUA 2OM5A 3FB5A 2B1AL 4QHNA 4UNTA 4LVHB 1RZFH 5FCSH 4WO4A 4JFEB 4I4WA 1FIGL 1MRCH 1ZK9A 4HZLB 5T1LB 2HAZA 3BEWA 2W0FA 2I5YH 1OSPH 1XF3A 2FATL 4YWGL 3QI9B 1T0MA 4ZOCA 5LXGH 1XIWC 4G9DB 2Q7NA 5CIPH 5B38B 1HHIA 4OLZH 5C0BE 3JWDH 3WFZA 3D9AL 3QEQD 2ADFH 1JHTB 4OT1H 1J1OL 3L6FA 3FQTA 4P9HH 5A2JH 5HSFA 2WLZA 5IOPB 5K59E 3VXSD 4JDVB 1EJ6A 4PLJC 5ENWB 4HF5L 1F6FB 5GJSH 2NLJA 1EIBA 1YEIL 3ZYZA 4L8SC 4LCWD 4MNQD 3C08L 5B3JF 4KQ4L 4PGBB 4NNYA 4G6AC 2EE9A 5KVDL 2I60H 1Q72H 3DO7A 4OD2A 4PJDB 3UTTD 1RZIB 1FVDA 2BHZA 2XZQL 4FTVD 1FL3A 4Z0XA 4QHMA 5KSAB 3RU8L 3SE8H 4P57B 3O4OC 2WNGA 2R1YA 3KPRB 1KT2B 4U6VL 5E2TL 1QSFD 1FG2A 3L5XL 2ICWB 1AD0B 4HQQL 3DIFB 3GNMH 1Q9LA 1RFDH 2HH0H 2EXWD 1EO8L 2HKHH 1AGBB 2A6IB 4LU5H 1HILA 3L3IA 4PG9B 4NC1C 4U6XA 4KV5E 4P2RE 4I13B 1HXMB 5DJ6B 2ADJB 3K4AA 3MNWA 5I75B 4QHKI 1OARH 2R2BA 4JY6B 5F7KC 1OTSC 5L2KA 2VLLB 2V2XA 3TPUA 4Q58C 1TCRA 4U3CA 3FFCA 1YQ2A 1CLZL 4NQVB 4P9HC 4YXKH 1J8KA 1NGYA 5EU6D 4UU9A 1F13A 2BFVL 3C5ZB 4LNVA 4D2NA 1INEL 2YUZA 3LPGA 4ZFZA 4LHUA 2PW2B 4QWWD 5MHSD 1CFVH 3RZCC 5DVKA 4CVWA 1NCAH 3KNBB 4E41A 3JV5A 1INDH 3L1OH 3BZEA 5ANMA 3ROOB 3I2CL 1I1AA 2EC9U 4GRMB 2P7TB 3P4LA 3QJFB 4G5ZL 1GZPB 1U3JA 5INDB 1IT9H 4JPVH 2MPAH 4JZJA 1DFBH 3PF2A 5IFHL 4AZ8A 3HI5H 2OCFD 4M3KB 4KJQC 2QSVA 2BVYA 3BW9A 3WIHH 1JPGA 4K3JL 2C1OB 4CU8A 2ESVD 5EZJA 1T03L 1W0VA 3SDYL 3TV3H 1NC4A 2YA2A 4TUJB 4RDQF 4LRIC 3BWUC 4HX1A 5F93C 2HLAA 4XBPB 1WC7A 2PYFA 4HV8A 4YHLL 2ITCA 5I1IL 4R3SA 2YMXH 4G6MH 4MJID 2Y9RT 3MROB 5D2LA 5BVPL 4KI5C 2ADIB 1U8IA 3QQ4A 3SDAA 3BPLB 3T0ED 1JK8A 3V6ZA 1MH5B 4ZPVB 4MD5B 3NIGF 3GSNA 4XPAH 5J57B 1ACYH 2H1PL 1DBKL 5F7EH 5GS3A 1QEWA 3G5YB 3M1BB 3I6LD 2E7CA 4JFFD 4MNGB 2QJDA 1IQWH 2FIKA 1UM4L 2P5EB 5HD8D 3L3HB 1KIRB 2B39A 5FUOH 1G6RH 3C60D 4UIKL 1IEHA 3HCVA 3VA2C 5HVGB 4PJAB 1CD1B 3CPLB 1JYNA 1OOAA 3P0YL 2W9DL 3V5HA 3FO2A 4FQ1H 2BNQD 1AXSA 5IUSA 5C7XH 1CDJA 1MFDL 3VWJA 4NN5C 1TNMA 5E0QA 1KCRH 4IRSD 1Q9WA 1SQ2N 2Y6SC 4KTDL 4CN6A 1M7DB 2X4TB 3AREC 4PJ7E 3S37H 2VDLH 1XGYH 2NY3D 3LS4L 1YEKL 2HFGH 3GSNL 2CRIA 3LB6C 4R4BB 5GGQL 5HHXL 5CILL 1RJZB 2QKIA 2NY1D 5IKCA 3HZMA 1CL7I 4WI3A 3PJSB 2XKSA 4RSVA 1I9JL 1B9ZA 4WWKC 2C3VB 3CJJA 4PY7A 1MHEA 5GIRA 4IM8A 5T5NF 5CEZH 4JVWA 5FUCC 1GAFL 1X44A 2R1XA 4JFXB 4L4VD 4BQCA 2IADB 2KDGA 2P8PB 4K7PL 2HP4A 3SDXE 4KJYB 5DGRA 3NACL 2GTWB 2BMKB 3LZFH 4OZHF 3MNVA 3CU7A 3WS6A 2EE6A 2QQLL 4Y4HD 4H1LG 5KTEL 3J8F7 1CFNB 3TBWA 5EC1A 3TYGL 2P45B 3NH7H 1IAKB 4BH7B 3QDMD 1UWXK 2WWMD 3WO4C 5I1KH 1Y6NR 1LNUB 2J4WH 3TO4C 3HC0B 3T0WA 2VDOH 4ELME 3OF6D 1S9VB 3DGGB 3QH3B 4FFZL 3B6SB 1QFWI 3MOBL 3P11H 4ONGL 4Z7VE 5KSBF 4LF3B 3BN9D 2HWZL 1K8IB 3ECBA 1NGXA 2B4CH 2BJMH 4OFYA 4MB4A 1U8QB 4FQ2L 3QIWC 1YN7B 3TVMA 3D87B 2NPLX 3NAAL 2R39A 4ZFFB 4Y5VB 1JL8A 4F2MB 5EH1A 2EDBA 4Z7WF 3VGDA 5JORB 1KB5L 4P3CL 2IALB 3HG1B 2HFEA 1P7QB 4LEOA 3F5WA 3REWB 3ZE1F 1I3GH 3PIQB 2RAMA 4IRJB 5F9JB 4PJFB 5EOCJ 4I3GA 2WIIA 4MCZA 1QFUL 2CLRB 1NCUA 3CFDB 3IDMB 1Y0LA 4KTYA 1G7JB 3DX6B 4WI6A 3VRJB 5CSGA 4OFVA 1EFQA 2DJSA 3B2UD 5DMKB 1FL6A 4GFTB 1RJLA 3FL7A 3T2NH 4RZCB 3OKNB 1YEHH 4JN2B 4XWOD 3S35X 3ILPA 4Q9QH 1ZA3B 3FOMB 4HCRH 4I3SL 5D1QD 2D9QB 1MI5A 4P2OD 5HHOB 2EYTA 4OFKA 1L6ZA 5MEOB 1V7ML 4JRXE 1ZVHA 2VXUH 1DSFL 1XF5A 4HUMB 4C56D 3P77B 3BYTA 4K3EL 2PR4L 4Y19A 4L4TD 3T4YA 4O4YH 2QADB 5EULV 4KQ3L 1F90H 1CT8B 2B4CC 2VDML 1IAII 5D8JL 5BQ7A 5HYSB 1OP5K 5DHVA 1OB1B 3LN9A 1FE8H 1GC1L 1R3JB 3HC4L 1S7VB 4KU1A 1V7NL 3FB7B 2VLRD 4ZUVA 1V3MA 4WTWA 5ICZA 2FR4A 2GSGB 3NMEA 4QRRA 3T8XB 3S34H 4XNUL 3K8MA 3AB0B 5FOJA 1NEZG 2H45A 4K3HA 2A6JA 5FUZH 3VFNB 1I7TB 5AZ2H 4KKLC 2LU3A 4U3HA 5D7KD 4GBXD 3QFJB 4C57C 3LEVH 4ZSOB 4TUKL 1FYTB 5B3NA 2J8UF 3LV3B 3F7VA 5F8QC 4U7KA 2HJLA 2Y5TA 3I85A 1EFXD 4FFWD 2X89D 3Q6FA 2XA8H 1Q38A 2JB6A 3KYAA 5FB8A 5T33L 4JVUA 3F7QA 3QWOA 4KVCH 1NKOA 1YMMD 3AS1A 1KCVH 4I48A 4K7FA 3EOAB 4UDTA 5D71L 1KFAH 4FQXC 4HWUA 4OGYH 2X4QA 5JPMB 1GGYA 1KEGH 1PBYA 2DQCL 3WO3B 5CLTA 3QUMA 1FZOA 5I0DA 3VD5A 1H3VA 2YXMA 4G9FE 3KJ6L 4NHUB 5E5UB 5TDNA 4Z76B 1NGWA 2BOCA 3THMH 3KHQA 2XKNA 2KBGA 2R2CA 4NDMA 3L3JB 3TZVD 5E6IC 3AFLA 3LD8C 3TH3T 3RWIB 3FHQA 5KS9F 1RUPH 3CSYB 4CDHA 1NDMA 5DDHB 3TA3D 5TE7H 3RNKB 1QSEA 5HVHB 3SO3B 2F19H 4M6NH 2Z31C 3B9KD 4JREC 3C6LD 1HINH 4GW5B 1PKQB 4S1RL 5LBSH 1G7LA 1TDQA 1FH5H 3VDAA 4CVUA 1F11A 5C08D 5KJRH 3QUML 5E5MB 4NKDB 3ARDB 1H3TA 4KZEL 5FAAA 1QRNE 1YNLL 5DGQA 5IVZA 3SKUD 4YDJB 3GUTB 1R3LB 3TBVB 4J4PA 4KJWD 3KGRA 2YPKA 4GRLC 4JN1H 1A7PL 2CIIA 1B6UA 1G7QB 4QRTA 3O4LA 3V52L 1M05A 5FA4B 2J6EH 1C5DA 1RI8A 4JO1L 3CFEB 3MA9L 2V2WA 3U7AA 3MV9A 2P24A 5EIIB 1IE5A 4K94H 4WU5A 3B9DA 2ZSWB 