1J5DA

Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PLASTOCYANIN
publication title The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j5dA00
1JOIA 1HAWA 4DP2X 1OCOB 4A66A 5B3SB 4Q8BA 1MG2C 2IWEA 2IH9A 2FQFA 1NTDA 3S3DB 1NDTA 1NPNA 4AX3A 1X9UA 4A68A 2FT8A 3T6ZA 2BWIA 4F7KA 4HHGA 3SBQA 1ZV2A 2IAAC 5I26A 1CUOA 3OMNB 2DYRB 1PMYA 5A7EA 3TBCA 2YAHA 1RKRA 1J9TA 1TEGA 1UATA 1WS7A 3X2QB 1NZRA 3X1FA 3WI9A 4DP7X 2OJ1A 1GS7A 4HALA 1PZCA 1BQKA 2X87A 1KCWA 4E9TA 1JZJA 1R1CA 1JZGA 1W6WA 1TU2A 1BYPA 1E30A 2FJSA 2CJ3A 3L45A 2PPCA 4TXVB 2UXVA 1NIAA 1SFDA 4YSUA 2FQDA 4KNSA 2EILB 5ANHA 5B7EA 2IDFA 3AY2A 4HZ1A 1J9RA 1ADWA 3NJJA 4CSPA 3EH4B 1AACA 3NP4A 4G7SB 3ABKB 4BDVB 3S8FB 3OMIB 1KBWA 4DP1X 1JZFA 2GI0A 1NIEA 3CVBA 1BQ5A 1YLBB 2AVFA 1FA4A 5D4JA 1JZHA 4GP8B 4UANA 2BZ7A 1KV7A 3GYRA 3FSZA 1ILSA 2Q9OA 3TA4D 2DWTA 4AZUA 2BW4A 1PLAA 3GXUB 1KYAA 2YXVA 3WNJA 3NT0A 5I5MA 1AR1B 4E9XA 4W9ZA 3GDCA 2PP7A 1PZBA 2J57A 5B1AB 2X88A 5I6LA 2VSKB 1SF3A 2UXGA 1GR7A 4UF7C 1A4CA 4BXSV 2I85A 2XXGA 1ASOA 1QHQA 4M3HA 5F7BA 4BDVA 2FT7A 2YARA 4KO7A 3SQRA 2XUWA 3IN0A 1A3ZA 4YSTA 2J5WA 3EF4A 2BWDA 2FQEA 2Q5BA 1NWPA 3H4HA 3S3CB 2WSDA 4JKNA 3ZIYA 1SHXA 1DZ0A 2CCWA 2B3IA 2VW4A 2ZXWB 1WS8A 4A67A 2GC7C 1OCCB 2XV2A 4NAJA 4KO6A 1GS8A 5B1JC 3ZBMA 2IDSA 2PPAA 4MFHA 2AZUA 2HXAA 3CG8A 1OCZB 4GY4A 5AFAA 1MDAA 1OF0A 3FPXA 9PCYA 2H47C 1AS6A 2P80D 4HCGA 3OMAB 3WIAA 3FU7B 2UX6A 1BEXA 3FSVA 2OCCB 2YXWA 4G72B 3SBPA 2EIJB 2AZAA 2XVBA 2YAQA 3ABMB 2RACA 1JVOA 2CBPA 4DP4X 1OOWA 3PXLA 2PPDA 3HEIB 2HZHA 5E9NA 1HFUA 2I7OA 2VW7A 3RYMA 1QLEB 3H4FA 2PCYA 2GB2A 3FYEB 4E9SA 3X1GA 2HX8A 1ZIAA 4HHWA 5FC9A 8PAZA 5I5JA 4DP5X 1A4AA 2Y1AA 3N2JA 2P80A 4DP8X 1AZCA 4YSCA 1E67A 1ASPA 4GXFA 3WKQA 5AKRA 4EF3A 3QJUB 4WTQA 4FA7B 3ASOB 2GIMA 3NJGA 4AKQA 3FU7A 1SDDB 3IN2A 2DWSA 3CVCA 1ASQA 1JZIA 2LLNA 2EIKB 4FAAB 4YSPA 2PLTA 1W6LA 5B7MA 1NIFA 2FT6A 1GW0A 4KNTA 3PLYA 1J5DA 2YAMA 4A2FA 1BXUA 1W8EA 4KNUA 3KW7A 4KOCA 5AZUA 1CC3A 2VM3A 2AANA 4HCIA 3FQ2A 4YSAA 4PCYA 1GSKA 1OE3A 2Y69B 2QDWA 1AZBA 3NYKA 1KCBA 2TSAA 3NSDA 5I28A 2BW5A 1MZYA 1SNRA 2MRYA 2VW6A 2IWFA 4HCFA 4WKXA 1OCRB 3NSFA 2NRDA 3AG3B 1DYZA 2IDUA 3FQ1A 4DP6X 4M4RB 4YVUA 4G70B 4E9YA 1SDDA 3DTUB 2J56A 2XXFA 1SHWA 4YSDA 2PPEA 3IE9A 3WNIA 2FTAA 3IBOA 1F56A 5D4IA 4YSSA 1AQ8A 1EZLA 3OQRA 4YSEA 3NSCA 5I6KA 4DP9X 2YAEA 4JHVA 3NJKA 1IUZA 2E86A 1CYWA 1PF3A 1X9RA 5D4HA 1RCYA 4DPAX 2CUAA 1L9RA 2A3TA 1JVLA 4BWWA 5I6OA 2UXFA 1WAEA 3NJLA 4K9JA 1AS7A 1SJMA 2VM4A 1E65A 2DYSB 1TEFA 1A65A 1BQRA 1RZPA 1NWOA 1AG6A 7PCYA 2YQBA 3TBBA 5EHFA 3AW5A 3QQXA 2AFNA 3AG1B 2QT6A 3N55A 3NJFA 1PNDA 1JXGA 1AANA 3QJVB 1PY0A 3T6XA 3C75A 5B1KA 3S3BB 1IBZA 2UX7A 2DY2A 3UADA 2UXTA 3TASA 4DPCX 3EHBB 3X1NA 1PLBA 3FPYA 3FSWA 2W88A 3NJHA 4E9WA 4P5SA 3UACA 3FU8A 3H56A 5PAZA 2IH8A 1GY1A 4CSZA 1TKWA 1WA1X 1CURA 3T71A 3QJSB 3WKPA 1JXFA 1FFTB 2EIMB 2BO0A 2GC4C 2PP9A 3NJNA 2XWZA 3PAZA 2GBAA 2GSMB 1ET8A 3PPSA 2HX7A 1BXAA 3IEAA 4AI7A 2PP8A 4BWTA 2TSBA 2R7EA 2JFCA 4Q89A 4KO9A 4E9RA 1ZDSA 3X1BA 2XU9A 2J55A 3MX0B 3PAUA 3QPKA 4GP5B 1ILUA 3FT0A 3FQYA 1RZQA 1WA2X 2XV0A 5B1JA 3UGEA 3CVDA 3EH3B 4JHUA 1PNCA 4N8UA 2JXMA 3BVDB 1ID2A 4BWUA 3QJRB 4UAHA 1ZDQA 1KDIA 2HRGA 3V9CA 1AG0A 3DIVA 3SBRA 1BAWA 2IWKA 1GY2A 4A2EA 3S8GB 3PAVA 4L0PB 3QJQB 4HIPA 1A8ZA 2QPDB 2QDVA 2FWLB 5LDUA 3NJMA 4YSOA 2FNWA 3BQVA 1FWXA 3T9WA 4GYBA 3UAEA 1PZAA 1IKOP 4BK5C 1JERA 1CYXA 2BP0B 2HX9A 1E5YA 4DPBX 1E5ZA 4X4KA 1URIA 1PLCA 3ABGA 3OM3B 2QPEB 3X1EA 2VMJA 2CAKA 4BXVA 4DP0X 5I5IA 2I7SA 2ZOOA 2BHFA 3T6WA 5IY5B 4QKTA 4A2HA 2BZCA 3AZUA 3NJIA 1MG3C 5F7AA 2VN3A 1KDJA 1XB8A 4NERA 4AKPA 2HRHA 4ENZA 1V55B 1XB3A 4E9QA 1IBYA 1L9PA 4N4YB 3UAAA 2B08A 4A2DA 2MTAA 1L9SA 3T6VA 5I6NA 1XB6A 3ERXA 1JZEA 1HAUA 1KGYE 2GHZA 2XX1A 2WO3B 2YAOA 4E9VA 1MZZA 2BP0A 5TK4A 4HAKA 3CZUB 1AZUA 1V10A 1M9WA 4G7RB 4YVNA 1NICA 3FYIB 1SF5A 4KO5A 4W1TA 1OE2A 2XYBA 2BP8B 2H3XC 1NPJA 4ZK8A 4RH4A 1J9QA 2YAPA 3EH5B 1JXDA 1M57B 2JKWA 5TK2A 3NSYA 1M56B 3V9EA 5B7FA 1AZNA 2R7EB 1OE1A 6PCYA 5I6MA 1NIBA 5I6PA 1AAJA 1J9SA 3FU9A 1QNIA 2ZWNA 4GP4B 1L9QA 3TU6A 3FSAA 1GYCA 1AOZA 4P5RA 1I53A 1B3IA 1ET5A 4AKOA 4YL4A 2H5UA 1AS8A 2EINB 3QJTB 5PCYA 1AZRA 1KBVA 1BXVA 1PAZA 3HB3B 3UABA 6PAZA 2PCFA 3NP3A 1VLXA 4A2GA 1NIDA 2IDTA 3AG4B 1OV8A 2WO2B 2DV6A 3JT2A 3G5WA 3JTBA 3MBWB 2HLEB 1NINA 2BP8A 3OD3A 2FQGA 4YSRA 3CDZB 7PAZA 3ABLB 1IC0A 3DKHA 1N70A 1ET7A 1EHKB 3ASNB 4F2EA 1N68A 1SFHA 1XMEB 2PPFA 3WG7B 3ZDWA 5B1BB 1ZPUA 3AG2B 3FS9A 3ZX1A 2CALA 2W8CA 2XV3A 2XX0A 2N0MA 3D12B 4NB7A 4YSQA 1PCSA 1GS6X 3PCYA 2XLLA 2OV0A 4PAZA 1ETJA 2VSMB 1L9TA 3KW8A 1BYOA 1V54B 4F2FA 1J5CA 1A4BA 1T5KA 4G7QB 2IDQA 1ZIBA 3U25A 4KOBA 1AIZA 2ZONA 1L9OA 4G71B 4QLWA 2YAFA 1WA0X 3CDZA
chains in the Genus database with same CATH superfamily
