2PP7A

Crystal structure of anaerobically manipulated wild type oxidized afnir (acetate bound)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp7A02
3AG1B 3QJRB 2WSDA 1ET5A 3T6VA 2XYBA 2WO3B 6PCYA 3AG4B 4F2EA 1AQ8A 3SBPA 5I6LA 3HB3B 2CCWA 4A68A 3WG7B 5B1BB 2GIMA 1E65A 1AG0A 1V55B 2OJ1A 1AZBA 1MZZA 4F7KA 1W8EA 1GYCA 1DYZA 3NYKA 2FQDA 4GP8B 4UANA 2H5UA 4YSEA 3UAEA 2H3XC 2J56A 4YSDA 4QKTA 1NIBA 2AFNA 1J5CA 1A8ZA 1WA2X 4N4YB 2HRHA 3NJIA 3SBRA 3S3DB 1YLBB 1JZGA 2HRGA 4JHUA 1GY1A 4KO5A 3AW5A 1CURA 1AZNA 3JTBA 2HLEB 1ZDQA 3WNIA 3UACA 1ASPA 1IC0A 3C75A 4E9XA 2H47C 2YAPA 1PLBA 5I6KA 2XU9A 1N70A 3IE9A 1ID2A 1EHKB 5B1JA 3QJTB 5ANHA 4AKPA 1GY2A 2GBAA 1SNRA 1JZJA 2P80D 1J9RA 1JXDA 3QPKA 3X1EA 4FA7B 2GC4C 3TASA 2ZONA 5I6NA 1TKWA 3FU8A 2XV0A 3PAZA 1BXUA 2R7EA 4AKQA 2YAMA 1RKRA 2UXVA 1L9QA 2TSBA 2FTAA 1JZFA 3PAVA 4UF7C 1N68A 5B1AB 1KCWA 4KNUA 3FYEB 4KO6A 2BP8B 2PCFA 3NJNA 3NP4A 3NSYA 3CDZA 5D4IA 1B3IA 4CSPA 2XUWA 1ETJA 3SQRA 4M3HA 2QDVA 4E9WA 4A2HA 3FSZA 4YSSA 1AR1B 2YAHA 2ZWNA 3FQYA 3L45A 2BHFA 3DKHA 2AZAA 4A2FA 2IWKA 1PY0A 4QLWA 4MFHA 2CALA 1AZUA 1SFDA 2VW4A 2FQEA 2AVFA 5B1JC 2NRDA 3IN2A 3FPXA 2IDTA 1ET7A 1NTDA 4HCFA 1KCBA 3HEIB 4KOCA 4YSCA 1E5YA 3IN0A 3PPSA 2IWEA 1HFUA 1CC3A 1ZIBA 2BW4A 3CVDA 3NJHA 1EZLA 3FPYA 2VM3A 4E9YA 3CZUB 4GP5B 4YSOA 2QPDB 2CBPA 2W88A 1NDTA 3NT0A 1GW0A 2QT6A 5I6PA 1AOZA 1AANA 3TU6A 2GI0A 3T9WA 4GP4B 4YL4A 1W6LA 2EINB 2TSAA 2HXAA 1ASQA 1XB6A 3IEAA 4G71B 1NWPA 1BAWA 1A4CA 5F7AA 1SFHA 1AS7A 2IH9A 2OCCB 1PZBA 3FT0A 3IBOA 1GS8A 3N2JA 4BDVA 3EF4A 2FWLB 3GYRA 2PP8A 5TK2A 4F2FA 4HHGA 8PAZA 3OM3B 1A4BA 1I53A 3ABLB 1JERA 3TA4D 3FYIB 4TXVB 1AACA 3T71A 4DP0X 1HAUA 2I85A 3ERXA 2R7EB 5E9NA 2A3TA 3OQRA 7PAZA 2XVBA 4PAZA 1PLCA 1CUOA 3FU7A 3QQXA 1URIA 1BYPA 3CDZB 2YAQA 2VSMB 3UABA 4G7RB 1FFTB 1PCSA 4YSPA 1W6WA 1WS7A 4NAJA 1ZPUA 2B08A 4DP9X 2EIKB 3BVDB 1GS6X 5AZUA 2GB2A 5IY5B 3FSVA 1J9SA 1GR7A 3CG8A 4HCIA 5A7EA 1ILSA 2AZUA 4AZUA 1PNCA 2DY2A 1HAWA 1OE3A 2X88A 4DP5X 4G7QB 4A67A 1JXGA 2PPDA 4W1TA 4AX3A 4KNSA 4Q89A 1ZDSA 2FT7A 1L9OA 2FT8A 4YSAA 4DP1X 1E5ZA 4UAHA 1SDDA 3MX0B 1RZPA 2XX1A 4WTQA 2FQFA 1MDAA 2VSKB 2IDUA 2HX7A 3NP3A 3OD3A 1OCOB 1OCCB 2PPEA 3PCYA 4KO7A 2OV0A 4HHWA 4JKNA 1JZIA 2EIJB 1X9UA 1ZIAA 2BWDA 2UX7A 1J5DA 1ADWA 2JKWA 2JXMA 1PMYA 4E9TA 3UADA 2WO2B 3FSWA 1M56B 2PP7A 5AFAA 1AS6A 1WA1X 2FQGA 3S8GB 5LDUA 3H56A 1JVLA 2EIMB 5B1KA 3EHBB 1SF3A 4KNTA 3NJJA 1NIDA 1BXAA 1BXVA 1A4AA 4BDVB 5B7EA 1SHWA 3NSCA 4KO9A 5F7BA 2E86A 4A66A 1NICA 3GDCA 4EF3A 3GXUB 3H4FA 1NZRA 2BZ7A 3TBCA 3T6ZA 2XXFA 1AG6A 1L9SA 3X1NA 1AS8A 3X1BA 3X1GA 4DPBX 1V10A 4E9QA 2XWZA 1QNIA 4Q8BA 2BW5A 3CVBA 2VM4A 2IWFA 4P5RA 3FU7B 4M4RB 1SHXA 2DWSA 1JXFA 2PLTA 3H4HA 2IDSA 1WS8A 5B7FA 4P5SA 1MG3C 1WA0X 2VN3A 4GYBA 2HZHA 2LLNA 2IDFA 1XB8A 2XLLA 4BWWA 3EH3B 9PCYA 2HX9A 1AIZA 2YAFA 2BP0A 1OCZB 2FJSA 1SF5A 1A65A 4CSZA 4NERA 1NINA 5I6OA 3WKPA 3ZBMA 3FS9A 1OOWA 1TEGA 2J5WA 3D12B 5D4JA 2GSMB 1ZV2A 2QDWA 4YSUA 4A2DA 3RYMA 3X2QB 1SDDB 2YQBA 4BXSV 2I7OA 3QJQB 4AI7A 4X4KA 1ET8A 4HCGA 3QJVB 1E67A 1L9TA 2XX0A 2ZOOA 1NIAA 4W9ZA 1M9WA 3WNJA 2YXVA 1BQKA 5I5JA 3TBBA 3ABMB 1KDIA 2FT6A 1QHQA 2YAOA 3FQ1A 3V9CA 1OF0A 3DIVA 1PZCA 1IUZA 5PCYA 3FSAA 1CYWA 5TK4A 2I7SA 3BQVA 2CJ3A 4DPAX 1IBYA 1SJMA 4DP4X 3WI9A 1PLAA 1TU2A 4YSQA 5B3SB 3OMNB 3NJMA 2ZXWB 2J55A 3ABGA 3KW8A 4ENZA 1L9RA 4YSTA 1KDJA 1ASOA 3QJSB 3SBQA 3UAAA 1TEFA 2X87A 5PAZA 4NB7A 4HIPA 5EHFA 1JZHA 3ASOB 3U25A 5I26A 1KGYE 4YVNA 4BWUA 5I5IA 3CVCA 3EH5B 1CYXA 2DV6A 3NJGA 3G5WA 3ZDWA 1X9RA 3S3BB 1NIFA 2VW7A 3UGEA 3ASNB 1NPNA 2DYSB 2XV3A 3S3CB 3T6WA 5D4HA 1MG2C 1IKOP 2YXWA 2GHZA 1JOIA 1PNDA 4DP2X 2B3IA 1PAZA 2J57A 1JZEA 2IH8A 3MBWB 4DPCX 2BWIA 4G72B 2QPEB 4DP6X 3ZIYA 4YVUA 5I5MA 2BP0B 3PAUA 2BZCA 1XB3A 1R1CA 4HAKA 2FNWA 1AAJA 2CAKA 2GC7C 2YAEA 1GS7A 4BK5C 1FA4A 3NJLA 3OMAB 6PAZA 2XV2A 2P80A 1BQRA 1QLEB 3ABKB 4L0PB 4BWTA 2VMJA 2YARA 3WIAA 3PXLA 2Q9OA 2EILB 1OCRB 1NIEA 1ILUA 4KOBA 2AANA 1XMEB 3WKQA 1A3ZA 3X1FA 1KBVA 3AG2B 2HX8A 1KBWA 2UXFA 1UATA 2RACA 3AG3B 4N8UA 4K9JA 1IBZA 4DP7X 2Y1AA 3N55A 1KV7A 4GXFA 1VLXA 3S8FB 2MTAA 1L9PA 4E9SA 3T6XA 1M57B 1FWXA 4ZK8A 1OE1A 1RZQA 1AZRA 1WAEA 1OE2A 3AY2A 1NPJA 3KW7A 4RH4A 1J9TA 1E30A 2PCYA 1BYOA 1KYAA 2W8CA 2PPAA 7PCYA 4WKXA 2JFCA 2PPCA 2BO0A 4E9VA 1BQ5A 2Q5BA 3FQ2A 1PZAA 3NJKA 3OMIB 4DP8X 1T5KA 1PF3A 1MZYA 2IDQA 5FC9A 1V54B 1NWOA 4YSRA 4G7SB 3ZX1A 1JVOA 2PPFA 2PP9A 3JT2A 4A2GA 4BXVA 5B7MA 4JHVA 3AZUA 1DZ0A 1RCYA 2IAAC 2VW6A 4PCYA 2CUAA 4A2EA 3EH4B 3PLYA 3QJUB 2DWTA 1F56A 2DYRB 2MRYA 2UXGA 2UX6A 3NSFA 1GSKA 4FAAB 4HALA 5I6MA 1J9QA 4HZ1A 1AZCA 2BP8A 1BEXA 3NJFA 4GY4A 1OV8A 5I28A 2UXTA 3DTUB 3FU9A 3NSDA 4AKOA 2XXGA 5AKRA 3V9EA 4E9RA 2N0MA 2Y69B 4G70B
