2CPCA

Solution structure of rsgi ruh-030, an ig like domain from human cdna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
GSSGSSGTDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords KIAA0657 protein
publication title Solution structure of RSGI RUH-030, an Ig like domain from human cDNA
rcsb
source organism Homo sapiens
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cpcA01
1ZS8B 2DQEH 1W72L 3CFBB 3LEYL 1LK3H 3HE6A 5F3BA 2COQA 3HE6D 1JGUL 2XZQH 1NLDL 3ARSA 3QYCA 2AJVH 3PP4L 3W0WB 2V5TA 4GJTB 4RFEA 3HMXA 4F9LC 1TCRA 4PJIF 4XNMA 2A0LC 1BAFL 3T0EA 3NCMA 3MCLH 2A6DB 2E9JA 3T0ED 1I7UB 3TIDB 4KDTC 1K8IB 4J3TA 5KVGH 4UT6L 4C4KO 3BKMH 3HUJA 3ULUC 4XNUL 1JPGB 2BSSB 4C56A 3D1MC 5I0DA 4C56D 1K5NB 1OF2A 1RQ5A 5E6IC 2OSLA 4PGBA 1OSPH 1FRGL 4EQ2A 1NCWH 3GEWB 1T83C 5GISL 4YDKH 1IILE 3U0WL 3NZ8A 5FB8A 5HHOE 5F97E 5BZDA 4MWFA 4J12A 5D7JA 5BZWB 4F7TA 3FRPA 4HUKB 5C86A 1JWUA 2YXMA 3A6CH 2HG5A 1GXEA 3E2HB 3LKNB 2DJ4A 2YBRB 2GYSA 5KJRH 1HXMB 2FL5B 1J8HE 1CD9B 3ARRA 4M1GL 1D5XA 1FORH 3F7QA 4NJ9H 3IDGB 43CAA 4TVPH 4NRYA 3I50H 3ARVA 2ATPA 2VLJA 1DBBL 1X5AA 3M1BA 3T65B 1N7MH 4FFZL 4XZUB 1K3ZA 4P46B 3SJVB 1TTFA 5EUKB 1SYVB 4JZNA 1C8PA 1NCAH 1KC5H 2OR7A 2Q3AA 1U92B 3EOAB 4IIQC 5GS1B 5L88L 1NAMB 4QHUB 1UWEH 5JIHA 5DEZA 4Z7WB 2XG5A 2I9TB 4U6XA 5DI8B 5E8OA 4OB5H 1OAUH 1JZ8A 4JDVB 1FNGA 1UWGH 1YN6B 4M9OA 4F57L 1ZVHA 4MCZB 3OR6A 1HSAA 4LCYA 3HPJB 1KTRL 2AEQL 1KLFA 1SJHB 5HGBB 3CXHJ 1FL3A 4R7NA 1S7TA 4FP8L 5DQDH 2GSGB 4H26B 1QA9A 3W39B 3C5SA 1ZLUH 1YQ2A 2HLAB 1HEZA 5F6HI 2P24A 3S35H 4M6OL 2F54E 1F11B 4G9FD 3CVIH 3L3IB 4JFOA 2FX7L 1HKLH 4Q2ZB 4LAQH 2X4NA 4C83B 3H3BC 4EZMA 4XVTL 1A6VL 3TFKD 1XFPA 2MOVA 5EU3A 3GJEA 3PABA 1NBZB 5F1OB 3MRHB 2QLVB 2Q7YB 1T80A 1ZXQA 3AC0A 4F2MB 2JE8A 4E41A 1NLBL 3WDJA 1FFRA 3OKOA 2B5IC 5SWSA 4E41D 2MKLC 3WN5C 43C9A 3IKCA 3K2UL 3QULB 5SWSD 4QCIB 4I18A 4ORGA 1ZSDB 2AV1B 3U6RA 1IBGL 1KSRA 1LP9A 4LASL 4LKCB 1ETZB 1J10A 4N8VA 4KFZC 2GITA 1CFBA 2FGZA 4QXUH 1KEGH 2W38A 4XP4L 4POYA 2NYYC 3DYMA 1JCKA 4XGZA 3N9GL 2CXGA 4RISH 3WUZA 5EBMA 3ARDD 4XHJD 1OQOA 3NFNB 3D85B 1YEGH 2H32A 4WHTA 5B8CB 4QXGH 4MMZC 5LGJA 2R2HA 5MHSE 4NM8L 4KJYB 2R1WB 2VLKD 1DUZB 4XPAH 5HDOA 3WD5H 4A2MA 3MCKB 5I1IH 2W0KA 4LHUG 4LP5A 5EO1A 2W59A 4IIQB 1OCWH 2EDFA 3RIFF 3UTSB 4XPGH 1M71A 1VHPA 4LSRL 5KS9F 3SY0A 1UACH 1P4LB 1QP1A 2BVEA 2BXYA 3U4BL 3D25B 1UM5H 4Q6IA 1T20A 1QFWM 3FQTA 5D5MB 1CQKA 2IF7A 1K4DA 1K2DA 3ARFC 3MX0A 3QCUL 1FL5B 2F53E 4CU8A 4LNRB 2HKHL 3CGTA 3FN3A 3BDYL 1IAKA 2V2TA 4LPTA 2ARJQ 4KKLD 1OW0C 4Z5RB 3CNKA 2EKSB 5DZLA 1RHHB 3CFJB 1WEJL 4HWNA 2OTPA 2G5RA 2GSIA 5TDOB 4Y16C 4MXWL 4WNQB 1XMWA 4XVSL 1J0HA 4KK5D 4UDUB 3RX5A 1T04A 3VFWA 1GSMA 3FT3B 4PJ5A 5DJXA 1U8PB 1RJYA 3PWPB 1HXYB 3U2SA 4PJ5D 5J1AB 2FSEA 2BOBA 1E0OB 5AWNH 2B5IB 2H2SD 3KS0J 4GG8B 3MFFA 4QF1A 3JTSB 3MUZ1 4LCWA 1HHGA 4L29B 4F7EA 2IANA 4LCWD 1F4AA 3RBGA 1EDQA 5FF6B 4J23A 4KI5D 3WJLC 5C0BE 3O6FC 4UAOC 4KKCD 5TE7L 3IDXL 2RIKA 1U36A 2W0FB 3HCVA 4Z76A 4KROD 1LVEA 1LHZA 4YHIB 1N0LA 5GGVL 2AW2A 2NY4B 2HVJB 1C16A 4Y5XA 3LKPA 1DBKL 1ZGLA 1JYXA 3VD3A 5EU7C 3KYAA 3BHBB 1AGCA 4XPTL 4ZO8A 1BGXL 1INQB 4LPUA 3HZMA 3TNNB 1F58L 4HDIB 1BJ8A 3F58L 3V5DA 4HV8A 1S7UB 4PJ7B 1XF5B 3CVHB 4GKNB 1N5AA 1NJ9A 3O8XB 4P2CG 3RWIA 3QQ4A 2FH8A 1ORSB 1X4XA 4C59B 5GRWA 1Q8MA 5DVNA 4YHYC 1YEEH 5A2JH 2D31A 5FYLL 1QSEB 2NNAA 5DQ9B 4ZS6D 2Y6SC 4X98A 2FHBA 4LVHC 1C7SA 1LO2L 4P2YA 1VACB 1HIML 2QJDA 3INUH 3Q3GB 2IGFH 1S3KL 1D9KC 3CU1A 1D6VH 2G75B 5D7LE 4H20L 3CX5J 2E9BA 3ULVE 3AROA 5KSAA 2BY2A 3ARFB 3OKMB 1H0DA 2V7HB 5D2NE 5ACLA 3TA3B 3KYOA 4IJ3C 3L5XH 1FNEA 1JV5B 3QNZB 3U0PB 2RFXB 4FTVB 1FPTH 1I4FB 3IDUA 3QDJB 4W68A 4BSVA 2BSRB 3I6LE 2HKFH 1HH6A 3P4MB 2VAAB 4P5KB 1FO0H 5FXCH 2FLRT 1N59A 1FQ9C 4Y16B 3O2DA 1U93A 1QBLL 3OGOE 4HCRH 3EOTL 2PO6D 2QADB 1MCCA 5MEQA 4PRPD 3TBTB 2APBA 1T1YA 3TBSB 4H8WC 4YBQC 5ACZA 3X3FH 4AYFA 3VG9C 5JW3H 3VFPB 3PL6C 3ROLA 4X7TA 2XZCL 4HLJA 3OXRB 4HLZG 5JOPD 4OLXH 2FX9L 3X11B 1KTLA 2VWEE 1XCQB 3O6FB 5I19L 4UAOB 4UQ2B 2R2BA 3L3JB 2NY2D 3DO3A 1W2KT 1RUML 4R96A 3L3DA 3CLFH 3FRPG 5J12C 3O4OC 3NA9H 5JDJA 5HVGB 4K7FA 4XBGA 3H8NA 4PJIE 4H8WH 2ADJB 2PW1A 5L6YL 2ADFH 3GMOA 5FO8B 3CFEA 2FR4B 3S3SA 3QNXB 1AE6L 1Y6NR 3ARBC 2JTDA 2GIYA 1KG0B 4FQQB 4JJ5B 4FNLL 1JGEB 4ZPVA 4XNYL 3C6SA 4GXUM 3S97C 4JPIA 3BP7B 3KJ4C 4JY6A 1NFKA 1J7VR 3B2UC 3RTQC 4G6AD 1NANH 2IH1A 2NX5E 2CXKA 2B7DT 2I5YH 4YHYB 3LAFA 3QXDA 4KQ4L 2VIRA 5IFJB 3U79A 4LVHB 5EN2B 1BVLB 3V4PL 2G2RA 4K9EL 4P4KC 3TYFB 4KPHH 5F9WC 3TCXA 4KZDL 1MWAL 2XTJD 2ZOLA 3DVFA 4Z78B 3OPZL 4EJ1C 4IJ3B 3NIDF 4J3WA 2QSQA 3QJFB 4ODUA 4PJFF 5FK9A 4L9LA 1MRCH 4WEUD 3BZEA 4MJ6B 4MQ7B 4HPYL 4U1MA 1DP0A 1HHIB 3BJLA 4KMQA 4JPVH 3H9HA 2GT9A 1HYSD 5DRXA 1L0XA 3VFMA 5FO7A 4X4XA 4JFFB 2CH8A 4RMWA 1KIRA 3RHWF 2DMCA 3VDCA 1SVCP 7CGTA 5E00A 2AV7A 2YEZB 3QUYC 3IDJA 3PL6B 3VXTB 3CZFB 2YUXA 2HT4C 3L1OH 4XMPL 1C5BL 5D7IE 3RVTC 4FN0A 1R3JB 4QWWD 4F3FB 2FD6H 1ZTXH 3CSYA 5E4IA 5H37H 4M1CD 3W11D 5D2LE 1AQDB 4HKZB 3LN5B 5HGAA 2ZUQC 2OZ4H 2CK2A 4JE4B 2BVOA 5EO0A 2BNQB 1BJ1H 4N8VG 