1J5DA

Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 19
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j5dA00
3X1GA 2BW4A 2EILB 1BXUA 2IAAC 3QJTB 1GS6X 1E5YA 3FYIB 2CBPA 3HB3B 1AANA 1BQRA 1OOWA 3MBWB 4BXSV 1BAWA 2YARA 1OV8A 2QPDB 2XVBA 1PLBA 1IKOP 1KBWA 2BP8A 1BQKA 1V55B 1GY2A 2PPDA 1CC3A 1OE2A 2B3IA 4HHWA 4A67A 2HXAA 4A2GA 5I6KA 3S3CB 4CSZA 4W1TA 1AS7A 2FQGA 1RCYA 4A2HA 1BXVA 2JKWA 1JZJA 4YL4A 3WKPA 2I7OA 2PPCA 4KO9A 1AS6A 1ET7A 1SF3A 1AQ8A 1A4CA 1ADWA 4K9JA 2UXVA 3PAVA 1CYWA 3NJFA 1N70A 1KGYE 2GC4C 4AX3A 1F56A 1NICA 1NIBA 1PLAA 5I5MA 1JVOA 3BQVA 2HX8A 1HAWA 4QKTA 5AFAA 4ENZA 3FQYA 1SHWA 4KOBA 1SJMA 2Q5BA 1GS7A 2IH9A 2VSKB 3FU7B 3CG8A 4CSPA 3ZX1A 1SDDA 3WG7B 3QPKA 4DP6X 3ZDWA 4KNUA 5D4JA 2XV3A 1DYZA 4HZ1A 3ERXA 2QDVA 3DTUB 3NYKA 1AZBA 1J9TA 1PNDA 3NP4A 2AVFA 2YAPA 2FQDA 4PAZA 1JZHA 2VSMB 5B1AB 3X1EA 4A2FA 2X87A 1OE1A 1PZCA 3ABGA 3NSDA 1OCZB 2HRGA 6PAZA 1JZGA 3NJHA 4W9ZA 2W88A 4KO5A 2AZAA 2EIJB 1NZRA 4AI7A 2NRDA 2LLNA 1GYCA 1PCSA 4YSOA 2GIMA 2BP0B 4UF7C 3CDZB 2FNWA 4BDVA 4BWTA 1MDAA 4JKNA 4HIPA 3FU9A 3SBPA 3NJGA 3SBRA 2H47C 3KW7A 1X9UA 2IDFA 3NJLA 3WIAA 2ZXWB 2P80A 3UACA 4UAHA 1ZIAA 2PP8A 2FQEA 1A8ZA 3IE9A 3UAAA 4YSSA 4DPCX 4G71B 3IN2A 4E9YA 2N0MA 2XX0A 4E9RA 2CAKA 3OMAB 1ILUA 3JT2A 1BEXA 2H5UA 3IEAA 1B3IA 2XUWA 1MG3C 2ZOOA 3PAUA 3NSCA 3RYMA 4YSRA 4NB7A 2DYSB 3AG4B 3PLYA 3FSVA 4F7KA 1ZPUA 2AFNA 2UXGA 4BWUA 3NJMA 2ZWNA 2JFCA 2H3XC 5ANHA 1KYAA 3ASNB 1NWOA 3SQRA 2PLTA 5AZUA 4G7QB 4G70B 1OF0A 2YXVA 2BP8B 2QDWA 4DP4X 3JTBA 1DZ0A 3ABMB 3QJUB 1V54B 3T9WA 2XV0A 1A3ZA 5LDUA 2FT7A 4DP1X 3FSZA 4YSEA 9PCYA 2FWLB 1AS8A 4UANA 3ZBMA 4NERA 4YSDA 1NIAA 1UATA 2PCFA 2TSAA 1IUZA 3GDCA 5I5IA 2QT6A 1NIFA 1MZZA 3X2QB 1GY1A 2R7EA 4YSQA 1JXFA 3AG1B 1AZRA 1NTDA 3WNIA 1QLEB 4GP5B 1BYPA 4NAJA 5AKRA 4DP5X 3CVCA 1JERA 2J56A 3QJVB 3CVBA 2XLLA 2VM4A 2W8CA 2BWIA 2PP9A 2YAFA 2IDSA 2QPEB 3HEIB 3NT0A 2I7SA 4GP4B 1AAJA 2IDQA 1JZEA 4KO6A 1E5ZA 1OCCB 3EH4B 4BWWA 1GS8A 1RZQA 1SDDB 3NSFA 1HFUA 1JZFA 2OJ1A 2BZCA 2EIMB 1PY0A 5B7MA 4KNTA 1URIA 4YVNA 4E9WA 1NPNA 1W6LA 2GC7C 2BHFA 2Y1AA 3FQ2A 1JXGA 3FS9A 1KDJA 4FA7B 2DWSA 1NPJA 4DP9X 4AKOA 1ET8A 1AG0A 1E30A 3EF4A 1AR1B 3N55A 2XXGA 1JZIA 3WKQA 3UABA 4M3HA 1SFHA 3S3BB 3NP3A 1JVLA 1N68A 1CURA 3FYEB 4KO7A 3ASOB 1ASPA 4BDVB 3DIVA 5F7BA 5B1JA 2IDUA 3S3DB 4QLWA 2B08A 3NSYA 2EINB 1SF5A 5B3SB 1OE3A 2YQBA 4N8UA 4AZUA 1SNRA 4HCFA 4E9XA 3OM3B 2HX9A 3ABKB 3AW5A 1ASOA 4A2DA 4E9QA 3IN0A 1GW0A 3TASA 4AKQA 3TBCA 4RH4A 1TEFA 4BK5C 1WA0X 1KDIA 5E9NA 1L9PA 1L9TA 4F2EA 1J9RA 1XB3A 1M56B 1HAUA 1TU2A 5PAZA 1W8EA 1BQ5A 3C75A 1TKWA 4P5RA 4HHGA 5I6LA 4GXFA 4WTQA 3QJQB 1ZIBA 3EH3B 2VN3A 5D4IA 3FU7A 1EHKB 3UGEA 5I6MA 2DV6A 1PAZA 2BO0A 2GSMB 3FPXA 2BWDA 4E9TA 4HCGA 2FTAA 2Q9OA 3NJKA 3MX0B 2XX1A 1PZBA 1CYXA 3SBQA 2PPFA 2I85A 2HLEB 2RACA 3NJIA 2YAHA 2J5WA 5IY5B 1YLBB 2AANA 2IH8A 3X1FA 1NDTA 1QHQA 1FWXA 2J55A 1VLXA 4E9VA 1ZDQA 3H4FA 1A4BA 2YAMA 3CZUB 2R7EB 3D12B 4JHVA 5B1KA 1OCRB 1GR7A 1JXDA 1ASQA 3FQ1A 4G7SB 4HALA 2BP0A 3CDZA 1A4AA 2FQFA 3GXUB 3V9EA 1BYOA 1SFDA 1WA1X 1KCBA 1M57B 2E86A 2IWFA 1J5CA 2GI0A 1ZV2A 4HCIA 2IWKA 3FPYA 2VM3A 3QJRB 1R1CA 1L9RA 3OMIB 3PPSA 2DYRB 2VW6A 5B1BB 1KCWA 1XB8A 4JHUA 2YAQA 1J9SA 5FC9A 5I26A 3ABLB 3N2JA 2HX7A 1NIEA 3TBBA 3T6VA 1PF3A 1BXAA 1AZUA 2PPAA 2WO2B 4EF3A 1AOZA 4GY4A 2J57A 2UX6A 2XWZA 3AG2B 3OD3A 4YSUA 2FT8A 2XYBA 1CUOA 3BVDB 3S8GB 2UXFA 2YAOA 2YXWA 2VW7A 4DPAX 1KV7A 5I5JA 1OCOB 3OMNB 2A3TA 4P5SA 5I28A 1FA4A 5F7AA 3FSWA 1NINA 4Q8BA 3H56A 4DPBX 2CCWA 1AZCA 2MRYA 3QJSB 3FU8A 3NJJA 4A68A 1M9WA 2OV0A 4KNSA 4GP8B 4MFHA 1E67A 2GB2A 2UX7A 4TXVB 3NJNA 1KBVA 1A65A 1IBYA 3T71A 3TA4D 3EHBB 2OCCB 5B1JC 4HAKA 4DP8X 4YSTA 5TK2A 3V9CA 1J9QA 2DY2A 3WNJA 4A66A 1WS8A 3H4HA 4DP7X 4ZK8A 3QQXA 2HZHA 2JXMA 1RZPA 3T6XA 3PCYA 1T5KA 1ILSA 1RKRA 2FT6A 1X9RA 1ZDSA 1AZNA 1XMEB 1QNIA 3UAEA 2CJ3A 1PMYA 4WKXA 2DWTA 2WSDA 2PPEA 1NIDA 2ZONA 3DKHA 1PLCA 4YSPA 1J5DA 2FJSA 1W6WA 3L45A 1ETJA 1FFTB 2EIKB 2UXTA 4Q89A 1L9SA 2XU9A 4DP0X 4PCYA 3T6ZA 2P80D 7PCYA 3GYRA 1WAEA 3ZIYA 5PCYA 3T6WA 2IDTA 1TEGA 4L0PB 2IWEA 5I6OA 1ET5A 4DP2X 1NWPA 1SHXA 2CUAA 1MG2C 3X1NA 4GYBA 2CALA 3X1BA 1L9QA 3U25A 1AACA 2PCYA 4KOCA 2Y69B 5D4HA 3AZUA 2VMJA 4X4KA 1GSKA 1MZYA 1V10A 1IC0A 3OQRA 4N4YB 2YAEA 1ID2A 5I6PA 4F2FA 1AIZA 1PZAA 3IBOA 4BXVA 5B7FA 7PAZA 1WS7A 6PCYA 1L9OA 4A2EA 3G5WA 4FAAB 1AG6A 1JOIA 2GBAA 2MTAA 4G72B 2BZ7A 2X88A 4YVUA 2GHZA 2PP7A 2XV2A 3S8FB 3PAZA 3CVDA 2AZUA 1WA2X 2BW5A 3KW8A 3WI9A 5I6NA 2VW4A 2WO3B 3AY2A 1EZLA 3FSAA 3AG3B 2TSBA 1E65A 5TK4A 1XB6A 3PXLA 3UADA 4E9SA 4G7RB 2HRHA 4M4RB 3EH5B 5EHFA 1I53A 4AKPA 5B7EA 1IBZA 3FT0A 2XXFA 4YSAA 8PAZA 4YSCA 1PNCA 3TU6A 5A7EA
chains in the Genus database with same CATH superfamily
