2PP7A

Crystal structure of anaerobically manipulated wild type oxidized afnir (acetate bound)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp7A02
1E67A 2WO2B 4E9VA 3ERXA 5I6KA 2H5UA 2OJ1A 2BZCA 2J5WA 3V9CA 4FAAB 1JVOA 3QJRB 4JKNA 5I6PA 1L9RA 1BYPA 2I7SA 3X1GA 3FU7B 3H4HA 2WSDA 1E30A 5IY5B 1RZPA 2CJ3A 1URIA 1V54B 4CSZA 2YARA 2XXFA 2UXTA 4GP8B 1VLXA 1OCZB 2J56A 3NJIA 3IEAA 4CSPA 2EIKB 1PMYA 1AG6A 7PCYA 4DP0X 4HCIA 3KW7A 1AG0A 3IBOA 3NJMA 1A65A 1WA2X 1A4AA 1PLAA 2XU9A 2FT7A 1AS6A 2VM4A 3AW5A 1EHKB 2VSKB 4DP9X 4EF3A 4GP4B 1HFUA 2H3XC 1OCRB 1GS7A 4YVUA 3EF4A 4Q89A 5TK2A 3ASNB 2AZAA 6PAZA 1KGYE 4YSDA 1J9QA 1GY1A 3N55A 3PLYA 1JZFA 1OV8A 1E5YA 2VW6A 1OCOB 1NZRA 1BXVA 2HRGA 2VW7A 1GS8A 2IDSA 2I7OA 4E9YA 1NTDA 1GYCA 5B1KA 3T6XA 1PNCA 2Q5BA 2WO3B 3ZBMA 1ASPA 2ZONA 4KO5A 4BXVA 5I5IA 2IWFA 2VM3A 2DWSA 3NJNA 4AKQA 4YSAA 1ILUA 1MZYA 2IDQA 1AZBA 1PNDA 3ABKB 3X1NA 4MFHA 4AX3A 1JZJA 3H4FA 3SQRA 4G71B 1IBYA 1IUZA 2J57A 4E9RA 3ABGA 4BWUA 5AZUA 3T71A 2I85A 1NICA 1N68A 1OOWA 1XMEB 3FPYA 3V9EA 4BDVB 1TEFA 1V10A 1TU2A 2DV6A 1PZCA 1L9OA 1WA1X 4L0PB 2Y69B 1DZ0A 4YSOA 1J5CA 2LLNA 3CVCA 4BWTA 3FU8A 3NJHA 2DYSB 2HRHA 1MDAA 2BP8A 2FQGA 5EHFA 1W8EA 2GBAA 3QPKA 1AR1B 1NPJA 2JFCA 5I28A 3GXUB 1SHWA 3NJGA 3JT2A 2YAQA 4HZ1A 4NERA 2J55A 9PCYA 2PCYA 4YSRA 3FU9A 2HX8A 3PPSA 2X87A 5PCYA 1V55B 1W6LA 4YSPA 3T6WA 1I53A 1ASQA 1A8ZA 3PCYA 5TK4A 3G5WA 2DWTA 4Q8BA 3WKPA 3UAEA 2NRDA 3AG4B 2PPAA 3S3DB 1HAUA 4E9WA 3TBBA 2JKWA 3ZDWA 5LDUA 4DP5X 2XV2A 3AG3B 4A2HA 1AZRA 3FYEB 1AS8A 4DPCX 1NIEA 1PCSA 2AFNA 1NINA 1GW0A 2R7EB 3NJFA 1UATA 1XB3A 1ZDSA 1OF0A 5B7EA 1QNIA 3ABMB 2GI0A 1KCWA 3CVBA 2A3TA 2BO0A 3AG2B 4DP8X 3WG7B 2JXMA 4YSSA 3PAVA 5E9NA 1JZGA 2YAEA 1SJMA 4BK5C 3FQYA 1BAWA 2R7EA 2FTAA 2XLLA 4PCYA 3DKHA 5I5MA 1DYZA 1RCYA 4P5SA 2GC4C 2QDWA 1NIBA 1OCCB 2QPDB 2QPEB 1IBZA 4DP1X 4UF7C 1NPNA 2CCWA 2OCCB 1JOIA 1BQ5A 4YSQA 4HIPA 2FT8A 2UXFA 2HZHA 3U25A 1YLBB 3T6ZA 1ET5A 2IWKA 1CC3A 2BHFA 3AZUA 1F56A 2TSBA 4TXVB 4DP6X 2XYBA 3N2JA 3DIVA 4F7KA 1T5KA 2EINB 1X9UA 3MX0B 2VMJA 1R1CA 4QLWA 1FA4A 1RKRA 5F7AA 1ET8A 4M4RB 1E5ZA 2HLEB 3NP4A 4A67A 1J9SA 4YSCA 1SHXA 2XX0A 1FFTB 1M56B 1CUOA 2ZWNA 2TSAA 3NSDA 2FJSA 1L9QA 2EIMB 3NP3A 3S3BB 1CYXA 1NIFA 2IDUA 4K9JA 1FWXA 3D12B 4UANA 2E86A 3CG8A 2HX7A 2FQEA 2YQBA 3C75A 3H56A 3SBRA 1JXDA 1PY0A 3FSVA 1JZIA 5I6MA 3WI9A 3QQXA 3ZIYA 2BP8B 2YAMA 2IDTA 4YL4A 2ZOOA 1SFHA 2AVFA 4GXFA 3FYIB 2VW4A 2CAKA 2HX9A 5FC9A 1AZCA 2W8CA 1JZEA 3GYRA 3NT0A 2N0MA 1KYAA 4RH4A 1SF3A 1MG3C 3UADA 4F2FA 4KOBA 2PCFA 4YSUA 4E9XA 3IN0A 2B08A 1BYOA 4M3HA 4HCFA 1WS7A 3OM3B 2XV3A 1NWOA 4G7RB 2FT6A 4ZK8A 2Q9OA 1QHQA 2DY2A 2MTAA 1ID2A 1GR7A 1A4BA 4X4KA 1M9WA 3CDZB 1A3ZA 4W9ZA 4KOCA 2PP9A 5I5JA 3FSZA 4BWWA 3QJQB 4AI7A 4NB7A 2P80A 2YXWA 1TEGA 3RYMA 4A66A 1ZDQA 3NSYA 3FPXA 1WA0X 3S8GB 2IH9A 3CDZA 3OD3A 1ET7A 2XX1A 3EHBB 4ENZA 1KDJA 1OE3A 2BW5A 1PLCA 5I6NA 1KBWA 3AY2A 3T6VA 3EH4B 3NJJA 2PP8A 4JHUA 3EH5B 3HEIB 1PLBA 3WNJA 4P5RA 4KO9A 4KO7A 3ASOB 1CYWA 2XXGA 3TU6A 1KV7A 1BQKA 4KNTA 1XB6A 1NDTA 1ZIAA 4DP2X 3ABLB 3CZUB 4DP7X 4YSTA 4AKOA 1TKWA 2ZXWB 5AKRA 4HAKA 1MZZA 1J5DA 4WKXA 1NWPA 5PAZA 1PZBA 5B1JC 4UAHA 5B3SB 2EIJB 2BZ7A 8PAZA 2GC7C 3L45A 3SBPA 4GP5B 2IWEA 3UGEA 1JZHA 2GIMA 1BEXA 1SDDB 3WIAA 5B1AB 4HALA 3IE9A 4E9TA 1ILSA 1IC0A 1NIDA 1JVLA 4E9QA 2BWDA 2H47C 1AACA 2YAPA 2UXGA 3X1FA 3EH3B 2AZUA 2W88A 3QJTB 2FQFA 1KDIA 1WAEA 1PF3A 2GHZA 1X9RA 1GSKA 3FQ1A 1SDDA 2YXVA 3FQ2A 1GS6X 3HB3B 5B7FA 3DTUB 2CUAA 4KO6A 3FU7A 3FSAA 1L9TA 3MBWB 1B3IA 1NIAA 2IH8A 2PP7A 2GB2A 1OE2A 3CVDA 1J9RA 4GY4A 1IKOP 4DPAX 3WKQA 2BWIA 1W6WA 4N4YB 2YAHA 1M57B 2EILB 2QDVA 7PAZA 1AZNA 2CBPA 2QT6A 5I6LA 1AS7A 3PXLA 4A2GA 1JERA 3ZX1A 4AKPA 2XUWA 3NSCA 1MG2C 1AZUA 1BXAA 3X1EA 2PPFA 3JTBA 2PPEA 4N8UA 3QJVB 4DP4X 2YAOA 1WS8A 3OQRA 3UACA 3PAZA 3T9WA 1EZLA 2DYRB 1SF5A 1OE1A 4BXSV 1AQ8A 1ZPUA 6PCYA 3NSFA 3BQVA 1AANA 5I6OA 2B3IA 2XVBA 1BXUA 1ADWA 1ZV2A 4KNSA 1E65A 3OMNB 1ASOA 2XV0A 2FQDA 3OMIB 5D4JA 5D4HA 3QJSB 1A4CA 3FSWA 2CALA 2IDFA 2AANA 4KNUA 3KW8A 3NYKA 4A2EA 2PLTA 1N70A 4G7SB 4PAZA 3FT0A 2Y1AA 3X2QB 2PPDA 3SBQA 4QKTA 5D4IA 3NJKA 1PZAA 1L9SA 4FA7B 2BP0B 1KBVA 4BDVA 4E9SA 4W1TA 1ETJA 5B7MA 2RACA 2UX6A 2UXVA 4YSEA 2OV0A 1HAWA 5ANHA 1JXFA 5B1JA 1RZQA 2YAFA 1L9PA 4A2DA 4G72B 4DPBX 1PAZA 2VN3A 2X88A 4YVNA 3QJUB 3TBCA 1SFDA 4AZUA 4G70B 1AAJA 2UX7A 3PAUA 1CURA 3IN2A 3TA4D 3TASA 5I26A 2BP0A 5B1BB 2MRYA 5A7EA 1QLEB 4GYBA 5AFAA 4F2EA 3UABA 2GSMB 1AOZA 3BVDB 3NJLA 2BW4A 2XWZA 4HCGA 4HHGA 4A2FA 2FNWA 1ZIBA 1AIZA 1GY2A 2VSMB 2FWLB 3AG1B 3UAAA 4WTQA 2PPCA 3OMAB 2P80D 4HHWA 1KCBA 3X1BA 1BQRA 4JHVA 3S3CB 1SNRA 3GDCA 2IAAC 4NAJA 5F7BA 1XB8A 2HXAA 1J9TA 3FS9A 3S8FB 1JXGA 4A68A 4G7QB 3WNIA
chains in the Genus database with same CATH superfamily