chains in the Genus database with same CATH superfamily
4ENED 3II2A 4WW2F 1ID5I 3K8KA 3VFWA 4ZSOA 3L08A 5B39B 4BQ8A 4MZRA 3QJFB 3L6FA 3HC3H 5GPRA 3A6CL 1CL7H 5TDPB 1X5XA 5AOIA 4F7KA 5F21B 5HDLA 4PJBA 3CVHL 1YA5A 2DTMH 3OSVA 5JDJA 3P69A 2YZ1A 1ETB1 3FO0H 4BUHA 4MD4A 2XG5A 1ZLUH 3U7YH 3MOBH 3N42F 4Y19B 2EXTA 2VISA 4XZ4A 2XVLA 3IGKA 2XZQL 1HILB 2BP5M 3HG3A 1J18A 4PG9A 3B2DC 3O3AB 4XNMB 1ZTXL 4OTXH 4UT9H 4URTB 3UBXB 1JZGA 3TBYA 2WVTA 5EULV 3NFPB 3I9GL 4I3SL 3QUYC 4M48H 4ZFFB 5F9JB 5EG6C 4RQQA 4OJDH 3K2UH 1LP9E 5E1HB 4A2LA 2QKIA 2W81C 1JNNH 2CUHA 3UZQB 4UINL 2ORBH 4ANWA 4QAWA 3IMRA 3VGAB 1R3HB 2CHZA 4QNPE 3B8YA 2XRAL 1QABA 3H2PA 4UQDA 5I8EA 4HZLB 1TQWA 4OJYA 4RVBA 4LVOC 2BOBA 2BH0A 4H1LG 4LHUG 5K9KB 3T0EA 2FE0A 5E8PB 3ARPA 2Q6WA 1FI8C 2MOVA 3QFJA 3TASA 4HWEH 4PUBH 1RJLB 4YPGB 4ZAKA 3SJVE 3HMXA 2WXQA 3ZKNC 2IG2L 4W9KC 3JTSA 4QWWD 5HHXL 3T65B 3QXWA 5AKTA 1NKOA 3MBXH 3QQ4A 4X6FA 2WLKA 4XO8A 4ZW8A 5I1DA 4KO6A 5DDHB 3WFCH 3EJSA 1S7QB 1AZZC 3WTSA 3BUYB 4YDZA 2F19L 1K6QH 2NY1D 2ZPKL 3E38A 4PTUB 4ZO9A 3TO4A 4HF5L 5C0GB 2H0EA 5I17A 4JGMA 3JXAA 3RL2A 5B39G 2GABA 2UWEF 3NCEB 2QKIC 3ABZA 3KBPA 5E6ID 4A2FA 1CJYA 3BZFA 1YEDA 5FPIA 2R0ZL 1G9NC 2EDBA 2WINB 3VI3A 3BAWA 4PLNC 3KPRB 3QEUA 1AZUA 1YN6A 1TJHH 5GISL 2ITDB 4Z7OF 4IRZA 4PJEB 4EZJA 5J1AB 1R3JB 4V2BA 2A4CA 2PYEA 4M7ZC 5FFLA 4FKEA 4D3CH 3PWPB 1S7RB 2QFRA 3WDHA 1G7PA 2L0DA 2YEZB 3T0EC 1YEJH 1RZ8B 3AT0A 2NY2D 3DJ9A 1F3JA 4HEME 5K9QI 3W37A 4OLXH 4G6FD 5CP7A 1YMMD 2D7OA 3KYAA 4ZAKC 1M71B 2BVYA 4GMSH 3UBXG 3E80A 2VDPL 3WY4A 5ALBL 1KCRH 1YEHH 3OTTA 2JMRA 4HC1L 3HNVL 2AJ3A 1AY1L 1EJOL 1NGQL 1UT1A 2GI0A 4H25B 3T9WA 5KSVB 3UTTA 1R5IB 2OMXB 5D7IE 1KCVL 3BIBX 4HXBH 1SXZA 2FD6H 3H3PH 2AQ3A 4J2QA 1WTGT 4PEEA 1DUZA 3WFHA 3TO4C 4UILH 4CBZA 2V37A 2A9AA 3HMWL 9CGTA 1YYCA 2B5IB 4OZFA 5BRQA 2ZYHA 3FB6A 4UCFA 1NLBH 3MV8E 2M2DA 1JZ4A 1NM9A 2DWXA 4NNYB 3EJJX 2BNQE 1R33A 2FUTA 2VLJD 1QPXA 3BFQG 1FDLL 2UY6B 4U1MB 1QFUH 3U0WL 1DFBH 1AR1D 3K3QA 4XCYB 5D96C 4WV1B 3PHAA 3PV7A 5C0CA 1JERA 3GBNH 3V4VH 4ONHB 1SBSL 4TTDC 4F3FB 3C9NA 4D7PA 3RVTD 4HBCH 3ARWA 5F9AC 3WENA 3K72A 2EIEA 3F5WB 4AYID 2C3WA 3FU7A 4XPTL 4AGQA 4Q6IB 1D2OA 1KN4L 2VDLH 3NSXA 4KY1L 4Y5XB 3TWYA 4Z7IA 2NY5C 2DQTL 4UTCA 4G7RB 4G5ZL 1UXSB 4TYUA 3ARBB 3QDHA 5TQ2H 5C7XH 5EC2A 1FCGA 4NAJA 3EOAA 5C3IA 4GT0A 4MXWL 3U2IA 2XV6B 2XY1A 3ULUL 1AO7D 2EIKB 3CH1A 3QUMB 1KJ2H 4HOMA 4NUGL 4ONFH 4WHDA 4PJ9A 5BUGA 1D5ZA 5KSBE 2K9UA 1FZKB 1BFOB 4A7TA 4MD0A 4KQ3H 3ARTA 4EE2A 4PP1C 5B8CB 4ZW3A 5IJKA 4M29A 1KN2H 4PJGF 1MLCB 2GJ6B 4UAHA 1WQVT 3DURB 1Q0XL 4K7FA 3U30C 4DGIL 5KYYB 2DQIH 2VUKA 2VJ0A 3OKYA 4I1NB 1QLRA 4Z6AT 3CCHB 2OP4L 4GI9A 2DS4A 1WV7T 4Y4FA 3H7LA 3N50A 4A7GF 5GGSB 2JB5H 4ELME 4ELKB 1X9UA 5E2UH 5I74B 2QGCA 4BGLA 1DQKA 4XMXA 2Z93A 2UZIH 4MQTB 5JW4M 3D33A 1N67A 2Q86A 1ETZB 4RGMB 5EO1B 3ZLQC 5I1HH 5IUCA 1KEGH 2TRHA 3TA3A 3QZPA 3WNOA 5AZ2H 3R1GL 1QNZH 3UERA 1OSZB 3ZZQA 3BP7A 4OCXH 4PJ9C 2FLMA 1CK0H 3CSTA 3VXUE 5BJTA 3MRMA 3PP3K 4UBDC 1KCLA 2UZPA 4AQ1B 4EBQL 4HJJL 2ARJQ 2NY0D 3WMSA 1ACCA 3G6JE 4GSDL 3C5ZA 3KM1A 4N68A 3VGDA 4YHYB 4HD9A 2IGFL 5EV7A 5DK0B 5FB8A 4YIQA 3NPSC 3F7VA 4ODSH 2WN3A 1ZY9A 1BZ9A 2E74C 3QA3B 5AVXB 4E9QA 3SE9L 1CF8H 1IE5A 4LLYB 5DD3H 1QSEA 4PJ6A 4Y4FC 4KKZA 3B2PA 1TJMA 3HZYA 3PJNA 4Y1TA 4MCZA 1NC2A 4QTHA 2HLAA 4PJ5A 2YR3A 1TF4A 2PLTA 1D6VH 2EH8L 1CWVA 3F04A 4X42A 4I1PA 4IS6A 5BVPL 1CU4L 2FIKA 1D5MB 5LQBL 1JV2A 3FQWA 3GSNL 4AY0A 3QZWA 2F53A 1DQVA 1ZSDB 4JN2B 1PIGA 4MGXA 4GRMA 4EO5A 4U1KA 4YQXH 2EDXA 4UU9B 4DZBB 1EO7A 4YFEA 4GLRH 4L1BA 4NZDA 3MRFA 5HJDA 5DA4A 5FKPA 3N9GL 4DO4A 5KZCB 3FFDA 4BFRA 4UQ9A 3EYUL 3NPZB 4XN1A 4DSYA 4UDUA 2NZ9C 3C5ZC 2R59A 3QJQB 5IF0B 1VFAA 2NNXA 4TQEH 4X5WB 4B5EA 3GSXB 5CD5C 3SDXE 4MZ2A 2EE3A 2R29H 3ECVA 1W8NA 4AENB 5F7HA 2VR4A 1NBQA 4UTAA 2A6KA 4X6CB 1I7RB 4U6VH 1RY7B 3GBML 1B0WA 1PDKA 3CJJA 3CLFH 3NIDB 4IKNA 1RUAH 1YEIH 1MCCA 3S5ZA 2EC9T 3ZTNL 