1J5DA

Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j5dA00
3HB3B 5A7EA 3NSFA 2ZWNA 1JXFA 2H3XC 1M56B 1A4BA 4NAJA 4KNTA 1L9QA 4DP9X 1NZRA 4KO9A 5B1JA 2VW6A 2YARA 1SFHA 5B7FA 3GXUB 2GI0A 2ZXWB 4HHGA 5I28A 2P80A 1DYZA 3CDZB 2CALA 2HX8A 2X88A 1OCCB 3L45A 2ZONA 3C75A 1ILUA 2HRHA 2YXVA 4F7KA 3OMNB 1AZCA 1ILSA 4HALA 2XU9A 1PLAA 4BXSV 2MRYA 1WS8A 4DPCX 3QJVB 2IWFA 2FT6A 3NYKA 1WAEA 2EILB 1BYPA 4UANA 5I6PA 4NERA 3S3CB 2UXGA 3NJKA 1BXUA 3NT0A 7PCYA 1PNDA 3UABA 1XMEB 1XB8A 2AFNA 4CSPA 1PZAA 4HCGA 1MG2C 3ZBMA 2UX7A 1JZFA 2IWEA 5AZUA 1FWXA 2UXTA 3KW7A 1ADWA 2CCWA 1YLBB 2XX0A 3X1FA 3PAZA 1DZ0A 3OMIB 1IBZA 4WKXA 4DP2X 1J9TA 1OCOB 4KOBA 5FC9A 3NSDA 3T6ZA 4PAZA 1M57B 2HXAA 2JXMA 1PLCA 3PLYA 4QKTA 4E9XA 2AZAA 4MFHA 5I6OA 1L9PA 1ZIAA 3FSVA 3MBWB 2H47C 1ZV2A 4HIPA 4Q8BA 3OM3B 3QJUB 4N4YB 3WKPA 4HCFA 4E9VA 3FSAA 4A66A 2FTAA 3V9EA 3CVDA 2VW7A 3WIAA 3IE9A 1JZIA 2XYBA 4GP4B 2IWKA 4BWTA 1I53A 4A2EA 3QQXA 5I6KA 4AKOA 2J55A 4WTQA 3X1GA 3SBRA 3WNIA 4JKNA 2CUAA 2GIMA 2OCCB 1E65A 4A68A 2FJSA 2TSBA 3CZUB 1R1CA 4TXVB 4UAHA 4F2EA 4W9ZA 3SBPA 1RZQA 1IBYA 1PAZA 5B1BB 2I7SA 3NJFA 1GSKA 2PCYA 2YQBA 3DTUB 1ET5A 4YL4A 1GS7A 2FQEA 1A4AA 4A2HA 2EIKB 2DYRB 4F2FA 3H56A 3IN2A 3KW8A 1L9RA 2PP7A 4AI7A 2Y1AA 1X9RA 3S8FB 2I85A 1ASOA 1J5DA 3TBCA 1PNCA 3OQRA 3PAUA 2AVFA 3WNJA 4YVNA 2CJ3A 3ASOB 2BWDA 1AG0A 2QDWA 1JERA 3X1BA 2UXFA 2BZCA 2LLNA 3FQYA 3AZUA 1MG3C 1URIA 2DYSB 3AY2A 2HZHA 9PCYA 1ASQA 1M9WA 1BXAA 2GB2A 4P5SA 1OE2A 1PMYA 2WSDA 3ABMB 1BQRA 1J9SA 1ET7A 1L9SA 3ABGA 2J5WA 3GDCA 5B7EA 2PLTA 2H5UA 1BEXA 1NIDA 2IDTA 2FT7A 1RCYA 2YXWA 2IAAC 2TSAA 2FQFA 4DP5X 3S8GB 1F56A 4FA7B 3FSWA 3X2QB 2QDVA 1W6LA 4GY4A 5B3SB 3QJRB 4E9QA 1A4CA 3AG4B 1X9UA 3QJTB 4YSSA 1KDIA 3N2JA 1T5KA 4YSPA 1NICA 3ZX1A 3UGEA 3QPKA 3EH3B 5I6NA 1NPJA 2PP8A 1TU2A 1MDAA 1OCZB 3FT0A 1JZGA 4YSOA 3TASA 1IKOP 1L9TA 3FU7B 4KO6A 5PCYA 1AS7A 4HHWA 1N68A 4YSQA 1SF3A 3FPYA 1AACA 4L0PB 2EIJB 1AZUA 2RACA 5I5JA 1E5ZA 1KDJA 3PXLA 1KCBA 3JTBA 2XV0A 5B1JC 2VW4A 2XUWA 1NIFA 2BW5A 2MTAA 1NIEA 2XXFA 2VN3A 2XWZA 2FNWA 5PAZA 3WI9A 1JXGA 1SHXA 3FPXA 1AS6A 2XVBA 2GC7C 4PCYA 1JZJA 2XX1A 1KV7A 1PCSA 1V54B 5D4IA 2XV2A 3SBQA 1ZDQA 3OD3A 5TK2A 1GYCA 1J9QA 1EHKB 2UX6A 4N8UA 1AIZA 3HEIB 3TA4D 1TKWA 1ZIBA 3AG3B 1JOIA 3H4HA 4GP5B 2BO0A 4AX3A 2OJ1A 2JKWA 4M3HA 1JZEA 2DV6A 3ABLB 2W88A 1PZCA 3CVCA 1IUZA 1SDDB 5B1AB 2VMJA 2A3TA 1W6WA 2BZ7A 1TEGA 8PAZA 4YSDA 1OE1A 4KNUA 3ZIYA 2AANA 4NB7A 3EH5B 1MZYA 6PCYA 1A8ZA 3UACA 4E9RA 3PCYA 2GC4C 3WG7B 3NJLA 3QJQB 2VM4A 1AAJA 1QLEB 5D4JA 3N55A 1SHWA 1WA2X 2PPEA 1ASPA 1JZHA 3FYIB 5I5IA 1FA4A 2JFCA 3MX0B 3NSCA 3ASNB 4KOCA 3T71A 1HFUA 2BWIA 1RKRA 4E9SA 3NP4A 5TK4A 2Q9OA 1EZLA 1GR7A 2HLEB 1BQKA 1KYAA 3IEAA 2QPEB 2ZOOA 3ZDWA 4P5RA 1J9RA 4HZ1A 2J57A 1KCWA 4FAAB 2EINB 3TU6A 1PLBA 3NJGA 4G72B 2B08A 4ZK8A 1BQ5A 3UAEA 2HRGA 4YSEA 1ET8A 1TEFA 4EF3A 4YSTA 1AG6A 1NINA 2CBPA 1MZZA 3X1EA 1HAWA 2IDUA 3AG1B 3CVBA 1V10A 1V55B 4DP6X 3FU7A 4DP8X 4JHUA 4K9JA 1SDDA 2PCFA 3GYRA 7PAZA 1SJMA 3NJHA 1XB6A 3BQVA 1JXDA 4E9TA 3EHBB 3FYEB 3IN0A 1AR1B 5F7AA 2FQDA 1E67A 4DP0X 1ID2A 2YAEA 4DP4X 4ENZA 3NP3A 1SF5A 4G7SB 1NIBA 2BP0A 4KO5A 4DPBX 2BP0B 1RZPA 1QNIA 3NJNA 2BHFA 3T9WA 4G71B 1AOZA 1WA1X 1OV8A 2FT8A 1OOWA 1OE3A 2HX9A 3IBOA 3S3DB 3EF4A 4AKQA 2PPAA 2VSMB 4DP7X 2E86A 2XXGA 1VLXA 2GSMB 3NSYA 2UXVA 2R7EB 2DWSA 1BYOA 6PAZA 2I7OA 1A65A 1A3ZA 3FU8A 2IH9A 4A2FA 2WO2B 1JVOA 2X87A 2YAHA 2OV0A 1B3IA 2NRDA 5I26A 1BAWA 1E30A 1AZRA 1KBWA 1IC0A 1ZPUA 3PPSA 4BK5C 2QPDB 3S3BB 4BWWA 2IDSA 1BXVA 3FQ2A 4G70B 3OMAB 3FQ1A 2WO3B 1N70A 3AG2B 1SNRA 4A67A 1NWOA 1PY0A 1CYXA 1XB3A 2Q5BA 1L9OA 3U25A 3QJSB 3UADA 2CAKA 5I6MA 2J56A 1WS7A 4A2DA 1GY2A 1CC3A 3DKHA 4BDVA 4A2GA 2YAPA 1ZDSA 4YSRA 4AZUA 1CYWA 2YAQA 2B3IA 3NJIA 2YAOA 3UAAA 1KGYE 1AQ8A 1FFTB 4YVUA 1SFDA 3CG8A 4BDVB 4GP8B 3RYMA 5I5MA 4UF7C 2GBAA 2VSKB 3FU9A 4Q89A 1AZBA 2PPDA 2FWLB 4GXFA 4RH4A 3JT2A 2BP8B 1QHQA 2IDFA 3T6XA 2EIMB 3EH4B 1KBVA 3DIVA 1HAUA 2P80D 4BXVA 2IDQA 3NJMA 4GYBA 4HAKA 5ANHA 4YSAA 4DP1X 2FQGA 4HCIA 5F7BA 2HX7A 1NWPA 2N0MA 4QLWA 1GS8A 2IH8A 1WA0X 1E5YA 3FSZA 2PPFA 5E9NA 4AKPA 4YSCA 1J5CA 1OCRB 3H4FA 1CUOA 3WKQA 5AKRA 5I6LA 4DPAX 5AFAA 2XV3A 1PZBA 3X1NA 2Y69B 3CDZA 1AANA 1GW0A 2PPCA 2YAFA 3SQRA 3T6WA 1GS6X 4KNSA 4E9YA 2YAMA 3V9CA 1OF0A 3AW5A 5LDUA 4W1TA 2XLLA 1CURA 2R7EA 3ERXA 2DWTA 1NIAA 4G7RB 2BW4A 3FS9A 1ETJA 2VM3A 1NDTA 1W8EA 3NJJA 5B7MA 3TBBA 2PP9A 4BWUA 2QT6A 3T6VA 5B1KA 4KO7A 1NTDA 4YSUA 5IY5B 1NPNA 2W8CA 2GHZA 4M4RB 3ABKB 3BVDB 1AZNA 4X4KA 3D12B 1GY1A 3G5WA 2DY2A 4CSZA 2BP8A 1UATA 4JHVA 2AZUA 1AS8A 4E9WA 1PF3A 5EHFA 3PAVA 1JVLA 4G7QB 5D4HA
chains in the Genus database with same CATH superfamily