3KPMB 4FP8L 3VFPA 4Z77A 4BK5A 3P40A 4NWTH 2R0KL 1XF2B 1HK6A 4AEHL 3MZTA 5F1NA 3SY0B 1ZWIB 2D9CA 1TJIL 3OXSA 1BREA 4YHPB 1J8HD 3FTGB 3PABB 3U6RB 1UZ8A 4FQIL 2AXGA 1JI2A 4PD4K 4HC1A 5F70A 4EUPB 1ZHNA 3QDGB 4HBQA 4MQTB 1SM3H 4PP1C 1T1WA 4UNVA 2MFNA 1PZUB 3WIFA 1KIPA 4LBEB 3MTRA 3B8YA 3MV7A 3QXAB 2Y36L 4X6DE 5F88B 5JOFB 2FYYB 5IB3B 4JHBA 1T20A 3E6FA 5D7IB 1G9MH 1DL7L 1RURL 1D7FA 1HSBB 1U6AH 5EUOF 3ULVF 1HHGB 2FCBA 1CFQB 1NUNB 4XRCB 3G6DL 5EZLA 2H3NB 5MENB 1ULVA 3MRGB 3HRZB 3VFUB 3DMMA 3SDCB 2QSTA 4ZTOL 3RKPA 5BZWB 3SBWC 4HMCA 2GFBA 1FN4B 2DKSA 5I30L 4PRIE 4HC1L 4MXWL 4JO4L 4GRWF 1J9CT 5DFTA 2B1HH 4K94C 4I0PD 1D3CA 1F4XH 3FJTA 3IXAB 4JY5L 2OS7A 5ADPH 5C09A 3IU3B 4G6FB 4UT6L 5EPMB 5TH2A 4WHDA 2D7TL 4DK6A 3FONB 4TSCH 4H0HB 4HFUL 2AJ3B 4EXPX 1QVOB 3QQ9C 4KHTL 2PW1B 1UXWA 3O3BA 1A6WL 2WMPA 2X9XA 5CD3B 1MCQA 1ND0A 3RTQD 1AO7E 3GSOA 5DR5H 3O9WB 1N7ML 4PJ5B 2IPKB 3WD5L 4GAGH 4L1HA 5DQDH 1WCBA 3MCKB 2CDGB 5C3LD 4AT6A 5IP4A 4GAYA 3GSXA 4IIQC 4S11A 4EIZC 4Z0BL 5L0QB 1I85C 3BDYH 4CMHB 1G9MC 2C4FU 4E0RB 3T0BA 4DKFL 3Q3GA 1VGKA 4XXDB 3ES6B 3WS3B 1HOCB 1F4WH 2NY6D 3LN4A 3W39A 2QEJA 2Q76B 1HCFX 2Y07L 4PB0H 5FEBA 3OZ9H 1A7NH 5LAXA 3MRBB 2VR4A 1K6QH 3RVUD 3F6IA 4RISH 1SJHA 1AR1C 2QSCL 4G8IB 3SGKC 1U93B 3CFBB 3U9PH 3QWRA 3OKDB 3O6LH 4XPHH 4F7EB 1BVKB 1A5FH 4KDVA 5C8JA 1I1YB 3WYRA 2A1WH 3QHFH 3Q48A 5ID0A 1P69B 1Q9OA 1ZT1B 3DLQR 3U9UB 1C5BL 4HIJB 5E8OA 1RQ5A 1VGEH 5DJXB 4GKSB 3CVHA 3EJYD 3MUGB 5DEFB 3K2MC 3JBG7 4M5ZH 1GGIL 2AAVA 2AABH 1WISA 5E2WL 2E9IA 5K93A 3NCCB 4PJCB 5DJ8A 3RVVD 5EUKB 1S8DA 2IPTL 1QYGH 5L8JB 4TOYL 3NBNA 1UG9A 4RQQA 2F8VA 2IWGA 4PJ9A 1E4XH 1OAZH 4WEUD 3FQUB 1MY5A 1MFBH 1DQQA 1QTYT 3BWAB 1T83C 4J8RB 1U8OB 4X9IA 1LE5B 2WBJA 3JSSA 5F72S 3STLB 3EYVB 5CINL 2AJXH 2CR6A 2VITB 3RY4A 4HIHB 1CFSA 1FZKB 2XY2A 4LCCC 1JWSB 3RZCB 2EYSA 4W6WB 1HYSC 4K2UL 3CVHL 4EI5D 3DBXA 2DWEA 4M7ZC 3VMNA 1R5IB 3K4DA 3L3OB 1YNTB 3EO1A 3O6KH 4PUBL 3WFCL 1AD9B 5DD6B 4GG6E 1F5WA 1I8KA 1RSFA 3TT1L 2IAND 4PB9H 1RUMH 5IEKA 2D31A 2AKRB 4PRAB 5DUPH 4PJIE 3EDJA 3BXNB 3KPPB 2VLMD 3P4OB 3EYUL 4PJXF 4KKBC 4CMMA 5ICXA 1HE7A 4JJ5A 5C0EB 4WEMB 3T2QA 1QBLL 1VFMA 2JB5L 2YRLA 4NFDA 1ZHLA 2PTUA 4Y2DD 4D9QE 2A9NL 4U6HB 2R9HD 5C9JA 4MAYB 5IJVA 4C58B 1UADC 2P5WB 1A0QH 1JPSH 4QXTA 3FHAA 4QHUB 4JM2D 3TJEL 5F7FA 5I1GL 2PTVA 4LDLB 3WJLA 5IW3A 1GGBH 5D7JB 4HJGA 3D3VD 3N85H 7FABH 2OL3A 3ZTJG 3FO1B 4WI8A 3D18B 1RU9L 4XVUD 1FLTX 5AUMB 3E3QC 1KJVB 1MCBA 3OB0K 2VSDA 5FK9A 4LQFH 3FRUB 4NQDE 1BQUA 3TPKA 3CLEH 2LV4A 5M7QA 1T21A 1DANT 3R0MA 1QA9A 1CXIA 3IDXL 1OGAE 5C07E 3WSQH 3DRTB 2DIJA 4OZIF 1J1XL 5HHMB 3IYLW 4ZQKB 5J13C 4G80A 2VISB 5ESQA 3ZT5A 3FFDA 3HUJA 5A2FA 5ACZA 2UY7A 4YQXH 2NZ9D 4R8WL 3OKEB 1IGFL 4GW1A 4JHAL 1PW3A 25C8H 4LLVA 2OL3L 2A2QT 3MRKA 5A3ID 1PD6A 1ZE3C 3RVWD 3MR9A 2IQAA 3CAFA 2WANA 1BBJB 2HYMA 3LPFA 3KAAA 1U2HA 2ATKA 2ENYA 3AREB 4JCMA 4OZGB 5DFVC 1RHFA 4JB9L 4PIRF 2NY5L 4WI5A 2YEZB 1ZSDB 4PRHD 1R5VB 1R3IL 4GRWH 3V7AG 4Y4FB 1BIIA 1MUJA 3DO7B 2E7LA 2MCPH 1MCWW 1FVDB 4WWKB 2CLZA 3QUYA 4I2XE 4PY8J 5BS0A 4H25A 4QHMB 4M1CC 4R90H 1MFCH 1MF2L 1HI6B 1KXQE 3I6KA 2EH7H 3ZYOA 5IVNA 4YBQD 4IEFB 1HNGA 2I9LB 3HR5A 3PDDA 1U3YA 4KROD 2P8LB 4AMKL 4KK5D 3WFEH 1P4LA 2ZOLA 2PTTA 1G6RB 2YXFA 4AY0A 4NOBA 1T6WA 1B0GB 2VUYA 2NZIA 4OM1H 1S7SA 4M7JH 2BY3A 4A6YA 1RIUL 3RAJH 1NEUA 3S36L 1MAML 1MCLA 3ULVC 2X9YA 3TO4B 1PQZB 4PYHA 2JCCF 4QXUL 5BRZE 4J1UB 1OCWH 1BZQK 1TCRB 5DD0L 2X4PA 3WUWB 3ZHLA 4YR6B 8FABA 4PG2C 4YDKL 4OGXH 1C1EH 1IC5L 2FX8L 3WHXB 4P2RA 1F42A 3MV8D 3QIWB 3L5WA 3MSPA 4Y5YC 1ZS8A 1DQMH 5FYLE 4E41B 3BEVA 3A67H 4XC1H 3T1FA 3BZEB 2CD0A 4ODTL 1MHHA 3O41B 3I75A 3BIKB 1F00I 4LEXL 1I1AB 3HNTH 4DGYH 1T1ZA 1TJHH 1MIEH 2MNUA 4MVBC 2D3VA 3DXAE 4A6YL 4P5TC 5D6CB 1UT9A 2XQBH 1CDBA 1D5ZA 2AEIT 1AHWB 4B41A 1M6OB 2G9HA 2HFFA 4M61A 2HT3D 5I76B 4HUVB 4Y8AA 2VXQH 1YEEL 3SEPA 1HHHB 1U58B 5DRWA 5FDWB 4P46D 2VQTA 3VG9B 4HWEH 5J3HD 1ED3A 1RK0A 5I73C 4U4BA 1YN6A 4H1LA 4HV8B 3GJFK 4KHXH 2ITCB 4ZFGL 4Y4KC 3QEGH 5T3XD 5JW3L 2C5DC 5D2LB 4POZC 5I8EB 2VXVL 5EO1A 3QUXB 5HHNB 1QLRB 2XWBB 4PJEF 4GLRI 1IFHL 2DLTA 2H9GB 5LCVH 2R0LH 1KCKA 1MRFL 1OPGL 3WXWH 3H8NA 4Q97A 2AVGA 1CTNA 3Q5OA 1U8NA 2VZUA 4MD4A 2E9JA 2BNRB 4DQOL 2Z8SA 3BPCB 2CUMA 2DQGH 5IBTH 4BQ8A 1T4KB 5DVNA 2P46B 2PXYD 2Q86B 4AQ1B 3SJVB 2ZKHH 3LQAH 2VE6A 1Z9OA 2J12B 2IAMA 3RY5A 3RBGA 3ZZ1A 4R7DA 3HE6D 3H9ZA 3UBXB 4OD3H 4EZMA 3B4NA 2XQYK 4QY8B 4OCXH 1D5XA 1H3PL 1G7IA 1N0LA 3MOQA 1QHOA 4U1LB 3UJJH 4LOUC 3HKFA 3KXFB 1DUZA 1WTGT 4U1JB 3OG4B 1L7TL 5I9QC 1UM5H 3A6OA 1FLRH 5D1ZC 4KUZH 4LSUL 3X13B 1YEJH 1MLBA 5AYUL 5KVFL 3VFRA 2JK5B 5IB4B 1ROWA 1CDUA 