2CPCA

Solution structure of rsgi ruh-030, an ig like domain from human cdna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGTDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0657 protein
publication title Solution structure of RSGI RUH-030, an Ig like domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cpcA01
5ADPL 1S9XA 1FH5H 1X4YA 1BAFH 4R90H 5FYKE 3L95A 1ZLWH 4ZTOH 2GT9B 1I1CA 3MZGB 1P1ZA 4ORGB 5D6DA 3ZSSA 3L7FA 3BO8B 2NY6D 5JMRA 1PY9A 3GSNA 3EYQC 3LQAL 5DJ2B 5L6YH 1RUMH 2EXWC 4C55A 5IW6B 5IESL 2W60B 1OARL 5D6CB 5GJSL 1A47A 4PRPB 4ZAKC 2A6KB 2YPVH 4OZFH 2ICES 2F5AH 3KPPA 3MUJA 1NPUA 4R96A 5D2NA 4R0LB 3MBEC 2EIBA 5B8CC 1NC2A 3NCEB 1N8ZA 1J9CT 1T83A 4MXVF 5HJ3A 3S34H 2GAZA 2X42A 3C6LA 3DNKA 4JR9H 4LMQI 5FFLA 4NO5B 4P5TB 4F2MA 3CFKA 5SWZB 2FIKA 2Y1VA 1QO3A 3LN4B 2B7DT 5DZLA 1I7RB 2OL3B 1FDLH 1FC1A 2XKUA 3BD4A 4RMRA 1OTUD 3TZVB 1VACA 1NFDF 3KPMB 4OAWA 4ERSL 5BVPL 5D93B 1S3KH 3HI5H 2EDRA 1J86A 1J1XH 1KN4L 2Q1EA 5J06A 4XMLL 4CUCA 5D7JA 3ZE0F 4M6ML 1UXWB 1OGTB 3ZSTA 1OTSC 2HP4A 1I7TB 1NGPH 2CDGB 3I3DA 2QLVB 4Z7UE 3NZHH 3IVKB 4P2OA 5HGHB 1R3LB 3PWUB 3RNKA 1DFBH 4RDQG 4HDIA 2AXFB 4KVNL 5EZIH 1G7MA 3RVTD 2ATPB 1LE5A 2NY0B 3R4DA 1N5YH 4KJPC 5B3JE 2OR9L 1CGSH 4NSKA 2H9GA 1UJ3A 3KGRA 3F7VA 3VG0L 1NBZA 1IE5A 4G6FD 4P46D 2ZCHH 3G6AA 2IQAA 5CD5C 2PYEA 3K80A 3OR7B 2QQKH 5E8DH 1G9MH 3O3BA 43CAB 2DWDB 3MRKB 2E27H 3QUYC 2P47B 4ZUSA 4NWUL 4LSVL 2IBZY 5EA0L 4HPYH 1INQB 4PJGF 4LSQH 3V9FA 1JHTB 5BV7L 5KVEH 4XHJD 4Z76A 1DBAL 2Q8BL 4NIKB 4CMHC 1Y6NR 1FNHA 4D9LL 2DL2A 3VFNA 4X4YB 2C4FT 2FJGB 1U3HA 2XZQL 4YNYB 1K4CA 3VCLA 4JO4L 2NX5D 4QOKE 4S2SB 3BH8A 2QTEA 3C5SB 3RPKA 4NJAL 4NRYA 4XBGB 1LQSR 3I3EA 5DHYB 3UPAA 1IJ9A 3HUJA 4P2QD 3PUCA 5IROA 4BH7A 2OM5A 4PJDE 5EOCH 4UT6L 5E08H 3DMMC 2XXCB 5HDBF 1JTPA 5E5MB 2PN5A 5D1QA 2JIXB 3BIAX 4Z7VE 4ZUTA 3SY0A 3QPXH 2VSDA 3THML 5DFVC 3NTCH 3NPZB 3RTQD 5ID0B 3MA7B 5D9SA 4EI5D 5CEXA 5TDPB 3VMNA 2UUDK 3BUYA 3SKNB 1NGWB 4GAYA 4CU6A 1J0JA 4HGKC 3CH8A 4ZODA 2LABA 2VLJA 3G6DL 4K8RD 1NLBL 4OD2B 3WL9A 1DQDH 1PKOA 5FF6A 4JM2C 1JPFB 3CSYB 2V7HB 3AU1B 1BMGA 4GAJH 4XMPL 4LLVA 2XA8H 1ZEAL 4TULH 3S3SA 3R1GH 3DX8A 4IOFC 3KYMA 2V9RA 1DUYB 2I60L 3VGBA 1J8HB 4HPOL 5KTEL 1A6PA 2J12B 2BVYA 4LKCB 1CWVA 3QEUB 4G7YH 5C0GB 1HH6B 3M45A 1HXYB 3WBDA 2XWBA 4XBEH 2AJ3A 2AJVH 2W9EH 4NZUL 1QBLL 3BQUA 5EU7E 4BFIA 5C8JA 2CRIA 4WEUD 5T5FL 4OTXL 2OTPA 4O4YL 1P4LA 2ZUWA 2DM4A 4I5BA 4RGND 5J1SC 3SE3C 5DVMA 3P0VL 3MV01 1PSKL 3CJJA 5J7CC 1MCPH 1X6NA 1YUHB 4KHTH 4R6UA 5JIPA 1CGXA 4NHCH 5CS7A 4Q97A 3TBSB 5JZ7C 4KK6C 2IANB 5T5NF 4K3EH 3FT2A 2O5YH 4NOFA 3LEYH 2J8UF 2CO7B 2HJFB 2VLME 3L7EA 4FQJH 4HX1B 4OZ4B 3PQYB 5DRXB 4OI7A 1IGIH 3SDAB 3VGEA 3LIZL 3ZKXC 4NDMA 5I1KH 1FNSH 4GRMA 3QCTL 4XVSH 5B39A 4UILH 3VRLF 2I07A 4R7NB 3AREB 3DROA 1UYWH 3HG1B 1EHNA 4Z7OF 1KEML 5E03A 1CU4H 5DI8A 3NBNA 2DIJA 3MLTB 2Q7YB 4XB8A 3C2AH 4YBQD 1H8NA 2QR0B 1OWWA 1II4E 3RVXC 2HJKA 3M8OH 5GGVH 5CJOL 2C3HA 1I1AA 5FKAA 5DA4A 3NFNB 1CGWA 1RMFL 4EBQH 2XXMB 4PJEF 2IEPA 2BMKA 2UZIL 5D70L 1XZ0B 3G5YA 4P48A 5J56B 1WBYB 4XP5H 1YMHB 4PRBB 2JCCB 5T3ZE 1JZ8A 3WN5A 1SVZA 2JJTC 2BOBA 4MA7H 3SBWA 5K9KA 5IG7B 3I6LD 5E1AA 5HI4C 5FM5O 4MDIB 1EO8H 1LEIB 4F7TA 2R9HD 4K55A 3FZUD 5T1KD 2QSTA 3H7BB 2UZYB 4ZOEA 5E6IC 5F6IC 2AVGA 4MCYA 2EYSA 1HYSD 3FONA 1VESA 5FCUL 5EBMA 5KSAB 4N9OB 1QFHA 2HVKA 1U8OB 4NGHL 1AI1L 4UBDD 3EYOA 3CXDH 1AQKH 1F4WL 3L5XL 1YEHH 1OCWH 2R69L 3BESR 4B41A 5JOFB 2J88L 1YEKH 4TUJA 5TQ0L 1MCFA 2X89D 3QEQE 3P4OB 4CVUA 3K3QA 5SWSA 1K4DA 2AJYH 1H3PL 3OKNA 5AZEL 3BKCL 4PJCB 1EEQA 5F3HB 2Z92B 3O9WC 3WIIH 5TE7L 5LBSH 3UAJD 2F8VA 2FL5A 3B6SA 2EC8A 4R9HA 1J1OL 4ZO6A 5SV4A 1INEL 4JO2H 1AQDB 4W4OA 1H3WM 1CR9H 4PJHF 5C07B 2AJSL 2BFVH 5DMJB 2EDLA 4FQPA 3TVMD 1IGJB 4Y4HA 2FH6A 3BSZL 1A3LH 5FYJL 1U8IA 3HS0B 4JVUA 4LLUA 2VR4A 3OGOE 5DLMH 4AYFA 2M1KA 2O26U 2A74A 3TPUA 3HC3L 3MNVA 1ORQB 5C9KA 4R8WH 1VADB 1TTGA 3WNKA 1U8KA 2ID5A 3P4NA 2NLJB 5HHVL 2NY7H 4YO0A 3HAEH 3H9SD 5IMKB 4A2MA 4ODHL 3TA3A 5H37H 3T3PE 3MQIA 2NY2C 1QLFB 3S96B 4JKWA 5I1HH 1AXSB 3NIGE 1TNNA 4L8SB 2BNQE 4MQSB 2D4DA 5KSBF 4FQXC 5FO8B 2CKNA 1A2YB 3WDJA 1AD0A 5CJXA 3V6ZB 4OGXH 5ITBL 1V05A 3E2HC 4PJ5E 4ODBD 1FG9C 1U58A 2X1XR 3QAZC 1I9JH 1YJDC 3PP3K 1JF1A 3CFDA 2H26B 3T2OA 3BVNB 3KPLA 1TPXC 4DVBA 3VD4A 1MCDA 5H2BB 3RX7A 3MREB 4RWHA 4V1DD 5I18L 4X80H 4XP6L 3VXTB 1OQXA 3K2MC 2FZ3A 3IFOA 5EC2B 4JQXC 4PRPE 1C5DB 1KCVL 2D2OA 5KOVC 3WD5H 5I1GL 3I02A 4QHKJ 3MGTB 1K2DA 1I1RA 5DK0B 2YN5A 3Q6FB 2AK1H 3KLDA 3OJVC 4C56B 2V2WA 3T0AA 3A6BL 4OCRH 4F7PA 4YHZL 5FGBC 2ESVB 3W5NA 3GSXB 8FABA 5I1JL 4KRPD 4E5XB 1RK0A 3CLEH 5DJCB 1YEDA 1KC5H 5B38A 3GKWH 4PS4L 1B0RA 3LKQB 1R3JA 3HTLX 4NN5B 2GQHA 1HXMA 4G6AD 2Y6SD 4AZ8A 3D3VA 1FE8L 1Q0XL 3RU8L 2L0DA 2IPUG 5ICZA 4LVNC 4ZAKA 1IRAY 4I9WD 4U6TA 4PJXA 3MBEA 4WW1A 5B8CA 3GI9L 5DEGA 4FQCH 4JPWL 1I3RB 1HWHB 5EOQL 5HVHB 4PJFF 3WKML 5I16A 1FO0L 1CXEA 4ODVL 4XPAL 1D5IL 3EO9H 1AH1A 1M7DA 2XKNB 1SBSL 3EJJX 3QFJA 4KMTH 2BSRB 5E8OB 4PV8B 3CUPA 4LRNL 2Y5TA 4X83A 2H2PC 1U8JB 1WFUA 3SQOH 1OAYL 3FB7B 