1HINH 1QSEA 5IQNA 4HKBB 4JFXA 1GGUA 1N0XH 1P4LA 2QVFB 5D1QE 5C07A 2ZCKH 1ROWA 3GSWA 1BIIB 1LJMA 1SMAA 3E6FA 3I3DA 5C3LD 4OUUB 3VGBA 1WC7A 3GBMH 3GT6A 2YUWA 4LVHB 1MHEA 4N20A 1CLVA 3H6JA 1CVSC 4R4NC 1T1ZA 1NC2D 3REWB 3X1FA 2I60L 3D25B 3TF7C 2HVKA 3IGAA 4PJEA 3SQBA 3FTXA 3S4SB 1BFTA 2APFA 2GSGB 1S7VA 1FV1B 4YPGA 5KJ4A 2BIIA 3U6RA 4B3EA 1GIGL 1R1CA 1X4YA 2LFEA 1H19A 3KXFD 4WV1A 1W6WA 3CFMA 5IFHL 4NO0A 1UFGA 3KL5A 4UILL 3VQLA 2TRHA 3L45A 3SBWC 3RAJL 4BELD 3QIBA 5E2UH 3VU1A 3QIUC 3ZIMA 4PJGA 2BC4A 3QVAA 4KNSA 4MXWL 1KYDA 3Q2VA 5C0RH 1BGXH 1ML0A 2VDQL 4WU5A 3MRLA 5FYKL 5E6YA 2ZXAA 4K7FB 2AJUH 1IX2A 2BHUA 5IROC 4UTAH 5A40E 1NL0L 4BDVB 4KTGA 1FPTL 4ZW3A 3W11C 1L4IA 1LEKB 2H41A 1F02I 4NC1C 4L9LC 1WCQA 1I75A 1YNTB 2Y07L 3CFIC 3JBG7 3D0VA 1BQ5A 1MPAL 1YLBB 1KB3A 1FNAA 4ZW5A 1A7PH 4GP8B 5J3HD 1KV7A 1NEUA 2F61A 4XXWC 2VDOB 3G6JF 1TTUA 1UOLA 1T21A 4IK7A 3SKOA 2OQJB 4HMCA 5HY9A 2PWEA 1RJYA 3IPBA 3U0WH 1UACL 3NT0A 4L8BA 3UTTB 5JA8B 3CFBA 5J6HB 2ED8A 1PZBA 3HI5H 2WXQA 1JDDA 2OTUA 3BP6A 4UQ3B 5J6SA 4I4WB 4IBTA 4TLUA 1A7QH 4ZTPH 2B1AH 1GR7A 4BSVB 1QTSA 1OXYA 3L3IB 4K5OA 1D5IL 4PJBA 4RFNC 1QHQA 3EW3B 3WJMB 2FT7A 3TO4C 3L4UA 1QW9A 3GXIA 2VSDA 1AZVA 4ZO7A 3SKMA 5KVEH 4GUCA 4IHOA 4ZRGA 2MQ3A 4NQSA 1KCRL 4PI0A 3EUDA 4MWFB 4G6AD 1BP3B 4KQ4H 4X6DF 3UYPB 1QPPA 1YEGH 1MI5E 1OCCB 4U1GB 4BFJA 5JPNB 2ADIA 4X5RA 1K8IB 4WTXA 3U36B 4BRJA 4YHOL 3X13A 1IC4L 1S3KH 3NAAL 2XFXB 1R0AL 4FFZL 3SDDC 4ZPTA 1MF2H 2CCVA 3TJHD 1B2WL 2BLFA 2XWJB 3MR9A 4OF5A 1DEEB 5L8KB 4RNRB 2CIKB 4JB9L 4QHMA 4IKNA 2YD5A 5IB3B 4UB0L 1A1NB 3K5SA 3MGOB 4G72B 3MMEA 2VUYA 4HW6A 3KEDA 4HJIA 1I8IA 1QUNB 4KUCF 1BDYA 3GBEA 3ULUD 3GDBA 4XC1L 2PYED 1D9KA 3ARBA 3ZRCC 5CWSA 4OCXL 3F6JA 1ED3B 4WO4B 5GZND 2VQTA 4KVPA 5EULV 5T1DL 3M6DA 3RYMA 2UZIH 2IFFH 1CBVH 2EC9T 4S1RL 3VSTA 1NM9A 4ZXBA 3X1GA 1JGVH 4IEFB 2ZCLL 1MFCL 1V5JA 3NJXA 2F6AA 3N2JA 1JVKA 4NBYB 5LGJB 2GUOA 3WKQA 2C3GA 3AREA 3O6KH 1KJMA 1WYJA 3HNTH 4K55A 4J3WA 5CO1A 2Y5TA 2Z93B 3LS5L 2ATAA 2EUZA 1W9XA 1V7MH 4WSKA 2VAJA 5D8JH 1U33A 1WAAE 4UOW0 4ZDHA 2P5WB 3K46A 4AEFA 3FSOA 4ZSOA 5FCUL 4HOMA 2FLRT 3FUKA 4KOCA 1KXQA 4FFTA 4FQXB 3DXAD 2EYRB 2RR3A 5DZPA 2JJTC 3MO1B 1X5YA 4O02H 4D9RE 3GMNA 1OE3A 5EBGA 4J4PD 4ZOBA 5DMIH 1R75A 1AD0B 4MA8H 2MRYA 1C5DA 2X1WL 3DSFL 4H2AA 4PG2C 2V9UA 1AR2A 4Z7UA 1HWWA 2E7HA 3T09A 4J3VA 5DGQA 1G0YR 5EO0B 5HHVL 3ZKXC 1LO5A 5ANMB 4KH9A 5LBGA 1IAIM 4IGBB 2FTAA 4KU1A 4R90L 4KY2A 3FN0H 3DIFB 3S2AA 3HN5A 2QSQA 3FUEA 4L4VA 4LHJB 4G1EB 6FABL 2R8SL 1OGAE 3UAJD 4JFZL 1XSOA 1N59A 2HLFD 4K9JA 4OIIH 1FAIL 3HE7A 3BFOA 3G5XA 3F62A 5I75C 5GGSB 2CKBB 3KBFA 4MJ6B 1F0LA 4B27A 2WMPB 2FGWL 3IFNL 4JY5L 5DO2D 4K8RH 4D3CL 1IAIH 4HPOH 1HXYB 3L1OL 3D3VA 1WPCA 4PJ7E 5AOJA 4DN4H 2Z4QA 4XVJL 5F1SA 4JM2F 4WCYH 4M02A 4D0BA 3CDGB 3QHFH 2NY0C 4Z3HA 5I8CA 5IEHA 4P23B 2P52A 3KDMA 3T0EA 3BDYH 2BDNH 2I32A 3UACA 3HBPA 1J0IA 4I0PC 4FXKA 2XTJE 4M5YH 4NKMA 1JK9A 1Y7VA 4WRLA 3UP1A 4AUYA 2ARJA 3HMXH 4XPHH 1MAMH 2FJFA 2EDNA 5JIHA 4CSZA 3EH2A 5ITFA 3QUYD 1EZVX 3QJSB 2VZOA 2Y7OA 5IGXH 2XWRA 2EXYC 5D7JC 1Q9WB 1JJUA 4WGWB 3NFPA 3R8BB 2WAQA 4JRXA 3GJFB 1QWUA 1BAFL 1MFAH 4LBEA 2R7EA 1H8SA 3L8QA 2CIIB 1QTPA 4PJ9A 2CHDA 3MLWL 3QJHA 25C8H 3MNWB 4HLZH 2J55A 3LZLA 5K9JL 1L0YA 2XA3A 2VUKA 1JZ4A 2YD7A 2IH3A 2WLIB 4GIPD 1N19A 3CZJA 3GZPA 5CIPB 1HI6B 3VFRB 1KBPA 1J48A 4GUQA 4OW6A 2J20A 3IDXH 3QS3A 1ADQH 1JGUL 1XGQA 2PWFA 3N40P 4I2XA 1UT1A 4EKJA 4NHUA 5E4OA 3LEXB 3S34L 5HHNB 1YAIA 3TBVA 2DRUA 4BZ1H 1NM4A 3FB8A 3K6SA 2FECL 3V9CA 1AQDA 1FYTE 2BCKB 3VD4A 1VZGA 4U6XA 2BOBA 3MCKA 3BPOC 3LNGA 5E99H 4F5CE 3WY2A 1BFVL 4PSRA 2J8UB 3UP6A 3UPRB 4GAGL 4U6HB 3B7UX 5EOCH 4TTDD 3O3EA 1I1RA 1YYLH 1EEYA 1R4XA 5EU6A 2HN7A 3P3UA 1T1YB 5HHQA 4ODXB 4P3CL 2ADYA 1FNGB 4NQDE 4XZUB 3GLEA 4PJGF 1NCGA 2Z1KA 1DFBL 2FBJH 4DGUA 4NQUA 5C09A 4G82A 4B9ZA 3ABGA 1BMZA 4KPHH 4LSVH 3WFDH 1Z9NA 3UTQA 5E1HB 4AJWA 1P84K 3I6KA 3KHOA 3FUMA 2ICCA 5IY5B 3GRWH 4IOIB 3RDTD 2RALA 4WI9A 3K6IA 2ZIDA 4I1RA 4ZUTA 2VN3A 3RJOA 3LQZB 3ZMEA 2OP4H 2HLAA 4UV7L 2HJKA 2LE9A 3MRPB 3ETTA 3FOLA 3QWOA 3ZZ1A 4LAQL 2KHAA 3PG2A 4MZIA 2ISDA 3N04A 4PJ6A 3BKJL 1YEHL 4KUZH 5E2JA 2YC1A 2F1EA 4ZS6C 4OUUA 2MOGA 4DH2A 4R7LA 4E9VA 3QG7L 4WI0B 3QDGB 5I73B 1TKWB 4JFDB 1S7UA 2L8AA 1CE6A 2IC2A 2X42A 4HZAA 5E94A 5AYQA 1AZUA 4ZOEA 3LZQA 4WDIB 3DK2A 4MJIE 3MSPA 3RTQD 3CHRA 3A4EA 4GRLD 1L5GB 4PJBF 3WIFB 2B5IB 4KTDL 3V95A 2HTKD 2VABB 3VXUD 1P84J 1TQCB 2D0HA 1CYGA 5AW2B 2DOCA 4QRQB 2XA8L 1X9QA 5C70A 3Q05A 4DGVH 1FC1A 1K5NB 4DFHA 2EXTA 3OKKB 1VACA 3GMOB 1CE1L 3L3HB 4AKOA 4GG6A 3OKLB 3RKDC 2QKIB 3JWOH 3OF6A 1TJGL 4J28A 4E41D 1IFRA 1QSEE 1GCYA 1CFBA 1SOXA 1LWRA 2VIRB 5FM5O 4GQQA 5AB2A 5D1XE 4L9DA 5CN2A 4IRZH 3FL7A 2X12A 4XP9L 1LEKA 4HU2A 3GTNA 4G8GA 4JN1H 3EYSL 3TBWB 3VWJB 5IM7B 5EZOH 3D2TA 4LIQE 4M7ZC 4YSRA 2ZOTA 3CDZB 1IZJA 3ZR6A 1A6WL 4UQ2B 1H8NA 2PR4L 3PXJA 3KBHE 2QHRH 5EO9B 1A21A 5BV7B 2NXZD 4OSUH 4JKWA 2JIXD 1P53A 4AW7A 4OZFH 3QPQC 4PJEE 5J12C 4AC4A 4BFFA 4OI7A 1ZPUA 2YS4A 2BM3A 3FS9A 1RK7A 2WZ6A 3UTTA 2XV3A 5CHNB 3ZDXE 3DIDA 3ZTEA 4ETYA 5C9JA 4FLHA 3FXIC 4L5FL 1PCSA 1WWAX 4NM4L 1HQRB 4I4WA 3QA3B 1A2YB 3NCYS 4JREC 3FONB 4BSVA 2CG9X 3I9IA 4PJGE 1UH4A 3QUMH 3QIWC 3CFEB 4Y5YB 4AK2A 1FLRH 3DX4A 1QI4A 4MHHI 2JTYA 4QTFA 4G71B 2DDQL 3Q7JA 3VX0A 4OFIA 3ISWA 1X5HA 1ZLVH 3LB6C 5KS9B 3C9NA 3KYOB 