1UWGL 3LH2L 1TJGL 1CU4H 2BXZA 2ARWA 1E0OB 4UIMB 3WXVL 4ZODA 4JFPA 2X5PA 3QUZD 3DETD 3LIZL 1MHEB 2O5XH 2X41A 4MNHA 3RDTA 4XNQB 2ZCKL 5E70A 3GMPB 2AK1L 2R1XB 5K33A 2R4SH 4V2BA 1BJ1H 2FHBA 1X7QB 5HHPB 1KB5B 1MWAA 3MOAH 3OR7B 3MODL 1D5MB 1AP2B 1JGLH 4ZNCD 2PO6C 4TRPL 3VXMD 3C8KA 1ZGLM 2FJFB 1QG3A 4C54A 5C0DB 4AIXA 4LMQI 4Z7OE 3EBAA 4JREB 4IMLB 1X5LA 4G3YL 4XMLL 4FQPA 5DD5L 2PYEE 3LQAC 3QDJD 3V4UL 5L7XH 3WFHB 1L7IL 5CEXA 4I18A 2ED7A 5D4QA 2QV2A 1YECH 3C2AL 3RPIB 1PEWA 4P23A 3BESR 3X12B 3SDXA 4CNIB 4YZFF 2YK1L 4LARL 1S7QA 4NUJA 5INCA 4XMPH 2JJSC 1NBZB 1NGPL 4G7YL 1ZT4B 3MGTA 4CJ0A 1WCQA 3I3EA 5DK3A 2XZZA 4JM4H 4G8GE 1WGOA 3PGFL 2JELL 1A7RH 4W81A 4OAWA 1ZOXA 1FDLL 2BRRH 1CLCA 4PRPE 1OSZA 4K71B 1BIHA 4NBYB 3T0EC 1MWAL 2F54D 5ICYA 3RY6A 3VGEA 3WDIA 3VD4A 3I9GL 5CZXC 3U30B 3PGDA 3VFOA 1RJYB 3SKJL 3DRQB 2NXZB 3MJ9A 5E9DD 4N0FA 4N9OB 2W65B 5HD8C 1RHHB 4HUUA 5D72H 3P73B 1E6JL 4F33B 2F15A 4NM4L 3UJIL 3C60C 4OBRA 5EOQH 5DURB 3OXRA 3MO1A 5DJCA 4PR5B 1SYSA 5J7CC 3NFSL 1IAIM 4Z7UE 3WL9B 4WUUD 1RY7B 4OBSA 4F57H 1A2YB 3QZWG 2I9TA 5DYOA 4KGLA 5SWQA 4FQCL 1NFDF 1VESA 3WMSA 2BK8A 5ESAA 2IF7A 4ERSH 1U36A 3L7FA 5F7UA 1OM3L 4GJTB 3T4YB 3WBDA 4AG4L 1IEBB 1MPAH 3IDGB 5I8KH 5BQ7B 4LGPB 4P5MB 5DHVB 2NY1C 3MJ9L 1I8MA 4W4NA 1NGQL 4OM0H 1ZEAL 3SCMD 5ICZB 3IDNB 2FR4B 4JRXA 4YIQA 1ZTXH 4DFHA 5EZIH 4MA8H 3EFDH 5EU3A 5T1DL 3W5MA 2OMBA 3GMOA 3AC0A 2QHLA 3L95A 3EYOA 5FHAH 3OKMA 1WLHA 3BGFB 4Z95H 2F53B 4DKEH 1CGSL 1T3FA 1Z2KA 3UZVB 4C4KT 4BKLB 2G60L 4EBQH 1AGFA 4DN4H 5T3ZD 5TDOB 3OX8B 2HTLD 5FF6B 4X5XB 3SKNB 4F3FA 3QG6B 4MJ6A 2IH1A 1IKNC 3HMXH 2NW3A 4LLDB 3TIDB 4JAMB 4LGRB 3TESA 1OLZA 4N0UE 5D7LB 5IEHA 4Q9RH 2WWMC 4XVJH 4UDTB 5JPNA 5I66B 4MQ7B 5JIPA 5C0BD 3IXTB 5KSBB 1KELL 3OAYK 4HK0B 4TVPL 3EJJX 5CSBA 4HS6B 4O5LH 1JGUH 3O3DB 2VDRH 4P4KA 2NW2A 5JW4N 3S7GA 3E2HC 3BN9C 3SPVB 3JTSA 4NRZA 4U6TA 3C08H 4JFEE 5C0GB 2EH8L 1L4IA 4Z7WB 3GSUA 2FB4L 2XT1B 3I84A 3NGBC 4H5SB 1EDQA 2XKNB 2LVCA 3HPJB 4EN3C 4AEFA 3B83A 1A64A 4BA8A 1H3XA 1AE6L 4ZXBB 3VMOA 4DOHB 4NO0D 3GMMA 4J23A 3NA9H 4G9FA 5I1DA 2OJEB 4WU7A 3V79C 3PL6C 2BSED 3PDGA 3NFNB 1HZHH 2VABA 2D0FA 2V2TA 1G7LB 5JR1H 3O8XC 4DJMA 1F11B 1FC2D 3DTXB 4HIIB 4LQ1A 3VXNA 1EERB 5DMGD 2A6DB 2UYLB 1DLFL 4BFIB 1JZ8A 1WICA 3P30L 4XWOC 3M17A 1WBXA 4LK4A 5IVZB 3QEHB 3S96B 3KYKH 3IGAA 5B8CC 1F8TL 2HJKA 4ZO8A 4W4OA 5MEQA 4JFYA 3PHQB 3F12A 1P4BH 2HG5A 3NCYS 1PKOA 3WDHA 3EO0B 4QRQB 5CJOL 5J11B 4XMKL 3KG5A 1GZQA 1WBYB 3KPRE 1QRNA 5IHBA 1BWMA 3QXDB 4DGIL 2VOTA 4NKOA 1PDKA 4MHHG 3IJHB 1NCTA 4WO4C 4Z77B 3P9WB 2JJTC 4ODVH 3KYMA 2AJSH 1U2CA 2E7BA 1PZ5A 2M26A 3WIIH 4XAWL 2XFXA 3L5HA 1UH4A 4U1NA 2N56A 4JPKH 1P9MA 4D9LL 1WBZB 3T0VA 5E4IA 2WQ8A 2OXHA 4AL8L 1TPXB 4H8WH 1XGTB 4HUWA 3QP3A 4X80L 3ULUE 2IGFL 3LEXA 3P9MA 4HUNB 2CO7B 3SDYH 1KG0B 5AAMA 4WCYH 2GJ6D 1XZ0A 4XCEA 1X5KA 3QIBA 4OTXL 4RBPK 4XP9L 4ELKB 5IB1A 4NN7C 3PP3H 3LEYL 4R26L 5JHDA 3T0DA 1VEOA 4OCNC 2ZJSH 4NQED 3IJSB 5FIEA 4R96A 4X6DA 4OLEA 1CDHA 4WFHD 1MELA 4P99A 4TNVK 3D25B 5J89A 2GFBB 1KTLA 2PCPA 2VZ3A 1YEDB 3IFLL 4QGTA 3VRIA 1ZA6B 1UA6H 4JHWH 1M1SA 1UJTA 4YHZH 4L3AA 1F6AA 1KNOB 2A74A 5DEZA 2E27H 1F4AA 2O61B 4X6CA 3FO9B 1A6UL 2H6PB 1PLGL 5JOEA 3TN0D 5B38G 2ZUSA 5J13B 1AJ7L 1IM9A 4ORGB 4BZ1L 1KJ2A 4FXGB 3DSNA 1J5OH 1U41A 2VDQH 1OF2A 1Z9MA 1CDCA 1EVUA 4AT6B 3MNZB 2H26B 3NN8A 4X8JB 4H8WC 2VKXA 2VDPH 1YC7A 5C0AD 4S2SB 1NMCB 5LGHL 5CGYD 1N3NB 4E5XA 1VGKB 1CXFA 2EIDA 4NM8L 5HI4D 4HG4J 1AO7A 3IFPB 4HKZB 3FT2A 3LN4B 5GGQH 2G5BB 2X09A 5JQ6H 4LAQH 3OG6B 4MA3A 1A3RL 4XVTH 4OFDA 1AKJB 5FV2A 4HJJH 4MNGE 1LEGA 4LCIH 2P5EE 1UKTA 4NZUL 3AXLB 4UTAL 5BW7A 1HEZA 2D0GA 2OTWA 4NZDA 3VMPA 1T80A 2AJUH 4PJAE 3MRMA 4XH2B 3JWOL 4N90D 4QTIH 5BMFH 5GSVB 5JMOC 3MRHB 2GTZB 1U92B 1PYWA 4JZJC 1KJ2L 1OAKL 3NPSB 1VA9A 2ITDB 5E8OB 3PWPB 5F7MC 3CVHB 2YD6A 1FFRA 2DQHL 3ZE2E 4APQA 2OR9L 4KDWA 3ZSSA 4FQHA 3RL1B 2KQMA 4XI5C 1RZGB 5TF1H 3ZHDA 2AEPL 2EE3A 1MIML 2VZOA 3MPCA 4X4XB 1RMFH 3RWEA 4LSVL 3D85A 4FFZH 3SDAC 1QLEH 3K46A 4NQUA 4NWUL 4ONGH 3H0TA 3V5KA 1DQQB 4W68A 2A9MH 2AGJH 2NY4B 1S9XA 4BJLA 5DRNA 3PHSA 4QRPD 4JY4A 5I1AB 3MMEB 1BJ1J 1VPOL 2VLKA 4FXLA 4Q7DA 5TGBB 3TIEB 2X2YA 5FYJE 2EO9A 3HC3H 4UV7L 2LQRA 1UFUA 1B90A 1CICA 3FMGL 1IGJB 12E8L 1MEXH 4R7NB 3WNKA 2NY2B 3BVNA 5FYKE 3DBXB 3U4EA 1JRHI 2YN3A 5F7LB 1PG7W 3EO1B 2ORBL 1I8KB 4M43L 1HWHB 1RUKH 4I0PC 3OMZA 5FM5O 1JNHA 1K8DA 2WIMA 1W8OA 1TTUA 5DRZA 4CUCA 4K8RD 1EJOL 4OLWL 1J11A 2X1XR 5ICXB 3PWLA 5J6GA 2R4RL 4I5BB 1ZLUK 3IDJB 4HPYL 4YC2C 1ZHLB 3ALXA 3RTQC 1A6VL 4ZD3H 3OBAA 4S1DD 5BVJB 4GS7B 1QLFB 3AGVA 4HGWB 3W9DB 3WN5C 4Q6IC 5I73B 3KLHD 4QXTB 4RAVA 1NFIA 