4DOHB 1NCDL 3HRZB 1G6RL 4HWBH 1KLUB 1FIGL 1F3JB 4WW2F 5C6WH 4Y4KD 4HXAH 2F19H 3LKQA 5E2VH 4WUUB 4AMKL 4APQC 2DQGL 3MJ8A 2VKWA 5DUMH 2I07A 1CK0H 4Y5VC 3AXLB 2J6EL 1H3VA 1FG9C 3RTQB 4JFDA 3WLWD 5EORL 3VMNA 3BP6A 3OJ2C 3P4NA 4JFDD 1G1YA 3SEPA 1XH3B 2GTWA 4I48B 4JFYB 1J87A 3LRSB 4DTGL 4XXDA 5BRZA 2N7AA 3R8BB 4Q58C 4HX1A 3VFOA 1H3GA 1XGUB 5HHOB 2VSDA 5BRZD 2QQQA 4KVNH 4KTYA 1IC5L 1CDUA 5DXWA 4P4KB 4R90L 1BD2E 5F9WB 5F8RC 5D4QA 5DD1H 5DJAA 3X13A 3GDBA 1EVUA 5DK2A 3OKLA 5F7WC 5C7XH 2Y72A 5GIRA 3KLDA 4GAJH 1A6WH 1FZJB 2VXTL 4XC3L 3C8DA 3C2AL 5C07E 5I74B 3PHOA 3N0PB 4Z7OF 2AJSL 2CGRH 2HFFA 3HRPA 4DEPB 4RGOL 1U8HA 4RIRA 3MGOA 3T0VA 5IB2B 1CT8B 3RY5A 2X41A 2H9GA 1R3KA 2VDOL 1YYML 4GAYA 4XP9L 4MYWB 1ZK9A 2IBBA 1MVUA 1OTUC 4ZUVB 3N85H 1T0NA 1JNNL 1PG7X 4GKSA 4A6YB 4JPWH 1NGXB 3MOBH 3S98A 5E99H 4NHCL 4X7SH 5F7YC 3SGDI 3FB5B 1I7TB 3QWOA 1KIPA 1RIHH 1MHEA 1M6OB 2XTLA 4HFWB 4WWKB 4N1CA 1U3JA 3UYRL 2Y06H 5F7MC 1XGTA 1I8KB 3O4LA 3WXVH 3UC0H 3HZVB 3VWKA 5D9SA 2NR6D 4LLAA 5K9OB 2VXUH 3MBEA 3O4LD 2UZYB 3L6FB 3BX7C 4HZLB 5F3HB 3ZDXF 1AO7B 4F7PA 1OP3H 2A38A 1F8TH 1XGYH 2WWMC 2ZUYA 3OGCA 1XIWD 2BC4A 3MRQB 2O61B 3C87A 1T7ZA 1JJUA 3RWJA 3VGDA 3EO9L 3RQ3A 3GI9L 1FGNL 5DD5H 4PB9H 1QOKA 4LCIL 1NEUA 5EA0H 3OKNA 3O3AA 4NYLB 1CFNB 3I75A 4Y89A 3M8OL 4I8DA 1U8KB 4X0KA 1I1YB 3GUTA 2E8ZA 3FFCB 1NL0H 4JM4L 1RZIA 1QBAA 5IFAH 4IRJC 3H7LA 3O0RL 1PW3A 5T5NF 4YAQB 1X5LA 1G7QB 1GGCL 2VDQH 5CINL 4W81A 3L9RB 2XYCA 3OJMB 4O2FA 5KSBB 1W0VA 5DVKA 4E5XA 2BSTB 4L9DA 3QPXL 4TQEH 2OXHA 4NSKB 4Z7VA 4WRLA 2JIXA 5HHNA 1RHFA 4H5SA 4PTUA 1CN4A 1TFHA 2JIXD 3ZKXC 2R0ZH 1SEQL 5TH2B 5DK0B 4OV5A 1CIDA 1EIBA 3FOLA 1SEBB 1MHCB 1CDYA 3HLAB 2E27H 3UPAA 4PGZA 1NMAL 3LZFL 3CFKB 3KWWA 1QLEL 4YDJB 2Q1EA 1PX4A 3AVEA 3IXAB 3I2CL 1RUKH 4HJGA 5C0GA 3CPLB 4P4RB 4UTAL 4FQHA 1OAKH 1YPZF 4PJ9C 1E4WH 5DJYB 1SVZA 2OQJA 3QFDA 4IOFD 4XB7A 2IBGA 4TSAH 5DJ8A 2LFGA 5CJQL 4EI6B 1PFCA 4FQLL 2ZPKH 5BS0A 2FHFA 2X05A 3V7AG 5BS0D 3JVGC 5E24E 2R4SH 3IFOA 1DQJB 4QKXB 2X4UA 1J12A 4PJEF 4NHUB 2OR9H 4XNQA 4FXGA 1T3FA 1I7RB 3IU3A 4IOIA 4WENB 5EOTA 5JUEL 4G8EA 5C8JB 5IB1B 1HHHB 4KJQC 3OJDA 5LXGL 5D1XC 1ZLUK 1KELH 3IJSB 4P2OA 3KPPB 3MUGA 1KTKE 4Y7MA 4K7PH 4P2OD 5GJTH 2R0WH 4UDTA 3G08A 3MBXL 5IK3A 3LD8C 4PJAF 3AU1A 5LQBH 4KK8D 2BMKB 4ZQKA 3VFUB 1KJVA 3FONA 4JRXE 5C09A 3MCG1 5EU5B 3V0AC 2OS7A 2J3SA 3FJTA 5C09D 5FUOL 4GSDH 4YZFF 3MXWH 2C4XA 3KPLA 3QEHB 4BUGA 3SDAC 1JVKA 1YY9D 3P77B 5ADPH 4JZOB 4XP6L 1RFDL 3MRRA 4LARL 1KN4L 1Y18B 3MROA 5A2IH 5ITBH 1UXWB 1P2CA 4JLRA 3EYSL 3ZHDA 5C0BB 4NQEA 1DTUA 4PGJA 2NTFA 1IGFL 2BDNL 4P5TA 1BBJB 2VR4A 4GRMA 5T1KB 3NTCL 1WIOA 4ODSH 1MUJB 4QY8A 3WUWB 1D6EB 3HB3C 3GRWL 1BVZA 4KK9D 3RWHA 5EG6C 4WI2A 1GH7A 1OAXH 4TVPE 1CD1B 1DEEB 4GLRI 4JFPB 5GGTA 4DCQB 2Z31B 4L3EB 3BQUC 1TXKA 5DJCA 4Y4HD 5IF0A 5L0QB 2A83B 3PF2A 3B83A 5I30H 4PJ9B 4D9QD 1D5BA 5GGUA 1LEGA 4TUJA 2BERA 2CD0A 4LSUL 1U8IB 3TT1L 3H9SD 3BXNB 4X5XB 5ADOH 3MV9A 3UTQA 1XEDA 2OK0H 4V2BA 3RVVC 3MV9D 3LKOB 1GZPB 1L6XA 2VZUA 1P6AB 3HMXH 3PV7A 2VC2L 2DTML 5D7SL 3T1FB 1RULL 2FB4H 5IVOA 3RL2B 1V8HA 3RVXD 3MNZA 4JO3H 1QR4A 2P8PA 2Z9TA 4PP1C 4Z8FL 3VG0H 1JPFA 1NGZB 2C4FT 5EC2A 2E6JA 5JXAL 1VFAA 1EZVY 5CSZA 5D7JC 5EU4A 3DMMD 5KVFH 2E6QA 1ZANL 1UCBL 1ZEAL 3K1DA 5EC1B 3G6JB 4QT5A 1ZA3B 1IL1A 1NFDE 1LEKA 1F6AA 3EHBC 1CTOA 4HH9B 3JV0A 2NY1C 3SDXA 1OPGH 1G7LB 4CW1A 4U1NB 3N1MC 3NIGE 3SDAB 2OJZH 3HAEA 4HLZH 3CZJA 3AM8C 4HS6A 3V5KB 5C08B 1LK2B 3EJJX 3CC5B 2DWEB 3EOYG 2EIZB 3EFDH 1A6AB 1T1XB 4BQCA 3QG6A 4PBVC 2OMBA 2ORBL 2P45B 1HI6B 3V7MA 4FHBD 5J9PA 4CBPA 4IDJH 4MZ3A 4DZ8A 3LY6A 4PJIB 3ZE1F 1S7QB 2VQ1B 3CK0H 4M62H 5HDBF 1RZFL 2CR6A 1WBYB 4NP4L 2PETA 3FMGH 4P23A 4MQXD 3MJ7B 1MJUH 1I3GH 2R23B 4P23D 3BQUB 4WTZA 1Q9KB 4EUPB 4E0RB 2MCPL 1T66D 4L8DB 4M93B 5FA3B 5HI5D 4P57A 2AJYL 3WSQL 2W9EH 4TULH 4LSQH 5FYJU 4PRDB 2KL6A 1LD9A 1RIVH 2R0KL 3V4UH 4UU9A 2D7OA 1PKQA 2HFEA 1D5ZB 5CGMA 1R5VB 5D70H 4KJWD 4PJXA 5TQ2L 1GGBH 4AM0A 1P9MA 5F72S 3BO8A 3OZ9L 1DLFL 1ZMYA 2EH8H 1A6TB 4KAQL 4OF6A 1KJ3H 4UINH 3U1SL 2P5WB 1EEQA 3O41A 3QXWA 3KHOA 1G7PA 1IEBA 2WBKA 5HPMA 4M02A 4XPHL 2ZOKB 1LDSA 3MRJA 3WFEL 4HUVB 4JFZL 2R9HC 3G04B 2DS4A 4PS4H 4EDXA 3LEVL 2X7LB 1NC2A 4CVXA 4OT1H 1WT5A 2HRPL 1A1OA 3OHXA 5ESVB 1IGCL 4DVRL 1BQUA 3WMSA 2ATKB 1A0QL 2UZIH 3SO5A 3EW3B 4CJ0A 2DWDA 1UZ8A 3GMPA 1F4WL 2OJEA 3E0GA 3UJJH 5JA9A 1NEZA 2FEDD 4YXHL 4AIZB 4OLYL 3Q0HA 5F7FA 4DZBB 3THML 5EZIL 5I2IA 3SGJC 3NOIA 4YE4H 4MQSB 1FCGA 2CMRH 1TCMA 3L5WB 5F21B 1CF8H 3QDMA 1EA9C 2X9WA 2R1YB 3CSPA 3HHRB 3Q6GH 3RVWC 3QDMD 5HD8C 3QEUB 4JKKA 1P4BL 4MDJA 1FFNB 2H32H 5H2BA 1Q0YL 1FJ1A 3EGSB 3LS4L 1CVSC 4LLDA 3MGTA 4X6CA 4NC1C 3V0WH 5DYOA 1WUNT 4ZSOB 3SGKC 4CMMB 3TZVA 5E03A 4HMEA 3GSQB 3DO7A 5TJWK 2ARJA 1JYVA 3S96B 3TZVD 2G9HB 1QYGL 3ULSB 4KI1A 3RDTA 4QHLA 3FN0H 5CIPB 3RNQB 1DQLL 3RDTD 3B3IA 4FFVC 4HGWA 4K94C 3BKCH 2ZCLL 5EULV 4DGIL 2H26A 3WYRA 5ICXB 1CLZL 3QUXA 3MRGB 2DTSA 2BVQA 2WIIA 3QUXD 2NY7H 5MI0C 4QOKA 1TJIH 3D48R 2ZCKL 2HTKC 3MRMA 3MTRA 2B2XL 4OKVB 1AIFA 2AXGB 5DDHA 4PJDE 4KHXL 1XR8B 4NUJA 4HHAB 