3UYPA 4NFCA 5C71A 1OCOB 3B8YA 1OAQH 4M9PA 5EUOA 5J4MA 2DI7A 1BYNA 5JPNA 2BFVH 1NTDA 2NY5H 4OCRL 3NESA 4WUKH 4FZ8H 4M1GH 2G60L 3IAGC 2WVUA 1DJHA 2YKLL 3WEOA 2FIRT 2XFXA 1JE6A 4JRYB 4H20H 1V3JA 4ERSH 2DWDB 5B3JE 4LGSB 3V4PL 1H5BA 5E2WH 4DK6A 4ZMNA 2ID5A 2XWJA 4KJPD 4S0SD 2LT9A 1AD9B 1DEEA 1HZHH 5DJAB 5EO1A 1P7BA 4HV8A 4XBPB 5IVZA 2B8OT 4X6FA 4HU8A 5I16B 4BHUA 1A1NA 1I85C 3FK3A 4KHTL 1HHHB 1KN2L 3MGOA 3KM2A 2CNZA 5GRXG 1QUNA 2A6KB 4Z7UF 3CHQA 3WTSA 4JAMA 4WWKB 1IMHC 2P9RA 3VRLF 1MCPH 1PKOA 1YAZA 4PY8I 3MRRB 5ITBL 1BYPA 5LNDA 1ED3A 5E6UB 2VLRB 5D2NA 4JHWL 4EE2A 4YAQA 1T66D 1WT5A 2F8OA 5MEOB 1T2QH 4WJKB 4YSUA 3BDBA 4EN3D 3CV5A 5GGRY 1QLEL 4L3CA 2PTTA 4BK5A 4UQIM 4PN6A 4IEFA 1FSKB 4P2CG 12E8L 2ESVA 2F7QA 4P05A 3QCUL 5LGYA 4GMSH 5I74C 1OGPA 4JPKL 4O2EA 5GISL 1KTLB 1RUMH 3J8F7 3I84A 4DUXA 3TBYB 5I82A 2D7TH 2J25A 3L3DB 4LL9A 4Q6IB 1SLXA 3MBEB 4F33B 4UNUA 4YXHH 5CP3A 5KOVC 2ZE0A 2ODHA 4LLVB 5LKNA 1JP5A 2FEEL 1KLUB 4R7NA 2IGLA 1BXXA 4UT6A 3UTSE 5CJ5A 1JZHA 5J3HC 4IRSB 1R17A 4KBPA 4WFFD 2R56L 1AHWB 2D03L 2JKJA 3BC9A 4YNYA 1PQZA 2DWTA 4FQXA 4NQED 5AWNL 4OJAA 3D5OF 4ABWA 2NSXA 4HSAC 5LG1A 5EEXA 3HC3H 4C56B 1GZPB 5EPMA 2XWCA 3W56A 2ITFA 3RQ3A 1ES0B 2R4SH 4JE0A 4U31A 2IADB 4H1LG 4BFOA 3AU1A 1XSKA 5CZRA 5CEZH 2G9HB 5HGAB 3UCRA 1OY3B 2CGRL 2IOMA 5KVEE 1LE5A 1QEXA 4KZDL 5IP4A 3QEQB 4YSTA 1KYFA 1BJ1J 1ZTXE 4KMQA 1LP9F 2GVYA 3QEHB 4MCZB 5KSBB 1S5IL 1WBYB 2BWDA 3LPFA 5ISZD 1MW3A 1WBXB 2W9EH 4I3RL 2EDXA 2IGFH 2VW4A 2OJZH 3U2SB 3H3KA 4Y88A 1DQDH 5F7DA 2A1WH 1A3QA 4OZGE 4W9KC 3CK0H 3EOYG 4OLEA 1J10A 4HIEB 3B9KB 3CG8A 4Y7MA 3TJHC 4C55A 2NNRA 9PCYA 3P9LB 4OFQA 4OD1H 1QA9B 1KXQE 4G8AC 3WUWA 1BFOB 3UX9B 1I1AD 4AEIH 3VWKA 4AJYV 4JFYA 5F0MB 2J72A 5LAPA 4HUXA 2KYIA 5F89B 3RX7A 4JHBA 3MGTA 2V2TB 5I30L 3TESA 1J86A 1MIEL 3CDGA 4TQHA 1QRND 1OOWA 2YLKA 3PXLA 3TS8A 5GZNC 4Z7UE 3QORB 3RFZA 4XP6L 4LPTA 2H0PA 3QP3A 1ULVA 2K78A 4K3JH 3VD3A 3K6DA 4TLTA 2CO6B 1GTNA 4I3SH 2AC0A 4PBVC 3LAFA 2J12B 3VFWA 1SMOA 3FTYA 2WQVA 1JGDB 1KIPB 5I1IL 1U8OB 1Q9WA 2A74A 1XGUA 2AK4A 5E0FA 4NXSA 3OR6B 3FHAA 1YUHB 4PJ5D 3MRMB 3IE4A 1H0DA 1MJ7H 3ZLQC 2QV2A 1XGYL 3NQKA 1X44A 2NY3D 3CPLB 5MERB 3WV0A 4JPVH 1M6OA 5GRZA 4H4NA 3LD8C 4ODHL 3S35H 2WLIA 1MJ8L 3ZDYF 4CGUB 2AJVL 1VDGA 5AZUA 4GSDL 4NKIL 1HI6A 3BYTA 4Y1SA 3VFRA 5L9DL 2MIZA 3QIUB 4GI9A 2R15A 3JQOB 5C7XH 2XHNA 1E7VA 5L8LB 2D2OA 3DJSA 1MNUL 4J4PC 2NY2B 5C08D 3LPGA 1CICA 2K9FB 1R5IB 3V0VB 4X5XB 5E8DH 5AOKA 3WYRA 4OLVL 4PJCE 2NRDA 3AQZA 5HDRA 4XWGL 2X7LB 1AGBB 2BHZA 3RA7H 1NJ9B 2JNZA 4KRPD 4P4RB 3FQ1A 3W0WD 1GCFA 4U3XA 4P3DA 4L9LB 1KTBA 4M43H 3A6OA 3VXSB 4AE1A 1S9VB 2JK5B 1E7UA 3PRZA 3UPRA 2J8UA 4U6HA 2VLKD 1MSPA 4AL8H 2BRRL 1KULA 5C0EB 5ERWB 5HYJB 1A7OH 3ARFD 1T1YA 5DGRA 5D4HA 2FO1A 4HJJH 1FNGA 2BVEA 2VDPH 2ZYSA 4OZHB 3UAJC 3ZN6A 4EPSA 2W9DH 4QXGH 5EEVA 1LO3L 4XCEB 1KB9K 2HLFC 3IJ7A 3HJEA 4M6OL 1X6LA 3DYOA 1U30A 1RIVL 4GG6F 2QBWA 5KANI 2YFOA 3FULA 1LDPH 4LCIH 3D85D 3LQMA 1Q94A 4X7TB 4M48L 2PF6A 2DYSB 1TXKA 4TRPL 5DO2C 1RZFH 4QMEA 1A1MA 4QWWC 4A6YH 4Y2OA 4IOIA 2I24N 4I2XE 1BG1A 1XVSA 3VGDA 4CVZB 4ELKA 1C8PA 2B20A 4CN1A 1PY0A 4JPWL 3MRHB 1CFNB 1IGCL 2L7QA 4WK2B 2C5DC 4GI6A 5E8OA 5T3ZD 5DA0B 3LXAA 5EN2B 2BNRD 2VLME 3GEWB 4MDRA 4X7CC 1RP9A 5F8RC 4D0DA 4R0LA 5IB1B 5G4MA 5HVGB 5IB4A 5E9DE 4HFUL 1HXMB 3MRJB 1MRDH 1ACZA 2OCFD 3ILQD 2O93L 4POZD 1D6EA 2CK2A 3SDDB 1TKWA 1JWUB 2IBZX 3QUYC 5AVVB 3E3QC 1J18A 3IF1B 1NAML 4F2MA 5EG6C 1NCHA 4PJAA 1JXFA 3RVWC 1A9VA 1KB9J 3PAZA 1XV8A 1ANUA 3ZXAC 3VW3L 5GRVL 4RMTA 3WIFA 5J56B 3S35X 5JHMA 1OF2A 4GS7C 2LU3A 3VFVB 1E8WA 3JTSB 4Z3IA 2VL5A 4QRTB 4HJ0D 3BXNA 3QDAA 5C0BD 3E38A 1LMIA 1GZHC 1TETL 4AM0A 1BZEA 3UTPE 4Z3FA 5D7LA 1ZHLB 4QOKE 5K1JA 5KJRH 3QPKA 1FG9C 5DYFA 1HSBA 5CZVH 2Z91B 3GMOA 4HXBL 4E68A 2DTMH 4B5EA 2F15A 2VMDA 2ZG2A 3VDAA 3OKLA 1S5HB 3EXLA 4QXUH 2VDNH 1AIFB 4N8UA 5E00A 4HSCX 4NQXA 4PWKA 2C7FA 4MD0B 2AQQA 1N64H 2WQAA 4ZQKA 3TT1L 2NW2B 2DWYA 5D7KD 5KVDE 3VWJA 4HWEH 4OLWH 5IM7A 1A6ZB 3C8DA 5DEJA 3U7WH 4DO5A 4UQ2A 5DHXB 3L4ZA 1OM9A 5EO9A 4YGAB 4EDXA 3BWUF 4TTDC 3KVQA 4PUBH 4JHAL 1KBGH 3CLFL 3GSRB 2D7QA 5JXAH 5GGSY 2GIYA 2L7UA 2VXUL 4K94H 1CFQB 4JPSA 4JZJA 1OB1B 1OANA 1RHHB 4RSVA 5DQDH 4N8VA 1NGPH 4L4TD 4AQ8A 1SVZA 2AXFA 4XNDA 1SEBA 2PTVA 3QBTB 2HG5A 1GGTA 4YEEA 1E5YA 3GI9L 2B15A 3D0AA 4OKVB 3QA3A 4V1DD 2P3YA 5F9DC 3L81A 1YEKH 3IETB 4DW2L 2LHAA 4ZZFA 1RZ7H 1UVQB 3DX8B 3RDTC 4ONHA 4IW4C 3RIFK 4L48A 2BS71 5EU4B 4UTBA 4F7CA 4DAGL 3HA0A 1Q90A 1FCCA 3ZKXB 1XB3A 1NCCH 3QWRD 3A6CH 4ODVL 2XQBH 3GK8H 3QT2A 4C59B 5I2IA 1FBIL 1J8RA 3MUHL 4MAZA 1OWRM 1D5MA 4HZLA 1UB6B 5GPRA 3SGDH 3RE0A 3QRGL 4JRYA 4F7TB 3K5RA 1K6QH 4FFYH 2EDTA 2BP0A 4DUWA 4YIQA 2UWEA 3MNZA 4JLRB 1ONQB 1AD9A 4WFHE 4NRZA 3ZKSD 4R3SB 4G7RB 5CGTA 5IBTH 2C9AA 3SKNB 3RTQC 5I16A 1SF5A 4GRLC 5CEXB 1TLKA 5I75B 3AQYA 3EJCA 3VNZA 1HHHA 4S1QL 5FIEA 4HWUA 3QQ4A 5L8JB 1EEZB 4O58L 3ULVF 2HTKC 2ICEC 4LSRL 5BRZB 3U46B 2J3SA 3NDZE 1P0SE 4JO5A 4QRRE 5TFSL 3C6EA 1J9SA 1B0GA 3MREB 3QZWG 4ETQB 2VLRA 1XHHA 1IZKA 2XIIA 5MEOA 1INEL 4PRIB 