4ODTH 1PZDA 4LLUB 5KZCB 3UTTB 5E4EC 3EYUH 1U92B 1KLGB 4F8OA 5HDOA 3GI8H 3QNYA 4WHTB 5D1ZD 1KJVA 2O5XL 3U82B 4YQXL 4ZPVA 3QW9A 1N8ZB 4Q6IA 5M7QA 2RBLA 2NT1A 3NSJA 3C5SA 3IU4H 4XVSL 3TO4B 3EOAB 2HWZL 3GMOA 1E28A 4Z18A 3O4LA 5FECA 3TEXA 4ENEC 4IBZA 1DSFH 3UZQA 3MNVA 2YARA 1W80A 2ZXCA 1URZA 3CLFH 3IKKA 3SPGA 5C0AB 1B0WA 2J5LC 4QXGL 1YPZF 3MLYH 3ZQXA 3H6JA 3O8XB 1NGQL 2VO8A 2VUYA 4YIQA 2GABA 5DJ2B 3I74A 1MY7A 2ERJB 1BLNA 2YXMA 3IF1B 3QXDB 5GHWH 3RVVC 2VISA 5C7ZA 5JPNB 1FIEA 3S88H 3QULB 4NYLB 1MW0A 1XGQB 5HYEA 2Y7SA 2DWDA 2NNAB 3AW5A 3HBGA 3X11B 4RMRA 5INCA 1AFVH 2P44B 5TK2A 2D31A 2VMFA 4ADGA 2AZAA 3N85L 5ABAA 5K9QG 1J1OL 3ARGD 3Q8BA 4E42A 3K72A 2P5PA 2GCYB 2FWUA 1T5XB 3TTYA 4LE8A 3B7YA 1ETZA 3O3AB 4P48A 43CAA 3FO0L 1XSIA 3WJJC 2ZE0A 2D4FA 3HJEA 5JW5A 3ULVE 4WUUE 2BSRA 3QUZC 1C8QA 1UH3A 4TULH 1NAKL 4LBAA 1QSFA 3CU1A 2WO3B 1PJ9A 1JGVL 4FQLH 4KO5A 5F9OH 1OF2B 1XDTT 4OQTH 5EO0A 2H2SD 2F0CA 4YHKH 1XCQB 5F7DA 4NKQB 1G9HA 1VZHA 3HS0A 4HLZG 5GS0L 4P05A 1TQWA 2F54E 4E9RA 3BJLA 4JQVA 4KK9C 4Z7VA 2EXWC 1QUNB 1CGTA 3C5JB 4D0BA 1EDQA 4QLRA 5GSVA 3ULVC 1PZCA 3AC0A 1U3NA 3KPSD 5DK2A 2Y69B 3SZ6A 3WFBH 5I24A 4ABQA 25C8L 1J5CA 1O6VA 3CN4A 1EAOA 2ZX8A 5D55A 1F4XH 3IAGC 1SUJA 3EF7A 5EHFA 2WVVA 2YPVA 2XKSA 4N5UA 4QRSA 3SDDC 1TO5A 2F5BH 4YEEA 4OFPA 4ZS6D 1OP3H 1QO3B 3RVXC 1IL1A 4MS8C 3T0EB 1O6SB 4HZ1A 4RQQA 5K59E 4KVCH 2Y22A 4CKQA 5IHUH 4AGOA 4NUPA 4KZEL 2QTVA 5GGTL 2QELA 1RZ8B 2ROXA 1H3GA 4FNLL 3NG5A 4ODHL 4UTAH 3U1SL 3M7OA 3TVMA 3CN3A 4NKIH 4H20L 3I3BA 1PFOA 2R83A 1NBZA 1UB5A 1AGFB 1N7ML 1CF8H 5IBUB 3PV6A 2C9PA 3V0HA 2AP2A 1B4JH 2EO9A 2R2EA 2RR3A 1J05B 1IBDA 3MBEC 4GO8A 1IGTB 4U1JB 4U1SB 5B7EA 5DO2C 3FAWA 3WUZA 5C6TL 1U3HC 1A6UL 4XMLH 5SWZE 3GTNA 2C3HA 5LGKA 3W9DA 4FADA 3DGGA 3EBHA 3BMVA 4Y9CA 5D2NE 4G3YH 3WG7B 1JRHH 1UXMA 5E00B 2PABA 1MLCA 5IG7B 5D7HA 4GMTL 4GSRA 5DHEA 2FRGP 2OMWB 2WUBH 1JDCA 2XIDA 3IFNL 4PGBA 2NY4C 4G8GB 5EU6B 1GC1L 4ZW8A 1DYZA 4P5KA 1YQVL 3CFBB 4W70A 5TQ2H 4OI8A 2K4AA 3FQWA 4OJFH 1INEH 4C4KO 1IBGH 1KCRL 4C55A 5T5NG 1RY7B 2X9XA 5JXEC 1WITA 2HMID 3TO2A 3PHQA 3X17A 5KJRH 1DBAH 1VKXB 4ONHB 4CVXA 2X10A 3GRBA 2W0FB 3KDMA 5CSBA 2BP3A 3GTTA 4PS4H 5D2NC 2HJLB 1YECH 1XCTB 1XVSA 2AAAA 2G5RA 2I5YH 5A16B 5ITFB 1FL6A 4FQIL 2FR4A 1LEGB 3OKYA 1P84J 1AE6H 1U8HB 4QF1A 3VFOA 2AXJA 2KLRA 5LQBH 4Z77A 5ETUB 1MVYA 1O9VA 4JM4H 5AKVA 3DGCR 1KYDA 3GSWA 2V7HA 4UB0L 4QUOA 2ZCKH 3ESPA 1HWWA 5HBBA 3VG9B 3KZ8A 1LE9B 1RKRA 4AQ1B 5AAMA 4G7YH 1HXYB 1F3DH 2AJ3B 1E5ZA 1UVQB 3VI3E 4KXZI 4L3FA 4G8IA 4UQCA 4GAYB 3KAAA 1OWRM 2A38A 1UZ6E 1XSKA 1FV1A 5FO8A 1SEQH 1L9QA 1WUZA 5EEUA 1NMBL 3LH8A 1UT9A 2HVJB 2XWRA 3FHEA 3INOA 1P5UA 2K6YA 4GMSH 4KKRA 4M7KL 5AUMB 3VXOA 4Z7WB 4PN6A 1R46A 1W9XA 1LMIA 3PE9A 3T2NH 1NUFA 2APSA 3KXFA 4X50A 5HGBA 1LO5B 2X7LA 3ULAB 4MQXC 3KPSA 1OPGL 3VYNA 1NANH 5AAPA 5GXBB 4LHUD 3QS3A 3V4PH 5JA8B 3GM0A 1E2WA 3PNWA 1Z9SB 4R90L 4Z7UA 3RNQB 2Q76B 4GW5A 5DRXB 4LU5L 3E1ZA 4JMNA 4NCDA 3N06B 1MG3C 4F9LA 4N8CH 4YPGA 1P4BH 2YN5A 1U91A 1UZ8A 3MRDA 5E6UB 2YA0A 4YHMH 3OB0K 1OHQA 5ENWB 1BAFL 5SX5H 4W6WB 3HB3C 1WZ1H 3S37H 3V7AG 3M1BA 1P5VA 4G9DB 4RBPK 4NJAL 3MUJA 2IQAB 3BUDA 4X4KA 4AEHH 4ALAC 4NO3B 3K6OA 5FFOA 1B0RA 4N2HA 2GSIA 5GS2H 3WTUA 4XN9A 4XC3L 3FSZA 4HUKB 5I1LA 3Q8CA 1J7VR 2IANE 1E9PA 1KPRB 2PR4H 3CZSA 4RMSA 4N3TA 4C83A 2PCXA 4PGZA 5IMKA 1P9MA 5C0CB 3MFGB 2V9RA 5IK3A 4PRID 4RZKA 2B9BA 1PAMA 5EZPA 3CDZA 1EZSA 1GPOH 4F2MB 1DQDL 1ET7A 5D2LE 3RPKA 3VRLE 5EEVA 2WBJC 4I3RH 1GGBH 2Q8BH 4NM8H 1MCWW 3C9NA 2AEPH 5I19L 4R26H 2R0LL 4P5RA 1JV5B 1SLWA 1QASA 1KTCA 3WIHL 1KV7A 4TVPH 4DGYH 3CV5A 3EO1B 1KIRB 3ECQA 2WUCH 1BF2A 3F2LA 1KJ3L 2VR3A 1X6NA 3VWJD 1YZZA 5CEXA 2W92A 1HHGB 4HG4K 4YSTA 1NLBH 1CFQA 1QLRA 1IEBA 3HMWL 3TPUA 1LO2L 2DPKA 4PREB 2WQSA 3JTTA 2XBTA 3TTSA 2QMKA 4J3XA 2JB5L 1JSYA 4BQBA 1PX3A 3B5HA 4KUCF 4NS0A 3MMEB 3U83A 3K2IA 2B15A 1N5AA 2L7QA 2X1WL 1A4JB 1AGCB 2X6BA 2G5BB 3W39B 1SDDB 3U9WA 4KTDH 1U95B 3QH3B 4HALA 3MODL 4Z3EA 4E9QA 1EAPB 2F7QA 2HFEA 1AACA 3HC3H 1DDHA 3IDXL 2YAPA 3SDYH 5IB3B 3U9PH 4WKZB 2OMBA 3Q43A 5DC9B 3CFCH 4HU2A 3P2BA 1KDIA 3GJEB 4FQXD 2WXJA 1HINH 1MIEH 1VHPA 5AEAA 3NCEB 4IBLT 1JRHI 3P69A 1EZUA 4GG6A 5BRZD 3QEQA 3UCRA 2NXZC 3EO0B 2A6DB 2BX5A 4EI5A 1EANA 3QWOB 4FNSA 4Y4KB 4PH8A 3HN8A 3VYPA 4XNMB 3VXTB 2X4OB 3SQBA 1L3NA 4TPRL 1VCBC 2EEBA 1GOHA 4NZUL 3FUNA 3PXLA 5CHNA 4CN4A 2V3FA 3VXME 4FL4C 1SBSH 3BDYH 1BXAA 1YMHB 4P4KD 4LHUA 5C09D 3ZHDA 1E7UA 2PPEA 3U30C 4M7LL 2WAHA 5C07A 1ZTXL 1M53A 1H3XA 2D7TH 1JGDB 1O7VA 4OLXH 3KBPA 4GRLD 5E9DE 5MENE 3HI6L 2EDEA 2NNFA 2NY5H 4TQ8A 1VFUA 3NA9L 2EVIA 3MNWA 4L0ZA 1I9JH 1ADWA 3MRMA 1IQDB 5LCVA 4GSXA 1ASOA 2XV0A 4ZAKC 5D4JA 2X4RA 15C8L 1QFWL 1ADQA 4UIMB 5CGBA 3BZFA 3OJMB 1LILA 3V5KB 3Q3GA 4WCYH 4LVHC 4MQ7B 3UZEC 5KSBE 4XNQB 3VTAA 2BSTB 1FVCB 3JZ7A 3GEWB 3MAWA 5L88H 3L7FA 1RXLA 3BC9A 2I26N 2CCLA 5D4IA 3NJKA 2AJVL 3OVUB 4H8WC 1HKLL 3GINA 4ACPA 4PJHB 1QW9A 3WNNA 4X6EB 2DEYX 3ENEA 3QRBA 4C4KT 3KLSA 1QFWM 4A2DA 4G72B 3PGFH 1C5CH 1CFSB 4DOHB 2ITCA 4EXKA 3QJUB 2WTOA 4DEUA 2DLFL 1IBBA 4WI2A 5DUBA 4PI2A 1GAFL 4G11A 4JFYA 2EH7H 4JY4A 2BVPB 3FRPA 1JZ8A 3NZ8A 1P4LA 2X70B 4GO9A 4P3DA 3VWJA 3TYFB 4OGAC 3MUHL 1OGSA 1CFTB 3BYYA 3SJVD 1IKFL 3OMAB 3IRPX 1IGML 5MEOA 4ZFOL 3N41F 3VNZA 1DFBL 3IJSB 4FCHA 5KBNC 4UQBA 1FAKT 1BQRA 4L18A 