2OL3B 5BJTA 5EOCJ 1NMBH 3MXVL 4WTXA 4BH8A 5FM5O 1FFPA 1RK0A 4GBXA 1Y0LB 3E6FA 3ZKND 4OF0A 1QFWI 2NY5H 5I8EB 3NAAH 1NPUA 1O5DT 1ES0B 1DL7H 3F5WA 2I60L 2V5MA 4PGCA 4G6KH 3C08H 5FKAB 3IVKA 3DTXB 3NPSB 2E7MA 3TESA 4UQ3B 5ANMA 2W07A 3BKJH 3IETA 5IKCA 4NO3B 5I71B 4UT9H 4KKNA 4GG6A 4PLOB 1R5IA 2J5LC 3RVUD 2FBJH 4JRYE 4XBPA 1PGRB 3V6OA 3DXAD 3ZE2F 3BH9B 3AY4A 3VW3L 1YPZE 1FVDA 3GZKA 3FKUS 3VFTB 1LEIB 3GKWH 1RPQA 2H45A 4P2RE 2DQDL 5JR1H 5KS9B 3MOAH 3I6KA 5ID1A 5IG7A 3OV6A 2ZG1A 1QLFA 5C3TA 1QNZH 2EDYA 2Y07L 4LRIC 4D0CB 3RGVA 3MREB 2VZ3A 4LCCC 3RAJH 2M2DA 2ZP0T 4JFQB 1S5IL 4OLUH 4M43L 5FYJH 5C0FB 1UA6H 3RBSA 4LEXL 3B5GA 4WHYG 1CFSA 3WIHL 1GGIH 2EDEA 4KUZH 3IU4H 1BZ9B 4OF3A 5IJKC 1P84J 3GSNB 5KSAC 4J1UB 3NFSL 3C5ZA 4NO5B 1NBVH 5B39G 5EU6B 1RZJC 2HFGL 2P8MB 2X4TB 3RZCB 3DETC 1R24A 3UTTB 3DUUA 1KB9K 5DLMH 1N6VA 5AYUL 3TWCL 5DTFA 3DX9A 3ZTNL 5LWYL 5EFIB 3ILPA 1P1ZB 4OCXL 4PRNB 4IRZH 3D0LB 4PG9A 2QQLL 5I8KH 1T6VN 4YFLF 1K6QH 2W60B 2A74A 5B3JF 3T09A 2D3VA 1MSPA 3P9MA 4EVNB 4PBXA 5MI0B 5L2KA 3GMRB 1J11A 1NGWB 1YMMA 4OD3H 2VZVA 1RZJH 3C8KB 3WS3A 4QRPE 5JORB 3T4YB 2HWZH 1U8LB 2OLDA 3QCVH 4M7JH 2PTTA 2V2XA 3BIAX 2WK2A 5HDQH 5D71L 4OZFB 3WFHA 3RWEB 2Z0BA 4HT1H 4I3GA 5IBLC 1D5MB 3P0YL 3O2DH 3QFJE 4GW4B 1XF3A 1MI5A 4HUWA 2VXSH 3PWUB 4QLRA 4LF3A 2X70B 3I84A 2PR4L 2YHGA 4HJ0D 3S6CA 1RUQL 1FLRL 1MCFA 4TPRL 5IHBA 5BV7H 3WS6A 2J5LB 3HNTL 3CDGA 2H41A 5I76B 1M7DA 3K3QA 3HAEG 3TJEL 5I1CL 2IG2H 2BX5A 5E8PA 3SGDH 1DQMH 1KJ2B 3TBVB 3IS1X 2A2QT 4MNGB 3JV5A 2PNDA 3FO9A 1OP5K 1K4CB 3L3KB 5HGHB 2CLRB 1MCBA 3VRJA 4J4PD 1OP3K 2BP3A 3MV7D 4NQVB 3BZFB 4Y4FC 4D3CL 4RFNB 5D1ZC 4LCCB 1EGJL 2ERJC 2R69L 4KY1H 3S5LB 2E9WA 2H6PB 2FJGB 2IFGA 5C0AD 2LAAA 4AEHH 1J5OL 3R0MA 2F9BT 3K4AA 2ADIA 1DE4B 1I85C 4G3YL 4ZS7H 5JHLH 1Z0MA 4IRSA 5FYKD 5BVJB 4K07A 4LVNB 4XXCC 3AS1A 4JRXB 4IRSD 4OUUA 4V1DE 4U49A 5ITFA 2VOTA 1A6UH 1B0RA 4LCUB 5IMOB 3S37H 2I9LB 1HSBB 3GO1H 4P3CH 4WTZG 4QRQB 3I3BA 2HT2D 3BGFB 4KTDL 4LLUA 1YJDC 1UQSA 4L9LC 3Q1SL 4C55A 3CSBA 3BUYB 4I0PC 4ZOBA 4F58L 1U8JA 4BSWB 2VABB 4LQ1A 4HUUB 4JDZB 3IJYB 1IAIH 2YD9A 1IM9A 4TSCH 2QHRH 4CMHC 2YPKB 1XGRA 3C6LA 3U30C 3IDYC 2DQJL 3C6LD 3VE0B 3QDGE 4NQXB 3L5JA 5I8CA 3ZDZE 4AG4L 4ODWB 2JK5A 4DKEL 1MCEA 1OT2A 1MJ7H 3HNVL 1YJDH 4U1HB 1XR9B 4HUXA 1MLBA 4X6EB 5IVXA 1CE1H 1WJ3A 1S8DB 5C0RL 5HHVL 3T2NH 1LQSR 2KQMA 4FQXA 4L5FH 1MFNA 1V3MA 3D9AL 5HDBE 2VLLB 3QUMA 1ZKAA 1KJMA 1SBSL 4JHAL 3AREA 4WW2C 4MJIA 3TGXA 3NACH 5FUZH 4PJHE 4H0GA 4MXQC 5F1NA 5IB5B 4AH2A 4P48A 3QHFL 2X4SA 5HYSA 3SE4C 3BVNB 1UYWH 4OLVH 1A7QL 5I1GH 4NKOB 1NEZG 4S10A 4X5WA 4MVBC 3QXUA 1LMKA 2QKIA 1H8NA 3EDEA 2QQNH 3DSFH 4LVEA 1VCAA 4RA0C 3ILQC 4Y4FB 1U91B 3BWAB 1JP5A 4R26H 1RZGA 5D1ZB 5IR1A 1T22B 2IMNA 5ID0B 3HZYB 1AI1L 1KCUL 4U1GC 4NUGH 3DHMA 1HHKB 2R39A 4WFEE 1ORQB 5DA0B 4M00A 3DUSA 1HQRB 4YR6A 2MWCA 4PLJC 2OL3L 2EDDA 3WHE1 4PLKC 4PJFB 1U8NA 1R0AH 1BEYL 2RR3A 3IRZA 3SCMA 2N7BA 2WBJD 4HXBL 4LQFH 1NBYA 3JTTB 1F3DJ 3SCMD 4ELMF 5A2LH 2D2OA 1Q0XH 2HJKA 2EC9U 4I0PB 1UXSB 2GUOB 1RUAH 1Z5LA 3VFSA 2VLRA 1C12B 4UOJA 3VFVA 4PJCF 1A5FL 3RFZC 4U6VL 1PBYA 4U6TA 1H5BC 3HI1A 4ZNEA 3U30B 2IALA 5D6CA 3HKFA 5HHXH 1JZ3A 3UTZB 2HP4A 4BQ9A 3D0VB 3MRIA 1WFNA 3SPVB 2M1KA 1BM3H 2K3TA 3ZT7A 3I9GL 5EUOE 1PYWB 5CHNB 1T21B 1V05A 4LLMB 3LEXB 1JUFB 3BAEH 3BUTA 4WHDA 5DRNA 2DRUA 4L3CA 4X99A 1YNKL 1AGEA 4JO4H 1J8HD 5BW7C 4Z7UA 4NO0A 4GLRH 5DD0H 1MRDL 1MPAL 3VWKC 1UJTA 4KI5F 5GGSA 3MBEC 3OJVC 1S9XA 1INEH 3JWOC 4WW2B 5F96H 1HINL 1TZIA 2R2EB 5J56B 2GK0B 1T03L 3E3QC 5KVEH 1TDQA 2MQCA 4NC2B 3DVNA 1EEZB 3RWGB 1Z3GH 3O11A 4M7ZC 4PRHA 5F93C 1CFTB 2NZ9C 3R06A 4PRHD 4WUKL 1A4KA 1U3YA 3CFCL 1JZ7A 4YWGH 4PTTA 3G5XB 4G8FB 2EDQA 3VJ6B 1OQXA 3OWEA 1MCDA 1EPFA 5HI3D 1AC0A 4KQ3H 4U1GB 5CUSL 2J4WL 4GS7C 2AK4E 3A6BH 3OX8B 1A6ZB 1TITA 4K8RL 2Y5TA 5IEKB 2DKSA 2EXYD 2Y7QA 2L7JA 4KZEL 5EIVA 2PYEE 2C3HA 5IM7B 2EEBA 5JMOC 4OZ4A 3W81A 3KPQB 4JANA 2DQEL 3TBWB 1LK3L 1RJZA 3NFPA 3O6MH 4WO4A 1WAAE 1E28A 3T77A 4WO4D 4KKAC 4CN6A 2ZUTA 3RRQA 4ZFOA 5I18L 1NMCC 3O3DB 3ZYZA 1BHGA 2XZQL 4WY7H 4CKVX 1H5BB 2GJ6A 3UP1A 4DGYH 3MRCB 2AJVL 2O26U 2GJ6D 3WEXA 4Y1AA 5AUMA 2LV4A 5GS2D 3VXSA 5IW1A 5HHMD 4OD1H 4Y1AD 4BFIA 1UVQB 3VXSD 3KPRE 5I75C 4NKDB 4NCDA 3KXFA 3MNVB 4FXKA 3VI4E 3MCLL 4RAHA 1AR1D 3V4VH 2ID5A 3KXFD 3MLRH 1U3HC 1Y6MR 1R3LA 5ICZB 3WNLA 5KVGL 1MCOH 2VE6B 3GSUA 1HE7A 5GSVA 5I9QB 2VDNH 3BKML 4NO2B 5DEFA 1K3IA 2DJSA 5JO5A 4YHZH 2EKJA 3ZLQC 4LLWA 5DURB 3A0OA 1NUGA 5CEXB 3RJDA 1ERNA 2D7PA 1IKNC 2A6IB 1OSPL 3STZA 3J8F7 1NCWL 1F97A 1VFBA 4YDKL 4G42A 4C57C 3GMNB 3T0EE 3VXRA 1DBMH 3N1QC 1AKJA 3VXRD 1AKJD 1UB5A 1ND0A 4EDWH 4DFHA 2A1WH 3ALXA 3A6CL 1RMFH 3MA7B 3HUJE 4JN1H 4ZUUA 5C0IB 5AZ2L 4GS7B 4OUOA 1P7QB 2F53D 4C56E 5KJRL 4OZHF 1A6PA 4YNYB 1FORL 3GSXA 5I73B 3BN9C 4NJ9L 3BH8A 1S7XA 4WWID 4YX2H 4S0SD 4P5TC 4TVPL 3MV8B 1Q1JH 3I50L 4WJ5A 1MQ8A 5GRUH 3MLPA 3SO3C 4E42A 2Z93A 4K71C 4JDTH 1L7TH 1TNNA 1KC5L 1NCAL 4OCMC 3IGAB 4X9HA 3VFGH 2KDGA 4R3SA 3QEQB 4IBLT 5JTWA 1UWEL 1QEWB 4M8QB 1DZBA 4CVZA 1YPZB 1U41A 2JCCF 4WW1A 4O2CA 4PJBF 1A8JH 4OB5L 