1AD0A 1UOVA 1UC6A 2PCPA 5DT1L 2BW4A 3OSVA 4DO6A 2FD6H 2IAAC 4FQCL 3RVWD 2GJZB 3UC0L 2H3KA 3AQZA 4OLYH 1QMUA 4U1HA 1N7ML 4GRLB 1BQRA 1UVQB 2ILLA 2YRBA 4G3YH 3Q01A 2CDFA 1GGUA 3JWNC 1IKOP 2V0AA 1R24B 2Z35B 3CX5K 3LDBC 1CGWA 2QGDA 3B9VA 3KMDA 1S7RA 4GRLC 4NKIL 4WK2B 3SDXF 1YEKL 3GI9L 2B0SH 1H8NA 1CC3A 1RURL 2YBRA 3V6ZA 1OB1A 2CKNA 2NNCA 4GAJH 4QHUA 5F1SA 4Q6IB 4XMWA 4BH7B 4Q9CA 1HK6A 3A5VA 1HVXA 1KTBA 4W1TA 1K6QH 1ZT4A 1YYLL 1QBLL 2CUIA 1SLXA 3BFQG 1G9NH 1ZHNA 4NQSB 3ZKND 4A7SA 4ODSH 4D0DB 2HKHH 4OCMC 4K9JA 2WXNA 3QIWC 4RAVB 5D55A 4ZO7A 2D03H 2EXSA 5J1AB 2FD6L 3GWJA 4R7VA 4HS6B 3U30B 4YHLH 3W11D 3LY6A 1FCCA 4OLYL 1FNEB 5JA9A 4UQBA 4ZUUB 3QC6X 4L4TE 1ODUA 3BQVA 3P1VA 2HX8A 1KB5B 4G3YL 3VYNA 1JZ8A 3RVTD 2J5LB 2A6KB 3HZMA 3ILQD 1WFMA 5DFVC 4HUMB 1SJMA 2BS8A 3MODH 1MJJB 4JPQA 4AYSA 3OX8B 2B0SL 1VPOH 5FYLD 4ZX3A 4JY6B 5BVPH 4PJFF 2XWJB 2J5LC 1BFTA 5AB2A 3PV7A 3ECBA 3LNIA 5I8KH 3MUHL 1NFKA 1K6QL 3BH4A 4NJAH 5EO9B 4PRNB 1G9NL 4YDKH 3CFNA 1MCQA 4L2YA 4ODSL 4UNVA 4JW3A 2HKHL 3IYLW 5I75C 4X99A 3RY5A 2ZQKA 4Q97A 4MJ2A 4XOBA 5EEUA 4LEEA 5HHOA 2D03L 2MNJB 5FO8A 1S9WA 4YHLL 3BO8A 3C2AH 4HKJB 4MNQB 4QPEA 4NCDA 3TPUB 2JIXD 2FLBT 3SY6A 1LO3L 3MODL 3Q8EA 4M7LH 3S37H 3TESA 4FP8L 1VPOL 3WHE1 5BVPL 3NIGF 1AQDA 4AL8H 2GT9A 2VUKA 1JNHB 4XBGA 5E5LA 5AALA 3MUZ1 5I8KL 3NCWA 4LAQH 4NJAL 5CMAA 5F7DA 3N42F 2LU5A 4GAGH 4YDKL 3QQ4B 5IJDC 2FQEA 4S10A 5C07E 4N2DA 4I2XA 1K9TA 3MREB 4R4FH 3ZXAC 2CAKA 1B9ZA 1ILUA 4WWKD 4PSPA 3EZJB 4UM9D 3C2AL 1JV5A 3CHQA 3JV0A 1B9KA 2PCPB 3PAUA 4JPIA 2DLEA 3VG9B 3GMLA 2P1YA 1YEDA 5B3JE 5BRZE 1K2DA 4NC0B 3KYKH 2UXGA 2V2WB 4Z23A 3KZ8A 1NFDF 4M7LL 3S37L 3VG9C 3JZYA 3GS0A 4G11A 5HVFB 4AL8L 5AQ0A 3BPOC 4V1DA 2B77A 5KYYA 1U8LA 2HLFC 2HT2D 4Z7OB 1WZMA 4LAQL 4KITB 3ARVA 2MOQA 2YBRB 4P2AA 3V6ZB 1OB1B 4QHUB 4GAGL 2Y6SD 3GLEA 2FT7A 1MCKA 1OAYH 2CHZA 3KM1A 1ZT4B 2FWLB 4NRYA 4OH2A 4Q9BA 4R4FL 4FQ1H 1ZHNB 3OKKA 5K9QG 3QAZC 3M88A 4FXKA 2JMRA 3KLHC 1JRHH 4X7DC 2YQGA 3WHXA 2P5WD 2R7EA 4LKXA 4ZFOB 5GXBB 3IKCB 4XPFL 3SGEI 3TCXA 3KYKL 2WYZA 1JERA 2J56A 1C5DA 4GH7B 2QFPA 2IQ9H 2Y7NA 3WFCH 3B5TA 4CSSA 2BWIA 2YAFA 3PWJA 3HZMB 4F7CA 1PJ9A 3NT0A 2I7SA 4GP4B 1U36A 1A9EA 5GRXG 1J10A 5BO0D 3BT2H 3TBVA 1SHSA 5CEZD 35C8H 3GXDA 1NEZG 4GSQA 2Z65C 3ECBB 2ED6A 1OAYL 3WKNA 3C5ZB 3LTVA 1CE6A 4FQ1L 4PRPD 3V55A 1EMTL 5D7LE 1NL0H 3FQ2A 4X99B 3VFUA 4G9DA 4J1UA 1JRHL 5DEFB 3ETSA 4Z3IA 5IHBA 3BH8A 5HHOB 5J13B 1TLMA 1EAJA 3V6FA 3MNVA 5LHDA 5GS0C 1O7DE 1JV2A 4I9WE 3V7AE 5J13C 2IQ9L 4NUGH 4Z7WA 3WFCL 3CVHH 4AYMC 3FTVA 2X7LA 1FLTX 2QVKA 4H20H 4LOEA 3PWPE 3S3BB 4BFKA 4RQQA 3HCVA 5A2FA 1LO5A 4YHIB 5EBLA 3BT2L 3H7LA 4HW6A 3CH8A 1BD2E 35C8L 2NYYC 4LSRH 3QEUA 4QLWA 1KYOJ 4XBGB 5D4QA 1GYAA 5AVXB 2I32A 2DZEA 2ZUXA 2E47A 4K5NA 1SF5A 2DQ6A 3A22A 1WD9A 5CMAB 3V0JA 3AMKA 1IAMA 5F7DB 2VLKE 4Y4KA 5LNEA 3POCA 4OLUH 3BC9A 4U1IA 1NL0L 5L2JA 1YEHH 2F54A 3DI2B 2IDCA 3MRRB 3MN8A 4TYUA 1INDH 4L3ED 3S6CA 1NGPH 2Y2YA 3DX0A 3IPEA 4MWFA 5E9NA 5DI8A 1BQSA 4NUGL 4IBWA 2ENJA 5FHBH 1K2DB 4AENA 4H20L 3N06B 1OALA 5SWSA 1UH3A 3TBWA 1XIWB 2E6JA 5C71A 3A21A 3LKPA 3C8KA 3N0AA 3ZGIA 3UGEA 4EUPH 1YSOA 4LSRL 1J0KA 4V1DB 2IAMD 1F6FB 1T2XA 3V0AC 5LDSA 2Q9OA 1QSFA 4GT0A 4WJ5A 2R2CA 3E7JA 1UWXH 2A4ZA 2ZWSA 4XTRC 4CC4A 4OLUL 2OTPA 3CVIH 5IT2H 1A7RL 1YEHL 5BZZA 1CGVA 4NRYB 3B7SA 3OKLA 1INDL 5EEVA 2IH8A 3FTUA 3L3IA 1NGPL 1YEGH 2F2HA 3MUGB 4FXKB 1UEMA 1QLFA 3N1FC 4XPBH 4H44C 3HZKB 4HPYH 2R7EB 4QI3A 4LKXB 4AIZB 1E4JA 1U8JB 1I8KB 4HKZA 5FHBL 4JHVA 4FXKC 5HJ3B 3WFBH 3MLYH 4MAYA 4IKIA 3NIFF 4ATTA 2AERT 5IW1A 1VFBB 2H2PD 1ZXQA 3TPKA 5E8DH 2RH0A 3CCHA 3GEWB 3P73A 3PWJB 4PJ9D 3WENA 4F7CB 4AIEA 3E9UA 4P2CG 1UURA 3OXSB 2NQDA 4DFIA 4UV4H 2BSTA 3UJJH 1J87A 1R1CA 2XVKA 5E8OA 5CR1A 5I26A 5IT2L 3CVIL 2HX7A 5T1LD 4EPSA 3MJGX 3WIIH 1CE6B 2JJTA 4AE0A 4Z3JA 1I7RA 4I89A 1YEGL 3A6BH 2WLJA 3BVVA 4NUPA 4FS0A 2GJ6A 4XPBL 4HPYL 1WZ1H 4HMEA 4TQHA 3V6FB 3QEHB 3CDFA 3WFBL 2AV7B 2ZAIA 3MLYL 1FYHB 4F8QA 5DEZA 2VLRE 1LE9B 5IB2B 2NX5B 2X7LB 4NBZB 1CICD 3NFSH 3IBEA 4A68A 5ADPH 5KSBB 4JGJA 4UV4L 5D1ZI 3UJJL 2D0HA 2XG5A 4ZRGA 4HUWA 5EBLB 4WW2A 2COQA 1XL4A 1HHGA 1H5BA 2HFTA 3QEUB 4JREB 4Y4FD 3FFOA 1JXKA 1RUPH 3E6HA 3T0EE 1IBYA 3RWHA 3T71A 4LGPB 4WCYH 4B7IA 5FDYA 3WIIL 2D8KA 3U9PH 4ZMTA 4JREC 4R26H 3A6BL 4U1IB 4N2OA 2F54B 4BV1A 1WZ1L 4KI5F 4S1DC 4UQDA 1E2VA 4Y4KC 1OM3H 4DP7X 4LCWD 2HA1A 4GKZA 1TCRB 3BVNA 3GSNA 2HRPH 3MGAA 2WB1A 4X6DE 2ZICA 5DI8B 6CGTA 2HLAB 2Z7ZA 2X4UA 3DSNB 2EACA 5D2NB 1YUHA 5DVOA 3AQXA 3NFSL 2XRAH 3G5ZA 5ADPL 3TBWB 5E0FA 3LKPB 2WM0A 4QOKD 5C09A 1V3LA 5D7KE 3DIDA 3L45A 2FJSA 1RUPL 4QXGH 1QEXA 4WCYL 5EU7C 3DVIA 2CHNA 1KULA 1RIUH 1A64A 3U9PL 4CMMA 3LZRA 4R26L 2PWFA 4OKVB 4ZFQA 4EE2A 2DQMA 3FB7A 4Q9RH 5BZDA 1SJVA 5E8NB 4M6MH 2I26N 4MZRA 2BLFA 5BOZG 3P2BA 1DBJH 3OKLB 3U4KA 1LNUA 1OM3L 2KL6A 4CC4C 1GJIA 4YO0B 1CDCA 1MG2C 2EEAA 3X1NA 2HRPL 4G8GE 4YXHH 2CBOA 2XT1B 2ZZUT 3QXWA 1L9QA 4OGAC 4WSKA 4ONHA 3GRBA 4RGNC 4MAYB 2XRAL 2E4FA 5IW1B 4QHKJ 4CJ1A 3J27A 1LEIA 3P73B 3PP3K 2OMTB 1PZAA 4MAYC 4XBPB 2BSTB 3SDAD 1AMYA 4DK5A 5DTFB 4A2EA 2JQZA 4QXGL 3KD4A 3KVPA 2MTAA 2Y1YA 4UDUA 1RIUL 2BZ7A 2PWHA 2GK2A 4Q9RL 1Q9WA 4M6ML 4JY4A 2XQYK 4BSWB 2VT0A 2VR5A 3ZKQD 5IB4A 1DBJL 5C0CA 2GCYB 1I7RB 3CVDA 3R0MA 3L1EA 2EKSB 4HJ0C 4YXHL 5CLWA 2BSBA 2P52A 5FYLH 4AZ8A 2JJTC 1BG9A 3K3QA 2X0VA 2XG4A 3L4YA 1AO7D 