5CJBA 1H9DA 3MRCB 4E41E 3Q5TA 4LCVA 3WDJA 3GJFH 1QSFA 4P2OA 2B1HL 2XOTA 3A6CH 2H7WA 5BO1H 4DEWA 2I7SA 3BXNA 2OLDA 3QR2A 4RFEA 4ZS7H 3BQUD 4DPAX 1RP9A 4TQ8A 2BRQA 2NXZB 3MLSL 4W9CC 2WZ6A 4ZMVA 1UJTA 3ETSA 5E1QA 5BRZB 3O3EB 1FC2D 3O9WD 1L9RA 1Q9LA 4GQQA 3PU7A 3WELA 3WU1A 1ASOA 1GC1H 3QJSB 4LE8A 4PLJD 2Y6SD 2HUEA 4PWJA 1ZTXH 1DN0B 4J3OC 2JELH 3MLPA 4P57B 3K7UA 4ZFZA 4XBMA 3O6LL 5DD6A 5IVXB 2DV6A 1CICD 2V5MA 5IQOA 5L4MA 2RALA 2DMGA 3MLRL 1X9RA 5HHMB 1NIFA 1W0WA 2XVKA 2CO3A 1KTDB 2QVTA 3DX8A 3LEYL 3SPHA 3FZUD 2EE2A 3BD5A 3O6FD 4OCYL 5AD0A 5KVEH 4Y9EA 5C86A 1T3FB 4OCLC 1HJCA 3NQIA 4UINH 3MJ9A 5FUOL 4LSTL 4A38A 2L7QA 5DUMH 4AGLA 2F7RA 3W3BA 2OXHB 4P2OC 1L5GB 2BVOB 4JRXA 2UYLB 1FFNA 3HG1E 3VXNA 1HSAA 5A2JH 2C9QA 3HAEH 1DBJL 1PPIA 1IBHA 2Q2EB 5LN4A 2IG2H 3ZMNA 2YGQA 3VFTB 3CZFB 5HHXH 2DQGL 1GZQB 3EO0B 5F3BB 4LLWA 1T5WA 3OAYH 3DHPA 1WIPA 3ARGA 4XNXL 4EUPA 4ZD3H 4FFYA 2R8SL 3GM0A 3MR9B 4OV5B 4GB9A 3RUGF 3VRJB 2B4CL 3BIKA 2RFXA 1CGXA 5CZRA 1WHOA 5BQ7B 1WICA 1A2YA 3MACH 2ATPB 3BO8A 43CAB 1TITA 4MX7A 2K7PA 1DVUA 2R0ZH 1CLOH 1K4DA 3P4NB 4RISH 4AQEB 4Z76B 2NUTA 1J7VR 4XXCA 1F4HA 4QRTB 2WAHA 3ATAA 4JMXA 4LKCB 4NKDB 4Z7VE 3ECWA 4LVHC 2XVGA 2YMXL 3LJ3A 4MQ7B 2OK0L 4GUCA 5IROA 1PS3A 1RJCA 5GHWH 2X70A 1AZRA 5D1ZD 5C0EB 1E4XL 3BP6A 1XZ0A 1AGCB 1SLUA 4QF1B 2HJLB 2FWOA 4HXAL 4N25A 3HRPA 4UDTB 1MHEA 4FN0A 3MNZB 3QORD 2OAAA 3KJ4C 2VDPH 3TXAA 1HE8A 1S78C 3LZLA 2ADIB 4KMQA 3LKQA 3F12A 2H4EA 3ARGC 5ESAB 3ULUE 1OB0A 1AY1H 2R4SL 2WB7A 4C56A 5HYJD 1TCRB 3CK0L 1KCVH 3L4WA 5CZXC 2PP9A 2J8UB 2YBRA 3NCYP 5DURB 1K5WA 5B7MA 4PV8A 1IQWH 2CPCA 1XR8A 4EI5D 3L9YA 3IJHB 3ARFA 3BEWA 4HS3B 4DHLA 4BFIB 2DWTA 4ZMPA 4RDQG 4FP8L 4IBQA 1MNNA 1N8OE 5AOJA 4F2ME 4XOAA 3VSTA 4XXCC 1CD1A 1QHOA 3V4LA 5JR1L 2VLKE 2VMDA 4W9IC 1KIRA 1J9CT 5IROC 3B5HA 3CC5B 3DROA 4CW1A 3NSDA 4RIRB 4TNWK 3UJJL 2OYPA 4UM8A 4ALAL 3FTXA 2KS0A 4FQ1L 1EHLH 2CO6B 2J5LC 4FI7A 4RDBA 1CZ8L 1I8IB 1SEQL 2Z0UA 4XMWA 4FCAA 2BVEA 1C08A 1S7UB 1FL3B 4JFYB 4ZFOA 1LVEA 4R4FH 4L4VD 4P04A 1CLYH 3AS2A 5FAAA 4BSVB 1DJHA 4AL8C 2JJSA 1CFSA 1WISA 1JWUA 4MXWH 1ACYH 1AZBA 1H3UA 3AQXA 3O8XA 4W9DC 5DVMA 5BXFA 1G7QB 1LHZA 2N01B 2CD0A 3MRIA 3ULVH 1EDYA 5T1KA 3UAEA 3VNYA 4O58L 4KKBD 3G5XA 5E6RB 3ARFC 1OANA 2GUOB 4JFDA 3DVNB 3KYOA 4GOSA 5JLZB 2F5BH 4HUCA 3VH8A 3QUML 4ZQTA 2D7NA 1S7TA 3T2NL 4UNVA 5LDSA 2W91A 2C9XA 2RQEA 1X7TA 1WBXA 2EYRA 2Z31C 4I2XE 1GYWA 4M5SA 3ZHNA 5DWUH 2Y2WA 3SY6A 2LHAA 4OIBA 4P5MA 1NBVL 2Y9RT 3O4LB 2UY7B 3EJPA 1QMUA 5EPMB 4XNZB 1NGYB 2HVKA 2XU9A 3PGDB 3WL9B 4OLVL 2VL5B 2IQAB 3D3VD 5CGBA 2YLKA 3LZOA 4QRPA 1DFXA 2MTPA 3TBTB 4X80H 4AEIL 2FO4A 1FZJB 1T20A 4N2LA 3KM2A 1J11A 3UZVA 1BIIA 3O8XC 4KK8D 4WFFD 1A6TA 1U95B 3CTTA 4PJCB 3RL1B 3X1EA 1LWJA 5JHBA 2ZONA 1EHNA 1SJEB 1F4WL 6FABL 1PW3A 5H35B 3ROOB 3CV5A 1T66C 2Z92B 3GSQA 4UYQA 2W92A 3T3MB 1P69B 2OMWA 3CFNA 3GHEL 4JNXA 4TOYL 1P2CB 1DVTA 4KK5C 5D93B 4C57C 2XWBB 5EC1A 2P5EB 2ZXQA 4HUWA 2Q7NA 5IQNA 5BNXD 2YGOA 3OGOE 3BZEB 1A6UL 1BD2A 5GGSY 3QWRD 3DKHA 5CGTA 2D03L 3RZCA 4LP4A 1FE8L 1U3HA 4JPVL 4JO4H 4AJVA 2OR9L 3MREB 4NOBA 3DHMA 1XGYL 2EH8H 2HP4A 4JO2L 4Z3EA 2EVFA 4LCWB 4PJDB 1QUNB 2WLIA 3TN0B 3Q2CA 1U3ZA 2C4XA 4D2NA 3PV6B 3VFOA 2HAZA 1E6OH 3SE3C 4YSCA 32C2B 5HVGB 3S96B 1FL5A 2WWNA 4WO0A 3WXWL 3CVDA 3BDXA 3D0LA 5BRPA 3MV11 3MRRB 2X42A 4IKJA 4QRQB 4ETYA 3JUZA 2CBPA 5IEKB 2EICA 4Y19E 1OGPA 5FM5M 3WO3B 3D69A 5KSUB 4IJ3B 3RGVA 4HSAC 3EYUH 5CBAB 1MCOH 3KPMB 4DKFL 4HDIB 3VWKB 2CMRL 4LBEB 3WHXA 3LV3A 4LNRB 4LSDA 4YL4A 1Y0LA 4ZUVB 3ULSB 4DZ8B 4RFNB 4JM2B 4F33A 3H3KA 4AMKL 4FNRA 2B8OT 3WO4C 1AD9B 4OZGA 1EFXD 3PP4H 1SVCP 3STLB 2B7DT 3MXVH 4HJUA 4PP2B 2G5RA 5E9DB 4ACPA 1KB3A 2HTKC 4YAQB 1UFUA 3RZCC 3P3RA 3ZY7A 1T04A 1MIEH 1U3HC 3D25A 2V5SA 1NCWL 1IC7L 3PDOA 4F2FA 4FLSA 1TFHA 2ILLA 2R69A 4XMZA 5EZPA 4HVBA 1A1MB 4KTEL 3P9WB 3BH4A 3I6KA 1OEZW 4LEEA 1Z0NA 3P2TA 3OJVC 3OF6D 3MLSH 1TKWB 2GJRA 4N1EA 4N90E 5AW6B 2L7EA 4HJGB 4M7KH 5KN5B 1YECL 4KTYA 4FNPA 4FC3E 3I84A 4AZ8A 5FO8B 4D8OA 1UM4L 1G4MA 1WPCA 2X2IA 3EUUA 4YHIB 4BRJA 5TDNA 4M4RA 2ZSWB 4XGZA 5A3ID 4LEOB 3JWNC 4BCYA 3FU5A 2F7PA 2O5XL 4X4XB 2ZCLL 5LGKA 5KVDE 5C0IA 3OZ9L 1CD8A 2VDNB 3GLEA 4YR6B 2YD5A 3L1GA 5F88A 3HC4H 4OLUH 4PVMA 4L9DA 1MWAA 2R2BB 3FXIC 4Y5VC 1N26A 1RU9H 3BN3B 4WTZA 3T04D 4JPIA 3APMA 4BE6A 1E8XA 3WBDA 