1OAUL 4LPYA 4P5MB 2YSSB 4DWHA 1UWGL 3MNWB 3UZVB 3VWJC 3REVB 4UBDD 1RUPH 1CYGA 3PWVB 3GGWA 1AP2B 4ELKB 3SGEI 3I6GA 3B4NA 4WHYH 2CDEB 4PJEB 3D18A 5DQDL 1U3HB 2VLJE 4LHQB 3NA4A 4IMLB 1JNHA 5GGTH 4KRPD 4HF5H 1CWVA 3S35L 4EKXA 3CVIL 2Q86B 3O9WB 1HKLL 4LAQL 5CJXA 4J3XA 1FV1A 2BHUA 4EEEA 3MLVH 3VU2A 3BRGC 4PJAB 4JAMA 5KZCB 1UC6A 3QIBB 4Q0XH 4QTIH 1RI8A 1CIUA 5FA4B 4BH7A 4HJJH 5HYSG 3MRPB 1GJIA 3DROA 3PWNB 3O6LH 4H0HB 3FOMB 2VDPH 3CAFA 4BFGA 3VD7A 1RK1A 5TDNB 3O2WH 3LQMA 4WI4A 5D7LD 4AEIH 4K23H 5E5MA 4QRPB 4LFHD 3RNKB 4HKBB 2EYRB 4QXUL 3RIAK 1KEGL 2UYLB 3U0TB 5TDPA 3K46A 4KHTH 3PDDA 4RFOH 4RISL 3KS0H 1QFWH 4OLWH 1YEGL 4NFCA 2OTWA 3QUKB 1IGJA 3B43A 4QXGL 4Y19A 4N0UA 4Y19D 3NCEB 3WD5L 1EAPA 3U48A 4WV1B 4E41E 5I1IL 3AMKA 3U9UA 1WGOA 1UG9A 5JPNA 5SWSE 1P7KB 3QBTB 5CJ5A 3HAEH 2CJUH 4XWOC 5DMIH 5FHAH 1OCWL 5FV2A 1BQHB 3HG1B 4XPGL 1U58B 1LP9E 4FQCH 1EEYA 3EUUA 4RZCB 4MNHB 1UACL 1GIGH 4O2EA 1JRHI 3TF7C 2HMIC 3GI8H 3VWJB 2C1OB 1UM5L 4YDLC 3P73A 1X5KA 5T3XD 3BD3A 4OSUH 2APWA 4KU1A 4FQ1H 4KXZI 4XT1C 4M7LH 2EZ0D 2VLKE 3D39B 2NW3A 2VO5A 4JQVC 1T1WB 2E7LC 5D1QC 4GRLA 1LE9B 4V1DB 2XPGA 4GRLD 1OT1A 1OGAA 2DDQH 5LGKA 2GI7A 5CJOH 4YHKH 2CIIB 2BNRB 1H8SA 2Z92A 3WE6A 5JZ7D 1ZT4B 1LO5A 3EYUH 5KN5B 1N2RB 4G8IB 4OD2A 4LP4A 1WTLA 3DV6B 4AY0A 3RUGF 1IC7H 4JKWA 3FB6A 4WI7A 3FRUB 2DBLH 1KLGA 3VGBA 4U7SA 3LDBC 1PY4A 5AWNL 3B8YA 3RWCB 1QQDB 4G6FB 1UFUA 1TVDA 2ED7A 1JHTB 2YPLB 4OIIH 3T0WA 5ICYA 3B9DA 5KSVA 2ZCHH 3I85A 3GK8H 4R4BB 4ERSH 1CS6A 1WCQA 2ITCB 1EHNA 1JMXA 3WFBH 3TBYA 1YUHA 1MELA 5EDXA 1YEDA 1HWHB 3TPUA 4ZYKB 3MODH 3BD4A 3GMMB 3MO1B 4W6YB 5IT2H 2OR8A 4PJ5E 4OV6F 5C1MB 4J8RB 4MD4A 3Q48A 4GKZA 1OGTA 2CRMA 4LCWE 1VGKB 3FB8B 2IANE 1F02I 5C0CB 2J8UF 4KZDH 3MYJA 2E7BA 3L3GB 1YEEL 2AXFA 2PUQT 5JHDB 3OPZH 32C2A 3FO1A 2X9YA 3KPOB 4YDLB 4OZIA 1R3HB 5J8OA 3INUL 2IGFL 3FQUB 1D6VL 4XC1H 5F7UA 1I8IB 2XWJA 5FYJE 5AAMA 2LU7A 3EO1A 5SWZA 3TVMC 4P3DA 4OBRA 5H35A 3SKNA 3MRLB 5D1QB 1WICA 2D4FA 3L5XL 4PGDA 3JV6B 5DHVB 4NQDB 1CDHA 1F4YH 2HKFL 2ZWLT 5JLZB 1FO0L 4LGSB 2NLJA 4HWZA 3VGFA 2HJLA 1KB5L 2XRAH 4HCRL 3KPMB 4OFYD 1EUTA 1UT9A 2ADGB 4PRIA 3RA7H 5FYKU 3R4DA 4PRID 3LDBB 1CLOH 3T8XB 1MY5A 4X83A 3X3FL 3EYOB 2JJSC 5JW3L 1C08B 3I3EA 3HC0B 1AGDA 1NCDH 2DLHA 2F74B 3MLSH 2NY0C 4OLXL 4HS8H 4BKLB 5EUOB 3DIFB 2VISA 2NXZD 1N5YH 4MX7B 5ISZA 5J11B 3CLFL 3P9LB 3NA9L 2LTQC 2VDMH 5ISZD 2PCPB 4Q9QH 5IQ9B 2HTLD 1EVTC 3LSOB 4H8WL 2ADFL 4HD9A 5HXMA 4Z77B 1JN6A 1IEAB 4ZXBB 5DS8B 1BVKB 1BX2B 1U3ZA 4ONHB 1L0YA 3PQYB 4DTGH 2P5EB 3V7AE 3RGVC 1M7IB 4I4WA 2NY6D 4DQOH 4F7MB 3KAAA 1X7QA 2ITDB 2F15A 3GHEH 4BQBA 5DMJB 2A73A 1T0MA 2C7UA 2GCYB 3DARA 4XCNB 3MRFB 1ZHLB 3Q6FB 5DHXB 4HIIB 5IMLB 3B8SA 2I5YL 1DVFC 3ZDYE 3WJJC 2DQCH 2YN5A 3QQ9D 1NKOA 1ZHKB 3PWLB 3FCTB 3MACH 4RGMB 2PW2B 3OAYH 3C5ZC 4LL9A 2FECL 4F7CB 4KPHL 1ZS8A 4QHMB 4MS8D 4M4RA 4FZ8H 3BP5B 3PNWB 3BE1H 2B4CC 3GMLB 5DVOA 2UUDH 3GB7A 4O5LH 1UZ6E 1LO0H 5CZVH 3M17B 2NXYC 3W0WA 5AD0B 2VDOH 2CKBB 1MRCL 5EWIH 3W0WD 3L7FB 1ZV5A 4QHNA 1FYHB 4JPVL 5T1LB 2J12B 2A6DA 1I7UA 4N0FB 3TIDA 5F1IB 5C2BH 1K8IA 3WNPA 1H8OA 3WHE0 2NTSP 1PG7H 1KXTB 1MFCH 2Z91A 4ONFH 2CDGB 1MCQA 5DFVD 5HYQB 3U36B 4NNYB 2XTJE 2BSSA 1ULVA 3L1OL 3FQRB 5D6DA 1TIUA 1K5NA 2FD6L 3GBNH 3MUY1 1J88A 1ZTXL 5F9OH 4JJHA 2YOCA 3QXAB 3KJ6H 1A1MA 2OZ4L 4XCEA 4PJBE 4U6YB 2LTQB 4K8RD 1NGYB 3HC3H 5IW6B 2C9AA 4HWBL 4MJ2A 1FG2B 2DD8H 2ZNXA 4CDGC 4FFYH 4OF8A 3HE6B 5BZWA 4ODTH 4YBHA 4HXAL 2F19L 3NCYP 5E2VL 1VA9A 3LKNA 2EIDA 4JFHD 5DUML 1GGCH 3C5JB 2APTA 1CK0L 3H3KA 5ETUB 4O02H 4YXLH 4RFEB 2VDKH 2AJZB 1DVFB 4XNMB 3O3BA 4BELD 2VUYA 1SJEB 3T0EB 1U95B 3P30H 4RDQG 3TCLB 3T65A 4KVNL 4XZUA 3E8UH 4MB3A 5CJBA 4JQXA 4P46A 4PYGA 5LAXB 1IGYA 3SJVA 4Q97A 5K59F 1ZHNB 1SYVA 3SJVD 4IHOB 4ZUSA 3S88L 5DD1L 2ZSWB 4I2XB 1U92A 3EOAA 5H8DA 5CLWA 5GS1A 1ADQA 5C7XL 4QHUA 1QLEH 1KYOK 5DEGB 4GAJL 3IFNH 1A6WL 4Z7WA 5FYKH 4JFEB 4C56B 2I9TA 5DI8A 4JDVA 4OLEA 5DD3H 4F9LA 4L1DA 2DN7A 4I1NB 5T1DH 5DO2C 5T5FH 3UBXB 2OSLB 2CGRL 4PGBB 4TOYH 4F8TA 4JFDE 3HPJA 4ZUWA 5CJQH 2A0LD 2O5XH 3ARGC 1SJHA 2J88H 5HGBA 4KDTA 2O5ZH 3TEUA 4LGPB 5BRZE 3NZ8B 5FB8B 1F42A 5DQJB 4CGTA 2GSGA 4H26A 4XCYB 5ECJE 4I5BB 4WU5B 2HLAA 4FQXC 1F11A 1A2YB 3N85L 3L3IA 4P3WA 1JWUB 4Q2ZA 4JPWL 3MOBL 3ULUD 4C83A 5FKPA 2V2WA 2Q8BH 2R15A 4X7SL 4U3CA 3AREC 5ENWB 1NBZA 1RIHL 2DYPD 3PHSA 4TNWK 2Y06L 3Q5OA 2Q7YA 1FNLA 3WXVL 3UC0L 3QWRD 2YXFA 5E6ID 2VXUL 3QQ3B 4F2MA 4RGNC 4ACPA 5L8KB 3IFPB 1F8TL 1XGYL 3HI6H 3FB7B 3QULA 1ZSDA 2AV1A 3REWB 3WL9B 3V8CA 4LKCA 5FUCC 3QUMH 5DD5L 4PB9L 4Y2OA 2C3WA 5EA0L 3SQOL 1FFQA 3PUCA 4K3GA 1YY8A 4U6XB 5TFSL 3L5HA 4HMDA 4OQTH 4ZFGH 4CJ1A 1FNGB 2Y23A 1NL0L 1MNUH 2DOCA 5E2WH 4OZGF 3RWDB 1PZUB 3NFNA 4MJ5B 1S9VB 3D85A 5IFAL 2ZKHH 3OAUH 3O4LE 3D85D 5B8CA 1Z9SA 5GZNC 2VDQL 1YMHB 4KJYA 1DUZA 3MCKA 4X6CF 4BZ1H 4MMXC 5GGSY 1EHLH 1FP5A 4G9FB 1QPXA 1B3JA 4IIQA 4TQEL 3GJFB 3UTSA 1PX3A 1ONQB 5E9DB 5F7DA 5DMGC 1MCLA 1P4LA 5EU3B 3ELAT 3PABB 2R0ZL 5F8QC 1UH3A 3D25A 2DQHH 2APFA 3VXOB 2E27L 3JWDC 2K7QA 5C0DA 5IVNA 4HKJB 4OIAA 3ARGB 5D5MA 3QRGH 3ZT6A 2J2ZA 4RMQA 