3UADA 1TZIA 4N2GA 5AB1A 2RQ8A 3MOBH 4I3GA 3B7YA 3G6JA 1I4FB 1SDYA 3WUZA 4A2LA 1J8HA 3HE7D 5DA4A 3UMTA 5HY9A 3VRJB 3FT0A 2H1XA 3PFQA 1HHGB 3A24A 1H5BB 2AGJL 4J4PD 4JZNA 5IVOA 2X4OA 4G5ZH 2CH8A 3E6HB 1BXUA 4XMPH 4BYHA 4WW2C 3L1OH 3QIUB 1JJUA 4IDLA 4ZAKA 3RWHB 5FCSH 3ZTEA 1H5BC 4K3DH 1VEMA 1KPRA 2J1WA 1J1XH 1OV8A 5ABZA 5C0IA 3WIHH 1KTRL 5HGAB 2EQDA 2R1YB 1YAZA 1MI5B 5FYLL 3GS7A 1YN6B 3QE5A 2CO4A 1UWYA 4C54A 3GSQA 4GKZB 4A67A 3GSNB 4GBXA 1PGRB 2Q6WB 3MOBL 3HB3D 1OQXA 2X4UB 1AS7A 1YUHB 4PVLA 3V4PA 1BFSA 3TYGH 2EKJA 4YDJB 2UY6B 2PPCA 4WO4B 2QMJA 4G5ZL 1ORSB 5IQLA 1ZLUK 4WK0B 4N0FA 2MQ0A 4XMPL 3L1OL 5CHNA 5A2LH 4N22A 4K3DL 1NICA 5DZ9A 5INCB 3ZDXF 5I5MA 3QYNA 4Y9EA 1J1XL 1RL1A 4XI5C 4ENZA 1BOGA 4NPYA 2H32H 5IB5B 4P05A 2F1BA 5D6CA 2WO4A 4F7TA 5F9AC 4KUZH 4HV8A 3ULUE 1F3JB 5LG6A 4HIQA 2A77H 2EO7A 2WZ0A 4TRPH 1RU9H 5C08A 2YKLH 4ONHB 5C0RH 5FDWA 1PY4A 4G9FE 5DVMA 3NYKA 3LN4B 3TYGL 5FWRA 3WV0A 4ODXA 2EO9A 2Q10A 3CNKA 5DQ9B 2YJLA 4L1SA 2B2XH 5LVEA 2B14A 1CDUA 3FCTA 3BP6A 4JS7A 3F01A 2XPGA 3PWUB 4UDUB 1KYOK 1EVTC 3DMMA 4W9ZA 4WHYG 4QXTA 4ZFGH 2XBTA 2Z31D 5K59E 2LLNA 1Y18B 3JQOB 3L2NA 2MEJB 4KUZL 3CXFA 5AW5B 3KPSA 4ZYKB 5CEZH 4YDVA 1ZSHA 2A77L 5FM8A 3PHOA 4DEUA 4TRPL 4NQCE 1RU9L 1IVTA 1X9UA 2XG4B 2YKLL 5C0RL 3WIAA 3VFWB 1Q9OB 4IJ3B 5GRYA 5GGSA 1SEQH 1TZIB 2R0ZH 3MJ6A 2TRYA 5IB1A 4ZMYA 3IE9A 2Q3AA 3QULA 2XWBA 2I60H 1J8HB 2WXOA 4Y4HA 5AD0A 2XX0A 2B2XL 2AK1H 1C12A 4IJ3C 1GGCH 4HGMA 3C87A 4JZOB 1E9PB 3WJLA 2VUOA 4GUQA 4M93B 5FKPA 1UH2A 3HS0A 4PLKC 4OGYH 4ZFGL 4KXDA 3ARED 3ZPDA 2VDOH 4LPTA 3X12A 1O7VA 1QFOA 4M93C 4KJWD 1QUPA 3QRFM 5I66B 4KK5C 3MI6A 2E27H 3L9RB 2ESVA 5C0IB 2DKMA 5HDBF 1Z5LB 2GJRA 5CEZL 5AVUB 1LJMA 3HPLA 1ZRUA 4RMRA 1PZUB 1P53A 5AW4B 1NC4A 3GSQB 4XVJH 2IPUK 3GTTA 3QJUB 4GBXB 2WV3A 4RZCB 3VQ2C 3TNNA 2Y4SA 2R0ZL 1XF3A 2E46A 2I69A 4PI0A 2I60L 4OZFG 1AFVH 1CF1A 4G1MA 2O5XH 2FYYB 2AK1L 4GBXC 1GGCL 1R46A 5H37A 5HGBA 1INEL 2BNUA 5E23A 3LB6D 1IUZA 1OPOA 2YFOA 4C56D 2CK0H 4Y9CA 4JKLA 4OGYL 1MRFH 2VDOL 3BP7A 1VACA 5KOVC 5GSRA 3AMLA 1MHPH 2G75A 3QWOB 2E27L 2FUQA 2XICA 4ZXBB 4KV5E 3IDJB 1A2YB 3V52H 5HXMA 4NPYB 1OTSD 4F7TB 4KO6A 4JHZA 4K23H 4XVJL 3QO1B 5E6RB 1M2VA 3MNWA 4N6RA 3D4ZA 1JGLL 4YAQB 2ADGB 1UCTA 1XGUA 4YGAB 5IGXH 1NCCH 5C08B 4PJEB 2ZCHH 1AFVL 2XYCA 2ZXBA 2O5XL 2VRQA 3DHUA 2PYEA 2KERA 3HLAA 1IZKA 3F62A 3AY4A 2CK0L 2IALA 4ZMPA 3ZK0A 3UGUA 1MRFL 1KDJA 1GJWA 3DA0A 4FA7B 4NN7C 5E1AA 3BP6B 4M02A 4Z7NF 2P8LB 2XZQH 2XPGB 1QFWI 4ILDA 1D6VH 2ZX6A 1MHPL 2A74A 4QXTB 3GSVB 1I1FA 3V52L 3SO3B 2XXGA 4M3HA 4DAGH 3DMMC 1KNOA 2OJEA 4K23L 1N68A 3BSHA 3GIZH 5DO2D 1XMWA 1MHHA 3ESPA 4YDVB 4I18A 5IGXL 3PHOB 5J89A 4PIRF 1A4KA 4H26A 2ZCHL 2AK4D 4QY8A 5ADOH 3PP3H 3S5LG 5GGSB 3Q48A 2QKIA 4E9XA 2CDGA 4BFBD 2PNDA 4FFYA 4B9CA 5EOTB 4Y4HB 3ARGA 1DVFD 4A2DA 1E5AA 2HTKD 3BVXA 1GW0A 1FZKA 3MGOA 2UWEF 4HCRA 4HVBA 1MJ8H 2XZQL 5FKPB 1E6OH 1D6VL 1OGPA 4E5XG 1L9TA 1TCMA 3IFPB 4Y4HC 3EYFA 5E6IB 1FO0H 3WJLC 3X12B 2DQIH 4WAFA 1G6RB 4M8UA 3HS0C 4WTQA 5TFSH 4DAGL 3KGSA 3RIFK 3JTSA 4Z78A 1GZHA 3IVKA 2NCMA 5IIEA 4YH6A 3GIZL 2ESVB 3S35X 3OGOE 3JV6A 1JGDA 2XPZA 4HLEA 3BWZA 1NC4B 2GSMB 5FGCE 3PV6B 5HBBA 5ADOL 4MA3A 1G94A 1BJ1J 4R90H 3VXUA 3WO3B 4P5KA 2PPFA 3IGUA 4M7KH 1HCYA 4TLSA 1F4HA 4L05A 4P5MB 1NCGA 4U1NA 4Z0XB 3ZQXA 4M03A 2QGCA 1MJ8L 3HOGA 1E6OL 3MRQA 3CE1A 4BBWA 1FO0L 2FIKA 3KXFE 5D5MF 4W9LC 5ERWA 1CD8A 2DQIL 2P5EA 3UZQB 2NZ9D 5GSRB 2GJPA 3U9WA 5J56B 5JO5B 5TFSL 4S2SA 4EDXA 2G75B 2ZUSA 3FTXA 1HJBC 2QGEA 3GXUB 1PW3A 3RPKA 4HXBH 5J6HB 3WNPA 4WF7A 4DUXA 3D2UD 2ADFH 3MNWB 4FFTA 4N6RB 3ECWA 4R90L 1JZ3A 3N2JA 4UU9B 3PJNA 4RMQA 4DKEH 1ADQA 2IBZY 4M7KL 3CMGA 2OS7A 4NRXB 4YHPB 2ZUTA 5CAYB 1T0PB 1FFOA 2D7TH 4MSWA 3D39D 2A9MH 3ARBB 3C8DA 4DTGH 2ICEB 3DXAD 4R2GC 1VB9A 1LLAA 1KV7A 1UD3A 3AY4C 3WEAA 3P4OB 1TZAA 3RUGF 1BZOA 4U6VH 5C0DA 1I1FB 4HXBL 4BFFA 4HJSA 3DX7A 3UAFA 3QJSB 3FU8A 3NDYE 2A74C 1GYWA 3WJMB 1KNOB 2OJEB 3F84A 4L4TA 3VRIA 3KPPA 2IMNA 1MHHB 4Y5XA 2ADFL 3Q6FA 3FN0H 3UO1H 2UX7A 4BQCA 5HVHC 5DJ8A 1JDAA 4PJ5B 4TUOB 2DI7A 3KLAB 4PTUA 4DKEL 5CKAA 4I7ZC 3EHBB 2PN5A 4I18C 2IFFH 5E1HB 2D7TL 4Z18A 3L4XA 2NLJB 4BUHA 3ARGB 1FL3B 2A9ML 2C9SA 1JN6A 2QKIC 3MGOB 2F5BH 4MDIB 4K5MA 1GGTA 4DTGL 1TTCA 2V3DA 3UIYA 4K5PA 1JBJA 3ARGC 3V4LA 3EYFB 3T6XA 4U6VL 2FX9H 1M7DB 4M1CD 1AC0A 4WLCA 1W91A 4X98A 4ZUVB 1X5YA 5BO1H 1HL8A 1F45A 1XMEB 2XI9A 2CJ3A 3NZHH 3JTSB 4U4IA 2DWTA 4JM2D 5HI4D 1PX3A 2WSDA 4N8PA 4L8CA 3HS8A 1VFMA 3JV6B 1UGKA 5AVZB 3FN0L 3ML8A 1SQ2N 3UO1L 1JGDB 3MV01 4H25B 4Y5YA 4AM0Q 1OAZH 3HUJF 4GG8A 4N2IA 2Y23A 1JZ2A 1IGYA 5D2LF 4ZSOB 2IFFL 2RQEA 1OT4A 4TVPD 5D9SA 3QG6B 4F7EA 2C3VB 1U8KA 2CM6A 4FMVA 4U3HA 4XXDB 5IMKA 4HWBH 4BEIA 2BOBB 4KKBC 4P2QB 4TN9A 4KZCA 2F5BL 3D0AA 5C07A 4FTVE 3DPBA 3H9SE 3UTOA 3P30H 5EF2A 2WWOA 4LB8A 1A6UH 2FX9L 1KYUA 2FIKB 2NW3B 5BO1L 3ZDYB 5C0AB 5KVGH 3VFRA 4S2SB 3NZHL 3E0GA 3UTSD 5K69A 4F37K 1CQYA 5BRZA 2WZ5A 1I3VA 4JFFD 1N18A 4LSPH 5MEOA 1OAZL 5FYKE 3VNZA 3IDNB 3MUY1 4OZ4B 3L3KB 4X5XB 3E1ZA 1CMOA 4ALAC 2XNAB 1UD5A 4WFFD 3S4SA 5IP4A 