3MYJA 1FDLL 4AL8L 3CFJB 2R56H 2IAAC 2XTSA 3J8F7 4QOKE 4Y7MA 1FVDA 5F7BA 4URTB 3SCMB 3QHZL 4K71C 4KKLC 3S8FB 4G7QB 1NAMH 3B9KC 4WFFD 3ZDXF 1QFUH 3MRFA 1FCCA 2AXGA 1BQUA 1NCBH 1YEKH 3ERXA 2J5WA 3RJQB 4HX1B 4KXCA 3RWHB 1FFRA 2NYYD 4AGMA 3BWAA 2Z92B 5I6PA 1EERB 1L9RA 3C5ZA 1RZGB 1E9OA 3RURA 3U6RA 4FQXA 3STLA 2Z7YA 3G6AB 2Y5TB 3L1GA 3L7EB 2HTKD 3ZMRA 4Z3HA 1TSRA 1OW0C 2G75B 2XRAH 4OF8A 1B9ZA 4I1NB 1JPTH 5BRZA 1MIML 3LN4A 3JTSB 4LGSB 4YXKL 2YRPA 3HBQA 1CBVH 3D18B 1UCBL 1FSKB 1QOKA 4UQ9A 2VERN 4QJ4B 1KOAA 3JV4B 5IT2L 1D9KD 3E0GA 3VG0L 2P1YA 4FLQA 2V5MA 3O6FA 2GJ6B 3VXRB 1PFCA 2XZQH 4IRSD 1F4WH 1XH2A 4XBGA 2X1XR 1GVIA 2VSKB 2KZBA 3NIDF 4GP4B 3IVKA 3MJ9A 5C09A 2OMNA 1NFDF 4LDOB 1I31A 4U1HB 1PS3A 2Z93B 4D9QE 3A6CL 5I23A 4LQFL 4PG2A 5FO7B 4BKLB 4L29A 1U58A 2CPUA 3RG1C 3WIFB 1A3RL 1JCVA 1JV2B 1FL3B 2AXHA 2F8OA 2ATPA 3DXAB 5IV2B 3PHSA 3C08H 3PL6B 3WNOA 5B1KA 5CZRA 5IJKA 2PUQT 2NY7H 5F9DC 5JQIB 2BFGA 4OLWH 3MX0A 1XGTA 2ZP0T 4NQSB 4PJGF 5FUOL 2ETWA 3KM2A 4MXQC 3TFKC 2HFGL 4CVZA 3BVNB 4XMPL 1LJMA 5KSAD 2EVHA 1DQML 2CM5A 1FNGA 1MRFL 1UWGH 3DO7A 2Y3AA 4FNPA 2Q87A 2PN5A 3NIFF 1MFMA 4NQEB 4WEBH 5BW7A 1NL0H 4Q52A 5B39G 5DLMH 2C9SA 1TEFA 3PFQA 4GQRA 5DGQA 2UZIL 3HMXA 2X12A 1A7QL 4F1SA 2DJ4A 4OF7A 2IALA 4PRAB 4R8WL 2GJ6D 4AE0A 4QGTA 2Z7UA 3T65B 2B59A 2Q7AA 1VFOA 4H8PA 4HAFA 2BDNH 2TRYA 5EPMB 1QLFB 1QFPA 1XF3A 3K8KA 5CLTA 3JUZA 3DX6B 4Y5XB 2XN9A 2WXHA 3MRBA 1YNTA 2VUKA 4CC0A 1UJ3B 1ZE3C 3JVGC 4AYID 5HYSG 3NACH 4GBXA 4HCRA 5FW6A 1K9TA 2HVKB 3PG2A 8FABA 2IWGA 9PCYA 3QHTC 1QYGL 4R4FL 2ZNWA 4AQEA 4YHYC 4YN3A 4YXLH 4PGEB 5JMRA 4HC1L 5TK4A 3HCVA 4IMLA 4IGBB 4FDWA 4Q8BA 3QZWB 2CWRA 2VDRL 2WLNA 2F6AA 1SN0A 1BJ1H 3PWUA 3KPLB 4IMKA 4MA7L 5AKSA 4E9WA 2JKWA 4ODBD 4QXTB 1PYWA 4YBQC 5D93C 3RWJA 1QRNA 2YEVB 4EN3D 5HVFB 4NZRH 2G2NA 3NJFA 4AEIL 2X44D 3SZKC 4NKDB 1J8HB 3ABMB 3OJDB 4ZXBC 4HDIB 4CSSA 4HUXA 4KY1L 3VXUE 3AG2B 3DURA 4ZTOL 1XF5B 2J8UF 4ONGH 3U36A 3ARWA 3OLGA 2P8MA 4S1DC 2VWEC 4FHJA 3DX9A 1O9WA 2NY1D 1AD9A 3WE6B 4QRTB 1DJXA 3AGVA 5HYSA 3C87A 2ESVE 1N19A 5KBMA 4KKQA 1Q8MA 4OZ4B 3VDCA 4F9PC 4AC4A 5GS1A 3QORC 3QYMA 1G7QB 4M29A 4NQQA 3KWTA 2VSDA 3W0WE 1MHPL 3EJSA 5JLZA 3KPQA 2WXLA 4U6VL 3PP3H 4Z95H 1DJWA 3AXLA 1RUPH 5F72S 4G6FD 2YD7A 1EEYA 1JOIA 3MRKB 5JIMA 1MFDL 4K9EL 2CXGA 2OBGA 4IGBD 4WNQA 3EJTA 1BD2A 4IRSA 4XWOC 1OP5H 4F7CA 2IBGA 2WBXA 5E6YA 2APVA 3SEPA 1WIOA 3ZDYE 1B4LA 2YO3A 1GGCH 2DKUA 1WT5A 3PHOB 1W91A 4Z7NF 2VQ4A 5EU5A 3DOSB 1I4FB 2FATH 4YR6A 4HIEA 4QRQB 3F83A 4TXVB 4DP6X 3AREA 3FQ4A 2GBUA 4L23A 5HGDB 2SODB 4R0LA 1T5KA 5E8DL 4LSRH 3C6LA 5LBSL 4OZGF 1A9EA 4WWKB 4ZSOB 3O45A 2WZPD 1DJSA 1QBAA 4OGXH 5AD0B 1I8LA 1IZKA 2BVUA 2ZXAA 2ZYHA 2KERA 1CO1A 1C7TA 4AM0B 2E7BA 3L4XA 2Z4QA 2R1YB 2VL5A 4PJ8D 2YS4A 3NSDA 3US1A 2MCPH 3V10A 1LO0H 3DROA 3SDAA 3VGBA 4PJDF 5MEPA 3IETB 3KPPB 2ORBL 4JDTL 5I1IH 3IMSA 4B0MM 1G6VK 3FB5A 4QNPE 4X7FC 5FUZL 3D39B 1CTNA 3AU1A 4XNZB 1RZIB 3O6LH 3S35X 3KPRB 3MV9D 4WGVB 3CQQA 4JHBA 5ADOL 1FNHA 5CMAA 5ADPL 4EI0A 4N6QA 3P73A 3QIBA 4S2SB 2ILLA 2EXTA 2CAKA 1H15A 2Z9TA 3MV8B 3T08A 1NC4D 1MREH 1CDUA 4P07A 3ARDD 3BVXA 5F7LB 3QS2A 4Q6YA 2N0MA 5HI3D 1VIWA 4AG4H 1RL1A 1HOCA 3T8XB 4F7TA 1HSBB 1AHWA 2NR6D 1Y7VA 4JFOA 4LCWE 5DQJA 1W0WB 4PTUB 1DVFD 1ETB1 2NX5E 4BV1A 2PWGA 2PYED 4GKOA 4WWKD 3K71B 1MQKH 5C71A 3SE3A 1M7DB 2XV3A 5FYJH 3MACH 1CLZH 1OARL 4QYAA 4WNSA 1H8OA 3VYOA 2HFFB 1YEDB 2CO4A 3CFKB 5CCHE 1XR8A 3QUXB 4AI7A 2EAEA 5J13C 2NTSP 4KAQH 2F53E 1OGAE 1T3FB 3CH8A 4XMKL 2JJTC 1FE8H 2H32A 3RYMA 3D85A 2GTQA 4W68A 3Q1SL 4NUJA 2VYRE 3LZFH 4N90D 1KWGA 1BOGB 2GITA 2QQNH 3H6AA 4XOEA 1R3HA 3NTCL 4Y2NA 5LXVA 4M93C 1F3DJ 2WVSA 2E6JA 3CLEH 4HGWA 4G1MB 4K3JH 1YUHA 4TNWK 3LKRA 1SVBA 3P30H 4J23A 1N3NA 4L3EE 2G3XA 1AGEB 5LGJB 4AMKL 4JFUA 4KO7A 2EYSA 5FWQA 3OHXB 5J6HB 5ECGA 5GGTA 4PV9A 4JRWA 5FHAH 3BP4A 3O9WA 3AB0B 5I8OL 2P24A 4R7NA 5T5FL 4F24A 1N6UA 4DN4H 1ACZA 3JV5A 1S5IL 1IGFL 3P4OA 2H7WA 3D2TA 5DHYB 5IWLC 3QQ9C 5AKRA 4I0PC 4XNUL 3U7WL 1E5CA 2G2RB 3OB8A 4G6KL 1MEXL 5LNEA 4EKJA 2NY6B 3LV3A 4HWEL 5B1JC 5GSRB 1FVEB 4CVUA 4L05A 3QEGL 4HZLB 4P2QE 4CAGA 3UGEA 4YDLB 2QHLA 3PWLA 2OCFD 1AZVA 1EJFA 3APCA 3FU6A 1SM3L 1G9MH 1NIDA 3L1OH 1BHGA 4X5RA 5KYXA 4KI1A 4MKTA 1PLGH 1XGUA 1GZPA 2XIBA 4KKAC 1ZA3B 3O4LE 5E03A 1KCUH 5LN8A 1WAEA 2GPZA 4PV8B 4JG0H 1TTFA 1GYUA 4FQCL 1W2KT 3WKYA 4FQPA 4Z8FL 2QJDA 4PIRF 4ODTL 2EJ1A 2QMJA 4PJ8A 4HPHA 3HE6D 3EYUL 3MBWB 4IBQA 4M6OH 5D6DC 3GI8L 2XFXB 1OXYA 2R4SH 5FYJD 1FNSH 2YAHA 1E6OH 3E8VA 3GMRA 3IU4L 1M57B 7PAZA 3VFSB 2YZ1A 3TWCL 1GJIA 4PJIF 2OW6A 1KG0A 4CGUB 4CC4A 4MJJA 2YD5A 3MV9A 3WJMB 1IAKB 2XUWA 1DSFL 2OTPA 2K8QA 4PRDB 2WO4A 3PABA 3CLFL 3QDJD 5I18H 3TIDB 3GPSA 3MLYL 2V7NA 3EJYD 1N4XH 3ORJA 3HG4A 4AXWB 3OGCA 3LPPA 1E6JL 2X0WA 3OKMB 4OCWL 3A23A 4U1NA 5DLLA 4YAQA 4MAYD 3U79A 3S88L 1DVFA 3O3BB 5BO0D 1QSFE 5GGQH 2CKBA 4PS8A 2Z35B 3HS9A 2WANA 3OR6B 5F1NB 2CJTA 2EDWA 3TC9A 3L4WA 3G6DL 4OJCA 2D73A 4JQIL 4MMXA 4YFLF 3TGXA 4L1DA 5HHOE 4I77L 2PLTA 3E6HA 2PO6C 3IMWA 4M5YH 1I7ZB 1Q9LA 3RKDC 3ILPA 