4XMLL 4NNPH 3LPWA 1B3IA 1EXHA 4NUPA 1F5WA 1A9EB 1AS8A 4I0PB 2V9TA 2G4EA 1AR1D 3DJRA 2ED7A 5EUOE 2R1WA 1NFDB 3NP3A 2FB4L 3V7AG 1FN4B 1HYRC 4QHLB 3FQ4A 4Z3TA 3HHRB 5F7EH 4GKSA 3JT2A 3DETD 4LCVA 4LLVA 1CD8A 1KLUA 3CQPA 1RUPL 3GB7B 2VC2H 3L4VA 3T2OA 4ZG1A 3D9AH 1AO7A 1HOEA 3S6CA 4IRSA 5J8OA 2Y72A 4YFEA 1G5AA 1TVBA 1XF4A 4Q0XL 1JZ8A 2NXZC 4YH6A 4J7RA 1UXMA 3SPVA 4HIJA 1LVEA 3ZE2E 1BZQK 4XMKH 3BH8B 3EO0A 3WG7B 4D94A 5JQIB 5HDBE 1K3ZA 3JSSA 1CDGA 4Y19B 5GZOC 1SOQA 4RGMC 4RX4A 2N0MA 1SJHB 4IOFD 5D2NE 5MEND 3MACL 2IADA 4LNRA 2DEXX 2QQNL 3MLZL 3UZQB 2H26A 4Y7OC 1M2OA 2P7TA 5BQ7B 4GBXD 3QEQA 1X3DA 4X8JA 4EUPH 2VQ4A 3PQYB 5KSBA 1AIZA 2WLJA 1NGXB 4OGYL 1MQ8A 5IKCA 1GYWA 1OPOA 4QF1B 4UT7H 3LKPA 3U2JA 3HUJE 1P5VA 2BNQD 2JI3A 4B7LA 1U8KB 4D9LL 1G1CA 3BPOB 4QYOB 1FH5H 4HKJA 4R84A 3K72A 3ZO9A 5B3SB 3V0AC 5AW0B 4HP5A 4R26H 1EHXA 4M8RA 5CCKL 3FT4A 2F68X 1NDTA 4ZFGH 3ZT5A 4AX3A 5C0DB 1OHQA 1WCBB 3QEUB 3HHMA 4F7KA 2VXSH 4XCFH 1QFUH 4KJPC 1EFXD 4XPAH 5I26A 5IWLC 2VMCA 4MASA 4ZUUB 4OCSH 3L3OC 1BFOA 3DUHA 4WUUE 5AKTA 4D7BA 1GKOA 1P69B 4N5ED 3ZE0B 3HC0A 4AG4H 4W9DC 1CK0L 1L7TH 1RPUA 3EOAA 2FAUA 4GEJA 2QZQA 3NIGE 1CXLA 4PS4H 3L9YA 2XPYA 4EAEA 3U7YL 1S9WA 2AQRA 2YEQA 4DVRH 2J8UF 1NAKH 4IM8A 4EN3C 5HGHA 3M17B 2EILB 3SOTA 1ITCA 2ZXGA 4YDIH 1T1XA 3R06B 1C5BL 1AACA 1M4KA 3B7YA 3A22A 1JGDA 1RJLA 1KIPA 3O8XB 4G9FE 2J6EA 1HXKA 3HZYB 3JWNH 1HIMH 1LO2L 3QZMA 4JFPB 3GMQB 4K2UH 5TE6L 5GS1B 1I9JH 5GIRB 3G08B 4IRJB 4LLQA 5I18H 4UIKL 2C1PB 4F58H 5C6TL 4XN5A 2WP3O 3O2DH 3MUGB 5L88H 4JQIA 3D8MA 4ES9A 3MLRL 4OB5L 4PWEA 4WTZG 4K3EH 1DVZA 3E80A 3KPPA 3P4NA 3MOAL 1YY8B 2KLSA 3SBWA 3L17A 4HJGB 3QIUA 3S37H 4J2XA 4MA3A 2DS4A 3HE6B 3PFQA 2YKKA 4G42B 4A37A 4W9ZA 1XGZA 2PP7A 4KY1H 5CEZE 1J5OL 4HIQA 1WWCA 3KNBB 5F3BA 5IROA 4F7MB 4QO1A 1AGBA 4I9WE 3WKNA 2XZCL 4MNQD 1WFJA 1YNKL 4PHZA 2MQ0A 4HA1A 3RPIA 3VXSA 3WFZA 4OGZA 1S9VA 3EF4A 4M7ZB 3SPHA 5EEZA 2VLJB 4HS6A 3DX2A 4QI3A 2WSDA 5GJSL 3WEXB 1ZRUA 4MYPA 4XXWA 4XMZA 5C0EA 2H7WA 3KPTA 3E1ZA 2YSTA 4Z76B 4JZOA 4KQ3H 1FO0A 1N8OE 2DQIH 4MFHA 1B9ZA 4G8FA 3D4CA 4YUEH 3IJSA 3MA9H 2APTA 1AP2B 2K70A 3F7QA 1CLCA 2TRYA 5A2KH 1OARL 3GWJA 4LSSL 4JREB 1I1AC 1YN6B 5AW9B 3DDGA 1E42A 1AQMA 5GJTL 3TO4A 4WENB 4U1JB 3VGFA 3QIWB 3DA0A 2F1AA 4MD4B 3GS0A 2W1NA 1WV7T 3FO1B 4K0OA 1IEBB 1LEGA 5ADOL 3Q06A 2FX8L 5DSCB 3JWDL 1F45A 3WSQH 5T3ZL 4QGTA 4UQDA 1S46A 2YZ1A 2KZWA 4AOFA 3HLAB 1JHTB 2VW7A 2O61B 2RCSH 2DQJL 4O5LL 5DVLA 5E0QA 1HXMA 4JFWA 2Z8WC 5I6XB 4LSUL 1C5CH 4K3GA 3SDDA 3V7MA 4JFQB 1AVAA 1FNSL 1D5BB 2A0LD 3IF1A 1GTFA 3VFUA 1R3JB 1FF5A 2XXCB 1BW8A 2ZCHH 4E5XG 4DWHA 2DQEL 2NTSP 4U1MB 1KJ2A 1BZ7A 1F11A 1ASQA 3S37X 4PJDE 1UWGH 1F3DH 2NY3C 4OZIB 5CFHA 3PABA 4AIOA 1LK3H 4CJ0A 3TLRA 1ZHLA 5DJDA 5TH2A 3NRQA 5KS9F 4WNQB 3OMZA 4WFGD 2ADFH 4HCIA 1XCQB 4N6RB 3DTDA 3NA9H 1RV6X 3FO2B 4YXLL 2JJUA 3EYOA 5ABDE 2BSCA 4XI5D 2NZ9D 1KCSH 1URZA 5I74B 3O11A 2X4SB 3Q8FA 2UWEF 2NW2A 1XWVA 4KRPC 1ORSB 1SUJA 2YD8A 3R4RA 3SD2A 3DROB 3TPKA 3UO8B 1KTDA 4X98A 4M7LT 3VRJB 4M4RB 1BD2D 1SDDA 2FO8A 3QDMD 3LS4L 4PJAE 3AT8A 4C4KT 5E5MA 4U3SB 3L7EB 3WNIA 2OYMA 3KEHA 1XZWA 1CFQA 1EGJH 1UOKA 3GMMB 1RHHA 3LKNA 2O1AA 2X4PB 4Z6AT 1QFPA 2FVNA 5FECB 3T8MA 5KG9A 1OB0A 1G6RL 2JJTA 3ESUF 3N44F 3G5YB 3DC0A 3H9SB 4OKVA 1NUFA 5LXGL 2WWMD 4UAOC 1TTRA 4PG2A 1WBZB 4NZRL 3WY1A 3AUWB 4L8SC 3MV8B 4J3TA 3JV4B 5MEPA 1YYMH 5EU4A 1U8LB 4G6FD 2QT6A 1DJYA 3NJFA 3U1SL 2OR9H 1ZGLA 2EADA 3C75A 3CBKB 4Q9BA 3S3BB 1PKQE 3JWDC 5HPOA 2UX7A 4PRPB 2VYRE 2UXTA 1S7TB 1P4BL 2XWBB 2YPLA 4D0CB 1UB6A 3NCCB 3VTTA 2MNWA 3ILQC 1KGXA 1UB5A 5AG9A 2IH8A 3DV4A 1H3VA 3PUUA 4FFZA 2P47B 4OGXL 4PWIA 1ONQA 3RZCD 2XT1B 2OSYA 3HB3D 2FL5A 4UDTA 4P5TB 4EI5D 1KJ3L 3FQUB 3SKNA 2BOLA 2XKSA 4YR6B 1UQSA 3C2AH 1JNNL 2EIMB 5DR5H 1SXAA 4WHDA 3PXHA 3O2VH 1DO5A 3GBNH 3DARA 4GAAA 1EEZA 2C8NA 1KT2A 1YMMA 2CDFB 2PXYA 4HJ0C 2IANA 3RP1A 3U46A 3ZY7A 5KSBF 2CUIA 2AK1L 4NM8H 2E7BA 4KO9A 1E6JL 2V2XB 3LIUA 2YD6A 2C4XA 4N2FA 2XU9A 4N2NA 4PD4K 4OI8A 2V5TA 1HL5A 3N5AA 4GP5B 3SY6A 2ZJSH 4M1CD 3EGSA 4WJ5A 4RFEB 3CN4A 3LKSB 3QHTC 3CVDA 1EJ8A 1KEMH 4Z77B 1HDMA 4Q2ZB 1UA6L 4ZMTA 3TN0C 3DECA 1QZ1A 4RFOH 4PV8A 1DN0B 3K2IA 4J8RB 4RIRB 3CFTA 2FWSA 5D7JA 3VVWA 4XBMA 1VKXA 2EDRA 5LN8A 3LQAH 4CBPA 5E24E 1I7ZA 5T1MB 1RJCA 3EJYD 3MJ8B 4PY7B 3ZPDA 3D2UD 1CXIA 3QW9A 1TSHA 3KPSD 4NAQA 3H42L 1CIDA 3LD8B 3UDWC 5FF6B 3UAEA 5D96B 1KBKA 4N2EA 5F3HB 4K7PL 2JELH 4QNPF 1KB5H 1KCUH 1OPGL 5GRYA 5LQBL 3FRPG 4PVMA 1E28B 3E9TA 1D6VH 1I8UA 2WC7A 4IDJH 3P11L 4M6NL 2P8LB 3OKDA 2WOBA 3FCUB 3Q5YA 3SOBH 5I5IA 5BQ7A 1A6PA 3WFCL 2I7SA 2ZOOA 2VCOA 3SEPA 4M7JL 3P4MB 1KTCA 3AZUA 3NJIA 4PEEA 4XCYB 1W8OA 1PZSA 2CMRL 2D8KA 2AS5M 1WWWX 4TUJA 1MVYA 3LMJH 2YD0A 4QYOA 1RZIB 4FKEA 4IMKA 2I25N 2LU7A 2JJVA 1J12A 1UD5A 1X4ZA 4XCCL 4BV1A 4JS7A 3CSFA 4O4YL 4H44C 1KYUA 3GSXB 2WO3B 3QEUA 4X9IA 5CJBA 3UTZB 4U6VH 2YGQA 2FX7H 5DD1L 3N91A 5C2BL 4B97A 4U6TA 5AW6B 4ZUUA 5KWYC 5ALBL 4I1PA 1UEMA 5CP7B 2EYTB 2ZP9A 1R3KB 2BNUB 5C0ND 4G83A 5I23A 5ACZB 1F6AB 5GGTH 5M94B 2FR4A 2H3XC 1YYCA 4TPRH 