1AY1L 1V7MH 3N50A 1XGQB 1DBMH 4LKXB 1MREL 1U8JA 1OP3K 2ZUVA 1FPTL 3HG1E 3T3ME 2QQQA 3VXSB 5I19H 3G5XA 1RULL 3ARGA 4QTHA 4QRSB 5DT1L 3QAZB 3FQRA 5GRUL 1OLLA 2BXYA 4PJFE 5F3HA 3SE3C 4B50A 3CX2A 4KDTA 4LCWB 5K9JL 1R24A 2X1PA 1CS6A 3C6SA 1WAAE 5CMAB 2DQDL 4MNQB 4NQXA 3RVUC 2OK0H 2IH3A 3OAZH 1MJJA 1FNHA 2QBWA 4UT9L 4UQ2B 4U1MA 5GSRB 2ZNXA 1QA9B 1OAXH 2E8YA 4LCYB 4X7TB 3IKCA 4TUOA 2YPVH 3D39D 4FTVB 2OSLB 5DJDB 4NCDA 1PG7X 3N9GH 3WS6C 3PWJB 4HJ0D 3LHPL 3L7EA 3EDKA 3BKJL 1RZKH 4Y8DC 3ARFD 4CN4A 1QSFB 5ACZB 5HHOE 3EO9H 5EUOE 1NCCH 3UYRL 4ODUA 5CD5D 2R8SH 4JKWA 3BKCH 5JMRA 1IGYA 5DVMA 4F7TB 2PKDA 3MLYH 1OGAA 5C07A 4LLVB 2AV7B 3JTTB 2ZUTA 1KIQA 4ZAKA 2YD3A 5J56B 1UZ6F 1Q1JH 3CC5B 1QNZH 5CP7A 3QNZB 5HYJD 2KUTA 2UZIL 4JPWL 2X70A 3MRCB 4Y5XC 3S35H 3V0AC 4DVBB 4DAGL 4FQQB 4M00A 5KG9A 1A9EA 3RHWK 4LVOC 5F1IB 1IAIL 1MUJB 4GT7A 3BP4A 1VFAA 4QRUB 1YUHB 4LCUA 4HIEB 5BS0B 3NCJL 3QIUA 1G0YR 4NNXB 5D5MA 3DX7A 4F9PC 3QFJE 4NZJA 5CHNA 4I8DA 5JOPE 5C0CD 1GC1C 4TULL 1WWAX 4ZSOE 1QQDA 2GSIA 3STBA 4X5WA 2Q3AA 5GGRA 4GKZA 2ID5A 3Q5YA 3DWTA 2XRAL 3LKNA 4BSVB 3L3DA 3H9SA 3S98A 3K2UH 4HAGA 3SGJC 4I2XA 3QPQD 3BH8A 5SWSD 2XPGB 2GCYB 2D7OA 3FN9A 4S1RH 2V5MA 5L8KB 4JJHA 2R23A 4HKBB 4XC3L 1NDGB 5BV7H 3QA3A 4JE4B 2RB8A 4JFDA 4AH2B 4ZFOL 4L8CA 5TE4L 1S7SB 1I3RA 1IZKA 1WTLA 3QUMH 4A6YB 5CSZA 5K9QG 4GAJL 5MERB 1P5UA 3RL2B 2X4NA 2R9HC 3O81A 1S3KH 4PJ8D 1PJ9A 3TCLA 4PRDB 4N1HB 2XI9A 4OCRL 3GJFA 4JM2C 1A9BB 4U1GC 1CF8L 4U0QB 4MJIB 4CKVX 1U3HA 4KH2A 4AM0B 3WLBA 4PYGA 3BEVB 5BRZA 4K23H 2DDQH 4XVUC 4YHNA 4J3TA 2Y72A 1DUYB 1MHHB 1MNUH 4RMSA 43C9B 5C9KA 4P2QE 2IFFH 1T1ZB 1PKQE 1L9NA 1YNKH 3ZKXC 1T1XB 2FWOA 1Q0XL 1RZ7H 3B5GA 5FA3A 2DMKA 4LSDA 1XR8A 3NIDE 1B4JH 1D5IL 1WZ1L 2K1MA 4WUKL 4OZIB 4JFFB 1UB6A 2EKSB 1S5HA 4HIXL 4M8QA 2E7HA 5CLWA 2H8PB 2G9HB 3E8UL 3EYFA 4FG6D 1VKXB 4JG1L 5DRWB 1DVFD 4DKAA 1X6LA 1U95A 3ZYIA 1RK0B 2NZ9C 4KUCF 1P6FA 1YN6B 2HA1A 3D0VB 4H1LB 2ZCLH 2BNQB 3DXAA 3MXWL 3OTTA 1RUQL 3MREA 3BUTA 4UNUA 4OF5A 5GQBA 5A3IC 3RVWC 5EO1B 2VIRB 3HNVH 1NLDL 2AJZA 4TSBL 2YKLL 4IRSB 4WHYG 4YFDB 4YNYA 4DUVA 1C7TA 1VACB 3MBEA 4XP4L 4U0RB 3KPTA 2NY3B 1AFVL 5EOTA 4I77H 1T1YA 5AYQA 1IEAA 5D70L 5I6XB 1PVHA 4PGDA 1BQLH 4LSSH 2NY1B 3IJYA 4RMUA 1X3DA 1JHLH 2CK2A 3QDGE 1FRGH 4GMTL 4XP1H 1FFOB 3MGOB 4PRID 1ORSA 4LLUB 2R2HB 4XPBL 1XGPA 5DJYA 4NPYB 1BBDH 1JHKH 5H35B 3QCTH 1NCBL 4HFUH 4ZS7L 2Z8WC 4L4VB 1MQKL 3CZFA 5D7IE 5JUEH 4B53A 3EOTL 1N64L 4D0CA 4YO0A 4NSKB 4YX2H 4Y16D 1HXYB 2XTJD 5D96C 5I18H 1EHNA 1D5XB 1GJIA 1G7IB 4TSAH 2VLJD 4Y4HB 3NZHH 3V4PL 5C0JB 4G43B 3ARBD 3QDMB 5AZEL 2HRPL 5DVOA 5T3XH 3CMOH 2X7LB 3VJ6A 4PP2A 4WIQA 4DKFH 2CMRH 2YSSA 5F7NC 4FXKA 2VDKL 3QZWA 5F9WB 1ODAA 3HR6A 3QO0A 3LKQB 3E2HB 2DQTL 4AQOA 4JLRA 2DYPD 2RHEA 1MHCB 4MNHB 4YFEA 5K59F 3UO1L 4BSWB 5E2UH 2R1WA 2G2RB 5IF0B 3V8OA 3MYJA 4F58H 2EXYC 43CAA 2XWTB 4PGEB 4PJ5E 1BECA 5B39A 2AS5M 3FT3B 5DLMH 1B2WL 5T1KD 2E3VA 3QNXB 3BGMA 4RFOL 5EIVA 3D6GA 1K5NB 3UBXI 1S7TA 5ERWB 1KIUA 3EYSH 3OJMB 1P1ZB 1NEZB 2UWEA 4QOKA 1YMHA 3B8SA 4OF7A 3CFJB 5CEXB 4I18B 5GHWH 5CBAB 5EO9B 3MRFA 5HDQL 2UUDH 2DJUA 2HT3C 2C4FT 3MRRA 1BEYH 1FNLA 4AENB 5JA8B 2R29H 3ARTA 4NJ9L 4P46C 2GK0B 5J3HC 4RA3A 1KENL 1P7HL 1HH6A 5D1QB 4OB5L 4KV5F 4P2OB 4ACPA 3W2DL 1CQKA 1EAPB 3SGEI 5ALCH 2X1QA 1S5IL 5IR1A 3IF1A 4C56B 4WGVB 1SBBA 3LQZB 5DJZB 4L4TB 1QBML 4M3JA 3BOVA 4N1EA 3VCLB 3L3GA 2EDRA 4NQCA 1F58H 2X4OB 1LO3L 3PGDB 4ZYKA 5SWZD 4X4YB 4GXUN 3CUPA 4PLKD 3NVQA 4EUPG 5F1KC 4OD1L 1BF2A 3CU1A 4PUBH 2VLRB 1BQHG 1BFVH 4HUXA 3TNNB 4XPTL 3NFPA 5AWNH 2RGSA 3BD5A 4FQJH 3Q6GH 4KRMB 2GT9A 1A14L 3RX8A 4QNPE 2ARJA 4LSQL 2FSEA 3PGCB 5LGKA 3JV4B 1XIWD 3H7BB 5DJCB 3SHSA 3QCVH 4OFIA 4G7VH 4GBXB 4OLUL 3T77B 4M03A 3QULB 3HNSL 4DTGH 3RWHB 3HE6C 3M8OH 3OR6A 1TQCC 3ARQA 1GOHA 5DYOB 1AGDB 4MA1C 3EZ8A 4PLJD 1FVCA 2FGWH 4LLQB 3L7FB 2CKNA 4BUHA 3WNMA 4XP5L 3TJEH 1YMMB 2BSSA 4UOW0 1AGCA 2VSCA 1ADQH 2H2SC 4Z7UA 3SE9H 5HGAA 4G6AD 1NSNH 4CVZA 1G0XA 1ONQB 3ZKSD 1HQRA 3OAUL 3BDBA 4WTZA 1OAYL 3K1DA 3PWNB 4K9EL 1NCDH 3QUZC 4FFYL 3DETC 3S4SA 3TEUA 5BZDB 1KYOJ 2G5RA 3VXUD 3BRDA 3UYOD 1F45A 4NQDD 1K2DA 1AC6A 3OKMB 5EWIL 1OGTA 4B5EA 4ZUTB 2IFGA 3VFSA 3TZVB 1QKZH 4JDZA 2VWEE 2CJUH 3TA3B 3U36B 2KH2B 2P5WE 3C87A 5JW5B 4F3FB 5F21B 3WKNA 4UI2A 4MJ6B 3PQYE 5EO0A 3PDOA 3B9KB 2OZ4H 4G8FB 5CGTA 5J1SC 4RGOL 3C6LB 4FABL 5HBBA 1UB5B 4M48H 4GKNB 1Z3GH 4ODHH 3EYQD 1IGFH 1A8JH 2V9TA 4PJ9C 4P2CG 4PJEE 1FORH 5GJTH 1OTSD 5C08B 4OGZA 2WBJC 1MJ7H 2Q8BL 1LO2L 2ARJQ 4P4KB 3KLDA 5E8DH 4MDJA 4PV9B 1T04B 2AEQL 2KQNA 4P9MH 3UPCA 2HJFA 3CK0L 2XG4A 5CEYA 1I9IH 1WWWX 4N0UA 2BSTA 3FOLA 1HSAB 1Q8MA 4PJ7F 