1BQHG 3I75B 2WWKO 5IROA 1HXMB 4OV5B 3IM1A 2QADD 4XMZA 5A3ID 2WPGA 4HWBL 2RALA 1J5OH 1KZQA 3P30L 1Q1PA 2PXYD 4CDGC 1A6UL 3AY2A 3AFLA 2WQUA 1X7SA 5KVGL 3INUH 3HN8A 4NYLB 3TV3H 3UBHA 5F1NA 4XO8A 4ZD3H 4WRLA 3CFBB 3GSUA 4RCAA 4X4ZA 1X4YA 4DERA 2VE6A 4LSPL 2EUVA 1T5WA 2EYTB 4KDVA 2XXFA 4UZUA 1EFQA 3VRIB 3ZU8A 2V37A 5T3XH 5C9JB 3Q6FB 5LLIC 1DUZB 5ICUA 2NY4D 3GXIA 2DEXX 3D2TA 4PTUB 4Y5XC 3N41B 4OF6A 2BIPA 1F2QA 2X6AA 2HRLA 1J5OL 2V9TA 1BFVH 1W0WB 4CN4A 1H3XA 5IEKB 2V2XA 2VDQB 1FYTD 2I07A 4N5UA 4XP6H 4PJ6A 5E2JA 2CD0A 3MLPA 5D7LA 1OE2A 1IM9D 3FHQA 3INUL 1ZANH 3DUSA 3TV3L 4LDCA 4ZD3L 3WSQH 1LGVA 4CSZA 2C8NA 2DQFB 3QDHA 2JSFA 1AKJA 1JZJA 1RZIB 3VFSB 4L8CB 5ACLA 5T3XL 1QASA 3T2LA 4NBYB 4N0YH 4OZIE 3VWKD 4JGNA 3TEZA 3VX0A 1CYWA 3PWPA 4FX5A 1F56A 3QFJE 3KLSA 1BD2A 3KGTA 5J1SC 1Z0NA 4N3TA 4R5VA 2R1XA 4OSUH 3CSGA 4UWQB 2H1LM 1F6LL 2X1OA 1VKXA 1BFVL 2BCMA 4ENEC 4QKTA 3NIDE 2XSKA 3ROLA 1T0MB 3FXIC 2YPVH 3PP4H 4XP6L 3R4DA 2NSXA 1E7VA 1KWKA 5C07B 2BHUA 3DPBB 2OL3H 4EJ1C 1ZANL 4JGMA 3WSQL 4JEGB 1E4WH 3T8XB 3VFRB 1VHPA 4YHMH 4K7PX 4F8TA 4N5EC 1ML0A 3BUYB 2A99A 4N0YL 4DCQA 5HDOA 3A23A 2E7CA 2LVCA 5F7YC 1NBZA 2VO8A 4A6YL 4HEME 4OJYA 3TT1H 1HINH 1CE1H 4H1LH 4OSUL 4LHUA 5DMIH 5IOKA 3L17A 4OCRH 1WUZA 4X4YA 4OLXL 2F53B 2YPVL 3PP4L 1HH6A 3MNZA 4CSTA 5KS9E 1KY7A 2LT9A 4OFYA 1UD6A 2WVTA 5I1LA 1MDAA 2OL3L 5LBSA 4BKLB 5J1TC 1T5XB 3G9VA 2AEQH 5EB9A 2VXVH 3BAEH 1E4WL 1ZY9A 4DIXA 3B43A 3F12A 2NMSA 4WEEA 5F1NB 1X6NA 3QDMB 1ORQB 4YHML 3OJMB 4R7DA 1A6WH 1G43A 1MWAA 1WZLA 3SGJA 5B3NA 2VQUA 3FMGH 2G0KA 4DOHB 2OR9H 4XNZB 1YEJH 4J3UA 2ERJB 3TT1L 1VJSA 2XUWA 1HINL 2FO4A 1IL1A 1G0YR 2JKRM 2OMYB 5DMIL 4W9GC 1MELA 3M17A 5E70A 4XNZC 2G3ZA 4OCRL 4WV1B 2ERJC 3WN5A 1DBKH 3C60A 1A6TB 4GXUN 2J4WH 2HMID 3U48A 2VC2H 2J6WA 2XY2A 1OL0A 2ZX9A 2J8HA 5IZ7A 2D31B 5IBLD 4UAOB 5DSCB 2VXQA 4DESA 3T3MF 2AEQL 1MLBB 5BV7H 2CJSA 2VXVL 2W92A 3BAEL 1IVLA 2VR4A 3IETA 1RP8A 3NAAH 4UAOC 1A3ZA 3HG0A 1A6WL 3CZNA 4X8GA 3EJUA 3FMGL 4L5FH 1FHGA 2OR9L 2VLRA 3FUIA 1YEJL 3SE9H 4ABVA 3ARXA 1U8PA 1NEZB 4LLDA 4HOMA 1HDMB 3IJ9A 4HFUH 1JXFA 1O7DC 1NC2A 4BM7A 1U92A 2KUTA 1PZ5A 4NAJA 4AGNA 1ZWIA 1DBKL 2EO1A 1P7QA 4BFGA 1XBRA 1BD2B 2J4WL 5E5MB 1PFOA 1OSEA 1C08A 2VC2L 3VGAC 2WXMA 2OPCA 4GRLD 4WWNA 3T0EA 2MHAB 4A2MA 2BNQB 1SEBA 2NDGA 5BV7L 1YG9A 2YMTA 5L8LB 2IF7A 3BWUC 4JFHE 5DA0B 5BQDA 2ENQA 1I7ZA 4BIKA 1GS8A 3NAAL 1CL7H 5H4ZA 4N2NA 1FNLA 4X0KB 5K1VA 5AL0A 1OSZB 1PY9A 2HFGH 4AUJA 4L5FL 3OLIA 4X6DA 4Z3EA 4RGOH 3AU1B 4BFEA 3SE9L 4E9WA 3FU0A 3C9NA 1COBA 1S7VB 1AMXA 3CSYA 1HXYA 3FQRA 3UYPA 4ODUA 4DCQB 3B9KB 4HFUL 2J44A 4UINH 3E3QE 3CXHJ 4MCNA 4IHOA 5EU5B 5E94B 3LPFA 3MBWA 4U6YB 4KBPA 1ED3B 3T08A 1BIIA 2J73A 1LK3H 3CQQA 2OSLA 3UTQA 4NNPH 4U6TA 1W0VA 3HHRB 4FZ8H 4I88A 2NY5C 3B3IB 4NFDA 1YEEH 1L7IH 1IFRA 2WP3T 5E2WH 5I1LB 4P2YA 3HFFA 4MD5B 1CL7L 4K94H 2A7BA 2HFGL 5B3SB 2XKSA 3MRBA 2E59A 4N8UA 4G8GA 3F12B 5MENE 2JK5B 4RGOL 1XGTA 2YQ3A 3OM3B 4DZ8A 4R7DB 1MWAB 2OXGA 2LV4A 2APFA 4WHTB 2DYPA 3UROR 5E9DD 4E9QA 5I1HH 4OT1H 3RX7A 1E5UI 4NQED 1HZKA 5FA4A 2DF3A 1U3YA 3SPHA 2BFVH 1Z3GH 3SGJC 3WGVB 2OW6A 3F05A 4PIBA 3QR2A 3MV8B 2FO4B 1IL1B 1MUJA 1N8OE 5HYJB 2IC2A 2XVGA 3EO9H 4MNQD 1LK3L 4Y7MA 3RPBA 3WN5B 4NNPL 4JB9H 1XH1A 1ZPLA 4LLUB 5TJWK 3SJVE 4FZ8L 5I1AA 1YEEL 1L7IL 5E2WL 3WN5C 3MCG1 3C60C 3MA9H 3I74A 4BQ8A 5KVDE 4K94L 2JCWA 1YECH 3FPXA 3MRHA 5IR1A 5E99L 1PD1A 5I24A 2OZ4A 3IETB 5TQ0H 4ELMF 4ZZKA 1OK0A 4MD0A 3CZJA 3K4DA 2RIKA 1L3NA 3ARZA 4UTBH 5I1HL 1G9MH 2AS5M 4OT1L 2VLRB 2BFVL 2ZX5A 1Z3GL 4L3FA 4NKMB 4ADGA 1U8PB 1G9EA 2J8UE 3QC5X 2X3AA 3D18B 1MSPA 2WINA 3GTVA 3MGTA 5DD1H 1U92B 4XNMB 3Q8BA 4UMSA 5IG7A 3VNYA 1P7QB 3MV9B 4JB9L 2IPKA 4G7SB 3UBXG 1R3LA 4GKLA 2UVFA 2FQFA 5ABDE 4K4KA 1HKFA 3C6LA 3T0EB 2HLFD 2BX5A 3WY3A 1WFIA 3T09A 3FPYA 3MA9L 1SEBB 2JKNA 2XN9B 3GJFA 3KBEA 3LRMA 3SEPA 3EO1A 1YECL 3U0WL 4KKCC 3T0EC 3MKGA 1I7ZB 1TSHA 5F7EH 4QRPE 1U8MB 3LS4L 4XX1G 5TQ0L 1QP1A 3V4VH 1SDAB 3VGHA 4JN2B 2X4QA 1V3JA 5E00A 4FCAA 4UTBL 1G9ML 5KYUB 3KLHD 4E0RB 4W9FC 4X6DB 3VFPA 3FQRB 3UYPB 2XWZA 3TN0A 5DD1L 3BUTA 4BE5A 3OR6B 5DZJA 4B0MB 4IHOB 4HOXA 5ID1A 2BVTA 1S3KL 3RRQA 2DTSA 1FVDA 3IGLA 3WEOA 2AXWA 3M7OA 2L7EA 2BSRB 3QH3B 4GI6A 1W0VB 2FL5B 4XPAH 5E2VH 1WC7A 2W59A 5DQDH 2G2RA 3TH2T 4F1SA 1N2RB 3QI9B 2Q7YA 1FNGA 5F7EL 2GB2A 2V17H 3N43B 3JUZA 3V4VL 1A65A 1DL7H 3LIZH 3CN2A 3MRBB 2MOVA 5B1CA 5IVXA 3O3BA 4C4KO 3GBMH 5A2BA 1VRSA 2LAAA 2YGPA 3D4CA 4DZ8B 3UJIH 2DYPB 4G9FA 3AGVA 1WISA 4M3JA 4LMQE 5GS0D 4HZLA 3F83A 3MBEB 1M71A 2E4TA 3V0FA 2HZHA 5HHOD 3RIAF 2YRLA 5DHVB 4GJTB 3LQAL 1ZTMA 2XTJE 3VXSE 1DQLH 1T5KA 2IADB 3MBEC 1HE7A 3AUWB 5AEAA 3EFOA 4XPAL 5E2VL 1BZQK 1N26A 5DQDL 2BWQA 3K72A 2EP6A 4NWTH 2V17L 1JRHI 1A47A 4OI7A 5L9DH 2UXTA 1DL7L 3APFA 3LIZL 3MRHB 4WEBL 5IR1B 1WBXA 5IVZA 3II1A 5CEZE 4DWHA 2DEWX 2CO3A 1Y7VA 3GBML 3MCYA 1YQ2A 3KNBA 4NQCA 3UJIL 2I27N 4PWKA 3KS0J 1ZK9A 2PW1A 3LRSA 3KPOA 4PRPE 1HJCA 3VTTA 1PX8A 4TLTA 1BJ1H 2WINB 1OK8A 4TV3A 1MNUH 1BPLB 1DQLL 4HWUA 3ZGHA 3ZW3A 4IOSA 2N1KA 1IC0A 3OQRA 2VITA 