4N0FA 4NUJA 4I13B 1IBFA 1M7UA 4I1NB 1JXFA 3FRPA 1R5IA 5K5YA 5G4NA 4FKKA 1CXHA 1HIMH 2IALA 2RBLA 4X6DF 4H5SA 4N0CD 4FQ1L 3APMA 3EYSH 3GXUB 4X99B 2PN5A 3U9WA 2P80A 2FGZA 3DVNA 1UUSA 1NFDE 3ALPA 3L9BA 1YECL 2ZONA 3QK0A 4TVUA 5AB0A 4JN1L 4Z7WF 4MA3B 5A6IA 4CVXB 1KXTA 1MKFA 2VE6B 5LHDA 3DGGB 1WVZA 3UBXG 3HE6C 1XFPA 3IF1A 1I8KB 1BVNP 3TESA 3QSKB 4NERA 3DHPA 4TV3A 1UENA 3GBMH 4NUGH 1A25A 4GG8A 3AADB 1CLYL 5GS2H 3IYLW 5CS7A 2YS4A 3HI6H 3MRGA 1LEKA 5C1MB 4IMKA 3ELQA 4CGTA 4PJGA 3U7AA 4OJYA 2H0JA 1MH5A 4QRPB 1JPTL 1QW9A 4XVOA 1ZT7B 1CLOL 2VXUL 1SLUA 4IBTA 3O3DB 3BT2H 4JANA 4U6XA 1DO5A 4NZTL 1AKJD 1K8IB 4X6FA 4X7SL 1KB3A 5EZJB 3VFTA 1C08B 4YQXL 5T1LD 2Q8AL 5EIIG 5EIIB 2FEDC 3Q3GB 4IIQA 3G04A 4J2XA 4AZ8A 3WLWD 3F04A 4LPYA 5HDBB 3QIBA 5FWQA 4HWZB 2CNZA 1KN4H 1QR1A 3QUKB 3QNYB 1RAMA 4WKXA 3TBVA 4XTRD 4F8NA 3CFCL 1BWWA 2Z92A 3DUHA 3QORD 5LBGA 5JXEA 5HI3D 3C2AL 2O93L 5AKSA 4MAUH 4BFGA 3VXOB 1G1OA 3LN9A 1FJ1A 2AJUL 2XTJD 4AMKH 2Q8BL 4MASA 5FK9B 4YHMH 2Q6WB 1OM9A 1YSOA 2QEJA 1KPRA 3EJYD 1OB0A 1XXFC 1F90L 4YZWA 3SB3A 5I1LA 2EH7H 4NC1E 1HEZB 2BVYA 5KSAA 4ODXA 1UADC 5E5MA 1J0KA 4HIEA 1QRNB 5A2IH 4BA8A 1OZTG 4AK2A 4QWWC 1Z3RA 2NQCA 3U48A 1YNLH 4LEOB 1B4JH 1P84J 2H2SD 3U7WH 1ACCA 2P4AB 2AV7A 1CDGA 4J7RA 3N6YA 5F7NC 5IVXA 3TBSA 3EDKA 3KEDA 3OC8A 3UCRA 2AK4A 4S1QH 5EUOE 4AQ1B 3PGDA 3Q2VA 2O6FA 3TEYA 1R9FA 3P9MB 2JTDA 3NA9H 1T22B 4NJAH 4O2EA 2NY6C 3BZ4A 4H8WH 4I0KA 1O5DT 1HH6A 2DYRB 4UQDA 4XVUD 3SJVA 3KW8A 1CICC 4AC4A 1L9RA 3WJLA 4PJFE 2VWEC 3VX1A 4TF4A 1Y6MR 3IDGA 3Q44A 4J5VA 2ITEA 1S78C 4J3VA 4DK3A 1TIUA 4ENEC 3B83A 1KNOB 2CJ3A 3FQRA 1AGFB 3SO3B 5FF6B 3AM8C 1HE8A 3ESNA 4KAQH 1PZDA 5SWSA 3SGDI 5E8EA 1E40A 2HH0H 1KZYA 3LS5H 4GIPD 2ZX9A 3C08L 4PJHA 5FO2A 3QDJB 5E08H 2HZHA 1CFTA 4X2UA 9PCYA 1M9WA 2MHAB 3CIAA 1OE2A 4PUBL 4YHPB 5I17B 1F6FB 5I1KH 3MLPA 3GSUB 4QAMB 4WV1B 5D1XD 4L18A 4J12A 2F53E 2HPOA 1JGDA 2X28A 4JAMB 4BSVB 5F3HA 2WB1A 4KKPA 1ZHKB 4PJBB 3GUTA 5DHVA 4PJXE 1JF1A 3IJ9A 3QIUC 2VDOL 4W9IC 1I3UA 4YE0A 3K6DA 4NWTL 2TSAA 2WCSA 1HINL 2P5EA 3N04A 1PAMA 1DBAL 1OARL 4LSRL 4MJ4A 3US0A 1N8OE 3B5TA 5GZOD 1C7SA 1OT2A 2NXZC 1NC2A 2VR8A 3KPSB 4YSPA 1NMAL 4U4BA 3K7UA 5BV7H 3FT0A 1OCZB 4G3YL 3SDDB 3TYFB 5F1SA 1EVUA 3V4LA 1UOWA 2NSMA 1G7LB 2R9HD 3TTSA 2PCXA 2Z6FA 3OSVA 2EIJB 1M2OA 3BAEL 1NC4A 2VUYA 2IBGA 2JJVA 4YHZL 3PXLA 4MCNA 3S9DB 1UJ3B 1T1ZA 4WDIA 3KR3H 5DZNA 2WIMA 3JV5A 3RIFF 5IJCC 2DJUA 2XWZA 2QFPA 1FH5H 1KB9K 3QIWD 1SOQA 4N3TA 3FTSA 1JXGA 4Z7VE 5H94A 3FPXA 4HS8L 3VMNA 1SHSA 1JZ6A 2X6VA 5JIIA 1KXQA 5IJBC 1HEHC 2ISDA 1H8OA 2ODHA 1QZ1A 3ZHKA 4P3DA 3ZDZB 1XGRA 1SM3L 3NSJA 4KK8D 5LGYA 4M6NL 3RVXC 4PJ5D 1TZOA 5IMKA 1SXZA 4N2KA 4UTBL 2B9AA 4NJ9H 3HMWL 3GHEH 5C0EA 1UXMA 1INQA 5KJ4A 4K2UL 4YSDA 2RHEA 5GS0L 5E1HB 4L9LC 4JDZB 4PP1C 7CGTA 3IM1A 2BY2A 4U6YB 5HDWA 2V2XB 3RWCB 3BDXA 2YD2A 4Y9FA 5I0XA 2PW2A 5C97A 5E0FA 2I25N 2IMMA 4TOYL 2XN9B 3V6OA 5HDRA 4HC1A 5AG8A 2FL5B 1MWAL 3PHOB 5DJCB 4F7CB 2X4UB 3MX0B 5HVHC 2ZCKH 2JJSC 5JHLL 2WSPA 1HFUA 5JHDA 1OAJA 3BPNC 4IRZA 3NP4A 3P0VL 1WF5A 4EQ3A 2QHRH 3IEAA 3ZLQC 2EDHA 3ULUH 1ND0B 1R3LB 2X05A 1S7TA 3TOPA 2XN1A 4UOJA 2OMTB 3UJJH 3VRIA 4MJID 3ESOA 3U46A 2QGCA 3CLEH 1BAFL 3UO8B 3GSXB 1UQSA 4FI6A 5IMMA 4XHJD 3E2HC 2PO6C 4FP8L 3P0YH 3OR6A 2R1XB 1KTCA 1YN6B 4G8IA 5F0PB 3THMH 2BY3A 4YSTA 1JFHA 2O30A 4DGIL 5IB5B 1HNYA 4XVJH 1PZUB 5IBTH 5ADOH 1IM3D 5DJ6A 2VMEA 4Z6AT 4K9JA 4WHDA 1A7RL 5FYKH 1JIBA 1U8CA 4OJFL 2ZKHL 1TTCA 1BWMA 4P9MH 3JZYA 3B2VL 1D5ZA 1ZT7A 1E43A 2B3RA 2NDFA 2VDMH 5BOPA 1JXDA 3N0PB 4LARL 4NQDA 4HLJA 1AR1B 4B96A 3MNZB 2GYSA 5IIEA 4HS6A 5E5RB 3WY4A 1QA9A 5B39A 2FAUA 4G71B 4Z77A 4HF5L 3HG1D 3QQ3B 3QXWA 2LTQC 3ECWA 5CEXA 1UZ8B 1WFJA 3FMGH 1A7BA 2R0LL 1JPSL 2DZEA 2ICEA 3WL9B 5E6YA 3H9SB 1R4XA 1VLXA 4LF3A 2Z1KA 3MUY1 4KFZC 2BSBA 3VXMB 5IB4B 1JYNA 1U8OA 3C8KB 3AITA 1W0WB 3U79A 4K8RD 4X6FB 4J8RA 5SWSD 1IGCL 1X9LA 5EORH 2M2DA 3INUL 3O3DA 4JANB 4QTIH 1NCUA 4Y2OA 5HHOB 3PRZA 2ZE0A 1MSPA 2FE0A 4JDTL 1UOLA 3R8QA 3POCA 3VD2A 3NCWA 2JV6A 3ZKMD 1DL7H 5IMMB 1KC5L 3QYCA 1RJZA 3PPSA 3RAJL 2EVFA 4Y19E 1AD9B 2C9XA 3IXAB 1R3HA 3KWVA 4KKZA 3MRDB 2ZNXA 1NGPH 3EOBA 4K73A 3TC9A 4B7LA 5EOTB 2BIQA 4LQFL 4WUUA 5JQ6H 2YUXA 4TLKA 1C5BL 3DUUB 1NGWA 4NQCD 1F3JA 1R3IH 4LLUB 5JR1H 1REIA 5SWSE 2NW2B 4BSWA 4JG0L 3QG6B 2CO6B 2WINB 4A2GA 4NS0A 5D1ZB 2EC9T 4BINA 3NIDE 1PJWA 4XP1L 4G9DA 3HHRB 2YAOA 5CLYA 2A9BA 2P52A 4Z76B 1SFDA 1TCMA 2EZ0D 2XPGA 3P73A 2YKLL 2P46B 3KXFA 4MS8C 5T3ZL 1SN0A 2LFEA 3L16A 4PRDB 3G6DH 3FW6A 3GBDA 3KCPB 2OMVA 4FNTA 3DUSB 1G9NH 4KXZI 2WZPD 1MCHA 3OGCA 1KBVA 4BXVA 1T2QH 4NO0D 3VE0A 4QHNA 4JKMA 4ONHA 1HHGB 2DQIL 1NCBL 1TETL 2OL3A 3B7UX 1NWPA 1T22A 1WA0X 1SJHB 4OD3L 1E0OB 3FSZA 2XQYK 4AKPA 4YBQC 4CN4A 4YSCA 2D0FA 3RX9A 1Q9KA 5EZLB 3QEUA 3BIBX 1FP5A 4LAQH 3TPUA 1P5UB 5EU4A 1CGUA 2N7AA 1F4WH 1UA7A 5E8NB 4GFTB 4F8TA 5I8EB 2FK9A 3WCYA 3C60A 4NCDA 2D9QB 4KK5C 1KN2L 2PO6D 5CN2A 2QVFB 4E0RA 2ENSA 4PBDA 3VWKC 4XH2A 3ARTA 2YAFA 5EOCH 4B6ZA 1T89C 1A9EB 1UCTA 4G7VL 3TCXA 1HU8A 3BP7A 4JRFA 1UURA 2CRIA 2HN7B 5F7UA 2JQZA 3QXTA 5CJQL 4TS6A 3IE4A 4RWYH 4FFZH 2DWTA 4EN3C 2Y7QA 4ZXBC 1MCPH 2J5LC 1EJ8A 1X4XA 4H7VA 5MENA 1ZTXL 1D5MA 2FH6A 2ZCLL 3ETBF 2D31B 5EU6B 3SDDA 2NY2B 4N6QA 4MCZA 3VCLB 1LE5B 35C8L 3TXAA 2WLYA 1NBZA 3E1ZA 4TVPH 5IY5B 3FO2A 4XPFL 2XQBH 1I9IL 4I48A 3R19A 1M1XA 1KGWA 2DYPA 5AENA 3W39B 4NQED 3BLBA 4N8VB 4CSZA 4YO0A 1V3KA 1UWEH 