5DQJB 1CBVH 4LLWB 3MJ6A 1V3JA 5CKGA 1FAKT 5HHME 4OIAA 3K8KA 1MF2H 3BAEH 3W5NA 5ALBL 2WP3O 1J0HA 4XCFL 1QUNA 4H0GA 2NXYD 3FN0L 4JFEA 5HYIA 4HZLA 2APFA 5T1LA 1G9NH 1RZJL 4AMKH 1GPOH 4ODBD 1J8HB 5H8DA 1UJ3C 3UTQB 3QI9A 3SKOB 4OZGE 4PJGB 3VRLE 1WITA 4G9DA 3SDXF 1KJ3H 1AXTH 1WBXB 4X6BB 5IROA 5B38A 2JJVA 3IGAB 2DQFB 2DLHA 2HJKB 5JNYB 4YHOL 5ADOH 4Z8FH 2P49B 1NAKH 1LK3L 5DZLA 1JHTA 3ZDYE 4KI5D 2R0ZH 4J3UA 1KN2L 4JDVA 5ENWA 1SMOA 2EIEA 1JGDB 5D7SL 4OI8A 4Q74A 1CFBA 4NKQB 4N1CA 2NY5C 3KPOA 3CXDH 4Z7VF 4PGBA 1G7HB 2EEBA 2FL5B 1X9QA 2UY6A 1E4KA 3QXTA 4PJDA 1RZIA 4ODTH 5FYLD 5IB5B 5KW9L 1GIGL 1PZ5B 4BQ6A 1HHJB 5KSAA 1NH6A 4P57A 4YE4L 4CGTA 4YUEH 2E6QA 1YYMH 4WI7A 3KPRA 4I0PB 1KT2A 4NFCA 4WENB 2Q1EA 1FAIL 2ICWA 3DIFA 2OJZL 4OCMC 3B9EA 2D7NA 1G9NC 3HFMH 1B3JA 3LS5H 1AGBA 2A6IA 3T4AB 3ZT7A 4YC2B 1YEEH 4PG9A 4XNZB 1MFAH 3IRZA 3SOBL 5GS0L 1VDGA 3QIBB 2VH5H 3TP4A 4PTUB 1HXMA 2DM3A 3AROA 1CD9B 5DJ6A 2ADJA 4E42B 1U8LA 3WN5B 5IB1B 1IQDB 3I3BA 4MJ4A 5KVGL 3AUVA 4JY6A 1S7XB 5MI0C 5JHLL 3H3PL 1M4KA 4E41E 2VLLA 2GK2A 2E7LC 1JGEB 3E0GA 1BAFH 1P4IH 2FLBT 3QDHA 3QUYC 5DMIH 3C5ZA 4WHCA 2NY6B 3NCEB 1LO5B 3V0WL 3C8DA 5I8CA 5TQ2H 4H20L 4M7LH 2VYRE 3DVIA 1MJUL 5GZND 4WFFE 1EGJA 3A6CL 3E1F1 2FX9H 3FT4B 3CH8A 3ROOA 5IJKC 4GRMA 2FJHB 4LASL 5F3BA 2DTML 3HMWH 3QJFA 5INDA 1S7UB 1NL0H 1IM9B 2NY7H 4NYLB 2AJYH 5D2NC 4GO6B 5L9DL 1OL0A 1RZ8B 5HI3D 4HHAB 4EOWH 1GYAA 2FO4B 1MHPH 1OF2B 4O2FB 4UV4L 4QO1A 5D2LE 4ZUSB 5E99L 3NN8B 5KN5B 2C1OA 3QISA 1XF4A 3ULUL 5CS7A 1J0KA 5ID1B 5DMGC 1JPTH 4AJ0A 4XB8A 3UMTA 4TUJA 4BH8B 4YHYB 5DXWA 4XBPA 5AYUH 4Y5XB 1N26A 2H2PD 4UB0H 5GISL 4RRPA 3MROA 4HS8L 1VSCA 2W92A 2ADIA 1UWGH 4UUJB 2F9BT 3G5VB 2B5IC 4JFZL 1EGJL 3NABL 1MH5A 5GGTA 4L5FH 4ZPVA 4MD5A 2X1WL 3GMRA 3MRMB 2BNUB 1N5YH 3SJVE 3LKSB 1LEKA 1T2QL 5FKAB 5CEZD 4HPOL 3G5YA 5GRJH 2X4SB 4EI5B 3LKOB 1JN6B 2P5EA 4ZDHB 3L3HA 2WWKO 3MLPA 4TRPH 4HWBA 2W1NA 2IANB 4XAKE 3CLFH 4PJAA 1VFBB 3WHE0 5KSUB 1NCWH 3S6CA 3NCBB 2PYED 3SN6N 5K9OB 4HH8A 3BRGC 1UCBH 1EA9C 5J12C 4G7YH 4Y2DB 3FO0L 5GGTL 3BDXA 2ZG2A 4RWYL 1M7DA 4FMKA 4DEPC 1JMZA 2DLFH 4GQ9L 3QPXH 5GS1C 4S1QH 4KK6C 4G8GD 4JM2B 2MWCA 1KB9J 3ZL4L 1RJZA 3K4ZA 4Z18A 3NIFE 2OI9C 2YD7A 3PJSA 4PRPD 5CUSH 3CDYA 3D2UD 3D3VB 3MLSH 4YGAB 3U4EB 3VFVB 4L1DA 2Z4QB 4PTTA 4HWBL 1KBGH 4OCWH 4F8QA 1WF5A 3VG0H 5GGVL 1LDSA 1KCUH 1UM6H 3DI3B 1U8KB 1JNHB 2ZPKL 4JFXA 1MVFA 3MFFA 2IAMC 1JYVA 2IADA 4DCQB 5E4EB 5E1HB 2P8PA 3WFDL 3C5JB 4KJYA 1QR1B 1T89A 4UOJA 2GTWA 5LWYH 1ITCA 3TN0C 4OIIH 2EDKA 4J3WA 5MP6L 1IAKA 4JO3L 5BV7B 1N6VA 5D6DA 1LNUA 4RAVB 1GHFH 3HC0A 3TWCH 1S9VA 1WZKA 3DGGA 5AG8A 3QH3A 1U8JB 3B6SA 5I74C 4X6DF 1AQKL 4NCC2 1BZ9B 3B2VH 6FABH 5HI4C 1K8IA 1FNSL 1XCTA 3MRPB 4PJHB 2ATPB 1DBBL 2APVA 1U8QA 3F65A 3O2VH 4LKCB 3H42H 1R24B 4X7SL 3C6SB 1YN7A 5E08L 4KRPD 2YBRB 1Z0MA 4PRHB 4ZFFA 3QWQB 4Y5VA 5FYJL 3MXVL 1ZEAH 1UXSB 2OTUB 4F2MA 5JORA 6CGTA 4NRYB 3RI5K 4KAQH 1KCSH 3ZDXE 3IU4H 3KPSD 5FYKL 3HG1A 3UJTH 1P7QA 3REWA 3BQUD 2Q7YB 5TE6L 1BD2D 4KTEL 3PIQA 4IRJA 4JDTH 3DECA 5F96L 4HXAL 4X6CF 2F5AL 3REVB 2CLRA 3CFDA 2Z31D 3IDMA 3IS1X 4K8RH 2FH8A 1MLCB 2DJ4A 1WAAA 4HFWA 3WNPA 1G7JA 3DX6A 4KROB 2ERJC 3VRJA 1KPUA 4P23C 3RGVA 1II4E 5DMKA 1K4CB 1IGYB 3KPLB 4XCCL 5C2BH 4OCYL 3PHOB 4H88L 35C8H 4RZCA 4WV1A 4F15C 3CFCH 2HKFH 1U8HA 1ZA3A 3FOMA 1JPFB 2BVQB 2XZAH 1YJDH 4NKIH 4ZFOB 2X70B 1UYWH 3G04B 5HHOA 1Q94B 5MEOA 3MUZ1 4IJ3B 3V4VL 5KG9B 1T5WB 4JQVA 4MGXA 3P77A 2HT4C 3W81A 3MRDB 4GUPA 4LCUB 1AQDB 1CT8A 5D5MB 5HYSA 5CHNB 1OB1A 2F53E 3VD3A 5DD1H 3VW3L 1OAQH 5I1CL 1JWUB 2FIRT 1R3JA 1S7VA 1A4KB 3FB7A 5HVFB 2B8OT 3U7YH 3JVGA 2GW5A 2GSGA 3TO2B 2AV1B 4JG0H 3U48A 3INUH 5C70A 1BMGA 3VFNA 1I7TA 1GGCL 5FGRA 5D7LE 3GMNA 5IVOA 5C92A 2NQCA 1NLBH 3QFJA 4K8RC 4JFDB 2J2ZA 4RDQG 2QHRH 5E2JA 4ZSOA 1FYTA 5CSZB 3LV3A 2GAZB 3WJJC 4PREB 2ZCHH 3IB4A 3G6JA 1XFPA 1DLFH 4HBCL 3HE7A 1GCFA 4V1DD 1TVBA 4S1DC 5J8OA 1QPXA 3RA7H 2OP4L 2DQJH 5CCKL 1A1NB 2OQJB 2FEEL 3L3KA 5JPMA 1FBIH 1YJDC 3GJFB 4TPRL 3IKKA 4MB5A 3BGAA 1BFSA 2VDNH 3WLBB 1NBVL 3DX8B 4PRNB 1QSEE 5IWLC 4NZRH 1XEDA 4RFNC 4NHUA 4MCYB 4Z76A 1F3DH 3ZKND 5DUML 5IESH 1I7ZA 1DQLH 2NR6D 5C0FB 4F7PB 3L3JA 4P5KB 1FGVL 1PX4A 3DX9A 3KLSA 1ITBB 4KXZI 4RAUB 3RWIA 1UB6B 3CSYA 5IM7B 5DDHA 2R69L 4WW2F 4OQ1A 1EBAA 2EE2A 1IGCL 2V5YA 4HJ0C 4D0BA 3EYFB 1H8SA 4NCC1 1G6VK 2PXYB 3ET9F 3ARFC 4GW5A 1H15B 3O4LE 1PKQA 4GG6F 1HWGB 1S7WA 4GG8B 2IGFH 5CD5C 4PJIF 5E5MA 4XX1G 5C0RL 3ARDA 4CADB 4MA1B 3GO1L 2AJZB 2JF1A 1KC5H 2V5TA 4LRNH 4YDJA 3GUTA 4WHYH 3TBVA 3MBEB 1J0YA 1QBAA 1D9KD 5CJQL 3W11C 4LVNC 1G7QA 2W9EL 5I71B 1CD8A 3KPQB 3LDBB 3UTSD 5E95B 3MRLB 5FA4A 1J88A 