4HKJB 1LDSA 2N7AA 4F58L 2BNRB 4HKBA 3MPCA 3UTPE 1UCBH 4YXKL 2DIAA 1ZMYA 5DDHA 3SGJC 4HMCA 1MFBH 3CFCL 1MJUL 1A21A 2WK2A 2NMSA 4I18A 2XTLA 3C5ZB 4WO4A 1G6RB 1CT8B 1ZHNB 3TCLB 2R2CA 1DQLL 32C2B 1T66D 4I3RL 3LD8B 3NFSL 4H1LB 4CAGA 3HRPA 4QRUA 4Z7QE 2CGRL 1KLUA 1R3IL 2HMID 2GSIB 1JUFB 2IBZX 1O0VA 4KKAC 5GHWH 4XRCB 4K3JH 4OT1H 4MJ5B 5SWQB 2P5WD 5CZXC 1OB1B 4J3UA 2E5EA 1O5DT 5EIQA 2B0SH 4JANB 1RJZB 4LCIH 3QDAA 5L88L 3ULUL 1HNFA 3B4NA 3QUYA 3PIQB 3DO7B 3OF6A 2A2QT 4KQ4H 3ARBD 3D3VE 5C6TL 4GT7A 3BP6B 5HHOD 1MHHA 3K81A 4HWBH 4O9HL 3L1OH 3RWGA 2VOTA 4HIEB 4DGIH 1XF2A 2I26N 4U6VH 1KV3A 1DE4A 1FNAA 3IFNH 2OK0H 1BOYA 1QFWM 4XNMA 3WFDH 4AEIL 1CGTA 5J57B 1U3YA 4YGAB 4J6RH 1WC7A 4HUVB 2ADJB 5GIRA 3MC0A 4DKDC 4ISVB 2AQ1A 1U8HB 4PJ7B 4UV7L 3DMMA 2QEJA 4KTYA 4K94L 3K1KC 3PWLA 4MXWH 5CINL 1Q8MA 2HFTA 4NJ9H 4QEGA 5KJRL 5L9DL 3IGAB 4C4KT 1J8HE 3VD7A 1DVFB 5BO1H 5JW4Q 4IJ3B 4LU5H 2FEDC 4JCMA 5ADOL 3EYSL 4Y4KB 1YY9D 2YPLA 4R2GD 3S9DB 2F54A 4DTGL 4POZC 2B20A 4JM2A 1HHKA 2QADB 4RISH 4AIZB 1L7TL 2VISA 3IJSB 4OGYL 5J11C 3B5HA 1QRND 5DUMH 5GXBB 3CMGA 3X14B 5DWUH 2EIDA 2F19H 1HINL 3PV7A 5TFSH 2MCPL 5GS2H 3VXMB 5DC0A 1YYMH 4J4PD 3O6FB 3BUTA 3GB7B 3U79A 2Z35B 3UJIH 1TJGH 2IANE 5F7WC 3W9EB 1UZ6E 4GH7B 2FIRT 3AS1A 5DK2A 1E27A 2D9CA 4HUUB 1F42A 4X6BB 1CE6A 1AO7A 1FL6B 3FRUA 3HC0A 3PQYE 4K71B 4YK4C 4XCCH 2LAAA 5T1LB 1I3UA 4MJ6A 5F9WB 3MV7B 5J6GB 1A6ZB 2F53B 1BFVH 4UB0H 3TIDB 2GTWB 1VSCA 2PCPA 5LXGH 3HG1E 2X44D 3DXAB 5L2JA 5ACZA 2DQIH 3GMNA 4YBLB 3SE3A 3OJDB 1ZVSA 2HH0H 4GLRI 1F00I 5DMIH 5IHBA 4M00A 3HZVB 4PG9B 2VXQH 1H5BB 4WFGE 5DMKA 5AAMA 2NXZD 2YWYA 1ZLWK 3U36B 3SKJL 3WNOA 3QXTA 4IHOA 4OSUL 1A4KB 4PGCA 1U8MB 3OXRB 5JW4N 2IADA 1MHCB 3VFRA 3PE9A 5TPWL 5JIKA 3FMGH 4Z8FL 5DURD 5HHMD 2JCCE 4C4KO 1JTOA 5GZND 4GSDH 5GGTH 4IRJC 3RX5A 3QG6B 2FWOB 3SO3C 1FP5A 4X6EA 1PYWA 4UI2A 1JPGB 3BW9B 2Q8AL 4X6DB 3LRHA 2BVEA 2YEZB 1AGEA 1FZKA 1QR1B 4KAQH 3G9AB 2H2SD 5TH2B 1KLGB 2YPLE 4Y2DD 2F54E 4PJIB 2R2BA 3P11H 3S6CA 5GZOC 5F1KC 3VWJB 3GSNL 4HKXB 1DL7L 4Q0XL 1X3DA 3U83A 1WZ1L 1UGNA 4YC2C 3VRJB 5K9QI 1MJ8H 4L8DB 5JHLL 4OZGF 1KPVB 1CXHA 2ZOKB 2JJTA 3OWEA 1GGBL 4WCYL 4PJCE 3D69B 5IB4A 1SJHB 3ARYA 3OKEA 2P48B 5DD1L 2DDQH 2X4QA 5JHDA 5KG9B 2GSGB 5E6IA 4BZYA 1S7UB 3MV8B 4XC1H 5CJQL 3EOBA 2RJMA 4U31A 4F7CB 3D18A 3HE7D 2HTKD 4JY4B 3STLA 1E4KC 4S1SL 4N0UB 1TVHA 2G75A 4XP1H 3MRRA 4PIRF 2Y4SA 4HJJL 1AGCA 1UWXH 1RAMA 3IJHA 2YSSA 1CICD 4FQ1L 4OCWH 4U6HA 3QUKB 2AP2A 4Q7DA 4AL8H 1PW3A 3I9GH 1VPOH 5I1CL 3G5ZB 4MX7A 3VGAB 3R0MA 4M03A 4RZCB 3O2VL 3CFBB 5GSRA 3UJTH 2IALB 3O9WA 4XAKD 1E4XL 4O5LL 4JFDD 2VDRL 3STBA 4NHUA 1JRHI 4HHAB 4WJ5B 5KS9A 1I85A 1FNGB 4N0CC 5C0BA 2AEPH 3T08A 3V4UH 1DCLA 1JI2A 5JQ6H 1RJLB 4PFEA 1VFAB 4R96B 4LNVA 5GGRB 1T1XA 3D0VA 2NW2A 5I17B 4Y1AB 2YXMA 1KYOK 4I0CC 1QBAA 1SYVB 4LCWB 3NA9H 4TSAH 4LSUH 1RZKC 2J3SA 2WP3T 4DKFL 4NT6A 2XTJD 1LD9B 4PR5B 4GXVL 4KROD 2R0ZL 1BPVA 3GSRB 3HZYA 4TUOA 4LEOA 1MH5A 3AUVA 1U6AH 2OJZH 2P4AB 2UVEA 3FOMA 1KN2L 3B3IB 2VUOA 3EJZD 4NKMA 3NGBC 3O4LB 1NCWL 1JPSH 2IGFL 5GS1B 3MV9A 2X9YA 4BM7A 4FMFA 4GQ9H 4CKVX 1DBJH 4XMKH 2CQVA 4KGLA 1Z9MA 3VFGL 3BD3A 1VGEL 3FCTA 1EZVY 4NKQB 5IVNA 3AC0A 3VXUB 4MQTB 2YR3A 5D5MA 3HZKA 2YK1L 4UT7H 3OKLB 4FQXA 1OM3L 5TE6H 3H3BC 1MELA 4NYLB 1G7PB 4ZTPL 43C9A 1MCIA 3WS3B 4XPFL 4U1NB 3EOTH 1FFNB 4M5ZL 2EDOA 4C56E 2ZUTA 4LSRL 2DYPB 2ESVE 1QOKA 4ZSOB 1IVLA 2GY5A 5ISZD 1YMMD 5D1ZC 1LP9B 3AB0C 4YXLH 4ZXBA 2GJJA 3P4MA 3J8F7 4MHHG 5CHNB 4DWHA 2BDNL 3TFKC 2EH8L 1UQSA 5DR5L 2X5PA 2XNAA 5IHZB 3IDIA 2YZ1A 4JQXA 4KJWC 1VEMA 4BQ6A 3DV4A 4KQ3H 3IFPB 3MLYL 1KIQA 4X7CC 4OZIF 2EDDA 1A6AA 3ORJA 5EZOH 1QVOB 3LKSB 3W2DH 1WK0A 4K9EC 4R7DB 1CFQA 4YDJA 5E00B 4NZTH 5FGBA 1I9RH 1Y18B 1FGVH 3QRFM 1CFVH 5I71C 4ZUUB 4Z78A 3RWIB 5T3ZL 4R4BB 2WP3O 1MLCB 1Q1JH 2VDKL 1JYXA 2LVEA 4H0IA 4P2RB 5F7LB 1OP3H 1FRGL 1KOAA 3MFFB 1RIUL 5DRNA 3KYKL 3PWPD 4DW2L 1D5ZA 4JG0L 4M8QB 4OIIH 2DAVA 3MXWL 35C8L 3RDTB 4YHML 1A7NH 2OQJA 4S0TD 2VDQL 5BRZD 3X12B 4FFWC 1XCQB 4YAQB 3G5VA 4GRLD 4Y5XC 2BNRE 3MRDA 5JDJA 4UDUB 2X70A 4L3EA 1RHHB 1XGRA 1J8KA 2Q7NA 1G9NH 2HT4C 1R3KB 3LAFA 3V52H 1C16B 3JWDL 2VQUA 1M7IA 2FLRT 4EVNB 3SPVA 5IOPB 3IETB 2GJZA 3TH2T 3KXFA 3W11D 1SY6A 3VJ6B 2Y7QB 3LRSB 4LNRA 4XVUC 1FVEA 5T1MB 1BZ7A 1G7IB 5J9PB 4LARH 4JKMA 1UT9A 1ZK9A 2ATKA 3DVGB 4Y4FA 3S3JA 3BEVA 1FBIH 2RB8A 4G6ML 4Y16D 4WY7H 4G7VH 2VL5B 3SGJA 5BW7C 3R0NA 4LAQH 1EBAA 5IB2B 4WWKB 3PV6B 5T1DL 1FAIL 1ONQA 5F7EH 5A40E 5ABDE 4HG4K 5E94B 3RWCB 3BKYH 3QEHA 3GJEB 3D0LB 3ULVE 1TMCB 4PP1D 4N0FA 4HCRH 4JHAH 5EBLB 2YD8A 1XF1A 3H9HA 1DBBH 4ZPTA 4EKXA 2NNAA 4N8CH 2FSEB 2R29H 1EVTC 4M93B 5INCB 2BHZA 3INUH 4FXGB 1MFEL 3PL6C 2Q6WA 1XF5A 4PBVC 5I0ZA 3DUSA 5DRWB 3C8KB 3QUMB 4OCMC 3ARWA 4NQEA 1FV1B 4PJ7E 4FQ2L 3MRNA 3QUXC 4TNWF 1FCGA 3MUGA 2CUHA 1FZMA 1SYSA 5BCAA 4XC3H 4UTBH 1DDHB 1C08B 3UO1L 4G8FA 4P9HC 1X5YA 5C6PB 3RVWC 1Q0YH 3SKMB 2EZ0D 4ONOA 3L3HB 3BP5B 4WRLA 2Z91B 4N5UA 5ESVA 1IC4H 1RZIB 4JRYD 3QWRD 1UJTA 3HZMB 3IFLL 5C71A 4ODXA 3SDCC 5FM5M 2DQJH 5HPOA 3FFCA 4AY0A 4QRPB 5E4EB 3RWJB 4Q9BA 