2F8IA 1HHJB 1GR7A 4MAUH 3KGTA 1IBBA 1BLIA 1PNCA 5FYJU 4LIQL 1NCCL 5FUOH 4WTWA 4BZ2A 3D51A 2LTQC 2IPKA 3IJ9A 2APTA 4NM4L 2P9RA 3AS1A 1TZGL 4M5YH 3KPRE 2YOAA 3DIFB 4KXCA 4DP1X 4FULA 1XSOA 4OCRH 4KHXH 4R3SA 3HVNA 4PWHA 2AQPA 2E75C 4PJEE 1KPVB 7FABL 3S35H 4L4TA 3PWPE 2H0PA 4H26B 5EO0B 5KW9H 2Z7UA 1XTLA 5JHMA 3HE6D 4Z95L 5A2LH 1MJ8H 5LAPA 2FBOJ 2JXMA 1RPKA 3BP4B 4S2SA 1MI5B 5EBMA 2D7MA 3U9UA 4DQOH 4ZT1A 3HS0B 4HUXB 1IAKA 3O2VL 4CDHA 2B4CH 3IU3B 5GGQL 2JKSA 5K9JH 1KJVA 3LAFA 4OLZL 3NRFA 4LVEA 3GMOA 3LRHA 1ACZA 3OG6B 4U33A 3JTTB 4LQFL 3WMPA 5JQIB 5HYIA 4KX9A 3SQOL 3GXUB 3W39A 1SN5A 2YLHA 2YMXH 2XXFA 4G6AC 5EB9A 4G80A 4J8RA 1W8OA 1PY4A 4E5XB 1FVDB 5EIQA 5FOJA 3D52A 3SCMC 5CD3B 4MCMA 4NBYB 3VFVB 1WZAA 4RMRA 3QUXA 3H9HB 2J2ZB 2F54B 2VZSA 4XN4A 2A9NH 4WFHE 4WWOA 5ITFB 5J13C 2HTLD 5H37G 3LNDA 5DMGC 3H4HA 1O5DT 3PNWB 4AUYA 3QEGL 2HMID 2BPBA 3ARZA 4BWWA 3EH3B 2X6BA 3PG2A 2IAMA 1JHTA 1TNNA 3IAQA 4KK9C 4P23D 4M1CC 2X4OA 4X7TB 4AXWB 3LQAL 2O5YH 3IPFA 1UJ3B 1MJJB 2XNAA 3FONA 3BZDA 5EZLA 4EI6A 2J5WA 3K8LA 4DCQA 3T8XA 5E23A 5T33L 4TL4A 1NGPL 3C5SB 1IC4L 3QXAA 4B95C 5EWIH 2R0LL 1D5XB 1XMWA 4AI7A 3QRBA 1F8TH 4FKKA 3UJJH 2GJ6E 5JXED 4I18C 4NZUH 3MLXL 5ESQB 4WTXA 3UZEA 2GK2A 4LEBA 4YZFE 3TNMA 2YXVA 1XF5A 3BWAA 4UB0L 2Z7YA 5T5NG 3OXSA 3QUXC 3D9AH 3IXAA 2D4DA 2ZQKA 3RWEB 5DK2B 3ABMB 4CADB 1A02N 3VXMB 3DIVA 5GGRA 4GG8A 3U9PL 5F7MC 1GGIL 4OSUL 5ALCL 5KYWA 2MQ3A 2P8MA 4XB8A 3FO2A 1IBDA 4ONGH 1SJMA 4NWUL 4W9EC 4MJ6A 1N59A 5KYUA 1ZHNB 1JGDA 2PO6D 4MS6A 2IAMC 4ZUTA 1E7VA 3KW8A 4PGDA 2J1XA 2YN5A 2PW2B 1YDPB 4KKAC 3VFUB 4YJZL 3V4PH 1A5FL 4HS8L 4WO4D 4NT6B 1N2RA 5IVOA 5HHQA 1BFTA 1HZLA 4JDTH 4XMKH 5AALA 4BWUA 1SVZA 1WCBB 2C8NA 5IP4A 2Z4TA 2CU9A 3G5WA 3H1ZA 1SY6A 1FFOB 4EPSA 1QWUA 2F58H 5E51A 2V7HA 2KT6A 3EZJB 4ZYKB 5SV4A 4CMMA 2NNRA 4JPWH 1NBVH 4BEIA 4OLYL 1CXKA 1NPNA 4J3OF 1E5AA 1ADQA 1Z5LB 5IJVB 3BMVA 3P0YL 3Q2NA 1G5AA 4KKPA 2VGLM 1J1OL 1FG2B 1KTRL 1YYML 5J12B 5JW5B 4JO1L 4HG4K 4P07A 1GRWA 3FT3A 3MDJA 4N0CD 1JK8A 3PRZA 3VYNA 1I7ZB 4AEIH 2LVEA 3I02A 3ZIYA 4YVUA 4FYRA 3KLAA 4ENEC 5C70A 5HPMB 3GUTB 4NSKA 1O9ZA 1T7WA 5TD4A 1UEMA 3L2NA 3DVGA 4AM0Q 1H3PL 3W5MA 2J72A 3EF7A 1F4WH 3SYPA 2X3CA 4GNKB 1MVFA 7CGTA 3VI4A 1YEKL 2XJKA 2QHRL 1MCDA 4G9FB 1XBRA 3RX8A 4QGTA 4N87A 2P5WB 2YARA 3MLTA 3MSPA 4TOYH 3TF7C 3SYQA 3SO5A 1THAA 4JZJA 4KOBA 1PX4A 2AJVH 1FGNH 4GKZB 2MNJB 2AVGA 4AC4A 5D72L 1KBWA 4U1JB 4JKPH 4HIHB 5I9QB 3HN3A 1EZVY 3BHBB 3CFEB 4GXVH 4I77L 1P84J 3D2TA 1A9VA 4GINA 1IO4C 4X6CE 1K5NA 1FE8H 4K9JA 3FCSA 4C58B 1JXKA 3L5JA 3QZBA 3NIDE 1XGYH 1E9OB 5LBSL 1QLFB 1R0AL 3CFJA 3ZMEA 1XGRA 3CFCL 3GINA 3VD7A 1RZQA 2CE6A 1ZMYA 3L48A 5E6IA 3MNDA 3WXWH 3RDTA 1A7QH 2ED6A 1IGIL 2H26A 2YPVA 4N0RA 5IESL 1U92A 2IPUG 1JPTH 4NCC1 4PG2A 4ETQA 3CSFA 3IDJB 7PCYA 5BRZE 1FFRA 2VO8A 3Q06A 1JGVL 5CIPB 4PRIB 4NBZB 4P06A 3FQ2A 1PD0A 1T5KA 3Q8FA 4UV7L 4EJ1C 4RWYL 3L4VA 5JW4Q 3V0VB 4Q0XL 1JPFA 2ZUVA 5T3XD 5LG6A 4G7SB 4JGUA 4EN3B 1YMMA 3QXVA 1AXSA 3D2UD 2PPFA 2V3EA 4XP4L 1OT2A 1Q1JL 4QWWC 1C7TA 5AZEH 3JV4A 4LIQE 4PG9B 5IVXE 3P3YA 1T2QL 2OMVA 4X6DA 1CB4A 1RCYA 1ORSA 5EU7C 5CU9A 4PCYA 1KY7A 4A2EA 3QHZH 3MODH 2X2HA 1AE6L 5LAXB 1F56A 5LO7A 3BUQA 3ZZSA 5TE6L 4U6YB 5FGCB 3DX7B 3DUSA 3T77A 2UXGA 5DF0A 1XH3A 2V7NA 2NY1C 3OGCA 4YXKH 4IHOB 1ZE3H 1R5WA 3AY4A 4ZZKA 3B37A 3MRPA 1FVCB 4WNQA 5E6IC 3MLVL 4MDJA 4B9ZA 1B4RA 1KENH 1YECH 3H54A 2YK1L 3N0PB 3EOYG 2VLJA 1G7HB 3C8HA 5IFJA 5GJTL 5IMKB 1F6LL 4PG2C 2K6ZA 3AXLA 4X5RA 3IDXH 2BSDA 3FUDA 1DVSA 4K0OA 2HH0H 2O6PA 3QFJB 2XWEA 2CO7A 4F9LA 3OZ9H 5EIIA 4NO3A 3ZZLA 4FTVB 3CUPA 1S9YB 4O9HH 4RSYA 4TQPA 4HKZB 1H8NA 1K8IB 2WVSA 2FHFA 3FW6A 3ILEA 5IHWA 1RUKL 3FCUB 3SEPA 3E9UA 2PNDA 3QCTL 2QQNL 1P1ZB 1UH4A 2AFNA 2VDNL 3LHPH 4Q9QL 3P54A 4NRXA 3IDNB 3SBRA 4R97B 3UJIL 5D70H 2AJZA 1AO7A 1HHKB 1TJIH 3BW9A 1ZLWK 2C7UB 4LL4A 1JPGB 3AY4C 4OF8A 3ARYA 1GY1A 2OMUA 3LKNA 4XWGL 1RZGB 7FABH 1A9EB 1EAPA 3C87A 3T2QA 2P44B 3DARA 4OZIA 3JUYA 1HINL 3WFBL 1F18A 3N44B 2J43A 2XPGB 3KDPB 5D96B 1NPUA 2YAPA 5DJDB 1AR1C 2H8PA 2CDFB 3UO1H 4APQD 5I6KA 3V8OA 4F20A 5F0LB 5EFIB 1U8NA 5DZJA 5GGTL 2OL3H 1V8HA 4U1LA 1F3JB 1LNUB 1VDGA 3AQYA 3LKPA 3O2VH 3RVTC 5I73B 5E6SB 4CSTA 4JRFA 3QNZA 3I6LE 4K8RD 4Z7WA 4OLZH 3GNML 5HJBA 1F11B 5LGJA 2J8UE 4JN1L 4DGVH 3FT9A 2GC4C 4PRPD 3TONA 4LQFH 1RD6A 