4HH9A 3IJYB 3CFEA 2IG2H 3IFLH 1EX0A 1GOFA 5EIIA 5JXED 3QUZB 1DBJL 4OJFL 3KPMA 2ZSWA 3MV7E 5TFSH 4M1GL 2GJJA 1XF2A 2VB5A 2D03H 3VWKA 1YEFL 3EW3B 4G8EB 1ZWIA 2AK4A 1DLHB 3MRQB 4YHPA 4XNXL 3W0WD 3FTGA 1PEZA 3PABA 3U6RA 4Z78A 3SDDD 4EUPA 1AJ7H 3QDGA 4YO0B 3UTPD 1GXEA 4LNRB 4YEFA 3VXMB 2F8XC 5CBEB 3QXWA 1SBSH 3BKML 5F7DB 3QXAA 4W4OC 5F88A 3O45B 4JRYD 3F58H 5JOFA 4YHKL 1RIHH 2FYYA 5L88L 5IB3A 2AJVL 1DQJB 5D7IA 2IQ9H 3WFBH 3VFMA 1CVSC 5H94B 3KR3H 5FM8A 5DD3L 4G6JH 1CFQA 4XRCA 3UP1A 2H3NA 5MENA 4DUWA 3MRGA 3GSQA 3HRZA 3S5LG 3O6FD 1VB9A 2YPLA 3VFUA 4KY1H 3SDCA 3DVGB 5C3TA 4X6FB 4WDIA 3OKLB 3O6MH 3Q0HA 4UILL 5E2VH 2NY0B 1FN4A 3GK8L 4O00A 4F7CB 3D0LB 4JO2L 2F54B 3U4AA 1ZLVH 4JANB 1P9MC 2H32H 4U1HB 3UEZA 3KYNA 3MGAA 3R1GL 3OV6A 5M95B 3IU3A 4FZEL 1ES0B 4KKBD 2DQHH 2AJ3A 4QOKB 1YMHB 5E9DB 2PW1A 5F6HJ 1UJ3B 3ZE0E 5EOCL 1IGIL 2L7UA 4NHCH 3O9WA 4PJ5A 1R3KB 1SEQH 4NJAL 1DVFC 3LRHA 4LPXA 3MCKA 3MJ8B 5IHUL 2CDGA 4AIOA 2MHAB 1D6EB 4JR9H 3UZQA 1HH6B 2XKUA 1OAUL 2YA1A 4WUUB 4XXCC 5KVEH 4NBZB 4E0RA 4NNPH 4XP6L 1N0XH 4XXDA 1CR9H 1X5YA 2AI0L 3ES6A 3IF1B 4TQEH 1HOCA 3WS3A 4LHJB 1CL7H 1PAMA 3MLZH 3GHBL 5H37H 2WUBL 3MLWH 1NMAL 4ISVB 1M7IB 1EXUB 5CP3H 3L3GB 4NQCB 3SGDI 3PWPE 1JMXA 1MCOH 4QGYA 4DVRL 4URTB 1VFUA 4G8IA 2X05A 3CFBA 3OKDA 2XWJB 3SCMB 1T2JA 3BO8B 4DW2L 4F7EA 1BVKA 3BPOB 5DVLA 2DN7A 4XPGH 1I1YA 2DD8H 1J18A 1ZT1A 1A02N 3U9UA 3S9DB 1ZLSH 4MXQC 4HIJA 5DJXA 3DGCR 3BPNB 3QHZH 3MUGA 5DEFA 3FZUD 2YRZA 5BO1H 4HPYH 3IFOB 1IKFL 1DBAL 3R4DA 2P48B 4OGAC 5B22A 4QCIB 1JGVH 4GMSH 2R56L 4NC2B 4PJCA 3DO3A 5EUKA 1QFWH 1I9RL 5DFVD 2ILLA 4M1DL 4LSRH 3ALPA 1AGCB 5EZOL 4OF3A 1Q0YH 3U7WL 3FQUA 4YHIB 2VL4A 1X5HA 3SKMB 3BWAA 1ZV5A 4J8RA 1U8OA 1LE5A 1OP9A 1W72H 1JNNH 2CK0L 5K9KB 5K9JH 2FECL 1TVHB 3IDUA 3STLA 5CJ5A 1NMBH 4M1CD 1LD9B 2VITA 4HIHA 3O3UN 3UXFA 1RZFL 1FZKA 1K2DB 4M4PA 4UT9H 1JWSA 1S9YA 3RZCA 2MOVA 2R15A 4X0KB 1X5GA 1MRCL 1OGTB 3MZGB 1R5IA 2FZ3A 5ITBL 3L3OA 3AVEA 1YNTA 4Q2ZB 2I5YL 2XY1A 1OSPL 1AD9A 5HVWA 4EDWL 3C2SA 4HMDA 3WLWC 2AKRA 4PRAA 3F8UB 2EKJA 4X99B 3BXNA 3KPPA 3PV6B 4DKDC 5D2NB 5CJXC 4OLXH 4W6YB 5C0EA 4OLZL 1A6TB 3JWDL 2EDWA 3ULVD 2OYPA 2K7QA 2ADFL 4YXHH 4OT1L 3VXSE 4U6HA 4P9HL 4MAYA 3MLXH 5DF0A 4LCWE 4R4FH 2P5WA 5GJSL 4LRIA 5I1LB 5F7YC 4QHUA 4M6MH 4J7RA 3S97C 3VFTB 4YK4C 2BDNH 4FTVE 2I60L 2FX7H 1Q72L 4YEEA 3FRPA 3FO1A 3D18A 5IB2B 5AUMA 1LP9B 4U2YA 1KJVA 2VAAB 3V6OE 3HUJE 4MZ2A 3SE8L 1QSFE 1J1PL 4TULH 3KJ4C 2C1PB 4Z7QE 4MVBD 4PLKC 4WW2C 3QG7H 4P5TD 3GNML 5FGCB 3FQNB 1HNFA 4YDLC 1RFDL 2HH0L 3DRTA 4QKXB 2HKHL 3MBXH 4LU5L 4ZQKA 3EJZC 2VISA 3PP4H 1XF1A 1PG7H 4C83A 1IC7H 4XPFL 2ZOKB 3T65B 4WFED 1OARL 4FMFA 3QEUB 4HULB 4Y4KD 4MZ3A 3OKEA 5SV4A 4JKPH 5JIKA 4Z7OF 3WIHA 2F5BH 4POZD 2GJ6B 3ARGC 5BS0E 1BBJA 4YXKL 1BZ7A 2KKQA 3JV6B 3AREA 3ZSTA 5MHSE 4OZGA 4ZOEA 4DEPB 3OPZH 5GS1B 5ISZA 3MYZA 3EOBB 3KPOB 2YEZA 4RWHA 1CFVL 1ZSDA 4NQEB 1R5VA 3VFGH 3BFOA 4Y4FA 5FM4A 5EBWA 3OWEA 1BHGA 3GBNH 3L1OL 1INDL 1S9KC 4XWGH 1JE6A 5F6IC 4WWKA 3P4NB 2VUOA 2NNAB 2FD6H 5DC4B 4P2QD 1HI6A 1Q0XH 1CGYA 1IT9L 3MV01 4JPVL 2MPAL 4NO2B 5KANG 5IT2H 1DFBL 4EVNB 2I9LA 5HY9A 3LSOB 4JFOB 5TF0A 3HI5L 2P8LA 2K7PA 2B2XL 1M71B 2ICCA 2ZZUT 1HIML 1NCNA 2V9RA 4F9LA 5LKNA 3WIHL 2A0LD 3E8UH 5GGRY 4BZYA 2DM2A 2J5LB 3UTZA 5IHZB 4RGNE 3S8WA 3TN0B 3TV3L 1G6RA 1Z6JT 4LOUD 4HS3B 3V0VB 1N59B 1B0GA 1OHQA 4L9LC 4KZDL 1MRDH 1U8LB 1UEYA 5LG1A 4MJIE 5D1ZD 3EYQC 2YMXL 2P44B 5I0ZA 1X4ZA 1ZMYA 4G6ML 1CGTA 1PQZA 3TO4A 2YWYA 4J1UA 2I26N 1NLDH 2NTSP 5C0AB 4Z7UF 5MEPB 4CJ1A 1IMHC 3WUWA 3QIUC 4YR6A 1T66D 1EHLH 4TTDD 1UH3A 4PJ7B 1AR2A 1IC4H 1OWWA 3WHXA 4XPAL 3QIWA 4RFEB 5I8CB 3I6LE 1ACYL 5GRVL 5F7EL 3VH8B 2XXCB 4JKMA 3VE0B 4GOSA 3PXHA 5FYLH 4GMTH 5IVXB 3K8LA 4HG4K 1WZMA 1IQWL 4YDVB 4G6KH 3O41A 4GW4B 3BIKA 1P84J 1P5VA 4Y1AD 5FUOL 3WDJA 5F3BB 1G6RL 1KTDA 2PO6D 4J6RH 1ORQA 1NCBH 3HA0A 5IMLB 4J3XA 5JW4R 4ALAH 2NXYC 2BNQE 4O2CB 5D6CA 1V5JA 4FQ1L 1AHWA 1N64H 3RJQB 3MLVH 5C7XL 3V9FA 3MQIA 4N8VB 1M6OA 4NGHH 2BZDA 3IFNL 1XF4B 5I76A 4HUVA 4HDIB 1KCRL 1HHHA 2W07A 1U58A 5FDWA 3RX5A 3S37L 2VDLL 1XGYL 1VFOA 3R8BB 3VGHA 4R9HA 5A40E 4ZTPH 2AQ3A 4U6YB 1WFUA 1U3HC 3FB8B 1RPQA 1DDHB 3VGAB 1H8NA 5I8EA 3QUXA 4ELMB 5HHNA 1QLRA 2XWBA 2RFXA 4OQTH 5IIEB 3O0RL 4XBEH 3U1SH 4Z7VB 4QRPB 2OR8A 3GMRB 1NBYB 2H9GA 4K7PX 1WEJH 5CZXD 1LEKB 4M6OH 4L4VE 4Y2OA 5D1XD 1FP5A 4X7CC 3FN3A 5GXBB 2JIXD 2KPNA 5CAYB 2BNRA 4L3ED 2EDTA 5C1MB 4YBLC 3BPCA 1CIUA 1F3JB 3LZFL 2EYRA 3UDWC 3N1GC 1T4KA 2Q86A 3QDME 2YZ1A 5DK0B 3SJVA 1CXLA 2C3GA 1VEPA 3RJDA 2VQUA 3NH7L 2DI8A 3MRIA 5I1KL 1FCCA 2VXSH 4O9HH 5HDQH 2J4WL 3UBXA 4MAUH 5I2IA 2VDOL 1B0RB 4QY8A 1A3LH 