2ADGA 1MFCL 3DJSA 3BISA 3ARED 3JWNH 4RA0C 4F2MB 1D5IH 3R7QA 5D7LD 3NSFA 2BC4B 4FNRA 2OA9A 1QABA 5IFAL 5IHBA 1L7IL 4KO9A 2OYPA 4JDVA 4WW2F 3S4SG 2GUOB 2QQNL 3WHE1 3BKML 4OT1L 3QRFM 4H88L 2MCPL 4TNVF 1E4KA 4ELMB 2C9QA 2HLFD 4GI9A 1QLEL 1ZPLA 1DYZA 1NCDL 3HZMB 3L45A 4LU5L 1QUNA 4KROB 2HUEA 3GXDA 3LEVH 4G8EA 5B39G 4BXSV 1PLAA 4FXGB 3M88A 3RL2B 3QJVB 5I6PA 1RIUH 3MV9A 3L48A 1VB9A 3S3CB 3HZYA 1WK0A 4OAWB 1HQ4A 1PNDA 4XPTL 7PCYA 4HCRL 1FH5L 4I89A 1IT9H 4Z8FL 1OAKH 1URLA 2FL5A 5IHUH 2R9HC 1JK9B 2VL5B 4NP4H 4L8DA 3CBKB 1WWCA 3TWYA 2DEYX 2Q2LA 3ZTNL 4AJWA 5ID1B 4P4RA 3FUKA 4Q6IA 2OSLB 1T21B 1IGML 4PJ9B 4G80A 5D7LB 2WQVA 1GZPB 2CKBB 2O5YL 1U91B 3V10A 3RX5A 3K71A 2CCWA 1G5GA 3OAWA 4AUYA 2DRUA 3HMXL 2UVEA 4Y0GA 2EJ1A 5EEVA 1BVNT 1F3DH 4PD4K 3FBQA 5TQ2H 3OR7A 2F5AH 3VYNA 3WEOA 1X6LA 2P43B 4WFFD 5C0DA 3MV8D 1G1KA 2AZAA 2MNWA 3FQUA 5K9QI 4UBDC 2ETWA 3WIFA 4GO6B 4X5RA 4C54A 2FX8H 1L3WA 3BX7C 4JFPA 2EH8L 4AEHL 4M3JA 1XGPA 4TOYH 5LN4A 4HCFA 3LHPH 2HLAB 1AXSA 1U8JB 3EYFB 1MCFA 2FD6H 3GGWB 3H9ZA 1OT4A 4UQ3A 5AOZA 5F89B 3VD4A 4YIQB 3LKRA 5IHUL 2OP4H 2AQNA 3BAKA 1KPUA 1CPUA 4Q97A 2NY3B 3GLZA 3KPTA 4JJ5A 4N2MA 1RK1B 1BVKB 4A2EA 4ZUTA 5ICYB 4MDIA 3OB0K 3DETC 1MCKA 4LDEB 3B5HA 4EI5D 4N8PA 1A4KB 3QDMB 5D93B 3SDCA 1SZNA 1M6UA 4Z0XA 3W56A 2L7EA 4XBMA 1P2CA 3QO0B 4Q6YA 3NACH 3CC5B 3BC9A 3CVHA 4J3SA 4F2EA 4FI8A 5DT1H 3K8MA 4I4WA 1S9WB 2BNUA 1K3IA 4UMSA 2I7SA 3LKOA 3HJ0A 4R5XA 3TV8A 4K7PL 1CFNB 1MFAH 4M02A 5BRZA 3EBAA 3P4NB 4JZJC 4MJIA 4PJ6A 3THML 5AL0A 2PKDA 4N5EC 4HISA 3BWSA 3FUIA 4L5FE 4NO0B 4TLUA 1XF3B 4AI7A 1Q0XL 4AT6B 4WHYH 3UL4A 2BNRB 4AEHH 4WU7B 3SDXA 4ZYKA 5ES4B 4YVNA 5L88H 4OCYL 3GHPA 4Q9BA 3EYUH 4M7LT 2YGVA 5DYFA 1LK2A 4XC3L 4P2QD 3DA0A 1TVHB 3HAEH 1F0LA 3RIFK 3ZRSA 5KVFL 3HVDA 3KPNA 5F9OH 4KQ3L 1FPTL 1TQTA 3C6LC 2YIHA 3VXQA 1LO2L 4Y7OC 2ZWSA 3K74B 1J9SA 1ET7A 3MRIA 2VLKD 1W91A 3FMGL 5GRVL 5B7EA 2CO6A 2WINA 3C5ZA 5D7JD 3LNHA 1T0OA 1XSJA 4G6AD 2MFNA 3W57A 1R3HB 2EACA 5CLWA 3UC2A 1I82A 4I0PC 3FH7A 3JWNG 1UWXK 3S37L 3KHQA 3JQOB 2MEJB 4GY4A 4X4ME 1CQYA 4N5ED 4Z7UB 2APBA 4P2QE 4E9QA 1Y1UA 5IT2L 4JZOB 3WD5L 1T5KA 5IG7A 1NSNL 4XVSL 3B1UA 3LKNA 5I6NA 3CPLB 4NQSB 3L17A 4LB8A 3CDYA 4GKSB 4XXWC 1BLNA 5DEZA 1FZJA 2WWOA 5CAYB 4NBYB 4AVIA 5IBLD 2A7BA 1LM8V 5J11B 1BX2A 3Q9PA 1K72A 4GS7C 4RFEB 3SE9H 5LWYH 3D06A 2MKLC 1AGCB 1DVXA 3WV0A 1CD9B 5FDWB 5CGYD 5IEKB 1L5GB 4GKNA 1I85C 1GCYA 1S9VA 1Z0NA 2ZUQB 4DTGL 5JO5B 1FPTH 1DVFA 1G94A 4PRHA 5E8NA 4UUJA 1BGXL 2FNWA 1U4EA 2TRYA 3ARGC 4MCYB 3TS8A 3LKQB 3SQBA 3L5XL 1LMIA 1NCJA 4MZIA 4HC1H 1FVCB 4KZEH 2GTWA 2XTJE 4KI5D 3GLDA 5DDHA 4UQCA 5LAXA 1ZDQA 2BSSB 2YMOA 1W0YT 2X4NB 3S37H 3WEMA 4XWGH 2BNQA 3I9AA 4NUMA 1X5JA 3TA4D 3HTLX 2E6PA 3AG3B 1PY4A 4BQ9A 2RA1A 4CADA 2X6UA 5GRZA 3GMQA 2YPKA 3UYRL 1P6WA 3AROA 4J4PD 2ARJB 4JM4L 5AUMB 3QG7L 5T5NF 3X14A 2C3WA 4YLQT 3UPAA 4ZSOB 3F3HA 1UZ6E 4WUUE 2X9YA 4EDWL 3IDUA 2IEPA 1N7MH 3NQKA 2XTLA 4ANWA 2JK5A 3VTTA 2HN7A 5FFOA 4HFUL 4XMUA 4N2FA 3S97C 2DQTH 4XZ4A 4LKCA 2WLKA 3U36B 5ELIA 3IGAB 1RIVH 1RZFL 5HBBA 5DMIH 1ESOA 3GMMB 2E9WA 2J8UB 4JGMA 2VERN 1BLNB 4UCFA 4AXWB 4JRYE 3MREB 1ZTMA 4FNPA 1P7QA 5FYLE 3T8VA 2FRGP 3QUMA 4ZDHB 4PS8A 5C0BD 2ZOOA 3N43B 1FVEB 4NRXB 2FZ3B 2YN3A 3Q6GH 4JREB 4B3EA 5GS1A 3RB5A 5CFHA 3LDBB 1WAAF 4GUCA 5LG1A 2GUOA 4AL8H 4EXPX 4Q52A 1S8DA 4D0DA 5L0QC 4X0KA 4S1DD 3RUGE 4N9GA 3RTQB 3L13A 3GRGA 3MN8A 2Z4QA 1PGRB 2CR6A 4ICWA 4Q4IA 3BGMB 3IFOA 3NOIA 1WBXB 4HUUB 4HFWA 5BRQA 4MKTA 1T89A 3AG1B 3VYOA 3MRHB 2WVVB 3RWJA 5I66A 1ZANH 4L37A 4OZHA 4XMKL 2Q7YA 3TA3B 3BMWA 1QSEE 4W81A 3QHFH 3QW9A 3T65B 4PJ5B 3RFZA 3ZDXE 1K4CA 4QWWD 5DRWB 3LPOA 5IQOA 5JA8B 5EO9B 2KC0A 1ADQH 5MEND 4ZW8A 1IIKA 5EUKA 2BOBA 3EHBB 4WEEA 1ID2A 3BESR 4IJTA 5LB1A 1BAGA 3L4UA 4G7SB 2P5EB 1TTUA 5KG9B 2GEEA 3U2SB 1J5IA 2UY7A 4AL8L 2CLZB 1T7ZA 3EFOA 3WXVH 1GGCL 3V0WL 4KXAA 3BZEA 5FYKU 4IHOB 4QDGA 3BT0A 2YJLA 1H3PH 4DP7X 3RTQC 2AK4E 1B0RB 1XCXA 1G7PA 2A6DB 2LLLA 4KK6C 1G7HA 3OLEA 1JGEA 1BYOA 5AQ0A 3W5NA 1FGNL 2GHWB 2WUBH 3FO1B 4PB9L 1DZBA 4KVPA 3D25B 4QYOB 4AJ0A 4JKKA 2WZAA 1WT5A 5D7LA 3HC4H 4EUPA 1M6OB 5SWZD 4A55A 4DW2L 3FU8A 4MMYB 3BW9A 4O02H 4A2FA 1BFOA 4P57A 1LO3L 1JVOA 1QHOA 5JOEA 3QIBC 2JLPA 4BK4A 5I26A 1TSHA 3EO9H 5E8OA 3FT2B 4Z8FH 4R7VA 4LEXH 1OAKL 4NENB 4QCIB 4WWID 3PGFH 1DJHA 1BF5A 1ADQL 1DSWA 2QPDB 4UT6L 4ZQKB 5KANG 5I1CH 4PJDF 5TDOB 3OMAB 1NPUA 2K8QA 4KUZH 5B4MC 1MIMH 5E94A 1R3JB 2A74A 3BD5A 5DR5L 3KBHE 3RFZB 4H0GA 3CC5A 4WK0B 4FLRA 4PG9A 2W07A 1PJ9A 3F00A 2DQCH 1IKNA 4R0LB 3JWOC 5EEYA 3UO1H 4WEBL 1ACXA 1LD9B 2OSXA 4AZUA 3I85A 2CDEB 1ICTA 1QYGH 2DD8H 2LGNA 2D7TH 4YVUA 3JWNE 4M5YH 5FGCB 5IVZA 3ZKSD 2UZYA 1SMAA 1O6SA 2MNJB 2AABL 3Q13A 4NZUH 1BHGA 4QJ3B 1ZE3C 4F7TB 1CT8B 2EH8H 2NLJA 2I60H 2UV3A 3AAZA 5EZOL 5IQNA 3CN1A 4GIOA 4ZZFA 2M1KA 1N2RA 2XG5B 3L3DA 5D7IA 4U6TA 3RUGA 5I8CA 1UWFA 5K9OA 1IEBA 1X4ZA 3MGOB 5H4ZA 2IG2H 1YQVL 3OKKB 4N2OA 2C9PA 3LRKA 1VENA 2IFFL 1VA9A 4UT6H 1TO5A 2HT3D 2CGRH 1CGSL 4HIJB 1E7UA 3LB6D 3BUIA 3NABH 1MXDA 2PPFA 4BGLA 3KYMB 1M7IA 3BWAB 