3AS3A 2I9LA 1IGCH 2X4TB 1D5BA 3ARRA 1PX4A 2I9TB 4NP4L 3LKOB 2W9LA 3G5XB 1QRKA 3KNBA 4G8EB 2C9AA 3CX5J 3KXFE 3O41B 3QRGH 2JB5L 4G5ZL 4D8PA 3LN5A 1V7MH 1JWUB 3BZFB 1VKXA 3MRLA 2MHAB 4GW1B 4LCCB 1J1PH 2VDMH 2A73A 1S7VB 1FGNH 1T80A 4UUJA 5ERWA 2Y25A 3TCXA 5HI5D 2DQTH 3MV7E 4M61B 1YECH 2OL3L 2F53E 1UACL 4A6YB 4XPBH 1PY4A 2X4RB 5GRVL 3LQZA 5I19L 2JB6B 3IRPX 4WHYG 5I15L 3ARFD 3KPSB 5FAAA 1G9MC 4UIKL 1MFDH 3QHZL 4G8GA 3MJ9A 4LPVA 1I8IA 5C0IB 4HUXA 1WZKA 2EYTB 5FYKD 2CRYA 4HZAA 4M43L 5FOBA 3F6IA 3MRGA 4APQD 3ECBB 3KAAA 3ARGB 3HNSL 2EDYA 1ZLVH 1LO4H 3BDYL 4KPHH 2PXYD 2GCYA 5TGBA 4W4NA 1RU9H 1N5AB 3L3KA 5I1DA 1WJ3A 3W81A 2XG4A 3CVHA 3LS5L 4Z0XB 1IM9A 4E9LA 3MRIA 5EU6B 3F7YB 4X6DE 4QRRB 4G3YL 1HHJB 4WHTB 2C26A 2ZSWB 4YXHL 5ANMA 4MDJB 1P53A 2VAJA 1TZHA 1AC0A 3VWKB 4P49A 4QHNA 2W65B 4CMMA 1MVFA 4WFFD 4LBEB 5I9QC 4XWOD 2A6DA 5K93A 4OZFB 3QA3B 4A2LA 4YE4L 3GBNL 4CW1B 1JMZA 4HKZB 1NAMA 3IYLW 3Q1SL 4IRJA 1XIWB 1OTUC 2EDQA 4CNIB 3KHOA 1TQBC 4LLYB 3D39A 3DSFL 4HT1H 3MV8E 1CE1H 3KPQB 1T5WB 2X4SB 4TNVK 1MREL 3B2VH 4PJAB 4LGSB 1YQ2A 4HMDA 2DLGA 3CVIH 4YQXL 4EDXA 4U1LB 1UM4L 1A7PH 1D9KB 2YRZA 3LZFH 4F33A 1S9WA 4N0UE 1RUKH 2PO6D 3O3UN 3V0VA 1UWGH 4HFUL 2V9QA 5ILTH 2X1PA 3QJFB 3RVTC 4KDWA 3TO4C 1OT1A 2VZTA 3P2TA 2YOCA 2R39A 1YC8A 4X98A 1FL3B 5B22A 2KQMA 1Q94A 4J12A 4WEMB 4Z7UF 1KTKE 2Y06L 4HSQA 4MQXD 3WIHA 1T4KA 5C0FA 4P46C 1JYWA 2PTUA 3SDYH 5DD6A 1E4WL 5K9OB 2PKDA 4GAGH 5DJXA 4L8CB 3CCHB 4UU9B 5EN2A 1F4HA 2Z8WC 5B3JF 1HKFA 1F11A 1E4KA 5FYKH 3VMOA 1BFOA 2XZZA 5E56A 4KDTC 4Y1AE 1SEQH 5DD0L 4JVPA 4X99B 1I1FB 2FJFA 5FDWB 3TBWB 5I1IH 1KJVA 4PV9A 1O7SA 4XHJC 1EGJA 1JNNL 4WUKL 1S7TA 4OF8A 2DQUL 1C5BL 4O58H 4QOKD 3IKCA 3MNZB 3N1FC 4YPGA 5CILH 5E2WL 4JPVL 1R24A 3BYTA 5FO7A 4NQDA 4OLYL 4JPKL 5HY9A 3AY4C 2CK0L 2QV2A 3UJJL 2VLKB 1OHQA 3LSOB 4JGMA 3JTSB 4LSTL 5D2LA 5F88A 3LEVH 3VE0A 4H26A 5LVEA 2P1YA 3QZWB 3CSPA 1BIHA 3QULB 2B8OT 1KJ2H 5C0ND 5AG9A 4MAYD 2NY5H 3OJ2C 5EFIA 4RAUA 3VXUE 3ILPA 1WIPA 3EFFB 5GGUA 1BLNB 3RTQC 3TJHD 1YEEL 3BZ4B 4RDQF 1A5FL 4EI5C 4YX2H 5AAWA 3GHEL 4PJDF 3WNLA 3TV3H 5F96L 2HLFD 5MERB 4LLAA 3RZCD 4K8RC 4WW2B 4Z7VF 2ADGB 1NCBH 2XN9A 4K23H 3VDBA 2VXSL 4OZHA 3VH8B 2P49B 3W9DA 4GOSA 4HEPG 2OSLA 3MMEB 4NO3B 4P2OD 4ZSOE 1NCUA 3PWNB 4ZNEE 1LP9E 1MCOL 3FQNA 1JGLL 1C5CL 1EEYB 1HHIB 3RWHB 1OWRM 3D2UB 3VFVA 3P73A 2ZCKL 1JZ5A 2LU3A 3KPNB 4N1HB 5C9JA 1IL1A 4O2FB 2RGSA 4K3DL 4AK1A 3O3AB 5CEYA 4BZ2L 1H8OA 4HC1A 1CF8L 2G5BA 4P9ML 4L4VA 1GGIH 2EEAA 2EIZB 3N85H 2FB4H 5D1ZA 3RPIB 1F58H 5JW4R 3HNVL 3WHE0 4JFQB 4QTHB 3JWOC 2VXUH 4RGNC 2V2TA 3MOQA 2XPGA 4JKKA 1N6QH 3PWJB 2VE6B 4FQHA 4D0DA 1TJIL 3WEXB 1G9EA 25C8L 2WUCL 2DM2A 1QR4A 3I6GB 1NGZA 1HKLL 1P7QA 4U1MA 3QNXB 4XZUB 4PJBB 1R5VB 2GJ6B 1MNUH 2VLMD 5C0JB 2ITCA 5D2LE 4EQ2A 5KZCB 3LKPB 3SGKC 2FHFA 3D85A 5IV2A 1TCRA 2UWEA 3ZTJG 2P42B 4NN6B 1RVFL 5D1QD 3CDGB 4FA8A 3MUHL 5F89A 3WUWA 1IGFL 3HNTH 1X7QB 1D6EA 5IEHA 1ZSDA 2VYRE 1HZHH 3NCFB 1UM6H 3QQ4B 1RUQL 2R2HA 1EHLH 4LQFH 4DJMA 4H8WH 2R4SL 4JN1H 1LDPL 4YBQC 3L5HA 3S5LA 1Q9KB 1ZT7B 4PJ8B 4JLRB 3DJ9A 4LHUA 2VXVH 4PLOB 1R5WA 4MA3B 1FZJA 4OZHE 5T3XH 3OV6A 1NDMB 5DGQA 4I48A 4DVRL 3OAUH 1A14H 2R0LH 1IEAA 1Z5LA 5EUKA 1P69B 4V2CB 3F62A 2IPKB 1JGUH 5HYJA 2EH7H 4JFEB 5T3ZD 4NOBA 3FRPA 3D87B 4M5YL 4I4WB 4JDTH 1Q9OA 1ZLSH 2R9HC 4OFPA 5ELIA 3QIWD 1P4BH 5IHUH 3FZUC 5C0RH 3ARVA 1SJEA 1BIIA 4TUKL 3KJ6L 1H3VA 1FIEA 5D72H 1HYSC 2XQBL 2AJXL 5KVFH 2ZPKL 1QA9A 2DI8A 2FHBA 3I84A 2QHLA 3QDGA 1AFVL 5DHVH 4IBLT 4DUWA 1FVDA 2IG2H 4B7IA 4ETYA 1OSPH 3QNYB 4UBDC 1C12B 1G1YA 1ZV5A 1PLGL 4LHUG 5E4IA 5IB3A 3UDWC 4AG4L 3QEQD 4GS7B 3EFDH 3H0TB 1BWMA 3BGFC 4QHUA 2WQ8A 5BW7A 1PG7X 4JKLA 4W81A 2VZ3A 4BH8A 4JY6B 1QFWH 2UY6A 4TOYL 3UAJC 5LGHH 1QPPA 1FNEB 1NUGA 3P9MB 2EDJA 2AK4B 3T4YA 1KCSL 1NFIA 2BHUA 5DK3A 4QXUH 2AJZA 2QHRL 2IQ9H 1Z3GH 3PL6A 4QRPE 4U1SB 3OG6B 3OHXB 1UWXK 1LO0L 3TVMC 4XXDB 2BZDA 1KENH 3BKMH 3MACH 3GMOA 3QUXA 2VZ1A 3TC9A 3PGFL 2AJUL 3KPTA 4HV8B 1MAML 3GRWH 3GJFH 4MJIB 4XCNA 1NSNH 3V6OE 4PRIB 3ZDXE 1BVLA 3OR6B 3BPNC 3JV4B 3EAKA 3SDCA 4BQBA 4G9FD 5BQ7B 5JXAL 4OLVH 1EERB 2KDGA 1NC4A 3C5JA 4CADB 4Y19D 5EU4B 3V6FB 1NANI 2GHWB 4IRSD 1N7ML 4O51A 5KW9H 1MUJA 4NPYA 4PGBB 1I7UA 3HPLB 2J4WL 1XGTA 2A38A 2BNQD 2VH5L 4P57B 1HHGA 4X9IA 3E6HB 1DQMH 4JO1H 4JZJC 4MSWB 1TZGH 2QSVA 4IOIA 3CXHK 4PJ5D 4OZFG 1CBVL 3HAEB 4MGXA 1SEBB 4PJ9B 3KPSE 3RZWA 3T3PF 3DRQB 4DOHB 5I73C 4MQ7B 1AGBB 3RWDA 1IEBA 2ADIA 2Q3AA 4D0CA 3NIGF 4P59L 5EPMB 3UTSA 1T7XA 4HS6A 5F6IB 2A77H 2NY3B 2IFGA 2AQ3A 1BX2A 1X5GA 1PKQB 4OM0H 2G2RB 2ERJC 3V2AR 3ILQD 4IIQC 1N64L 4HXAL 1JNHA 4PRPD 4NZDA 1F3JB 3RIAF 1YY8A 3FHAA 2DMCA 3AGVA 3VG9C 1GC1C 4JO3L 1ZHBA 3SGEH 3L5WA 3EYFB 5EU6E 1X5FA 3OZ9L 1HH9A 3PNWB 4MD0A 2XKSA 3RAJL 3QYCA 3QPQD 2XOTA 1DBKL 4KTDL 1NUNB 2UYLA 4N0YH 2B1AL 4X5XB 5JLZB 4KRPC 4P5TD 1ZAGA 2CLRA 2DQFB 3OQ3B 1YDPB 5F7HA 1MIEH 3PABA 3L9RB 4P23B 1WCQA 2K3TA 3GSQA 4QF1B 4AT6B 3Q3GA 4G6AC 2Y6SC 3VGHA 2Z4QA 3TZVD 4GBXC 5ICXA 3U4AA 3JWNC 3QR2A 1C8PA 4OKVB 1FIGH 2M26A 3T2QA 4JY5H 1S8DB 4P5MA 1BZ9A 3T8XA 3RHWK 3VA2C 