1J5DA

Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
b'ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j5dA00
3CDZA 2VM4A 1OOWA 2XXFA 3IN2A 2XU9A 1HAWA 2DWTA 1WA1X 5I6MA 2BHFA 3WNIA 1A3ZA 2GSMB 4YSUA 1YLBB 2AZAA 2FQFA 4KO6A 1PAZA 2UX7A 2GC4C 3CDZB 2HRHA 1EHKB 1IC0A 1NIAA 2HZHA 3FS9A 5TK4A 8PAZA 4AX3A 4E9YA 1WS8A 5B3SB 5TK2A 1FA4A 1KCWA 4ZK8A 2IH9A 2VW6A 1A4AA 2PLTA 3OD3A 3KW7A 3S3DB 1ZV2A 1AG6A 1KYAA 2GIMA 2BWDA 4E9XA 1J9SA 4UAHA 1NICA 4DP1X 2FT7A 2EILB 2FQGA 2Y69B 4DP8X 1JXDA 3RYMA 1NIFA 4HHGA 1MG3C 2J55A 3NYKA 1JZIA 4W1TA 5I6PA 3ZDWA 3FQYA 1B3IA 2J5WA 4A68A 4PAZA 1TKWA 1ZDSA 3UADA 3NJGA 3ABLB 3FYEB 4F7KA 1F56A 2VSMB 1ET5A 1NTDA 5B1AB 5I6OA 2XX1A 4E9RA 2PCFA 4YVUA 1SDDA 1SHWA 1MG2C 1WA2X 4Q89A 4E9QA 2XYBA 3QJSB 4M4RB 2DYRB 3D12B 1NPJA 3IE9A 4DPCX 1SHXA 4DP2X 3CVDA 4P5SA 4GP5B 4AKPA 2WSDA 4KO5A 3BVDB 3X1BA 4G7SB 2WO2B 3PAUA 3AG4B 1AS8A 1JZFA 1KGYE 4F2FA 7PAZA 1AR1B 1NPNA 1AS6A 1SDDB 4A66A 2FWLB 3AG1B 2ZWNA 5I5JA 4FA7B 1JXGA 1AAJA 4P5RA 4WTQA 1CC3A 4RH4A 3U25A 4YSRA 2BW4A 1MDAA 4BXSV 1L9PA 3FSWA 2QDVA 4YSDA 4G70B 1ETJA 4UANA 2PP7A 2Q9OA 2XUWA 2FTAA 1OV8A 3AG2B 4YSCA 1IBZA 1W6WA 4GP4B 4E9WA 1ASQA 2TSAA 4YSQA 9PCYA 4DPBX 1AACA 2NRDA 1I53A 2BWIA 2P80D 1NIEA 3NSFA 1VLXA 3NSYA 3SBRA 1BXVA 3T71A 2HXAA 3BQVA 1R1CA 5ANHA 1QLEB 4YSPA 3T9WA 1PNCA 1OCRB 1NDTA 4G71B 1OE3A 4GXFA 1SFDA 3X2QB 2W8CA 5PAZA 1SFHA 4G7QB 3ASOB 4ENZA 4AZUA 2XV3A 1GS7A 3NJIA 4KNSA 2XWZA 2YAPA 2DY2A 4K9JA 1ZDQA 1JZHA 1AQ8A 3EH4B 2CJ3A 1GW0A 4DP9X 3T6XA 2FJSA 4L0PB 1XB8A 1M9WA 2HLEB 1GS6X 1PMYA 3JTBA 3T6VA 3UAEA 1ET8A 1OE1A 1PLAA 1PZCA 2BP8B 4BXVA 1ASPA 3T6ZA 4YSTA 3UABA 2HX9A 2I7SA 2FT6A 3NJKA 3ZX1A 2PPEA 3PPSA 1V54B 1PNDA 1JVLA 3AZUA 4CSPA 2Y1AA 3SBPA 1FWXA 2R7EA 3FQ2A 2XVBA 3H56A 2OV0A 2Q5BA 1OCCB 3N2JA 4KOBA 2P80A 1MZZA 1X9RA 5I6KA 3FU9A 4A2EA 1AIZA 1A4BA 3TBBA 1ILUA 1RKRA 3EF4A 4HCIA 1BAWA 5D4JA 1AZBA 1PF3A 3IEAA 3KW8A 2AZUA 1XB6A 3EH3B 2R7EB 2YXVA 2ZONA 3AY2A 4BK5C 2PPFA 2HRGA 2BP0A 3FSAA 1W6LA 3AW5A 5AFAA 1CYXA 2X88A 4JHUA 5F7BA 1KDJA 1KV7A 1KCBA 2XV2A 4M3HA 2YARA 1UATA 2A3TA 1AG0A 1N70A 3NJNA 2BP0B 3OMIB 5B7MA 1XMEB 3T6WA 2YAQA 2CCWA 2B3IA 2AVFA 1E67A 1L9OA 1L9QA 3QJUB 4BWWA 1M57B 5B7FA 3WKPA 4A67A 1KBVA 1EZLA 2IDFA 2UX6A 2TSBA 1E65A 1NWPA 1L9TA 2VW7A 5I28A 1ZIBA 2ZOOA 2B08A 2CBPA 1JZEA 4QKTA 4DPAX 2XV0A 4YSAA 2AANA 2VW4A 2DYSB 3QPKA 3X1NA 1BYPA 4GY4A 2J56A 1ZPUA 4G7RB 3NT0A 4DP0X 1SF3A 1IUZA 3NJLA 2HX7A 3GDCA 1AZRA 4DP6X 5I5IA 1W8EA 3S3BB 1AZUA 2UXFA 1JZJA 2BO0A 4FAAB 7PCYA 5AZUA 3WI9A 3QJQB 3OQRA 5LDUA 4MFHA 3FYIB 4HAKA 4NAJA 4YVNA 1FFTB 1BQRA 1AS7A 4DP5X 2IDUA 4BWUA 1OF0A 2OJ1A 3FPXA 4HIPA 1OCOB 2GB2A 4KOCA 2YAHA 3DTUB 1BQ5A 1N68A 2IWFA 2E86A 2IWKA 5AKRA 1MZYA 2H3XC 4NB7A 1CURA 1WS7A 1PLBA 1GS8A 3H4HA 3TASA 3HEIB 3FQ1A 2YAFA 1RZPA 1SNRA 1BXAA 1GY2A 1PZBA 3AG3B 3IN0A 5D4IA 5F7AA 2BP8A 1DYZA 2MRYA 2J57A 5I6NA 4GYBA 1AOZA 1NINA 2FNWA 5A7EA 2H47C 3PAZA 4E9SA 5I26A 2EIMB 1RZQA 2UXTA 2XXGA 1KBWA 3CVBA 2JXMA 3NP4A 3IBOA 3MX0B 2YAMA 1ZIAA 1A8ZA 2HX8A 4A2DA 2N0MA 3S3CB 3SQRA 1AANA 1ADWA 1E5ZA 4Q8BA 5EHFA 2EIKB 3G5WA 2UXGA 2BZCA 2VM3A 2PPDA 3OM3B 3UGEA 1E30A 2GBAA 2IDTA 4YSOA 4YL4A 3ABKB 3X1EA 1J5CA 2PP8A 4AKQA 4F2EA 4YSSA 5FC9A 4A2FA 1JZGA 4PCYA 2DWSA 2PPCA 2DV6A 3QJVB 2PPAA 1JERA 3NJJA 3TBCA 1QHQA 3HB3B 4KO7A 1JVOA 4E9TA 4HCFA 1E5YA 2JFCA 3PXLA 3S8FB 2CALA 2RACA 1NZRA 4WKXA 2FQDA 2GI0A 1TU2A 3FSVA 1A4CA 1J9QA 3SBQA 1M56B 2PCYA 1KDIA 1IBYA 3V9CA 3EH5B 4BDVA 3TU6A 4BWTA 2QDWA 2W88A 3NP3A 2PP9A 1L9RA 5B1JC 3OMNB 4GP8B 1GYCA 1RCYA 2ZXWB 3QJTB 4N4YB 1A65A 1GSKA 1GY1A 4DP7X 2QT6A 4HZ1A 4UF7C 2BW5A 4BDVB 3UAAA 3QJRB 1BEXA 2IDQA 1JXFA 3DIVA 1OCZB 2CUAA 2YXWA 3ZBMA 1NWOA 1HFUA 3MBWB 4TXVB 2OCCB 3PLYA 3PCYA 1NIDA 3S8GB 2QPEB 2XX0A 2LLNA 2UXVA 4G72B 1AZCA 4HALA 4N8UA 1L9SA 1PCSA 4AKOA 3FSZA 3UACA 1TEFA 1GR7A 1V55B 2YQBA 3DKHA 1BYOA 1PY0A 4EF3A 4AI7A 1JOIA 4E9VA 2IDSA 4W9ZA 4A2GA 3ABMB 5I6LA 1ASOA 1DZ0A 3EHBB 3N55A 5B1KA 4CSZA 5B1JA 3WKQA 2GHZA 3C75A 1AZNA 3ZIYA 2FT8A 3FU7A 2IWEA 4NERA 2VSKB 3CZUB 3ERXA 2MTAA 2VMJA 2EIJB 1SF5A 2YAEA 5D4HA 3ASNB 1CUOA 1ILSA 3CVCA 5IY5B 2BZ7A 1IKOP 2EINB 2IAAC 3FT0A 1TEGA 1ET7A 3GXUB 3FU7B 2CAKA 2YAOA 3NJMA 4KNUA 2GC7C 3V9EA 2AFNA 2QPDB 3H4FA 1V10A 1X9UA 1PLCA 1J5DA 5I5MA 1CYWA 2I85A 3CG8A 3FU8A 4YSEA 1BQKA 4X4KA 3X1FA 4KNTA 3QQXA 4JKNA 1BXUA 1T5KA 1J9TA 1HAUA 5PCYA 1J9RA 2I7OA 2VN3A 3JT2A 2X87A 5B7EA 3WG7B 3L45A 1QNIA 4A2HA 2H5UA 2WO3B 3TA4D 1WA0X 3FPYA 1SJMA 1NIBA 1ID2A 2FQEA 3NSCA 4HHWA 3WNJA 3X1GA 4KO9A 1WAEA 4JHVA 3OMAB 3WIAA 2IH8A 4QLWA 3NJFA 4HCGA 2XLLA 3NSDA 3NJHA 5E9NA 1XB3A 1PZAA 1URIA 2JKWA 3GYRA 3PAVA 5B1BB 1OE2A 4DP4X 6PAZA 6PCYA 3ABGA
chains in the Genus database with same CATH superfamily