2IALA 3GHEL 1N0LA 3T77B 2IGTA 3TCTA 2J5LC 5DRNB 1O9WA 3NZHL 2DW5A 1N3NB 2MOQA 4YHKL 5F7UA 2BINA 4P04A 1ODAA 1J5IA 4JZNA 1AOZA 4OBRA 1MREH 4W4NA 1AY1H 3HAEG 3ZJAA 2H1PH 2H5UA 1AR1C 1VEPA 1Y6KR 1Z2KA 2F19L 2F5AH 2XZQL 2RMNA 1BXVA 4MYWB 5GRUL 4ALAL 3AWFA 3D1MC 3R06A 2VB5A 1RVFH 3QUYB 3MV7D 5A2BA 4QPEA 5JO5A 1AC6A 5B3NA 1RUAL 1OAKH 2CKNA 3HZYA 3DETC 4TKWA 2HYMA 2NYZA 2QSVA 4OCYH 4F57H 3G08A 2BP8A 1UCTA 2IAMA 1T7VA 2EO9A 3SE3C 3MUGA 2DZEA 3CFJA 1XAKA 3QO0A 4P0DA 3E8UH 1J8HA 4FLOA 3UC2A 1YY8A 2H32H 2PPFA 1F4WL 1A7NL 3IBEA 1DVFD 2DPKA 2F54E 3JUZA 3WNMA 1MWAH 1E4WH 2HA1A 2OM5A 4JO1L 3TC9A 4AMKH 2E8ZA 2XX0A 4ODUA 1NCBL 5FO8A 4MA7H 2EC9U 2DQHH 4QNPE 1ODUA 2QVIA 1KELL 4GBXC 1MI5D 1A4BA 4KV5E 2DMCA 2ZX8A 4YDVB 2CR3A 3BZ4B 4S1SH 2QPFA 4PVNA 3LEYL 1FL5A 4GNKB 3IDGA 3L3JB 1EZSA 4CVWA 2GUYA 1TJMA 3S3PA 5LWYH 5TQ0L 5SWZD 3UZVA 1D2OA 2W81C 3MRNA 2X9XA 2XN0A 3LJ3A 1B4JH 4Z76A 4H1LB 1NPNA 3I02B 4MJHA 1RH8A 4FG2A 1X9UA 4GMTL 3A6BH 4AQ1A 1X7TA 1CFSA 3PPEA 4L37A 1NKRA 5A2IH 1AP2A 3LH9A 1MIML 1WHOA 2R69H 1E43A 1I9IH 2V37A 4FTDA 3SGEI 1VSCA 1RKRA 1TEGA 4JM4L 1MCDA 1H3UA 4N5EC 3W1ZA 5AB0A 4U1JA 3D0LB 4D9QE 5LAXA 3QIWA 4MD4A 4OR1A 3M8OH 4F37F 5EU3B 3B2VL 3RWEA 4N0FB 3IDJB 3PWLB 1KCWA 2EUWA 1UWYA 4JHZA 3VSQA 3VRIA 4HLEA 5EORH 4HSQA 4XO3A 1CO1A 3HLAA 3FU3A 4JPQA 2OMUB 1SFDA 1TZGH 1U6AH 4WFEE 4NLHA 4JFHD 2IO5A 1VPOL 1OP5H 5ANHA 4AY0A 1AGCB 2H6PB 4F7PB 4ALAC 2DMHA 4OKDA 3QUZD 2OR8A 3WLWD 1XBRA 1T4KB 3Q2LA 8FABA 1NAMB 1NC2A 4CADA 4LSQH 2NY1D 3HZMB 3OAZK 2P5ED 2HKHH 4MMXB 4DP1X 3UMTA 5LJYH 4KKLD 1MFNA 3PP3H 2JQZA 4R96A 1T0NB 3CIQA 5IJBC 4PJIE 3SGJC 4JKPH 4OZIA 3KXFA 2WXFA 2XOTA 3T65A 2AEWA 2LGNA 1CCZA 3BP4A 3SDAD 1BBJB 2ZUUA 2DTSA 4AZUA 2FECI 2C7UB 1ZANH 5L0QC 4N6RA 2JJWA 1FE8H 2YXVA 3FO2A 2O5NA 3NZ8A 3J2PA 4H40A 5I1DB 2DLEA 4LP8A 2TAAA 1KIQB 2GQHA 3K2MC 2X4SA 5A6IA 5TPWL 4XN9A 1ORSA 1E9PA 3DROA 2IQAA 2R27A 3FQWA 4PV1C 4YZFE 1TMQA 4PJHA 1F1DA 3KLSA 4X6BA 5FWQA 4G1MB 3GS4A 4Q9RL 1UYWH 1OSZB 5KUMA 4QJ5B 1OGAD 2ATPA 1RFDL 2Z7YA 1QZNA 4G43A 2X4TB 2H2SC 4U3SA 4XMVA 4A67A 3SZKC 4P2QD 2JIXB 2HMID 3GMMA 2J2ZA 2X4PA 3FW6A 3PWVB 1T2XA 3FFDB 3PGDB 1UH3A 3DMMD 3T0VA 4XPTH 2V7NB 1CBJA 3ETBF 4IBQA 2E56A 3IDNB 4YO0B 3CTTA 3FB7B 5AFAA 3UPAA 2DF3A 2DWEB 2CA3A 2QPSA 4HCGA 4FNQA 2VDLL 2KBGA 1BBDH 3BKYH 1GJIA 1EHLL 1YDPA 4UOW1 3VFNB 3UGXA 1YY9D 3VI4B 4ZMQA 3TCLA 4HKXA 1XSJA 2XTJD 1DLFL 3TJEL 5IUCA 1HJCA 2AZAA 1D3CA 2Q20A 2XVBA 3U2IA 3WXVL 2B1OA 4P9HL 4XOBA 2MCAA 4DP4X 2DLFH 3FTWA 3HMWL 4D0CA 43CAB 1HZKA 2W0FA 4OM0H 1TFPA 2IIJA 4HIHB 3IU4H 1DL7H 4ZW6A 2A0LC 3V4PA 2KPNA 1F97A 4JY4B 5DQJB 4PYHA 4ZFZB 3S48A 2N0KA 2FBRA 4CGTA 2MH4A 2W91A 4JG1H 2FRGP 3IMRA 2VH5L 5AUMB 3DJTA 4JFTA 1CU4H 1XGTB 3L3OB 5DURB 1E4XL 2YFNA 1ETZB 3NJGA 2OTWA 1E3ZA 3GO1L 3FU7A 1NCWL 5DD3L 1BPLB 1MCQA 5CM1A 2PYEA 5EA0L 4Z0XB 4ZD3L 2Y7SA 1X7SA 1G6VK 1G1OA 1OO2A 3ZUCA 1EDHA 2EIBA 2J21A 4J3SA 5GZNA 3CDYA 1YEEL 2XY2A 3RTLA 4HWBL 2OX5B 3KW7A 4QR7A 4JKMA 1CC3A 4P4KB 5CU5A 1CLZH 2IF7A 3CMGA 4HAFA 3EYFA 4RISH 1M71A 1H3TA 4RA3A 5LGHH 3ZKND 4NZDA 4TUKL 3ZMNA 2NZ9C 3DTXB 4Q6YA 4ELMB 3L5HA 2VN7A 2NX5B 4YDZA 1BOGB 2JKRM 3MFGB 4KTYA 1HWHB 2VW6A 2IWFA 4FEMA 4M7LH 4WKXA 2VXVL 2ZXDA 4XNUL 3WLBB 1GSMA 5KW9H 3T3MB 3VDBA 5BZWA 2VWEE 4J3OH 1VIWA 1DDHB 3C5ZD 2YRZA 1K4DB 2NXYB 3L7FB 4LU5L 3ZE0F 3MLXH 2VDOH 1JFQH 5FEBA 1XMWA 3DTUB 4NQDD 2XTLA 3FB5B 1IIKA 4NI3A 5AVZB 4YDLB 2XXFA 4L8CB 5I9QC 2AVGA 2XPZA 3NK3A 4GPVA 4NZTL 4R7XA 3MN8A 4F3FB 3N41B 4XB7A 4DN3H 3AROA 3F58L 1F90L 4JY6B 5FF6A 5I6KA 4NQEB 3UO1L 1YMME 3DXAA 3QE5A 3HI1A 4XVTL 1N5YH 1L9RA 2VXQL 3V0FA 2UXFA 1CD1A 1E28A 4J4PA 3LOWA 3LN5B 5ALCL 1EAPB 1QR1B 2WWMC 5D5MB 3RHWF 1A5FH 3N43B 5IFAL 1JIBA 1OP5K 5IB5A 2YD1A 3MNVB 2Y24A 2DAVA 1RZPA 3P4MA 4FYQA 4XNMA 4AEEA 5I8OH 4B9YA 3NEXA 4XCYA 4C83B 2CSPA 3B56A 1OAXL 1B6DA 1YC8A 3KLHC 1SN2A 2F8XC 2J43A 3AG1B 4MBRA 2EDFA 3RNKA 1ACXA 3MBXL 3UERA 3BLBA 2EIEA 1RZIA 3MV9D 2X2YA 3O6ML 4P9HC 4FQCL 1J1PL 2VMEA 3T2NL 1FZMB 4DTGL 2BSTB 4MJID 3EG9B 1DQLH 2B0SL 3VM5A 5FGCB 4IMLA 4CW1A 3FU8A 3FUIA 3UAJA 3D51A 4X7FC 5J11C 1E6OL 1TPXC 2PYFB 3RZCC 4XVUD 5FLVA 3FT3A 1J1XL 3HB3C 4QY8B 1B4LA 4EI5C 4ZI8A 1HH6A 1EEUA 1DBKH 2WKLA 3ZL4H 2BIHA 2XNAA 5CP7A 2WKOA 3WHXA 2Y4SA 2BNUA 2BO0A 2HH0H 1I1AB 3NJNA 3S96B 4PTTA 1I4FA 4XBGA 3MLVL 4Y1AB 5DO8A 3T2LA 4U1NB 1T2JA 1HL8A 1MUJB 2RA1A 2X6AA 3SQOH 4XMXA 4LLAA 3T77A 3UJTL 2QQQA 4I85A 2HVJB 3PL6B 2EACA 1FUNA 2J1KA 4L3AA 4N90E 4NZUH 4K9EL 5E8NB 1N3NA 3RPBA 5D1XD 5EIIG 2ZOKA 4M1CC 1U2CA 3GMRB 3DI3B 2XV0A 4RMWA 4OV5B 3LCYA 5HDOA 2YJLA 5DK0B 1NSNH 1T0OA 2V7HB 3H3PL 3O3DB 5DS8A 2FEEI 5DI8B 3M1OA 4G8EA 1MFBL 2GYSA 3QUYA 2AJXH 1MLCA 5EU5A 2O5ZL 3AAZB 4Z7NE 5FA4B 5GRWA 4UT6H 5FYLD 1JCVA 4LARL 1ZJAA 1PY9A 3DPDA 2PNDA 3L95B 2RFXA 3QULB 3EJYC 1D7CA 3PAVA 4FZEH 5EH1A 5FYJD 4V2CB 2CLZA 3TYGH 3MRQA 4UV4H 1PD0A 1ZY9A 2FWLB 2VDKL 1U4FA 4FA8A 1GZHA 3NJMA 4JDEA 1AQHA 5CLTA 5HHOB 2DQMA 1JCKA 3LKQA 4ZOAA 3F6IA 3TVMB 3MX0A 4YXKL 3GSNL 4HBQA 3QQ3B 3EO9L 2ITDB 1M7IA 1ICTA 3ULVH 4KAQH 1T3FB 1A0QL 1PLCA 2C3XA 