1QFOA 3TIEA 1B90A 1JF6A 5SWSB 1RUKL 5A2FA 1FYTB 1FL5A 1OAKL 4I18B 4MSWB 3EFFA 4ORGB 4YLQT 4PV9A 1E4WL 1EHAA 1DBAH 3MSPA 1B0WA 4TSAL 2XKNB 4Z5RA 2EKSA 1RHHA 3CFJA 2YPVH 1TZGH 4PUBH 3HMWH 1CZ8H 2IADB 4DAGH 2R4SL 3FZUC 3JWDH 4YHMH 1IQWH 4L4VA 1QPPA 3ARDB 2QR0A 4UDUA 2OXGA 3FT3A 4L4VD 2OR9L 2KZ1B 1U8PA 3PWPA 1HXYA 5SV4A 4RGNB 3PWPD 5J1AA 4WHTB 2LABA 3Q5TA 3PGDA 1ACZA 2VLKB 4PV8B 1IGMH 4N9GB 3WN5A 3JTSA 1KELL 4L29A 2BFVH 4P2QB 3R0NA 4K7PL 2XV6B 5FF6A 1CGYA 1F4XH 5EO1B 2XOTA 2R0WL 3KYNB 5GJTL 1MQKH 2I25N 5LQBL 2ZUWA 3DGGB 4GH7B 1M71B 4ODBD 2W0FA 2LU4A 1T7XA 3SY0B 2F8OA 4YHIA 5BS0E 4GSDL 2NYYD 3AUVA 4PJGF 3T3ME 5SX4H 1U2CA 2HVJA 3MXWL 2NCMA 2IH3B 5ADPL 3FQTB 2CKNA 4ELMB 4HC1H 3CD4A 5ITBL 3TNNA 4HDIA 1AHWC 1Z2KA 4FOMA 3R8QA 4NN6C 4NQTA 1S7UA 4PJ7A 4F15C 1X5GA 4PJCB 3CVHA 4X6FB 1IAKB 2IPTH 3PDOA 5GZOC 1ORSA 2XG4A 4ODSL 5FGRA 3ARXA 3DBXB 2KZWA 1J0IA 1QSEA 5DQ9A 3EJZC 5TQ0H 2PO6C 5C09E 1QSED 1OAXL 1N64H 1T04B 4UI2A 4PJ5B 4M6AA 2FGWH 3VI3E 3U2SB 3Q3GA 3WFZA 2G75A 4XAWH 2VQUA 2V9TA 1QSVA 5LJYH 3ARFA 2Z35B 1BPVA 3OKMA 4QF1B 3W5MA 5F7KC 3ARFD 5I30L 2X4PB 2V7HA 1M05B 2WBWB 5A16B 1JV5A 1FDLH 5JXEC 3U0PA 5CD3B 2RFXA 4FTVA 3VFNB 1I4FA 2BSRA 2OK0L 4FTVD 4R97C 1S9WB 2VAAA 1FVCA 1OAYH 4Z76B 3HCVB 5E8DH 3BGMA 3HMXL 3PGCA 4EXPX 3KPSB 3CH1B 4Y16A 1JRHH 2QEJA 3BFOA 4Y16D 4ZO9A 2FB4L 2UWEA 3GKZA 3STLB 1C16B 1TVBA 3TBTA 4BQ6A 3RWFB 5E8NA 3TBSA 1FAKT 4JO3L 4KXZH 1AGCB 4R8WH 3SDCC 4JKMA 1HZHH 3VFPA 4KRLB 3V9FA 4HBQA 1CL7L 3VG0L 3OXRA 1KIUA 5HHQB 4D9QE 1IVLA 1XCQA 3O6FA 1YDPB 4UQ2A 3L3JA 3ARQA 5KVFL 4MD0B 3O6FD 3EDKA 5ESQA 2QL1A 2WINA 3CX5K 3MV9E 1OTTC 3AFLA 4EIGB 5DF0A 5ILTH 3RI5F 2XXMB 4D0DB 3BIBX 4NWUH 1OPGL 5KTEH 4OIBA 5FO8A 2OJZL 2FR4A 4MXVF 3QNXA 1AHWB 1H0DB 3BJ91 1KG0A 3EFDL 4FQQA 4JJ5A 1JGEA 3DLQR 4F15B 4ZD3H 2BVPB 3BP7A 4Y88A 4YPJA 4WEBH 4JGMA 5AEAA 1WIPA 2LVEA 5CGYC 4IDJL 4GO6B 3P0VH 4GKOA 4GXVH 2PO6B 1U93B 3CK0L 4M62L 4B41A 5EN2A 3MQIA 2Y6SD 2FLBT 3NMEA 5CS7A 1F3RB 4PRPB 5CP7B 3FMGL 1KB5A 5I66A 1ZT1B 2XA8H 4K55A 2PF6A 1MJUL 1I3GL 2VJXA 3OR7B 4KV5F 4M48H 3SDXE 1D9KD 5BV7B 2FEEI 2CK0H 1KEMH 5IJVB 2YKLH 3N1PC 2UVEA 3RPKA 1EZVX 1WVZA 1FE8H 1ITCA 3QDAA 3LRGA 3QJFA 2NY2B 2R2BB 4MJ6A 4MQ7A 3KDMB 4MCYB 2W9EL 1KGCD 4TULL 4LSQL 5LGHH 1HHIA 1NBQA 4R96B 2BK8A 3L3DB 1RIVL 3V4UL 3HPLB 5D70L 4JFFA 4K7FB 3UJTH 1GGBL 3V79C 4P2RD 4AZ8A 4JFFD 2XA3A 3AAZB 2X1QA 1UKQA 5JOFB 4AT6B 2ICEB 2YEZA 2EH8L 4E9LA 1KJ3L 4UINL 4YBQD 3SDCB 3PL6A 4WEMB 3VXTA 3CZFA 5K59E 2HAZA 1YEFH 3PL6D 3BMWA 3SOBH 1R3JA 4F3FA 4JPIB 5DGQA 2D0FA 4HUNB 5FO9A 2ZG2A 1AQDA 2X89D 3LN5A 4H88H 4HKZA 4QTHB 4PS4L 5DFWH 4S0TD 5IB4A 3FO2B 1HWGB 2BNQA 4OT1L 5ALCH 2EC9T 3HI5H 3HRZA 1JF1B 1KLUA 1PKQE 4D8PA 1F3JA 2B1HH 5EOCH 2UZIL 4PJXE 4U4BA 1JTPA 4R0LC 3S9DB 3UJJL 2C3VB 4WUUA 1CXEA 3NH7H 1X6NA 3ARBD 4WUUD 2P47B 2FIRT 1CVRA 3RTQA 1JI1A 3B2UD 4PJBB 4YE4L 3RTQD 2R8SH 1XH3A 3GBMH 3IRPX 4JFYA 4RBPH 3LRSA 1IC1A 5DJ0B 2CMRL 5E2JA 5DRXB 1CF8L 4S1QH 4JM2C 3Q6GL 1G7HA 3IDNA 3O45A 2Q87A 3K4DA 4P4KA 1ZWIA 5GGRY 3P4LA 4P4KD 2ENSA 3M07A 3V0WL 5E00B 1IGIH 1IGTB 3DX6B 5ESAB 3S3PA 3HR6A 3IDJB 4HS3B 4KUCD 1FZJA 2X40A 3U4EB 3FN0L 2FYYB 1YEKH 2D7TH 5TF0A 3BKCL 4FG6C 5SWQB 5KVDH 2ZSVB 4OAWB 3D3VB 3OBAA 1NGQH 2FO1A 5I1LB 5T3XH 1CT8A 5IB2A 2NY7L 4TYUA 3QDME 4U3XA 1S7WB 4WFHD 2SEBB 2YWYA 4RAUA 4CU7A 4WI5A 4Y4KB 1TJIL 3IDIB 2UUDK 3FHQA 2EO1A 4ZUVA 4M8VA 4OKDA 2XICA 1W72B 4X6CE 4XCFH 1DCLA 4A6YA 2VQTA 1NMBL 3QUYD 5JOEA 1CD0A 2P49B 3MJ8B 4AENA 4BFEA 2N4IA 5DT1H 3CMOL 2HT4D 3FB5A 2QBWA 2XWTB 3RVTD 1TJHH 5KAQG 1M6OA 4HFWA 2NY5L 3NAAL 2DLGA 1DDHB 4JFDB 1DL7L 1X5FA 3QG7H 9CGTA 3HZVA 2NPLX 4G6KL 1IC4H 5K9OA 5CMAA 1TPXB 3C08L 3L6FA 5C70A 4HZLA 5BRZB 1AO7A 2V6HA 3TJEH 1QG3A 1AO7D 4CU6A 1I1AC 3IYLW 3BKJL 4UT9L 3MRQA 2O61A 2P4AB 1UENA 2OX5A 4APQA 2FBJL 3OKLB 2CDFB 3QA3B 3MLYH 1NDGB 4APQD 4NYLA 4XHQA 1FN4B 4KGLA 1CFNA 3GKWL 4Y2DC 3D2UB 5JR1L 1I1YA 3MOAL 3FFCA 3TH4T 1A3LH 4POZC 1A64A 3FFCD 1QNZL 2C4FU 4GW1B 2PKDA 2F58H 3MGOB 1G7QA 1KCSH 4OLUL 5DJ2A 3L9RA 4UV7H 5FYJL 1UA6L 5BXFB 5ANME 5KSBA 1GGIL 4KUZL 3IU4L 2XQYG 1LGVA 4YHPB 1T0NB 3K8LA 4GKSB 2AP2A 1CGUA 1WTGT 1NBVL 3L5IA 4JPKH 3V6OE 5JW4N 3OXSA 5T3ZD 3KLAA 5DLML 5TH2A 1M4KA 3EBAA 1CDBA 1SEBA 1BFSA 1MHCA 3HLAA 5FGBC 3KR3H 4IRZL 3CFKA 4WTWA 1HQ4B 2IPKA 1N6QH 5I8KL 5CZKA 2BRQA 4F7PB 2VN7A 1K6QL 3RI5K 5IOPB 3IXAA 4QYOB 1XIWB 3CPLA 4P4RA 2KBGA 5C0RH 4M7KH 5IMMB 3QR2A 3FT4B 4OD3L 3LKSA 1RZJL 5GGRB 1OTUD 4XCCH 4EI6A 1OWRM 1M7XA 3OF6A 2W9LA 5E7BA 4QRRA 1E4JA 3OF6D 2HWZL 3BDXA 4QRRD 5J13C 2IQ9H 2IAMC 4WFED 3QCVL 4M7JL 5EZJA 4H1LB 1KNOB 2EXWC 4RNRB 4U1LB 4NHUA 5HDQL 3GUTB 4YDIH 1FGVH 4ZOCA 1I7RA 1AJ7H 3LOWA 4HT1L 5C8JA 3O2DL 5IB1A 4UTBH 4WDIB 1KIQA 1HHHA 3SE9H 3MLWH 2VXSL 5HYJB 2V5RA 4LPWA 2WWMD 3IJSA 3KPPA 2FECI 4O2FB 1W0VB 1CG9B 4LLVB 1CGTA 4U1SA 5L2KE 4GAFB 5MEPB 1JWSB 2KPNA 2IG2L 1VFUA 4AEEA 1YMME 4X80H 2ARWA 2J8UB 5EU5A 1OM3H 5DA4A 5GGVY 1DQML 4PTUB 4O4YH 5FHBH 3PDGA 4IRJA 3ARPA 3PJSB 3QDHA 4IRJD 3EOBB 4KY1L 3LVEA 1Y18A 4AEHL 1UXWA 3H7BA 1MI5E 3BEWA 5DRWB 1JNJA 3S37X 5CKAA 4ZS7L 5JHLL 