4JFEE 3KBHE 1CD1A 3GGWB 1XIWD 3F7VA 5FB8A 3H53A 4PGDB 3S8WA 3V8CA 1T22A 2VN6A 4NWTL 4BXVA 2YRPA 1EEUA 3GJFB 2OYKA 4V1DD 1GTFA 5L9DL 3EO1B 3C6LC 3NDZE 3NJVA 3PU7A 5CP7A 1PJWA 3LZLA 5FOBB 4DKAA 1ES0A 4U3SB 4IGBB 3KL3A 2VABA 3LJ3A 4EN2A 4N68A 3F65A 1KLGA 3KCWA 5E00B 2DMHA 1SXBA 1YNTA 1RIVL 2NW2B 1G7LA 1EFXA 2B16A 2VLME 2JJVA 3FCSA 4OVVA 1A4JB 4OCLC 3TN0B 2WO3B 3RZCA 4HJJH 3RI5F 1CTOA 2QZQA 3ZMEA 1WCBA 1MNUL 2NY0B 4L3EE 1JPEA 4NS0A 2G3XA 3SZKC 1GVIA 1AHMA 4CVXA 2Y22A 1XB6A 4E2OA 3TN0C 3A67H 2HRHA 3AACA 4L4VE 2NY0C 3QO0A 2EDKA 4MNHA 4G80A 1E9OA 1HQ4B 3D0VB 1DVYA 1YEIH 3MRMB 2G2RB 4EIUA 3RGVB 5D1QB 2YS4A 1UWEH 1DVXA 1QYGH 1YYCA 3B2PA 2XTLA 5C3IA 3M45A 3FBKA 4GAFB 4OZFA 5D1QC 3BD4A 5IVXB 1GS6X 1T7ZA 3O3BB 4XX5A 2ZF9A 3A0OA 1IC7H 2ZKXA 1F00I 4NZUH 1OAJA 4A7VA 2EDHA 4G9FB 3HRZA 3ULUC 3UZVB 3GSWB 3F7LA 4HJJL 4HZLB 3IS1X 4HKBB 2OYLA 1KCVH 2ZP0T 1DVUA 3GO1H 5K9JH 2ZXGA 4NKOB 2Z92A 3IT8D 4MMXB 2QZ5A 2AKRA 3A67L 1N6UA 5EFIB 5EOCH 3ATEA 5C9KA 1RJZB 5ESQB 5DJCA 2KQNA 5KJRH 2NX5D 3EFOB 1YEIL 2V7NA 3WKPA 3BZEA 1RD6A 2CBTA 2FVNA 3K72B 4LSSH 1UWEL 1A4CA 4B0MM 2PTVA 1J0IA 1QYGL 2WLMA 3H9YA 4LOVA 4PJXB 4AX3A 1RSYA 3L3GA 2PYFA 3JWDC 3EJPA 4PJHF 4KPHH 4Z7VE 1AQKH 5DMJB 1IC7L 3MV7B 1UTDA 4S1DD 4N3UA 3KNBB 1MCBA 4NQCB 4NZUL 1DFXA 1QVOB 2F54D 1XCQA 5B21A 1E8ZA 3BKMH 4X8JA 5KUMA 1KCVL 1CXIA 1GHFH 2NNFA 3GO1L 5K9JL 4QHMA 2CBQA 4WU5A 3QNXA 5EOCL 3ZDXE 3TV8A 5LGKA 2XV3A 1XR8B 4QTFA 1ANUA 5DWUH 1UXSB 5KJRL 3IAGC 5F3FA 1AR1C 4PRDB 1AZZC 1JIBA 5SWSD 2W38A 4IHBA 4LSSL 4AVKA 5FB8B 1T22B 4X9IA 3QUXA 2E3VA 6PAZA 4KPHL 4FMFA 4ZOEA 1R0AH 1AQKL 5F0MB 5GRWA 1ES0B 3JWNH 5ISZE 1ZAGA 2K4AA 4AI7A 3H3BC 1A1OA 1TYRA 2VABB 4KHTH 3IE4A 5E6UB 4N24A 1KLGB 3CFMA 2HFEB 4CVUA 4OZHE 1KCLA 1BWMA 3BKML 1G7LB 3QWNA 1SHMA 1SOKA 5F6IB 1GHFL 4BDVA 1EFXB 4AH2A 2SEBA 4E5XA 3ZZ1A 1G1KA 1WCBB 4HGWB 3QXVA 1G1OA 1JZ4A 1E4KA 3B5HA 2N01B 5DWUL 1NJ9A 3I6KB 1T0OA 3RZCC 4OFIA 4MAYD 3P4MB 4LLYA 2DWEA 3KXFA 1DQJA 3QO0B 3SQOL 3SDDA 4BSVA 3FOMB 3OKMA 3OPUA 1UOKA 4AYBA 2HYMA 4QOKE 1R0AL 3DBXA 2FJHA 1UENA 2GIYA 3WTUA 4G8IA 4KHTL 5AUMB 4OZFB 1R5WA 4R84A 4AMXA 3NJMA 3NRQA 1V3MA 4HJ0D 2NSMA 4EKJA 4W9HC 3DIFA 3SQRA 4RMUA 3WCYA 3TH3T 3HRZB 5EBWB 4EXPX 2A73B 2GJ6D 4IBYA 3VXRE 4DP4X 5IJVB 4YZFF 1DZ0A 5DK2A 3QUZB 1UJTA 3FK3A 1R5IA 3HRZC 2AITA 2HN7A 2XV0A 2DIBA 4ZQTA 3Q2CA 4LEXH 1F2XK 2V7NB 5EZIH 1K4DA 1WG3A 4LQFL 1S7QB 5D7EA 5EO1B 4B9JA 4E36A 4JO4H 3QB7C 1NIFA 3SKOA 1MXGA 4GS7B 4APXA 2WXJA 4UILH 1XF2A 3L3GB 3REVB 1QBBA 2PYFB 3CVCA 4HIIB 8CGTA 5C0EA 3CFTA 5FF6A 1KB5L 1LP9B 2OP4H 4PMEA 3SKJH 1Q9LA 2OFQA 3CXDH 3D07A 1W16A 2PP9A 2JCCE 4JLRA 3SE4A 3EBHA 4WNJA 4KJYA 4ZUWB 4ABWA 1MI5D 2Q20A 4X8JB 1PZSA 3QP3A 2DTMH 1ZA6A 4WU5B 1HEJC 1EZVX 1TO5A 5M95B 1FC1A 1PY0A 3T1FA 5B7MA 2W94A 1G7IB 1CTNA 4LEXL 4ISVA 4HPHA 5EZIL 4MS8C 4JO4L 2KS0A 3L5HA 4WO4D 4RAHA 1XO8A 3QUXB 4GOSA 1L7TH 4UILL 2X2JA 1MJUH 1NPJA 1W0YT 4W4OA 1I9RH 4XI5D 4JFDB 2EDBA 3BH9A 3QUXC 1GZPA 2K1MA 2OP4L 4S0TD 1XAKA 2CPCA 3KGRA 3CXDL 1A1OB 2V7HB 4PJDE 1SGKA 2Y72A 3WKQA 3EJTA 3RFRA 3VWJA 3MTRA 1UB6A 4I1RA 1JVLA 2JH2A 3MCLL 2DTML 4BDVB 1IC1A 4AH2B 2SEBB 1A9BB 4E5XB 3FQ4A 4LESA 4CRPA 2APXA 1YPZF 2WOBA 4Y0GA 3MLVH 4FTVA 3H9SA 3F64A 3AB0B 4JR9H 2EDRA 4HUKB 4KJQC 3C12A 2DWEB 1DQJB 2ENSA 4M6OL 3STLA 5KVGE 1HYRC 1ND0A 2X4NA 1E4KC 1F5WA 1S9VB 1DQTA 4BSVB 4DGVH 1FL5B 3AB0C 3APCA 1L7TL 3OKMB 4OCSL 1MJUL 5I1IH 2Z3FA 4GUCA 5CJ5A 1I9RL 1E90A 2WLZA 1EO7A 2YXMA 5I1CH 2FJHB 1MCWM 3SDDC 4EZLA 3GSXA 4PJCF 5CN3A 1R5WB 5I15H 1NCWH 2RD0A 2FR4A 2DQUH 1I1AB 3DIFB 1AOHA 1BEYH 5C0CD 1EHKB 1WTLA 1PL3A 3DUHA 3QQDB 3FFDA 3T04D 4WWOA 3CSBA 4F8NA 4E9TA 1XX9C 2BWDA 3MLVL 3X11B 4FA8A 4MQSB 3NJKA 3CFIC 4BQBA 1CYXA 4JR9L 1AXSA 1F1AA 1SYSA 4ERSL 2LAGB 2AJYH 1YLBB 4J3SA 4R0LA 4U1SA 4DGVL 1J8HD 1K4DB 3MRGA 1G9NC 4YBQD 5GS0H 5I1IL 1J0YA 3EYVA 1KBBA 4FN0A 1ROCA 4ZFOL 5I1CL 3HAEA 4WFGD 1YDPB 4KK5D 1AC6A 5T3XE 5I15L 3F58H 1NCWL 4K7FA 5DVPA 2OXHB 2DQUL 1BYOA 1BEYL 2C9RA 1IEBB 3WTVA 2CG9X 4L9LB 3WNKA 3BT0A 4FQQB 1R75A 2VRAA 3OR7B 1L0YA 4K73A 2WBXA 2XBDA 4MB3A 4M5YH 1XGPA 4XMKH 5EOQH 2DYRB 4JRFA 1ZA6B 1CLVA 4YHKH 1Z5HA 2C7UA 3SE4C 4W6XB 4B6ZA 4GBXD 4X5WA 4OGQC 4MZ3A 2UZXB 2L7JA 3C2SA 2WNXA 2AJYL 2WO2B 3WYRA 5GS0L 4AXWA 1RK1A 4Y2OA 2NR6A 1HHJA 3DX9A 1KTJA 1XF4A 1BVLA 3BDXA 2YXWA 3F58L 3FRPG 3UG5A 2ARJA 4JDTH 3VA2C 3OMNB 4OZIA 5J6GA 1GZPB 4FQLL 4M4RA 2BXZA 1DQDH 3G7TA 1FA4A 1I3RA 4Q58C 1WHOA 3SGDH 3WFZA 4ZXBD 3QFJA 2MRYA 4JDEA 3HN5A 1X5IA 5CJOH 1S78C 4ZW5A 1UB6B 3MMEA 3TYFB 4M5YL 1OM9A 3P4NA 4XMKL 2Z0BA 4ZPTA 5EOQL 4YHKL 3C6SB 1X5AA 3CLFH 2YMOA 4ODWB 3VWJC 4IOIA 4MQXC 4HUXB 4S1QH 4FTVB 5HI5C 3HBPA 4PJ8B 1KV3A 3EO0A 5ESVA 4RLDA 1CT8A 5C08D 1ZJAA 5JIMA 5CBEA 4YSTA 3RKDC 4KMTH 3OB8A 5TE4H 1ND0B 1MCPH 3I2CH 1WS8A 5L4MA 4Z76B 1EEYA 2JXMA 2OI9B 4UOW0 25C8H 1F58H 1DQDL 5I0WA 2ENYA 1H15A 1E8XA 3CC1A 4MRCA 4MKTA 4HEMA 2L7QA 4Z5RA 5SWZB 3AS3A 3JYBA 3SODB 3UG3A 2OI9C 1L5GA 3OJDB 5CJOL 2FR4B 2G9HB 2HTLC 1NIDA 1DJWA 1E3ZA 5HYSG 3KPSD 3GRWH 3CLFL 2BPBA 2EC9U 2F8OA 2G2NA 1J5DA 