4YK4B 3D06A 2DI9A 4F80A 2HJKA 3FT0A 5HI5D 3CFMA 3ROLB 5GZNA 2VZTA 4TULL 4I1PA 3NZHL 1BJ8A 3SDXA 3QDGB 4XZ4A 1A5FH 2UVFA 3OXSB 3P2TA 2AF2A 4HW6A 3KD4A 3JT0A 2I27N 2V8MA 1KBVA 3UPCA 1PDKA 3DVGA 1XSJA 3Q2LA 4JFQB 5J12C 1F6AB 5B7MA 1EH9A 5C6WH 4ZPTA 2ITDB 1M6UA 4FKEA 3AROA 1ZT4A 3O11B 3V6ZA 3HS0C 3FT1A 3LKNA 2G0KA 3V6OC 1JGLL 2MOQA 4JQVC 2BWQA 4WI6A 1VB9A 1XIWD 2R29L 4S0HA 5B1BB 3MNDA 2VZVA 4TM9A 1O5PA 2Q7YB 5TFSH 3GRWL 1RHHB 4ORGB 4LSQH 5DC4B 1NLDL 3VGHA 4OTXH 2FNWA 3WFBL 3VUAA 3CX2A 2NZ1A 1QR1A 2R0KH 2B3RA 4L3AA 4IIQA 3S34H 1KPVA 4IK7A 3X1BA 1MWAH 1EPFA 1ZXKA 1VGEH 2F5BL 4KXAA 2LLGA 2A0LC 3HIZA 1E4KC 3QIWC 4CADA 1SDAB 2WO2B 2ITEA 3R4RA 4H8QA 4FFZH 4R4NC 4E9VA 5IHUL 2YKLH 1BZ7B 1RI8A 1PX8A 2ZX7A 3X3FL 4DWHA 3KL0A 4FXTA 2ED6A 2XY1A 4Q9RH 2WKLA 3MOBH 3PDGA 4NKIL 4ELMA 3TVMC 5D7LD 4PJAF 2EDQA 2R1WA 1CF8L 3FH5A 3O4OC 4XPFH 5HP5A 4UTBH 2WD0A 1BG9A 3ZY7A 2UXTA 1OL0A 3U0PA 3ULUH 2DYPD 3PGCB 4TSCH 5C0EA 2EIDA 4NQUA 5KW9H 3LPOA 4TQIA 4Y19B 3BGAA 4NQCB 1B2WH 1PMYA 4W81A 1GIGH 4XMLL 5FLUA 4OH2A 4Y5YB 2FUQA 4PW9A 3ESNA 3WEXB 4G3YL 3C60B 2WXRA 3F01A 1MWAB 1JRHL 5HPMA 3KH3A 1G5AA 1P1ZA 3BUQA 3QRGH 4IRJA 5DD6A 1ESOA 2WUBL 3RDTB 1A14H 3UYRH 2YA2A 1OGTB 3EJZD 4K7PY 2JLLA 1F2QA 3KGRA 4MWFB 1DQVA 1YEIH 5TQ2L 4OJFL 4PY7A 1INEL 4WFED 4B5EA 1IBGL 1E2VA 2VW6A 1LK2A 3MUZ1 4UAOB 2G3NA 5KJRL 1DBAL 2IDSA 1KBGH 3GBDA 1QEXA 4K2UL 4DK3A 1AY1H 4ZI8A 3O0RH 4ZYKA 1UXWB 4H8HA 5JIKA 4NP9A 1GYCA 3LEVH 1E4XI 1SHSA 4QRFA 1Z9OA 2I5YL 2VABB 1WFOA 4UMSA 4P9ML 1IT9H 1IVLA 1SEBA 3EDFA 3HBPA 4UNTA 4YSAA 5F3BA 1AE6L 5KYYB 4P59H 5LQBL 1ZMYA 3KWUA 3CDYA 1I1FB 4PJEA 3BQUD 2ZOWA 3VXNA 4P2OD 1A9BB 4OIAA 4EUPH 3N43F 3Q5TA 4AITA 5GGRY 4ANWA 4GXUN 3LKPB 3KXFE 3WIIH 1FG2A 5FEBA 2Z8VC 5AAMC 3FFDA 3KPSE 2C9RA 3BUBA 1EO7A 3NCYS 5KVFE 3M45A 3TZVB 2CA4A 1M6OA 3QJHB 1CL7H 1TZAA 3MUGB 2XSKA 2RJMA 4Z7UE 1SEQL 3FQNB 3ES6A 4KKPA 1HDMB 4GMSL 2R8SL 2R4RL 3RPIA 3TNNA 4L9LA 1TFHA 3KLAB 1AR1B 2NY4B 1CWVA 3SO3B 4YDMA 5I28A 3CVIL 1XIWA 4OJAA 4PWFA 3JT2A 2YAQA 5D8JH 3DX7B 4JM0A 1OEZW 3ARFB 4HOZA 5IIEB 5M95B 2FX9L 2NY2B 1WH0A 5DFTA 5IB5A 1V55B 5IB1B 5JOFA 2F74B 1NMCC 4DCQB 5I0DA 1SXSA 5IM7B 1P6WA 5FDYA 4B9KC 3FO1A 2YUZA 4JFXA 2P5WB 3BWUC 5C97A 1QSZA 1ZS8A 4Y4HB 4C8XA 5LDUA 2HTLC 4HKZA 4HH9A 4N8CL 1P4BL 4NHCH 3UGXA 1ZLUK 4F9LC 4A55A 1S2EA 3D2UB 3IKCB 1BBJA 5JW3H 1T83A 1FYTA 1AC6A 1NINA 1UD6A 1V7ML 1WZ1L 3S37L 1JZDC 4LCUB 1OF0A 2IH1A 3UC2A 1S8DB 3EYVA 2IOMA 4PB0H 4NKOB 1JF1A 2F7IA 4AEHL 1ZLEA 1CFNB 2I9TB 2QKIB 1RD6A 1WD9A 3AS1A 5D7LA 2BSSB 3MCLH 2PW2A 1UXSB 3AWGA 4LF3B 2NY3C 2PR4L 3FQYA 4OKVB 1BAWA 5DMIL 2WWMC 4OVVA 1AKJB 1N8OE 2DYPA 1JD7A 3EJPA 4JPSA 4PCKA 5I5MA 1P9MC 3QPQC 2VITA 3L5WB 4M8QA 1NIBA 1Q0YL 4N9GA 2K1MA 2R9HC 3N0PB 2APWA 3ME0A 5EC1A 3GBML 3JWNG 2EC8A 1E5AA 2Q8BL 1GGBL 4IK6A 4NM8L 4OIIH 2RGSA 4E2OA 1MF2H 2AEPL 3MGTB 4R26L 4HIPA 3HZYB 5J3HD 4BH7B 2R0ZH 2DB8A 4IBYA 2JV6A 1QHPA 1KBKA 2E75C 4TVPL 3X13A 4A6YH 2A6KA 4AYGA 5FW8A 3SBWA 4J3WA 5I8CA 3K80A 5MEQA 3FBKA 4Q4IA 3GPEA 3CPLA 1OTTD 1TPXC 3ZL2A 3FAXA 1NLBL 3I75B 1KACB 2EINB 1OPOA 2ARJQ 1R1CA 2DLIA 3TXAA 3IMTA 4K94L 3LKOB 4O02H 4ODWB 4FLOA 4KUCD 3IJEB 2XX0A 5GJTH 4IKJA 1QZ1A 1FFPB 1UOVA 3D6GA 4L4TD 4NIYE 4GG6E 2XPGB 3QEQE 5DZLA 7FABH 2ZWNA 2J12B 4A38A 4H7VA 1ZT7B 1BJ1J 4ELDA 1J0YA 1MCIA 1OLZA 4KTDL 4RGMC 4QIRA 3QZBA 2BNQD 4PJ5B 4XN7A 4BRJA 1DEEA 3ZKXB 4OAWB 3RVWD 3HC3L 2QGDA 3SDYL 4K7PX 2CNZA 2YD3A 4KMTL 2A74A 3EG9B 3T1FA 1SVCP 3CFCL 4P46C 1KB3A 1OT1A 2CD0A 3ESOA 3KG5A 4H1LH 1AQHA 1HINL 2FQEA 4R3SA 3KNBB 1MIEL 4PJBE 1JZIA 3O2DH 4RGNE 4UUJB 4A6YB 4C4BA 2HUEA 3EDDA 5C07E 4XP4L 5HDQH 2EDFA 5BQ7B 2B1HH 3U46A 1JZEA 3Q1EA 4M56A 4F8LA 3Q2CA 4RMUA 5L4FA 4FF9A 1KZQA 1FL5A 2ENQA 5E8EB 3T8MA 3K2MC 4J3OG 4NWTH 4OF0A 3ZYZA 4KOBA 2Q3XA 4O02B 3PGDA 4UIKL 1CG9A 5LN4A 3B2UC 5F1IA 3S3JA 1ND0A 4DGVH 5BV7L 1SBSL 1A0QH 4ZMXA 5BRPA 1G7MB 4FQJH 4RGNC 4W9EC 1KMGA 2XWJA 2BVQB 1A4BA 4J1UB 3L2NA 1JWUA 2NUTA 2D7TL 3Q6GL 3OC8A 3N40F 2D3VA 4OLXL 2KHAA 3NFNB 3P54A 4FMVA 3TP4A 2P80A 4H1LB 4HKJA 4IKNA 2B4CL 1WBZB 1JF6A 3FONB 3DTXB 1CXFA 4ZFFB 1WFNA 3EZ8A 1I9JL 3ZMNA 1IIKA 4GKZB 1FZKB 3LZLA 3H7BA 3BD5A 1T6WA 4ONOA 2EADA 3N41B 3SE9H 1PLCA 1O7DE 3JWOC 3WNMA 4WCYL 4N0CC 2PP8A 1CL7I 3K2KA 3C8DA 3UTSD 1JZ5A 3OGOE 4RWYH 3HI5H 1H6UA 3ASOB 2MIZA 1BSIA 4V2BA 1NGWA 3GMMA 4DPRA 1ZAGA 1A7RH 4HC1A 5CJXA 1URLA 5FB8A 2KPNA 4X6CF 3GSUB 3ELQA 4WEEA 1KXVA 2HLFD 4MA8H 1SXCA 2A9AA 3RTQC 2ZXWB 2BIHA 1KB9K 1MZZA 1A3LH 1OT4A 3ETBF 1JZ3A 4JQXC 4JW3A 4N8PA 1K4DA 3SDCB 4UAHA 5D9SA 3FCGA 2G9KA 5EORH 3T3PE 3LS4H 2GC7C 3ALXA 3BD4A 4I8DA 4LPVA 2BK8A 3P4MB 4KI5F 2MEJB 3LNFA 4XX1G 3GLZA 5B1AB 5CFHA 1LXMA 5I0XA 5K9OB 5JOPD 3GEFA 3FO9B 1F45A 3QEHA 1TJGH 4I5BA 1LE5A 5ICZA 5JIPA 1IM9D 1XZ0A 3T0BA 1YEGH 3VFPB 2WLIB 3MCKA 2AJZA 3NIDB 2W88A 1T2QL 3ARYA 2R56L 4IDJH 3GSNH 4L4TA 3RAJL 5EBWB 3DDFA 5BRZE 1NFDB 2JJSA 4U1IB 1GS6X 3H9HA 4P3CL 2CUAA 4POZD 1JNLH 2A9ML 1MPAL 1DJGA 2V6HA 3PJSA 2YPLA 2BNQA 1NCBL 1YEKL 3MHZA 4ZUWA 4OZFH 4FQHA 4F92B 3CFEA 4HJGA 4FQQA 3NGBB 3ARBA 