5ESAB 3VXNB 4PJAE 5LAXA 1VHPA 1FLTX 2PW2A 3FOLA 1UEMA 1B6UA 2P24A 2R4RL 3MLUH 1OP3K 3LQAC 1MJ7L 1N0XH 3ULVL 3CZFA 1CDBA 1PX3A 5F70A 1UVQB 1OVZA 2NY0D 1NCAH 4UTAH 2VDNL 5I8KL 4MAUL 3M17B 1K5NB 1DLFH 1V7NH 5DJAA 5E8PA 1UB5A 3BE1H 3C08L 1NGXA 4D2NA 4XBPA 4X6CB 2WWMD 3UTPD 1OAZL 3UTSE 3B9KB 2X4NB 3MRQA 4QT5B 2ZCLH 5EDXA 4NRZA 5GSVB 3CMOH 4PPTA 2MQ3A 3G6JB 4CVZA 4NUJA 2YHGA 1XGQA 3TNMA 1PG7H 2OTWA 3QAZB 4JB9L 2AKRB 2BOCB 1CFNA 4DAGL 4LLDA 1T66C 1KB5A 4K7PY 4YHNB 1QSVA 4MD5A 2BSTA 1H3GA 3O45B 1DSFL 1E4XI 2HMIC 4HJ0D 4OF7A 5DD3H 1T04B 3IDMB 3GMQB 5J89A 3GIVB 3K7UA 4P46A 4ZO9A 4BFGA 3OXSB 2VLKE 5DC4B 2DQGH 1A9BB 1GZPB 1FNFA 2ICCA 4Z7QF 5CD3B 3TIEA 3U7YL 2JIXD 3F5WB 3WUZA 2F15A 3D3VD 1RZGB 4KDTA 1SY6L 3ARBC 3D9AH 3QDJB 2OLDA 5FXCH 5JDSA 3SDXB 2QQQA 2MPAL 5EWIH 5J6HB 4Y2OA 3DI2B 1ZGLA 2HKFH 4JAMB 1WVZA 2J1KA 1IQDA 3K46A 5IT2H 3LPGA 3GMMB 5HVGB 2BRQA 1J5OH 3TBTA 3O6MH 1I4FB 5I1LB 4C58B 3AY4A 4WTZG 3ARDB 4LVNB 3GSUA 4WFEE 1ADQH 2ZJSL 4LLWA 3T2PA 4JFYA 3C2SA 4NKOA 3VW3L 1D6VH 5D7LB 4GMSH 3KYNB 3S88H 5GJTH 3KJ4C 2AEQL 4FTVB 3NH7L 3UYRL 1EXUB 2JJVA 2R0WL 1J88A 3JV6B 5BV7C 3ZE2E 1J8HD 1G7LB 3RTQA 4M48H 5GRJL 3L6FB 4M7ZC 5ICYB 4EI5A 2VZVA 5DD5L 5TQ2H 3UZQA 5D71L 5JA8B 4KUZH 1FSKB 2F5BL 2VDLL 4XP9L 3JV5A 1MLBA 1LE9B 1VA9A 3IXTB 3ARPA 4HH9A 1YY9C 4R2GC 3UBXA 3GMRA 1QBBA 4JZOA 5H35B 5FGCB 3KLAA 4QYOA 1L6ZA 3LKNA 2IPTH 2QJDA 1A1NB 1IAIL 1BJ8A 3UC0H 4NWTL 1GYAA 4OQ1A 1CXFA 5GS0D 4M7LT 2P7TB 5EZJA 1RUPH 5BVPH 3SJVB 3U46A 4B7LA 2YA1A 3V0WL 4U4BA 4U6XB 5A2KH 3MLSL 1PAMA 2IAND 3HC4H 4M6MH 4D0BB 4QO1A 3WO4B 4YBHA 4NKIL 2BJML 4PGDB 3PQYD 5CGTA 4QXTA 2GEEA 4M1DH 4F37F 2Z31A 4K7FB 4XCFH 3UTQB 2V6HA 4OV5B 5EUOB 4N68A 2K9UA 2Y36L 1UM5L 4HS8L 3ARED 5C2UB 2J8UA 3MA9H 2DTSA 3HG1D 4U0RC 1KJ3L 2HWZL 3PDDA 2W9DL 2DM3A 3RX8A 5HYSB 1UZ6F 1DUZA 4YHLH 3O8XA 1QFPA 4NO2A 2D0FA 4FQQA 1X5XA 5I6XC 4WFGD 1DLHB 1IILE 2NXZC 2ICWA 5GRXG 3OX8B 4UNUA 1JJUA 3QI9B 4MNGB 2RBLA 1T22A 4L29A 5KN5B 1ZLVK 2R8SH 1JNLH 5FYJU 3RL1B 2RCSL 3SGKA 3SKUD 3N50A 4QWWD 1I3GL 5BZWA 5CBAA 4NWUH 1LWRA 3QQ3A 4O00A 1ITBB 1TZIA 3AAZB 4JFEE 3ZMRA 2RFXA 5GZNC 4KK9D 1BVKB 1HI6A 3QCVH 3F7QA 4PJEA 3IJYB 1UXSA 1MCSA 3B8YA 5EU3A 2NY4B 3ZKMD 1QQDA 3GIZH 5KSAD 2VQ1B 2YPLD 2H2SC 5IB1B 1T0PB 2F54D 3KPOA 2N1KA 4Y2DC 2JCCF 2J8HA 4HAGA 1W0VA 4UT6H 1ZANL 3CFJA 2Q86A 1WAAE 1DN2A 3UTTB 1W0YT 3T1WA 4Z7NE 5LCVH 3THMH 4Y0GA 3CVHL 1U8PB 4TTGA 2X4UB 4KMQA 1BQLH 1GGCH 4XVTH 1BREA 4O02L 4OF6A 1JPTH 5T1KA 4QHLB 2Z8SA 4OLXH 5GS0H 1F6LL 2NYYD 4WI9A 2AK4E 4KVCL 5C07D 4YHOL 1B6DA 4GKSB 5I1EH 3HAEG 3HE7C 4LLQA 2HTKC 2LV4A 2X4OA 5H37G 3FQWB 3FTGB 4FQLL 4PJCF 5CSZB 3RIFK 5F93C 4YIQB 1NAML 2JJWA 1TTUA 1CICC 2VITB 3QISA 2X89A 3A6OA 4U1HB 1U8QA 1HEZB 4PJHA 3L3DA 1RZ7L 2I60H 3EDEA 1U95A 5JORB 2G5RA 4UMGA 2R2EA 2IMNA 4K3HA 3U9PH 5IFJB 5I8CA 1CVSC 1JWMB 1N4XL 2P5EB 2UV3A 4MJIE 2FCBA 1YNLH 5IFHL 2DWEA 5CUSH 1X44A 3AM8A 1DJSA 2A6JB 3AXLA 2DF3A 1IAOA 3I75A 3RNQA 3VXPA 4OCSL 2VIRB 3TVMA 2CXKA 2QQLL 4WUUB 2PR4L 2XT1B 2VDPL 4WI8A 1PSKH 2X6MA 4NC2B 4U7SA 5HPMA 3RI5F 1OSZB 2XTJC 4EEEA 1A6UH 4KROC 1YEJH 4XX1G 3WIHL 2ED9A 4DOHE 2YRLA 3L3IA 2FEEL 3VD3A 4BQ8A 1W8NA 2FBJL 3WLBB 4MVBD 4EI6B 1S5HB 4RX4D 3AMLA 5ALBL 5KSBA 1CQYA 1TETL 3EJZC 1OF2B 4N8VA 1X5LA 3H9SA 1WIOA 3DTXA 3BP4B 3QCTH 5TDNA 4IOSD 3IXAA 4X7TA 2HG5B 1PKQE 4DK6A 1F3RB 1RURL 1DEDA 1MRFL 2P8LA 1FFOA 4UQ2B 5I66B 1BGXH 1EGJL 4NC1C 1MWAB 4Q2ZB 3BPOB 3I6LE 3P77B 4CU8A 4FXKB 3L3JB 5D7IA 4XNQA 3QT2A 3ZDZE 4TVPH 4F57L 5E8NB 4C56D 2HFGH 4NQVA 2ESVD 3EHBD 4J3XA 2WIIB 3LHPL 4P2CG 1HK6A 1ZT1A 5IEKB 3ZKND 1U92B 3QO1A 4XX1E 3MR9B 3UTOA 3CK0L 3HHRB 2HFEB 3V7AG 4C83B 3LKRA 3V8OA 1QEWB 4IIQA 1ACYL 3NCJH 5C2BH 4G6KL 4FFZH 3A67L 5HGBB 2VZSA 1WBXB 1T1ZA 5IK3B 3TWCH 3LCYA 4X8JA 1QYGH 4NGHH 4WHCA 5EO9B 2CD0A 4BKLA 4YDKL 4JHZA 3L5XH 4UDTA 4JM4H 4AM0B 2HJLA 4Z77A 1NEZA 5FUZH 4P4RB 3RGVB 2CIIB 3RQ3A 1FVCA 4HWBA 3BKCH 3TH3T 2JKXA 3QJHB 4PJFA 4DKEL 4XAWH 3GBLA 1INEH 2J2ZA 5FA3B 1XCTA 4HC1L 4J8RA 1YPZB 2BNRD 4X6CE 2BP3A 5DUPH 3T77A 2V7NB 4GRLC 5D4QA 4I77L 4IRZL 5GS3A 3V7AE 4PTUA 3V7MA 1F8TL 1G7QB 4NNXA 3BGMA 1RZ8B 3BSZH 1YEGH 6CGTA 5FYJH 3EIFA 2AV7A 4L8BB 3C5ZD 4QY8A 1NEZG 3JV0A 3FO0L 5D7IE 1QHPA 4DZBB 2QSCL 2JJSC 3W11C 1S7QB 4L4TB 3FB8B 4WV1C 4OD1H 5DYOA 2GTZB 2DD8H 4K9EL 3DX7B 3E8UH 4ODHH 4LCUB 3H9YA 3QQ9D 4FNLL 4OCYL 2NW3A 3CX5K 4K7PX 4TSCH 4YZFE 3DRTB 1CLOH 5IKCA 1ZTXL 2WIMA 2GW5A 3D25A 3MRPA 1BZQK 4BK4A 4Y16C 4ELKB 2ZKHL 2A0LD 5CLTA 5CIPH 4WDIB 4UT9H 4ZG1A 3MOBH 5C1MB 1M71A 5KANG 3ULVD 3VGGA 1U93A 3FQRA 5GRYA 3CPLA 3OAYH 2I27N 1FQ9C 3OKKA 3QDJE 3QUZC 3SDDB 3C8HA 4PP1C 5CZVL 2YUXA 3T4AB 4RA3A 2VRAA 2DB8A 4YDLC 3MCG1 1N59A 3O4OB 3OG4B 5I1AA 5TE4L 4BZ1H 4F8QA 1P4IL 4KTEL 4ELMB 1CLZL 4PLKD 2PW1A 3IDJB 1DP0A 3ULVF 2GIYA 3L3GA 4JFXB 2P5WA 1NEUA 3GHBL 2W07A 5D7LE 3O3EB 4JCLA 2R23B 1HSAB 3QXAA 2CUMA 5DJZA 4FTVE 4ZFFB 12E8L 5I1GH 3ARBA 4RSVA 1BBDH 3WNNA 5HHOA 3CDCA 1DVFD 3RKDD 5FKPB 2X4PB 3DV6B 3U9UA 3O0RL 5DJ8A 3GFUA 4PJ7F 3R06A 4HK3N 3QIBB 1NMBL 5EOTA 2D03L 5E5RB 5KSUB 3C9NB 2OTUB 1R3HA 2XWJA 4X9FA 