4Z0XA 3HB3D 4UM9B 1TZIB 2DN7A 1JFQH 3WUZA 4WHTB 3D18A 1NCBL 1X3DA 1JZFA 3KVPA 3QI9A 4MJ5A 4MZIA 4OLWH 3WFHB 3ZRFC 3WEMA 43C9A 2H32A 3T4YB 4FG6D 4P46B 3CDZA 3TM6A 4G9DB 1XSIA 2WOYA 3NESA 1HXKA 1TQBC 1KYOK 3MAWA 3B2XA 1GZHA 3DGGB 1T7XA 5IQ7H 3B2VH 3IMTA 4FL4C 1IL1A 3O0LA 5JPNA 2VLRD 5HHNA 5EU4B 1PY0A 2WQAA 2H9GA 4M7JH 2YSTA 1DBKH 3RI5K 2C3HA 3K72B 5LNGA 3SE8L 1IGFL 3WJMB 2IDTA 3MV8D 1FP5A 3NCJL 4RMBA 4P9HC 2GEQA 2F1EA 1F97A 1RZJC 4PJHB 2CKBA 3NJHA 2A83A 2WLYA 3F7KA 3KH4A 3JV5A 3P77A 3D0AA 4NQEB 4YDVB 4CVXB 1LM8V 1HOCA 2FK9A 1ZT4B 4MB4A 3DC0A 5CN1A 3QI9C 3M86A 1Z66A 5AOMA 1NGPH 5I6PA 3T3PB 4TLTA 2Y5EA 4JDZA 5E1AA 3O2DL 4U1GC 3PJSB 5HDQH 2WN2A 4ZFGL 5GGUA 5IV2A 4W68A 1W6LA 4K3HA 1KFAL 4WFGE 5DUBA 2Y3AA 4M62L 4MD0B 5SWZB 1WGOA 4MXVE 1XB6A 1BA9A 4E68A 4U1HB 3NIGB 1GZHC 2NY0C 1PG7W 4KWUA 3LKSA 5JPNC 3O4LE 2IH9A 3UMNA 1E6JL 2YD8A 1OP9A 4XWOD 5HGBB 1WK0A 3VQMA 1WIOA 1ZLDA 4HPHA 3D09A 3F05A 2JH2A 3A4FA 4FQXD 3CXFA 3GBEA 3A6OA 1NC4D 2WQRA 4NJ9H 1KJMA 2GT9A 1B2YA 1E4WL 4PJCE 5C0ND 2Q86B 1JIBA 5KJRL 3N3EA 4ODHL 5CSGA 3CSPA 1UWFA 2R9HD 1URIA 1SUJA 4AQAA 5F7LB 3CHOA 4KQ4H 3BKCL 3O9WA 1J0KA 3T3ME 5FCSH 5BJTB 3TCLB 3BLBA 2EE9A 1EJFA 3PDGA 2EEAA 3OL2A 2P5EE 4KH9A 5IY5B 1AJ7L 4NJAL 2YA2A 3FSVA 4IK6A 4TMPA 5EDXA 1RZIB 2B3RA 4F24A 1RK1A 1CICA 2EUZA 2FZ3B 2GFBB 5C9JB 2G60H 1KNOB 1NMBL 4YHOH 5DD0L 5HGAB 5CJQH 1QSEB 5CM1A 3NCCB 2BNUB 2K4WA 1SDDA 4LCWE 4PJDE 3P9LA 2QVIA 4PRDB 5C0BA 2W0FB 5GS0H 4QTHB 4X9YA 3MFFB 1PU0A 1DQDH 4NXSA 1KELH 1YEKH 1QR1A 4LVNC 2GITA 5HTSA 5DMYA 4IS6B 3HZVA 4KRNA 4RNRA 5HD8D 2CKNA 1JZIA 2CIIB 3BQUC 3HKZA 1IQDB 4U3SB 1MSPA 3ILPB 1I3GL 1M2OA 5C2UB 1S5HA 5AVZB 2DI7A 2FQGA 3O9WC 4HHAA 5D72H 1MHHA 3S8GB 3FNKA 3WE6B 1XT5A 2YXFA 2QTVA 4ISVA 3RPBA 3MRFB 1MAML 2YC1A 3JYBA 4LLUA 4JY5H 4PLJC 2Y6SC 1K2DB 3U46B 1G9MH 4I77H 1HU8A 2F8VA 4M61A 4M8QB 4R6UA 4JKKA 3DO3A 1CICC 3NFNB 4FFVD 5E9DE 2NSQA 1CI5A 3EW3B 1R0AH 1S7SA 3VSUA 3OKDA 4NO2B 5FM4A 2DQEL 1CQYA 2VC2L 3LD8C 3TEYA 5ESVB 3FZUC 3O6FC 2JKRM 1T0MB 1XXFC 1JCVA 4OJFL 4IDLA 3X1GA 3KR3L 1QNIA 4O2FA 2BW5A 3MRQB 3OKNA 2F7IA 3CVBA 5BVJA 4N3UA 5D6CB 1QSFB 1Q9OA 4U7SA 4JRYD 1HCVA 3FH5A 4RWYH 4UV7H 1CDGA 4FQ2L 1Y6NR 4Q0XH 3K6SB 1U8CA 3EOTH 1DTUA 3B5TA 1NEPA 1FNLA 1WRFA 2IDSA 4QI3A 4LXFA 1OXYA 1MDTA 4LAQL 4LDLB 4MA3A 5CLYA 5JW4R 3MRHA 1UQSA 1Q1JH 1WAAA 4Q52A 2IH1A 5EH1A 3DTXA 4HQQH 4D9RE 3UL4A 2XTJE 4G1EA 5HYEA 4LPUA 2Y7OA 3ARED 4OAWA 1EZVX 5HYJA 1UWXH 2JB6A 3NEOA 4YBQD 5TE6H 3UEZA 1LJMA 3BVUA 3UBGA 1T2JA 5D4JA 3CFTA 4RRPG 1O5PA 3SKOB 1ND0B 2QDWA 3GXMA 4EI5A 1O7DC 5AD0B 3KVDD 4A37A 1PFCA 4X4KA 4ZUWA 3MLVH 1G7IB 2YK1H 4PGBA 1HIMH 2VO5A 3ARVA 3ZDZB 1REIA 3IFNL 4H8PA 4LT7A 4LVHB 4OIFA 3QZWG 1XSJA 3ECBA 2YGNA 4HFWB 4HMEA 2Y36L 2UVFA 4OR1A 3U6RB 1OP3H 5D1ZC 5BQDA 3U0PA 3VW3H 4BQBA 4JM0A 3F7PC 3N85H 5J8OA 1QWNA 1MI5E 1CGUA 3QORC 3HI5L 2DOCA 2ICWI 3GKWH 3L3HA 3L2LA 1Q72H 3AROA 2CJTA 2MH4A 2YWYA 2A9MH 5F70A 3VFPA 3CNKA 4AW4A 1H15A 2RA1A 3LRLA 4GAFB 4L4VA 1J48A 4H20L 2QQNH 3NCXA 3N1FC 1OM3H 3RVWD 3RILA 5J9PB 1SM3L 3BSGA 3UJIH 1AIFA 3WTUA 4LLVA 4NC0B 1A9BB 4PS8A 4EI5C 1U8LB 2WTRA 1K4DB 1I1RA 2XQBH 2VXVL 1DBAL 1HSBB 3G3LA 4XC3L 3UGEA 2X4UA 2K6YA 1CXEA 3BPLC 4W9FC 1E28A 3NA9L 4ZNEA 2BS9A 1MG2C 3S4SA 4BELD 4JO8A 2YXWA 4PIBA 1PNDA 2F54E 3BP6B 2WSPA 5GGTH 1H3WM 1HH9B 3WEXB 4D9QE 3IETB 3IJYA 3MRBA 4KZ0A 5KAQF 2ZOKB 1MHEB 5JIDA 3FAXA 3HBZA 1HN1A 1VZGA 2DKSA 2DWYA 4XVOA 1MQKL 2CJUL 4CGUB 2QLVB 5F6IC 3AU1B 4EEEA 4XCFL 5C0DA 3D39B 1GS7A 3D3VA 2A77H 5EUOB 5E00A 5SX5H 2WVVA 1AXIB 4K5MA 3P3SA 4WUUB 5FOBA 3H3BC 4L0PB 4PCKA 3MLWH 4P48A 3KWVA 3B3IB 4PYGA 4XR8C 3FRPB 3OR6A 2QZ5A 4G8AC 4KKBC 3E8UH 4KKCD 3R06A 5INDA 2M26A 2XA8L 1N7MH 3ULUD 5D2NB 2Z31B 4YXLH 1KIRB 3I2CL 3GSVB 1KV7A 3WN5C 3VB8A 1KWGA 3OKMB 3QWRA 3KS0H 4ODXB 5EO9A 1N18A 3VO0A 3CHPA 3VXME 4TF4A 4NXKA 2VLLB 3ZSTA 4EUPG 1FG9C 1K8DA 4BQ6A 1ZV5A 3DBSA 3VFSA 2AEOA 4ZFOB 2D3VA 2FCBA 3DXAB 3V6OC 4KZEL 3O4OB 1BJ8A 2VLKD 3RWGB 2BOLA 2W8CA 3E3QC 3IE4A 5KBNC 3LNIA 4WKXA 2XFXA 5C0RH 1N64L 1CFSB 1W0VB 2IANA 5I1CL 4ZTOL 5JZ7D 3VDAA 2GSGA 2Q5BA 4LBAA 2Z8WC 1CN4A 5ID0A 4RGNB 4QOKB 5EU3A 4KK8C 5FO7A 4D7BA 3O2DH 3DGDA 4M4PA 5DJXA 3SPIA 1WGVA 5KSAD 3G5XB 4I13B 1R3LA 1H6EA 2QPFA 2BCMA 3ZX1A 5B1CA 3EHBD 4JCMA 2OZNA 4N2NA 3S5LA 5HYFA 3AZUA 3VI4F 2FH6A 2AGJL 4UTBL 4WHYH 