4JQIH 3FTWA 5JHDE 4FYTA 2XETA 4URTB 3MODL 5I6LA 4UU9A 4OGAC 5E9DB 3ZKXC 4OV6F 2EVIA 3DECA 3HS0C 3CDZA 5GS2D 1ZEAH 1CZ8L 4AL8C 5KZCD 4OLUH 3Q3GA 1NFDB 2IPUG 3H3KA 4AZ8B 4PJCF 4Y19D 5B1CA 2W9LA 3N3EA 3LZRA 1CTMA 2YAMA 3RPBA 1ZGLB 1DE4A 1HSBA 3I02B 3ZZ1A 3MJGX 1YPZB 2A6IA 4J3BA 1QWNA 3JZ7A 4XN7A 1FVDA 2PWGA 2OLDA 5HYJD 4MHHG 2K6YA 4RGOH 4G7RB 2CR0A 1EAPB 5D7IE 2X89D 2VUOA 5FR3A 1KIQA 1TKWB 4KC3B 3BUYA 4MQXC 4NQDB 2ZUWA 5BOJA 2JCCB 4B9IA 2HLFC 1IAOB 3BYTA 5D71L 5DS2A 1E8ZA 3SYQA 1PIFA 5IQ9B 4HBQA 1BJ1H 2MKWA 3Q01A 5HYSA 3MV9D 5E0QA 3K4AA 4P5MB 4I7ZC 3WAKA 2WBJB 3CV5A 4M5TA 3RIAF 2PYEA 5DWPA 3NPSB 1KCKA 4LXFA 4NZ8A 1GY1A 3KCWA 1IQWL 5K9OB 1VAHA 4UUJB 5IB5A 4BEIA 2Y9RT 3TBVB 4HSQA 3CSYA 5CLZA 3T0VA 5K1NA 4FD0A 5LNDA 3RHWF 2MIZA 4G7QB 3U1SL 4MJ6A 2QBWA 3O0RH 4MAYC 3BZFA 3NRPA 3RWFB 3NAAH 1YNLL 2R69L 1CBVH 2LFGA 1EFXD 3J07A 4G8GA 4HJTA 4U05A 4G6JL 4GKSA 3HNSH 4LHQB 1HOEA 1IFGA 2BIIA 4QXTA 2VW6A 4TUUA 1SFHA 1S7UB 3HZKB 4XBGB 5FUOL 4P2YA 4M7LH 4XHJC 4JRYA 4Z5RA 4XC1L 2R23A 2AJXH 1OAYL 2CALA 4UOW0 1UXLA 4MLIA 5EU5B 2BPBA 2CSPA 4HIEB 3QJHB 3F7YB 4FMVA 5C0BB 4FE9A 5CUSL 3MRLB 3EYQC 4UQIM 2F8VA 2GTWB 4LKCB 2NX5A 2H7WA 2K7QA 1OGTA 3LHAA 5DK2B 4DGVL 3MXWL 3WFBL 2NY3C 3DMMD 4HJEA 5CU9A 4OQTL 4IBQA 2V33A 1NGZA 3CSFA 3STLA 3IDNA 4AGLA 3DRTB 2Y06H 3P2BA 3GT6A 5ANMB 2VLLB 3IAGC 4KZEL 1XMWA 2BP5M 1WIUA 2Y36L 5DFAA 3U4BL 2D03L 2RFXB 4HS3A 1JZ5A 3NEXA 4QOKB 3WFEH 3FFCB 3QI9A 4UTAA 3LIUA 1D7DA 5SX4I 1NBYB 3BPCA 3P4MB 4O2FB 4FQXA 2FHCA 4N2BA 4NQXA 5GSVA 2D3LA 3BDBA 4OGXH 4PJFB 2F8XC 3MJ7B 4PTUB 2K0RA 3V0EA 1JGIA 5GGRB 4XC1H 3QORA 5FF6A 1J9TA 1HZKA 2X41A 1TJXA 1Z66A 1QBML 3JYCA 1BZ9A 4FKHA 1KIPB 2BOCA 5AG9A 2JXMA 2R2HA 1F58H 3QR2A 4E9XA 5L7XL 1L9PA 3GHBL 5CHNB 4A7QA 5IV2A 3IU4H 1QG3A 2H47C 1ZV2A 2YD5A 5F3BB 1QPPA 3QJUB 1YEWA 1CR9H 1QEXA 3MQIA 2V8MA 2Z8WC 1NCHA 3ET9F 4QHMB 3RL1A 3FSAA 5FHBH 3VH8G 1NMAH 2X2UA 4OB5H 2WQ8A 1EO5A 1ZHKA 4BCXA 4RAHA 4YBQD 3ZRCC 3ESVF 5JIKA 3QQXA 3MRFA 1VZGA 5KEZA 3C5SB 4P2QA 4WTQA 1FG9C 4YR6B 4IK6A 3VX0A 4HUUA 1RZIA 2D2CC 3WS3B 1O9WA 3T6QC 3T09A 3TV3H 5DLML 4EPSA 3U0WH 1GGIH 4GRWF 3ZR6A 4YS4A 1R1CA 1LVEA 1Z5HA 2KS0A 2QGEA 4Z7NE 2MTPA 1Z9SA 3BN9D 3R1GL 1SBBA 3TO4C 5DC4B 2WVUA 1P5UA 4L9LA 3FTUA 5HSFA 1B0WA 2J6WA 1HDMA 3WFDL 1BJ8A 4GO8A 4WJ5A 2Y7SA 1N19A 4K3DL 1Y6KR 5FKPB 3SKMA 3HE7D 4MJHA 4KH2A 1NFIB 1MW2A 1TMQA 2C3GA 5DFVD 3ESPA 2EDKA 4UNUA 3BE1H 1EHAA 3PDGA 1CGXA 4F93B 2BP3A 4PGEB 2WLIA 4KVCH 2IF7A 3HPLA 5D70H 3GIVB 3MNDA 3TO4A 1G87A 1HXYB 2LE9A 3HUJB 1IKFL 2YPLB 5GSRA 4IOIA 1IBHA 4PRAA 3H55A 4WFFE 1F8TL 2R4RL 3SPGA 2KZWA 4LAJH 3ARBD 3IMSA 3ZZQA 4YDJA 4AQOA 1JGEB 4LCWB 2H6PA 3OKLA 3ABGA 3SO3C 1FORL 2WSKA 5CFAA 4MWFA 1S7TB 3QZWG 5B38A 3R1GH 1A2YB 1S7XB 1IRAY 3HNVL 1E28A 2OMTA 4YO0B 5I5RA 1KLGA 5D6CA 2CLVA 1D9KA 5EO1A 5CMAB 3I74A 1F56A 3OLDA 3AS3A 5GRXG 1T66D 1WZ1H 1KF9B 5I15H 2ZWZA 2AXGA 1A4CA 3DURB 5KAQF 3ZX1A 3T4AA 4MCMA 2YKKA 2AKRB 3D0LB 1B2WL 3EH3B 3L3DB 1Z9SB 4Y4HD 5D7IB 3QYNA 2ZUTA 3FN3A 4YPGB 2ATPB 2X4UA 1JZGA 1QP1A 2O5NA 2OS7A 1Y18A 3I9PA 1R5WA 4K5OA 3MLVL 2CMRH 5I1CL 2ZAHA 4LRNH 2BJML 2CKBA 3REVA 1TO4A 1E5ZA 1DR9A 1U91A 4ES9A 3FKUS 2ZXDA 5C6PB 4I0PD 3VFGH 3L5IA 1SJEA 5AD0B 3CSTA 4A39A 1DBKL 3MV7A 2XYCA 4I85A 1KB9J 1PG7H 1UGNA 2PWEA 2W80C 2MJWA 5JXEC 3V4UH 3AT8A 3G7TA 4ODBD 4G42A 4HSCX 5C0DB 3QQ3A 4GG6E 5JHBA 3A6BH 1IU1A 5TDNA 4QGTA 1KFGA 1FNHA 2A9MH 4YXHH 1IGTB 1XTMA 1DQVA 1KJVB 1JOIA 2A9CA 3EOAB 4BFFA 1JAEA 2JCCF 3BSHA 3DDFA 3EUDA 4FFWC 4IEFA 3D5OF 2VXSH 2NCMA 5BS0D 2I9LA 2ZZUT 2V8LA 4YHNA 2X7LB 5FA4A 1KIQB 1QLFB 4IKLA 3CFCH 3M1CA 1TEGA 1HHIB 4DEWA 4OIAA 3Q5OA 1Q72L 1WBYA 1LGVA 4PJHF 3ZYOA 1HOCA 1U58A 3FB8A 3QNXA 2AK1H 2VDOB 1ZGLA 1H9DA 1FO0B 2KDYA 3ORJA 5IEHB 2AKRA 1AHKA 2CM6A 3D0LA 4QTIL 2WWMC 2C34A 2ENJA 4NKOB 5EBMA 1BD2E 2XY1A 1IE4A 1RUAL 4HQQH 3RA7H 2BSTA 3NSCA 1UTDA 2E76C 3H42H 4AK1A 3MRMA 4JE0A 5HI5C 5KW9H 3OKMA 3V4VL 5HTSA 2QPEB 4AIZA 2NZ9D 4PWHA 2XZQL 3L1OL 4K3JH 1XCQA 2ADJB 2A6JB 1TITA 2DLEA 3R4DA 2JKNA 5I8OL 1QFPA 4XHQA 2H1PH 5I8KL 3DX2A 4YWGL 3D2UA 4Q2ZA 3SDCB 3SPVA 1EFXB 1OY3B 2YQGA 2CPUA 2Z93A 5HYJA 3TNNA 3PQYE 4BCYA 2CBPA 1MZZA 1UM4L 5DUML 4R2GB 3FRUA 2AK1L 4HAGA 5ILTL 1NLDL 1XSOA 2FBOJ 5I19L 4NM8L 3D3VA 3O2VL 4LLUA 4HSAC 4AQEB 3HG5A 1F11A 1YMME 1OTUD 4X4XA 2X7LA 3GSVB 3L3HB 1MIEH 3FUMA 5D7EA 3TYGH 5G5DA 4TRPL 3HZVB 2D4FA 1Q9KB 5EZLA 1JGVH 3S7GA 4I77L 5TJWK 1EV2E 5CKGA 3QWRD 2B1OA 4NKIH 1J05B 4XWOC 4X83A 5JIHA 2R1WB 4QHKJ 5LXGH 1QNIA 4CW1A 4NC2B 4RGNE 4Z7AA 2VDRL 1WA1X 5DS8A 2VQUA 1D7BA 1WSST 1OB1B 4MS8D 3VGAC 3VXRB 3VSVA 4U7MA 1DCLA 2X0UA 1E4HA 2VSMB 3OGCB 4M8VA 1JZ8A 1NEUA 2ERJB 2GSMB 2R7EB 3PL6C 1H3GA 4KJQC 3RVTD 3FRPG 4JRYD 4RGNC 4BZ1H 3MGTB 4WWOA 4XBEL 1N59A 2YO3A 5C86A 4M1CC 4GO9A 4NCC1 4U3XA 4WO4D 4WIQA 4UOQA 5JIPA 4J4PC 3OAZK 2HT3C 4QHMA 1MFDH 5IROA 3E7JA 2VCOA 4RMQA 2BM3A 3BH9A 1KBWA 1DN0A 3C60B 3B8SA 3CX5J 2LR4A 4JPVH 2HFFA 4BFIA 1CD1B 3B37A 5EPMA 3C08H 4ADIA 5FYLH 2GCYA 1BXVA 1KOAA 4KJPD 4EQ2A 3C87A 5E7BA 3WFEL 1W8OA 1JK8B 4EN2A 4C59B 4A67A 