3IDGA 1BQHA 3IU3B 2QADD 2BY3A 2B5IC 4XHQA 4LVEA 2Y23A 4PY7B 4TN9A 3QXDB 4K3GA 3KXFD 4Y5XB 5F1SA 5F97E 3EO1B 2YPKB 1FH5L 1MJJB 1RPQA 1BAFL 3GBML 3GJFK 3BHBA 4R90L 2A6IA 4PGZA 3U0TB 4ZTOL 4GKZB 4Z0BH 4ODWB 4JFPB 5A16A 4M4PA 4YH6A 1RUML 4H1LH 3OGCA 1FFPB 4H5SA 1FG2A 3ZKQD 5MEQA 3P4LA 1A1MA 1A7QL 2YPVL 5E2JA 5T1LD 5CP7B 1D5IH 2F5AL 5CSBA 3MV7D 4F7MA 5HI5C 2D7NA 2F53D 1Q38A 1S5IH 5EUOE 4RGOH 2ZOLB 4KRLB 4R3SB 5BVJA 1M7XA 2GITB 4D9QE 4QRQA 3DXAD 4P9HL 4UZGA 4EN3B 3S34L 3ARFC 3MRFA 1QRNA 4H25B 1JGEA 1A9EA 2FRGP 1OAYH 5DO2D 3T1FB 4WGWB 4EXKA 2A1WH 4TTDD 4J4PA 1Q72H 4TRPH 2DQHH 3F65A 1Y0LA 3L3OA 4MNGE 1FDLL 3TYFA 2EYRA 4PGEA 2XQYK 4APQC 1OAUH 4PTTA 3HI5L 4KZDH 4LPYA 3TO2A 3NCMA 3NACH 1J1XL 2PXYC 5FHAL 4E42B 2BY0A 1WT5C 4N1EA 2E7HA 5HHOE 1R3IH 3CZJA 4X0KA 4RNRB 2CKBA 4S1QL 3FHQA 3W0WB 4RGMB 2R15A 3NZHL 5EBWA 3MLWH 4GW5A 1ZHKA 4P4KA 2NTFB 1QLRA 2X05A 3WMSA 4D3CH 1XR9A 1LEGB 2PUQT 4U1JB 5EZIL 1T20A 3O11A 3ULUH 1CD1B 5CKAA 2UVFA 2AS5M 2YMXH 1G7HA 1KELH 1CGSL 4XWOC 3S4SA 4X6DF 4AQ1B 3JBG7 2WNGA 1N3NA 1LILA 2ZCHL 4ODTH 3WIFB 5ESQB 5DEFB 1NFKA 1G9ML 4X5LA 4HIIA 2H3NA 5TDOB 1EAPA 1A6TA 2E27L 2DQEH 3MV8D 1LO5A 4OZGA 1U8LB 2FHCA 4K7PH 1ETZB 4KKLD 3X13A 1JHLH 1S9YB 4UOW0 4HPYL 1RK1B 3W39B 4Y2DA 4LSQL 1V8HA 3OBAA 5KVEL 1RQ5A 5KVGH 1CD9B 4EUPH 5JPMB 5I2IB 2Z93A 1Q9LB 2ZSVB 4G8IB 4LSSL 4DN4H 4BELD 1IARB 2YKLH 2IC2A 2C3VA 2PO6C 1Z6JT 3HFML 5KJRH 2CO6B 4RFEB 3S4SG 1QRNE 3LV3A 3QWOB 2M8XA 1H3UA 5EOCL 2IAMB 3FN3A 5ADOH 1RZJH 5E08L 5I76B 1PZ5A 4MQXC 1JIBA 3EYUH 4RRPA 3HI1A 3QPXL 4QCIA 4RQQB 3NTCL 4MYWB 3HE7A 2HLAB 3F12A 1J05B 4OGYH 1IKFL 1KPRB 4HWNA 1N2RB 4Y1AD 3WFBH 2ZNXA 4WI2A 4WUUE 2K1MA 1CFBA 5HDQH 2R56H 4J1UA 1CICA 4L3AA 1HINH 5J13B 2BSED 1S7SB 1DQDL 3U2SB 1FN4A 3BH9A 1J0IA 5F6HJ 5GRUL 5GGSA 2GK0B 5F7KC 5JW5B 1MVUA 4GAJL 4M02A 4U3HA 3DIFB 4JFDA 2XA8L 3BEWA 4QHMB 5KVMC 4TULL 2DKMA 1MCWM 1Q9WB 3R1GL 1IGYA 4JKPH 4ZMAT 1I9IL 3AMKA 4DEPB 4XNZB 3ISWA 3OTTA 1AGDB 3MXVL 5GGQH 5C0NC 1KB5L 1NBYA 1KIRA 4MAYC 4NZRH 3VXUD 4LLMB 5B4MD 1NFDB 4WHYH 5MENA 1QSFB 3MJ8B 1WIUA 3TJHC 4XBEL 4OM1H 3N0PB 4KXZI 5I9QB 1AKJB 3K2UH 4V2BA 4XPTH 3FO1B 5IGXH 3LMJH 1AXIB 1FL5A 2HLFC 1DEEA 5DQ9A 3RZCC 3MROB 3CIQA 2LE9A 4HFWB 2COQA 3MTRA 3GSOB 3DPBA 5DJAB 5HI3D 4XPGL 5DJ6A 5HHXL 4JZNA 1YN6A 5TPWH 1AGFA 4F7EB 3NZ8A 3GSVA 4P2OC 4Z8FH 5AUMA 4AH2B 4KHTL 2E7BA 4OLUL 4M62L 4NHCL 5D8JH 3TBVB 3FT4A 1UADC 4K3EL 2O5YL 1S7RA 3PGCB 3LEYL 4XT1C 2XIDA 1I8KA 4FQJL 1GJIA 5DXWA 5IVOA 1IGIL 1CFNB 3EO0B 4MB4A 3VDAA 5I1KL 1LP9F 4PP2B 4Q9RH 4XVSL 1F6AA 3PDGA 4UILL 3VXSB 5DUBA 3NPSC 4NKDB 4N8PA 5H8DA 2W59A 3O6LH 4RMSA 3TO4B 1UYWL 3IDNA 3I2CH 3BRDA 5I74C 1CU4L 1ZWIA 5EU7C 3IU4H 4BSWA 1TJHH 4MCZB 4AMKH 3C2AL 3EOAA 5IB5A 3TJEL 5ISZA 1NH6A 4PJGB 1YMMA 2X1QA 3KDMA 3M8OL 5GGVL 1K6QH 4WCYH 2IF7A 3ZL4H 1KG0A 2CLZA 2XY1A 1KTLB 4EBQL 4PRDA 3D1MC 3SGDI 2VDOH 3BD5A 4NZJA 3RDTD 4E0RB 3EYVB 3V5HA 1OGAB 4XP5L 1DQTA 5E99H 4RAHA 5IROC 1FFRA 1X5ZA 1YPZE 4L5FH 2G9HA 1QSEB 3C60B 4MA7L 4LVHC 5FM8A 3GK8H 1EO8L 4JG1H 2KKQA 3REVA 1GL4B 5D1QC 2ICEA 1DANU 2NX5B 1JZ2A 2NTSP 3M1BA 1CG9B 5I1CH 5MENE 2H32A 3TF7C 4P2QB 3K74B 3O2VH 5D2LF 1AR1D 2O5XH 3CXDL 4O5LH 1AQKL 4L4TE 1YEHL 4WI5A 3PWPA 2Y9RT 5DRZB 1YEKL 1W8OA 1K8DB 1U2CA 1GOHA 3OAZH 2CDEA 2AJYL 3O6KL 3MOAH 3S36X 4GRLA 2W0KA 3G04A 3PDOA 5FECA 1E6OL 1RIVH 5LBSL 3VXOA 3JWOL 4RMVA 4DKFH 3LH2L 5I8EB 1QBML 4JO2L 4OZHF 1CR9L 2VC2L 4PUBH 5F1NA 2JJSA 3QIWC 2BFVL 1FZOA 3KWWA 4S0SD 4NRXA 3NN8B 4U3CA 1ZS8A 2BRRL 4WV1A 5BZDA 1EA9C 4PREA 2JTDA 1NCWH 1A3LL 5JIHA 3EGSB 5F8RC 1WLHA 3BQUC 1VFBB 2PYFB 1BOGB 3VFUB 1NMCB 3K4DA 5DJYB 1HDMA 4OFYD 3Q5YA 1A6VH 4Y16A 1E28A 5M94B 5D1XB 3JWDC 1MPAL 5FM4A 2ORBH 3S37X 1YNKL 4M6AA 3B43A 3BRGC 2X7LB 1P7QD 4MA1C 3KPRB 5C0CB 4F37K 2BVQB 1W0WB 4MNQB 3FQTB 4ZUVB 4M5ZH 3CSBA 5DJDA 3H6JA 1I7ZB 2BY2A 3OB8A 5I1HL 3D85D 4L9LB 3FB5B 1I8MA 3MCLH 4KC3B 4P3DA 4QRPD 3GMLB 1YA5A 3FFDB 3HMWH 4DQOH 4N90E 2CRMA 1ZT4B 3MRJB 4OGXL 4YDVA 4XGZB 4JDVB 4HIHA 2BDNH 3MRHB 2BSSA 3SKOA 1BHGA 1RIHL 15C8H 1IAIM 1QHOA 1T0NA 1EJ6A 4ALAH 5H94A 3ULSB 1TVBA 1F3DJ 3PWPE 4O2CA 3DGCR 3B9VA 4LHUD 1XH3A 5IMMA 3ROOB 3QXWA 1F6FB 4JRWA 2OBGA 1J18A 4JRYA 3QWRA 2W38A 4X80L 3VFOA 4ZFZB 4QGTA 3UTZA 4N9GB 2CJUH 4YR6A 4WVRA 2R1WB 1ZA3B 1EHAA 4XCYA 3WD5L 4F3FB 4IRSC 4HIXH 3U1SH 3ZDXF 1EK3A 1IAII 1W0VB 2JK5A 2Y5EA 4LDEB 4OCRL 4LCYB 35C8H 5IR1A 1NGYB 4S1DD 3KPSD 3WFCH 4HS3B 1WEJH 1GZQA 3CLEL 5C0DA 1KC5L 3BWAA 3NIDE 4OF3A 3QH3B 1WFTA 1I3VA 2H8PB 2FR4A 3ARGD 2DKSA 5FO9B 1T03L 2VERN 3ET9F 2ITDB 5F8QC 3BXNA 5SX4I 3RUGA 4BQ9A 5AG8A 4F8TA 1XF3A 2ZWLT 3ILQC 4XWGL 2O61B 1UC6A 2GFBA 3QUMH 3BZEB 4N1CA 5EU6D 5JQHC 1K8IB 1WITA 4AENA 4HZLB 4R0LC 2FO4A 4DZ8A 4LASH 3MODH 4F9LC 4NO0B 2HFFB 3QPQC 1I9EA 1JNJA 1P7KB 2D3VA 5BOPA 3JXAA 3VWKD 4G6MH 4KMTL 4P5TC 3RVUD 4KUCD 3H2WA 1D7FA 5CMAA 5IVZB 3HRZB 4HGMA 5F3BB 2PXYA 1XIWD 4NBXB 3TZVC 1WT5A 5F7DA 1EEZA 3DBXA 3BPCA 1DQQA 1MAKA 4ONHA 1WCBA 1NCDH 5D93C 4IEFB 1IC5H 2NXYB 4U6YA 4KUCF 3TA3C 1PD6A 3S36H 1VEPA 4POYA 4LVOB 4CN4A 5E8EB 1KJ2A 5DJ0A 5C09B 1D9KD 3SE4C 