4G8EA 4XNYH 5DVPA 4N86A 1H6TA 1JVKA 1OAQH 2NR6D 4N2OA 1JTTA 2EYRB 4DGUA 4RGOL 4NC1C 3LH8A 4NZ8A 1MKFA 2Z34A 4AYGA 2ICWA 1GGBH 1MVUA 1EFXA 3IJSB 5D7EA 3L1OH 3OVUB 3WIIL 3WIHH 2NZ1A 1I8AA 1AZCA 4NQVA 4X7CC 5GS1A 3L7FA 2Q7YB 1A6WH 3IDIB 3HJEA 1LK3L 2AJSH 4QRPB 2WSDA 1AHMA 2BMKA 5IT2H 4XT1C 1BOYA 6PCYA 5I23A 3NK3A 2ZP0T 3EFDH 3RE0A 5I8OL 2L4OA 4MMZB 4G9FE 4QRSB 3UEQA 3GK8L 2JWYA 2X4TB 2MNUA 5MEOA 2P5WE 3RWFA 3WG7B 4WWPA 4I0PD 5B1BB 1SEBB 5BZDB 2VE6A 2XKNB 2FGWL 3QCUH 1IJ9A 2H5UA 1WFJA 4NJAH 3RWHB 5AYTA 3W5NA 5KBKA 1TXKA 1PZDA 3QFDB 4PREA 5I16A 5I1LB 3QXDB 3RJDA 1ZV9A 4UT6L 5HHVH 4NLHA 1WA2X 5D7LA 4UUJA 4HJ1A 3WO4B 1CE6A 4F9PA 3ULAB 4AEHH 1X9QA 5J56B 3KMDA 4XE5B 15C8L 2HRGA 3DMMB 2XQ0A 4X6DF 1UD8A 12E8L 4DN4H 4KO5A 4JKWA 1U3HB 3IKKA 5GS1C 1UM5H 3FK3A 4K7PY 5LWYL 4LDEB 3EGDB 4MQSB 1BQLL 3OB0K 4P3DB 5TGBA 4Q58C 2KBGA 2OSLA 5ANMB 1S7XA 4WSGA 4JG0L 5SWSA 5CLXA 4ZI8A 1FL5B 2QSCH 3KEHA 1JYNA 3WSQL 1LE9B 4PRIE 2B59A 1AGDA 1ID2A 4P3CL 4PJBE 2BINA 4UIMA 5CP3A 1HHHA 3WTWA 3BEVB 3MCKA 3VH8G 3L3JB 3BPOC 3HE6A 1MAMH 3MKGA 3CFBA 1WG3A 3GZQA 5F96H 2MWCA 2ODHA 3C6EA 3EJRA 3LKRA 4NQXA 1A7PL 3DYPA 2IBZY 4XBPA 5A3IC 2Y1VA 1ZGLM 2OW6A 4OFPA 3LV3B 1BXUA 4Y5VB 2NOYA 4MXQD 3WJJC 4XAKE 2RQ8A 5AW5B 4UF7C 4K9EC 2DQEH 5FGCE 2VC2H 1F2XK 4OZGB 4F9PC 2VQUA 2BP8B 3NJNA 1HH6B 5JUEL 3II3A 4PH8A 1SMOA 4OJFH 5E4OA 5JTWA 2LTQB 3FQNB 4HPOL 4U2YA 4E9WA 4Y2LA 1M7IB 4ODTL 3IGAA 2HB0A 1M2VB 1OQOA 3ZXAC 3WE1A 4H88L 4F8PA 1JPEA 2WTOA 2FJHA 3MOAH 4QLWA 1M6OA 2Y2TA 2DDQH 2EDRA 1XDTT 5DLMH 4Y16B 1TG8A 1ZT7A 4QHUB 2VW4A 3BP5A 5JIHA 3FQUB 2NYYD 5IQLA 4X0KA 5CBEB 3QFJE 5DFWH 4N2AA 1EHXA 4Z7AA 3HE6C 4BHUA 1HFUA 4FTVE 1QBAA 1YEGH 1CC3A 3UTQA 5EEZA 4AH2B 1NCDL 1I31A 1UASA 2UVEA 5FECA 2X1WL 3K4AA 4B9JA 1Q94A 3ZYJA 1DBBH 2QPDB 4LSUH 3RTQB 2FJGA 1MFEL 2ENSA 4JFQB 3MRDA 4KI1A 1KEMH 4FE9A 4FYQA 2K3TA 4HWBA 2QT6A 3BWZA 3TIDB 5CILL 4GBXB 4P23A 5BV7C 4F5CA 2QGBA 4Z7WF 3G9VA 1NEUA 1PX8A 3A21A 2IALB 4NYLB 5GSVB 3M45A 3BLKA 2F0CA 1M05A 5ISZB 3GO1H 3LH2H 5F7AA 4YL9A 1R19A 4H0GA 4HH8A 4JZOA 1C5DA 3MRNB 3PDDA 4MKTA 3SCMB 2WM0A 5JXEA 2HN7A 5IW6A 2BSED 1YAIA 5IK3A 1VKXA 2X5PA 4X83A 2C9VA 4MBOA 4R96A 1KY6A 2W60A 1QFWL 3CBJB 5J13B 3FB5B 1HXYA 2AQNA 4WU5B 2BC4A 4FFTA 2HTLC 4P2QA 4S2SB 3HZMA 4BZ1L 2Z91A 1IAKB 1XGUA 2A1WL 5CJ8A 2IPTL 1SM3H 4XCEA 2HMIC 3LMJH 1PKQA 1KYOJ 4PHXA 5TE4L 2PO6A 3PWPD 4KH2A 3QDJB 4Z7QF 4P23C 2WANA 4UMGA 2A6DA 1YPZA 4M7LT 5FYJL 1TQSA 1JZDC 4FNQA 5MERA 1WS7A 2YD4A 4WO4A 3QNFA 4XC3H 1GXEA 4PD4K 5HI3D 3BGMB 5AZUA 3AWEA 4NUPA 1BYNA 1HQRB 2ZOTA 4J8RB 2EECA 5DUPL 4DETA 4I18B 2FATL 2KH2B 3N06B 1ZHLA 4UT7L 5IFAL 5JXEC 1EHAA 1MCWM 5F7KC 4BCXA 4DEPC 2FT8A 1GMEA 4O02H 2ID5A 2V2XB 2EYSA 1MLBA 4DT2A 1GYVA 1BOGB 4G43A 4HK0B 1ZLEA 1KZQA 1F4YH 3V0WL 4WTZG 5BMFL 4PJHE 1QFWM 1QKZL 4NQCA 1JZ6A 4DK5A 1Q9WA 4QTFA 4NQEE 3Q8EA 4TNEA 1KLGA 2CNZA 4GAYA 2PO6C 5DD1L 1P7QA 1DDTA 2XNAB 3NTCL 4KDWA 3T3PE 3LIUA 4F80A 4PJAB 4MNHB 2OMYB 4WFHD 4AYMC 4BK8A 4H8VA 4WO4C 3T8XB 3UPAA 4DCQB 4XMPH 4NZRL 4WY7L 3NMEA 5DC2A 4ZUUA 5SWZE 1JTPA 1G1YA 2JI2A 3WUWA 1OD7A 3NIGE 3PYCA 1Z9MA 4KTDL 4PCTA 1JHLL 1G7LB 4K3DH 4C4BA 2V8MA 2WZ5A 1NICA 5F7EH 1GOHA 2C1OB 3TBCA 3T6ZA 1FBIH 2D7QA 4DUVA 5F1KC 1MHCA 1JWSA 5J6SA 5LCVH 3OXSB 5E1GA 2XA3A 3GMPA 3ME0A 1I9JL 4IBSA 4LK4A 5J11B 3QPXH 4L1TA 3O41A 2CQVA 5HJ3A 4KZEH 1Q8MA 4TVUA 2VM4A 5AB1A 3EFOB 4N0CC 5I1CH 1MIMH 4BRVA 2P8MB 1SHXA 5IOPB 2OMNA 4JBSA 3EJUA 2F18A 5FYKU 5KUKA 3T6QC 3ZO9A 2ESVB 4X8JA 1FGVH 1MRDH 4WIQA 3BPCA 1LEGB 2Q8BL 1VGKA 2F15A 4RFOL 4U7KA 1UYWH 1ZVSA 2A0LD 2X10A 1JV5B 3SDDB 5IG7B 4KROB 3AITA 2NT0A 3KYMA 1IB5A 4OD1L 4YHZL 3D2UA 1Y1UA 3X3FH 2XIBA 1TEYA 3ZE2F 1I8LA 1YUHA 2XWXA 2O5ZL 4NO0D 3HR6A 1N6VA 3RU8H 3K6OA 5JNYB 1QSEE 1UB5A 3LIZH 3HFML 1LILA 3G5ZA 2ZG2A 2ZOOA 1T5XB 3QW9A 4H5SB 4LOVA 2WIIA 4R8WH 3O81A 1JGEA 4O00A 1KB5H 2WXNA 1BQKA 2P7TA 1IV8A 1HESA 2KYIA 1ZGLP 2JQMA 2PXYA 2D0GA 1FSKC 1TJGH 2FT6A 3BFWA 3FHEA 1ETA1 3FRUB 4FMFA 5B21A 5E24E 2XWTA 1KPRB 3D48R 3MROB 2PF6A 2ROXA 3VD3A 5EF3A 5L88L 4CU7A 2H0FA 4JHZA 3OMNB 2A2QT 3F7YA 3D8MA 3MLTB 2CGYA 4ATTA 4UT6H 1LP9A 4XRCA 2V4LA 4XNQA 1ZANH 1A7RL 4FDWA 1TSHA 1GJIA 1NAMB 1I8LC 1GSMA 1UKSA 2J8HA 1WAAF 3HHMA 15C8H 2ENJA 1PJ9A 3ROLB 2KLRA 3L3GA 1K5NB 1T22A 3Q9QA 5I6XC 3V79C 1YY9D 5DEFB 1QP1A 1I7UA 2NY1B 2IV9A 