5CXPA 1F02I 1L9OA 1MVFA 3GRBA 1QFOA 1E6JL 5E03A 5L8KB 1SJXA 2WLZA 1VHPA 3L3HA 2VN5A 2WY3B 3K6SA 4RFOL 2NXZB 4MZRA 3KPOA 3LMJL 3VFWB 3QEQD 4DOHE 4LNRB 5DTFB 4HZLA 3C6SB 7FABH 2OCFD 1A1MA 1PX4A 1U8NB 4C4BA 4H0IA 5LQBH 4X6CA 3FU9A 3BEWB 2J6EA 5DZPA 4H0HB 2YEQA 1GSMA 3NGBC 1MPAH 5FHBL 2QQNH 1U8HA 2X44D 1HS6A 4OGYL 5DWUL 1UOVA 1CF8L 3DIVA 4HU8A 4YHIA 3QORC 1BMWA 2DB8A 2Q86B 2ZYHA 4AGPA 3UDWA 3QUMB 3GMRA 4L48A 1GS8A 5BVJB 3ETSA 4OJAA 4KJWC 5KVDL 5D2LB 2OTWA 4WWPA 2XTSA 3RHWK 3WKQA 1THAA 2ZXAA 5BRZD 1HH9B 1SOSA 2QHLA 4EDXB 1TZ8A 3TLRA 2N01B 2PO6A 4HV8A 1E9OA 5D7JB 5JHLH 4WHTB 3MRQB 4FZEL 4M93C 4O51A 2HVJA 3I6GA 4AYEC 2VDOH 2HCZX 3QA3A 5HJBA 3WHXB 1KXVA 5C09B 4X6DE 4YOKA 3KYNA 3IDYC 2B14A 2P8PA 1G7IA 4AJVA 3T2LA 3NN8B 2B4CL 2BFGA 5B3NA 3O6KH 5ESAA 2APVA 3MUHL 1KIUA 3DVGB 2VQ1A 1HHHB 3UBXA 3O9WC 4JY4A 1UASA 4UQAA 1MCWM 3CHOA 4XB8A 1KLGB 4XT1C 4H1LA 1D9KB 5EO1B 1SJVA 2EKSB 4APQD 4Y5YC 3QJFB 2V4LA 2WQWA 2HAZA 1W0VB 5CJ5A 3D12B 5HPMB 3BDYL 4MLSA 2ICEC 2FLBT 3TJPA 5EO0A 3NJXA 2ZKHH 3RWEB 1P5UC 2PTVA 4ZW5A 4Z0XB 2ICWA 3Q05A 5A7EA 2O1AA 3PWNB 3HLAA 4CN6A 2R2BA 2UZXA 4NAJA 4DP9X 1IGIL 3GSOB 4YHYC 1NEZA 5HXMA 1R0AH 2ZPKH 3N1GC 3QUXC 1DSYA 1YZZA 2FH8A 4P9HH 3TTYA 3VQ1C 3EYFA 4KK8C 5AKTA 4WFGD 2OX5B 3DI3B 2HX8A 1P4BH 2PYFB 2BERA 5D7JA 5DMJB 3SEPA 1KTLA 4YGAB 3HR5B 4MA8L 5D1XA 1IAMA 2P45B 4XCNA 3KGTA 2OYMA 2H26B 3E3QC 2C3VA 1I8KA 5IBUB 3B7TA 2FWOA 3BEVB 4M03A 4ORZC 4PRNA 2Q87A 2VE6A 5JHMA 2ZXQA 1IAKA 1G4MA 3MXVL 4GNKB 4K8RL 4XNMA 1H3WM 4N9OB 4PRIA 4LLAA 1XB8A 2CE6A 1EHXA 1CDJA 4HH9B 4LOFA 5FECB 3ZBMA 1MVUA 4LLQB 3EO1B 5D2NB 5FA4B 4YHNB 1FNEB 3BP6A 4OFDA 5E6ZA 2KQNA 3LSOA 2WGNB 4WUKL 4QT5B 1YLBB 3S3JA 3X1FA 1WZAA 5A16B 3ULVH 3FTXA 3TX4A 1Q9OB 4NYLB 4X9BA 1WBZB 3F58H 3DHJA 5E94B 2YGOA 1D2OA 5ACZA 3VNZA 3ARGA 1KLFB 4MVBD 4XBPB 2FJFA 3NQIA 3O6FC 1FZMA 4ALAC 4AYGA 5IMOA 3FQXB 4GXVH 5T5FL 3TL5A 3P02A 1I85A 1OP3H 1JHLH 1IEHA 2EYRA 2YKLH 5FK9A 4FERA 1B9ZA 4DQOL 1D5ZB 5IBTL 5ADOL 2CO1A 4LHUB 4NUGL 1CDBA 3MXVH 1CLCA 1G7MB 3G5XB 1G9NL 4ZNEA 3IE9A 3MOAL 1KTLB 1P4LA 4L1LA 4V1DA 5BQ7A 1SY6L 4ZFOA 4F3FB 1XGYH 4PRBB 5SV4A 3C9NA 4KNQA 1C5BH 3ZN6A 3I6SA 3FRUB 1CTNA 4WU5B 4U1LA 1A5FH 1J9CT 1AGBA 4XMZA 3MYZA 3KPSD 4XN9A 4PJIA 3OZKA 4HIJA 3SOBL 5G4OA 1EAJA 2OK0L 4KY2A 3N1MC 2YWZA 2QSCH 4A2HA 4HC1L 2EIKB 5CZXC 1IAOA 3T2OA 5C08A 2ICES 4LLDA 4NQEB 3MFFA 3MLXH 3LZLA 3HI5H 4N26A 2HYMA 4IRZL 3BOVA 2UWEE 1J5DA 3RLSA 1JVKA 4RDQF 1H5BC 2AVFA 1QSFB 1TZGL 5DJ0B 15C8L 2NY2D 2DQGH 3RY6A 5EN2A 3CD4A 5TGBB 5BZDB 1THCA 2AK4B 4R5VA 1XL4A 4CJ0A 2MMXA 1SY6H 3BH4A 5C0GB 4J8RB 3QG6A 4I0PB 5D7KD 2HJKA 4WFHD 4NI3A 2EP6A 3E8UH 4PIBA 1FCCA 1FZKA 2Q20A 4OLZL 1TUPA 5E2WL 1USZA 2X9WA 3FQTB 3EJZC 2PLTA 2K70A 5C0AA 5I0DA 2ARJA 4WCYH 5F97E 1VKXA 1BEXA 3FB6A 2ZKYA 3QIWA 2Y24A 1RZGB 5DEGB 5JZ7C 4XB7A 1MLBA 1EAQA 2E6QA 4JFEE 3PNWA 3QDHA 4B5EA 2K4WA 5FW6A 3VE0B 5C70A 1AGBB 1X9UA 4A7TA 2AQ1A 3BGAA 1GGBH 3IGAA 4M8UA 5A7BA 3W1ZA 4TUJB 4WO4B 1DSFH 5F9WC 5J06A 1TU2A 3KPMA 5T1LA 1OK0A 3CUPA 1YEIH 4HIXL 5FS5A 4KKCD 1B4JL 1S5HB 2HRPH 2DBLH 5HJ3B 2DMCA 4JRYB 4KFMA 1WUNT 4YHKL 4L0PB 5CR8A 5E08L 3BI9X 3L3IB 4M5SA 4TSCH 1KDJA 4M48H 3LH2L 4P59H 1LP9F 3J7HA 3ROOA 5F7DB 1WT5C 1G7LA 3JTBA 4X6CB 5CIPH 3GK8L 5DI8A 2MTAA 5DJ0A 4HZLB 3IAPA 3IDJA 5E2UL 3IJHA 3RTQA 3AQYA 4TNWK 1GAFL 3ULVC 1FZOA 4OQ1A 5A40E 1MRFH 2JXMB 1E5UI 1P4IL 1JTTA 4Z7VB 4B5ZA 1I31A 4HBCL 1YJDH 5TK2A 4KHXL 5EU6A 4HIIB 4P3DB 4TQEH 1OLZA 4FOMA 3FU3A 1KCSH 3SE3C 3ZDZE 3FNKA 5ESAB 2OM5A 3FQTA 3DV6B 1NCDH 4PJ7B 2YN5A 3TA3D 5GJSL 4HMDA 3CSBA 1AO7E 4R2GD 2A3TA 1JGUL 5GXBB 1YEIL 4HIXH 4Y2DA 3VUAA 4EOWL 3EIFA 2EIEA 4F58L 3WNNA 5E8OB 2A77H 3QA3B 4DOHB 1RUQL 4L8CA 4BM7A 4DKAA 5KN5B 1A7QL 4QRPD 1TTAA 1RFDH 3VTAA 4Q0XH 4J6IA 2P8LB 3N55A 3FHQA 4LCYA 2EXSA 1N0LB 3FQWA 1XH1A 3U6XA 3AMKA 1AHWB 3UZVB 2J1ZA 2XN9E 1R3JA 1SDAB 2GJZB 3OAUH 2KPWA 3TBWB 5HPOA 2DTMH 3N42B 3SD5A 1S9XA 3MLUH 2VDNH 1JMZA 2OMXB 3G5YB 5CBEA 3U30C 3QFJD 1KJ3H 3IMWA 1YEDB 3D07A 3ARGD 3O81A 1V7NL 4H1LB 4EZJA 4DUVA 3RWHB 3ARZA 1S78D 4FAAB 5D2LE 1MQ8A 1MHHB 3ATFA 3PY9A 4G3YH 1FL3B 5KJ7E 1CICD 4U6YA 3D85A 4CNIA 1JTOA 4UDTA 1ZA3B 5DD3H 3HS0A 1BM3L 4NO2A 4WEBH 1GYAA 4FEMA 1IM9A 3HJEA 1ET8A 2VZTA 3VJ6A 5C0FA 3PV7A 1AG6A 1JNNH 5H4YA 3RWEA 2DJMA 1HAWA 2HVBA 4QIRA 3FTYA 3V0AC 5HGAA 3KBEA 4Z3GA 1GRWA 2F58L 4Z7NF 2FUQA 2CQVA 3RRQA 1VFMA 2CK0H 1NFIA 3WS6A 4XO4A 4HH9A 3EOTL 4V2BA 1SJMA 5DEJA 4ONFH 3BQVA 3OAUL 3FYEB 1SN5A 3HG1A 4IRSA 1VADB 2FSDA 1KTRL 3CTTA 3IETB 1U92B 3GBEA 5FIEA 1ONQA 2CIIA 3QFJB 3ECQA 2QR0B 3FO0L 3V55A 2ADIB 4N25A 2FT8A 3GJFB 1HILA 1Q9OA 5EFIB 4KH9A 1DQKA 3QE5A 1T3FB 2IV9A 4NC1C 2VDPH 2AGJH 3D69B 4OZFG 2HFTA 2ZIDA 2F74A 4PG2A 5GGTL 5H2BA 3WUZA 4RAUB 5I1JL 3WNLA 1ED3A 4W4NA 5HGDA 1OTSC 4EE2A 2FWSA 3FCSB 1KPVA 3DSNB 3GSWA 1Q90A 3RI5F 1KCUL 4M7KL 3TT3H 3IMVA 1C5CH 4B9GA 4FXGC 2R8SH 2GK0A 3MRKB 1QMUA 5FXCH 5DMKA 4JM0A 1TZIB 1L0YA 3PABB 4BK5C 1U3ZA 1ZVYA 2WBJA 2OP4L 1F1AA 3DURA 4XRCB 3FJTA 4HEPG 3FXIC 4CC1A 4Q9QL 3FQUB 2YZ8A 5ENWA 5IKCA 3LKSB 3T08A 