3UP1A 5IW1A 2CUIA 2WINA 3VFMA 4OUUA 4OGAD 3VFTA 3HCVA 2VWEC 3V4VL 5FK9B 1RJCA 3KYAA 3MNWB 3BPNB 3MSPA 2APVA 4G43A 5CJXC 5GHWL 4K3JL 3GSWB 4OT1L 4M7JH 2NY0C 2VLRB 5E2TH 4FQIH 4PJAF 3DX9A 4A6YH 1LNUB 4YWGH 4ONGH 3V5DB 3MRCB 1JE6A 2B0SL 3VFPA 4M6NH 4LCIL 5EC1B 3VRIB 5ENWA 2FYYA 3QG7H 3OKDB 4G80A 3UTSD 3DETD 4JZJB 3RWEA 2WWMC 3I6KA 1KNOA 2LAGB 3VXRB 4KQ4L 4NQSA 1B0GA 4GG6A 4LKXB 4HH8A 4HWBL 1IAKB 2SEBB 3L1OL 4U6VL 3RUGE 1P5UA 4WI4A 2EDKA 4YFLF 4GG8B 4Z7UA 3S37H 5EU5A 5A2JH 3IFNL 2PO6A 2OK0L 1D5MA 4MNHA 5DS8B 2JB5H 2Q76B 4MB5A 5DQJB 2HRPH 5F9JA 4ETQB 5FGSA 4J6RL 4I0PA 4TVSa 3KR3H 1KTDA 2VSCA 4V1DB 4HJ0C 4JN2B 4MD4B 1DBML 3DYMA 2ZUUA 5IMOA 2VLKD 4MXWL 1XF4B 2E6PA 2F74B 4NJ9L 4AEHL 3TBYA 2YC1B 2FJHA 2J7LA 1BFSA 5F9DC 5IJKA 5L2KB 5BO1L 1V3KA 4OFIA 1QSZA 2CMRL 3F58H 3OAYK 4LU5L 3P9LA 3VFWB 4CJ1A 3O2WH 2A83A 1T0MA 1IM3A 1QSFE 1QD0A 5CBEA 4EJ1C 2DQDH 4RISL 4YHIB 2FEEI 3MX0A 4QOKA 3ZT6A 2VN4A 2J6EH 1AXTH 4MLSA 2CIKA 4WFED 4JQVA 4GBXB 3HNSH 1JWSB 4WTXA 1VGKA 1U41A 3PJSA 4WFFE 4PJDA 2DLFH 1JMXA 5TFSL 4R4FH 4PB9H 2AXHA 4ZYKA 1YYML 3MRMA 3IDYB 4Z7VA 1TJGL 3D2UD 4MAYA 3DVNB 1IGTA 1Z0NA 4G9DA 4GW4A 2VAAB 1F90H 7FABL 1AJ7H 2CPCA 1J10A 4XCCL 5HHPB 1T1WA 3BISA 2FATL 1B4JH 4E41A 3MCKB 4DUVA 3VXSE 4UB0L 3RZCA 5LXGL 1A1OA 4I3SH 3Q48A 5CCKH 4GG6E 1M6OB 4JPIA 4I18C 5IMLA 2DQIL 1LO3H 2H6PA 2V9TA 3ZE2F 4WO4C 4XH2B 2HH0L 2P8MA 2BNUB 5DMIL 5ETUB 2QKIB 2VXQL 3Q1SH 4NCC1 3RWFB 5GS0C 3U30B 1EMTH 5DHVA 3OSKA 3MLXH 4ZDHB 1EFXA 1OGAE 2E3VA 2GJ6D 2VR5A 3PGDB 4U1IB 3FMGL 5KZCD 1V3MA 1QSEE 3PHQB 4GSDL 1W72A 7CGTA 5AD0B 4Q6YA 4UOJA 5F1IA 3REWA 4OLWL 5JUEH 2C1OB 4HFUH 2YBRB 4FZ8H 3DLQR 3AREC 4KAQL 2BVTA 1TLKA 4ODUA 4EIZC 4TPRH 3ZHLA 5CWSA 1JN6A 3P11L 4HWZA 1A22B 1RZFH 4Z7WA 1Z9SA 5C08B 2C7UA 4ZUWA 1DR9A 2UZXB 2V2XB 4U1KA 3UX9B 1YN7B 4PJ8D 4HLZH 5ITFA 4XB7A 3TNNB 3P0GB 2J8OA 1F4YH 2N7BA 2Y07H 4EOWH 3CH1A 4Q6IA 2C1PB 3FO9A 2O93L 4JRXB 2DRUA 3UPRA 3FO2A 4QWWC 5EZLB 3UYOD 5INDB 4FRWA 2DDQL 3WE6B 1K9TA 1HOCA 3LEXB 4JFED 5DD0H 1F3DH 1OD7A 1K3ZA 2NZIA 1XGUA 2XWTA 3MO1A 4XC1L 1CFSB 1MCKA 1T1YB 3RVVD 3VFSA 1JNNH 2BXYA 3GJFA 3IDGB 5E70A 3VXQB 1ZE3C 1G84A 2B2XH 2GYSA 1VENA 2YUVA 5IQ9B 4PRAA 5T3XE 5E2WH 4JPVH 1TQCB 3ZKMC 1RHFA 4U33A 2OJEA 4E41E 2LFGA 4XP1L 4X6FA 3BFOA 2FO1A 2R1XB 4IOFD 5IFAH 1RULL 3UJJH 5LGJA 1NMAH 3WHXB 1MI5B 1U36A 4OCWL 4WNQA 5I30H 4DCQA 5IJVA 4PRNB 4GUPA 5BV7B 5C0AE 3I9GL 1VPOL 1U91B 1ED3A 5F9OH 1YEIH 4JJ5B 3DURB 3UJTL 2VABB 5DC9B 5F7NC 4BSVA 1CD0A 2CKBL 3O3DA 3EOYG 1KT2B 4R2GB 2DBLH 3GUTA 1TITA 2AEPL 2QBWA 3JTTB 3V4UL 1JGDA 5HHQA 3WDHA 1NJ9A 4RAVA 2UY7A 3KPRE 2Z9TA 3U6RA 5C0CE 5F96H 3CGTA 3QIWA 4MNQE 1BEYH 1WAAF 4M1GH 2AK4D 1TTFA 2NYYC 2PETA 4Z7NF 4QTIH 1BBJA 1HQRA 1S9VA 2Z31D 4TSAL 3NA9L 3BP7A 5CEZH 4LSUL 1K85A 5L0QC 4KJQD 3BT2L 1JGLH 1JK8A 1SMOA 1AP2B 4G42A 3OKMA 3HE6B 3QEQA 3WFHB 5JW3H 2WBJB 4YJZL 3O8XD 1H0DB 1U6AL 2CDFA 2OJZL 3GGWA 1JPST 1XR8A 4Z7WE 1IBGL 2P44B 1JPSL 4XNXH 4GQ9L 4HUWA 4MJID 4YHPA 5EO0A 5CJ8A 3PWVB 1DBJL 4PRID 4WU7B 4XMKL 3ROLB 3CU7A 1FPTL 2K7QA 1IC1A 3MGOA 3CFEB 3GMPA 5GRWA 4P9MH 3STZB 1CF8H 5HHNB 2XFXB 3QIUB 4OLZH 1KJMA 3Q6GH 4XPHH 3RVXD 4L3CB 5ACMA 5TE6L 4LK4A 3ARUA 2XQYG 3EOTL 3IF1B 5IIEA 1HILA 4L8SC 3QFDA 25C8H 4P3CH 1CFTA 1LEKA 2M2DA 4CDGC 4PJ9D 3P0YH 4JHWH 4ZFOB 4RFOH 4X5WA 5HGDB 4YXLL 3HPJB 4MVBC 4HD9A 4KKNA 5BS0B 3QNZA 1A4JA 4AJ0A 1XGPA 1WF5A 5JNYA 3NMEA 1A7OH 4U2ZA 4X7SH 4GKNA 1DN0A 1D5XB 1HCFX 2KQNA 2NY3D 3DGGA 4Y5VB 1IGFH 4G9FA 4IS6B 4YDIH 4ZPVB 4KQ3L 4R26H 5MEPB 4Y19A 2R1YA 5EZOL 4IRSA 1I1YB 1IC7H 5E9DB 4HGWB 1WBZB 3QO0A 3SE8L 3OKOA 2BNQA 3LDBC 4NZTL 4DK3A 5JPNB 3MLRL 2OXGA 1FGVL 3QSKB 4PJ5A 1ES0A 1CFVL 2IH3A 1CLYH 4OGZA 3WXVL 2BCKB 1S7XB 5JXED 2NY1B 1IZKA 3B8SA 1Q1JL 3TN0B 3EHBC 4RFNB 5F72S 2OP4H 3U0PB 2GT9A 4ORGA 4P23D 3ZKNC 4OIIL 3V4PH 3ZDZF 5IF0B 3BO8A 3JZ7A 1A7NL 2ZUQB 4M5YH 5DJ2A 5IBUB 3T65B 4NN5C 1JZ3A 5L8JB 1WZMA 5IW6A 2AABH 2W60A 5D6CA 4JFOB 4Z9KB 2P8PB 4PY8I 1M05B 4PRPA 3KJ6H 4HW6A 4RIRB 1I85C 3RA7H 4HXBH 3V52L 4R0LA 4YGVB 1GOGA 4JDZB 4F9LA 4MZ3A 3FQUB 5BJTB 5DT1H 3P3YA 1VEOA 4Q9QL 1HQ4B 5HVHC 5C09E 2EO1A 5KSVB 4NO5A 4P5TA 3N1GC 1CZ8H 3ZYZA 5SWZA 2O5ZH 4HJGB 3CC5B 3LN4A 4JREC 2WMPA 4U49A 1HHHB 1I7RA 4PRHB 2PTTB 5JW4M 1UWEH 2OL3A 4IDJL 4NNYB 1UKQA 5FUCE 4WU5B 4RWYH 2VLRE 2RQ8A 5ID1B 1JP5A 3T0VA 3TZVA 1O7VA 3BIKB 5FUOH 5GPRA 3KPMA 5J1AB 1U8NB 1FBIL 1ADQA 4LAQL 3B9KD 1T21B 4QRSB 2HVJB 3UZVB 1UXWA 1YQVH 4G9FE 3BKYL 1JV5B 1OGTA 4OFVA 4UIMB 4HCRL 4JHAL 4Y19E 2EE2A 3D6GA 3SE4A 1I7TA 2CDGA 4TNVF 3DX6B 3C5ZC 2MFNA 2AI0L 3IVKA 1DBBL 4CN6A 4N8CL 5HGHA 1R3LA 3FT3B 3PWUA 3KYOB 4FOMA 4KKBD 4X6CF 1MAMH 2AXFA 4NM4H 1JHKL 3LD8C 3INUL 2ATPA 3ALWA 3ELAT 5HYQB 4HK0B 3IDUA 1S7WB 4XI5D 3S35X 1YEFH 1L0QA 1P2CB 3OAZK 1ORSB 5JXAH 4I2XB 1JTTA 1LK2B 3QQ9C 1RD6A 3IAGC 4XC3L 3OR7A 5D7IF 4UTBL 2OMNA 43CAA 4G6JH 1AIFB 4LPCA 4ZXBC 4F80A 1XGYH 2DWDA 3MRKA 2A0LC 5L2KE 1MQKH 1Q0YL 3C6SB 4Q9CA 2D31B 3QDJD 3ULVC 3LVEA 4X4XB 2DQJL 1INQA 3DUUB 3V5KB 5MEOB 1CBVH 4OZIB 1JHTA 1KFAH 5TF1H 4YZFF 1ZHLB 1PQZB 2YD4A 3TGXA 5A43C 4MXQD 