3GB7B 3SKJH 2CXKA 1FL6B 4BFFA 1YPZF 3BKYL 1JDCA 2WQAA 3C2AL 3E8VA 5AD0B 2X3AA 4HLZH 1KTCA 3W9DB 4YQXH 3MO1A 5E1IA 2E9GA 4O2CA 4R0LC 3LKPB 3KCPB 3FQWB 1CZ8L 4AENA 2VXUH 1M71B 4WFHE 3ZKND 2EECA 2G60L 3VWJC 4Q9QH 2P3YA 3OGOE 4JBSA 1K72A 2DJ4A 3FS9A 1NFIA 2CNZA 4Z7AA 3SSGA 2EVGA 4XNXL 2Y7NA 4OLZL 3OAWA 4ODHL 4EVNB 2P8LB 4M1GL 4I0PA 3DK0A 5ES4B 1G6RB 4XE0A 2YPVH 3Q2LA 2FR4A 4K8RH 1R24B 1ZTMA 5HI5C 4EPSA 4K0OA 3FF7A 3PGDB 1KN4H 2VLLA 1J0HA 4BK8A 3RVXC 3DX9A 4DERA 4JFFA 4KJQD 4FZ8H 5I6PA 3GJFK 3JWNH 3GXIA 4H20L 4F7PA 1TKWA 1E2VA 2FH6A 4NCC1 3VXQA 3EGXA 3D9AL 1A0QH 3EJYC 4DKTA 3GSQB 5F93C 3LKNA 3P30L 4XPAL 4GG6A 5MI0C 4MCYA 3PWPB 4KK5C 2A83A 3WNOA 4PRPD 4AYDC 5L4FA 2VZ3A 3WTXA 2OM5A 3P0VL 4AYMC 5DZAA 5GSVA 3ZZ1A 5GRYA 4IM8A 1U2CA 2VDNH 3V8OA 3P69A 4K23H 1FFNB 2JH2A 2R1XA 5L4IA 3W2DL 5IHLB 5MENB 4AKPA 2HFEB 2NR6D 4R3SB 2GG1A 3G5ZB 1EUTA 5FYJU 1XF4A 1CGVA 1VA9A 5ISZA 1PS3A 3PJLA 3KYNB 4OGZA 1KPUB 4UDTB 1HWWA 1TFHA 1ZLEA 1T89C 4U2YA 5K5YA 2R59A 4U6VH 1WBXB 3T1FA 2O6FA 4P2QD 3RWIB 3EBHA 2BW4A 3L7FA 4RGMC 3GTVA 5HDOA 1UYWH 3NA9L 3FSWA 4K71C 3LD8B 2PXYB 4RMUA 4Z0XB 3S36H 3KWWA 4PSRA 2CKBL 3ZTEA 1QBMH 3CZGA 3AG2B 4FFZH 1SY6H 3DJSA 3N04A 1AGEB 1XD1A 1KV3A 2O6PA 4WHDA 1HHKB 2NNRA 4YJZL 1TQUA 3C2SA 4JLRA 1I9JL 2NRDA 1DQIA 3GIVB 4CKVX 1QLRB 3WFEH 1P5UA 1Q94A 3DBXB 3GRWA 4GW4A 5D1XC 4MJ2A 4OD1H 1GYUA 5I74C 1INEH 1Y0LA 2JKXA 1P84J 2OMZB 2OMXA 1QTPA 1CFQA 2F0CA 2VSCA 4LOUC 1MRFH 4FFTA 4DQAA 2WCPA 4L29B 1DJIA 2AQNA 4DAGL 2NY5H 2VH5H 3QEUA 3FAWA 4LQ1A 5JHDE 1FN4B 1MAMH 3NCJL 5C09A 1OW0A 3I6KB 2OJZH 2V3FA 1SHMA 4DKDC 1R6VA 3U9UB 1S7QA 3F85A 4GJTB 1UM6L 1XO8A 2XV3A 3SE4A 1W0VB 1ITCA 1FAIL 1YMHA 1UASA 3MRHA 3ZMEA 5L6YH 4M1CC 1UQSA 2CLVB 1LQSR 2E9IA 2YEZA 1QZ1A 3PDGA 4M00A 1JV5B 3H8NA 3GXPA 3QNYA 5DT1L 1EEZB 4JHAL 3MBEC 2AXHA 5IUCA 2VL4A 3DX3A 3BFQG 4JRXA 3UAEA 5EV7A 5DMKB 4JY4A 3NSXA 3QZLA 2ZUUA 4RMVA 3UTTA 2PR4H 5JQ6L 2FT6A 5I1KH 3IAPA 4R2GB 3L7EA 2PPEA 4DK3A 4IBYA 2HH0L 4M7ZC 5ESQA 3MRJB 1RUPH 2ZYHA 3DV6A 3KPSA 1XIWA 3WIIL 2ESVB 4PJXB 4OV5B 1C8PA 3QQ9D 5JQHC 4I18B 2UY6B 3U2SA 5F1OB 2BVTA 5AOIA 4A2EA 1OWWA 4FQ2H 3TN0B 3BEVB 4KWUA 3W11C 2Z31B 3JV4A 5KVGE 4EZMA 1XB6A 5CNHA 5E4OA 2PPFA 1U3HD 2DMGA 3KMDA 3EYOA 1ZTXL 5KYXB 3AACA 4RFEB 1CS6A 5C0RH 5L0QC 1RI8A 2Y36L 4JPVL 3BWAB 4ZX6A 2V17H 2TRHA 2W9EH 3O6LH 3EDEA 1E8WA 3HI5L 4G8GD 5HPMA 2XN2A 1Y6NR 2F53E 3II1A 5DTFB 4HVBA 3H9HA 5MHSE 5ICZB 4G5ZL 4BKLB 1FIGH 1MCNA 5FUCE 1UXSB 1RPQA 3SD5A 1IAMA 3WEXB 2GEQA 3CMOH 1NWPA 3C5ZA 4KI5D 1I7UB 2P5WD 5FHBH 1MFDL 4MKTA 1DANU 1KTLB 2UWEB 2GY5A 1DL7L 4FXKA 4GXVL 5D96C 4URTB 4HJJH 4PCTA 5C07A 3X1NA 4KVCL 2P9RA 2DS4A 2JKNA 1IGTB 2I27N 4EUPH 1G7JB 4NQED 4EIZC 1ZHLB 4PY8I 5BMFL 4MAYA 4N2LA 4OLWH 2R0WH 2CKBA 3QEQD 3AXLB 1WQVT 3C08H 4G6JL 3GHEL 1HH9A 2BO0A 1WUZA 1E6OH 1T5WB 4R8WL 2QBWA 3DOSA 4PJ5B 5I1GL 1JN6B 4G6ML 1UHVA 3PY9A 4HFUL 1IM3A 1G7PA 3D09A 3QDJA 5HYJB 5SX4I 4TQPA 1BQRA 3EJZC 1OARL 3AWGA 3T4YA 4BH8B 3IXTB 3RILA 1KUMA 4HSQA 3BN9D 3B4NA 2GB2A 4NZDA 4L3AA 4UTAL 3RGVA 1CBJA 2CM6A 4J6RH 5DZVA 1LP9B 1MZYA 4PRHD 3MNWB 2KKQA 3JTSB 4J7RA 5CM1A 2EDRA 1D6VH 3H0TB 3ZE0B 1ICTA 2XZCL 2ZSVA 3HBGA 1VCBC 1RFDH 3ULUD 3RPIB 4NKIL 4ZO7A 2DQDH 1HS6A 4FCHA 3QJXA 3L95A 1BXAA 1GY2A 5IG7B 5E1GA 3MUJA 1IKNA 3OPUA 2ICWJ 1JFQL 1BVNP 1DYZA 4LB8A 3DA0A 3VAEA 3P3TA 1P4LB 1NPUA 4P5TC 2EDQA 3VXMB 4I3RH 3KNBB 4C83A 5KBNC 4OCWH 2YSTA 2AJXH 3T6QC 1XV8A 1BFOA 4QTHA 1KXHA 3IBOA 4P4RB 1ZIAA 2QADD 5CIPA 2ZX7A 3EGSB 3ZHLA 1ACZA 4WFHD 1IFRA 2EXYC 2FEJA 3CN2A 3IXAA 1NUGA 4OZGB 5CSBA 3GK8L 1AC0A 4L8CA 2VM3A 3US9A 4ZMZA 2GBAA 3OVUB 4QJ3B 4UQ3A 4UZUA 1NEPA 4MMXB 5I1EL 1S9XB 2BM3A 1HOEA 1U2HA 2J2ZB 1JPFB 3A0OA 4JFYA 1A1OB 3P3YA 1FH5L 4DO4A 3ILEA 4IRJB 2JELL 5EBLB 4AZ8A 3M45A 1F90L 5H8DA 4GEJA 4W81A 2ZOTA 1E40A 4AW7A 2NSQA 3LEXB 1J1OL 3NFSL 5F7DB 5C8JA 4EDWH 1JVOA 3ZL4H 1GZHC 5LCVH 3KPLA 4MXQC 4WKXA 2Q3AA 4X6DB 3UTSA 4GMTH 5H37G 3NTCH 2X40A 2BY2A 4Q56A 2HFGH 2SEBB 1WFJA 3DROB 3BVTA 4JRLA 5TF1L 4FQQB 3X14B 4OZHA 3MU3A 4LEOA 1IZJA 3GBML 2DDQH 1L9RA 3T09A 5L4JA 2GK0B 3FQTB 5E94B 1P7KA 4AM0A 4KGJA 1COBA 2XQYG 5J4MA 4BFOA 1E42A 1TJHL 2P7TA 3GJFA 4HZ1A 1A7RL 4N5EC 4HH8A 2PWHA 1EJOL 3UAAA 1AP2B 1QA9A 2F54E 3CXDL 5EWIL 2IDQA 4BBWA 1OPGL 3DIVA 3HG5A 3LZFH 5ILTL 2IV9A 5C7ZA 4RISH 1NWOA 4K3EL 3PIQA 3UZVB 2AV1A 3TXAA 3MBWB 4FNPA 4JZOB 3PCYA 4JL2A 4TQEL 3MV8B 1E43A 5BRZE 2PW2B 2JSFA 4HALA 4P3DB 5EUOB 1I3VA 2ZUVA 1N64L 1T0MA 2YD4A 4ZT1A 1ZHNA 3ZDXB 1ZGLM 4U1GB 1BF8A 2X1XR 2CZNA 3BXNA 3E6HA 4XCEB 4L4TE 1XMWA 3ETSA 1H6UA 1G9HA 1F41A 2BMKA 3TCTA 1DZ0A 3FFCE 5B1KA 4DCQB 2GHZA 5T3XE 1OAKH 3D85B 5EU4A 2P5EB 4FZEL 3RIFF 3ZE2E 5E7BA 2CJUL 5DJ8B 2YUZA 5TTRA 2EIJB 3FQUA 1KCRH 4HUWA 4XH2A 3PV6A 3MRIB 4JFXA 4MLIA 2QGBA 1FFPB 1SVZA 1OZUA 3QO1A 4IHOB 4KJPD 4ONHA 1VFOA 5DJ0B 1G7MB 3EF7A 5JHDD 5KN5A 4L9LC 1LGVA 2OL3L 2XVKA 2VN6A 4PJBB 1ULVA 4LSPH 1QX1A 4TPRH 4Y16C 3QA3B 4DUVA 1OHZA 1UOVA 4HK0B 3PHSA 5C0IB 1BZ7A 4L8BB 3BZEA 2YKLL 2BS8A 4WJ5A 1PFCA 5DLLA 5D1XE 3FU8A 4ENED 4NHUA 1UENA 5C2BL 4WW2A 5EU6A 3TH3T 2ARJB 3IDGB 5AL8A 1BVZA 3M17A 3NN8A 5IVXB 5IW6A 1J9TA 1U8PA 4NNPH 1YY9C 3MRDA 3HNVL 5DA4A 2NX5A 4APXA 5E0FA 2PTUA 5HGGS 3A67H 3VU2A 2VDML 4HWEL 4QRFA 1TNNA 5CCGE 4F80A 1ZGLA 4IGBA 1IAIH 1MRCH 1P5VA 2F5BL 3BVUA 4KKLD 2FB4L 5C71A 1WBZB 3OZLA 1AHWC 4QRTB 5C08A 4EUPG 3JYCA 5DSCA 2H8PB 3SDDA 