4LSTH 3B4NA 1CL7I 4A7GF 2E27H 5D1QC 3FQTA 3W0WB 4YDVA 4FG6C 1QNZH 3X3FH 2K8MA 1L0PA 1IILE 3BZ4A 1K8DB 4CVXB 1AKPA 3ECBA 3U4EB 2GY7B 3UBGA 4ENZA 3II3A 1INQA 2CNYA 1IBYA 4LDOB 3V8CA 4OZIF 4N4YB 1E40A 4MQXD 3VFSA 1AGFA 3O3UN 2GTQA 3L13A 2CRYA 3KBEA 1S7RB 4H1LA 4DK5A 1W80A 3RWJB 4QTHB 3EH1A 3A4FA 2AEOA 3E1F1 2CKBH 1YPZA 3IJYA 3ISYA 3STZB 1EVTC 4N0YH 3ZYIA 4EN2A 1HL9A 2PCFB 5I1GL 4G59C 1J8HE 3OKMB 1KUMA 3IVKB 3OVUB 4WNJA 2CPUA 1M9WA 5K9KB 4FERA 5AOLA 2M83A 1ECZA 4N2KA 1NICA 4FQIH 3ES6B 4GW4A 3D0LA 4GG8A 2DQ6A 2ZX7A 3JVFC 2A9NH 3RDTA 1HHIA 2V3EA 1TTGA 3F01A 3KJ4B 2HP4A 2JKWA 4J3XA 1A6TB 2W07B 5ICXB 5B7FA 7FABH 4XVOA 3LNEA 3PWLA 2ZAHA 4ONGH 5I1JL 1SM3H 1QX1A 3W2DL 3I6GA 4K9EC 2B14A 2XIBA 4KROB 1H6FA 4OTXH 3TIDA 2AQSA 4TOYH 1O5PA 4RESB 3AM8C 3IXAB 1SLVA 1UC6A 4H88H 2J73A 2DL2A 4X6EB 1NOFA 1JHLH 5SWSD 1F4YH 3UTSD 1MCOH 3GJFH 1RQ5A 2EEXA 4X5PA 3QQNA 3HZMA 4OLZH 3RTQA 1Z9LA 2H6OA 4GRLA 4YDJB 2A77H 1TOXA 3GGWB 1OT4A 5E4EC 3WS6C 1SY6H 3O9WD 3FH8A 4UYPA 2ICEA 3VXUA 4MSWB 3FT2B 4PRAA 1YA5A 4XB8A 2X4OA 5CIPH 3BKCL 3LNFA 1JZ2A 3TH3T 4DGYL 4P59L 3GXFA 1QVOB 3KBPA 2V5MA 1HHGB 1N68A 2QMJA 2D7OA 4N8CL 3ZDWA 5JR1L 2WBKA 2C7UA 1Z1WA 1SBSL 2JB5L 3DUUB 4XNYH 4HJTA 4E41A 3K8KA 1XZ0B 5ETUA 1I3GL 4BFIA 2P45B 2HT2D 3TN0B 2IPTL 1KIQA 4XNQA 1NANI 4GXUM 3ARED 4TQ8A 1DCEA 1E90A 4F2FA 4NN7C 3BFWA 1VFAB 5FKPB 4JFEE 2A4CA 1JGIA 4NWTL 1DBMH 1OSZA 5AVUB 2QMKA 3W9DA 1FH2A 5JNYB 2CUMA 2X4TA 4GLRI 3UG4A 4L0YA 3NPSC 1BF2A 3L6FB 2JIXA 3EGXB 3F3HA 4LPUA 4IBUA 3MUY1 4K15A 4W9FC 2FQFA 3OJDB 4F8QA 1OK0A 3FFDA 1SGKA 2AJZA 4L4TB 1CQKA 4X0KA 4XH2B 4AITA 1P5UC 2AXWA 3FTUA 1O6TA 1QYGL 2V7NA 2BWIA 3FCSB 3OB0K 1G6RB 2IMNA 4RDQG 5IK3B 2E5EA 4ANUA 1Q0XL 1ERNA 3KD4A 1I3VA 3C5JB 2CLRA 2K8QA 2HRPH 4PGCA 2BIOA 1YJDH 4KMTH 3VFNA 3MODL 3KE0A 4ODSL 3BHBA 5HDQH 5K59E 3HS8A 4JO4L 5CZKA 5K39A 4GKNA 2X87A 3DOSB 3BOVA 1JZJA 1S9XB 3WJJA 1VADA 5HGDA 2Y5EA 3QUXD 2ZG1A 2VDML 1LD9A 3AT9A 4GUPB 4OCWL 4PJHE 4LPCA 1K4CB 4G8IB 3IDIA 4HIHA 1N8ZA 1IU1A 5B7EA 4JJ5B 3MV11 1LMKA 5AVSB 4HZ1A 5HHMD 4E42A 3QUZC 4JY4A 4PCKA 3L48A 4NP4H 3B9DA 4ZFZA 3WLWC 5C0GB 5IWLA 5TQ2L 1FAKT 4IBZA 2NY1C 2QADD 2JCCA 2QQLL 5AUMA 4M3JA 3QCTH 1WISA 4N5UA 1U8PB 3L3OA 1AKJB 4KKLC 1ETZA 3TNNB 2DLGA 2DQGH 4GO6B 1AYOA 1RL1A 4HGWA 1JF5A 2UVEA 4Z0XA 4NZJA 4LSPL 1GGCH 5JOPE 5D2LB 1OP3K 2J5LB 2NDFA 2WXGA 5FKAA 3WNLA 3SDAC 5DHVB 1DSFL 3BUPA 4EN3A 3JT0A 35C8L 4XGZA 5IW1B 1P6AB 2ETWA 4RRPG 1RIHH 3WFEH 4NRYB 4E5XB 5IV2B 4X7DC 4Q97A 3SKUD 1AR1B 2V0AA 2Z34A 4QJ3B 5JHBA 4G80A 3ESPA 3WENA 4BD4A 1NLBL 1QKZH 3M45A 4GQPH 5EZJA 2B4CL 3R1GH 1HU8A 5EN3A 1EXGA 1LLAA 1K4DA 4R7DA 4XXDB 4K5MA 2WKOF 5BZDA 5BV7H 3P73B 1A3ZA 2XCMC 2G5BA 2BOCA 4TM9A 3TOPA 4KZEL 3FB5A 2EZ0D 4IK6A 4KKAD 2ERJC 2XIDA 3H4HA 2NZIA 4JO2H 3ZIYA 5IOPB 3HG5A 3NSJA 2DEWX 3LKOB 3QNYA 4WEBH 1OD9A 4F3FA 2HMIC 2QFPA 1IV8A 4GT0A 3FO0L 5TTRA 4NQEA 5JPMC 3O4OB 1EPFA 3C08L 1U8CB 3MYZA 2ZF9A 3QDHA 4HD9A 1LO0L 3ULUE 3DMMC 1LE9B 5C1MB 2GY5A 3UJIL 1SOSA 5E6IB 4E2OA 3NIDE 1QR1A 3LXCA 2Y5QA 5MENB 5B1CA 4UTBH 2JTDA 4QXTB 2X9ZA 2X9WA 4NQQA 1FRGL 1YY9C 4LGRB 3SDCD 4HUKB 3JTTA 3NH7H 2XTJC 5F6IC 3SBPA 2F7OA 5E9DD 5ISZA 1ECYA 1EJFA 2FHFA 2GPZA 2WYZA 1UWEL 5KVGH 1U8MA 5I0DA 1T83C 2ZNXA 4PWFA 3T3PF 2O5XH 3O41A 3WN5B 4I18B 3QQDB 1G94A 1T04B 4ANKA 5KSAD 1Q72L 3HPJB 5F9OH 4LF3B 3ILEA 5FC9A 2BJML 3H1ZA 2EXSA 2YRLA 1FHNA 5IQ9B 1PY4A 5C97A 5LBSL 3VGAB 2F7RA 1I1AA 5FXCH 4QOKD 5D6DC 3QJUB 2KLTA 3ASOB 1G7MB 4U1NA 1TQTA 2RJMA 4F91B 1MUJA 2WNKA 1JPTL 2NQDA 1J8KA 1KLFB 3PHAA 5JW5B 3GSUB 2W92A 3STLB 2YGPA 3OKOB 4N8PA 1QRNA 4EEEA 3HVDA 4GXVL 1UURA 4J6RL 1CD0A 3C6SA 5CJOL 1W8EA 4G7VH 1EO8H 1UZ6F 3P3TA 1AQKL 4LIQL 5GSVA 3ZKNC 4S11A 3KGTA 1Z3GL 5DI8A 1GSKA 3HG2A 1V7NH 2I5YH 3K2UL 5FYLL 3TEWA 1YPZF 4FX5A 2BH0A 5DVNA 4QLRA 4M5TA 1VESA 3C5ZC 5ADPL 2B4CC 3QFJE 3QZWA 3L95A 4PJ5A 2AW2A 3RVUC 4YDKH 2Z92B 3QULA 4U7SA 2KKQA 4YE4L 2BY2A 3P40A 4KVCL 3ZKQD 1AI1H 4M6MH 4BSWB 1JPGB 4WF7A 2OI9C 1FFNB 1TEYA 1JTOA 1UG9A 1Z9SA 4K23H 4ZTOH 3ARGD 5FLUA 3H8NA 2AJSL 5MHSD 4NWUH 2DQCH 1AXTH 2KL6A 1ZS8A 4WLCA 3RL1B 1MW2A 2FZ3B 2R0KL 4LCYB 1I8KB 1RCYA 1TZHB 3RGVD 4WW2C 4B5ZA 4BWWA 5L0QB 1HINL 5CSGA 5C08A 3TL5A 4YX2H 1A3LH 1N0XL 5JIMA 2A9AA 1AS7A 5HYQB 3I50L 4R2GD 5KTEH 3W0WA 1S7WB 4FQ1L 1D5RA 3GBML 1MLBB 3ZHLA 3HS0B 4XRCA 2XWEA 5FUZH 1PNDA 3AADB 1U3NA 4QRAA 1C1EH 2VLKA 5FUOH 4BUHA 2A4ZA 3FRPB 2GTWA 1MQKL 4MNGA 4NDMA 4WFHD 2K6YA 4MAUH 4ZFFA 2YUXA 1EUUA 1S7RA 3ARFA 4OJCA 3KR3H 3QR1A 3X1NA 1DQTA 4HEMA 2DMBA 4LCWB 1OALA 4XVUC 4HH8A 3CQQA 2WYHA 3OKMA 3IVKA 1F4XH 3D85A 5E2UL 4Z8FH 3DI2B 4QRRD 2WPGA 3ARVA 2X2HA 4NQTA 4FCAA 3PWUB 2ZUWA 2EYSB 3HC4L 1BGXL 4XXCA 5E9AA 4L8SA 2B9BA 4ZMZA 2XFGB 2W07A 2AJUL 3WY3A 2IBGA 1G4RA 1NC4D 1LNUB 3PUCA 5DD0L 4L05A 5DZAA 2H1LM 2ZKHH 2JB6A 2NY7H 2WVVB 3F8UB 5D1XC 3VM7A 4X4YB 2DBLH 3K6FA 4KDTC 1ORQB 2BNRA 1MNNA 1NUGA 3IXAA 1A7PL 3VI3E 1WFOA 3QXDA 5A6LA 2LTQC 4F27A 4QCIB 4Z5RA 3VFTB 1XQ4A 2JKNA 3VH8G 1I1YA 1R3HA 4C4BA 4J2QA 4F15C 5ICYA 3ECWA 4JG9A 1HS6A 4KGJA 5BS0E 1M6UA 2FYYB 1SJVA 2P5WE 