3VXQA 2MFNA 1EX0A 5I2IA 3D0LB 2W9DH 1XD1A 3QG6B 5CP7B 3C5ZC 4FP8H 3HC0B 4LIQL 5HHPA 5CIPH 5T1LA 3ZX1A 5BOJA 1WIUA 2J88L 1H5BB 2IFFH 2XRAL 4PJGB 1T04B 3E6FA 1JXKA 4PP2A 1JPTL 4Q0XH 2XZAH 4U33A 2MKWA 4KV5F 5C09E 3SDCD 3T04D 3RWDB 3W11C 5DD0H 3HKFA 2WMPA 5HYQB 2OL3B 5JHDB 5IZ7A 3NIFB 1CE1H 4FNTA 4ZMZA 2I9LA 3VB9A 2OR8A 4NZTH 2CBOA 3B5GA 1TVBB 5F89A 3OKEA 3UAJD 2XZQL 2XICA 1F4WL 4M8UA 3O6FC 1G7IB 3GSNB 4HIIB 4N0UB 1F5WA 2R2BB 4KNSA 4GOSA 1S7WA 1NGYA 4OI7A 3AQYA 3OMIB 2A83B 4XGZA 4Y5VB 3VAEA 1A1OA 1S7UA 4O5LH 4OZFB 5CEZD 3QWRD 5IQMA 3R0MA 3QDMD 3F7VB 4JJ5A 4XVOA 1N70A 4LKCA 3QCUL 2AMGA 2EH8H 3UL4A 1TEYA 4ZMYA 4NQXA 2YC1B 5I1HH 5JO5A 4OGYL 4AIXA 5CIPB 4PBDA 2Y1AA 3NEOA 5E2TL 4R97C 3WBDA 3ZTJG 3M7FB 2CGYA 5HDBF 2VRKA 4X9IA 5IJKC 2E4TA 4HS6B 1BECA 4OLWL 3I9PA 3KYOA 2C9XA 5D1QB 4P23D 3BHBB 2BOBA 4W1TA 3FH8A 2GUOB 3V6FB 2XKNA 3HRZB 3IFPA 5FS5A 2AKRA 1UM4H 2DJMA 2ADGB 1UWGL 3LB6D 3V52L 1EAQA 2UYLA 2XN9E 4XI5C 3SYCA 1NL0L 5BW7C 2COVD 4M00A 3HNVH 5FYKH 3QJFA 4FKKA 4BIKA 5T3XE 2GSMB 4YZFF 1JZ4A 4GSUA 4NO0B 1A7NH 1JPFB 5BZXA 4Z3IA 2J8UB 2X2JA 3PUCA 1ZIBA 2BDNL 3FFCB 2VSMB 5B1CA 1AQMA 1BVKB 2C1PB 4MMYA 5KN5B 2OMXA 2BM3A 5DWPA 4HHWA 1DVTA 2ICEB 2EDKA 4PD4K 1S5HB 5AVXB 2Y7NA 4CNIA 1CTMA 4PLOB 3ATFA 4ZQKB 1UCTA 1QRNE 3INUL 3OLDA 3G6JA 3S4SB 3UJIL 2R59A 5E99H 1NC2A 1C5DB 1T1WA 4GBXC 3V0FA 3N0AA 4ZTPL 3GHPA 2OKMA 1D2OA 5LKNA 4YXLL 3I6KA 3C6SA 3RILA 3QUYB 3TNMA 1A6AB 1UXLA 2IV8A 5DHXB 2I7SA 5DJZA 2ZP8A 3L9YA 3ZT6A 4BFEA 1TJHH 1M1SA 3L3KB 3SO5A 2L8AA 5CWSB 5T1KA 1KN2H 2EYTB 4Y1AA 2EDBA 1URIA 2F8VA 3NDYE 3P40A 1GGIL 1E9QB 1N0LA 4Z7NB 2IV9A 5HYJD 1U92A 3D87B 4MZ2A 3EDKA 4JPQA 4PP1D 3V2AR 1TLMA 3IEAA 2BMKA 1CGVA 1R3LB 1T1ZB 2A9DA 5GQBA 1JG9A 3WTYA 3MV7D 3TO4A 3EOAA 3VSQA 5FDWB 4MA3B 4ONGL 3P0GB 2XG4B 3O2WL 1BD2E 3WY3A 1DVSA 3QP3A 4MNGA 3CCHB 5DJ0B 1YEFH 4TUKH 4DP9X 5C0AA 5TH2B 1REIA 3FK3A 1S9VA 1JHLH 2AEQH 4XBMA 5DA4A 1HJBC 4IBVA 4NIKB 2P48B 1CLCA 5GS1C 5DJ2A 3PLYA 3TN0D 4H13C 4PJDB 5GRUH 3IF1A 3BVVA 4Y1TA 4XCNA 2HRGA 2L7EA 4Z95L 1RUPL 4PW4A 3TL5A 2X4NB 4NYLA 1KNOB 1QPPA 4RMWA 1XGQA 4KTGA 4E9YA 4O4YH 3BKYH 4QXWA 4YHYB 1EDHA 5AAWC 3M86A 3SD5A 3IT8D 1ASPA 4MD0A 4MAUH 5LUMA 4P2AA 3MREB 1GGCL 3WO4B 2GCYA 1T5XA 5TQ0L 2JH2A 1KGXA 4LLDB 5FYKD 2IDQA 3ZE2E 3O3AA 3QWRA 3BLBA 4PMEA 2DTMH 2MWCA 3ZRCC 3LTVA 3QG7H 4HUVA 2VLLB 4ZFGH 1XMEB 3NJXA 4P5MB 4YFDB 4HS8H 5IJBC 5K59F 2P5EA 4AYFB 4LHJB 1NJ9B 2F19L 2WSKA 1OF2A 4DQOH 1B6UA 4OGXL 2PYFA 4YWGH 1YC7A 4CL7A 4IYKA 1KJ2A 1XCQA 1YNKH 1U8NB 3CC5B 3OKDB 1SY6A 4HJJL 3CZFB 2EVJA 6CGTA 3HFML 3UOAB 5G4MA 2MCPL 1LO0L 1IM3A 2DWYA 3LQZB 3NJHA 1QUNA 1GYVA 3C5JA 4G9FB 5DSCA 4LL1A 1PZ2A 3SDAC 3DI3B 4AVIA 2ICWA 2VM9A 5IBUG 1CFMA 4XCFH 3ZKQD 1Y18B 3HNSH 5CZXD 3RHWK 5L7XH 1N67A 3O6LL 4J6RL 3RB5A 5KANI 1JP5A 3NAAH 2XWDA 4F7PB 3LVTA 4JQIA 3QJOA 1I1YB 2DL9A 3ZN6A 3FTZA 3EGSA 3RNKA 1F8TL 3MLZH 4LCCC 1MREL 4GRWB 3DRTB 1U8QB 5HD8D 1I1AD 1R4XA 4GQZA 3UMNA 3WHE1 4AG4L 1A2YB 1JI2A 2ADIB 1O6SA 3SGJA 3D48R 1ECZA 1Q1PA 5KYWA 3BH4A 1MQKL 4KUZH 1JMXA 3LJ3A 3MACL 1CLZL 4A37A 2GI0A 4FXGB 4KK5C 3CVBA 3IWUA 3VWKB 3HE7C 1AGFA 1OAYL 3VRJB 4OLVL 5E4OA 1FN4B 3V8OA 4AIOA 1NBYB 5CNHA 2R29A 4O9HH 3RE0A 3BWZA 5I1KH 3L95B 1S7SB 2UV3A 1KIQB 4ZMPA 1FE8L 1J05A 4J3BA 4FNQA 3GRWA 1OZTG 1T4WA 1YVLA 4U1JA 2M83A 4MJ5B 3Q05A 3VSUA 4XO8A 4Z7OE 3ESUF 1IARB 3C8KB 5ALBH 2QQNL 2KQMA 1T7XA 3MV7A 3K6FA 4BUQA 4WU7A 1RFDH 3GLEA 5E00A 3CLEL 4K3JL 3I9GH 3V0DA 3MLRL 3NUKA 4YHPA 3D3VD 5HPOA 3DX0A 2OMWA 3P30L 5CR8A 5JPMA 2V2WB 3FXIC 2EXYD 3GO1L 3N5AA 3MNMA 4G8GA 2FT8A 1OOAA 1AGDA 3CFBA 3RWCB 3ZO0A 4A1RA 1HZHH 2PCPB 1J0HA 4NRXB 3UO1H 2V8LA 4FRWA 5LB1A 3O9WC 4K8RC 1VKXA 4ONHA 2W0FA 4DH2A 4B27A 1GA2A 2CIKB 1Z9PA 4BQ9A 2W9LA 1E8XA 2VT0A 4NQDD 5A16A 4JM2D 4AOFA 1T20A 5LVEA 1QX1A 5FKPB 1BQLH 5EU7E 5L6YH 1U8HA 5J6GA 2E7CA 2C34A 2H3NB 3GSOB 5G2NA 5FOBB 4MDIB 1BQSA 3L4CA 3RWEB 2JVUA 2VN5A 3MLPA 2V5RA 1E5UI 1FNEB 4JFHE 4JLRA 1BVLB 1E4XL 1ZVYA 4AQ1A 2EDNA 1HXYA 2BVTA 2QTEA 4ZJ9A 4M62H 4WW2B 5EIVA 1Z2KA 2PW1B 3V0AC 4AGQA 3OHMB 4F20A 5DVLA 1KCUL 2VR5A 3H56A 3QFJB 4GAYA 1GC1C 1PY4A 1KBPA 3SY0B 1OY3B 4N5EC 3ZIYA 1UOWA 5EU7C 3SKMB 4F7MB 1V05A 1VEMA 4WK2B 2I32A 2WVUA 2CO6B 2R4SL 2VSCA 3T1WA 1FNSL 1MCFA 1SZNA 5D72L 1E6OL 5EIQA 5AB9A 4X9FA 4X0NA 3RRQA 5DHDA 4DZ8A 3U4KA 4NM4H 1Q94A 3MRLA 4YSUA 5CJBA 4HMDA 4NOFA 4CC4C 3JQOB 1BMZA 5D2LF 3SD2A 1Z9SA 2Q3ZA 4MD4B 2Q9OA 3J27A 4WFHD 3WN5A 1A3ZA 1N4XL 5I5JA 4GKSA 1HNGA 5E4IA 2XTJB 2MPAH 2WTPA 5FUCC 4PWGA 2JK5B 3I02B 2RB8A 3SDXE 1ES0B 4N90E 3HPLB 3WFDH 3GSRA 1V3MA 5BOZG 2EDYA 3NDZE 4NO3A 4JRYB 5C0BE 2CSPA 4IBWA 1TCMA 2D9QB 1OE3A 4UQDA 1GZHA 1UB6B 1QMUA 4RAUA 4KK8D 5AB0A 2DQUH 2GBVA 2EP6A 1VCAA 4M5YL 1UKQA 5C0CA 5AB1A 5BO1H 3RWIB 4LLYA 4XBEL 3VXSB 2OZ4A 4B9CA 1MVUA 4BFFA 3AT0A 1A5FL 4BFGA 5C08D 1VPOH 1JXJA 4F2MA 5GZNC 4X80H 5JUEH 1BVNP 3ABLB 4DP7X 1GOGA 3K5RA 4FG6C 5I8KH 3N1GC 4PJAB 3WL9B 4EIBA 2D3LA 2Y3NA 4YGVA 1EQWA 3PP4H 2W60B 3QAZC 1BMGA 1CGUA 3RL2A 3TT1H 5IQNA 2XA8L 2R23B 1KIRA 2AEOA 5J1AA 3VM5A 3IJYA 5FK9B 