3P11L 4U1LA 3KXFA 4OF6A 1KENH 4U1JA 2NX5D 3VXRD 2FEDC 2B4CL 2BJML 1EEUA 3B5HA 3X13A 1EZVX 1PX3A 3GHEL 4FQXA 2CGRH 4HCRA 3GI8H 3RVXD 5HDOA 2JK5A 5IB4A 4O02H 3ILQD 4NUGH 4P48A 1W0YT 2BVEA 2V9QA 4UIMA 1QPPA 2V6HA 4TNVF 4WVRA 1I3GL 4PTTB 3CX5K 4LSTH 4RFNB 4XNQA 1UACH 2DWDB 1MCFA 4LP4A 3GMPA 1YPZB 2V5SA 3Q2CA 5JXAH 3MFFB 4UBDD 5GZNC 2L0DA 3GGWB 2VXTH 2P8MB 2P1YA 5E6IA 1X7QA 5HHPA 2LFGA 1KB5A 2I27N 3D39B 1BGXH 1LDPH 3OR7A 1D5MA 1AP2A 3U83A 3T2NL 4MQXD 2FJFA 2G75A 1YEHL 1BJ8A 2DI7A 5C0DA 4PJBB 5HI3C 1ETZB 3ARFB 4IMLA 4P2YA 2V17H 4HCRL 1KV3A 3RPKA 3TJHC 3WFHA 3RWDB 4FNLH 4JQIH 3RPIA 4HT1H 1QFHA 2QR0B 1IBGH 3X12A 4CNIA 3UZEA 5DTFB 4L4TE 5FO7B 1NBZA 2M1KA 1CG9B 1ZT4A 3VFWB 3ULUF 4O4YL 4LSPH 1XCTB 5HYJB 1F90L 2C3XA 4GRLA 4N0CC 4QXGL 2H2PC 1A7QH 4MA7H 1EEZB 1R0AH 2VLRE 3C09B 1FE8L 4Q0XH 1PSKH 1HN1A 1YQVH 4EN3D 4KMTL 4CRPA 4X9FA 3S34L 1EBPA 3D5OF 4OKDA 5FUZL 3PL6D 1RJYA 5LQBH 4NBXB 2IMNA 3DRQA 1TXKA 5C0CB 4K3DH 4RNRB 4HFWB 1J10A 3QJHA 1KPUB 3RGVB 1CLOL 2W65A 3LEVL 1NJ9B 1RHHA 3O8XD 3P73A 1JZ4A 4F33A 3FQWB 2GYSA 4X8XA 5HYQB 4DFIA 1YMME 2LVEA 2XA8L 5SWSB 4WV1B 3BUYB 4PR5A 1U8HB 4KVCL 3PQYD 3WL9A 1KCVL 2X10A 1LK2B 1KFAL 4OGYL 1KEGL 1A2YA 4TVPE 5D7JD 1N6QH 1DTUA 2Q8BH 1NPUA 1F4YH 4U3XA 1MAKA 3GSRB 1N2RB 4U1KB 2DLGA 2DQEH 4PJ8B 4PBWD 4GUPB 1MCPH 1IEBA 3IDGA 2Y06H 2BVPB 4WO4D 1TQBB 2WUCH 4P5MA 5JW4M 2O93L 1GVIA 3THML 5DS8B 2NTFB 2PNDA 2J6EA 2AXJA 2X6MA 3VI4E 4P3WA 5SX4I 4ZUWB 1SEBB 3GBMH 2FJGB 3IDNA 4ZS6C 5FHBH 1RUPL 4D0DB 3P3YA 2X4RB 4EEEA 3K0WA 5TE7L 3X17A 4O51B 2X9WA 2F19L 4M6NL 4POUB 3GMNB 5DQ9B 4LFHD 1NKRA 4PJAF 3CFIC 1HINL 1QFPA 2F53A 5LBSL 5C08E 4BKLA 1FH5L 5HXMA 5KJRL 1JF1B 1HDMB 5TDOA 3G6JB 3GIZH 3M07A 3OX8A 5FF6A 4X5XA 3HE7B 3SKNA 3QG6A 1UENA 4MJ2A 1TVBB 5E1AB 2VERN 3TIDA 4LLDA 1R5WB 3ZE2F 4JAMA 1DVFB 4HLJA 4NOFA 2A83B 5D7LA 3NPZB 1HHKA 3T2OA 5I66A 4JN1L 3L3KB 1JF6A 4MQ7A 4HK3N 3IXTA 5KSBA 1V3KA 1XMWA 2BY0A 4HK0A 4CDGC 2J6EL 5IFJB 4U7MA 1I85A 4HS6A 3O3DA 4NKMB 3SPVA 4JEGB 3PXJA 5T5FH 1ZT7A 4BUGA 3D69B 5C0GA 5JA9A 2CPCA 2XNAB 3H9HB 5F1SA 4F37K 5J6HB 4Z7WA 4AEIH 4NWTL 5HGBA 4KRPC 2DICA 1KJMB 4H5SA 1J8HE 1P7KB 2VNCA 1I7ZB 3HPJA 3UPRA 5B21A 4LPWA 3DX9B 4H26B 5LVEA 4ZXBA 4PJGE 3BQUC 4PRIB 2OJEA 4YHMH 2V7HB 2VAJA 4D0BB 1SM3L 3V8CA 2H32B 3NFNA 5J9PB 1S7WB 3HB3D 5L2KD 3BISA 5KSVB 3FFCD 4S10A 1NGZB 4MS8D 3SOBH 3DTXA 4HIIA 1G9ML 2VC2H 1U6AL 4WW1B 2A6DA 4Y16B 2UYLA 2XTJB 4BFIA 1CLYH 1CTOA 2VLJB 3I50H 3QEHA 4M93B 5LGJA 4LHUD 3S96A 3AM8C 1B6DA 3ARBB 3DVNA 1Z9SA 3PP3K 3PHQA 2A38A 2DF3A 4HH9B 4ZUUB 4E41D 5JLZB 3EO0A 4NN6B 4QRQA 1I4FB 2WBKA 4R2GC 4ODXB 5HTSA 3RHWF 1I1AD 4I3RH 1WBYA 4RX4A 4LVHC 3QXDA 1OTUD 3T3MF 3F6LA 2DYPB 3IJHA 2B1HL 1Q9KA 1F4XL 1WSST 4ORZC 1A4JB 1KSRA 3VWKB 5ADPL 4LCCA 4PJFF 4XVSH 1D6VH 3QO1B 2AK4B 4TSCL 5BJTB 4WFFD 5ETUB 1WV7T 1WAAF 3QI9C 1I8IA 4Z78B 2DTMH 4BZ2H 1NC4D 5T1KB 1BQHB 5DR5L 1T0NB 2F8OA 5IROC 3X11B 4GAGL 1OVZA 1WBZA 4FQLH 4XI5D 4HEME 5JHDE 5DQDL 15C8H 5JZ7C 2XN9A 3VXTB 1XGTA 3H3KA 1BVLB 1KG0A 4PV8B 3SDAD 3BDYL 1FYHB 4I1NB 3ME0A 3AU1B 4NZTH 3VFMB 5GS0C 5JO5A 1KN4H 2EZ0D 3OHXA 3RUGB 3RIAK 1F4WL 4ELKA 4M7LT 5HHVH 1UQSB 5F9OH 4PB0L 5EBMB 3GSQB 1JI1A 3I02B 2YPLB 2YN5A 1A7NL 4GLRH 3NZ8B 3IJSA 1K6QL 1MJ8H 1ZGLB 3NABH 3LAFA 3MLUH 4WDIB 4HK3J 3D25A 4X6CE 3U9PL 5EU4B 5KSAC 3O6LL 4XPHL 1YEDA 1W72B 5IBLD 4S0TD 1ZA6A 3NTCH 2A1WL 4KRNA 1T0PB 5KOVC 3KYNB 1DEEB 3QHFL 3ZKNC 1QO3B 1U0QA 3BSZH 5EU5A 3KJ4B 5SWZB 5KS9A 2NR6C 1VGEL 4WW2B 1KNOA 4NO5B 2DIBA 1YY8B 2W60B 2ZWLT 3VWJD 4YDLB 2O61A 4M5ZL 3BKYH 3FO9A 4MLSA 5CJ8A 2H6PA 1AIFB 3CDFA 4DZ8B 3VGFA 2AABL 4ORGA 4XAKD 5HJ3B 5I75C 4FXGA 1XIWB 1CK0L 4PJIB 1FFNB 4HW6A 1NC2A 1QYGL 3RKDD 1SJXA 3HPLA 3MNZA 2H26A 4X8JA 4X5LA 1ZANL 1E4XL 1OAZL 3ULUC 4R6UA 1JNLH 4RWYH 4S2SA 1MFBL 1N3NA 3TYFB 2F58H 1R3HB 3IFPA 4HKZA 3QRFM 2G5BA 5E8EB 1D9KC 4L8SB 3R06A 1UWEH 5F71A 1AKJA 1MAJA 1V05A 3CCHB 3DSFH 3U0PB 3ARVA 3AXLA 1R6VA 4EDXB 2IANE 2R2EB 1KGCE 3O6KL 4XH2A 3L5IA 5JXEC 5GSVA 3MRHA 4PB9L 1RUML 2EIBA 1U92A 2GTZA 3O4OB 2ZUQC 3CNKA 3VXUB 4NQDB 5DUPL 1NAMH 3WFDH 2ITDA 1ZLUH 3PWPA 2JJWA 2IBGA 4KWUA 2EDYA 3SDDC 1QP1A 1QD0A 3RNQB 1TETH 1DQDL 1KYOK 1AI1H 1YDPB 2DKUA 2R0WH 3NIDF 3RL1A 2CKBH 2VLKE 1RZGA 4ONHB 4OFYD 4MWFB 1A0QL 4L9LB 1JPSL 2N4IA 5CIPB 1FIEA 2J7LA 1KLFA 4X4XA 3TVMD 3MV11 5IV2B 1FC1A 1GGBL 5DSCA 3V7AE 2HVKB 5HPMA 3OJDB 3N85L 7FABL 1FNSH 3QCUH 5AD0B 2DBLH 5I1AA 3MMEA 4GXVH 3O6FC 5TGBA 3TIEA 3OJ2C 2WSKA 3CLEL 2NXZD 1EMTH 3MXVH 3HLAA 1S9YB 3MUY1 3L5JA 4OF0A 5FECA 1WFTA 1IGJA 4R7NA 4TVSa 4HWZB 5T1MA 3WSQL 2FZ3B 4KTEH 4D94A 2HRLA 4CL7A 4NRXB 4ZMAT 5DHYB 2DQIH 5C6WH 4KMLB 2YD9A 5C71A 