1AQKH 5I6XC 4I0KA 2OQJB 1BBJA 2DAVA 5TPWH 4X6BA 1A6UL 4DKFH 3S37L 1EO8H 3GO1L 4P3CL 8CGTA 2BY3A 3WUWA 1D6EA 1FCCA 1JWMB 4W6XB 3IFOB 1HDMB 1CD1A 1DEEA 3JZ7A 4XNQB 5EIIB 4JFPA 2MQ3A 4DCQA 2Z31A 1KPUB 4M6MH 4L3EA 1JTTA 1OAQH 1IAIL 4GQPH 4TSCL 2GKIA 2QHRL 2A83A 5FECA 4K3JH 4P2OB 4PJ9A 4UIMB 3JBG7 5FYKE 4LGRB 3BKYH 1F3DH 1U8IA 1UEYA 2PXYC 4PJ9D 2Z8VC 3BXNA 4X5XA 3MV01 1UM4H 2P7TB 3HE7C 3AU1B 4Q6YA 2APXA 3LKOA 1GZPA 4YC2B 1MJ7L 3VD5A 1YJDL 3CDCA 3JVGA 4KJPC 5J13B 1PDKA 1BZ7B 1CE1L 2IAMB 3DVIA 3MUHL 3T2NL 5LBSH 1VSCA 3T1FA 4Y8AA 3U7YH 4NBYB 4ZO6A 4L5FL 3RL2A 3MRRB 3T0AA 4KJQD 5D1XA 4JLRB 5D1XD 1PEZA 3NACL 1TLKA 5FUZL 3Q5YA 4OM1H 2BCKB 4FZEH 5DMKB 1V5JA 2GFBA 2BRRH 4UT7H 1UYWL 4OLVL 3G6JA 1ZA3A 3G5YB 5I1GL 4NZTH 4LRNH 3DSFL 3WNKA 4PPTA 4HH9A 4G5ZH 5IVXE 4OFKA 1G9NH 1G7LA 1JGLH 2W65B 4U1NA 3KPRD 1II4E 3SDAA 4JGJA 4R26L 2AAVA 3OKDB 4Y4HB 3SDAD 3FQWB 5DJCB 3V5KA 3ES6A 5C08A 5B39B 1LK2A 4NUGL 4NDMB 5GSRB 3CC5A 2DWEA 2EIZA 5FOJA 4JY5H 1A6AA 1T1XA 4NRXB 4P46C 5I6XB 5GGUB 3H9SB 5D72H 3CSGA 4MJIE 3CDYA 2ZUUA 4G9DA 4NM4H 1HI6A 5GS1C 3UXFA 4YHLH 5KSUB 1R0AL 5I18H 2MJWA 5IESH 3EDFA 3HTLX 4LQFL 4PJIA 2RCSH 4PR5B 3HB3D 4MZ2A 4WVRA 1Q0XL 1WBYA 1MCPH 3MJ7A 1RUAL 1F00I 2R23A 3BQUA 1DQDH 5FUCE 1Q9KA 1NC4B 4E0RA 3NCYS 3MLZH 4YDVB 3BQUD 4YH6A 1TZHB 5H37G 2FJFB 1A3QA 4NZRH 1CDIA 4L8CB 1W0WB 4L8DA 3WV0A 5FA3A 2A77H 5HHXL 3DMMB 1ADQH 1TTUA 1NAMH 2PXYB 3WKMH 2APVA 1BM3L 3NVQA 3HE7B 5J3HC 4JHWH 5FDWA 1J05A 1IZJA 3BAEL 3DURB 3RVVD 2AS5M 4MNQB 1D5ZA 4UILH 1R5VA 4JO4L 1YNLH 5IQ7H 4QHKJ 5DD0L 2EYSB 1A6TA 4OFDA 1INEL 2JF1A 2CRYA 2P5WA 2VLRE 5F96L 2A6KA 4HIXH 4PP1D 3ULUH 2ZOKA 4FA8A 5KVEL 4ZNEE 5IFHH 3G5ZB 1REIA 5E0QA 1OTSC 1QSFA 5D7JD 4HUVA 3G04A 1Z3GL 5J9PB 1QSFD 2Y9RT 3LN4B 2X7LA 4PY7B 3IXTB 5ESVA 3GSWB 5AZ2H 4YWGL 3FQXB 3EHBD 2YA0A 3PP3K 2NY1D 2Z8WC 4Z7UE 3AM8A 1KBGL 1RSFA 4KQ3L 5B8CC 4X9BA 4WI6A 5FOBB 2VLJD 1L9MA 3A6BL 4EI5C 4DZBA 1U2HA 5D7IF 3LIZH 3HR5B 4MD5B 4JFXB 1I1FA 2F8XC 2GK2A 5D2LF 3QZWG 1PSKH 1X5ZA 2Y36H 4PRHE 4N9OB 4YO0B 3TH2T 2R1YA 5J89A 3GSRB 1J1PH 3QEUA 1JGVH 1FFNA 1IAOB 3EGSA 3O6ML 2F5AH 5JQ6H 3NIFE 1VKXA 5I16B 4YQXH 4L1HA 1OB1B 4FFWC 4ZSOA 4CMMA 1AD0A 3GSQA 4HEPG 4WY7L 1ZHBB 3S96A 4DGYL 3LMJH 4ETQB 5GRZA 2G9HA 2IPUG 1G7PB 3ULSA 5C3LD 5DMYA 3RNQA 5CIPA 3LQZA 1GAFH 3UZQA 4OD1L 3IS0X 1EFXB 2XWBB 3MRJB 1IZKA 4NC0B 3TJHC 3QCTH 2BSED 1DN0B 5ICXA 1F2XK 3V4VL 2AKRA 3MLRL 3MRGA 4Z0XA 1A1OB 3QPQC 4KRNA 2EE3A 4NPYA 4LSSH 1MCOL 3IF1A 4R2GC 2YUWA 2VDNL 2WNGA 3BISA 1UZ8B 4BJLA 4YHZL 4FQ2H 4HK3N 4OKVA 2AXGA 4U6HB 1XR8A 4OBSA 4HHAA 3LS5H 1ZA6B 1RURH 1JI2A 1MWAB 2NW2B 2GJ6E 1Y0LA 3RY6A 4LLQA 2CLVB 5HHME 1ES0A 5GRJH 4Y1AE 5LG1A 1OSZA 3VXSE 3ZYOA 3V5HA 2R9HD 5FKAA 3DTXA 5GHWL 5CFHA 3VRLE 3G6DH 4OZGB 3KXFE 1DBML 2RJMA 2PN5A 2RBLA 3HZKB 5IV2B 4EDWL 4NO3A 2NY4C 1MJJB 2A1WL 4X6CB 4YK4B 1RMFL 4JN1L 3DO7B 2EEAA 1NFIB 5EBWB 2XY2A 2YD4A 4EI5B 2VITB 4R7DB 3RDTB 3VFTA 1LEIA 2YN3A 5J1SC 4HIHB 4YX2L 5KS9A 3SGJA 3O8XC 2O5YH 4HG4K 1Q1JL 4NGHH 2IQAB 3SDYH 5GRUL 3VD9A 4Z7NE 3QUXB 5J57B 1IFHH 4JFQA 3CDFA 2HN7B 2BVQB 3WUWG 3RVWD 4JDTL 5HD8D 2V7NB 3VXRE 1L7TL 1ACYH 5C0FA 4RSVA 4NN5C 4UMGA 1G6RB 3VFGL 1WFOA 3MRMB 1BZ9A 3SGKA 1VENA 4RMTA 1WWCA 3GSNA 4J1UA 4ODXB 1T5WB 4NO5A 3CVHH 1FFPB 1RK0B 5EU6A 3GSVB 3D5OF 3JV4A 1CL7I 2K7PA 2P8MA 2X4TA 2V17H 4RBPK 3UTTA 3TA3C 5EU6D 5A3IC 1X4ZA 1RUPL 2K9UA 3S7GA 4FFVD 4F9PC 5J6GA 4TUKH 5EFIA 3D0LA 1TQCB 4NNXA 2W60A 3EYQC 4R2GB 5D8JH 5GGTL 2B39A 4PJ8C 4URTB 4EVNA 4HF5L 3IETB 1KB9J 4OCSH 2QADC 5K9JH 2BJMH 4PRBA 3GMRA 1NGWA 2HTKD 1LILA 3DXAB 5FEBA 3T4AA 4XBPB 4RAVB 3C8KA 5JORA 3GMQB 3MLVL 3RZWA 1U8LA 2EYTB 4L4TB 1FNSH 4Q0XL 2IAND 1QRNA 4PRAB 1Q94A 4JCMA 4QTIL 4OZFA 1QRND 5HYEA 1QLFB 1D5MA 4PJGB 4HJJL 3DV4B 2XN9B 4AL8H 1P84K 3DYPA 4XNZB 3O6LL 2X70A 3SKOB 3S8WA 2VDPL 3TLRA 1KACB 3O2WL 1CGSH 4MLSA 4AEIL 1MFAH 4K23L 1HHJB 5FYJD 1I3RB 3WNOA 5I76A 4LSPH 1J0KA 4Z18A 4KHTL 1KJ2A 3OMZA 4PB0H 4RFOL 3TBVA 4MNGA 3ZE0E 1GC1C 1QFWL 1X5XA 3AS2A 4OLWL 3DX9B 1K4CA 3L3KA 5HGHA 2CLRA 3QB7C 4NQVA 3BZFA 4LRIA 1HK6A 3OB0H 5IMKB 4LCCA 1MCHA 3S5LA 2H6PA 4JKPH 2FJGA 2X1OA 1X5YA 1DQQA 3CFDB 1B9ZA 1F90H 1JPTL 1T7VA 5I8OH 1DE4A 4NN5B 1KCKA 2CJUL 5DMIL 5FHAL 3LH2H 5BVJA 4FQCL 4JRXA 5JPMB 1KCLA 1ZVSA 4B7LA 2ESVB 5IJKA 4LCUA 5IMOA 1GIGL 2XNAB 5KSAD 4QRQA 3GI8L 5BQ7B 1IAMA 2PTTB 2YMXH 1WF5A 4S1RH 3DETD 2N1KA 2YS4A 3BUYA 4OSUL 4LVOB 3K8MA 1G7IB 3X14B 4HUUA 4JDZA 4FQ1L 5DR5H 4M7LL 4Y19E 4N0UE 2BY1A 4LF3B 1KB5H 1C5CH 2YPKA 4PJ8B 2R56H 5CAYB 2DDQL 4NQXA 5CJOL 1NAKH 5DZNA 1A14H 4YHKL 4ODWA 3CDGB 4IM8A 3EYUL 4U1HA 1XR9A 1MJ8H 4X6EA 2VNCA 5BVPH 1IC7L 3BT2H 3MV7B 2DBLL 5T3XE 5C0AB 5IBLD 1S7SB 1YEHH 2X4QB 3LQAC 1ZT7A 1HKFA 5E2TH 4OIIL 1V7MH 4JQIH 2ZCHL 5IB5A 3GK8L 4ERSL 4UV4H 4WCYH 3DHJA 2AERT 5C9KA 3MLTB 4LAJH 3BVNA 3WFBL 1B0GB 1OGAE 4N0CC 4QXTB 1G7MB 2MPAH 4MB4A 3V6ZA 2X2YA 3MODL 4Y5YB 1CGXA 4RQQB 4HGMA 4DVBB 5IT2L 3LQAH 3QIWC 4Y4FA 3BWAA 4MA7H 2J7LA 5D1ZA 3VFRB 1T22A 4Y4FD 5ID0A 3HZYA 1VESA 1HHKA 1W8NA 5F7HA 4HEME 4KDVA 5H94B 1I85A 1ORQA 2X10A 5E94B 4D9LH 3I02B 1HQRA 