2CCVA 3EFFB 1QG3A 2FHCA 5AW5B 3OR6B 4LF3B 4HCGA 4AQZA 1YN7B 5E9NA 3MAWA 4U49A 1G7HA 5KSBA 2X1QA 5EC2B 4Y4FA 1U2YA 1UB6A 2D3LA 3QIBA 3PDDA 2IANB 3PE9A 1FZOA 3U0TB 4F58H 1PKQB 3NIDF 1F00I 3CVHL 4FQCL 4XMPH 3MGOB 3DXAB 2JIXA 3VE0B 3NABL 1MWAA 1ZK9A 4BD4A 1CXHA 3Q13A 5KAQG 3DURA 4YOKA 7CGTA 4P2RA 3MV01 5D6CA 4WI0A 3CDCA 3D2UB 1KIRB 4HUKB 4XPGL 1L6XA 4M29A 3OJVC 1AJ7H 2HRHA 2F53D 4P3WA 5MHSD 5IHWA 1PAMA 3EKCA 8PAZA 1VFUA 2WLLA 3IYLW 5EF2A 4AX3A 4LQFL 2FX8L 3MRCA 2IGLA 4OCLC 4PTTA 4A63A 1XR8A 4P23B 3X13A 4O2CB 4WRLA 4AENB 3S48A 1G4MA 3KEDA 4C54A 3VX1A 4B41A 4PJGE 1GTFA 2GT9A 2XQBH 1B0GA 2HLFC 5FUOH 4FTVA 4Z77B 2KMWA 5GGSA 1NFIB 4B27A 4DSYA 3FB6A 3CC1A 2WYZA 4O2EA 1XCTA 1BMZA 4I0PB 1F4YH 3K6IA 2FR4B 4R83A 1GC1L 1WEJL 4QOKA 4L8SC 1BGXL 3UTZB 1DJHA 2UUDH 4O00A 1WRFA 2VLLB 5LBSH 4Y8DC 2IDCA 1YRKA 2VDPH 3DX9B 5I6OA 5IHHA 3B8SA 1S5IH 4JFFB 2H1LM 1R9FA 2Q20A 3F7KA 3SYAA 3NCMA 1OOAA 4Q89A 3L2NA 2RCSL 2IXQA 2EVJA 1NPJA 4F7PB 1TKWB 3VXQB 1T03L 2MOQA 3EGXB 4PJCE 3E9UA 2EEBA 2E56A 3FO0H 4LFHD 3OPZL 1SEBA 3LKNB 4GG6B 2H6OA 1BLNA 1KGYE 5I18H 2NY4B 1AR1B 4MCYB 2A83B 4XMKH 4GMSL 2QKIA 5GSVB 1L7IL 1XGTA 4MA1B 4BXSV 3LN5A 1E3ZA 5IQLA 4G70B 4NI6A 5I1JL 3RL1A 2CSPA 2PO6C 3BLKA 4WDIA 3O2DL 4MNQA 1KJ2A 1XXDC 1LO4H 4WI6A 1KTKE 3PP4H 3T1FB 3BP6B 3KJ6H 3L7FB 1MFAL 2ZYSA 3IMTA 3LIZL 4GRLD 1THCA 5DQDH 1G6VK 3LEYH 1EANA 3UJTL 4ZMXA 5HGBA 2CRZA 2C7FA 2HVBA 1A8JH 3ZVVA 4KTGA 4R97B 3SY0A 2OR9L 2JK5A 1OT4A 1L9NA 4IDLA 1EA9C 5KG9A 3IJEA 2QQKH 3GIZH 4JLRB 4W9LC 2Q7NA 3MFGB 5JXAH 1JYNA 4P2YA 5GRZA 4YHYC 4LSUH 2J71A 1P5UB 1SFHA 1Q94B 4OJAA 2WVTA 4GW4B 4XPFL 4ENZA 1U58A 4N2OA 4WEEA 4JPKH 3HRZA 1N26A 3FMGH 1Y0LB 4UMSA 2OMXB 4GKOA 3UP1A 2DBLL 4AGQA 1EHLH 1CFQB 2F5AL 4JGJA 5FW7A 4D3CH 4XNQA 1NBZA 3QEUB 3EH4B 5F7EH 5G4OA 3VW3H 1I3GH 1JCKA 4AGOA 5C09B 4JFOA 1Q72L 4NENB 4JGMA 3ULVF 3T6VA 3VWJD 1XDTT 1S7QB 3NQIA 1PZCA 5DD3L 5DZJA 2GABA 2DQTH 1YMHB 3MRHB 1FVDB 4HOWA 1UQSB 3DETD 1U42A 4KY1L 5GGRA 3ZX1A 2FL5A 3TCXA 5I71C 3H56A 2AJVH 2XVBA 3QNYB 4LLQA 4JY5L 3D52A 5HHPA 5JUEH 4XO3A 3AT8A 1FFRA 3WFBH 1EV2E 2PCXA 3I9GL 1KBGL 4ES8A 1CLOH 1FRGH 1OTUC 3UTTB 4OJDH 2FD6L 2QQLL 3D0LA 3S5YA 3L7EB 3QVAA 2W9DH 2XWRA 1YQVH 5ESQB 2OLDA 4XO5A 3KPSB 4PLKD 2F54D 1P4UA 4DGYH 1XIWB 8FABB 4H4NA 3L3OC 3EJYD 3AM8C 3NIFE 4RWHA 3H42L 2XSKA 4QRBA 3U2SB 1ACCA 2NUPA 2R2BA 3N50A 4LHUD 5DMGD 3V4VH 2A74C 1J0IA 4JPWH 5BRZD 5AOJA 2Z91A 2MHAA 4XCFL 3DIDA 3ZDZB 1I8LC 3JV4B 3DRQA 1ECYA 2R23A 5JORA 5LNEA 1FVEA 4XMZA 5A6IA 4L5FH 2QTEA 3EYOB 1VPOL 4Y9BA 1CCZA 4L4TD 3QXAA 4MJIA 2WXNA 4AIOA 2R4SH 1Q90A 1HK6A 4PY8J 4Z8FL 2BRRL 5T3XD 3DX1A 2VW7A 2XN1A 4M93C 5CR1A 5J11C 3CFTA 4Z3JA 5HPMB 4YL9A 5EG6C 5AL0A 3UJJH 2OMWA 2XV0A 3H9HB 1TJIL 1Z1WA 4Q0XL 3O41A 1NCDH 2EC9U 3A6CH 4HC1H 3LH8A 2NT0A 3ALPA 4D7PA 3HZYA 3CDGB 1EZSA 4FA8A 3C5ZB 5DURB 2AQ1A 5E6ID 2J88H 3R4DA 3VVVA 3PNRB 1A6UL 1YEFL 3ARDB 3FAXA 5BVJA 2F15A 4LAJH 2OXHA 3TTYA 4FXKB 2HG0A 4BH7A 5L7XH 1JZ3A 2JJTC 3QCUH 5LAXA 4A7VA 2CO6A 1L7TL 3LRLA 3T3MB 5DXWA 2AQTA 5C07B 5D1XD 4ODUB 3TURA 4FKEA 5EDSA 3KAAA 3N40F 1AXSA 4F3FB 4ZSOE 4P59H 2DEWX 1V3LA 3RY6C 1UJTA 5AZEL 3CNKA 4MAYB 1NCGA 3GSOA 4YXLL 1HH9B 2YD9A 3HVDA 3VXRE 1TMQA 4Z1PA 3GKWL 1GJIA 3DOSB 5FO8A 1AI1H 3T2OA 2DQCL 2IWKA 1IM3B 1AIFA 1G7PB 1XSKA 2B4CC 3QDJB 1NCWH 1VFBA 4JZNB 4LBEA 2MPAL 2WKGA 1GS8A 5B1CA 3TA3C 1OVZA 3T4YB 1F4HA 3QG7H 3S36X 4OF6A 2C1PB 3TEWA 2NCMA 3TNNA 4KQ3L 4BSJA 5CGMA 3MOAL 1IAII 3RGVB 1G7IA 4OM0L 3MNVB 1TJXA 3EDFA 3UFIA 3NCBB 4FQ1H 2VB5A 4ELME 1YEDA 1YAZA 5CGBA 2VMEA 2ZSVB 3EUUA 3BQUC 4OW6A 4OQTA 3WIHL 2YD3A 4QF1A 5M94B 5ERWB 3L95B 3E3QE 4LK4A 1YPZE 2DQIH 1JK9A 2WQ8A 4IIZA 4LCVA 2EDHA 3OAYK 2EO7A 5IB3A 2WV3A 3KPRE 3PQYA 1XL4A 3Q6GH 4OJCA 2NXYB 4TVPH 1J1PL 1E5ZA 5I6XC 4UOQA 4JO2H 4KQ4L 3W11D 1T66C 4U1HA 3UGEA 1YNTA 3VH8G 3E7JA 5DHDA 1BFOB 4QTHB 3WL9A 3O2VH 4QCIA 4Y1AA 5CIPB 3U7YL 4YC2B 1HTYA 1HX0A 2VAJA 5FC9A 1TZGL 1A7QH 3WXVH 4FYSA 2XN9E 1B6DA 4JFEE 3NZHL 1MFMA 1EO8L 4LCYA 1U3JA 4PCYA 4U0RB 4DW2L 2HWZH 3IXAB 2FUTA 3SO5A 1TVHA 5HPOA 4L8CB 1HHGA 3V0WH 5CCKL 2HRLA 4G3YL 2GVYA 2VDLL 1XGPA 2AJYH 1IT9H 3GEWB 1ZT7A 1N5AA 3W81A 1TU2A 2ORBL 1NBCA 1FUNA 1MLBA 4NGHH 5C6PB 1NC4D 1J9QA 3GO1L 4HOZA 1KFAL 1CBVL 4FRWA 1T20A 1S2EA 1A3RH 1H6TA 5EO0B 4GUQA 3R7RA 1IB5A 5SX5H 4QWWC 3TGXA 5J12C 3KPLB 1Y18A 4MCNA 3CH1A 3DJZA 2EUZA 1XF1A 1RU9H 5HVHC 3UTSB 1O6SA 2H32B 2QT6A 5CD3B 3CHRA 2FCBA 3OJ2C 4WENB 4Z0BH 4PW3A 3EDKA 2ZXCA 1HYRC 1V05A 2NY2B 1UGKA 1KY7A 3T77A 4JKMA 3QP3A 4LEOB 1K6QL 4HS3A 2WC7A 5CJOH 3MDJA 2EADA 1U3NA 1JWMA 4N2HA 4ZUTA 3RVUD 1XT5A 4GUPA 1P7KB 2V7NA 2OCCB 2UYLA 2ZOKA 4W70A 2YD1A 3QEGL 2P7TB 3GJFB 1OP3H 3HZKA 3ZKXC 1TR7A 3D69A 4Y5VA 4G72B 3WTTA 3KM1A 1ZSHA 2CU9A 5CSZB 3MV7B 5FW8A 3KWUA 3IKCA 1J8KA 1RUKH 2FX7H 1IM9D 1XAUA 4KRLB 3PIQB 5E7FA 2AV1B 1OD9A 1HC1A 3K7UA 1EVTC 2FEEL 4YZFE 3TPUA 1GZQA 3N85H 1DO5A 1T0MB 3DNKA 1ZHNB 4NERA 3Q5OA 4G6AD 2XY2A 2N7BA 3UCRA 5CBEA 3BI9X 1X5KA 3BXNB 4PP2A 3E6HB 3KCWA 3SJVE 4TRPL 1E3XA 1R3JA 2Y7OA 4DGIH 1CUOA 1FI8C 2BMKB 3EJCA 5EBGA 