2RCSH 4XT1C 2OX5A 3DURB 1A6ZB 3QRGH 1MI5D 5J4MA 1WWCA 3GKWH 4I5BA 3IDJA 1LE9B 2LTQC 4TYUA 1HH9B 25C8L 1MCHA 4UMGA 4Y19D 5D7IF 4R4ND 4PJHE 3LRGA 5BVJA 1QLFA 1J0IA 4HGWA 3W9DA 1F6LL 1YYLH 1IILE 4PRHE 1WIOA 3BP5B 32C2B 3QEQA 1XGQA 3DYPA 4LKXA 1A7OH 2GITB 3GRWH 1S7RB 4QRRD 3VXSA 4HZAA 2MCPL 2B0SH 4QRSA 4KVNH 4MHHI 4KJPC 1RVFH 2O5ZH 4OFPA 2L7JA 5C6TH 4LCWA 4BFEA 1FV1A 4R90L 1MFCL 3X3FL 5CMAA 4MNQA 4U1SA 3JXAA 2EH7L 1BFOA 2DM7A 1G7MB 4UQ2A 5GSRA 4N0RA 4YPJA 3UTTA 4X7TA 4LCYA 3WEXB 4X98B 1X4XA 4FTVA 1T5XB 2OSLA 5E6YA 5DJDA 3WFEL 3Q1SL 3F62A 1IM3A 1KTRL 3PWJA 4OZFH 3S36X 3V6OA 5FOBA 1QSFA 4C83B 5D6DC 4OM1L 3UAJD 3LKRA 4M7JL 2YD5A 2Z93B 3FZUC 3RAJL 3ULVH 3QSKB 4XGZB 1RUAL 4F7TA 4N5UA 4Y7MA 2AV7A 3JTTA 4L29B 2Q8AL 2DRUA 2FBJH 4NN5B 3BD4A 3LCYA 4ONFH 1RK1B 3ZYJA 3CC5A 5D5ME 1BZ7B 3G6AB 3QNZA 4KK9D 4OGXL 1BF8A 3MRCA 5ISZB 4DVBA 4D3CH 4Y5VC 4FQQA 3GSVA 2PN5A 3QXUA 1K4DB 1X5FA 3BHBB 2DQUH 1OWRM 2O5YH 2WP3T 1YEGH 5F1IA 5FGBC 1DQML 5EBWB 4LLMA 4QRUA 1YUHA 5IQ7H 1L9MA 3A67L 4XC1L 4HIEA 3H9SE 2A73B 4IRJC 5EU6A 2ICES 5GPRA 1QSED 1W0WB 4NNXA 3HNTL 3ZO0A 1TJHL 2A77H 4JFDE 4WJ5B 1O7VA 4LDEB 3CSGA 5DJAB 5HY9B 2XIDA 1LO4H 2EICA 1WFOA 5ILTH 3VXPB 2XQBL 2GEEA 1HKLH 2GI7A 4BSVA 3UTZB 2XPGA 2VXQL 2GCYA 1XGUA 4G42B 4J4PD 3DI2B 3RWJB 4HKBA 1NDGA 4AH2A 4HWEL 4JRWA 1AGEB 3O4LD 5TQ0H 4KHXL 1CGXA 3CXHJ 4QNPF 3WO4B 4S1SH 3QEGL 2HLFD 1EUTA 4JQVC 3SQOH 3DUUB 5MERA 2ESVA 5EORH 3RL2A 1CZ8H 3LPWA 2MMXA 3MV9D 5IMMB 4PRDA 1WUNT 1Z5LA 4AIZB 2YUXA 4RCAA 5BOZG 1SJEB 1U91B 1A9BA 4DN3L 5I8OH 5LCVL 2R0LL 3QQ3B 4Z7NE 4YXLH 4MJIA 1EHAA 1H5BC 2ZSVB 2W38A 1CFTB 3WXWL 3JVGC 4AM0A 5JW4Q 4BFGA 3O2DH 1CE1H 3T0EA 1KXTB 2EXYD 3AB0C 5IFAH 1DUYA 1DBJH 2HMIC 43C9A 2ICWI 2DQGL 4M5YL 2EIZA 5IBTL 1KTDB 4KKCD 3UYPA 3MV7D 1ORQB 4IDLA 1T1XA 1U42A 1INQB 2ZKHL 3LQAL 3GM8A 5A43C 4MMXC 4OZIA 3C5SB 4JFFA 4Z5RB 2EKSA 4IMKC 4KPHH 5IMOB 1YY9D 1MFEH 2H8PA 4OI7A 4OD3L 1EO5A 1E4WH 1CDYA 4OLYH 3C60A 4UTBH 1VKXA 4MQSB 3ZTNH 1XR9B 3UJJL 1QR4A 1S78D 2XZCH 3KDMB 3DMMD 4MB3A 1UM5L 1FLRL 3D0VA 3P2TA 4P0DA 4KUZL 4R0LC 1YEJL 2BNQA 2NYYD 3H9YA 1N8ZB 4HXBH 2VIRA 5GGUA 4IRSA 1CU4L 1VACA 2RFXB 3MCLH 3S3SA 4WHTB 2OTPA 4UDUA 5IG7B 4M7KH 3LOWA 2O5XL 5C09D 4KK8D 1XGRA 3MRNA 4OSUH 4PRPB 2VL5A 2VN4A 1U3ZA 3D2UB 2R4SL 1FFOA 1J12A 1KEMH 2CXKA 3MGOA 4LLUA 3MOAL 3VXME 3SO3C 2R2HA 3HI6L 4NPYA 1JGLL 1KB9K 5H35A 2EYRB 4UINL 1QSVA 4L4VA 4NP4H 5L7XL 3MRIB 4K55A 2X44D 3ARDC 1YECL 2YD2A 2A0LC 1IGIH 5I2IB 4NSKA 1HXYA 4CVXB 4N0YL 4XMPL 3HZVB 4Y4HA 1IKNA 5TJWK 2BSRB 5C0JA 4G43A 4JM4L 3QDMA 5CWSB 4FQXB 4OZGF 3VRLF 1A7RL 2YOCA 2H2SD 4ONOA 2X7LA 2BRRL 3BT2H 3OF6A 3QWRD 3BE1H 2BC4A 2F54E 2WUBH 1J05B 2W91A 1KPRB 3LKQA 1T66C 4TTDC 1REIA 3ZDYF 4JFQB 1MHCA 1X6NA 3AY4A 3BH9B 2UWEE 4QOKE 2WWKT 4LLYB 3WKMH 4JQXC 4BSWA 4KRPB 5E9DE 5I15H 4FN0A 2QSQA 1PY4A 2G2RA 5IF0A 2UVFA 1EHXA 3CVIH 5E6IB 2ZNWA 3LD8B 2XWTA 4PGEA 5FCUH 4GXUM 3KPSB 1F3RB 5D72L 3FT3A 4QT5B 1BD2B 3QNXA 1L0YA 1K5NA 4L3CB 5EOQL 5ERWA 2G75B 4M62H 4CN1A 3G08B 1P1ZA 2Z31B 1NEZA 3P0VH 4WUUE 1BM3H 5FV1L 3IAGC 5J1TC 3TT3H 3CFJA 4PJ9D 2V5RA 1I1FB 1CIDA 1FZJB 5CBAA 5EO9A 4F57L 3S88H 1IRAY 3BZ4B 3O2WH 2WBJD 4ERSL 2EDOA 5DI8B 4L9DA 4AENA 2I24N 1FGNH 4M1DH 1E6OH 2GK0A 4FZ8H 4NQCE 3HMXA 3MLRH 3UPAA 2CRMA 4MDIB 2FBOJ 3SDCC 4Q9CA 4Q6YA 1MPAL 1T22B 5D1QA 3T2PA 4GRLB 5I8KL 2WZPD 4BFBD 3LRSB 4P2OA 2NY2D 4W6XB 1EAPA 5DZNA 1SYVB 5L6YL 4ZO9A 3NOIA 3X3GH 4OM0L 1IJ9A 2RR3A 4C56A 1RD6A 1XH3B 3LQZA 3QUKB 4XNYL 4L4TA 5DJZA 5I1EH 1ZTXL 5EZIL 1JRHH 2AERT 1O5DT 3QB7C 3VCLA 4MA8L 3EFDL 3TBTB 2X4OA 4X4ME 1BP3B 5FHAL 2GUOB 4X4YA 1UCTA 2JJTA 5HDBE 5D1XC 2D4DA 2Z35B 4Z95L 4JKKA 5HDLA 4DGVH 4WGWB 5ITBH 1BPVA 4IRZH 3QJHB 4DKEL 2VLRA 3MJ7B 5T3ZE 3TNNA 4EDWH 3T3PE 4EBQL 3ARWA 4DN4L 4P59H 3O9WC 1S9WB 2XTLA 2C4XA 4TNWK 4KUCD 3T08A 3PGCA 2IEPA 3HAEH 3H7BA 3JV4A 4KC3B 3HMXL 1FO0H 3LMJH 5IGXH 4GBXA 3T77A 3D1MC 4Q9RL 3QULA 4XVJL 3RWHA 5K9QI 5EA0H 2JKXA 5L0QC 4CMHC 1JF5A 5E8PB 5GRWA 3GIVB 4MJ5B 1AGDA 1EFXA 4O5LL 1JGUL 4V1DB 4WEBH 3NA4A 2X89A 5D2LF 2VDRL 1PY9A 4JZOB 4LLQA 1RAMA 3WNOA 1WT5A 4U05A 1YMMA 1T6VN 1TZGH 3DYMA 4OLVH 3QDAA 4J12A 3RVXC 1C16B 5ITFB 3BIAX 1MCRA 3ILQC 4N8CH 4XBGB 4HEPG 3VXOA 5L8LB 1ONQA 2YUVA 1OY3B 4UT7H 3RFZC 3PWNA 1SY6H 3O3EB 3GB7B 5GGSY 2B1AH 1J1PH 5BZDA 3NA9L 3HZKB 5D2NE 3SO5A 1SVCP 1FIGH 3U46B 4F80A 3ZLQC 1WVZA 1HZHL 4ZUTA 1L0XA 4UBDC 4X7FC 2FATH 3TZVA 5JR1L 4OZHB 4YWGH 2KZWA 3GMQB 3TA3A 3U36A 1CE6B 3K3QA 5JW5A 4MQXC 3BP7B 4XPFH 1CDIA 3B9KA 4G8FA 3C6LA 1ACZA 1UB5A 4GKNA 2EEAA 3KYKL 5IQ9B 3D9AH 1HHKB 4JGMA 3JWDC 3X14B 3ALWA 1J1OH 2DAVA 1T2XA 4IIQB 5C08A 4RGMC 3AAZA 3EHBD 1P4BL