3AWEA 5KS9A 3N44F 3GJEA 32C2A 4Q89A 4XCEA 5AW7B 2XZAH 4S1QL 1WIPA 3RWFA 2P5PA 1KTDA 3I9PA 2Q3ZA 4KMTL 1I1YA 1SYSB 1WAEA 4ODTH 5TE4L 4LCCB 1MCPL 5I16A 5BZWA 4TLUA 4LNRA 3GZKA 3I2CL 4U1SB 3D33A 1A6ZB 3EG9A 2FNBA 3QDAA 3QNZA 4WDIA 2ZAHA 4Y4HD 5DGQA 5F93C 1AQHA 3HVNA 2WC7A 3P3UA 4YPJA 4K15A 25C8L 4R0LC 1BQHB 1F58L 3CPLA 3IRPX 3PG2A 5E6ID 1JNLL 3A4EA 4KOCA 1BBJA 2J25A 1FLRH 2A9NH 5F96H 3STZA 1BLNB 1I7UA 1QNZH 3E8VA 3RVUC 1S7TB 4OLEA 4P4RA 2ESVD 1ZT1A 2AQ1A 3GRWL 5B7FA 1KGWA 1TITA 3PGDB 4UDTA 5JPNA 4R6UA 3EYSH 1XGPB 2XZAL 5A2CA 2EVFA 4DN3H 1NC4D 4NEHB 4NAMA 5IHLB 2C7UB 4RNRB 2OMWB 3GF8A 3HKZA 3HNSH 5D71H 4UQ9A 5JYMA 4ODTL 4WUKH 4YHYB 5DLLA 4TSCH 4PRIB 2LHAA 3GMOA 5FW6A 5JW4M 2W9LA 4XP5L 3SKMA 4AXWB 3TA3A 3L7FB 3U2IA 4GG6E 1HHJB 3DX9B 1NEUA 4YHYC 3WNMA 4L5FE 4N0RA 1NKGA 3ZKXB 2IG2H 2NR6C 1FLRL 2A9NL 5F96L 3VMOA 4E9SA 4DGYH 5J6GB 5JUEH 4OZIB 4M4RB 1D6EA 1QNZL 1I3RB 3FUJA 4O2FB 4ZUTB 4O2EA 2ZWLT 3QFJB 2Y7MA 3ESNA 4JDEB 3UTPD 1IBZA 3W81A 3TU6A 3EYSL 2E9GA 4LCYA 4N8VA 4ZPTB 2H0EA 3T3PF 3NIDB 4IJTA 4Q4EA 1HL9A 5D71L 3AVEA 3HNSL 4IOIB 4ANWA 3WJJA 3EGXA 4WUKL 1ZEAL 4PJIF 3FYIB 1JF1B 4TSCL 5ESVB 4FYRA 1F13A 1EUTA 5IWLA 4BXSV 1T7WA 3IWVA 1DEEB 1Z9SA 4PS8A 4WEMB 2HT4C 1P9MA 1IM3A 1W8NA 3DGDA 4DQOH 2WTRA 2GBVA 4RSYA 3Q5YA 4LK4A 4LKCA 3WTWA 1IQDA 3HLKA 4JHWH 3S37X 2ZXQA 3I50H 2JXMB 4FYQA 4PJFB 4NN5B 4FOMA 3LH9A 4OZGF 5JUEL 4DGYL 5CD5C 3L6FA 1XHHA 2G0LA 3CSPA 1H15B 3P54A 2WAHA 3HE6B 4D0BB 4BD4A 1VSCA 1Q0YH 4AGQA 2IPTH 4YL4A 5TPWL 3JXAA 1OPGH 3EYQD 3LPPA 4P23A 1AS6A 1ET7A 4KRPB 3ZJAA 2WJ7A 1LMIA 4WI5A 2CCLA 2W80C 1UKSA 2XFXA 2CE6A 5KS9B 5DVLA 4PCTA 3KCPB 5J5EA 1JWSB 4QHNB 3U4BH 1FNHA 1L4IA 3Q1SH 2KKQA 4JZJA 3RWFB 3EHBD 5ICXA 1I1YB 2WXLA 2FATH 2IBGA 5I16B 3O41B 2DH3A 4DQOL 4YE4H 1MW1A 2ATKA 1EPFA 3ARFB 5IKCA 3G9AB 5MENA 4B9FA 3EG9B 3ARGD 2R0LH 4GRWF 4JHWL 5GGUB 3I50L 3BLKA 1O75A 2A38A 3NIGB 1OAKL 3WG7B 2XKUA 1J86A 1WDAA 5CEXA 3FB5A 5F7MC 5DZVA 2JKTM 3DV6A 5EZOH 1Q0YL 5EUOF 2IPTL 1R3KA 2Y1VA 1QPPA 1OPGL 1DEDA 3N42B 1DDTA 3PYCA 4FL4B 3U46A 1NGYA 4XRCA 5DUJA 1ZT1B 1SUJA 3SJVA 4YR6B 4UDTB 2F0CA 5DDHB 5M7QA 2EE6A 3NJHA 3Q1SL 3U4BL 1QUNB 1X9QA 1AGEA 1KBGH 2X70B 4I0KA 5JPNC 3K8KA 2FATL 3RVXC 2ADIB 1DVQA 4YE4L 1T2QH 4QF1B 1KFAH 1NFDB 2BMKA 2R0LL 2X2HA 4TLKA 3SKMB 4XP9H 1CXFA 4TNFA 2Y9RT 2H0JA 3WUWG 3T0WA 4B3EA 3VI4F 3BVUA 1WAAE 3V0IA 4LCVA 3GSNH 3TA3C 4P4KB 4HS3B 1IGJB 2VIRA 2FRGP 5EZOL 2J8UA 2P80A 3TEYA 2P5ED 3SKNA 4HISA 2LLGA 5HHME 5IHWA 2AJZA 4DPRA 3MJ8A 1YCSA 2CO7A 2WQ8A 1DDHA 2ROXA 3QJFA 4UCFA 4E9RA 1OWWA 2R69H 5KTEH 4I5BA 2F1AA 4JVUA 4N8VB 3RHWK 2Z8VC 1K4CA 3H9HA 4XGZB 1KCRH 2K9UA 1KBGL 4AQZA 3RA7H 5BPPA 3EGXB 5CINH 1JPFB 1B0GA 3II3A 4Y89A 3CHOA 1T2QL 3VXME 4QRPA 1KFAL 1LVEA 1QEWA 1O6SA 4N0UB 4OD2B 4XP9L 5DUBB 3LH2L 3WJJC 1IM3B 2DD8H 5A2KH 5T3ZD 3QFDA 5E4EB 1PZDA 2YXVA 3NABH 4PJ7F 4LKCB 3QT2A 2WSKA 5IWLC 1KOAA 3GSNL 1JMXA 2GK0A 1P9MC 4UQ3B 3UBXA 1JK9A 3DVNB 5C2BH 1EXGA 3CZEA 3L6FB 4DJMA 4XP1H 1HKLH 3K4AA 4WWKA 3WMSA 1SJXA 4ZMOA 3T5WA 1JWMB 1TZHB 3HI1A 4PHZA 5GZNA 2R69L 4YSDA 4P23B 5KTEL 2WSPA 4GRMA 2AXFA 4L4TD 3X2QB 4GT7A 4HDIA 4LP8A 1KCRL 3QCTH 1NTDA 1CPUA 2PTTA 4ZMXA 4GP5B 3RA7L 5E08H 4P23C 1FVEB 5CINL 2R1WA 1QO3B 2DMGA 5JHDE 3HC0A 4JZJB 2WIMA 3QYCA 3SBWA 5DRXB 2XLLA 2VM4A 3K7UA 2WNGA 4PREB 4U1KB 2DD8L 3EKCA 3NABL 3LPOA 5MENB 4J2XA 4JZJC 1NDGA 5CU9A 5CIPA 4YDZA 1ZVSA 2VISA 5D1ZB 5F7HA 4A7UA 4JUTA 3NSFA 1RZQA 2C34A 3MRDB 4RMVA 4UV7L 5GISH 4JG5A 2DLGA 4BSJA 5C2BL 1HHHB 5JMRA 1JGIA 2IEPA 4HETA 4E9LA 1VIWA 3FB5B 3OKDA 1HKLL 3P77A 3NPSC 4L8BA 4XP1L 3T65A 4KNQA 2JE8A 2DL2A 1BXXA 1U3ZA 4LT7A 3REWB 2H0FA 1T03L 3VXSA 4PJGE 2Y1AA 3U46B 4FKKA 1HN1A 1NGYB 3QCTL 1TQTA 5FGSA 3F3HA 3PNWB 4O4YL 5CN1A 5E08L 4LRNH 4M1DH 3H1ZA 3EFDH 4BK8A 3EAKA 3CDCA 5IMMA 4JY5H 3ZDZF 2CR6A 3G5VB 3TURA 5L7XH 3QBTB 1SFHA 4M61A 2N4IA 5CNHA 5B38A 5JLZB 3FYEB 4ABUA 5IFAL 1EERB 4IRZH 2IXQA 3ZE2F 5AB0A 5C07D 5BRQA 5GISL 1O9ZA 1OZUA 2M2DA 4PRPA 4XHQA 1TQVA 1NBCA 5BXFB 1OE3A 4N5ED 5KVFH 4NHCH 2QV4A 4IEFB 2JELH 3CN1A 4MB1A 2AJZB 4UYPA 3MJ8B 4X50A 4DKFH 2CO7B 4HU8A 2H26A 3QJFB 1JPST 4OJEH 5J9PA 3WFEH 5BRZD 2B39A 2VR3A 4GQZA 4JFEA 4I5BB 3NG5A 4NJ9H 4LRNL 3H9HB 1K4CB 4M1DL 3W5NA 3EFDL 2K0RA 1ZS8B 1U3HB 4UQEA 4MA8H 3NK4A 4JY5L 2XFGB 4MD4B 2ZSWA 1I9EA 5L7XL 5L6YH 3SDCA 2VN3A 1U3HC 1EH9A 2D73A 2F53D 1ZLSH 2QVMA 3K8MA 3EJSA 4IRZL 5F9DC 4XO5A 3L13A 3CN0A 4DETA 5CSBA 5GJSH 4PJAE 2G3NA 4X6CF 4ONGL 5KVFL 4Z3HA 3O6FA 3UBXB 2JELL 3OG4B 5C0GA 3RBSA 2EJ1A 4DKFL 2XWEA 4L3EA 3QDMD 5TE7H 5LNGA 2VXTH 3WFEL 4LVNB 2BDNH 1U8HA 3CBRA 1QHQA 4L4VA 4FADA 2WCGA 2DBJA 4NJ9L 2AXFB 3LHPH 5E7BA 2YAMA 1FL6B 1RHHA 3KPRE 2WVUA 4LVNC 2PTTB 4MA8L 3HZYB 3SOTA 3WFDH 4ELME 5TDOA 5GZNC 1CFSA 5EIVA 1MH5B 1ASQA 4QHLA 5L6YL 2AW2A 2LFGA 1U21A 1PKQE 1A4AA 5GS2D 1ZLSL 2NUPA 3WY4A 3O0RH 3RWGA 2QFRA 3FU5A 5CBAB 5CIPB 1L9RA 1M7IB 1ZVSB 2VISB 4PRAB 3SBWC 3R18A 3V0GA 1KCWA 1C16A 2UV3A 3PFUA 5MERB 1ECYA 3AWFA 2OA9A 4WNSA 2OK0H 3Q43A 5C0BB 1ITCA 5DEGA 3OKDB 4L8BB 4YFLF 2NXZB 4JANA 5TE7L 2WMPA 5DR5H 