2OW7A 2JTDA 3RB5A 1SM3H 1OCWH 5HVGB 1FAKT 3VXUE 5EB9A 1JRHH 5EU4B 3IMBA 4QMEA 4Q6IA 5E70A 2VWEC 2WBXA 3BGFB 1G9NL 1FNHA 5H35A 1YEJH 3GJEA 2N0KA 4P5TD 1TG8A 4CVXB 4U3HA 4NUGL 4HUWB 2FSDA 3PV6B 4JFXB 4XH2B 3QO1B 2ZCHL 4ONHB 2XNAA 3N40P 1BQKA 2FHBA 2ICEA 5KN5B 3X1FA 4KNTA 3WIHA 3BT2H 2PYEA 2R56L 1CL7L 4I85A 4PCSA 4UCFA 1RZ8A 1MWOA 2WINA 4AYEC 3VMPA 3JT2A 4NNXA 5CZVL 3F7QA 1BZ7B 3DSFH 1QSFB 5EZOL 3BZEB 2GBTA 1X6NA 4WJ5B 3STZA 2FJFA 1JZDC 2G0LA 1QBBA 5HHOA 4D0CA 5EU6B 5JZ7C 5IW6B 3M17B 3NN8B 4WHYG 3U83A 4KMQA 1U8PB 4IS6B 3MRDB 4LLVA 3LMJL 4ZX4A 3JV6A 4APXB 4QLWA 2NW2A 1LYQA 3MLVL 2GTQA 3EJSA 2LU5A 1ZGLB 2B9BA 1UJ3A 4OT1H 1LDSA 4IGBB 4NXSA 4QXGL 4BRVA 1NH6A 3CDZA 5C08B 2CGYA 4PJAE 1I9IH 1JGIA 4Z7NB 3TIEA 1WAPA 3SDDB 1EMTL 5EO9A 2A9AA 1NAKL 4AK1A 3DTDA 4GPVA 4F7MA 1C8QA 1DBBL 1YEHL 3S34L 2XETA 1G7HB 1XH3A 1R0AH 1MFBL 5CJ5A 3LX9A 2O6DA 1UB6B 4ALAL 4X8GA 3QIBB 1YLBB 1WZ1H 4A7SA 5EO1A 1KB5A 3ME0B 3NRQA 1FZOB 4O02L 5HYSA 2GUOA 2VRKA 3D0AA 4YPGA 3B7UX 4XI5C 5FECA 5TK2A 2J8OA 3NPZB 4JO3L 5T1DH 1ZLSH 1MWAB 3RWCB 3VXSE 4HS8L 5CD5C 5I23A 3DPDA 2AK4A 3BAYA 3KW7A 2WQUA 4LGPB 5D6CB 4EMZA 4WI0B 1KYAA 1KJ3H 2FT7A 4YO0B 4ZXBC 3P3RA 1A6WH 2FX9H 2WLLB 1RZKL 5BW7C 3MRCB 1HKLH 4YHNA 4FEMA 3R0NA 2E46A 1XR8B 5B3JF 3X13B 5BJTA 4JFPA 1ZXQA 2BP3A 2YGNA 1N3NA 2GT9B 3BISA 1B0GB 4IKJA 4YXHL 2X4OA 3P11L 1I8UA 3EOYG 2Y2TA 5GGSB 4E9RA 4I7ZC 4HS6A 4WTZA 1WA2X 3W3BA 5BNXD 4O2EB 1XCTB 2F6AA 5E9DA 3SN6N 3BCDA 1WPCA 2C9PA 4YPJA 3ARBA 3RDJA 5F70A 1XXFC 3TESA 5E4EB 1ZPLA 4P05A 1E7VA 2G75A 2WSDA 4QOKB 5AVQB 3NK4A 3OZ9L 5MEOB 3AJ7A 1YNKL 3VXRD 2WKLA 3VMNA 2BCKA 1PZUB 5IB2A 3V6OC 4Z3GA 3QXUA 3F64A 2HKFH 2Z4TA 3QSKB 1MNUH 1OLZA 4Z7UE 3JSSA 2IXQB 4WTQA 4FP8L 3G3LA 2B59A 3QORD 3M8OL 1CK0L 3HA0A 1MAKA 3QUHA 3MLTA 5EC1A 3SZ6A 2AABL 3VSUA 1BLNB 3AS1A 1N8ZA 1YY9D 4JO1H 3H3PL 3QGVA 5C86A 1CGSL 4GP4B 3HLKA 1ASQA 1GL4B 3VRIA 2CBTA 2QKIB 4LSRH 2G4GA 3TJHC 1XGTB 1G94A 5DHVA 4PSPA 3QQDA 3LN5B 1PSKL 2P43B 4WI3A 1XX9C 2XXCB 5KW9H 3SD2A 1OAYL 3QARA 3RHWK 4FKKA 3RL1B 1IC5H 3HB3C 3KPRD 4WDIB 4MNQB 1KJ2B 3P02A 3T9WA 5K1JA 4OZGF 3RAJL 1OCRB 2XZZA 2YA1A 3FQXA 4PJ9C 2C3GA 1E3FA 4KJWC 1SEQL 3MCLL 2WXLA 2NYYD 1EBAA 2JCCA 5MP6L 1RUQH 3HMWL 4HUCA 4E0RA 1XAKA 2EYSA 2W81C 4MNGB 3TYGL 1UXMA 3GM0A 1QYGH 2XN9D 3MJWA 4JFED 4Y5YA 1U8QA 2JK5B 3SY0B 3M1OA 1M7IA 4FQIL 3IJEB 5KG9B 1C7SA 1SYSA 2OYKA 1HJCA 1Q0XH 3MRFB 4L0PB 3E8UH 4X6DF 5FGBC 1UGNA 2R0LL 1U58B 1ZANL 1ET8A 3QI9C 1T1WA 3HRZB 3T6ZA 5IEKB 5GISL 2I7SA 5C92A 2OI9C 3MOQA 4GI8A 4Q74A 4XNQB 2Z93A 2PR9A 1NBZB 3RBGA 4X80H 5D7JD 3OF6A 4KTEH 4XWGL 3INUH 1TETL 5DLMH 5IWLC 4JFOB 4G42A 3VGEA 2Y23A 4N0FB 2Q0ZX 2HLFD 3O4LE 4UWQB 3N43B 4B9CA 2EIEA 1HCVA 2EYRA 3EJJX 5GGRB 4IBUA 3D4YA 2FL5B 3UTPE 5ID1A 5F0PB 4LVHC 3MRNA 1I1AA 3A6BH 3R8QA 4G9FA 4LLQB 5HHPB 4Q9RL 2BSCA 1TO4A 5LGHL 3HG2A 1DLFL 3KWXA 4HMEA 1BG9A 3PAYA 5CJQH 5L2JA 1PTZA 5FAAA 3P73B 1GYWA 3HKZA 4NPKA 25C8L 5EUOF 3RU8L 5KJ4A 5JPMA 2XV2A 5KUKA 1SBSL 1NGZA 4XVJL 1ERNA 2IFFH 3ATBA 4HIJA 1JTOA 4JJHA 4P04A 5KOMC 4DH2A 5B7MA 3OMIB 3TFKD 2HT4C 3K8MA 3QR2A 2NUPB 4JFDE 2R2BB 5B7FA 1DFBH 4UUJA 5FOJA 1A7PL 5KOVC 4L1LA 2XWJA 2VXVH 2YR3A 4JN1H 1TTRA 2Z91B 4LAQH 5DEFA 3NCYS 2WZPA 2VDKH 4CU8A 3DRQB 3HKFA 2R23B 3ZT6A 1QHPA 5JORB 4ATTA 2ZF8A 1FVEB 3E38A 3OG6B 3BPNB 3QXAB 3SJVD 3DARA 4X5WA 3UC2A 4MJIB 1BYPA 2EE0A 3HBPA 4PJBF 2J6EL 2PO6D 3VXUD 4DKFL 1OWRM 3DGDA 4L4VA 3D08A 4IKLA 3MBXH 4CN1A 3S3BB 3S37H 2YEQA 1B0RA 4LIQL 2OMWB 2X6AA 5IJDC 3O41B 3FTSA 1LEGB 1T80A 1BM3H 4PS3A 5D1ZC 2I32A 5E0QA 3HG1E 1KGXA 2UZIH 1JRHI 1F4WL 3HZYB 2R9HC 4N24A 4J4PD 1FGNH 4MZ2A 5K93A 3OWRA 3PJSA 1F8TH 3EFDL 3MRBA 5BVJB 1VADA 2QGEA 3TWCH 2OXHB 4JPQA 4BH7B 2J8UA 4PGEB 2N1TE 5LAXB 2A4CA 4KOCA 2AQRA 2CO6B 4IBLT 2GQHA 4PUBH 4Z6AT 4NBXB 1EZUA 2I9TA 4F8LA 3MV11 4DN3H 1AXSB 1CURA 1KJMA 2QSVA 4S1RH 3L9BA 3GS4A 4L9DA 4O9HL 1EDYA 5KVDL 1T0OA 1KC5L 1MUJA 3D30A 2MQGA 4ETQA 4FQLL 4UTCA 3U2JA 2BZDA 4JM4L 3TZVD 1A2YA 1UG9A 5FO8B 4OGQC 4MDJA 1AIFB 3IJ7A 3GUFA 4HGWA 4LBEB 3RKDD 4R4NC 2H47C 4PVNA 4XC3H 4LEEA 3QBTB 4GXUN 4OFQA 4X9GA 2IMMA 3D6GA 4G1MA 4MAUH 5C0BA 3NIDE 3TNNB 2EXWC 3CVBA 5L8JB 2F58L 1Z5YD 2E4TA 4HEME 1G7IB 4A2DA 5A40E 4ZTOH 2EZ0D 2NY3D 1OTUD 4LO9A 4H88H 3RWHA 4ZD3H 4DVRH 1YEDB 4ZFQA 3G5WA 4XHJD 1MCEA 5KBLA 4QF1B 4N6RA 2NNAA 3VXSD 2D31A 1JK9B 1HQRA 3RTQC 4Y4KA 1P9MA 1HL9A 1RMFL 3ARGA 2V8MA 3PQYB 4XP1L 4XBEL 2WTOA 4PYGA 1WFNA 4PBWD 5D2LF 1JAEA 2OSXA 2PPAA 3F7YB 1WAAA 2IPTH 4ZQKB 3TVMA 1HCYA 1QHQA 3QAZB 3GI8L 4KO7A 4JFQA 3W0WA 4UYPA 1YNTB 3IDYB 2YBGA 3WL9B 3QPXL 1ADQH 4HJ0D 4QCIB 4Y1AB 2PTTA 4LCYB 1IGFL 5BXFB 4PW9A 3PL6A 4LPUA 4UT9H 1TVHB 4OH2A 1HHGB 1UADC 5B1JC 3LD8C 4GRWH 1XGPB 3FO9A 1N5AB 4GKZA 2EE6A 1TU2B 1MLBB 1A6VH 1AO7E 2YOCA 4GB9A 3DVNA 5EZLA 3SKJL 1U30A 3I50H 3RNKA 3N1MC 3QYNA 4GG6F 4UF7C 2Q3XA 5IR1B 5ITFA 5LO7A 1T20B 4YQXL 4TYUA 2GCYA 5HDQH 4WUUA 5LHDA 3P77B 2V4LA 1O5PA 5DMJB 2WTRA 2VXUL 2ZQKA 1Y18B 4ZODA 2J6EA 2VTFA 3VNYA 3CH1B 5GS1C 3H54A 4NQDE 3HN3A 1O6SB 4GBXB 2VM9A 3HG0A 5KSUB 2ZUQC 1B6UA 2FE0A 