5DR5H 3RTLA 1W15A 2FNBA 5TFSL 4TNWF 1HHGA 5E56A 3WIAA 1ZCRA 1ZD6A 3OLEA 4PWEA 1CXEA 4OTXL 4PREA 1ZLWK 3HI1B 2R0KL 2EIZB 3S34L 4A04A 2OZNA 4E68A 2OP4H 4ELME 5INDB 4E9LA 4IIQC 5CGYD 3QJTB 2N0KA 4X9YA 1VGEL 3U48A 1A4JA 3D7PA 2G5BA 3W39A 1SDDA 3ABZA 4LBEB 3WXVH 1QVOB 3PV7A 1U95A 1UEMA 3TJEL 4GI6A 1SQMA 1EAPA 5DT1L 3K0WA 5FYLH 4LEXL 4R96B 4M5TA 1L9TA 2YKLL 2PO6B 3NESA 5IB3A 1N18A 4M6MH 3MLXH 4IU3B 2OI9B 4J4PA 4DETA 2E6PA 4D8PB 3MV11 4Q9RL 3GJEA 3OWRA 5CP3H 4HOMA 5F9JB 3TH3T 2EILB 2ZKWA 3IDUA 4Y2DB 2A1WH 2GW5A 5TPWH 1AS7A 3DMMC 3CH1B 4W93A 1CDJA 2FIKB 2O6CA 2ZOKA 4N24A 3EO0A 1TR7A 1UD8A 4EI6B 2EZ0C 4JDVB 3ULUL 3C6EA 4Y4KA 3G08B 2PPFA 4GI9A 4TSCL 3SE4A 3MXVL 3QJVB 4XNMA 3HA0A 3VXTA 2X4OA 3EGXB 5KSBF 5DURB 3N43B 1B2WL 4W6XB 1GIGL 1HU8A 3G5VB 2VQUA 1M3JA 5AW2B 2OYLA 4LMQE 3FNKA 1CZ8L 3QRGL 3E9TA 1YMHA 2GY7B 3CDFA 3UYRL 3FBQA 5H94B 4IRJC 4MMZC 2I25N 1BXUA 4Z0BL 4B97A 1BREA 4X83A 5AW7B 1JYWA 1YEIL 5GIRA 4OCNC 1MFEL 2EDTA 5HHVH 1QEWA 4HH8A 1LGVA 4KHTL 4PJEE 1WWCA 3L3HB 5FYJU 3DX3A 3CD4A 4PRPD 3C09C 1OSZB 4MJID 5IBLD 1KBGL 4I7ZC 3QIWB 4WAFA 5D7IA 1MI5D 5B3NA 4PAZA 2MPVA 5JW4M 1IQDA 3LEVL 3LIUA 4MX7B 2I60H 3BH9A 3G5YA 4H25B 3LH9A 4TNFA 1ZTXE 4WUKL 4PLJC 2ZX9A 2AV7B 2OW7A 3V5KA 1X5JA 4W9IC 4MQ7A 3AT8A 2UXVA 4XNQA 4DEPC 1Z3GL 1ZHBA 1TZGH 4ZS7L 3O4OB 2WXMA 5ANHA 5FOJA 4W9DC 4ODXA 1GHFH 3HZ3A 3NCXA 1PAZA 1FVCA 2BSTA 3MO1B 3ALWA 2E9BA 1G7LB 3WIIL 2W07B 3BPNB 3KEDA 4KX9A 3V5DB 5A7EA 2MRYA 5C08A 4PJHA 4WDIB 3BOVA 4X6EA 2QL1A 5LAXA 3IPBA 1CL7L 4HKXB 2D0GA 1DO5A 1Y6MR 1RP8A 5F7YC 3L6FB 4JFDB 4HJTA 4QHUB 4WTQA 3T2QA 2VAJA 3KE0A 4HJUA 2B77A 1A6VH 3IU3B 5FF6B 1KY7A 4JFWA 1K2DB 2CHNA 1CICD 1YCSA 2BVPA 5H4YA 1FRGL 3F00A 1FYTE 1D7CA 1ZWIA 3TYFA 4LVNB 1E67A 3KL5A 3DA0A 1CFTA 3TA3C 5I6KA 3KWVA 2BZCA 4FFVD 4MNHA 1WF5A 4FFYA 5E0FA 3F7YB 3IJSA 1EBPA 2HT3C 3DVIA 1QW8A 3ROOA 3QO1A 3R7QA 3A4DA 4JCWA 5D7LE 5TDPA 3HRPA 4QO1B 2RFXB 3KLHD 5FV1L 4KZDH 8CGTA 3SCMA 4D0DB 1Q9OB 1CJYA 3U9UB 2C3GA 3ZZLA 4D0CB 1Z0NA 4NHCL 3EHBD 2ENJA 2W1NA 2XXFA 5JW3L 5TGBB 4JL2A 3KBFA 4IOFC 5KG9B 4C47A 1T83C 3RWHA 3JYCA 4HGMA 3CXHK 1JWSB 1KENH 2WLYA 1R3JB 2EIKB 5DFVD 5FGRA 4QRPB 2CDEB 1AG6A 4PB0L 1QI4A 4FNUA 4EDXA 3WEBA 5DQ9B 3OR7A 2Y5TA 2AK4B 3WLWD 2GSGB 1XBRA 2IADB 1A65A 1WA2X 2JB6A 2FT7A 1KGWA 3JTSA 1Q1JH 3BKJH 2QR0B 4X9BA 1QI3A 2J7LA 3QJXA 2NNCA 4UNVA 1KEGH 1UD4A 3DHMA 3N55A 3JV4A 1GGUA 4Z7IA 4CMHC 2VQ1B 3S35H 3VXRA 4JHWH 1EFXD 3PWPB 3RZCB 1A8JH 1TT6A 2C3XA 2W81C 5HTSA 4P04A 2R0ZL 2Q5BA 3ARTA 3KJ4C 3BT2H 1NMCB 4HKBB 2CIIB 3Q8AA 4A6YL 5A3ID 2HG5A 3TCLB 1A7PH 1ILUA 5FO7A 3JWNE 3LKQB 1F4HA 1HHIB 1PNDA 3MRGB 2QVFB 4M4RA 4B9PA 3SBWC 3R7RA 4PRPA 3RIFK 5DC2A 3SKJH 1JV2A 1FL3A 2H26B 1TQBB 4BWUA 4I4WB 4YMPA 3DXAA 5IV2A 2ZG1A 3PL6A 4RBPH 2EDMA 1MI5A 1NICA 4NSKB 5E2UH 3REVB 3V4VH 1S9YB 4L1HA 4Z78B 4F8TA 4O02L 4DGIH 4NQSA 3WAJA 4WHYH 4L0PB 4HIJB 1ODUA 5GJTL 2BIQA 3EOYG 3BVNA 3LKSA 4PLKD 7FABL 4IBUA 2QADC 1JZ7A 3KYMB 1X5KA 4J8RB 4ZFZB 5EF1A 2I24N 1E4WL 3QZWG 4MZIA 1UA6H 2O5YH 2C3VB 3IGLA 4P9HH 2EDDA 5EUKB 5CCJA 2ZUSA 4PRAA 1T0NB 5I1CH 2UVEA 3VTMA 5J1TC 3MLUH 1SHWA 3DBXA 4CILA 1F3JB 3EW3B 1GJWA 3KM1A 1OTSD 4EJ1C 5EPMA 4H8VA 4U6XB 3T6WA 1ZK9A 3OF6D 1ASQA 2LE9A 3IRZA 2KUTA 1T89C 5I6XB 1GYAA 5CCGE 3DX6A 4PJFA 3MLTA 1OIOA 2KC0A 2X40A 4OT1L 1UJ3A 1ITBB 3SSGA 3TBBA 5KVDL 4MXVF 3V4VB 3MVSA 2H1XA 4F3FB 1A1MB 1L0XA 4HUCA 2JI2A 4KKCC 4D7PA 2AERT 1T4KB 3UDWA 2ZKMX 4X6CB 1GW0A 5IOKA 4XXDB 4JFEB 3VGGA 4FZEL 2DN7A 3R4DA 4ODUB 3QZWA 4LPXA 1RJYA 1X7TA 3TFBA 3K4AA 3KPLA 1KXTB 1NFIB 2LU4A 4Q9CA 4PIBA 4QXTA 5A6MA 3WENA 3QUMH 35C8H 4IOSA 3VQ2C 2O4EA 3ZDYF 4DZBB 3ELAT 3SOBH 4XXWA 1KYOJ 1ORSB 4NKDA 4PR5B 4JO2H 1YG9A 4X6FB 1J8HA 3OJDA 1HTYA 4UYQA 5E2WH 3UEZA 3GD1C 4L5FL 3PYCA 4Z3FA 4ZW3A 3GSVB 4BZ1H 2N1KA 1KF9B 1PSKH 5E8PB 3SE9L 4GSQA 4Y9BA 3VD4A 3HUJB 4OZ4A 4KJWD 1BQ5A 3CMGA 4J3OC 2CBTA 3KLQA 3VJ6B 5JZ7C 3HI5L 3W57A 4L8CB 4XHJC 2IG2H 2FHFA 1YY9C 1E90A 2IWKA 5IVZB 3WY1A 1A7RL 2EDOA 2X5PA 3U1QA 2OMYB 1F56A 4RFOH 2V33A 2UUDK 2WOBA 2H0FA 2HRLA 1OTUC 3CVHH 4QNPF 3DK2A 4MA8L 4DFHA 1G9NH 1EFXA 1KXVC 3QUMB 4CN1A 2VMJA 2XJLA 1FNAA 2IGLA 5D7JD 3II1A 4Z9KB 2MOGA 1Z5YD 3B3IA 4H8WL 5EORL 3RFZB 2K3TA 3LS4L 3SPJA 1I4FA 4ICWA 4QRQA 2FECI 1HIMH 4X4XB 1WYJA 3O3EB 2YPLE 4HHAB 2TSAA 3QIUC 2EIMB 2VUOA 2OL3L 3U6XA 1U6AH 3BCFA 4ZSOA 4M7ZB 4HGKC 3VVVA 5DMGC 3EDJA 2EEDA 1K8IB 1G1YA 3AM8A 4OD3L 1NCGA 1IU1A 4IDJL 1QWHA 4AM0A 3BPCB 1Z3RA 3GSNL 1S78C 3HLAA 4XX1E 1XV8A 4AV0A 2WNWA 4MJ2A 2UY7A 5ISZD 4JFTA 4YL4A 1JNLL 5D1XC 4PJ9D 1W16A 2PXYD 4L4VD 3FYIB 1OB1B 1T2XA 3CVHB 1TZOA 3BUIA 5FC9A 2HPOA 1LMKA 4RAVA 2FLMA 3MZGB 4PY8I 3D4CA 1W72H 2IOOA 1RZIA 4XN8A 3ARBC 4KXBA 4E41B 1PVHA 2FHBA 4KZCA 5HDBB 4NOBA 4K73A 3WS3B 4RA3A 4X6DF 1BIIB 1BYOA 1ITCA 3IFOA 5HJ3B 1CBJA 3FU3A 2XZAL 4S2SA 3OF6A 1MOEA 2IPTH 3IDJB 3RTQB 2BH0A 4S0TD 4YBLC 5DD0L 2YK1H 2PMZA 4LESA 3SKNB 4X8JB 4JO8A 3GHEL 3T8XA 2ZWKA 5DRZB 1HSBA 1CE1L 3NCJH 5F1SA 5L2KD 3VCLA 1W0WA 3CHRA 3MBXH 4NZTL 5EF0A 2XWTA 1BM7A 3VFTB 4G80B 5ACZA 2CK0L 3NFPA 