2PXYC 1I8LA 1Q0YH 4Y5XB 3QWQB 1NWOA 3PQYD 4LOEA 3S35H 2WZ5A 1UD6A 3QUXA 3TNMB 3OQ3B 3U25A 3CBJB 4AIEA 4ERSH 2J56A 3OPZH 3NACL 5F7MC 4ACPA 3IS1X 4W4OC 3MUGA 3CZGA 3QO1B 2IALB 2VDPL 4L3EA 2ZOLA 2WJ7A 4J6RH 2UUDH 3UC0H 4CAGA 2K78A 2I5YH 3WKNA 3F7KA 3CE1A 5DVKA 4Z7IA 2FATL 3DSFL 3ETBJ 1TLKA 2Y7OA 4LKXB 3EADA 3INUH 1AZBA 3I6KA 2HP4A 5KZCB 4K7FB 1SPDA 1LP9E 2O5ZH 3T6XA 4PJGB 5DFWH 5L88L 4KV5F 5I2IB 3LRMA 4O4YH 3NJMA 3P4NA 4YSAA 5JPMC 1RJCA 2L4OA 4CVZA 4A7GF 4APQA 3TBYA 5E9NA 1K8DA 2HKAA 4HF5H 1VZHA 2XBTA 4WWKB 2VRQA 5E23A 4OF8A 4ZX3A 1KXTB 4NRZA 1CUOA 1ECZA 3DGGA 3TCTA 3U83A 2V2TA 3L4XA 2XV3A 1TZIA 3WJJA 1J86A 2DKSA 3PABA 5LBSL 1AXTH 3QDMD 4B9FA 2IGLA 1FO0A 1CBJA 1HN1A 1P9MA 3DGCR 3D9AH 4J6RL 3L9RA 4HGKC 4GAYB 3SGKC 3UC0L 2IAMB 1KGCD 1T80A 3NJVA 4L8SA 2C4FU 3MLXL 4KKCC 5C0GA 5IOPB 1U8IA 5EORL 2UZPA 3V2AR 3KPNB 1CURA 3QXAA 4OZFA 1OGTB 2OZ4A 1XGUA 3IJEA 1ZHLB 5GS3A 3EYVA 1FH2A 1P1ZA 2H32H 3ASWA 4O2CB 1OAXH 1S2EA 3RKDC 4PJAB 4BKTC 1IFRA 1NGPL 1VEOA 1X5YA 2QT6A 2E0PA 2QQKH 5EU6E 4B41A 3D30A 4OCLC 1TJHH 1MHCB 1P7KA 3ME0A 2YPVH 4QRRB 4GW4B 2J7LA 2QADB 2CXKA 3PG2A 1CFSB 1Q1JL 3I2CL 2AQRA 3BVDB 1PW3A 4W9KC 3X3GL 4OIIH 3RDJA 3TN0C 4UYQA 1YY8A 4YDNA 3ZL2A 4DQAA 2HTLC 2NY1B 4LCIH 3CBRA 4OTXL 5HHME 5GHWL 1B4LA 4Y1SA 2EE3A 3PAVA 1F13A 3PUUA 2FUTA 3MR9A 5E8PB 4YFLF 4XCCL 3MGTA 4R4BA 4EAEA 4X98A 2CDGA 2VJ0A 1M53A 2WK2A 4Y5YB 2J4WL 2BSCA 4RX4D 4WI6A 4XN5A 1GGIL 3ZL1A 1YMHA 4JPQA 5E6UB 2J5LB 2X88A 1EIBA 4MB5A 2YXVA 3COOA 1A1OB 1WICA 4N85A 3W39A 4YDZA 3BUBA 4P2RA 4BQCA 1F3DJ 5IP4A 4TQIA 4P59L 1U9KA 1ROCA 2FT6A 3KVPA 5MERB 3GMPA 1BYPA 3PWUA 3I84A 4JFED 3KWWA 1QQDB 2YSSA 3I2CH 1NBQA 4WTXA 2VYRE 3DX1A 5C0AE 4AEEA 4DGYH 1F3RB 2AEQH 5A6LA 1HWWA 1YEHL 3LN5A 3T0ED 3EYVB 4GQQA 4YLBA 1AHWA 1CJYA 1QTSA 1DP0A 2NY0B 2PCPA 3UZVA 2VZVA 2AXJA 4G8FB 1EEYB 4ZSOA 1PZAA 2Q2EB 2HVKB 4G43B 2FR4A 1U8LA 2N59A 2ZP0T 1A1MB 3O0LA 5IFAH 4L8CB 2JKTM 2Z4QB 3KW7A 3BPNB 2YK1H 3QARA 3PHAA 1TFPA 4X8GA 4Z7UE 5DR5H 4ZXBA 3GI9L 3DX6B 4HG4J 4R4FL 2HB0A 3CHPA 3IDXL 3HS0B 4NO2B 2GSGA 1PLCA 1EMTL 3T0EE 3PLYA 2Y1VA 2A77L 4N2EA 4QTFA 3FSVA 3UTTE 5BO1H 3C5JA 5GRWA 2DJSA 3LB6C 4TULH 4KRMB 4AY0A 1DTUA 2WXKA 4W68A 4DZBA 1MNNA 5AW4B 1OGAB 5EUOF 4U1SB 4I3SH 1LJMA 5FGSA 1DQDL 1ZHBB 3G5ZB 2AJYL 4U1GC 4PJ7E 5DGQA 3ES6A 2COQA 2AF2A 4KX8A 4BWTA 3ZTNH 4ZMWA 5J9PA 3TEZA 4UTAH 2BVEA 1CWVA 4NDMA 3TO2B 4ZT1A 1GC1L 3VI4E 3VJ6B 1JGLH 4YNYA 2WVVA 3RWJB 1QFWH 2X2IA 3G6AA 1VSCA 2BVOB 4D94A 3HC0B 5E9DD 4FI7A 3GJFA 4TN9A 5BMFL 4U1KA 2WLHA 1NAML 1IBYA 1VACA 3IJYB 3QC6X 2CO2A 2EXYD 2NY1D 4BZ1A 5TQ2L 1ET5A 2XACC 4I5BA 4YDIH 4H13C 3ZT7A 4KTEH 3UTTA 3LKOB 4QCIA 4L0YA 2G2RB 2QADD 1ZK9A 2A6KA 2Z8SA 3MRNB 2YQ3A 2A74C 3IPBA 1HEJC 1JF5A 1RUML 3MACL 1DQDH 4EKXA 5E24E 3V95A 3BO8A 4MGXA 4OZFH 5JOPD 3IFLL 2B1AL 4GSDL 4L3FA 4S1SH 5E2JA 3PDDA 4WI9A 1P2CB 5C0NC 5AOIA 4GKLA 3G6JF 3QIBB 3AC0A 4E42A 1H8SA 2Z0UA 4XMVA 5D2NC 1T2JA 2NQ3A 3GSWB 2MOVA 3E6HA 2WXJA 1NM4A 2ZXCA 3IMRA 4RGMC 3RPIB 4DO6A 2P28B 4GW1B 1PU0A 4K9EH 3BCFA 2HG5A 4U6XB 4JFSA 4ODTH 4EO5A 1MOEA 3CN2A 4B27A 1CFBA 5IHHA 2IAAC 2IDCA 3VXPA 2ITDB 5IF0A 3LZNA 3GS4A 3B43A 1CFVH 3MLSL 4DP5X 2VXVL 2CDFB 3HC3H 3F7VA 3QJRB 2M83A 2IQAA 1UGKA 3BP4B 2J88H 2J1KA 2WZ6A 1IGJA 2WZ0A 5IW6A 2QPSA 5MP6L 1SVZA 1A6UH 5BXFB 1S5IL 4CC4C 2DIBA 2BSTB 3T3PE 2K6ZA 4AQ1A 5IQ7L 5L2JB 5CLXA 4OFQA 2X6AA 4PG2C 4L23A 4U6VL 3EJQA 2EICA 5A2FA 4RRPA 1RURH 2Q3AA 3EO1A 4HJJH 1YNTB 3HN3A 4UOZA 3IAQA 4YE4H 3WKML 2BS71 5KVGH 4MD5A 2NLJB 1DUYA 4N24A 2HTLD 2VW4A 1NIFA 4ADJA 4Z77B 2CJUL 4K9EL 3QIBD 5EB9A 4IU2B 4NM8H 2C3XA 2BWQA 5KSAB 5J57B 5K39B 1Q9LB 4ODXB 3N1FC 1UZ8A 2FWOB 4O00A 3X13B 4LCCA 1FG2A 4PJCE 3Q2NA 4Y1AA 3UAJA 4DNLA 5IK3B 2H2SC 1FLRL 1HZHH 2AHIA 1SBSL 3CMGA 3L3OB 43CAB 2BNRD 3WSQH 1CFVL 4ELME 1B4TA 2XZAL 2UX6A 3CDCA 3PQYB 3OB8A 3ZTDC 2X4NA 4M1CD 4MXQC 4B3VA 1TKWA 1E50A 4ZI8A 5LXGL 3KBFA 1XGTB 4J4PA 1Q8MA 4KVNL 2EDWA 4HJGA 4O2CA 5IEKA 4PYHA 3CQFA 2DKUA 4L4VE 4QT5A 4FG6D 5I30H 4PRHB 3W0WE 5LCVL 3TURA 5HY9B 1BV8A 3N44F 1PZ3A 1UJTA 4AYSA 4E9LA 4GS7B 5AUMA 4LP5A 2B15A 1B4RA 1P84K 1G9NC 1Y7VA 1U8IB 4EI5B 3GSNH 3ZMRA 5DC0A 3FH8A 4PJHB 3L8QA 4IDJH 3MU3A 2GTZA 4KUCD 2YD7A 2JELL 2FYYB 3FUFA 4NX0A 5IVOA 4BSWB 4C56A 1OW0C 2Y06L 3FYIB 5KYWB 4ALAL 1KEMH 2GJ6E 2WNXA 4KOCA 3FCGA 3V4PH 4U1HA 4Y4FA 1A22B 5FYJH 1SBSH 3P9LB 2P7TA 4MMXA 5HYSB 3ZDWA 2BSDA 3ML8A 4P5RA 4P3CH 5CD5C 3AS0A 1DBMH 1HL8A 1AD9A 4TL4A 3GUTB 4IMLA 4KKRA 4IU2A 4ZD3L 3MV8B 5F0MB 4Z95L 2HMID 2JJSA 4UIKH 2UUDK 2I9TB 2JKLA 2K45A 4ELKB 4NRYB 4ATWA 1BQ5A 1MHPH 1UCBL 4XWOD 1BMZA 2F7IA 3T0XA 4GRMB 3CFNA 3HIZA 4FTDA 2WXRA 5SWQB 2F7PA 1V10A 3JBG7 4LESA 3Q2WA 4P2OD 4H26A 5I66B 4ABQA 3F64A 1WZKA 5DO8A 4L3EE 5EU4B 1L0PA 2WW8A 3P0GB 3LN5B 3ROLB 2QKIB 4OGYH 5E1GA 1M3IA 5AWNL 4D0CB 4D9LH 2CA4A 3RPKA 2DIJA 1QVOB 4QRQB 3L7EA 3WIHL 3VVVA 2VC2H 1LK3L 3BUPA 3UX9B 3ZE2B 2P47B 1AOZA 1SLWA 1BZ9B 1CXIA 3T9WA 2BOLA 4QRPE 5C9KA 3BAJA 4M00A 2AS5M 4F5CA 3MGAA 3MMEB 1OE3A 3ZKQD 3DK2A 2WKLA 4KX9A 4EBQL 5BUGA 5FV2A 3FO9B 1U21A 2XXGA 