1GYVA 2VXTL 5KAQF 2RR3A 3DHPA 2BDNL 3FUEA 3J2PA 2ZIDA 2Z91B 3VXSB 3CSFA 1TUPA 4GKNB 2AQ2A 4X7TB 3WFDL 5D93C 2XTJC 2QL1A 1IU1A 1UJ3B 3ZT6A 5IF0B 5I28A 1BD2D 1G6RH 5D6DA 4UOW1 3VUAA 1RZ8A 2EDFA 3O0RL 3QJOA 5HPMA 3DOSB 3NJJA 4M61B 2OV0A 4PG2A 4CN6A 2JJSA 1ERNA 2BNQD 4GP8B 4XZUA 3WN6A 1A8JH 1NFIA 2OK0L 3PIQA 1UOLA 4EUPG 4FI8A 2YPKA 2IH1B 1KIRA 3NEOA 5D1XB 2YD6A 5DR5L 4MXVE 3WEMA 4HAKA 1UM5H 4N2BA 1FZJA 2YD8A 3ELQA 3POHA 4P9MH 2RFXB 4HJGB 3O11B 2H26B 5J9PB 2XQYA 2CIIA 3B9KD 3H4HA 3QVAA 4JFEB 3OGCB 5FO7B 1UA6H 5FCUH 1QA9A 1ZOXA 4QNPF 4Y1TA 3MO1A 4D7BA 1CICA 1URZA 1G6RL 1XQ4A 4BFOA 4ZX6A 4LHUD 1ZDSA 3SDCB 3QQ3A 4WKZA 4Y4FA 3EADA 3IJ8A 5ISZA 4LGSB 2ZKMX 3FT9A 1T21A 5CZXC 2C9AA 2QQNH 3SDCC 4OZHA 5EDSA 2KQMA 1R4XA 1ETJA 4MCYB 1HU8A 4U05A 1I31A 2FE0A 5F89B 3O6FB 1UM5L 4CAGA 4PW9A 5HHNA 1AHWA 5T1MA 5JQ6H 1H6EA 1XEDA 5SX4H 5DMKA 1EWHA 3ZE1F 1XCTB 4AG4H 2WXPA 3O6FC 5AAMA 3TWCH 1EAQA 3LEYH 2Y5TA 2YPLE 2YWYA 5DMGC 1T20A 4I0PA 4L4VB 4F2MB 2A6DB 1UA6L 3L3DA 5FCUL 1FSKB 2CALA 3U25A 5F88A 1Z9MA 2BP3A 2LVEA 2Y06H 5TDOB 4MA7H 1P7HL 5AZEH 5HYJD 3L7EA 1AACA 2PCYA 1VERA 4QHLB 4QT5B 3MRPA 4MLIA 4QOKA 1D5XB 5LUMA 5FW7A 2E9BA 4EOWH 5F3BA 4PYHA 3HR6A 4ETQB 5EUKB 4NQTA 2MPVA 4HJ1A 5CO1A 4K7PY 3DLQR 4HH8A 4UUJB 2QQNL 4LEBA 7PAZA 1ECZA 1RPUA 1QZNA 5CKGA 3ZYIA 4J23A 3ESMA 4A7GF 4WI4A 2Z64C 5A6IA 5SWQA 3RPIB 4YFLI 5HI3C 3KJ4B 3VXRA 5JQ6L 4JANB 2WMPB 3HC2A 2P24A 4M7JH 4AG4L 3TWCL 1BMWA 1GKOA 2YN5A 4BCXA 5A43C 3KJ4C 2VLRD 3KW8A 5C7XH 5T8IA 1G1YA 4HCRH 4Z7QE 1X6LA 3QUMA 2C9VA 2Y06L 4MA7L 5AZEL 1QRNB 3AM8A 1GPOH 2H6OA 1G0XA 1P7QD 1U95A 4EOWL 1ZGLA 5L8KB 1J05B 3SDAA 1WWWX 3LHAA 3TH4T 1WRFA 4FFWC 3S3JA 1RZ8B 1G4MA 4KKCD 5GHWH 5HPMB 3T0ED 4YSAA 3GS4A 1N59A 1CIDA 5D6DC 2XN9D 1NFIB 2JCCA 1Z66A 2KBGA 1O0VA 3E38A 1DBMH 4PG2C 3PIQB 1U8NA 2FGWH 3K0WA 2JJSC 4MJJA 2W07B 2DMCA 3FTGB 2B8OT 4GI9A 3ZVVA 1KEMH 4M7JL 4G8FA 3ZDXB 1QTPA 4PFEA 3CLEH 5LBGA 3TVMB 2I9LB 4JUSA 5C7XL 2CIIB 3L4VA 4HCRL 2PETA 3MRNA 4WW1A 4UQCA 2ENPA 4OIFA 5KG9A 1GPOL 4HHWA 1FJ1A 4LZKA 1QA9B 2HXAA 5AENA 5CSGA 1NAKH 3FQTA 4AUUA 3P3SA 4KXBA 5I6KA 1I9IH 4L1TA 2E75C 3BYYA 5D7KD 3OKNA 5GHWL 3BVTA 1KLFA 3QQ3B 3G6DH 1QOKA 2KLRA 3TTYA 4J4PA 1CICC 4NNXB 3VCLA 4ZFZA 4PLOB 3L3HA 1BM3H 4ELKA 3K2IA 2A6JA 2FLRT 4OF0A 1DBML 3KLLA 4MMZA 1N70A 3SB3A 2FGWL 5B8CA 5I71B 1QHPA 5HSFA 4MQTB 2TRHA 3S96A 3WS6A 1KEML 3WS3B 2DEYX 2OULB 1AHWB 4HWBA 3UCQA 2OMUB 4H40A 1ADQH 3SQBA 3CLEL 5T1MB 2UZYA 1MVYA 3BZ4B 5AKVA 1V05A 1BF5A 3U4EB 1KTCA 4NZRH 4KOBA 2DYPD 3BQUA 1AHWC 4P99A 5IBTH 2Y5TB 1WBZB 5FUZH 5T3ZH 1T20B 4I0PB 4G83A 3MBED 3ZX1A 1X44A 4B95C 1NAKL 2VL4A 5AAMC 4U2ZA 2CU9A 2J88H 4I0PC 4QAMB 4I85A 5FA3A 4WFHD 3MRPB 1Z9NA 2CIKB 4AT6B 3QK0A 4HP5A 4JRXB 1F90H 4LGRB 2NZ1A 3GUTA 1BM3L 4F15C 3X1EA 3V6OE 1MHCA 2JF1A 2F6AA 4IK6A 1FN4B 3LS5H 3WIFB 2V8MA 3P9LA 3TEWA 2V9RA 3U7WH 4F7PA 4JDVA 2W88A 4URTB 5TD4A 5TH2A 5GGRA 2DM3A 1ADQL 1FG9C 3EUDA 3VXRB 1IGIH 3DYPA 4EKXA 3RDJA 4NZRL 2LU3A 4I13B 4Q2ZA 5IBTL 5T3ZL 5FUZL 5DJXA 2JJWA 3B2UC 5EU3B 2UYLA 2VDQH 4FE9A 1X5MA 5HDBB 4R3SA 2BERA 5HGHA 3AT9A 3QUMB 2DQEH 1PDKB 2H47C 3QCUH 5J7CC 2J88L 2AV1A 3BP4B 3K1KC 4KKPA 4AIOA 5H35A 4FNTA 4EDWH 3SHSA 4Z3TA 4MQ7A 3UACA 3RWEA 1AGBA 1F90L 4IU3B 5HYFA 4YSSA 1OGAB 2YN3A 3AM8C 3C6LD 3V5KB 3K46A 1N59B 3LS5L 3TNMB 1B3IA 3SDAC 5ITBH 2Z31A 3U7WL 5CF3A 4WENB 1ZSDA 3LN9A 4K8RC 4NQVA 2HJKA 1U8NB 2IGLA 2WD0A 1IGIL 2ITCB 4RVBA 4IGBD 4NUJA 5KBDA 3OHMB 3PJLA 5CILH 4FKEA 1G7QA 2VDQL 3G04A 4G70B 1SY6H 5G5DB 4WW1B 3QCUL 3TN0D 3SIKA 3ARPA 1TTUA 2R83A 2NY0D 1IRAY 1FJ1B 4EDWL 3ABMB 3FQTB 4RFOH 1S7UA 2GKIA 3OKNB 4A37A 2VQTA 2NUTA 1KLFB 2OTWA 4G43B 2QQLH 5F1IA 4IRSB 4ZFZB 3AREA 4ZZFA 5ITBL 4A6YA 3NFPA 2A6JB 2NYKA 4HKXB 4F9LA 2H9GA 3RGVD 1LEGB 5D1QD 3FTWA 5JPMC 3B5GA 1AZRA 2GVYA 4J4PC 4X6FB 4Z7NB 1NCIA 3VXNA 1M05A 3ASWA 1LEKB 4KU1A 4XWOC 2J43A 5JOFA 4PRBB 2YPVA 5ICYA 4WI8A 5CILL 4MMZC 4P3DA 3SQBB 5B8CC 3KBFA 2UZYB 1IV8A 2OL3A 3ARYA 3WS6C 1SY6L 2W0FA 3BQUB 4ZT1A 4G9FD 1DP0A 3D25A 3UJTL 4FYSA 3UFIA 5DYOA 2EYSB 4RFOL 3BQUC 5J11C 5K33A 3LZPA 1UGNA 2QQLL 4J28A 2VNCA 2V8LA 4UOQA 2EYRB 2NOYA 2CLZB 1XVSA 5I30H 5KSUA 4UOZA 5EORH 5DJAA 1U2HA 1FVCB 3ZRSA 4MJ6B 4KXCA 1ZA3A 1MHCB 1MCWW 2DWSA 3FHAA 4B9KC 2A6IA 2P26A 1RJLA 4K2UH 4K71C 1JTTA 3KEHA 3KH4A 4F7PB 4JDVB 4U6HA 4MBRA 1EANA 5GS2H 2X0WA 4NQCD 2AC0A 4GIOA 1ZLWK 4PP1C 2DQJH 2CKBA 4P5TA 1ONQB 2J2ZA 4BA0A 4MCZA 4NRZA 1UQSA 3CFJB 1QFWM 1FG2A 2EIDA 1Y1UA 3DO7B 1LE5B 2ITDA 5H35B 3ME0A 3QJZA 4YLBA 4AZUA 5IMOB 4IOSD 4AVIA 1AGBB 4YXLH 3GMRB 1KIQA 3D0LA 5I30L 3DURB 1YY9D 1MRDH 5ID0A 1A7QH 2J71A 5EORL 1L0QA 3AW5A 3OXRA 3VGBA 2NX5E 2KZBA 5EIIG 4HX1A 3VU1A 2NNAA 4K2UL 3QA3B 5KSBE 4X7SH 1GCFA 3Q44A 2EDTA 1KGIA 5D5MB 5IESH 3VFNB 4QO1A 2ZYHA 5BRPA 1WT5A 4HHGA 2Z31C 4NUJB 4DH2A 4ZO6A 5JIPA 2ICWI 4XMLH 5FUCE 4IRJA 4KROB 1Y1DA 5FX3A 2CWRA 2DQJL 3WY2A 5GRJH 43CAB 5K1JA 3H85A 2YD5A 1T83A 5FOJA 1PZ3A 4MB5A 1EFXD 2BSED 1WGOA 5CUSH 4ZUSB 4JFTA 3RZCD 2WZAA 4Y19E 3EOAA 4GG6A 2L3BA 2R23B 3ZL4L 4OD3H 3VRLE 1EXUA 2XKNA 4DF9A 4YXLL 1S7UB 