5T1JA 1S6NA 2HFFA 1YEDA 4K7FA 2VKXA 3CFKA 4FJZA 4O5LL 2DD8H 2FX8H 3VQMA 3SGKA 2V4LA 5BJTB 2Z31B 3T6VA 1HNFA 4NFCA 1W72B 2VMEA 3EH5B 4PJXE 1IGJB 2WKOF 2YSTA 2EH8L 3B1TA 5SWSD 5I1HL 2XN0A 5JQHC 2XN1A 4RGOL 1XEDA 4X6BB 4OZHB 1YMMB 4Y1SA 4BHUI 1AO7D 4QGYA 4K4KA 3RWGA 5DJDB 2ZP9A 2K45A 2CO3A 3VI4F 2XACC 1MFAH 3GB7A 2VDQH 4ENED 5CD3B 2H6UA 2YEZA 1AGEA 1MCPH 4CDHA 1UM4L 4LASL 5KUKA 3ZE0F 1NM9A 4HUWB 4JB9L 2QGEA 3MN8A 4U2YA 3UBGA 5J6HA 2EIJB 1ZSHA 3G6JE 3HNVL 4M48L 4K23L 5HHME 4YLQT 2FGWL 1MNNA 3K91A 4G7VL 3RVVD 4U0QB 2DWEA 1A7NL 4AZ8B 4ELKB 1IC0A 4S11A 2G2RA 2NUPB 4J12A 1QR4A 2VC2H 4PRNA 3EH3B 1FVEA 2KT6A 5GSRA 1AGBB 5B8CA 5D7JA 4HZLA 4GKLA 2ZIDA 3FQTB 4FLSA 5GZOA 2LW3A 2V5YA 3EADA 4Y1AE 3UX9B 4UT9A 1YJDH 4RX4A 1PF3A 1FH2A 2FCBA 2QGCA 1A6WH 1N2RB 5SWQB 3UTTE 4CMMB 4DW2H 4ACTA 5E99L 3PRZA 4MLSA 5DC0A 4XMTA 1KLUA 1X3DA 5T3ZL 1NIAA 3QUZD 4LPTA 2VDQB 4OFYD 4HU8A 4DVBB 1USZA 4XVUC 1GTFA 1BF5A 1DBKH 4N4YB 4XODA 5A2JH 1I8IA 1AZNA 4WO4C 1TJHL 1MCQA 4PV8A 4ERSL 1HQ4A 5F9WC 4A2GA 5C0AE 2JMRA 1KN2L 3TWYA 4KK9D 2XFXA 5EBLB 2EICA 2EXWD 3UTZB 1X5LA 4Z7VF 3TV8A 3VGDA 4ONFH 3WTWA 3T9WA 1MELA 1NEPA 3BXNB 3VFSA 2VC2B 3ZYOA 1EZLA 4WUUD 2Z91B 3TO4C 3ULVD 3EIFA 5DEFA 2ZXDA 3WJMA 4F7EA 1I7RB 1WZLA 2NW3B 4PRDA 3FMGH 4W9LC 3EJUA 3V79C 2LOEA 1JHLL 2AEQL 2YD4A 4Q58C 1P7KA 1XR9B 2FQDA 3MJ7A 3O8XC 3X3GH 2O6PA 2PNDA 4AXWA 2F54D 5GRUL 3QJSB 3SDDD 4LVOB 4FFWD 1FNLA 2LR4A 3OKMA 5I73B 4MNQD 2Y7QB 2A4ZA 3B9VA 5BZDB 3RVXD 3GIVA 4KITB 4MS8D 5FXCH 3DETC 3O3BA 5JPNC 2WKGA 3IXTB 2ZCHH 2P5EE 4Y16A 1TTBA 4O4YL 3BKYL 4LAQH 2BS71 3N50A 5SWZB 4WSKA 5F1NA 3DNKA 3GI9L 4MAUL 3IJHB 4BDVA 2HP4A 5KBKA 1QI5A 3QO0B 4B7LA 3QZMA 4JZNB 4UM9D 2DQCL 2DTML 4NWUH 3T4YA 2IO5A 4LOUC 4Q6KA 1I7ZA 1OD9A 4IJTA 1HH6B 2Q2LA 2X88A 4H26B 3MBED 1W0VB 3QDGA 5DO2D 3WSQL 4AZUA 1YYMH 4G70B 3FUKA 3DHPA 1U3HD 3FOLA 4ZUTA 4YWGL 3B2XA 1RK1A 1RJLA 3UABA 1AVAA 1F6AA 2JCCA 1YNKL 2WNGA 2ZD0A 4N2IA 5JHLH 2ITDA 2EE0A 3ZPDA 4UQEA 1GY2A 2Q0ZX 3UAAA 3MRPB 5EN2B 4WENB 2M26A 1XHHA 1X6LA 2Y72A 3U1PA 3S97C 4AC2A 1CLOL 4WI7A 2OYMA 4XCFL 5ID1B 4JPVH 2Q7YA 5H37G 3HNSL 1UM5H 5L7XL 5JXED 4ORGA 5F7EH 5E6ID 4AYBA 5E95B 2AQNA 2GTZB 1OCWH 1J5IA 4LPCA 1HILB 4HK0A 4ZW6A 5C8JB 1KLFA 1ZA6A 1LM8V 1RUQH 2A6IA 4WGKA 1BPLB 1DBML 2P7TA 3ETTA 4AUUA 1BYPA 2X6UA 4I87A 2N01B 4TOYH 2QVIA 3MGOB 1U3ZA 4BFOA 3UYPB 1IGCL 3QHFH 4XO4A 3LD8B 2QGBA 3LQAH 5E70A 3CQFA 4QTHB 4I9WD 2D8KA 3T0EC 2CGZA 1SYSB 4YXHH 3WJJA 5C0GB 2HMIC 4NPJA 2PTTB 1OM3L 1XCXA 3LS5L 3QUZA 2LT9A 2X1OA 3VQLA 1CE6B 2P28B 5DWUH 2VOTA 1EHNA 1P6FA 3IBOA 3NJMA 4BCXA 4TS6A 1ORQB 4BFNA 4YHLH 2OMUB 5E1AB 3EFFB 4OCLC 3H9SB 3MROB 4TNGA 3IFLH 4G8GE 5EU6E 5H37A 5I1KL 4FGMA 1S9KC 5T5NF 4EF3A 2OTUB 1IAIH 3PGCA 1HFUA 4M7LT 3U2IA 3O6KL 1GS7A 4QKXB 3K4ZA 2FX7L 1FO0H 3W82A 4MZRA 4Y19A 4K7PH 4CSTA 1XO8A 4YSDA 5ALBL 1AJ7H 1CLYH 4Y5YA 5I0YA 3T2LA 4XVJH 3EFDH 1HESA 1OO2A 3WEXA 4WUUA 1RFDL 2IPUK 3C60A 5AG8A 1PD6A 1D7BA 4FHKA 3V4LA 1Q9WB 1SMOA 3IXAB 3I9GL 4MQXD 2AHIA 1MJ8H 1JBJA 7TAAA 3WAKA 1NTDA 2OMZA 5A2AA 3OG4B 4N1EA 1YNLL 3ML9A 2MJWA 4MWFA 2WIIA 3OPZH 5DU7A 4C54A 1OAKH 1HZHL 4APQD 4LCCB 4Z7UF 4MXWH 2D0FA 1AQKH 3SDDA 3RB7A 4IIZA 3UO1L 3TYGH 4LK4A 4M8VA 5DF0A 4MNQA 3AT9A 5BZZA 1O9ZA 3SQRA 4J5VA 3BE1H 3VFVA 1F4AA 1UXWA 2V17H 3HB3D 4B50A 4F58H 3KPMB 4FOMA 1U8IB 5D2LB 2ENSA 1VFBB 4A7SA 5L6YL 5KYYA 5LXGH 1FO0B 2EE2A 2G60L 3VW3L 5ANMB 1I1FA 2VDMH 4AJVA 1BP3B 4UM9A 4YSOA 5ESVA 4Z7WE 1A47A 4N2NA 3LKPA 3MXWH 4JKWA 2OK0L 2FQGA 4V1DD 4JKLA 4M62L 1KTJA 1U3HA 4XN4A 3NJGA 3TZVA 3QJHA 1PKOA 3RA7L 2EEFA 2J55A 4XMXA 3EFOB 2WBJD 1M05B 2J2ZB 4HIXH 5EEZA 5FYKU 3FQNA 3NRQA 5C0RH 4K3EH 5DQDH 1HDMA 1NEZA 1TCRB 4OM1L 2DWTA 5IQ9B 1UD5A 1HL8A 2NYKA 3KLAA 3T4AB 2IAND 5IF0A 2VJ8A 5FX3A 1QLEL 5GGRB 3ARFA 2DQGH 4B9ZA 5C0FB 3IMBA 5JXEA 2HN7B 1R19A 2OMVB 5IHZB 4Y4FB 3QE5A 4DCQA 2VDMB 2ISDA 2X4SB 4Q9QL 4JNXA 2YBGA 2P5WA 5I0ZA 4Y4HA 1TG8A 5AG9A 1MHEB 4AVJA 3RGHA 2ATAA 1H3UA 5C0CE 3D2UA 1MWOA 1CGSH 2MPAL 4LSVH 2AK1H 2DQIL 1ZXQA 4LCUA 1TZIB 1TYEB 3QI9B 3HG5A 4F2ME 5HVHB 1S8DA 3DJZA 4NKOA 3K1KC 1CFNA 4ABUA 1T0MB 2I9TA 2YQGA 3ZKSD 1SXNA 1INQA 2QKIA 4DP1X 4KKNA 3KVPA 2ZXBA 2CO7B 2BSSA 3IJ7A 1TVDA 2DMGA 1MDTA 2ZYSA 1UXSA 2DQUL 1GZHC 2VERA 1DL7H 1S9XB 2EE6A 1J18A 3K74B 3ZHNA 1B0GB 2JE8A 2NXZD 1JK8B 4GG6F 5BO1L 3V0WH 4YGAB 5ERWB 3ETBJ 4M3KB 2ZICA 4X80L 5DJ6B 5EZOH 5JUEL 4XN1A 5E9DB 4H4NA 4HIHB 1IEHA 2V3EA 1LDSA 4F7KA 4UQ2A 5I8KL 3MGTA 3OKLA 1X9UA 3HZYA 1SHMA 5DS8B 4BH7A 4QLWA 1AI1H 1WRFA 3VI3A 3PP4L 1T5WB 5F7AA 3TT1L 2ARJB 4AENB 2AXFB 1HL9A 2ZF9A 4GS7B 5CBAB 1B6DA 2HLEB 4JY5H 1YN6B 4CRPA 3ZDZB 3DSFH 3BAIA 2FSDA 3MRNB 3ZRSA 5DR5L 1FI8C 3BWSA 3EBAA 1CDBA 1ZLVK 4HG4J 2CGRH 4XZUB 3NJVA 4DIXA 3GMQB 3LKOA 3M8OH 3OWEA 2A4CA 4JZJB 4FXKC 1A02N 3P9LA 4ODWA 4ZAKD 3IJEA 2XNAA 4TVPE 4P4KC 3VXMD 1I9RL 1HX0A 2XPGA 3P77B 1EEZA 1HXMA 4YHZH 4R7DA 3WXVL 3CZKA 4RRPM 5B21A 1Q0XH 4PJ5A 1MAMH 5FYLL 4YDKH 4GT0A 1IAII 2N1TE 4QT5A 1HHKB 3QRFM 3GXFA 3OZ9H 3L9RB 4M6ML 1IE4A 1VADB 3EG9A 4V1DA 5MEND 2X28A 4J4PC 1NKOA 5FM5O 