1HIMH 4ZFGH 4X4YA 3U4BH 1IGCL 2FJGA 4YNYA 3O81A 4S2SA 5FYLH 3EDKA 5CIPB 3C5SA 3PP4H 1X4ZA 1RSFA 4XBGA 1J0KA 1PG7W 5DHYA 1LO2L 4PLKC 3ARDD 5EO1B 4XVJH 5D7LD 5CP3A 2GUOB 2W0FB 3QRGL 4JQIH 4PLJD 2P46B 1V7ML 4LFHD 5SWZE 1M4KA 4OI8A 4FTVD 5E5MA 5CJ5A 2JIXA 3CD4A 1UZ8B 4JO3H 1ZGLM 1J1PL 3WS6C 3TM6A 4RBPH 4FXLA 5ID0A 3MA7A 1DVFC 3RKDC 3PHOB 5TDPA 4CVXB 3SKNA 1NGWA 1P6AB 4LDLB 4XCEB 4XPBL 3U4EB 1AD9B 1JGVL 1HSBB 1Z2KA 4OD2A 2ED7A 5K9JH 1JPFA 2QADC 3CSYA 1OLLA 2V7HA 3C09C 4KJYB 2VWEE 3AU1A 2KL6A 5BRZB 2ENSA 2EC9T 1AHWB 3QDMB 1MHPL 5EIIB 4AEFA 1KXQE 3MGAA 1WWWX 1YJDH 1FJ1B 1DUYA 1NQBA 1B4RA 1J8HA 4UQ3B 2H41A 1LO4L 4Z5RB 1JI1A 3MLZH 4KPHL 4LKCA 1KIPB 4Y4FC 3QEUA 5HGAB 3X11B 1R5IB 1KPUB 3DHJA 3TT1H 5F1OB 5C0GA 1MY5A 3ARSA 3JSSA 1HH6A 1HXYA 4K71C 5C3TA 1C1EH 2R4RH 2BVPB 3N9GL 2V5YA 5GS2D 3HR5B 4D9QD 1QPXA 4ZQKB 2VDNH 1RZJC 1PFCA 1V3JA 4YBLC 2YD9A 5C08E 1QFUH 3C08H 2APBA 5DO2C 1YUHA 1FO0B 1H5BC 3UBXI 3RJQB 1AY1H 5DTFB 3TBSA 4TTDC 5EUOF 2IANA 2BC4B 2Y72A 3QI9D 2AAVA 3NFPB 3QUZB 2HJFA 5JO5B 1ND0B 2VJXA 4OCNC 2Q87A 4HX1A 4GAFB 4OZ4A 4JRXE 3PQYA 1CL7H 5DRXA 5I8OH 1H15B 4M4RA 3SDAA 3QHFH 1UB6B 2XICA 3VD9A 4HT1L 2FX9H 2C3WA 3ZTNL 4R7NA 5EULV 3AREA 3B2VL 3HG1A 4UAOB 2VO5A 2Q7YA 2NY4D 3CVIL 3MLTA 5GISH 2FX7H 3FB6B 3IB4A 1A7PL 5TF0A 3LZFL 2QR0A 1RUKL 2CLVB 4HUMB 2BY1A 2G60L 1MI5E 1UWGL 3NFNA 1MFNA 2X09A 5ILTL 3QDHA 3ZHDA 2KBGA 4QRTB 3O2DH 4ONFH 1XZ0A 4IMLB 3E6FB 1WBYA 1SY6H 4P5KB 1YMHA 4PRBA 2JCCA 2MPAH 5B3NA 3BN3B 5C0EB 2EDBA 3ZLQC 5IG7A 3SDYL 1RJYB 1UA6H 2XRAH 4MDIA 3SE9L 3SOBH 1LEIA 3S35H 3Q5TA 4GAGL 2ICWI 3H7BA 5JOEA 1PEZA 4M7KH 3LQMA 5FYKL 4WI7A 3TYGL 5KSAA 1A7RH 4KKLC 2AXGB 1MHEB 1U8OA 3VW3H 1CIDA 2WSKA 4P0DA 3MLVH 5I1IL 2LU4A 5IVXB 5EG6C 1MOEA 3V0AC 4HIJB 3E3QE 5I75B 4OCLC 1GXEA 4O58L 5JOFA 3HI6L 2VN7A 3X3GH 5CILL 5DSCB 3P4OA 3WFEH 4MWFB 4ZO8A 1JZ7A 1DQJB 1CDHA 4L9DA 3VGAC 4PJCA 5FB8B 3LEVL 5F3HA 2Z92A 1HCVA 2VDLH 4HF5L 4EUPB 3BJ91 1KJ2L 4LF3B 2NY5L 4Y5YB 5FHBH 5BXFB 5C7XH 1AQDA 5MP6H 5C07A 3ARFB 1MFCH 4Q58C 3BN9C 3ZDYE 4YX2L 1IGJA 4WUUD 1OAQH 3TV3L 4NQCB 2EKSB 3HS0A 1GGYA 1EFQA 4M7LH 3HLAB 4EQ3A 1NDGB 1NCBL 4K23L 4JFFB 4APQB 2FH8A 1H3TA 1IT9L 4EDWH 1ORQA 3E0GA 2DTMH 1G0XA 3RKPA 4P4KD 1VADA 2ARJB 1LGVA 5A3IC 5F7YC 4NBZB 5BS0E 3WHE1 2NLJA 5GS1C 2VLLB 2IH1B 5IMKA 2YWZA 1K3IA 1NCNA 1H8SA 1UM5H 1GPOH 3SO5A 4OFKA 3UZEA 1QLFA 3S96A 1EO5A 4W70A 4AIXA 1AXSA 5E9DE 3SCMB 5B4MC 2AV1B 4L8SA 1KCUH 3PXJA 3V79C 5KVDL 5FO8A 1A6WL 1FYTB 1A2YA 3V6ZA 1GGIL 4Y88A 2FB4L 4IDLA 1GHFH 3T0EB 4KY1L 5CGMA 1REIA 1F58L 1QNZH 4HWEH 5GGVY 4OI9A 1OTTD 2H26A 1F45A 1T3FB 1I3GH 3BVNA 1ZA6B 5IM7B 4LHJB 4RX4A 5FA4B 2I5YH 5HI3C 3TT3L 4NQXB 3MRBB 2FGZA 3BAEL 5DVKA 1IFHH 5H2BA 3MREA 3KLHD 1B0WA 3ES6B 2HN7B 3BDBA 4TVPE 3VXTA 4GXUM 1BD2B 2BVOB 3GNMH 3MJ9H 1G7JB 5EC2A 2DQCH 3M07A 1C5DA 4U1GB 2DMKA 1XMWA 1JZ4A 3OB0H 4MZ2A 3MGTA 4UINH 4PB0H 5DK0A 3HNTL 2ADFH 3Q6FA 3MYJB 4C56A 3WJJA 1HZHL 5C07E 4WFHE 1UM6L 2EE9A 1T5XB 2ESVA 3FQXB 3GSXA 1EHLL 1F2QA 4LQFL 1NGQH 4X8XA 4E5XA 3RGVD 4H8WL 4JN1L 1S9XB 5DJCA 4M8VA 4TSBH 1RFDH 3L95B 3LKQA 2VXVL 1P1ZB 4K2UH 5J3HD 3L7FB 5L7XH 5T3XL 3GSNB 3OAUL 1A14L 2R0LL 3RDTC 4MA8H 2H1PL 4MJ4A 4ODSH 5F7FA 2E8ZA 4PLNC 4DFIA 2OI9B 1T2QH 4KZEH 2C3GA 2W0LA 3KHQA 3KPPB 1OP5H 1OW0C 4JDTL 5D2NB 1EVUA 1ZLSL 1I3RA 1NAMH 1P4BL 1NC2B 1MIMH 1N8ZB 2B1HH 5D72L 5HJ3B 3RHWF 5HDOA 5MEND 2GAZB 4WENB 5KVFL 3C6LB 4F2MB 1YPZF 2XKNA 1N4XH 3CFKB 1OSPL 1AR1C 2FIKB 3P40A 4L4TD 2BSRA 1QO3B 5E8OA 4PV8A 4LP4A 4PY8J 4Z95L 1MWAH 4FFYH 1U8JA 4KHXH 3EFDL 5LWYH 4OD3L 1W72L 5FYJE 3FB7A 1VACB 4HKJA 4I2XE 4XP4H 4OAWB 2BNRA 3RBGA 2HKHH 2DI9A 2QQLH 3H3PH 1QFWL 5D7JB 5LGHL 1KCLA 4NUGH 3C5ZA 1QKZH 1G6RA 1CT8A 1ZHNA 3TCLA 3SDDD 3WIHH 4QXUL 2OR7A 32C2A 2MMXA 4P2OB 4H1LA 2IQ9L 1Z3GL 3RNKB 1UG9A 4HDIB 1IQWH 3FN9A 3T04D 1CK0H 4OJFH 3J7HA 1G7MB 1MFAH 1LE5B 2GSIA 1JUFA 4M93C 1GAFH 1KENL 5KANI 4QXGL 3BKML 4XRCA 3MACL 4NC0B 4MJ5A 5AYUH 5SWQA 4NSKB 2H9GB 1UJ3B 1FORH 1F4XH 1SM3H 3F7VB 1OB1A 2E9IA 1NBZB 3PXHA 1A0QH 2JE8A 3G6AB 4JANA 2IQAB 3VA6A 1RJZA 1NSNL 2PYEB 1HNGA 3O3BB 4F15B 3PIQA 4KKCD 3DO7A 2EXYC 2EECA 4ZD3H 3BP6A 4F57H 4ZUSB 4HIEA 5KW9L 3WNPA 3CLFH 4Z76B 3QIBD 1EO7A 3WSQH 4H1LG 3FAXA 5JR1H 3K1DA 4JO1L 3VFNB 4N90D 1U3HB 4X4MA 1K4CB 5E4EC 3VCLB 3BH8B 4HUVA 2NZ9D 4M6OH 4NRYB 2ADJA 1RZKH 4ISVA 1CTOA 3HUJB 1U8HA 3DWTA 4PJ7A 4BH7B 2L7UA 1ACYH 2OXHA 2YD6A 3A67H 4KV5E 4BUGA 4DKAA 3IGAA 2X1OA 5D1QB 4ZUTB 3V6OC 3WS6A 5E2VH 1DVFA 4QLRA 5E0QA 3SY0B 4OM0L 4YDKH 3KS0J 4JGJA 5D9SB 5CEXB 3MLPA 3BUYB 3ESUF 1L0XA 4Y4KA 5FCSH 1MCWW 4GAYB 5LGKA 1JYVA 2VKXA 2VLJB 3UXFA 3HMXA 1A3QA 4AIZA 4LEXL 3WL9B 5FF6B 1KIUA 3IJSA 4NBYB 3B9DA 4DKEH 1NL0H 4EN3D 5IQ7H 2J5LB 4N0YL 2A9ML 3X14A 4LLVB 4S1DC 4XNYH 4HC1H 3DX8B 4HQQH 3VXMA 1MIEL 1C7SA 1MAJA 2CR3A 3KYMB 4GMTH 3A6CL 4IRZH 3O6FA 3GB7A 2Z35A 4ZOBA 4Y8AA 3W9EA 2ZUSA 2IFFL 1MY7A 4HUUA 4X6BA 3ARGC 5DA0B 1WZLA 1FL6A 3TH4T 3T0DA 1ERNA 5T1LA 5AZ2L 1FIGL 3MV7A 2XWBB 3FO0H 4NFDA 5J6GA 2AJ3B 4JY5L 1A6ZA 2F53A 4ESKA 3HR6A 3NIDF 3TIDA 2GTWA 3BQUB 1I8LC 4BFIB 5C8JB 1WGOA 3DXAA 