3IAGC 4XXCA 4ZFFB 2JK5B 4PJFA 1L7IH 1VFOA 4HUXB 3MR9B 3JTTA 1MLBB 2NZIA 5F6HJ 1NFDF 3FAXA 2YRLA 5I74C 4I0PA 4XC1L 4CUCA 2GUOA 4U2YA 1KFAH 5AZEH 5HI4C 1N4XL 4I0PD 1XGQA 4DEPC 1C12A 4HIJB 3NIGF 6FABH 2HVKA 1KJMB 3ET9F 1KXVC 3UDWC 3OAZH 5F1NB 3UTZA 3D0VA 1RV6X 1F4YL 4YHOH 3SPVA 2X4SB 2OP4H 3DGCR 4R6UA 5J0BA 2EH7H 1PYWA 5CHNA 1T21A 4LLMA 2WM0A 5DRZB 1JUFA 1CXKA 2XRAL 4PG2C 3RA7L 4WWKC 3X17A 4OZIE 1TJGH 1CLOL 1KPRB 1CFVH 3MRKB 5IR1B 2X4OA 5A40E 2DLTA 5HVFB 4WW2A 3SN6N 3RP1A 1DSFH 3MLSL 4HS8L 1VEMA 5F89A 1UM6L 2R2EA 2GK0A 4MXQD 2YA2A 4A6YH 1WBXB 3SE4A 1N5YL 1EEZA 1CGVA 3RWGA 3FT2B 4XWGH 4XVUC 2WBJB 4TUOA 2VDML 1XZ0A 4Q9QL 1YA5A 1HILA 1CFTA 2KUTA 3AS0A 5B38A 4MVBD 3T0DA 1QZ1A 4XI5C 3G5XA 4NBXB 4XVJH 4G8FA 2HJKB 2Y25A 3BPLC 3QIWB 4L8BB 4O51A 4R4NC 4RMRA 4PRIE 3VJ6A 3EJYC 3ILQD 2DI7A 1T7YA 1YC7A 4DQOL 2WSKA 3GHEL 4NQCA 2Z8RA 3OX8A 1A6ZA 4QGYA 3T2OA 1XGPA 5D6CB 4G7VH 4ZOAA 4NQCD 5IEKA 2XZAH 1J8KA 1BFOA 2DQFA 3S88H 2VL5B 1X5JA 4PLJD 2Q6WB 2DQCL 1CD8A 3H9YA 4KMTH 3MACL 3SE8H 2EE9A 3KGRA 4I13B 5ISZE 1J8HB 2AJUL 4L3CB 1VADB 3DPBA 5HBBA 1AGEB 5DVMA 3KPQA 3TBWA 4FZ8L 5IBUG 5I1AB 3LB6C 3BE1L 1NUDA 5IBTH 2R1XA 4LU5H 1S78C 3O3DA 3QHTC 4O5LL 1H5BA 1LO0L 3MRCA 4UB0H 5DJZB 5CZVL 1N3NB 3LPGA 5KANI 5EWIL 3ARZA 5D96C 4NKDA 3F7YB 4NQUA 5T3ZH 3MNVA 3EO0A 4JB9H 3S36X 5C2BL 2AJXH 1N26A 2Q7NA 5ICZA 1PG7L 1DLHB 5B3NA 2VE6A 5BW7A 1MFCL 4ONFL 1HN1A 1FC2D 4GRWE 4NO2A 4ONOA 3VWKD 4OZFG 3MBED 1RD6A 4MA8L 5I1JH 5CEXA 2HJFB 3GBNL 1DEDA 5F9OL 5IVZB 3HC4L 2Y5TB 2M26A 2F54B 3KJ6L 3W0WE 4F37K 1T6WA 4WHCA 4YXKH 4PP2B 4BFBD 3FQNB 4TNVF 3HC3L 3GMNA 4U0RC 3SQOH 2VXQH 1ZLWH 2VLMD 3V52H 1K9TA 2NZ9D 5TFSH 2DD8L 4FFYL 2EDBA 3BPLB 1EEUA 4ODTL 4PBWD 3OKKB 1MFBL 1E28B 3MMEB 1OLLA 2BOCB 4HAGA 1IAII 1WBZA 1NUFA 5C0IA 4PJDF 5JW5B 4F8QA 1P7QA 1MAKA 3S5LG 4MA3B 4YXLL 4O02L 5HHMB 1P7QD 2VDKL 4YNYA 5AUMB 3BZ4B 4YHNB 3PGFH 3MV8A 3KXFB 4FXKB 3VXMA 4GAGH 3P30L 1MCWM 3MV8D 3VXMD 4MA1C 1UEMA 3E8UL 5KW9H 3WIIH 1JBJA 4NJAH 5A2KH 1KPVB 5GSVB 1GGUA 2EE6A 4NKMA 3IGAA 4BK5A 3QEQA 5GRXG 2Z31C 5DVLA 4M8QA 4KKAD 4OM0H 3IFNL 5FYKL 3OG6B 4JFHE 3HNSH 4P5MA 5L0QC 2YSSA 3FL7A 5DD3L 3GNMH 3MNWA 2Q8AH 2WW8A 4EIZC 3REVA 5T1DL 2X4RB 5T5FL 5MENA 1AY1L 4TOYL 4M3KB 3NN8B 3PWVA 5D96B 4ELKA 5MEND 2O5XL 3STZB 1GOGA 5KANG 1LE5B 2J88L 3P40A 4YEEA 2CDEA 2O5ZL 2L0DA 4PJEA 1U3HA 1BWWA 4OCWH 4LSTH 1S9YA 4IMLA 1U3HD 3O3EB 2EDRA 2CUHA 1ND0B 3SJVE 4AQOA 2Q86A 2ZJSH 3KPNB 3ULVC 1CDGA 1JGDB 1UB6B 3GSOB 3ESVF 2F53B 2Q8BL 3DWTA 5IW3A 2UY6A 5D2NC 1IT9H 4Z7WE 4Z95H 4DN4H 4PJAA 5T33H 5E7FA 1D5IH 5TE4H 3H9ZA 1IKNA 5I17B 4M6NH 1V3JA 3FFDB 5KZCD 3BH8B 1S7XB 1XF4A 1G9MC 4R4FH 5FA4A 5A1AA 2CPCA 1GCFA 4U0RB 3DRQB 3MRPA 5BMFH 3QT2A 3PWNA 4E42B 2Z93B 5E2UH 3HI6L 3FOMA 3ULVH 5MERB 2D7MA 3MC0A 2XKUA 3ALPA 3QUML 1CQYA 1T2JA 4HFUH 1I1CA 5F1KC 3VGAC 4FQJH 3RNKA 4HKBA 2EYRA 5JIIA 3ULUE 1I9RH 5CZXC 4OQTL 3U0TA 4ZFGL 2DM2A 2VWEC 1OD7A 4NT6B 1QLRA 1MNUL 5E2WL 3BZDA 4Q9RH 1BBDH 4JG1H 4NQED 3ZKMC 2ZKHL 3BN9D 1U8MA 3OAUL 5L2JB 3QUKA 2FX8H 4P5TD 1YQVH 4X4YB 5J7CC 3IAQA 4MA1B 2VERN 4BZ1L 4WV1A 1G7JA 4J3VA 3LKRB 4KRPB 4PY8J 4LDLB 1P7KA 4OGAC 1EHLL 4KUCF 3VGGA 1QVOB 1I8LC 1CE6B 4G8GA 15C8H 2GTZB 1BQHA 1JTOA 1KV3A 3HG1A 4G8GD 3HG1D 4ZMAT 4RZCA 3FAWA 4JG0H 4Q9BA 4D0BB 4RMVA 3VWJA 2C1OA 2DQHL 4M93C 1FHGA 3TO2B 3F7VB 3VWJD 3FHAA 1BLNB 1FC1A 3QXTA 3QRGL 3W2DH 1AXSB 3DROB 3D39A 1F4HA 3MJ9H 2RHEA 1T1WA 3D39D 3VXUA 3WFCH 3BIKA 1LE9A 2X44D 3DI3B 3VXUD 5D7LB 4EUPH 4OI7A 1DBAL 1VERA 4ZTOH 3B9VA 5KOVC 3OKEB 4XP5H 2YPVL 1TZGL 2CIIA 2BNRA 5HYIA 4PUBL 3UTSE 3OB8A 1SYSB 1CZ8L 3HMWL 1ZT4A 4ZUTB 5LCVH 2BNRD 5D2NB 4DAGL 5KN5A 4YHML 1N2RA 2J8HA 3JWDL 1IQWL 4G8IA 8FABB 5JNYB 4JO2H 5JIKA 3DV6A 1CL7H 2VSCA 4X4ZA 3GIVB 3ORJA 5CEYA 2OTWB 4B53A 5CILH 4W4NA 4X6DA 3OQ3B 4N0UB 1IGML 3RWCA 3CFIC 1YECH 4M1DH 4JY4B 5D5ME 4KK6C 1JHTA 2BFVL 3U9UB 2YPLA 5JPNB 4FABH 4ZODA 1F4XL 5B38G 4R4BA 1MQKL 4GUPA 3TN0C 3VGAB 2ITCA 3NCFB 3ZDZF 1TVHB 5C2UB 5J1TC 4ZYKA 4L4VE 1KUMA 5CBAB 3PWPE 3UPRB 4JO1H 1A7RH 4HC1L 1I3VA 4J8RA 1U8QB 3IJHB 5FM8A 1LDPH 3MPCA 5C6TH 4N8PA 4XMLH 2IPTL 5C0CA 2DKMA 4PJHF 1IMHC 4XWOD 1GL4B 5C9JB 2C3XA 3L3GA 5C0NC 3BI9X 3FO0H 5JHDA 1JK8B 5GPRA 3QIUC 5TQ0L 1NCCH 5JHDD 2HMID 1N64L 3KPOA 1FZMB 4N90D 1FBIH 2NX5B 1KN2H 4DUVA 2FGWL 5GS0C 3FQUA 1KLGB 1V7NH 4TNVK 1I8IA 3AB0B 4XAWL 2AI0H 5E70A 4J3SA 5DC4B 4JQVA 1D7FA 3QH3B 2E7LA 2W0PA 5M7QA 3MRLA 5D1QA 5ICYB 4XPBH 1VEPA 1OHQA 5D1QD 4ZFOL 1FDLL 3JV6A 5DHVA 4PJ7E 4NQDA 4K3EH 2VR5A 5I1DB 4NQDD 1OAYL 5JLZA 5E8DL 5CIPH 3TBYB 2D9QB 1JRHL 2D9CA 1YEDB 3KPMA 4J6RH 2ADGA 1QSEE 1SBBA 4RX4A 3RY6C 5GJSH 4DGVH 5E08H 1YEJH 3TNMB 5IWLC 3DVGB 1Z0NA 3EYOA 2J8OA 4R8WL 3NPSC 1HZHL 1NC2D 2DQIH 2F74A 2FATH 4ZO7A 4CAGA 4YGVA 1GGYA 3C9NB 3GHBH 4OTXH 3TN0B 4BKLA 1NDMB 5T5NG 5I71C 3RKPA 4QO1A 5DJ6B 4WFGE 4FTVE 4MX7A 5D7IB 1SY6A 1CTNA 1BIIB 2AXFB 3LV3B 3P9LA 4XX1G 5D93B 4NZUH 2PCPA 5EUOF 5IQ9A 2H2PC 5ILTL 3LSOA 1FNFA 5D2LB 4UNVA 4OZIB 4NWUL 1LO4H 4YFDB 4Z77A 3MLXH 4YJZL 5KTEL 1IEAA 5DS8A 1BVKA 1BX2A 5FM5M 1BECA 2UWEE 4CNIB 4ONHA 3PQYA 2P5EA 3PQYD 