2KDGA 3UADA 1C12B 2NSXA 4H1LG 1DN0B 5C0JB 1LL1A 3JWDH 2A1WL 3BAKA 3OAYH 5TPWL 4AIZA 1OD7A 3VRIB 5CD5C 2F58H 4I3GA 5DFWH 4A6YA 4FABL 4HUUB 1N0XH 2WBJA 4MCMA 4YDZA 4M3HA 1JPGA 4IJ3B 1WS7A 2IAMD 3NIGF 3OM3B 3S96B 4TF4A 1MCLA 1DP0A 1QHQA 3B2VL 5EFIB 4P5TB 1GR7A 3DUUB 1HWGB 4Y4KC 5I9QB 1DCEA 5T33H 4KOCA 1JJUA 4FYTA 5E8EA 3D09A 2XQBH 4BWWA 1NDMB 4O02A 4FQ2L 3HJ0A 4LLVB 2VN4A 3GHBH 4CDGC 4E0RB 1HHHB 5DFAA 1E27B 3AFLA 3BEVB 5D7IE 3WDHA 4W9GC 5I66B 2LGNA 4PBVC 4A66A 1CIDA 5HJGA 1G7MA 3OX8B 4KJQC 2IVFC 2BVQA 2ZSWA 3L3OC 4WI9A 4UZUA 3UTPE 3VGEA 5C92A 3OD3A 4U3SB 4NNXA 5HHVL 5AB2A 4PW3A 4KROB 5DZJA 1M2VB 1RUMH 3OKKA 2AQQA 3UBXB 1FGVL 3ESVF 3TOPA 4KKLD 3T3PF 3RZWA 1XAKA 3B9KD 4WIQA 1RVFH 3KGSA 1KT2A 2AAVA 3QB7C 3LRLA 1WBZA 2DM7A 5DYOB 5DMYA 3NCCB 4EZMA 2CCVA 5C08E 1J0IA 4PJHE 2ZG3A 3EYFA 2DRUA 1ZE3H 1SYVA 3D51A 3L1FA 5E8NB 4BE6A 3U2SA 1MCSA 4LPWA 4X2UA 2NY0D 4DOHE 1G7JB 2VDKH 4AKOA 3RL1B 4LEEA 1TZGL 5HXMA 2IC2A 5KUMA 1SJHA 3Q8EA 5EV7A 4QOKD 3GXDA 2FYVA 1YN7B 5IB4A 3APMA 3ISWA 3HLKA 1IGIH 2NTFB 3NCBB 1S7VB 2IGFH 4OB5L 3IE4A 1OGPA 3GSUA 3KDPB 5DD1H 1L7IL 1OZUA 5F0PB 1HH9B 3FQRB 5JMOC 4JANB 4OI9A 3EJCA 3H3PH 5HDWA 2HTKC 3AACA 3MLSH 4D3CH 3UP6A 1A6VL 3RVTD 2NY5C 4K5LA 2VE6B 2CPCA 4FULA 5LBGA 3VE0A 3LNHA 1C16B 5L8LB 2ZTBA 4OCRL 2GT9B 3R1GH 5K9OA 3FQXB 3E8UH 4KJYA 3FU7A 2UWEF 1VEOA 3VFUB 3NK4A 5JR1H 4NAMA 3VFPA 5K39B 4ES9A 5FO9A 1B3IA 2VDKB 5I76A 1JPSL 1VERA 1G6RH 3AUWB 4LSTH 3CU7A 4U1GB 1QP1A 3UG5A 4JUSA 4ZAKA 5BZWA 3SOTA 4KZDL 3N04A 4UDTA 5EBWA 2FECL 1NFDA 4U1IA 1JERA 2D03H 4MXQD 3TFKD 3SCMC 1S9WA 3M46A 2JF1A 4GFTB 1EUTA 4G2AA 4N22A 1I75A 1UURA 3UZEA 3ILQD 1FFNB 2FZ3B 3OMZA 4D9QD 4DEPB 4DUWA 1KGIA 4JKMA 3L54A 1VEPA 3H42H 4LP4A 2X0VA 5H35A 3DIDA 4DP4X 2BRRH 4OZFG 1TLKA 2YAOA 3P4NB 1WS8A 2TAAA 1KENL 1DCLA 3WJLC 2GK2A 3QG6A 1LDPH 3VXRE 4GKNA 4CW1B 1WUNT 2BC4B 3FB7A 3HC0A 3HOGA 4PJGA 1JHTA 3EBGA 3ISYA 1FP5A 2WXKA 5I6OA 4HJ0D 3RWDA 1Q1JL 3BKJL 5D7SH 3ARQA 1E65A 2APTA 4ANVA 5T3ZD 2WHVA 3FDWA 5HYQA 2OL3A 4PFEA 5JHDA 1FSKC 2C7UA 1RJZB 2KBGA 1J5OH 1NH6A 5E9AA 3AITA 3S35L 4RWHA 3DXAE 1G6RB 3NYKA 3GXNA 3QAQA 4LIQE 3ZKMC 5KANG 4AT6A 4JHWL 1LEKB 1MFBH 4XNXH 1MI5E 5E6RB 3GZOA 1CD9B 3GSNA 4N0UA 1QSEB 2F7OA 2R2BA 1MW3A 5ICYB 2OJZH 3UTQA 3BT2L 2PWHA 5CZVH 2ZWLT 1A6PA 4OZFA 3FUHA 5FFLA 1A7PL 3F7VA 1ZLUH 4DKTA 4YBQD 5EO9B 3VACA 4PM1A 4GNKB 1ICTA 3A4FA 3SKJL 1KCVL 2JIXB 2YC1A 3B9KA 5CIPA 5TD4A 5E2UL 3PL6C 5DI8A 3V4VL 3K1DA 4NCC2 4ZXBD 3S4SG 3BZEB 4DGIL 5I26A 4TSBH 1TKWB 4BQCA 5ID0A 2E7LA 3TIEA 3D0VB 4F33B 1XF2B 2OX5B 4A7GA 4URKA 3CFDA 4MCZA 3GUFA 3WXWH 1OW0A 1SN5A 2ADGA 4PJFE 3D9AL 1S7RB 4QY8B 2BCKB 1UUSA 3BSZL 1UA6L 2O5YL 3FN9A 4JRXA 4PS3A 1FJ1B 4YDIH 3QORD 3WE1A 1USQA 4GAGL 3GZPA 1SNRA 4Q4EA 2FO1A 3GDCA 5I1CL 1DQJB 1R33A 2HCZX 3MLUL 3L3DB 4B9IA 4GUOA 1C08B 1O5DT 3S36X 2J8UA 3HR6A 1KXQA 3VXUD 3OAZK 1F4YL 3I85A 4Z76B 1EHXA 1AXTH 1BVKA 3BGMB 3V9CA 3QGVA 5KN5A 5DMKB 4W4OA 1S5HA 1KTLA 3EOBA 4DVRH 5GRWA 2ESVD 4Y5XC 2YEQA 3H4HA 3B43A 4H2CA 1QA9B 2CJ3A 2NQCA 1UJ3C 2ZUUA 4FJYA 4LCIH 3S4SA 1EZVY 2GG1A 1C5DA 1K5WA 3W0WD 1Y1UA 1KGCD 1J8HE 6TAAA 1HSAA 3UDWC 3IDGA 5CJOL 3QUYA 1AP2B 1A6AA 1BDYA 1WK0A 3QNXB 5HDRA 3FTYA 4IGBC 4EBQL 1P7QB 5K9JH 3L3KA 4I18B 5IESH 5CWSA 2ZG2A 1MNUH 2EYTA 3QUML 4EN2A 4L8DB 3WEOA 5I8EA 4PG9A 2C9UA 1FHNA 2QADB 1OCRB 2ENPA 1MCRA 4XXWC 4JO2L 1T1ZA 4LVEA 4TLKA 2XZCH 5SX4H 5E2WL 9CGTA 2JSFA 5FDWA 4MA3A 4LCWB 5FGSA 5EWIH 4BZ1L 4EIZC 4KNQA 1PSKL 1IIIA 3GSQA 2VZ1A 4X42A 1UASA 5TH2A 1TSHA 3PIQB 5JHBA 2IG2L 3ZVVA 3N42F 3JBG7 1D7DA 2FUTA 4AKQA 1LVEA 2B1OA 3VM7A 3WLBA 2F53B 5L4JA 3WHE0 1W8NA 4RFOL 1KNOA 1JZJA 5ELIA 3CVHL 4FTVD 4ZSOE 3G9AB 2F1BA 4G71B 3TBSA 5IFJB 1I82A 1L6ZA 4XE5B 2YN3A 4U31A 5AZUA 1KV3A 1N68A 3KCPA 4X6DB 2A77H 2BPBA 3STBA 4BSJA 3HZKB 1JNJA 2CXKA 2X89D 2V2TB 4PMFA 4FD0A 5EF3A 1I85C 3CMOL 2MCMA 1BBDL 1LNUA 2QPFA 3OKOB 4R7XA 1HIML 3ECBA 3FUEA 4L3EB 1QFWI 1MCKA 2HG0A 3Q8FA 5EU4B 3II3A 3BW9A 1H3TA 2Q6WB 4MAZA 2VLLA 4Y88A 5ACLA 2NR6C 4Z3GA 4LCWD 4AYFA 4WWKC 5DJCB 2NX5D 5L8JB 3DRQB 3KPRE 4ZXBA 1QBBA 1QQDA 5C86A 3TEYA 4N6RA 3RIFF 4Q74A 2ZUQB 1U8NA 1CD8A 2I69A 3CC5A 1TTAA 3DPBB 3OKDA 2PTVA 2FJUB 2HX8A 3CZFA 1I7UA 4XP5H 5AYUH 3LQZA 1PCXA 3A3YB 3FCSA 4XVTL 4MCNA 1T2JA 4F9PA 2XQYG 2FAUA 2O5ZH 4AYEC 1DQTA 5I16B 1OGAD 5TDOB 1ZT1A 1XZWA 3ZDWA 4EOWL 2XBZA 4X5QA 5KBPA 4XNZC 1DVZA 3N40P 3KVDD 4HWBH 1DR9A 1SLVA 1KJVB 4S1RH 3RGVD 1FCGA 4ZPVB 3VX1A 1BIHA 4Q6IB 3QQ9D 3DJSA 4I0PD 5LO7A 2R7EB 1I1YA 4ZX6A 1ZDSA 3VI4B 1FZJA 3LEXA 4HMEA 2IPTL 4P0DA 4XTRC 1E28B 4QHLB 2WZAA 1MFUA 4HEPG 3DRTA 5FECB 1U8QA 2BSDA 3ZE0B 1A2YA 4M02A 4JKPH 5EZLA 2ADIA 1B88A 3NCJL 2JXMA 3U7YH 4FCAA 3MBXL 3PAVA 3KWWB 4YIQB 3BKMH 2AQ3A 4V33A 3CBJB 1XH1A 1BLNB 1ETA1 1UJTA 1U8CB 3QQDA 1ZHKA 4MA1C 3U6XS 1C9SA 3BVUA 4WY7H 2O6EA 1HE8A 1X7QB 4H0GA 5KVGH 3MJ8A 2XQYA 4G6JL 4XCYA 4KKAD 2FX8L 3L3IA 2OCCB 1HL4A 1ZY9A 1S7SA 3L95A 3QUXC 1KIQA 2VDPL 4PCTA 4B7IA 5BMFH 5C0NC 1WZMA 4P2QD 3Q9QA 4FXLA 4E42B 1J10A 4O2CA 4DKDC 5CSGA 2KH2B 5D1XB 4R4BA 1ETZB 1YLBB 2ADFH