3OJDA 4YLQT 1BVZA 1P4LB 4I5BB 2XG5A 4MJ2A 1CLCA 3MLUL 1H5BA 4PG9A 1N0XL 1ZTXH 4X4ME 3I3BA 3U36A 3VWKC 4MA1B 4LSPH 3RY4A 1A4KA 1NCAL 5J12C 4UTAL 1U8MA 3OXRA 1MHCA 3FT2B 4EUPG 3RVUC 1DLFL 1V7NL 3L7EB 3BE1L 1DTUA 4AIOA 1INDH 3QG6A 1XIWC 2FWOA 2OZ4H 4NDMB 4DUXA 4GRMB 2ZCLL 5B39B 1HWGB 1JPGA 2I07B 3CMOL 3BW9A 2X2YA 4W6WB 1CTNA 4X6DA 3DROB 3ULUE 1P4IH 1PG7L 4KTEH 2YEZA 5DI8B 4QHKI 1QR1A 5TH2A 1KLGA 4PJIA 4NCDA 1KEGH 3JUYA 2HJKB 3GHBH 3VWJA 4HKXA 4JVWA 2NCMA 5IVXE 1I1AB 4PYHA 4D9RE 4OGAC 4NM8H 5FKAB 5HVWA 1RY7B 3VRJA 4L8DA 5TJWK 2F58H 2XZAH 3U0WL 2BMKB 5DD3L 4R97C 1KPVA 3G5YB 4ENED 2ZOKA 4DGYH 3D69A 1SJHA 2IAMD 3VXME 3WN5B 2BOBB 5K9KB 5KG9A 5E1AB 2GSGA 4F7TB 2D03H 1S7UA 3MV8A 3DETC 4GXUN 4F7CA 4MCYB 2EYSB 3FONB 1VFMA 4JY4A 3IDXH 5EBMB 5EWIL 1KB9J 2HVKB 2HKFL 4N0UA 5E2UH 5IT2L 3EYOB 4NQCE 3GBMH 1KGCE 3FN0H 4BFBD 3QUKA 1J5OL 3DXAE 5FDYA 2D7PA 5EORL 3O6ML 4GRWH 3G5ZA 4JFFE 4TUJB 3RIFF 1ADQL 5SWSB 4RZCA 3CFBA 1K4DB 1D6VL 2MKWA 5T33H 3SEPA 2IALA 3OKNB 4GMSL 4S11A 3RUGF 3S88L 5GJTL 3P30H 4HHAA 2ICWJ 3MBXH 4WJ5A 1A7QH 1FNGA 2FL5B 3B6SB 1RJLA 1VFAA 3QEGH 5GGRA 2NY6C 4M48L 4LIQH 5TQ2L 5I17A 4KUZL 4P9HH 4Y1AA 1BECA 3V6BR 1QSFD 1SYVA 4LCWA 4Y4HB 1GGUA 1AKJD 1FYTE 1LD9A 1U8IB 4PR5A 4OQTH 3UYPA 4LLUB 3GSRA 4HUNB 2A74B 3TPUB 1UEYA 2IPTL 4WW2C 3T0EE 2E9WA 4PJIE 3MNVB 3UC0L 3B3IA 3O4LA 4H88H 5GS1A 2EE6A 1RUPL 1U8KB 3P4NB 3DVFA 3MYZA 5FHAH 4YO0B 3HC4L 3TA3B 1WTLA 4RBPK 3VXUA 1EJOH 1BD2E 4S1QH 3RY5A 4TQEH 3OKLA 4I3GA 1A8JH 4M1DL 4HMEA 4NYLA 1G7PA 4XCFL 3OJMB 3WS3A 3VXSD 4U1NA 1FFNA 1AD0B 5IBTH 3AS2A 3HN3A 3MA9L 3TO4D 1RI8A 2DYPA 1U58B 4YHLL 1JF1B 1VDGA 3CFDB 4OFDA 4ZSOA 4ZNEA 1LP9A 3KPLB 2YXFA 4DVBB 2Z8VC 3JUZA 5AYQA 4I0PD 1OL0A 2Z8RA 5CHNA 4GG6F 2R8SL 1JNLL 4NN7C 6FABH 5IHZA 1OGAD 5HYIA 5CAYB 2FZ3B 4HBQA 3IFPA 3IFOB 3WV0A 2A9NH 1JZ6A 1QVOA 3LKSA 1QSED 3C60D 3I02B 1NBQA 4R7DA 4Z6AT 1K2DB 2LTQB 3QCVL 4MMZC 5E00A 1CGYA 5D2NE 4LSSH 4NN6C 1J87A 3ME0A 1LK3H 1Y18A 3HFMH 2V2WB 4YHKL 4F7PB 4ZUUA 3RWIA 1WWCA 4R4BA 8FABB 3GIZL 3QXVA 1MLCA 2BXZA 4LCWE 1RK0B 4P2RA 1YEDB 5B38B 3MFFA 1B0RB 1R3JB 4GKOA 1WWAX 1HXMB 4M8QA 4PJ8C 2RAMA 3RDTA 3D3VB 5ICZB 4HUKB 5LCVL 3X12A 1XCQA 3IT8D 4ZAKB 3O4LE 4YAQA 1UCTA 4PD4J 4DGVH 1J11A 1BQLL 1IKFH 1OW0A 4H20H 4PJXB 1GGCL 4UDUA 3ZZ1A 4M1CD 4XVTL 3MBEB 1RHHA 4WW1B 4BYHA 1MF2H 5B8CB 1R3KA 1JPTL 5DEGB 1C16A 1KF9B 2AW2A 1CQKA 4OLXL 2FGWL 5GS0L 4OB5L 3RVVC 3BGAA 1T7VA 3KS0H 4OBRA 5I16B 4EVNA 1L7IL 5IOPA 3IETA 2DMBA 5T3XD 4LOUD 4DN3H 5I1EL 5GRUH 2HYMA 4RCAA 1M7DB 4E41D 1OAXL 3VJ6A 2Y7QA 1EZVX 3LRSA 4YEEA 3QFJB 4XTRD 3CUPB 1IGMH 5T1MA 1G7IA 1I9IH 5J9PA 5C0AD 2Y5TB 2E7LC 3DVGA 3L5IA 5AWNH 3U7WL 3U9PL 3MXVH 4FP8H 1KB5H 4GS7C 2JF1A 2VL5A 4HKBB 5D1XD 1J0ZA 2PYEE 9CGTA 1YNLL 4WI3A 5IB2A 5DDHB 4WWKA 3PV6A 5E94A 5CUSL 3KPRD 3RWCA 3GJEA 3D0LA 4I18B 4ZFOL 5C0CD 1EFXD 4MNQD 4WO4B 5EBLA 1B9ZA 3VDCA 1LHZA 2FSEA 4XPGH 4ZS6D 4QRUB 5INCA 5HHXH 1P9MC 1KLUB 2Z31C 4FXGA 3SN6N 3QCUH 3IRZA 1ZGLP 4OLUH 1A6UL 4M62H 4KJQC 1YEJL 1TXKA 2AGJH 5DRWA 1MQ8A 3C8KA 3QUMA 4OFYA 3HUJE 1FV1A 3O8XC 4P2RE 3ZYIA 1H9VA 4KRNA 1QUNA 1DDHA 1C08A 3QUYB 1SJVA 1MCJA 3EUUA 3SKMA 3L3HA 3BP5A 2Z91A 1RZIA 1MHHB 1CDUA 1G0YR 3RWGB 3HZMA 1BGXL 4OLEA 1XF2B 1BJMA 5ALCH 4CMHB 1DE4B 4Z7WF 3NCYP 5GGSY 3TJEH 2VLJE 4QRPA 4XNMB 1NCCH 3RWJA 5F44A 2X4TA 4TVPL 2I9TA 2HFGL 3LKOA 1WC7B 3G5XA 4G8EA 5GIRB 4GQPH 3O41A 1QFOA 4K8RH 3DMMB 4PJ9C 1CDCA 4S1RH 1JWUA 2MNUA 3PWLB 3V6OA 1YYLL 3BZFA 2DN7A 1GIGH 4OF5A 2MHAA 5B39G 4GW1A 4LCCA 1S7VA 2NY3C 3NCJL 5C2BL 3AVEA 4WI6A 4FFZL 4NQUA 4B0MM 3TWCL 2YPLB 2F54B 4M61A 1QYGL 2X1WL 4A6YA 2B4CH 2X4RA 1ODAA 4JM2B 1HHKB 2OCFD 2JB6A 4JM4L 2VISB 3DHMA 5FUZL 3H8NA 3KPSA 4NO0D 2D0HA 1WFOA 4HEME 2E6QA 3O6KH 5JXEC 3WXWH 2VXTL 5C0IA 2EYTA 1E6OH 3JWOH 3ECBA 3ARGA 4P23C 4XAWL 3OL2A 5DFTA 3LH2H 1E6JH 1U9KA 5DK2B 1E27B 1CE6B 3B5TA 1QBMH 1AO7B 3FRUB 3HC0B 4OF0A 2VC2H 5DUPL 1NLDH 3OB0K 4MJ6B 1N5AA 5L0QB 1I8LA 2BRRH 4Z0XA 2JELH 3KVQA 1YEGL 2PCPB 2NXYD 5EU6A 3F7YA 4ACPA 4QRRA 5L2JB 3AM8C 1HHJA 4WHTA 1EPFA 5ACZB 3GMNB 2ZSWA 1MEXH 1ZVSB 4MDJA 3E1F1 5C09D 3VWKA 2GK2A 4FFVD 2W65A 5DMKB 2K7PA 4LBEA 1OAKH 3I50L 1MPAH 4OD1L 4OZFA 3QWQB 2DD8L 4IHOB 1YNKH 4PGCB 3E8UL 2BX5A 1FLRH 2IADB 3QA3A 1EV2E 4CW1A 1NAKH 3VFRB 1CYGA 2VLRD 4HKZA 4TSCL 1BM3H 4UV4H 1CLOL 1XIWA 3ZKXB 4CNIA 3F8UB 2J6EA 1QLEH 4LLYA 1P7HL 2V17H 1OP5K 4X6EB 3GI8L 1PYWB 4UT9L 3VXRD 3KPQA 1T5WA 2X4SA 3B9KC 3MOBL 3MFGB 4PJAA 4N5ED 1AGEB 1FZKB 4ZS7H 4U1LA 3X3FH 1D9KA 2FLBT 1RIHH 2I24N 2R2BB 5HTSA 5CJBA 1RUAH 4BZ1L 5HVFB 4KKBC 4GLRH 1NBVH 2YUWA 3QJFA 5SWSE 3BKJH 3ZYOA 4XI5C 2EDXA 3B2UD 1FL3A 4Z18A 4KK8D 5IB4B 3OKEB 3OMZA 5JHDB 2X4QB 3RL2A 3LDBB 5K9OA 5E6IB 4YFEA 5DQDH 1BBDL 5L2KD 3EOBB 3N1QC 4L8CA 3CCHA 4Q74A 4UU9A 4W68A 3D18B 3STLB 4X99A 1I1FA 5FDWA 3TBWA 1TVHB 2G75B 3MRRB 3QBTB 1AGCB 4LAJH 3IJHB 2YSSB 4MXQC 4U6HB 4QRRE 3GEWB 4UNTA 3MNZA 4MX7B 2F9BT 3ARZA 5GSRB 4F9PC 4GBXD 2XI9A 3ARDC 1T03H 3O9WB 2VLKA 3LSOA 3JTSA 4RMWA 4NHUB 5SWZD 4PLJC 1G6RL 5KS9B 5C0BB 3BYYA 3QZWA 4Z0BL 3QULA 3T09A 4XWGH 2XZCH 1RV6X 1X4XA