2X0UA 3GHPA 1UOWA 1MRDL 1A7QL 1KC5H 3RFZA 2NUTB 2OTWB 1PG7H 5F1IB 3LAFA 2AANA 5E2UH 5D2NE 4NOFA 3X1FA 4LIQH 1UKTA 4X7SL 1F41A 4P3WA 4M6AA 3U6XS 3Q9QA 4KAQH 2XDHA 3AREC 5IESL 4OQ1A 4R5TA 1JGEA 3VXNB 2DPKA 1E4XH 2NY5H 4Q52A 5IFHH 1U8IB 3PS6A 1F86A 1PVHA 4HALA 4XMLL 4F9LC 2MH4A 5ICYB 3Q8AA 4OFKA 1P2CA 1YN7B 4KJWC 3B7RL 3U4AA 5C2UB 5GRJL 1UZ6E 1U41A 2J3SA 4M8RA 3ES6A 3BUQA 5CUSL 5AYUH 4CU7A 3F7PC 3D25B 2LLLA 3FRPB 4JX0A 3MCKB 4HF5H 4TVUA 1E40A 2VW6A 1IKNA 4GKSA 3ROOB 5DYOB 4OD3L 3QUZD 4X8XA 4GO8A 4YDMA 3FH5A 5GSVB 3FT3A 1GW6A 4BZYA 2MCPH 2XA3A 2YUWA 4U6XB 1DN0A 4ZFFB 5E2UL 1MWAH 3W9DA 1W9XA 4LIQL 3MFFA 1HH9A 1ZA3B 4KAQL 1MFBH 3S8GB 2A6IB 4L0ZA 3IJSA 4H4NA 5HP5A 1CFNB 1FFRA 1E4XL 2NY5L 4EI6A 5IFHL 4U6HB 4FQXB 3L81A 2GTZB 1BHGA 4TNEA 6FABH 1TETH 3RJDA 5C86A 3O0LA 5AYUL 3IJYA 3RNQA 3GMPA 4S0SD 1J88A 5LGJB 3LEVL 4HF5L 2CKBB 4P5TB 3MRIA 3LNEA 4MCZB 1QI5A 3JZ7A 1UQSB 2XPYA 4JQXA 4M56A 4NRZB 1VGKA 4LPCA 3UEZA 4IKJA 2ITDB 2GJJA 2R15A 4MS8D 4P5TC 2MCPL 3TA4D 3O2DH 5I0XA 1MWAL 5D2LB 2IWGA 4HFWA 4AK1A 4AQAA 4IU2A 5BNXD 5HYSB 4N9GA 5ID0B 4Z7UF 4ORZC 5CLTA 2ED7A 3MR9A 3UIZA 3OB0K 1XF5A 2DQGH 1E27A 3QUXD 4CILA 2R4RH 2E8YA 2OMZA 1PQZA 1GGIH 1L9NA 1JMZA 4JFDD 1T04A 1N19A 1TETL 2CHXA 1QNIA 2NY2C 2P8MB 2YBGA 4XXWC 4U1MA 4JDZA 3VW3H 4HQQH 4PS3A 3RX9A 4AJ0A 1WT5C 1J7VR 5I5RA 2YGOA 4IRJC 3D09A 2X1QA 2EIKB 5BV7C 1MI5E 3QUGA 4WTWA 2XA8H 1JHLH 3AWGA 1A6PA 4M6NH 3O2DL 1T83C 2NY3C 2WWMD 3K6SB 1EXUB 3W9EA 4PCKA 4PV1C 4ES9A 1WAAA 3GYRA 1J0ZA 3NACH 1KYDA 5BCAA 2BSSA 1CLYH 2DQGL 4OBSA 3BKYH 2R4RL 5BOJA 3RFZC 1GGIL 3V0VB 1NGZA 3VQ1C 1JGEB 1EHXA 4JM2A 3M1CA 1CGSH 2Y25A 4N4YB 3VW3L 3HG1E 2WIIB 2AAAA 2BXYA 4HQQL 4B41A 4XB7A 1TJGH 3CIAA 2HVBA 3ES6B 2IANE 5L88H 3M7FB 3T4AA 5F6HI 4KX9A 3VXMA 4X42A 4M62H 2XA8L 1JHLL 4GKSB 3L9EA 4M6NL 2X88A 2C3HA 1M1XA 2DIJA 1U8QB 2WHVA 3LPWA 2VDRB 4LFHG 3NACL 1IKNC 4KGLA 3KYOA 4APQA 1CLYL 3W9DB 4JFOA 4TNVF 1QACA 3BKYL 2VL5A 2BW5A 1NBVH 1HH9B 3TL5A 2X2YA 4M7ZB 1XGZA 1EZLA 3NN8A 3IJSB 1PZ2A 3OZ9H 5DHVH 1JHTB 5CEYB 4EI6B 3HMWH 1CGSL 3FTSA 1NAMA 1I1CA 3IGFA 1TIUA 3UH8A 2NZ9C 1AXTH 3B2VH 2HG0A 4JRLA 4PVNA 3LKNB 1S9YA 2QELA 1TJGL 4NP4H 2YGQA 2VJXA 4JBSA 2BC4B 3O3DB 5L88L 3O45A 3WEBA 5JHDA 2O6CA 3FT2B 4YSCA 3APMA 3GMPB 4M62L 3LIZA 2FGZA 3SE3A 2UUDK 3ULVH 2DWYA 5KYWA 1JTOA 1XTMA 4P2OA 4R83A 3EOBA 4K94C 5DJ2B 3WLBB 5T5NF 2J1KA 3VFTB 5JMOC 4JQXC 2HKFH 2ZOUA 3Q5TA 1X5XA 1FFQA 1OO2A 4HFWB 4AQAB 3EXJA 1NBVL 4N9GB 3MROA 1IAKB 3LKQB 5I18H 4GQ9H 4PGCA 4UM8B 1BQKA 1V55B 3DHMA 3KWVA 1YMME 3OZ9L 4PJGA 3HMWL 5M94B 1OF2A 3BAXA 2OMZB 1PQZB 1AXTL 1CDHA 1GZQA 1RSFA 3B2VL 3DVGA 5FUOH 4WFGE 4Z3FA 3BGFC 4PS4H 1S78D 1DE4A 4KVNL 4NP4L 4BHUA 2CUHA 3K74B 4HH9B 4U1MB 2EXTA 5GPRA 3U9UB 3ULVL 2X6UA 1ADWA 3SYCA 3GJFH 4PM1A 5HI5D 3ZL1A 1WE5A 1MCEA 1T0NA 4B9GA 3NCFB 1XCXA 3TBTB 3QXAA 3N6YA 2HKFL 4FTVD 3W9EB 1HAWA 2ODHA 4WFED 4Z7WF 5AFAA 5BJTB 4Q7DA 4ZNCD 3RTQA 5I18L 1KGXA 4GQ9L 2BSSB 1I8LA 1GS7A 2PO6A 4XR8C 4B9IA 4LLQA 5K39A 4CSPA 2P3YA 3IU3A 3TZVB 4CC1A 5FUOL 4PS4L 1Z9PA 2EE3A 5ABAA 2BVQA 2Z7YA 3QR0A 1EZVY 2CO6A 5FYKD 2CLVB 2FQDA 1WGVA 4MJ4A 2DJ4A 3KM2A 4PWGA 3K5RA 5AAWA 4JM2C 5HI4C 3WUWB 2Z93A 43C9A 4A2FA 5IMLA 3T4AB 1GCYA 2DQDH 4XN5A 2AQ3A 1IC4H 4KO5A 3T4AC 2AZAA 1XSOA 2GFBB 3BN9D 2FJGA 4PJAA 1JE6A 3S98A 4DUVA 3C08H 4GFXA 3S2CA 1PCSA 3QJHA 2NQ3A 4PJEE 4DN4H 2BP0B 4FG0A 4JFOB 2ZG1A 4UF7C 1N0XH 2MNUA 2ARJQ 4YDIH 2C9PA 3M86A 2WBJB 3PWNA 2Q8BH 3T3MB 4APQC 4PG9A 1X4ZA 4JO3H 3NJLA 3RVUD 4KKLC 1NAMB 3W57A 3KPRA 1ZIAA 2BOLA 3LQAC 2HCZX 4P9HH 4ELMA 4BK5A 4EVNB 4DPCX 1KTLB 2L04A 5CR8A 1CDJA 2P7TB 3TO4A 3CGTA 1A0QL 4OFQA 2NZIA 2XVLA 4R4NC 2N59A 3WMPA 3OMAB 4JJHA 5JHDB 1PKQA 2DQDL 4N6QA 2H5UA 2HWZH 3IEAA 5KYWB 1IC4L 3NSJA 3U0TA 2DYSB 4P2OB 1K8IB 2VKWA 4H0HB 2YC1B 3SE3C 1ZPUA 2AFNA 3C08L 5ENWA 3ETBF 4DN4L 5GRZA 3UTZB 1NWOA 2WLIA 1G0DA 4P2OC 5CCKH 3ZZQA 3DDFA 5TTRA 1N0XL 5DJ0A 4YDIL 3MROB 1OP4A 1OAXH 3ENEA 3Q6GH 3ZTCC 5I1KL 2NR6D 2Q8BL 4JO3L 1X5FA 4WHYH 5HDQH 4B97A 3MRFA 1NM4A 5ALBH 1OF2B 4NHUA 5EZLB 3L1FA 4P9HL 3KBPA 3VD9A 3N0PB 3V7MA 4LVHB 3QCVH 4NZDA 3BEWA 4PJ7E 4NN6B 3QFJD 2F5AL 5ILTH 2PCFA 2HWZL 1QW8A 1KJMB 3HG5A 5F7KC 3UAJA 5C8JB 4H2CA 1KEGH 4NN6C 5EF3A 1T0NB 3QXAB 2NY4C 3I6SA 1TVHA 2HT4D 5ITFB 4N0CC 3VJ6B 4YC2B 3GSOB 3OB0H 4XO4A 5CCKL 1HSAB 1J12A 1P7KA 2HJFA 3PDDA 1QSEB 2APBA 3RTQB 3Q6GL 1OAXL 4BGLA 2VYRE 5TDNA 4M8QB 4YC2C 3ISWA 2PO6B 3N3EA 5HDQL 5CD5D 3EH2A 4LLQB 4WW2F 3O3EB 5ALBL 3UYRH 3RTQC 1HFUA 3TJHC 1G84A 2CZNA 1ULVA 1SVCP 2BZCA 1I8LC 1OGTA 2EIMB 2PO6C 2VLJB 1QAWA 2BVQB 3QCVL 1G7JB 4L48A 1URIA 1YMHA 1NMCB 2CO6B 3CZFA 3HE6D 5CZRA 5ILTL 4Z7IA 4N85A 3HR5A 2BHFA 3MA7B 4MGXA 1O7SA 3A3YB 2XBZA 2Z93B 5IMLB 4D9LH 5ACZB 3UTPE 1KEGL 4KQ3L 2WLNA 2P8PB 2WYTA 2X5PA 2GJZA 4WTZA 3U83A 3US1A 1CWVA 3K0YA 5AAWC 1UVQA 3QDJE 1ET8A 4XXCA 1F6AA 4MZIA 3DUUB 4OZFH 1KPVB 1NKRA 1R24A 2Z35A 4PJAB 3TBYA 1T1WB 5L4FA 3FT4A 4JFYA 2EDQA 2EE9A 4XNQB 1MQKH 4BH7A 4Q6IA 3UYRL 5FYKU 2W9EH 1P6AB 2B15A 4PB9H 5DHXB 5EN3A 2YPLA 3ZDZE 1V27A 2EINB 1KZYA 1DANT 1LYQA