3VXTA 4XZUA 1YNTF 2NYKA 3ARFA 3T65A 2Y5QA 1I3GH 1QTYT 5DK3A 4QOKA 2JCCE 1MNUL 3TVMA 1U3HC 3BVNA 2I7OA 1A3ZA 5E5LA 2EDEA 1WZ1L 4Y5XC 4BKLB 2Q1EA 2AEOA 5LGHL 3AY4C 3TN0A 3PWLB 2HVKA 1MJ7H 2NRDA 2Y72A 4U1SA 3I9IA 1YEHH 4EDXA 4Z3TA 2CO4A 5ISZB 3DO3A 1E9OB 5C2BH 1NKOA 1NGXB 3CX5K 4D9LL 3UPCA 4F7PB 2ZUVA 2NZ1A 4AENB 2KYIA 4FFTA 3SGJC 1NCAL 3C6LD 1G7QB 5TDOA 4Z7WA 3Q6GL 2F08A 2WO3B 3HE6A 5TFSL 4MCZB 3VCLA 3WELA 3EFDL 1DHKA 3NGBB 2EDOA 1KGIA 5T33H 3LIZA 5MEPA 1A4JA 3CNKA 4OLXL 3R06A 1Z1WA 1CLZL 3GSOA 4MBRA 2IAND 1BFOB 4P57B 1D5BA 1F2XK 4ELMA 2VZ1A 3C5SA 4P2QB 3D05A 4BCZA 3WFDH 4R0LA 1H9VA 5I5MA 3B2DC 4UF7C 2VSKB 3DOSB 4ZW7A 4NNXA 2Z31A 4F2MA 4RA3A 3VGEA 5HGGS 2O61B 1KIRB 5FOJA 2V2WB 3GXFA 3OR6B 4GW5B 3TGXA 1LO0L 3FO9A 2IDFA 4KI1A 1ZGLP 1S7SA 3RTLA 1CDCA 4P0DA 3F2LA 4JFWA 1I1RA 1MFNA 5AEAA 3DTXB 3W9EA 1ZAGA 1MCDA 4PJDB 1YEDA 5KVDE 3UTTB 5CZVL 3S88H 1ACYH 4QRBA 3UTTD 4P2OC 3RG1C 3GKWL 4OZGB 2YPVA 3PWLA 1H8NA 3NZHL 4HKZA 4I5BB 4PS4L 4PR5B 4BUGA 3WLWC 2K4AA 3HBGA 3NSXA 4XXCA 5BZWB 1BG9A 1QSFE 1BJ1J 3ZR5A 3K71B 4UMGA 3JTTB 1RUAH 3G9AB 2C4FT 4HQQL 5D96C 3RA7L 2VZSA 3BDYH 4K5NA 4JVPA 2Z8VC 4LCWD 4PRAB 1VGKA 1S9YB 1SMDA 4V2CB 1MJ8H 1OF0A 4K3JL 1X5LA 3MOBL 2LAGB 3ERXA 4UM8B 5DJDB 4PJBE 4PJ9C 4WUKH 3MZGB 1OGAD 5BQDA 4H8PA 3GSRB 4TKWA 3HLKA 1B2WH 2NUPB 3GGWA 2WGXA 3NFNA 5F89A 3KLAA 3DHMA 3VI4F 5KVEL 1HCZA 1RH8A 2B0SL 2EDRA 4JHBA 4LSUH 1OSPH 1W72H 2PP9A 1QSFD 1TQBB 4A6YA 4MAZA 1JZ2A 4YSUA 3H0TA 4GIAA 4AMKL 4DO5A 4JO3L 1AQHA 3HE7B 4M4RB 5FGBC 1NLDH 5SV3A 4JRLA 2Y2TA 1FFPA 1ITCA 4BV1A 3MODH 5LBVA 3BVWA 3WEXB 2G9KA 1ZLWH 4R4NC 1FL6A 2XJKA 1PG7L 1T04A 4UV7H 5FA3B 3AU1A 3DX8B 4OLUL 3DGDA 5J6HB 1RJYB 1WFTA 4ZPVB 3KCPA 2EABA 3VXUE 1R5IB 3FCSA 1WEJL 3KDMB 4OUOA 5EULV 3GBNH 4JKWA 4QNPE 4YXHL 3CLFH 3QUML 4ISVB 1S6NA 2XG4A 2FB4L 1UM5L 2GITB 1GZHA 4JL1A 1YEKL 2OQJA 3O3AB 4HJGB 1T6BX 1GGTA 3IF1B 4ODUB 2IFFH 4H1LH 2J44A 2W0FA 4HPYL 1JFQH 4IJ3C 4WTZG 4OSUH 2YQ2A 2MRYA 4G9FB 5DUMH 3GRWA 3L3OA 4JO4L 1KT2A 3HCVB 4X9FA 3WKMH 2DQFB 4E0RB 2ZSWA 1MWAA 2BDNL 3O2VH 3MRMB 5L8JB 5IK3A 1WGVA 5I16B 1FJ1B 1H6FA 3W11C 5E00B 3S4SB 5J0BA 4JFZL 2GK2A 3QPXH 4IOSD 4CSPA 4M61A 4IBVA 5AOKA 3WNKA 1GA2A 4X4YB 2X0WA 4HCGA 1UKQA 1SQMA 1JZFA 2I26N 5J8OA 1IARB 5MHSD 1L0QA 4WGVB 1J48A 4DESA 1FYTE 4M7JH 1OWWA 5K9KB 3QQNA 1P1VA 4HUXA 4LSVH 2XKSA 1I7TA 2ADYA 2AJXL 2E7HA 4F33B 4PREB 2W5PA 4H8WL 4XPHH 4N8VA 5EV7A 4BZ1L 1EO8L 1E90A 3BWUC 4NQCE 4ZAKA 2FNBA 1XWVA 1ZSDA 2EDXA 1RPUA 4ZFZA 1KYFA 5G5DB 1CG9B 4KQ4L 2DWEA 4DVRL 4N1EA 2QZ5A 1PEZA 1LDPH 3SD2A 4E9VA 1LE5A 1A3RH 5HHNA 3FFDA 3AJ7A 1D5MB 2NNAB 2D31A 2Y2WA 3K2UL 3OL2A 3W11D 1Z7JA 4GP4B 4HHAA 4U1MB 3K6NA 3M8OH 5TE4H 2HG0A 5DJ2A 3MJ7A 2FX9L 3RVWC 2J1YA 5DMYA 1NJ9B 5I76B 4J28A 3ARBC 3ZHDA 4K15A 3LXAA 3S36L 4HLEA 5H37G 1HJBC 1O7DE 4KTDL 3VTMA 1F4AA 1CICA 4NXKA 1EHLL 1S7RB 4IHBA 4A68A 4Z3IA 1OP4A 3CZUB 4N6RB 4Y89A 2BC4A 5FYJU 2DM3A 2W9EL 4M61B 4L9DA 2IPKA 5F3BA 1JNHA 4N5UA 3DTUB 4DZ8A 4NRZB 3RL1B 2P44B 1J8HE 2GBTA 4WJ5B 5FKPA 3UBGA 5L2KB 4XBEH 5HVGB 5BRZE 4XB3A 3F7PC 4PJ7F 3S8FB 1D9KD 2I85A 2DMHA 3IXTA 3V4VA 4QRQA 5ESQA 3OQRA 4BGDA 2ED7A 3RZCB 1I7TB 4ZUUA 3VFPA 5DDHB 3O6KL 4A04A 1A7NL 2BWDA 2J8UA 4JO5A 4OBSA 4XPGL 3UYOD 3D85D 4PREA 2CHZA 4TQPA 1KJ2B 3K2IA 1PG7W 3K2UH 2XNAB 4ODWA 2UXFA 1I1AC 1GOHA 1JGUH 2OBGA 1DQLL 1DUZA 2WIIA 1DQQA 4LCVA 3VFNB 4Z23A 2XA8H 2FX9H 4YPJA 5J13B 2YD8A 4QRTB 4F7EA 2XY2A 1N59B 2VC2L 4NAQA 5GGVY 5HHOE 5C08E 5HDLA 4RVBA 3E2HB 3QXDA 3MRRA 2K7PA 5EU7C 3CVIL 3FFDB 3S8WA 4Q0XL 2R0WL 1J1OL 1OHZA 1MFBL 4Y19B 3VFRB 5I1AA 4RZCB 4JO2H 3ZIMA 1R47A 4PM1A 3CJJA 2B2XH 3HN5A 2VLMD 4FZEH 5KSBB 3P11H 2XWRA 4PYGA 4D0DB 1JZDC 4R7LA 2EUWA 2WUCL 2GKIA 4JFVA 2FQFA 5EF0A 4FQIL 5FUCC 2ICCA 4N0UE 4R3SA 5AZEH 5I71B 1V7NH 1H0DA 3VFVA 2QV2A 3ULUD 2GJ6A 1VESA 5HHOD 3QQ4A 3VDBA 1CYGA 3P4OA 3DRQB 4XPGH 2BRRL 3V6OE 3ULVF 3APNA 1WD9A 2GY7B 3C09C 3SO5A 3L4ZA 4PV8A 5JZ7D 4OV5B 1NCAH 2F1EA 1UJ3A 3ZYZA 5C0EB 3BQUC 3VI3E 4L8BA 4JDEB 4ILDA 3RDTC 3E6FB 3QDGB 1RMFH 2NXZD 3LKRB 2P49B 1MWAH 2H8PB 1E2ZA 4GSQA 2DOCA 3BJLA 4ODWB 3B2VH 3QFJA 1JZJA 2XX1A 3MTRA 1AR1D 2WBJC 4ONFL 5D4IA 3AQDA 5ALCL 3TVMC 1NFKA 3V5HB 1FNLA 3V4PA 4L5FH 3UEZA 1EHKB 1N64L 1T1WB 5HDOA 3SCMA 5C8JA 1ZIBA 4QRSA 2BO0A 3GF8A 4M93B 3AWFA 3Q8EA 1EANA 3GSRA 3S96B 4PQXA 4X0NA 3F58L 3NRQA 4HEMA 4PRIE 5D70L 1FBIL 4DN3H 3KPLA 3RX8A 3SGDH 4QUOA 2DQHH 5BS0A 3UDWC 1WCQA 4LSPL 2P1YA 6TAAA 1RHHB 4Z7UF 3SPIA 4R0LC 3G6AB 5SWZB 4X42A 3WXWL 1YHPA 2VM4A 4P2RE 3DX9A 3NBNA 2XIBA 3QZWB 4OCWH 3SY0B 1WA2X 3L4CA 1K6QL 3LPGA 4QXVA 1ZWIB 4KJWD 4JL2A 5A2AA 4KKBC 3ZL4L 2BWIA 2QTVA 3EOAA 2C9AA 4PJAF 2K3TA 3MOQA 4PG9B 4WI7A 4GMSL 3U9UA 1RZKH 4UAOB 3T4YA 3MAWA 2BHUA 3A6BL 1PVHA 2EDTA 3B9AA 5A2BA 4PLOB 3PS6A 3KLAB 3RVUD 2AXWA 2EQDA 2WV3A 4OKDA 5JQ6L 2APTA 4M43H 4A6YB 4JFDD 4M8QA 4D7BA 2APSA 3DX7B 2ZKMX 4JQXC 5DURB 4ERSL 3OPZL 1CVSC 1U58B 2XDHA 4FN0A 4PJEA 4XXWA 4FL4C 4N86A 5IVXF 4GKOA 3HC0A 4HEPA 2WTRB 4ONOA 2DQHL 2XG5A 2I07B 3ARQA 5I24A 2HT2D 3TNNB 1JWMA 2CH8A 4B60A 4WKZA 1IGCH 