5DD6B 3CLWA 3RY6A 3U0WL 3WIHL 1AG0A 1IQWH 2N56A 3WFBH 1DQML 3OPZH 3HI5L 2O5YH 3QJQB 5BMFH 5C0BA 5CMAB 4ZTPL 1A7QL 5INCB 3DV6A 3HAEB 5EBLA 4DERA 1YEWA 3QDJB 1AHMA 4Z7WE 2HFEB 2OXHA 4YSOA 5CR1A 4CUCA 5T1KD 5KVEL 1FWXA 4PWGA 1MJUH 3TPUA 2K7PA 1ZTXL 3DUUA 4LFHD 2H8PA 1WJ3A 2CO1A 3WIIH 1YEGL 5B21A 2JV6A 4Z7QB 3OM3B 4J5VA 4WKZB 3RWFB 1J0HA 1ZGLP 3P0YL 1FL6B 1GJWA 4AGOA 1S3KL 4OD3H 4WTZA 1KENL 3OB8A 1S78D 2JCCF 1MF2L 2VXTH 2C9QA 1RMFH 3QI9D 3BMVA 2ZKYA 1HN1A 3MZGB 5D9SA 3QDMB 3PJSA 2WUBH 1ETB1 2BIQA 1SQMA 4MQXC 3FTZA 4RSYA 3L6FA 5DUMH 3EGXA 5F7LB 2E9BA 4RGNB 5GGUB 3ZTJH 4GW1B 3OJDA 3UDWA 2HFFA 4WUUD 4YLBA 4L4TA 4XH2A 2GK0A 5I0WA 4MX7A 3KLQA 5B38B 3ETSA 1HE7A 3MCLH 4I48A 5IK3A 1CGSH 2VERN 4PRBB 4V1DA 4DF9A 5J13C 3SO5A 3EDDA 2UZIL 1V3MA 3C5JA 2IFFL 3ML8A 1CBVL 2VDLB 2GABA 4Q6KA 3T3MF 4E41E 1JGVL 1J9QA 3EH5B 2E9GA 2QFRA 4I88A 1DVSA 1X7QB 4GINA 4G6FB 2NLJB 4KKQA 3QWRA 2E0PA 3T0WA 3PJNA 1FZOB 3O6KL 1X5LA 3HNTL 5CFAA 5DZOA 5AD0B 5K9OA 4GUPA 3B6SA 3D18B 1X5AA 3MRKB 3OHXC 4QRUB 4G9FD 3N41F 1I53A 4M5SA 3WE6A 5IG7B 1MRFH 4U49A 5D8JL 3SDXB 2EINB 2X2UA 3POHA 2JQAA 2ZOWA 3CN0A 1F4AA 1OHZA 4X4XB 4U6YB 3RZCB 3HB3B 3UABA 5JIPA 5JHDB 3L9RB 2I60H 3FB6B 1UD2A 4PIRF 2R2BA 1NIDA 5DZJA 4O02L 1H6TA 3CHOA 1SJEA 5FGBC 1GIGH 3MBWB 1HESA 3ARDB 3ECUA 1OKEA 1ZVNA 3U1QA 1F2XK 1Q9LB 3QUGA 3C6LD 3F7RA 5IBUG 1OCWH 2IXQA 1G5GA 4NHCL 5LDSA 3TO2A 4DGIL 5CEZD 2Y22A 2OL3B 1L9NA 4MXWH 4F2EA 3AACA 5IVXB 5I8KH 4NQCD 3SYPA 1G9NL 5F1IA 3PFUA 4I9WD 1KGWA 1Z9PA 3EF7A 1XGPB 4E5XA 3QG6B 4PB0H 5F0LB 3G6DH 5F96H 1OD7A 2HT2C 4PGBA 3MXVH 4H8HA 2X0WA 4ZFOL 3AREC 5KBNC 4Q4EA 3L16A 1EZVY 4KKBD 1F18A 5CD3B 2R29L 5D72L 4KJQD 3V0WH 1J5CA 2BWQA 2LFGA 3NCBB 2BIMA 1T5KA 1ZK5A 3CU1A 1U58A 1BM7A 1FFPB 1MCWW 1O6SB 4JFOA 3SE3A 1WA0X 2JCCE 3P4LA 3NEEA 3OSVA 3V0IA 3V52H 1MG2C 4N2DA 1AXIB 5DU7A 1IAIL 1UACH 2Z31D 1U8CA 3UBXG 3TBTB 1LE9A 3V0HA 4ZAKD 4ZX4A 3QWNA 3H7BA 1Q9OA 2E3VA 3RY4A 1TCMA 2DQFB 1EIBA 1HNYA 1QI5A 3KPNB 5MENA 4QRSB 3BT2H 3FH7A 5DYOA 3BDYL 2BDNL 2DYRB 2WM0A 4MAYD 4OFPA 3V0EA 3MOBL 4UIMB 4GBXA 4M5YL 3D33A 5D1QB 1BX2A 1KN4L 1FQ9C 1MAML 3GQFA 3N50A 2BNQA 4BKSC 1E4HA 2QVTA 5IGXL 5IUSA 2ICWI 3EYUL 3FU0A 1IC4H 5EZLA 3F6LA 1OSEA 2BSSA 2FJGB 2CJ3A 4UM9D 3K0YA 3QQDA 1MFAL 2UXVA 1V3LA 1JV5A 3IAQA 2N1TE 4ZUWB 5TE4H 3BDXA 1B2WH 3AUVA 3B2UD 4XO8A 25C8L 4LF3A 1P1VA 1EFXA 1QPXA 2Q8BH 3NJJA 5FGRA 2J7LA 3EYVB 4UB0H 3WCYA 1O5DT 2X40A 3BWZA 4KDVA 1AGEB 3E6HA 3QJFB 4GXUN 1UM5H 4Y8AA 4Z9KB 4W9GC 5JOFB 1CXKA 1GVIA 3VFPB 2Z8SA 1G7MA 1T5WA 4XC1H 3H0TB 4L3EE 3KLAA 5LCVH 3CFUA 1KLFA 1ZSHA 4HC1H 5JW5A 2R4RH 3BZEB 1VFOA 4PREB 4H26B 5D4JA 2AXGB 2FWOA 4OAWB 4OZFG 3ZTDC 4BZ1L 3L1GA 4S1RH 3FSZA 4AGQA 5KVDL 3TA4D 2CHXA 3PHOB 1G9NC 4N24A 4S0HA 2ZCLH 4NYLB 1MFCH 3HPLB 3W37A 2Z6FA 1HKLH 2F8VA 1EQWA 5ISZE 1C16A 4U4IA 3WNJA 5D1ZI 3WAKA 2HB0A 4TTGA 2FSDA 3LTVA 1Q9KA 4YBLC 3RL2B 1N12A 5EOCL 4LAJH 2EDYA 1YYLL 2W0LA 4HJ1A 1HCZA 4BXSV 5C8JB 2RD0A 2XXGA 1GJUA 3O6FB 2V4LA 4LFHG 4PRNB 3CXDH 5FO9A 4FQHA 2WXNA 2Z92A 3MROA 3ZR5A 4JCLA 3VA2C 2LQRA 4XPFL 2FBJL 4PB9H 2EZ0C 2PCPB 3PHSA 4QRPB 1JPGA 4IJ3C 5DUPH 1FFNA 4LSVL 3S98A 5FCUH 3SGJA 2KH2B 2AMUA 3S3CB 5CZXD 2VDKB 4X8XA 1A47A 3S88H 2AI0L 4KXZH 3RL1A 2FZ3A 2CUHA 1GS8A 4IKLA 3L5XL 4NUJA 1WGOA 2K1MA 1LQBC 2ENQA 3GSNB 3P2DA 2HXAA 5SX5K 4BKLA 1QRNE 4HXAL 3HR6A 4GY4A 1U8IB 2COVD 4FC3E 3U0TA 1PS3A 3TEYA 4HFWA 1QLRA 1MI5B 4MNQA 3AT0A 3SDCC 9CGTA 5HHVH 2FGZA 2K4WA 2WVTA 3SGKC 2UX6A 1QSFB 1MLBA 3FSVA 3CVHL 3D07A 4NKOA 1KIUB 1UGKA 2OR7A 4S2SA 3IT8D 3AGWA 2YAQA 3ABMB 2SEBB 3FRPA 1RSFA 3NPSB 2R8SH 2NY4D 5IQOA 3D39E 4JFZH 1OSPL 2FEDD 5KSAC 4QTIH 3ROLB 2R0WL 4GUOA 3SPGA 5GS0H 3RUGA 2HX8A 2Q0ZX 4HUCA 1ZWIB 2IPKB 3BI9X 4DGVL 5CCGE 4I87A 2VJ0A 4DP8X 3MUJA 1ZT7B 4D3CH 4AZ8B 3GI8L 4LLWB 4KGLA 3L1OH 3PWUA 1BVLA 2EYSA 3BN3B 3CHPA 4H25B 2VQ1A 5DQ9A 4F37K 2PWGA 1XH3A 1H8OA 3C5SA 4XVJH 3JWOL 2MQGA 4JL1A 3SGEH 1J05B 2R1YA 3QAZC 5E56A 3WUWG 1UJ3A 2DIBA 2FT6A 3A47A 4KNTA 5AW5B 3LNDA 2WGXA 4MCMA 1O75A 4B0MB 1ZCRA 4BH7B 1BXUA 1A6AA 1DVQA 1A7BA 4LLUB 5CS7A 1OZTG 2D7NA 1T7YA 3VFTA 4N2AA 3PDOA 1IC7L 3V4VA 4OF6A 4HIIB 3ZHKA 4OSUL 4WGVB 3QSKB 3QUZB 4NKDA 1S2EA 2CHZA 4NCC1 2IEPA 4KVNL 1MJJA 4BZ2A 1BAFH 4JM0A 1OCRB 3VXQA 3AG3B 2ZSVB 1OQOA 3KPQB 3SCMB 3MLWH 4GJTB 2OULB 4N6QA 3F5WA 4EXKA 1QLFB 4MMYB 4G70B 2ITCB 5CMAA 3HAEA 4E9LA 2X4NB 3G6JB 3UCQA 3CH1A 4MNHA 4C56E 1CT8A 2R59A 4DIXA 4ATTA 1UD4A 4BUQA 1U21A 3QUML 2HCZX 4TSBL 3IBOA 3JV6B 1EBPA 1IBFA 2WLLB 1YHPA 1FLRL 1X4XA 1QQDB 5HYSG 3RGVC 2EQDA 1DVYA 2E4TA 3ARZA 4X6CA 3IJEA 2X2JA 1WFTA 5I6OA 3EOBB 3IMTA 3OX8A 1OAQL 1R3IH 1JZ7A 3CCHA 3NJLA 5EMYA 5I76B 4R2GC 4WKZA 4G3YH 3TF4A 4YHIB 4WUKL 3EBIA 4FZ8L 4LEOB 3SE9H 1FL6A 3EJPA 4XC3L 5T3XH 3L5WB 3BGMB 3G3LA 4M9OA 5I1EH 2IMMA 1LO4H 4WQOA 1BD2A 5E2WL 4HGKC 4L1TA 4GAGH 1D7DA 3QDMA 1OGAB 1RPKA 4EZMA 2EDJA 3DPBA 3R4DA 2QSCH 2G30A 1G7HB 2J1WA 4C57C 4FHKA 1BSIA 3NVQA 2PCXA 3WO4C 5JPMB 3EHBB 5T33H 4FS0A 3AY4C 2F5BH 3HRZB 2X6BA 2UZPA 3DMMB 1T5XA 1P1ZA 2DLIA 5J1AB 1CN4A 4PJ7B 3KS0H 2Q86B 2AJ3B 5H37G 