5TDOA 4H1LA 4LEXH 3FSZA 2EJ1A 3T77B 4ESKA 5J0BA 2VC2B 2XT1B 2YPVL 1S7XA 4OUOA 2X6BA 1JWMB 4ZUTB 4K8RL 2LAAA 4GUPB 2V7NB 2EDWA 1A7NH 2UYLB 2ZOKB 3H7BA 5LNDA 1LNUB 5T3XH 1KN4L 3HZKB 3D69B 4LSDA 4Y5VB 1NMAL 2KS0A 1I8MB 4FZ8L 3V0GA 3EG9B 3KGRA 3OKKA 5SV3A 3N06B 3D3VA 3IKCB 3ARFD 5D4HA 4H1LG 5HHVH 4BFIA 1AQDA 1EGJA 3HI6H 1A0QL 3SGJC 3PJNA 1JDAA 2A4EA 1X5YA 5DUMH 3TPUB 2NDFA 1GZQB 5CSGA 3GPEA 2V9RA 4NKMA 1MCWM 3GC3A 1JWSA 4LSQL 1GA2A 3ZW3A 2BNQE 5CBEB 5KSAA 2GC7C 4PP2B 3SDCC 5I0YA 2VDNL 4K23L 1R3JB 5K9OB 2DLGA 5HHXH 4IBZA 4JFTA 3FRPA 3LCYA 3CQQA 4G8EA 2B3RA 3QRBA 3QQXA 4EBQL 3S35H 3B3IA 1B4TA 5H35B 3GJEB 3Q5YA 2VN3A 2ZCKH 3ULVE 4U6VL 5F9WB 1IIIA 1T66D 2BWQA 2VXQH 2EDNA 2ZKYA 3NFPA 2WYHA 1UYWL 3IKKA 3T4AB 2XNAB 1NCJA 2ICEB 4L3CB 3S36L 3A47A 2PYEB 1QBML 5D7IE 1NFDE 5CEYB 1YC7A 2C9UA 4JHVA 1T6VN 3O4LD 4FFZL 3CBRA 1SY6L 5J1TC 1PKOA 1RZ8B 3NSJA 2HJKA 2WINB 2YPLA 4AITA 4NNXB 1PZAA 4XXCA 3IJSA 3UTPD 5HVFB 3STZB 3F04A 2FJFB 2EDKA 3WFEL 2NY0B 4A7QA 3U82B 3VJ6A 5HHOB 4D0CB 3ABGA 1GSMA 2IBZY 3O6FD 4OD1L 4HFWA 1KT2B 1JYXA 1INEL 3BFWA 5AW7B 5FEBA 5C0CA 3S9DB 3JV6B 1MRFL 4G7YH 2NW2B 3C12A 3RURA 4EJ1C 2ILLA 1RHFA 2NY5L 1WA1X 2VH5L 1HILB 4LFHG 1MAML 3IU3B 4RETB 1D5ZA 2OJZL 3QQ4A 3WNIA 1VFMA 3M88A 3CDZB 1LEKA 5I1CH 1EHKB 3LSOA 4HJUA 5L6YL 3TIEB 1QFPA 5GSRA 2BCMA 4JFDD 4QHMA 5EO9B 4L8DA 3SDYH 5CLXA 4F7MB 3SZKC 2Y3AA 3VVWA 1AGCA 2QHRH 1FA4A 2HSIA 1KCSH 1XH3B 1SUHA 2J44A 5GIRA 4K9EC 5EO1B 1DDTA 1KB5B 2AGJH 3LN9A 3B2VH 1OM9A 5HYSB 2FQGA 4YPGB 2D9QB 5BS0E 1SN0A 2PR4L 4XBPA 2VQ1B 4A7TA 5I1KL 3ZDYE 1A14H 4NBZB 2V5RA 4RAHA 4XMUA 4MB5A 1RUPL 4Y1TA 4PI0A 4FQPA 4JZJC 3VGAB 3T3MF 3FYEB 4CSSA 5EIIA 2P44B 1NTDA 2XN0A 3SDAD 2CO4A 2ZTBA 4FNRA 4UQ9A 4OM1L 4P99A 3HG1D 4FQ2L 4YHNB 3V0VA 3WGVB 5ETUA 4M4RB 3UDWC 2E27H 1DSFH 5FYKE 1XFPA 3QUZD 3FHQA 1N3NB 4FQHA 3QFJD 4UNIA 4P9HC 1I31A 2X4OB 4LCWA 4M62L 2OYLA 5C0RL 1AS8A 2P28B 7PAZA 3TO4D 2V17L 1FO0H 2QQNH 2W9EL 3LRKA 1YEKH 4HS6B 4GINA 3PXJA 3LS4H 3KGSA 3QHFH 2WMPA 4PG9A 4M7JH 3FOMA 4NO2A 3ARBB 2C3XA 2AP2A 1NSNH 1B4LA 2WJ7A 3IGAA 5EU3A 4PRBA 4M61A 4M3JA 2J5LC 1YUHA 3MRGA 2BCKB 1QSEA 2FBJH 2M26A 4UANA 5IB2B 5J57B 3CMOL 3BZFB 4GUCA 3B56A 3SYOA 5GGRY 4YSCA 5FHBL 4G8AC 4MMXC 4QT5A 1I9EA 2X9XA 1TTFA 5GJTH 3EUDA 3MNZA 3LEVH 2APTA 3D39A 3ARSA 2B59B 4TNGA 2VN4A 4HJJL 2P45B 5JZ7D 4NIYE 3BWSA 5BQDA 4ZX5A 3MLTB 5EC1B 4ONOA 1BHGA 3LIUA 4JKPL 1N8ZB 3GBNH 2VERN 5KBDA 1XCQA 5ELIA 2J1KA 3CPUA 4OLWL 3VRIB 2R0WL 3RI5F 1OE3A 4MVBD 3C08L 4NN5C 5DHVB 1ZLWH 3C6SA 1E6OL 2E8YA 2WY3B 4FFZA 4LHUG 4P46C 5IQOA 4LBAA 1MFEH 5JXEA 4UM9D 2YJLA 2EICA 3SQBA 1W8NA 4MTMA 1JBJA 1HH6A 1KZQA 2GSGA 3CX5K 3FTUA 3FQXB 3T2PA 4L1HA 1OQXA 1ZDQA 1JZHA 4ODSH 4X50A 3ECUA 5MEPA 1GW0A 2BNUA 4WHTA 4LCCC 5FM5O 4DP9X 5K9JH 3T0DA 1XB8A 1M9WA 2HLEB 4Y4HC 2JCCB 5F6HI 4J6RL 2WXGA 4HISA 4E0RB 4YLCA 3K6OA 4HCRH 2FGZA 4YSTA 1D6VL 1O6TA 1RFDL 1Z3RA 4Y5YB 1U8QB 2R15A 1M7IB 2DQDL 2WZ0A 5CD5D 3SBPA 3LRHA 1SYSB 2COQA 5HYEA 3KL5A 3PPEA 3MJGX 2HMIC 2O72A 3PWPE 3KWVA 3T3PB 1HSBA 5BV7C 1HNFA 4ZXBD 1T1WB 2W60A 4U1GC 1AO7D 1U93A 4YUEH 4I3RL 2XXMB 1YN6A 3MUGA 5C0AB 4W6XB 3TBBA 1BX2B 5MENE 2Z93B 2XWXA 4OCWL 3EH3B 4QHPA 5IESH 5ACLA 4G42B 3H6JA 4RESB 5DQ9A 5INCB 1K8DA 2VSDA 3SPJA 3EYQC 2LU3A 5IVOA 3BCFA 5D7HA 4IRSC 4NQDD 4UV4H 5AFAA 1DQQB 2EYRB 4HKBA 4WFFE 5ID1B 1KV7A 4M1DL 2NQCA 1U8LA 3MRNB 3BH8B 4G9FB 1AD9B 1UKTA 3M6DA 2HT2D 4PJ6A 4XAKE 3W82A 4WQOA 2YAQA 5L2JB 1E67A 1OSYA 1W0WA 2X1WL 2IALB 5KTEH 4UNVA 2UX6A 5HSFA 4L0ZA 5F7KC 4XVTH 2Q8BH 1LHZA 5JPMB 4KXDA 3ZL4L 2RAMA 3K46A 3GHPA 1UWYA 1GPOH 5E51A 5LCVL 1YHPA 3EO0B 4HIJB 1YJDC 4GMTL 4JFHE 3NTCL 2D9CA 2HFGL 4UUJB 4G7RB 4PB0L 2XWJB 3STLA 2BY3A 2MOGA 3ARXA 4GH7B 4N22A 2BIPA 3PDOB 2XWBA 1J8HE 1K5WA 4APQD 5DEFB 3ARRA 2DDQL 3ZTNH 2BNQD 5E8OA 2HJFA 2OFQA 4FHBD 1DQDH 1UACH 3OB8A 4CVZA 2OTUA 1DVYA 4OLUH 5D4QA 2K8MA 4Y2LA 4MA8H 4HUVB 2BVYA 2HFFB 3HPLA 1B3JA 1B4RA 1PX3A 1S4IA 4MJJA 3HB3D 1PVHA 5AVUB 2YHGA 5J1AA 3LZFL 3KYKL 4U7SA 4RISL 1AKPA 1UWEH 3MV9A 1B0RB 3ULVD 2CHDA 4KUCF 1CGXA 2H0PA 2Z3FA 4F7EA 1LO0L 5LG6A 4HPOH 1QWUA 1DJSA 1WS7A 2ESVE 4PJXE 3PJSB 3MRBB 5ESAA 1VZHA 1VADB 3QUYC 1BAFH 2YO3A 3VFNA 1PZBA 2H0FA 2J8UB 3VD2A 3C6LA 2X41A 1XD0A 4R5TA 3WO4B 1OAKL 5GS0C 2I9TB 3GXNA 2N56A 4GYBA 2CLRB 3PFUA 4Z7NF 5KAQF 1KJMB 3T0EC 3TEUA 4FF9A 5F2FA 3PAZA 3HFFA 5I26A 4WO4A 1RZQA 5BZDA 1WTLA 3CZJA 3MREB 1U92B 4OZFH 4ETQB 3MLWH 3W38A 1JCVA 1A2YB 1RIHH 3D4CA 2CNYA 1NEZA 4MDJB 4QYAA 4LSPL 4FMVA 4HGWB 4TPRL 4D8OA 1HESA 2BDNH 2QSTA 3WNNA 4NCC2 1T6WA 4I87A 4UB0H 4I0PC 2JJSC 3HMXH 4G1MB 4KZCA 5C0BB 3VG9C 2C1OA 1K5NB 3JWDH 3L2MA 3ZTDC 2V7HA 4W9JC 3UAJD 4HZLA 1FG9C 3FSOA 4R7NA 1II4E 2UWEE 2X05A 3RWHB 4NNPL 2FSEB 4XN2A 3WSQH 5HD8C 2QFPA 2DWSA 1E2WA 1GHFH 1MN4A 1PGRB 2NTFB 3A67L 4XO8A 5BS0D 5C7XL 4CRPA 2F7PA 3D06A 1ZRUA 4HCFA 3G6AA 4N6RB 1IAIL 4PJEA 1SXNA 2QJDA 1HQRB 4I0KA 4JG1H 4Y4KB 1MVUB 5DD5H 1F6AA 4FFYH 5ALCH 3VTMA 4Z3IA 5E8DH 2J1WA 4JKLA 2I69A 3EW3B 1R17A 2XY1A 4M6OH 3V9CA 1MF2H 3TVMB 4K3DH 4MA1C 2XIIA 2UY7A 2WLNA 3IETA 4JFQB 