1WCBA 3GUFA 3VGFA 3WY3A 1DEEB 1DBKH 1EGJL 4JPKH 4AEIH 3FU7A 4XMPL 2QMJA 2WYTA 4X50A 1SXNA 2XN2A 1OAZH 4LIQH 5JW4N 3C60C 1TNNA 2BSSA 1XCTA 1A6AA 1BZEA 1TYRA 1IL1B 1JPTH 4CMHB 1LO4L 4PLJD 4N2CA 1S7QB 5EA0H 3W9DA 4XCNB 4LSQH 2YAEA 1Z9LA 2H26A 2K9FB 1J05A 3HAEG 3CPUA 4ZSOE 2BY1A 1TYJA 2BP0B 4HWBA 1ZOXA 1R3IL 2A83B 3NJNA 4FQ1H 4S0TD 4Q9CA 3F8UB 1GYWA 4PBVC 3T1FA 1CU4H 1EAPA 5DJYA 3E6HB 2NZIA 4PJEF 4XR8C 4YWGH 4JN1H 4XP1H 2Z4TA 4OCXH 4UINH 3WNMA 1I7RB 4HUKB 2UXVA 2EVHA 4D0BA 3LIZH 1Q72H 4WLCA 4KBPA 4OSUL 5D1XC 4F80A 1IC5H 4ZUWA 4MAUL 4O02A 5KUKA 1M3JA 1NUDA 1NFAA 3PGCA 1SGKA 3P1VA 3WUWB 3LNGA 1OEZW 4RCAA 2NOYA 3VFOB 3X14B 2G5UA 1TZGH 2JNZA 4F91B 2MOQA 2BRQA 4WW1B 2E46A 1EEUA 1X6NA 1ZTXH 1MJJA 4ZTOH 3RWIA 1MCWW 4OIFA 4L3CA 5AVUB 3MLWL 1ORSB 3VA2C 2JMRA 1F3JB 3RI5K 5DS8B 4LGSB 4NZTH 35C8H 4J8QA 4JFTA 3HRZA 3CVHL 2VZ3A 5KBLA 4BFIB 5T8IA 3FUNA 2EYRB 1PY0A 5H37H 1QFHA 1T5XB 3QJSB 1E8YA 1Q1JH 4QRRD 5JMRA 1KZQA 5CINL 3GK8H 4EJ1C 4PV1C 5I6MA 4FFVC 3AXHA 4XX1G 1I3RA 4U2YA 1A6AB 1J1XH 3AUVA 2XPGB 3S35X 3VACA 1EAOA 4PJAA 3SKNB 4PP2A 2BVUA 4OF6A 2CG9X 2EDFA 2YAQA 5EF2A 4WV1A 5EOCL 1BQSA 4Z5RB 5BQ7B 4FQCL 2JSFA 4G7VH 3FTGA 4PJ5A 1IC5L 3ZU8A 4BK8A 1JHKH 4B9CA 3LY6A 1BW8A 3CU1A 3GXPA 3VM5A 1B3JA 1MF2L 2ITFA 3QCVH 4KDTA 2ZWKA 4K55A 1KG0A 4PW4A 2IAMD 2NX5B 2XWXA 3IFOB 5SX5K 2EH7L 3F01A 4ZNCD 1IZKA 3RNKA 4Z18A 2P80D 4G7YL 1QRNE 2GSIB 3SODB 4DAGH 4GSUA 3ZE0B 1PFOA 2YRPA 1ZTXE 2IH8A 3CZEA 2DLHA 2QQLL 1KB5B 1N5YH 3VG0H 4AUUA 1J88A 4UNIA 5EU5A 2YC1B 1RFDL 4B97A 3QAZC 3QDGE 4RIRB 1MLBB 4WW1A 1GXEA 2H45A 1J1XL 1E27B 2E8ZA 4XTRC 1IX2A 2KERA 2AQQA 3BEWA 3M17A 5I1GL 4JG1H 4E9YA 1QRND 3P30H 3QFDB 3U2IA 1MXGA 3V9CA 1MY7A 1ORQB 1DBAH 1OARH 3QCVL 4RBPH 5ANMA 4DVBB 5CNHA 5H35A 3A3YB 4K94H 1GKOA 2G2NA 1TF4A 3S5LA 3QEQB 3QQ4B 4CN1A 3VG9C 1E6OL 4IHOA 1ETJA 5DMGC 1E2VA 2OCJA 3I6LE 4KXZH 3S37X 3LKPA 2P5ED 4G7YH 2FJGA 4GRLA 5EOCJ 2XTJB 3OV6A 4PGZA 4ZO9A 1HQRA 3FB7A 2HKFH 4HA1A 3UTSB 5B7MA 3T6VA 1FYTA 3RZCD 1MW3A 1YVLA 4I48B 3QORB 1ND0A 4F92B 3IFNH 2EKSA 3O45A 1UYWH 4HCRH 4GT0A 5EC1B 1FO0H 2CU9A 2BP8A 4JZJB 5DK0B 3ZE1B 2B2XL 3VG9B 3WFCL 4A38A 1VF5C 5IGXL 5KBNC 3UTQA 3LQAH 5TF1H 3T3PB 3W82A 3OVUB 1VFOA 1PKOA 3MLUL 3VQMA 1T0NA 2WUCH 3QGVA 5J1AA 2YD9A 1N8ZA 2A9AA 1B88A 4PGBB 5DEFB 1YUHA 1T83A 3CZNA 1V8HA 1I8LC 4BKLA 2ICWB 1MPAL 1HYSC 1ZV9A 4JS7A 1PQZA 3CDGB 2CDEA 3QEGL 2KH2B 1ZHBA 3G5ZA 4HWBH 2Q10A 4K3EL 1PZSA 1NUNB 1R3LA 4BE5A 4UV4H 5EZIH 4ZS7L 5J6SA 5HD8C 4ZS6D 2HRHA 4XNBA 5I1JH 2A4CA 2X4SB 2F54A 3V0VB 3QHTC 3VRIB 5I0WA 1M71B 5KSBE 4NKDB 4HALA 4CBZA 2FHFA 3O3EA 2V17L 4PWKA 3QZBA 4XVJL 3K6FA 1L7TL 4UANA 2C3VB 4KTEL 4YDLC 5DU7A 3MGOA 3OKKA 4TSBH 1U3YA 3SZ6A 3K72A 1UYWL 3QEQA 4I3RH 3EF7A 4BUQA 2FIRT 3RUGB 5I8CB 4XNYL 2J3SA 4JUTA 4IRJC 4MWFB 2P48B 1P5VB 3RPIA 3DO7B 1F00I 3K91A 1DDHB 4K7PY 5TF1L 3VNYA 3V5DA 2HG5B 2EXYC 4LL9A 2IWEA 4ZMZA 3IK2A 5CGTA 3GSQB 2BXYA 1IGIH 3ELAT 3BSGA 3ZT5A 1OTUC 2XRAH 4AH2A 1NFDA 5AKVA 3W81A 2YPLA 5GSRB 3FAXA 3PIQA 3T4AB 3U1QA 2CBQA 3FU0A 2R0LH 1YY9D 4GRWB 3B34A 2QTEA 3F7QA 3WJJC 2G0KA 2CDFA 4DK6A 5AB9A 1JYVA 5DD3L 2HXAA 4HUWA 4IIZA 5B22A 2OMXA 3G5YA 1FZMB 4LSPH 3W9EB 2WTOA 2EADA 3T4YB 1Q0XH 5DUPL 3DUUA 3ARGB 4FADA 2MH4A 2XXCB 4G1MA 1Q94A 1FVDB 1GMIA 4V33A 3FAWA 3MCKB 4ANKA 5IT2H 4OT1H 5C6TH 4P4KD 4D8PB 5CKAA 2EO7A 2E74C 3CVDA 2X38A 4U4IA 5FYKL 2Y7NA 4OH2A 1ML0A 4QXTB 4XBGA 3C6EA 1TQUA 1MY5A 2WAQA 5I6KA 4AKOA 5J11C 4V1DB 4Y9EA 4ZFOB 3K6IA 3D09A 2K3HA 3L81A 4M43L 5ACLA 3V7MA 5DHDA 3BIKB 4EVNA 2E7BA 4KX7A 3KGUA 2TSBA 3QAZB 5DUBA 4P2RD 4W9ZA 4AVKA 5FGRA 3ULVL 4HYTB 3O8XD 1UD5A 1PAZA 1QPKA 4QRPA 1RUKL 5DJXA 5I1DB 1GJUA 2DL9A 3EJSA 5DS1A 1HX0A 1S7QA 3W9DB 3FHEA 1QNZL 2FSEB 4OLYH 4NQEA 5ESVB 1YEGL 1E2WA 2PP7A 3MRBA 2CNYA 3HE7A 2DI8A 4FMKA 1ASOA 2FWUA 3MV01 4G42B 3N85L 3WNJA 5DHXB 4MNQE 4EUPG 2ZX6A 1CN4A 5FB8B 5AW0B 3VRLE 2NQDA 2J20A 3VQ2C 2V5SA 3MOAH 4M8RA 4Y9BA 3UZEA 1QFUH 1YN7B 2DWDB 3HPJA 4JM4H 3ZKNC 2CBTA 1HKFA 3AZUA 4ZFQA 1MG3C 2FVNA 2WXNA 4UT7L 3BP7B 4OGZA 4CU7A 5LDSA 2F19L 1OT1A 1T66C 2G30A 2N0KA 4PJBF 2Z8RA 1OF2B 4OLWH 4D0BB 5KOMC 2NY7L 7TAAA 2ZG3A 2OKMA 4NO3A 2WKOF 3MRPB 2VL4A 2KQMA 3BLPX 4OU3A 4NLAA 3EJUA 1HEZA 2B20A 3IDNB 4LZKA 1NIDA 4M4RA 4G5ZH 4WUUD 4ZTPH 1SEBA 2XKUA 2AAVA 2D0GA 2QSCL 4BH7A 5F9JB 1KTDA 1AGDB 5IHZB 2Q8BH 2W94A 4UQEA 4FA8A 5AW1B 3S8GB 1R5VA 4CBPA 4D9QE 4FA7B 4Z3JA 3P54A 3KYAA 2HWZL 3QJOA 3IGFA 4H8HA 3R18A 3PGDB 4MRBA 2PWDA 4XXDB 5T3ZH 1A8JH 2ZCLH 4AQAA 1Y1DA 1D5RA 1SEQH 5T3XH 1F11B 3AB0B 2X4TB 4WI0B 4KWUA 1U2CA 4IKJA 1BYNA 2X4PA 1A3LH 2GSIA 4FLOA 3F12B 3NPSC 3MRCB 1L9TA 1TJHL 4I8DA 4HHWA 4GG6F 4M6ML 2BVTA 3RZWA 4XMLL 3FB5A 2RACA 3EGSB 3BSZA 2BIHA 2XWTB 2ZUUA 5GISL 5LN8A 1NA8A 4XMKH 5D72L 3M1BB 2J25A 2RMNA 1YYLL 4H2AA 1HYRC 1RSFA 4RIRA 4LE8A 4RSYA 1RJLB 4Y4FD 3DX0A 1Y07A 5PAZA 1ZD6A 2VO8A 1M7DA 1M1XB 2DQFA 2HT4C 4HD9A 1YN7A 2DWDA 1AS6A 1WUZA 4WCYL 3QCUH 5LBSH 2BNQB 2K6WA 2BIMA 1L6ZA 4ZTPL 5AAWA 4FQCH 4NNYB 3RGVA 1U3HA 3RL2A 3J27A 4L0ZA 2A73B 1L7IH 3WIHH 5FKAA 1P1ZB 1KJMA 2RH0A