4LPYA 3B3IB 2Z7ZA 2HKFH 2G4GA 3OC5A 1S9KC 4UV7H 4HBCH 3JWOC 3MUZ1 4AYGA 1X7QA 4GMSL 1P7QD 2XTJB 4LAQH 5F6IB 3VXRB 3IGUA 2XN9D 1CDBA 4OQTA 3BKJH 2D7TL 1XF3A 4PP2B 1YEHH 1TF4A 2A73A 3KPRE 4HS8L 5AD0A 2VM9A 1ZT4B 4YXHL 3DVNB 1J5HA 3MRKA 3FT0A 3KJ6L 3RURA 1HILA 4U1HA 2CZNA 5IG7A 4OLYH 5B1JA 2Z0BA 3UGEA 4JHUA 3B1UA 3RZCA 2WJ7A 2ZKWA 3BVDB 3OLIA 4NIKB 4R4BB 3L9RA 4EI5A 3S5LB 3VMOA 2BIPA 4KTDH 4XNAA 3WDJA 3WD5L 3PF2A 4LMQI 4BQCA 3BUYB 4I9XA 4L18A 2F54D 1Q9LA 2Y36H 3B2PA 2R4SL 1J0KA 2XA8H 3Q43A 4HIPA 4N9GB 4V2BA 3V4UL 3ZVVA 5CEZL 3AS3A 5CBEB 4YFDB 1MCHA 4R97B 3T1FB 5D2NC 1WT5C 4KFZC 1UZ8B 1B90A 3K3QA 4M8QB 4J1UA 4L1HA 3WDHA 4DEUA 1WE5A 3QFDA 2G2PA 3QO1B 3QXAB 1FYTB 4HWBA 4BK5C 43C9A 4J3BA 1FJ1A 3L3GB 2W9EL 2CGZA 5IBLD 1K2DA 2IGFL 2OJZL 4HAGA 5CGBA 4X4KA 1OZUA 3GBDA 3CK0L 3BEVB 1O9VA 1S78C 5FDYA 1A6WH 5HYJE 1R5WB 3QI9C 4AV4A 4ZUSB 1EERB 1U41A 1EHNA 2GK2A 2PR4H 1BQUA 3DDFA 4BFEA 1KDJA 1O6SA 4OZHE 3D2UA 5AW7B 4OD1L 1RERA 5EFIB 4ODBD 4WHTA 3WU1A 3KPSA 4AEIL 4FG0A 2NUTB 1J1OH 1T89C 3SODB 4FYRA 3GFUA 4L5FH 4RZCB 4XHQA 1BLIA 4NM4H 1RPQA 3OGCB 2VXQA 2W94A 3RHWK 1I7UA 1ZV5A 4WSGA 4Y16D 3PNWB 5TK4A 5C0AD 4HAKA 3I3BA 2ZX6A 1HHJA 2UUDH 2WINA 3QCVL 1PPIA 4TL5A 4KO5A 4MCYB 1E0OB 1LTXA 2OJEB 3FOMB 3CIAA 2XYCA 4I3SL 1S7SA 4JM2B 4P2AA 4WFED 5DRWB 5E1QA 1V3KA 3V9EA 1AZNA 1RP8A 2MMXA 2Y3NA 5F7MC 1L6PA 3S0PA 2G60H 1AAJA 1KTRL 1SEQH 2FJGA 3OAUH 4UUJB 3DX3A 5JYLA 4WI7A 4ZUWA 5L2KB 1C08A 2XG4B 3MFFB 3FDWA 3KPOB 2VJXA 3DURB 1L0QA 2KERA 3F7VB 2OZNA 1R33A 3KL3A 3LRHA 4BFNA 4KHTH 5AZ2L 3QJFA 5JOFA 3I75B 4JFFE 2FD6H 3CBJB 5EC2B 3VFPA 1RULL 2OYPA 1JDAA 1W0VB 3D69B 4H8WL 4ZX6A 5IHLB 3MRBB 5ITBH 3C6LC 3WOVA 1RUKL 3OD3A 4AV5A 3O0RL 5EF1A 3A67H 2LAAA 5E8DL 1TDQA 2L4OA 3V2AR 1QSEB 3ZGIA 4JFXB 3WE1A 3RA7L 3GPEA 1P4LB 2X6MA 3FFCD 5A3IC 4UINH 5K5YA 1NCUA 5T1LD 2NMSA 3PHOA 4M43L 3JVGA 1IC5H 2YZ8A 5GISH 5JIQA 3ZO0A 2LTQB 4MS8D 3KWTA 1XBDA 5D93C 4R5TA 4Z0BH 1MHEB 4AL8L 1GW6A 1DLHA 3MV7A 4BFBD 2BP5M 3QQ9D 3RUGF 1T1ZB 4KKBC 1M7UA 2F53E 4KJQC 1TENA 2IDCA 4XT1C 2W9DL 4QXGL 4MXVE 2AEQL 2OXGA 4KZCA 4PJEB 2BS9A 2R56H 4Y5VC 1E2WA 3SQBB 1NEZG 3WS6A 3SKJL 1S7VB 3U6RB 2J1YA 4GQZA 4LCIL 3VB9A 4WV1B 1DEDA 4QLWA 4M8VA 3W39A 1UM6L 1IC1A 3GZKA 5AWNH 2Z31C 4A6YL 1Q1JL 4LHUD 1DVFA 2CHNA 4XP4H 3J07A 5E1GA 4PJGB 4ZAKC 3RJQB 2ZXBA 4UDUA 3NUKA 4WU5B 2X6CA 1CICC 2A7BA 3OXRA 4EJ1C 2ARWA 4JN2B 2HJFA 4N1HB 2MJWA 1G7PA 4MAYC 3CDCA 2WJ5A 1BQHG 3GUFA 3MCG1 1MI5A 1WS7A 4X8GA 1G7IB 1GGBH 1ZLEA 3AXLA 4HISA 2VLLB 3WI9A 5DMYA 1CL7H 3F83A 3EJUA 4YBHA 3VJ6A 2EUVA 1X9LA 1TJHH 4OIAA 4PLOB 2XN2A 3DYMA 5SWZA 1T21B 3BP7B 1T7ZA 1BFSA 4GW5A 5G4OA 1OP4A 1WK0A 5HY9B 1OEZW 1RJZB 1RJYB 3B2UC 3BPCB 5KYXA 4L8BB 1TIUA 1P5UA 3HLKA 4PJ8D 3SE8H 1ZWIA 4X6CF 5BRZE 4NO2A 3NP4A 1CGUA 4MKTA 2X1PA 4C4UA 5J13B 2DTML 4RCAA 4Z7QF 1F42A 4H25A 3AS2A 3DYPA 1S7XA 3SKMB 2VDNL 4IHOB 3I9GL 4H8WC 1UT2A 4PRIE 5I30H 3JZ7A 1MIEH 5KYNA 1KMGA 1JL8A 1DBAH 4Q58C 2OMWB 4GAYA 2ZYRA 4UT9H 4NSKA 3P3RA 1N64L 3R0NA 4WAFA 2KMWA 4NOBA 1IEAA 4XP6H 4YDNA 2EE6A 2ZUQC 2RQ8A 4MNQE 3D30A 2ADIB 1NFDE 5BW7A 2XBZA 2G2RB 2FLMA 3DUSA 3T6QC 3OHXB 3VE0B 3U7WL 3IGKA 3PREA 4ZPTB 4GOSA 5CSZA 1XIWD 3IMWA 5JDSA 1E4JA 4AL8C 5I1IH 1KBGL 3QUZA 5E5UB 4YOKA 7CGTA 3OWRA 2X88A 2VSKB 3BN9D 4RWYH 3AB0C 3A5VA 5DQDL 1NGPL 2A9BA 2P5EA 2RGSA 2ZSVA 3CZNA 1XGYH 4TV3A 2X70B 5ESVA 5EIIA 4LGPB 3B7RL 3RUGE 1GPOH 3MCYA 1EDYA 4NQVA 4Y19E 1QRKA 2AABL 3ARBB 3CFNA 1DJXA 2P44B 4GSDH 4NKIH 1JG9A 3K2KA 2ZXWB 2OKMA 5GGVL 2WLLA 3VA6A 4BEIA 3SDAA 1UWXK 2V2WA 4BYHA 4P2RE 4H0HB 4ZYKA 2CU9A 5F9AC 2GTZA 3CSTA 4ZXBB 3E2HC 1LL1A 2E9WA 3PQYE 2Y6SD 4OLVH 3RZWA 2XQBL 3GK8L 4XWGH 5I76A 4L2YA 4FRWA 1MDAA 4XO9A 1JN6A 3AREB 1VB9A 3OV6A 5JW3L 1SXBA 3L5WA 1KJMB 1JS4A 1QO3A 1K6QL 1M1XB 5AENA 3K4AA 2Y2YA 1NANH 5FHBH 3BUQA 3VXTA 1OGAA 3VTAA 5IBTL 4ZDHB 2JSFA 1GRWA 1G9HA 1IRAY 4P2QA 2DIAA 2NY4C 4DSYA 2FEDC 5D70L 5JPMA 3WFHA 4GLRH 5EEWA 2I7OA 1RIVH 2VR6A 2WUCH 2Q3AA 3DMMA 2DH2A 2HWZH 1SDAB 2GB2A 1IKFL 4PJ7A 2Q86A 1SUHA 3EBAA 4TRPH 4ZO9A 1U3HA 1A4AA 4L4JA 2Y1AA 3B3IA 5DHYB 4N90D 4O00A 3V9FA 1C5DB 4XN8A 5BOJA 1C9SA 1E9OB 5DMJB 4Z7UB 5EOQL 4EQ2A 4HS3A 3IN2A 1IGCH 3CU7A 1LO5B 4O2CA 2VNCA 2D0GA 1MCEA 5DRXA 3DRTB 3ZYOA 5MP6H 3O3BA 4FF9A 5JTWA 4X83A 3KAAA 4HFUH 2WXMA 1T83A 3OQ3B 2A9ML 4KNUA 4L4VB 1BD2E 4ACPA 3PIQA 3O6LH 1NAMH 2BSDA 3TIEA 1A7RH 1N59B 3V6FA 3EDEA 5A16A 2QDWA 4WVRA 3CQFA 2D3LA 2QVKA 4XMKL 5IJVB 3VW3H 4B6ZA 2Z8RA 4JDVB 5EF0A 1YEJH 3IFLL 1IFGA 1KTJA 3DO7A 1MFMA 5JQ6H 3P0GB 2NW3A 4XTRD 1F1GA 5JMOC 5CUSH 4DP6X 1ZVSB 4N3TA 3IAPA 2ZWYA 1QHPA 1ZXQA 1EUTA 4HXBH 4QKXB 4YSDA 3WEBA 2AMGA 3OHMB 1XXDC 4BCYA 3IE9A 4BK4A 2C1OB 1RZ8B 1UZ8A 2IBBA 4LCCC 1AQ8A 4P46D 4PJCB 1KEGH 3QXAA 2Q76B 1CYWA 4UT7L 2WTRB 1OT2A 4NKMB 1JK9B 3L3GA 3SSGA 2ARJB 1FH5L 1INDL 2FJFB 5F7YC 5KBMA 3OLDA 3PGCA 5AW3B 1NGQL 2ZD0A 2AF2A 4LHUG 3H55A 5ITFB 3GRBA 5T3XE 2VLJE 1PFCA 4F5CA 2R2HA 4ZFOB 2ZP0T 1UT9A 2M2DA 3C5ZA 4ANVA 4ZFGL 3NFPB 1NCOA 4KX7A 2EDLA 1A65A 1PZ2A 2CE6A 2VXSL 3X12B 3A24A 1QFUL 4NRXB 4RMSA 2YR3A 4LBEB 4XPAL