4KDWA 2E7HA 4M6MH 1KYOK 1MFCL 4PJ5E 3VFOB 3V7AG 2CLZA 3U7WH 1AXTH 5IK3A 1CE6A 4FFWC 3TO2A 2WANA 1A65A 1SHSA 3T65A 5HYJE 1AQHA 2PTTB 1EZVY 2NMSA 4PLJD 3ZRSA 3KLDA 4XMPL 1URZA 5FB8A 1D7CA 1JPGB 3PL6B 1T5XA 4JG0H 2YOAA 2IGTA 1OT1A 1AMYA 1LP9E 3MXWH 4GKZB 5KBPA 4QHLA 1AJ7L 4QEGA 3ZE0E 4ZMQA 4FL4C 3DVNB 5EZLB 1MHHA 3RNKB 5I30H 3V10A 2E6PA 2UXVA 4Z7WA 2R9HD 4K7FA 4M9OA 4R97C 5ITFB 2GCYB 2BOBA 1PEWA 2WTRB 2D03H 2IDSA 1P5UC 1XF2B 2M2DA 2XKSA 2XQBL 3EHBB 5FUOL 3GSNB 1CFMA 3VXME 4U6HA 4ZS7H 2FLRT 4ZZFA 1NAMH 1PYWB 3ABZA 4H1LB 3WJJA 1JGDA 3LB6D 5KVFH 1OW0C 1MQKH 1F4YL 1SF5A 1S7XB 5IQ7H 4CVWA 1M3JA 3W57A 3H7BB 3SE4C 2J12B 1WD9A 4OZGE 3ESOA 2YSSA 5LBSL 5FO9B 4AEHH 3S37X 1S5IL 3RWEA 2CAKA 4YHKH 3R0MA 3OKKB 5FA3A 2FECI 4JL1A 4BQ8A 1A47A 1F11A 3D3VB 2NXZB 4AQEA 5IOPA 4XMTA 5A2JH 1AQDB 1N7ML 4LOEA 3LNEA 5I5MA 3Q8AA 4MDIA 3FO0L 5FUZH 1MJ8H 3O9WA 4YSEA 5TE7L 1D7DA 1J86A 3QZNA 1EDHA 5I18L 4NKMB 2H26A 1JIBA 1O75A 2FDBP 3BH4A 4LCUA 1JWSB 4HD9A 5AYTA 4XMKL 4X6DE 5PCYA 5AB2A 1RZ7H 2ITFA 3TYFA 2GSIA 2Y4SA 3ZT5A 5EUKA 3FRPB 2YBRA 4G8EB 2A6DA 2GBVA 2Y6SC 3TEYA 1TFPA 2OPCA 3N43F 2NZ9D 2RGSA 3B3IB 3PWPD 2ZF9A 3LPFA 1LO4L 5HDLA 2CUHA 4RGOH 2KYIA 3PP4L 4DEUA 4HUNB 2ZAGA 2JKWA 3BLBA 3KJ6L 3NFPB 4YHIA 5MEND 3M1CA 1PDKA 1RP8A 2JJVA 3QRGH 5DQDL 3LEYL 1BVLA 2YA0A 3CMGA 5FK9A 1ETA1 3IN2A 2HJKB 2YPLB 43CAA 1CLCA 4NRYA 2ZUTA 2DWTA 2QQKL 3GIZL 2RIKA 3MV8E 3IJSB 3FRUA 3BAEH 5JXAL 3T2QA 4WFFD 2PXYD 4LSUL 5EUOE 3VJ6B 4G1EA 3ZDXE 2HAZA 1KGCE 4IJ3C 3WYRA 2BPBA 4JPKL 4EI5C 4PRDA 3FMGL 3C5ZC 1OSZA 1H3XA 3F2LA 1EHLL 5C0CB 3R1GH 3B9VA 2H1PH 3GS7A 4D3CL 5D93B 1SLUA 3VW3L 4FXKC 1I3GL 1NKGA 5D5MF 4GAGH 4FXTA 1TQVA 2A9NH 1D5ZB 3QQ4B 2P5EE 3B2DC 1X7SA 2I26N 4OFYA 1LEKB 4F57H 3LSOB 2DQTL 3ZIMA 3M07A 1NIFA 5GSRB 4JFHD 4NRXA 4QHMB 4YDLB 2Z34A 4L8DB 4MAYC 3FTZA 4W1TA 1AGCB 3ZDWA 3J07A 3FT3B 1I9RH 3DHUA 4HHAA 2AJVL 4A68A 1U91A 4O2FA 4PJBE 5JUEL 1XH0A 1FYTA 3RIAK 2DLHA 3TJEH 3WFBL 2WXKA 4C4BA 4FNLH 3NA9H 1OD7A 1HYSD 1Q8MA 1CLOL 4BA8A 5A43C 4XBPB 3LV3A 1SDDA 2W9DL 4JHWH 4TQ8A 2O5NA 2Q6WA 2O93L 2DLEA 5GS3A 1YQVL 3QXWA 2XYBA 1HXMA 5SX5K 4H2CA 4DGYL 5T1LA 5ID0B 4FFVC 5IVXE 2R2HA 2CR6A 1Z9LA 1V3KA 3NBNA 2ZPKH 1KGJA 4JFWA 5EIIB 1MH5A 3V4VL 3KR3H 4UT6A 4NCDA 4JPWL 4R2GD 5T5FA 3TLRA 1M3IA 4J1UA 1AS6A 1OAZH 3C8DA 2ZWNA 3LZPA 5ETUB 2WXPA 3PG2A 4JCLA 5LBSA 1I7TA 2ESVD 4M9PA 1B0IA 3NRFA 5KJRH 4GIOA 3B7TA 4L5FL 4FQHB 1Y6KR 5DFAA 4ZMOA 3UBXG 1OP3K 3P40A 1EAJA 2NXYC 2R4SL 2K9UA 5DFTA 4DPRA 2ADYA 2F7OA 3QUXA 2Q9OA 4L8SA 1J0JA 2CWRA 3TN0D 2Z31D 1CG9A 1EEUA 3J27A 2IANE 1GGTA 2WMPB 3QYCA 4PG9B 4UQDA 3UJJL 1PKQE 3FOMB 4DNLA 3BVXA 1PIFA 4JKWA 2XWEA 3N1GC 1NCDL 4C58B 2QELA 3J7HA 3A6CL 4HC1L 5EU3B 1ZLUH 4PRBB 4Z95L 5DT1H 4M61B 3DXAE 2W0LA 1YUHB 1FC2D 4U0RC 3MRGB 1QSEB 2VDNB 4JHBA 4P49A 5ANHA 2AEPH 2IOIA 3COOA 2JI1A 2AQ3A 2J88L 4YSPA 3L4VA 4M43L 1FE8H 5MI0B 3QWRA 4QT5B 1NDTA 4PVBA 3C60A 1P6FA 5F6HJ 5L7XL 1TZ8A 3D39B 3QCUL 3TH2T 3CFIC 3PNWB 4X9BA 4M5ZH 4FDWA 2JB5H 3WKMH 1GS7A 3EADA 3AB0B 2GTZA 4P59L 4LPVA 4WAFA 1S6NA 3AY4C 1XCQB 3FFCB 5A7BA 1UUNA 5HYQA 3NVQA 1N2RA 2WTPA 2D2CC 2QVTA 5KYNA 3C6SB 3OXRA 3LKOA 3BAXA 1T7ZA 3CWGA 1EO7A 1AI1L 2VMDA 1OE1A 3VYNA 3HUJF 5TFSL 1NCWL 5CJ8A 3SQBB 2NY2C 3UABA 2I07A 3EIFA 4TF4A 1BBJB 2GSGB 3EJRA 3NJKA 1ZSDA 3QG7L 2QQQA 3MJ6A 1RLWA 4MYPA 4WHTB 3WEOA 1WWCA 4Z7OF 4PJ5D 4FABH 3GKZA 1SBBA 4JFFE 2DN7A 3R7QA 4FQ1L 3UBXI 1JZ6A 4G5ZH 1YECH 5DZLA 5HYJD 4NQCA 2X0UA 5DD1H 3GMNA 3SGEH 2IOMA 2IV8A 1SRDA 2WXJA 1O9ZA 4GG6E 2DQIL 1A1NA 2ZONA 3N91A 3BLPX 3GXDA 2BP0A 2ZG2A 3D33A 3Q6GL 1G0DA 35C8H 2W60B 4GKNB 5L8KB 2XWDA 3M86A 1KBPA 1U93B 3K2UH 1LE5A 1CR9H 3NIGB 1MFVA 4JO2L 2CA3A 4KC3B 3N5AA 3MUGB 1YN6B 4BFEA 5DGQA 4F27A 4OIBA 1S7TA 3CE1A 1OAJA 2OSWA 1WHOA 2FGWL 5ISZE 1N70A 3V4PH 1RJZA 3MPCA 3FN3A 5DQ9B 3O2VL 1K8DB 3NJNA 4ZS6D 4G82A 1A7QL 3IT8D 2Q76A 3BGFC 3WXVL 3MBEB 2W07A 3Q06A 3EBIA 2ICES 2VABA 5I1GH 2HWZL 4XMWA 4G6MH 3VXMD 4ZFGL 4HKBB 3Q44A 3V0WL 2CXGA 4XVSH 3V4VA 1U8LB 2IMNA 5C6TH 4ZMNA 5AWNH 2EO1A 2AJYL 1IT9L 4DPAX 5IMKB 5HY9A 5JOPE 4OR1A 1X4ZA 2NY1B 2AANA 4M7ZB 2OYPA 1I1CA 4XRCA 4NGHL 4XTRC 1P1ZA 1QW8A 1W0WB 3L3OA 3AM8A 5DQJA 2JLPA 1IUZA 2HX7A 1AZRA 2BRQA 3SKNA 2HRPH 3FT1A 3WEMA 1DP0A 1OGAA 4BZ1A 3AAZA 4WW2C 4XN5A 4IRJD 1RU9L 4ANKA 1JP5A 2HVJA 1MPAH 1T0PB 1JGUH 2K9FB 4Z0BL 1JFQH 3STLB 3PWUB 4Z3FA 3LRMA 1RJLA 2APVA 5C09E 2XWBB 3P4OB 3G08B 2IG2H 3HC3L 3OV6A 5CJOL 3RX8A 4DN4H 4RVBA 5L0QB 1DVUA 5E1QA 5E8OB 2HJFB 2K4WA 3QDHA 4NO3B 3WLWC 4CVZB 3AUVA 3DECA 1TTAA 3CQFA 1UZGA 3HPLB 4OQ1A 5E8PA 3TF4A 5EZJA 1OF2A 3NACH 5EU5B 4LLUA 3ZYZA 4FG0A 1CGWA 5J1AB 1PY9A 4Y4FC 1RUKL 4Y1SA 3H4HA 3ATEA 2FX7L 3TASA 3MV9B 3QIBC 3GK8H 5BQ7B 4YBLC 1GGCH 5CBAB 4F7EB 2JWYA 1H3UA 4NS0A 3UTTE 2HJLA 4LOVA 1EUUA 2BHZA 3PREA 4ZMYA 5F9JA 5I6NA 3N85L 5GGUA 3W5MA 3KPSE 3P4LA 2JELH 5D96B 2GKIA 3OHXA 1M1XA 4PJCB 1KEML 3JWOL 5ESAB 2HTLC 3BAIA 4HA1A 5J8OA 3VFNB 3EO1A 4DGIL 3QT2A 4NN7B 2X44D 3MV8D 3SE8H 2ZICA 1SM3L 4OF3A 1D5RA 1SOKA 2YAMA 1OCWL 1BJ8A 3C6LB 3BUQA 1FF5A 1JRHL 2MIZA 1JNLH 