4I4WA 1BQLH 2O6DA 2WUCH 4TUOA 4DPRA 5KZCD 4JQIA 4E2OA 4CN4A 5KG9B 1LEKB 2JKJA 1ML0A 1QSFE 3DYMA 3ZYOA 3BVNA 2YKLH 2DWEB 2RB8A 4S1QH 1F90L 4LSSL 5E99H 3FB7B 4XAWH 3C8KB 3CVIH 2IH8A 2DQHH 2BWIA 3K8MA 3FQRB 5I8KH 4JKLA 4Q2ZB 4APQA 3KWXA 3RVUD 5CZVL 1J8SA 4W9HC 2ZXGA 1XF2B 2AJUH 3TJPA 3X11A 2WXJA 4HOZA 5D7KE 4EVNA 2IDCA 4WWID 3QQ9D 3NJLA 3QO0B 4PJGB 4YE0A 1S7VA 3UO8B 2NY2B 1IFHH 5C0FB 1SHMA 5D7JD 1J5OH 1WFMA 1QI5A 4FMKA 1RV6X 5DR5L 4WDIB 1W72L 1DL7H 2VDRH 1OAXL 2F7OA 1MJ7L 2XSKA 3ETBJ 1TZOA 2NXZD 4FFZL 2AQQA 2CRMA 2R56H 4OJCA 4P3WA 3RX7A 1NEZA 4O2EB 8FABB 1KGUA 2CM5A 3S2CA 1YNTF 3DHJA 3HRZB 5EEUA 2WHVA 4YBLC 4GUPA 3AG3B 4K7PX 3ZDZE 4H88H 3F62A 1EGJL 5I66A 5J0BA 1XQ4A 5CJXA 1H8OA 3N55A 1FUNA 5HHMD 4PY7A 1GYUA 2ZCKL 4LCYB 4AUJA 4NDMA 3UCQA 2VLRA 2E9JA 5D7IA 4HAFA 3KD4A 3SPGA 4APQC 3GSRA 3WS3B 4DKDC 4HJSA 4TS6A 1E30A 1BYOA 3TEXA 2HG5A 2IFFH 3BH9A 2VIRB 2IBZX 3MV8A 5F71A 4OZHB 3E1F1 4Z3GA 1ZA6A 4H1LH 1QATA 4ZUSB 2YWZA 4K8RC 5KVFH 1KCSH 3W38A 1ULVA 2BNQA 4D0DB 1A6VL 5I71C 1CXIA 1BBJB 3QIBA 5SX4H 1OB1A 3FCGA 2X4RA 3HB3C 4OCSH 1R3KB 1OM9A 3BT2L 3ZPDA 5CJ5A 1MHPL 4TPRL 2L04A 2YD3A 4JHVA 3PWJB 1AMYA 1YSOA 5DRWB 3BW9B 5F89A 4FG6C 5FHBH 3F6JA 3MO1A 4HLJA 4Q56A 3U4EA 3K2MC 2WXMA 5CJXC 4Z78A 1TQBB 1V27A 3BSZH 3L5WB 3S5YA 4FL4B 4JFVA 4AVJA 5E2VH 2Y1YA 4XXWC 1JS4A 4PJIA 3VB9A 5E08L 3EJZD 5E6UB 4GY4A 5IWLA 1XGPB 3PUCA 1LTXA 2LU3A 4YHKL 4LHQB 4RMWA 1KWKA 1QRND 1I82A 1EO8L 2OMZA 2CHDA 2A1WH 3D39E 2Y07H 2ZF9A 3GIZH 3KPTA 2LT9A 3LKOA 5I19H 5EUOE 5JYMA 1QO3A 4FQXA 2GSIA 2Y7QA 5LGJB 1NC4A 2YKKA 4WUUE 3MXWH 1IMHC 1HKFA 3GXDA 3QIUD 1NFIB 3MGTA 4PRNA 5DHDA 2FO8A 4XP5L 3W0WD 3GRWL 4U6XA 1PTZA 1XF3A 4D94A 5CN3A 4UV4L 2QFPA 1I9IH 2GJZA 4HUVA 2IADB 1YN7B 2GTWB 2LLGA 4OVUA 5JOFA 1XH1A 3UJTL 1J5IA 5D2NE 2FATH 3I6LD 4FTDA 4ODUB 4ELMA 2E8ZA 1E7UA 5IFAH 2HRHA 4TNFA 2EADA 5MEQA 3AACA 2AJYH 4JFZL 1Z9SB 4PJ7A 5DURD 5G4MA 4FQJL 1P7KA 3S3DB 1EK3A 3SKJH 2Y1ZA 3GBDA 1IL1B 5FYLL 3IFLH 5A2CA 3H55A 3DO4A 4BSJA 5JPNB 1XV8A 1IT9H 4G42A 5HHNB 5IMOB 5F1NA 1G0YR 4N8VA 1CURA 4OI7A 1S6NA 1L4IA 4CVWA 4WGVB 1DEEA 3CU1A 4G82A 2NY3D 1ASPA 1IM3B 4XWOC 2XETA 3DXAE 3EYVA 3MUY1 3VXUA 1WO2A 4KFZC 1M1SA 4FQXC 4KUCF 2CKBB 1RIUL 3VRLE 2G3NA 3G6JA 4NQSA 4JG1H 2D0FA 4QOKE 4RGNE 5DMJB 3BPNC 3OPUA 3FN3A 4L8BA 5C0NC 3HZKA 3LHAA 4U3XA 4N0FB 1AH1A 1XF4B 1E4JA 2OQJA 2R9HC 3HR5A 4QXGH 3V10A 1JZ2A 4OF0A 4EDXB 4I0CC 3QS3A 4JDZB 3FU8A 4LDCA 4OKVB 1DBML 4MA8L 3DX6A 4YN3A 3W57A 4DERA 4PB0L 1NUDA 35C8H 1CPUA 2FTAA 3CVHA 2HPTA 4L8SA 5LGHH 1JXJA 2EP6A 1O6SB 4PGCB 4QHLA 1EFQA 1RHHA 1DCLA 5ILTL 3TBSA 1FJ1A 5IM7A 3ESPA 1B3IA 1DQIA 1F1AA 4GPVA 4CSPA 3NZ8A 3HC0B 1JGUL 4UZGA 3SQRA 1UZ8A 1DLFH 2X4PB 3KPLB 4ZMYA 2FUQA 3B2MA 4YSSA 2XTSA 1DZBA 3FQYA 4WQOA 5F7WC 3T2OA 5EMYA 3EFFA 4Y9GA 2AZAA 4QRPE 1MFDH 1MCIA 4FHJA 4TL5A 3RVVD 3AXHA 5JXAL 5IEHA 1CLVA 4YXHH 1U3JA 2FAUA 4DUWA 1SFDA 4GUOA 5FA3B 1RK0A 4JFXA 2FX9L 3O11B 2ZX9A 3IN2A 5D2LA 5FDWA 3O4LD 3Q5YA 4RFOH 4JVPA 3BQUB 3SDXA 3SB3A 5HD8C 2EJ1A 3MPCA 3PABA 4MYPA 1LO5B 4HX1A 4JEGB 3VXOA 4OGQC 2VM3A 2EXWD 3O45A 4YHZH 3ZRCC 5I8CA 3MRJA 3GB7B 4DN3L 5KYXA 2J1WA 3DGCR 2BSCA 5DJAB 5BUPA 3H9SD 2HJFA 4YDLC 1A7OL 3WFZA 4N2EA 3ZDXB 1T7VA 3GJEB 5FO2A 2L7JA 1AANA 2WKGA 4L8SC 5EF1A 3K6FA 3AREA 3WEAA 1CXLA 4HCRA 2A6JA 4H8UA 3PHSA 2V2WA 5LKNA 2ALAA 4FFVC 4CDGC 4MMXA 3VFMA 4J3UA 3MV7B 2BHZA 3SY0A 3MLZH 4UOW0 1SFHA 1TVHA 2DQFA 3O6FB 4XOEA 4K3JH 3VU1A 3H2WA 4H7VA 3ZQWA 1UWGH 3P9LB 1NCAL 5ANME 3VSQA 4LEXH 3LS4L 4QHKI 4L37B 3T08A 1FHGA 3GXNA 2G3MA 1AQKH 4YGVB 2GKIA 3OM3B 4HK3J 4XCCH 3GEFA 2KLSA 3FYIB 5AVSB 5I82A 3IXTB 4NZJA 1LE5A 4NP9A 2DMKA 1RUQL 2I85A 2VQ1A 4X7SH 1E27B 2V33A 1OP5H 1U6AH 3RWDA 3MUJA 5I24A 4G8FA 5FO9A 4BFBD 3TN0D 5HDOA 1Z9PA 4AM0A 4NHCL 5DJ2B 2UUDH 1DQMH 1RH8A 4YWGH 3UC0H 4NS0A 1R75A 3V5KA 3AREC 4OZGE 2WWOA 5B4MD 4YBQC 3HG1A 1KSRA 3D05A 4FXLA 1JMXA 4QO1A 1N5AA 5BOJA 1BFVL 2A6IB 1NAML 4MMXC 2WBXA 4XVJL 1P4LA 1CFNB 2VDKB 1U8MA 1SYVA 3P30L 4HC1A 3TT1H 4G8GD 4WGKA 2OS7A 3DJTA 3E7JA 3ESUF 1JXGA 1CBJA 4W1TA 4KX8A 4OM0H 4TSBH 2ZCHH 5ABDE 2QGDA 5IB3B 3CX2A 5CZVH 2GQHA 3DPBA 5D1ZB 3KPOA 3OWRA 4GAGL 1E0OB 4LRIA 4OD2A 2JK5A 5KBMA 1YHPA 4X6EA 1QEWA 4PB9H 1QLEH 2YOCA 3QORB 3K1DA 1YNKH 1KGJA 1W72H 2FLRT 1C16A 4J7RA 4R5TA 1BW8A 1PMYA 4IU2B 4Z7VA 2Z64C 1ZEAL 3G5YB 3QNYA 