5HDLA 4X8JB 5TF1H 1M7IA 4P3DB 2LAGB 2P5ED 2VKXA 1DQTA 4F7MA 4ZD3L 3D69B 2ITDA 4PGDB 4WEBL 5DUBA 3IT8D 2GCYA 1Z9MA 4OGXH 4ENEC 4XCNA 3MRFA 1ZHLA 3Q6FA 5IMLA 1Q9OB 1JYWA 1UKSA 1PAMA 1ZHKA 3PWLA 3F8UB 3WO4C 3P0VL 1RU9H 3FCTA 3QIUB 4GXVL 3VCLB 1H15B 2PW2A 2QSCH 5FCSH 4F7CA 4PRIB 3RZCC 4QHMA 2XA8L 4M48L 3PNWA 2ICWB 2QTEA 2CK0L 4NQSB 1KEML 3TVMA 2YKLL 2JB5H 5EU7E 1MHPH 5E5UB 1AGDB 5MP6L 3EDDA 1FE8L 3TVMD 1CLYL 3UEZA 1BD2B 3M17A 4HKXB 2XY1A 3B2VH 5DK3A 1FAIH 2GW5A 2CKBA 1EMTH 2NXZB 3I3DA 1T1ZB 3L7FA 3ZSTA 4G80B 3X12B 3GSNH 3BOVA 5FDYA 5LGHL 4QOKD 5T1LA 5EO9B 3DI2B 1OP9A 1U8OB 5T1LD 1ED3B 5J6HB 3SBWC 1RZKC 4N0FA 4K94H 5F1IA 3UJTL 5C07B 3CMOH 1C5DA 1K8DB 4GBXD 1JN6B 4JZJC 2CDGA 4KTEH 4DKAA 2AQ1A 4XRCB 3T3PE 1U42A 3B5TA 3V6FB 2JJSA 5HYQA 2FIKB 2NY6B 1WAAF 5EB9A 1QUNA 3OAZK 4I4WB 1YEFL 3FQRA 3SOBL 1Z9OA 2B8OT 1X7QB 4BA8A 3QEGH 2NY0D 3U46B 2W0LA 4H88L 4HPOH 1RZKH 1AC6A 1KGCE 1A47A 2FO4B 2GEEA 4FMKA 4J2XA 4U6YA 2WANA 1NGYA 5EOQH 3BP4B 5ALCL 3DNKA 3HI5L 1WK0A 3F12B 4I3SH 3VI4F 5L7XH 1FG2A 2B1HL 2MMXA 4OZFH 5EOCL 4UUJA 2CIKB 1AGFB 4GRWB 4JFFE 2R4RH 25C8H 5DJDB 3TO4C 3NH7L 3KNBB 3WHXB 4RFNC 3GB7B 5KG9A 1BOGB 3C5JA 3RGVD 2IEPA 3VMPA 1YNTA 1GGTA 2DICA 5ETUA 2AJ3B 1HOCA 1KXQE 4F33B 2WQ8A 1ZOXA 2R8SL 3KLHC 3GBML 1DVFA 2AJZA 2G60H 2H3NB 4LVNC 4Q74A 4QHNB 5EZLB 3WJJA 4DJMA 5I1KH 3WO4B 1BQHG 1SJEA 1DVFD 1U95A 2QSTA 1KJ2H 4S1QL 4S2SB 3TCLA 2ZZUT 3AMLA 1BF8A 2BNQE 3C5ZD 5LAXA 3NZHH 4DOHE 1QD0A 1ZHNA 3BGFC 2Z91B 4IHOA 3ZKSD 1WV7T 2YD6A 2ZSWA 1IGIL 4I2XA 1AD9B 4N1HB 2R0LH 5DEGA 2Z4QB 4YPGB 4JFEA 4WUUE 4WGWB 4X8XA 3VRIB 3HUJF 4JFED 5CEZD 1YEKL 2D7TL 2NXYD 3ME0A 4BYHA 5KVDL 3UBXA 1A1MB 1I1RA 4XCEB 5L2KD 2ICCA 1CDCA 1KYOJ 4BZ2L 1NGQL 1YMMD 3EDJA 5T3XL 2GHWB 4HIEB 5T1MB 5DQJA 3BMVA 4JZJB 4XCYA 5JW4M 3LCYA 4I5BA 4EBQH 4WU5A 4NOBA 2E6PA 4LIQH 1A2YA 4XCFL 5EBLB 5E8EA 1L9NA 3W9EB 1MI5D 2Q20A 5DT1L 5ENWA 1TJHL 1CXLA 1FZOB 3QG7L 4S1DC 3SE3C 4EXKA 1IC4L 1O0VA 2WUCH 1E6JH 3O3BB 3QQ3A 1RIUH 3PG2A 3D87B 3IFPA 5I1EH 3RKDC 1E27B 3C60C 4PD4K 3FB7A 2IPUK 1NKRA 1IGYB 4WFHE 2P43B 3BW9B 3REWA 4ZUSB 3WL9A 3SKJH 4X7EC 3TO4B 3DX8B 4ODHH 1R3IH 3MLYL 3HS0A 4CDHA 4HZAA 3OTTA 5IIEA 3ROOB 4ZG1A 1A3LL 3RWDA 2DKUA 1B2WH 4MJ5A 1S9VA 3ZTJG 3PHQA 1ZLWK 4ZUWB 2F58L 2DB8A 1KCSL 1YMHA 4NFDA 1AO7E 4UV7L 3T1WA 3ZL4H 3K80A 5D7KD 3L7EB 3L95B 4OI8A 4G9FA 1EBPA 4LPVA 3GJFA 3U9PH 4TSBH 1WSST 1ONQA 2LVCA 5E9DA 3UYOD 5FKPB 4EN3C 1MHHA 2V2WB 4JPKL 2DYPB 2IWGA 5E9DD 4ZFZB 1IM9D 3EYVB 2HH0H 5IEHB 5E6IB 3MA9H 3VXOA 3KR3L 1FL6B 5DO2D 3NCJH 4HKJA 3FFCE 3ARGA 1PVHA 3VGEA 1N6QL 3CCHB 3ARGD 4ORZC 1DBJH 3D6GA 1FYTA 5DHYA 2L4OA 4M7KL 5INDB 4MSWA 1FYTD 3P11H 2UZXB 2AEPH 4YUEH 2IBZY 2XFXB 4LLYA 5IHZB 2XKNA 5KSBE 4XH2B 3BEVB 4XCCL 4FQXD 3TT3L 5J4MA 3H2WA 2WZPD 1LP9F 1YY8B 2IADA 2IQ9L 3IKKA 3ARED 2XACC 5T3ZE 3ARDA 4MJID 2EO9A 4OQTA 4LSVH 4X9FA 4YDIL 1FGVL 2A6JA 6CGTA 1AJ7L 3QJHB 4UTBL 3SE9L 2VLKA 3MLWL 4PV8A 4RGND 3WO3B 4N9GA 3C60B 1JFQH 4LBEA 1SJVA 1JHLH 1ITBB 4P2QA 3K2MC 2ZG3A 4KRMB 3KYNA 4P2QD 1E4XL 4Y8DC 3IDMB 4N5EC 5DZOA 3QI9C 3DGGA 2E5EA 2DMKA 2WLZA 4X80L 5F7DB 1OM3L 4CADB 3V95A 2H1PH 3EYFB 4KVCH 4O4YL 1CXFA 5FHBL 1Q9WB 4QRRE 4XPFH 4JVUA 1WZ1H 2G5BB 4MAYC 5C0DB 1FVEB 1I7ZB 1QFUL 2IH3A 4LNVA 4Z7QE 1OWWA 1NFDB 4ELMA 5GZND 3TIEB 1CCZA 5JW4R 4YFLI 1DFBH 5EPMB 3C2SA 2DQTH 4QRUA 3EFFB 3N50A 1AQKL 4PV9B 4PJCA 3X3GH 4X6FA 5TPWL 4YIQA 2WWKO 4DKFL 4LK4A 2FWOA 2PTVA 1YEIH 4GMSH 1EO8L 4EN3B 3MRNB 5CKGA 1G84A 2VLRD 3DBXA 3RIAF 5DMGD 4NRZB 3UBXI 1YYLH 3TV3H 1QR1A 2F5BH 4L4VB 1DJSA 2QR0B 2NY3C 3DOSA 4B0MM 3A67H 1OARH 1IARB 4M6ML 1CICC 1MREH 1Q38A 1OAQL 3PGDB 5GGQH 2Z35A 2C1PB 3WN5B 4K3JL 3S4SA 2X4PA 1M05A 1A7BA 5A16A 3BKYL 5I9QC 5CD3A 3VFNA 1UM4L 4NO0D 1LO3H 3V0VB 4MAUL 1S9WA 2X1XR 2P44B 2EICA 3KPSA 3CH1A 4H25B 2AQ3A 3FZUD 5LBSL 3KPSD 3U7YL 4HW6A 3STLA 35C8H 1XF1A 3CH8A 3P4OA 1RZ8B 4OF7A 3RWFA 1HNFA 1FFOB 5CLTA 4L3EE 1EAJA 4HC1A 4J3OC 3KYMB 4Q9CA 4OM1L 5HHQA 1N8ZB 1LWRA 4FZEL 1YDPA 5DUPH 1MCSA 3PDOB 3JWOH 2BRRL 2X09A 1AGBB 2HA1A 4MD0A 4UT7L 3QI9B 5IHLB 4QRSB 1KBGH 1MH5B 1LNUB 2GQHA 4NZTL 2KKQA 4LRNL 4QNPE 4ZPTB 1YN7B 4MDIB 4D0DA 4G5ZL 1G9NL 4MAYB 2PYFB 5IB3B 1JGLL 5I73C 1BFTA 4L8SC 4AQ1B 5F9JB 2R29H 3M45A 1I9JH 1AHWA 4JY5L 3QO0B 5JDSB 2FDBP 2P8LB 1JZ2A 2BVPA 3OL2A 5D72L 4KGJA 4NM4L 1UJ3C 2FH6A 1HH9B 5SX5H 1H3TA 1BP3B 4YHLL 5GZOD 1E4KC 2YWZA 1RZ7H 5IESL 1FVCB 3BPCA 3BGMB 2RCSL 3PGCB 3G6JE 2PO6A 3EJZD 3RL1A 2NY3B 3VXPB 4PRPA 2UWEB 4WI8A 5CP7A 1MCPL 4R9HA 1ZT1A 3OR7A 1CICB 1TVBB 1EV2E 1ZLSH 5E8NB 1DQDL 3UBXG 4XTRC 5DD6B 3MLZL 3QQNA 4KMLB 1IM3B 5IJVA 1KTDB 4NZRL 5C08E 1NH6A 2A77L 5FCUH 1ADQL 1W8OA 1NAML 3WKML 5JXEA 5K9KB 1JE6A 3KDMA 5JXED 5LVEA 4MCYA 2LU3A 1PZ5A 4JHWL 5ESQB 2WINB 3O9WC 5MEOB 1PD6A 1QHOA 2AVGA 3G5VB 3ZDYF 5HY9B 1A7PH 1MFDH 1Q9LB 3HPLA 4UILL 1CBVH 1YNLL 5IQ7L 4ZAKC 4EQ3A 5F9DC 1MVFA 4XP1H 5TGBB 3AAZA 5JOFA 1R5WB 2DM4A 2MHAA 3QIBC 4AT6A 2ICEA 1MCWW 2R2CA 4U1IA 3ZYJA 4AJ0A 2FRGP 4U1KB 5GHWH 3SDCA 5CSGA 1MAMH 4PREA 3QO1B 2YD8A 2YD7A 3SDCD 2JB6B 4HIXL 4N0YH 3ULUL 1QFHA 1UZ6F 5ALBH 5IFHL 1QKZH 2HT3C