3ZDZE 1AKJB 1U95A 1KGCD 2Z8SA 4PGZA 5ACMA 4WSJA 1YEJL 4H2AA 1INDH 1MCBA 5DYOA 4NC2B 1ED3A 5BZDB 4WO4B 4NQUA 3UYOD 4XOCA 2BVEA 1MDTA 5DUBA 3TA3A 1ORSA 3K74B 5SWZA 1KWGA 3D85D 4RGNC 1S8DA 3BT2L 5HI3C 2BY0A 2P5ED 1NEZB 2APSA 5HXMA 1PCXA 1CXEA 4MA7L 1TJHH 1BPLB 4RAVA 3BSZH 2DV6A 2X1PA 3DSFL 5CU9A 2C1OB 4ATWA 3VTTA 1OPGH 2V7HB 1DFXA 3BQUA 1N5YH 4HIEA 4HZLB 4K3EH 4S1SH 4DZ8A 5AEAA 4R7NB 3VI3A 3B2UC 3KH4A 5F8RC 1G84A 4I1PA 3AT9A 1ZS2A 3H2QA 3T3ME 4KBPA 2A38A 3G6AB 1XGZA 5C07E 4OT1L 2UZXA 4PJEB 1UH3A 3IDNA 4M8UA 5JIQA 4B9GA 1JTTA 3VQLA 3OQ3B 1F6AB 1I9IL 3ZTCC 4M8RA 4DP7X 2EIDA 3HG3A 4IIQA 5H4YA 1RUMH 3JUYA 3OGCA 2QKIC 3FQNA 2CRIA 4N1HB 2V9TA 4RNRA 2UY7B 4QRPA 3IETB 4P5KA 4S1QH 1R0AL 2CUAA 3ZBMA 2H3NB 2B9AA 2VZVA 3NUKA 4KI1A 3Q05A 3MRMA 1HFUA 3QDJE 1DJZA 1FL3A 4HDIA 1CE6B 5IK3B 3TO2B 4LPWA 2ZCLL 5I1DA 3OAZH 2IBBA 3ZHNA 5FB8B 4F7CA 4PGDB 1WFTA 2W94A 4AKOA 3OB0H 5T1DL 3CSYA 3KVPA 1ZLSL 3IMVA 1I7RB 1VHPA 3R06A 3I9PA 1TCRA 3SDXA 4E9VA 1NM9A 2OJEA 1EEQA 2QSCH 1F3JA 2X42A 2IAND 1KJ3L 4RRPM 4QHLB 3SQOH 3D07A 5CJBA 1MHHB 1ID5I 4CADB 3IPBA 5C2BH 1A6WL 2FX9L 2WIIA 2KLSA 1UXLA 4Z7WB 3KWTA 3RWJA 1U8IA 3DXAD 4K7FB 4MQ7A 1HKLL 3QAQA 3K6SB 4BQBA 3PGCA 1QBAA 1B2WL 3GT6A 2OMVA 3D2UD 3ZO9A 2VJ8A 3ASNB 1SQMA 4HWEH 1BOGA 4DESA 2UZYA 5IY5B 4HLJA 4U6HB 4UQCA 2ED8A 5IFHH 3IGLA 1TEGA 3IWUA 4P23D 3N44B 5DJYA 2ADIA 4PIBA 1JGDB 1OXYA 3QWOA 4X98A 4NC1C 3PHOA 2LU4A 2IAMC 1WISA 3KBEA 2ZWSA 4RAUB 5CU5A 3BESR 2KZBA 2JCCF 5J5EA 1RV6X 2YSSB 1L6PA 5GGTA 3RWEB 2X4NA 1GCYA 5DRNA 1LEIA 1NANH 4X6CA 4MJ5A 1MNUL 3F00A 2VDQH 4I0PD 5FA3B 3ULVH 1F11B 3HJ0A 1C16A 3KL0A 4AQEB 5IOPB 3INOA 2MMXA 3O9WB 2A4ZA 2AI0H 1ZTXE 3I3EA 3TOPA 3VG0H 2X89A 4JFFD 3T3PF 1UH2A 1NJ9A 1RVFH 2D4DA 4FYQA 2WAQA 5HD8D 2H26B 4JO1L 4XN4A 2FHFA 5JOEA 5ITBH 4Z76B 3UTSE 3PAVA 3RDTC 4CMHB 3TYFB 2GSIB 2G2RA 4ONGH 3ROOB 3IBEA 3WOVA 5KW9L 2YBRB 5LDSA 2A6DB 1AR1D 2NY4D 4OZHE 2IPUG 4TNFA 1MCPH 1X5GA 1IC5L 3BJ91 4POZD 4ONFH 2XXFA 5A2BA 4PP1D 4BFGA 3BRGC 5IP4A 4GI9A 4RRPG 4RA3A 4N25A 4Y16B 3SGEI 4LRIA 1B0WA 1U8HA 2BHFA 4WSGA 4BE6A 5HHMB 1PDKB 1BF5A 1RUQL 2F9BT 3ULUF 4FFWD 2UX7A 2GC4C 1BVLB 2D73A 3MV7E 1GC1H 1R19A 2H2PC 4MQXC 1W72H 3V2AR 4EI0A 5CKGA 2WHVA 1J1XH 2WKOA 3PGFL 2F8XC 4TVUA 5TK4A 1QYGL 4G80A 5CO1A 1WS8A 43CAB 3FTWA 1N0XH 4NRYB 4LP4A 1ZJBA 4QDGA 3FRUB 2DIAA 1Q0XL 5IT2H 3OD3A 4O5LH 2WXRA 3E8UL 3QDAA 1AG6A 4G1EB 1G0YR 4JK0D 3BYTA 2VMCA 1BD2A 1JV2A 3RVVC 5DFVC 5JOPD 3Q9QA 4PRDB 4UDUA 5HBBA 1OSZB 4UQEA 1Z5LA 2Y7MA 2C8NA 1SXAA 1RZFH 1JZIA 4F33A 5JA9A 1HXKA 2HVKA 2Y0SA 3G7TA 1LTXA 4X80L 1BZEA 1ZE3C 4KTEL 2MPVA 1N0LA 4OLYL 5CJXC 2EDBA 4WZ9A 1DEEA 5DLML 5C9KA 3D2TA 3DPBB 5CEZE 5KANG 5FIEA 4V2BA 1R3IH 1WYJA 4QXTA 3C5JA 1ET5A 2H2SD 1MCDA 3GSVA 5DZNA 4DGUA 1A25A 1PD6A 3O3DA 4K5MA 4WU5A 3DI2B 5C09D 2DYRB 4HHAB 4PJ7A 3HZMA 5ABDE 4DP2X 1U91B 3DYPA 4O2FB 3D34A 4YLBA 5E23A 1FYTB 1BECA 1Q4NX 2H41A 2FZ3A 4HWZA 5CJQL 4TN9A 5DO2C 2KLRA 5DVLA 5EF3A 1M05A 3LV3B 3UJTH 1SDDB 1FVCA 2YXFA 3AG1B 5EU6E 1HXMB 4F9LC 5T1LB 2KQMA 1TNMA 5BW7A 1NCHA 2J8UF 4EQ3A 2NX5E 4KK8D 4L1TA 1MH5B 1DFBL 1YSOA 1ZV5A 3UTTD 1Z5HA 5DI8A 1ETJA 1EO5A 1RIVH 3NAAL 2VXVL 4S11A 4J1UB 4JN1L 3I3BA 3P0YH 4LAQL 2WP3T 1DSWA 1U8CA 2VDKL 3KPSD 4HKZA 3UYRL 1XIWD 1I7TB 5C08E 2VDPB 5TH2A 4Z7NE 4GSDH 3SE6A 3HI1A 4C4KO 4ZUWA 2BIIA 5I0VA 2K6YA 5KYYA 2VR3A 4DJMA 3ZL1A 2Y6SD 1BXVA 3QUXB 5KSBE 1R1CA 4L8SB 3QAZC 5C3IA 2Q7YB 3RPBA 1CG9B 2YGPA 3MBXL 4U4IA 3S37L 4KQ0A 1FFQA 4GXFA 3HLAB 4L37A 2ZUWA 4F8QA 2X4PA 1TJGH 2X2JA 4G7QB 5B39A 1TTGA 2KQNA 2NNCA 2NSMA 3WEBA 4ZW5A 1G6RH 3CU7A 4YGVA 3VNZA 1FGNL 1BVNT 4P2RE 5TF0A 3H3KA 3NJIA 3TBTA 4YWGH 3QH3A 1F8TL 1JWUB 2QQLH 3T5WA 2B1HH 3TWCL 4RIRA 3VCLA 3DJTA 3UG3A 1IVLA 2YFNA 1T1XB 4PUBL 1GS6X 1NCOA 2Q2LA 2ZKHH 1RHHA 2P52A 5EOCH 3UG4A 4OFIA 4KVNL 4DN3L 4ICXA 1FC1A 3C5ZD 5DURD 1WITA 1NM4A 2D2OA 4S1RL 5B39G 1DBKH 3ARDD 5J89A 1DCEA 4B53A 3WNPA 5HYQB 1HEZA 1N2RB 2Y1AA 5DMIH 4FTVE 4IK7A 1FWXA 3OXRB 4JN2A 1WFUA 3LKOB 4TTGA 4PJ9A 5C07D 3L1FA 1DJXA 2EDTA 3N2JA 4QAWA 3O11A 2WSKA 1DN2A 2CRMA 4XC3L 2I07B 3L16A 2YIHA 2F1BA 4MAYD 1F0LA 1ZSDB 3OC5A 1H3TA 3R18A 4MAUL 3HC0B 4QOKE 4ZUSA 1TYEB 1SUJA 3KW8A 3RNQA 3MJ8A 3L4CA 4BYHA 2QMKA 4Y5VC 1IM3D 1J10A 3TNMA 4ZTOL 2EKJA 3QDJD 3FSAA 1VDGA 4WKZA 4WK0B 4H88L 4ZD3L 1PEZA 4NQCB 4DVRL 4PJ8C 1H9VA 3CFKA 3QI9A 4B7LA 3GMNB 3VI4A 1YEEH 1X5HA 2QEJA 1A1NB 2RH0A 3RGVD 2E6QA 5KWYC 4Q2ZA 2BP0B 5G4MA 2QZQA 3ZL2A 5IWLA 2Y6TE 1DO6A 2ZOUA 2UVFA 2IPTL 1XVSA 4HULB 3MRLA 1ZIBA 4H8WC 4LPCA 1S7TB 2VLME 4PJAB 1SXBA 1ADQL 1X9LA 4AWJC 4DVBA 4MNQE 4YXLH 4Q6IC 5I71B 2Q76B 2NXYD 5JOFA 3QPKA 2W07B 2BK8A 1VEMA 2E4FA 2VABB 4U05A 1SF3A 3ARPA 4GSXA 5F9WC 4UT9L 3ECQA 3BH9A 1KLFA 5BZWA 2ZXBA 3DRTA 1LILA 2ICEC 4MNGE 5HY9B 4OCSH 4XRCB 3I50L 1P1ZB 3S97C 2BOCA 4FGMA 4Y2OA 3L3OB 1V8HA 2CO7A 2EXTA 4OM0H 5DQJB 4CDGC 1TTUA 4KRPB 5HDQL 1KYDA 2PABA 1BXXA 1XGRA 3SKNB 5AG9A 2JVUA 2QPSA 4JDVA 4XNDA 1AZZC 2NY0C 1OGAB 1W0YT 1R33A 2RHEA 3AAZB 4MHHG 3FPXA 2NW3A 4YK4C 5TQ2L 2HVJB 1OM3H 2EEXA 4LU5H 1XZ0A 4ZFOA 4HIHA 1IC4H 3IJHA 4BV1A 4LEXL 4NC1E 1RJLB 1PLBA 1PW3A 4JKKA 1NANI 1UJ3C 2ERJC 1CFBA 4LRNH 1J0YA 3MJ7A 4KQ4H 3X17A 3D18A 4M93B 5FHAH 5J11B 1A7NL 3UTSD 5T3XL 3L81A 5EN3A 5E8PB 2J57A 2C9XA 5EZJB 1OF2B 2NY2D 4LLUB 4TNVF 3QS3A 5D1ZA 3FU6A 1N4XH 5J13C 2BJMH 3LKRA 4N9GA 5HHVL 3AQDA 3UTQA 5DUML 2MCG1 2HJLB 2R0ZH 3KD4A 1NCUA 2MCMA 1NGWA 4M6AA 5FF6A 3B7YA 3KBHE 5C0ND 1NBVH 5GGUB 2YZ8A 2I5YH 3MV7D 4BZ2A 1RK1A 2R4RH 2YC1A 3OHXB 1M1XB 5EHFA 1WICA 1S78D 1JF6A 2WVVA 3EO1B 4C56A 3QULA 3ECBA 5HHXL 1GOGA 1J5CA 2D7NA 2NSXA 2YMTA 2A9ML 3FU3A 1U95B 4A2FA 1JZGA 2GUYA 3V7MA 1NUDA 3WUWG 2Y25A 2ZCKL 5DYOB 3MR9B 3NJJA 1ED3B 1T2XA 2VXQL 4P0DA 4MJIE 1TVDA 5I9QC 4BFKA 3BDYH 4X83A 1NGQH 2RACA 3H3BC 3TA3B 5SWZB 5LGKA 4Y19A 3Q1SH 5AVWB 1S8DB 5CEZD 4WEBH 2AV7A 1BVKA 3L4WA 5IW3A 1MI5A 4RAVB 5J9PA 3ILQC 4LDCA 3EJUA 1KJVA 5HYFA 4K9EH 4M56A 4EIUA 3BQUB 4HIEB 4KRMB 4DZ8B 1IGCH 2DMHA 1HE8A 3VI3B 2PCPA 3RTQA 1ADQA 5KS9A 4G7YL 4QR7A 1QSFD 4KUCD 5F3HA 4JGUA 1E5UI 3HAEA 5I6XB 1G9NC 3IDNB 4KMLB 5EU6D 5I1CL 4N8VA 4BK5A 3ATFA 5CN3A 4IIQB 1QKZH 1QTSA 5DF0A 3V0JA 3OGCB 1ITBB 4QLRA 3FQNB 2QHRL 5DC4B 2O61A 1GR7A 1KCSL 4QRPB 4P5KB 4IGBD 4V1DB 1NL0H 2CHNA 3QUMA 3F12A 4AI7A 3MRMB 1IQWH 4NUGH 1FL3B 4HDIB 4NT6A 5C08D 2AGJL 2MCPL 3B2VL 3HAEG 3TBWA 5B1JA 5I1DB 3SDDD 1C1EH 4HMCA 3QPQD 4F7CB 2FT8A 1A14L 2QGCA 1G1OA 2ZWKA 4HKJA 4N8VG 3QNFA 5TQ0H 4JM2A 3CZUB 3VFGH 3O4OB 2F61A 3EBGA 1TQBB 4AQ1A 3D8MA 3QIBD 3SDXB 2OJEB 3DIFA 1F3JB 4L3EA 1IC7H 2XYCA 1ILSA 1FNSH 5GJSH 1I3RA 4NZRH 1U8IB 4MQ7B 3ROLA 4Y5YC 3RWJB 5GS1A 5HVHB 4PJFA 3IS1X 1OP9A 4KNUA 3PGCB 5AW8B 4POYA 2SODB 2AFNA 2EDEA 2E27L 2HTLD 1DSFL 4Q52A 2OMVB 3PQYE 3IMRA 2XQ0A 3QZOA 5EOTB 3EFOA 4B9YA 1BOGB 2UZYB 2DM7A 4QXGH 5AKVA 4L0YA 4ALAC 2XG4A 3H7LA 1OY3B 1K8IB 1FO0L 1HAUA 4W9HC 1YEKL 5DJYB 2ADIB 1OGSA 3Q6FB 3QWOB 3QHFL 1DJYA 4X98B 4YLQT 4Y1AE 1MHCA 3PHOB 4M7JL 5E6IA 4X8XA 1ESOA 2X87A 1S7WA 1CXKA 3I75A 1NSNL 1E27A 3WFHA 3FFDA 3LAFA 2FBJL 1CD9B 5HDRA 3U48A 1EERB 1LEIB 5DRNB 4FTDA 4X6CB 4YIQA 2AQQA 1VSCA 1I1AC 1UZ6F 4BFRA 3OXSA 3CLEH 5GJTL 1RZKC 5B1BB 3BJLA 2H1XA 1DBAH 1PBYA 3LEVL 4QOKD 4Y2NA 1J5OH 1CTNA 3SDCA 1D2OA 1VKXA 2Q86A 3OKDA 5JPNC 2ZWYA 1NJ9B 3GBNL 3FUFA 1HEHC 3B2UD 2F74A 2EDOA 3FF8A 4XPTH 5AB9A 1CDHA 2D3VA 5JPMC 3NIGF 2QL1A 3C8KA 1QFUH 2AQ2A 5I6MA 1FSKC 4PS4L 3MZGB 3SOBH 3X11A 1JZ8A 1XH1A 1MFEL 3H9ZA 4KVPA 4U7MA 3U4BH 2COVD 5FOBA 3TIDB 1GJUA 3AADB 4BHUA 4YXHH 3ZE1B 2WWOA 2J8HA 3LRGA 4ODSL 2IH9A 1U8HB 3FUDA 1A4AA 5D7SH 5K9JL 3ZKSD 2VLMD 1CDYA 4HOMA 1W91A 3CN1A 3MGTA 4FNTA 3ZYJA 4HCRL 4I1RA 1KCKA 4G59C 1U8KB 4MNQD 1M1SA 5F72S 1YNKH 5DWUH 1KIPA 2HLAA 1TZHA 3F3HA 1CFNA 1X7TA 3O3AB 2H3KA 2E8ZA 2JKIS 5FS5A 1ANUA 2YD6A 3UYPA 3BMVA 2RQ8A 1I1RA 1YYCA 3AT0A 3K2MC 3PF2A 3T04D 4ANVA 4BFJA 5I66A 4JX0A 1BD2B 1JV2B 1T1YA 1P1VA 4UDUB 3M8OH 3C9NA 1Z5LB 4YUEL 1T4KA 1OIOA 1T2QH 4F33B 2HVKB 2BVQA 4FG2A 1N0LB 5IESL 3ALWA 1DEEB 3H9YA 4KH9A 3ZPDA 4AV5A 4WV1C 1QLEH 2KZWA 1A3LH 3QISA 1CB4A 1Q38A 2W5PA 3VQMA 4QXTB 2WO2B 3C5JB 3A5VA 4UV4L 4E68A 3KPTA 3GSVB 2CPCA 1NC4A 1U8NA 4F2FA 5C2UB 2P49B 2ENSA 3O3DB 3CFCL 5CAYB 3Q0HA 4WU5B 1NBYA 2JCWA 4PJ7B 1AAJA 3HZMB 4XGZA 4Q9BA 2PYEE 4YHPA 3QIWA 2MKLC 2V5YA 1L9PA 3FHEA 4F93B 2FZ3B 5G5DA 4HWZB 4CNIA 4MS8C 3MYJA 2OR7A 4JZJA 3NOIA 1BQHA 1CDBA 1M05B 4J23A 2FTAA 2GJ6A 4WGVB 4XVTL 2Q8BL 3C87A 1TO5A 4PJCF 1W6WA 5HHOE 2X4SA 3FKUS 3ISWA 4E9WA 1GPOL 3CAFA 4ABUA 5JW4M 5AG8A 1FO0A 3UDWA 3QO0A 2BHYA 5DI8B 3V5DA 2HXAA 5AYUH 1KG0A 1U8CB 4GAFB 3ZTNL 4HKZB 5KEZA 2VCOA 1TOXA 4G71B 3ARWA 4M6NH 5TH2B 1QASA 1DQDL 1P9MC 1T2JA 1UACL 4LCIH 4Y4KC 3HI1B 3ARGC 3F6IA 4OLUL 3PFQA 4MA8L 3OMZA 2Z0UA 3I84A 4FE9A 3TVMC 3VXNA 5BZXA 4TSBH 1UWEL 1R46A 3BVVA 4L37B 3RZCA 2X4PB 5JA8B 4E42A 4MJID 5EULV 4X5PA 4ZRGA 1DQVA 5B39B 4H5SA 1MHEA 4HPOL 3OR7A 4FOMA 5HGDA 3S3JA 5I16A 3RL2B 3MCKA 4YGVB 2OQJA 2AK4E 3PL6C 3K0YA 2XVGA 5HGAA 5AOZA 3TBTB 2DM3A 1UEYA 3QH3B 1WJ3A 2GIXA 3PPSA 2NNFA 1Q9KA 2A77H 1BAFL 4RIRB 2NQDA 3HS8A 4PJEF 3Q8CA 4PJHA 4WCYH 4NQTA 5SV4A 1RHHB 5LXVA 2MQCA 2Y24A 4KKCC 3REWA 3KVQA 4JW3A 4P46A 4C57C 1IBHA 1SGKA 4Y0GA 1HEZB 5ALBL 4OTXH 4MYWB 1PF3A 3MLWL 5A2LH 4X9YA 3EHBC 2MNJB 4JN2B 5HGHA 4NBYB 4XODA 4PJ9B 5DVNA 2CDGB 2R1WB 3I9IA 2MNWA 4LCCA 3O11B 5D7KE 2BDNL 4KK9D 2FEEI 3HMXL 2X88A 4ZUSB 1KCBA 4GKLA 5D7IB 3JWDL 5A16B 5GPRA 4XO4A 4ZDHA 3RNQB 3MJ8B 4HWBH 4X6BA 4EN3C 4OIIH 5FKPA 3TNMB 1XMEB 1L9OA 1RZIB 4WKZB 4YBQC 1M57B 3WSQL 2Y5EA 4L3FA 3O8XA 3PYCA 2FWUA 4Z7WF 1GHFL 3QI9B 4A6YA 3NDZE 1L9TA 2EACA 4MB1A 4NFDA 3VI4B 2FK9A 2ZOOA 1HHJA 1FZKA 2DMBA 2EIBA 4AJYV 4JG1L 2OI9B 5DEGA 2D3NA 3NPSC 4Q2ZB 5DD5L 4FFYL 5ALCL 5E8DL 5LQBH 4PBVC 4HW6A 1R5WA 4M6OL 3G5VB 1IGYA 5KSAC 1MF2L 3KLAA 3DGGA 4I9XA 3N44F 3MRLB 4PWGA 3CXHJ 1T7YA 3H2WA 2VAAA 4N87A 3U7WL 1CLYH 2YWZA 2DIBA 4DVBB 1KC5H 3PQYD 2CR3A 1MW3A 1VGEH 3L5XH 5JOFB 3P9WB 3D4GA 2A2QT 4P57A 3N0AA 5DK2A 3KBFA 1GGIL 3ZY7A 3GBEA 1BCIA 2JCCE 3BH9B 4FHJA 4JG0L 1KLFB 4TUKH 2WLYA 3APDA 2YEVB 3DRTB 4Y1AD 5E2VH 3MXWL 4B9JA 1XTLA 1G87A 1MOEA 3ZDYB 2VDKB 2MQ3A 1O0VA 1W9XA 3DTUB 1BQ5A 1G7QA 5CP3H