5CUSH 1OGSA 1YVLA 2UZXA 3GMLA 1GGTA 4PJXB 2VKXA 5HYJB 1CT8B 3ET9F 3MCYA 4JVUA 3VCLA 1I8MB 2N56A 3RVWC 4FQLH 1XD1A 3BAKA 1WSST 4Y4HA 3KLSA 2ZOLB 3KPQB 4WVRA 1EGJH 1T0PB 1KPUA 1A4AA 1Q0YH 1A64A 1X5GA 3D34A 3HHSB 5ISZE 4GS7C 4GRWH 5ECJE 4D9RD 4QHNB 4G6KL 1QWHA 2RJMA 5KJ4A 1YPZF 2A73A 4LGSB 3JWOH 1HVXA 1FNEA 3QJHA 3WNKA 1L9SA 3ECBB 1DJXA 2CRZA 3QO1B 3FUKA 3TYFA 4R7LA 3V8CA 1OK8A 3ATEA 1A4JA 2XWZA 4EI0A 4X98B 2PN5A 2Z3FA 4P5KB 3OLDA 2ENPA 4N2HA 5F6IB 4F2MA 2DLTA 4PD4J 3K5SA 5CLZA 4GO6B 2C3XA 4FQHB 1MW0A 2VJXA 4FNSA 4ZPTB 2R1YA 2VLKA 3EOBB 3QDJE 1MHPH 2NNAB 3TVMA 4TPRH 2P5PA 4HKXB 3K2IA 3MNWB 1OK0A 4UWQB 1P7BA 3WKPA 1ZWIB 5KSAA 5FA4A 3UBXI 1OOWA 1TEGA 2WTRB 3B9VA 3M1BB 4KKCC 2DJ4A 1IEAB 1ZV2A 2LU4A 4MB5A 3IK2A 1PKOA 3ULUC 5E08H 2VLME 3S4SB 4L3FA 1BLNB 3FF8A 2NR6A 3VD0A 4ANKA 1F02I 3EO9L 3WN5B 2NXYB 1VFOA 3NVQA 1B2WH 1OAZL 4M5TA 1MW3A 3WNJA 1NLDL 1MJUH 3D0VA 4BKTC 5GQBA 1MCQA 1FFPB 5CKGA 4M1DH 3DDGA 3GSWB 4RAUB 4IMLB 5JDSA 4DKAA 1N3NA 3QYCA 2RCSL 4GQZA 1U33A 4QYOB 1FO0H 3V4VB 1I3VA 1S9VA 1AXTH 3L3KB 2WVVB 3ZE1B 1S2EA 4I2XA 1INEH 4UV4H 3S34L 5B3SB 3VXQA 4PJAE 5JZ7C 1RPUA 1QA9B 3PWUB 1I8KB 2BVPB 1DHKA 1OAUL 4L1SA 1KDJA 4I0PA 2KPNA 3BJLA 4KI5F 5KSAC 1TZAA 2X87A 3IDYC 4JFZH 1IAIL 1AKJB 4GRLD 3EHBC 1M7UA 3GSNA 3C6LD 4IRJB 4LU5L 1C1EH 3CPUA 2NR6C 4FJYA 2E5EA 5EN2B 2XC8A 5A16B 1U91A 1DQLL 3AVEA 3IVKB 4OJEH 1KIPA 4P59L 5KANI 4A7QA 1BDYA 2X4QA 4LARL 1A6ZA 3KCPB 2QHLA 2P24B 5TFSL 2P28B 4ZTPH 2KMWA 2OI9B 2ADGA 4NKOB 1WBZA 2GK0A 4Z18A 2ESVE 2JNZA 4W9GC 1ZVNA 2X53A 1JK9A 2BZCA 2X89A 4A6YB 4Y88A 4DTGL 4R7DB 1NBYB 2O6FA 2EYTA 2XZAL 4C55A 4AIXA 3AMLA 4MA8H 3PUUA 4IJTA 3VXMD 1RUML 2V3FA 1BEYL 3BUBA 3Q8CA 4I0PC 5E5RB 3S4SG 2NX5D 1S5IL 2NPLX 5ADOH 4YFDB 3NDZE 4D0CB 2YD7A 1BJ1H 2Q9OA 4XPHL 5CCKL 3TBWB 5B39A 4YE4L 1IKFL 2ZE0A 5B38B 5JORB 2X1OA 3QJFA 4XP1L 1UM6L 5TDPA 3VFGH 4XVTL 1LWRA 5CHNB 3MLYL 1J0JA 3DX1A 1NBCA 1UGKA 1AOHA 2HKHL 4QNPF 5HVFB 4G7VL 4Y19A 3VWJD 2JCCF 1HILA 1L7TL 5AAMC 1L7IL 2F8XC 2DW5A 4E9SA 3O3AA 4KVPA 4ADIA 3KNBB 4XNMA 2Z8RA 3PHQB 2NSMA 4HUKB 1KFGA 1NKGA 4J6RH 4PCSA 3UBXA 3RVXD 1EEZB 2OPCA 3QIWB 1SLWA 3H42H 3NFPA 4GKOA 4KXAA 5DZNA 5K5YA 1BF8A 4ZFFA 4OCWL 4FX5A 4JCWA 4DESA 3BPOB 5IUSA 2A99A 4AYSA 3SDAB 3BE1L 3GQFA 3MA7B 1OP4A 4FA6A 4RSVA 2VZ3A 4UOW1 4G6JL 2O6EA 3UZQA 3QAQA 5EU7E 4KXDA 5FC9A 1E8WA 5C3TA 1R3HA 1QEXA 4HZLA 4MXQC 2MQGA 2J4WL 5TPWH 1CE6B 4DVRL 5EBWB 1VCAA 2I25N 1IKNA 4R0LA 5K9KA 3OKEA 5E8PA 1N8ZB 2BWQA 2QZQA 3BH8B 2BSBA 4YPGA 1RJLA 4IIZA 2FJFB 1CBVL 2B9BA 3NSFA 3IT8D 3MJWA 3T65A 4LPXA 4HALA 3QG7H 4N1CA 2V6HA 4XMVA 3X14B 4ACTA 1YAZA 4P9ML 5E6YA 1E3ZA 2I27N 1BEXA 4NGHH 4KVNH 1PEWA 3H8NA 1OV8A 2ZJSH 3Q3GB 4G2AA 5DDHA 3FU9A 1S7QA 2NW3A 1EERB 1RULL 4YLCA 1A0QL 1T03L 4OF6A 4ZO6A 1DVZA 2Y0SA 1XCXA 2B59B 2N0MA 1AGDB 3BUYA 2BSEA 1FLTX 4UIMB 4PTUA 4HAGA 3MMEB 2VKWA 3TWCH 1J1XL 5C0GA 2VRAA 1BQSA 2WO3B 2NYYC 2WLNA 4PJGE 4EOWL 5L2KB 3ARRA 5B38G 3ALWA 4JFSA 5DJ8B 5D7IF 2WINA 5JQ6H 3JVFC 4N2MA 1PCXA 1E65A 1S9WB 2HFGL 2WLLA 2ITDA 4PR5B 3VGAC 5MP6H 4PJEA 1GYCA 1MCHA 2CA4A 1HNYA 1DYZA 1R3JA 1T0OA 3QPQD 4JHBA 2J6EH 4M8VA 4H40A 4YH6A 3PWPA 4YSEA 2Z0BA 1S7RA 3P4MB 4H4NA 1ORQB 1XTMA 2ZXDA 3P30H 1IKNC 1U42A 3QZOA 4R0LC 3V52H 2H1PH 2YEZA 4F7MB 2IMMA 1NIBA 1RZ8A 4Z8FH 4NPYB 3B5GA 3US0A 4EN3D 3L1EA 3NJIA 3KBFA 5E95B 4YDKL 4M7LH 1U8OA 1TTRA 2B4CC 2QJDA 3B8SA 3SE6A 4B27A 3LNEA 4IBYA 4ZOEA 1OW0A 2VDKL 3GF8A 3FOMB 2CLRB 4XAKD 1OGTB 3QUHA 4H25A 1DQJB 4AE1A 5KSVA 1R5IA 2HKAA 1WEJL 1ZDQA 2OMXA 2Y22A 3GSUB 4JPKH 1U8HB 1HEHC 3NZUA 1G6RL 2CR0A 1NL0H 2WSKA 4AT6B 5D7SH 3GI8L 3E8VA 3ZKMD 4OZHE 3L17A 3N1GC 2XN9B 3APCA 4NNYA 3W11D 4CILA 2QLYA 3MC0A 3MBEB 2CRIA 5FGBC 4AG4L 1CFQA 2UY6A 3HI6L 4PBWD 4U1MA 1T21B 4XCYA 2JKIS 2B14A 1MCJA 2DM2A 5FXCH 5KSBF 1RERA 5DUJA 4FA7B 2I5YL 4F3FA 3MHZA 3O0RL 2J12B 3VXPB 4JDEA 4L3ED 5FF6B 4G6KH 3WOVA 3F5WA 5DHVA 1E2ZA 5AW7B 1M05B 1SN2A 3FYEB 3OJDB 5HI3C 3CN0A 4Q6IA 4FZEL 3EH1A 1OW0C 2XUWA 2Q8AH 3K6IA 4U7MA 1UXSA 3ARBA 1RL1A 1F4XL 1GH7A 2ZXEB 4A2HA 3MTRA 4ELMF 4M00A 3RB7A 1IFRA 3QUMA 3NZSA 4R96B 2AV1B 3HPLB 2B5IC 5MEND 5T1LD 1DLHB 4ZFQA 1HXYB 1FZKA 1WUZA 3S3PA 4UQ2B 1Z5YD 2AVFA 3VQLA 4ALAC 2ARWA 5B8CA 4CMHC 3P11L 4K3EH 3L8QA 4HCFA 4D8PB 4GIAA 1YEFH 3B9AA 1E5YA 1MLCA 2GJ6A 1ZIBA 3OSKA 3VD4A 3DURA 2CBMA 4X7EC 1B6UA 1YQ2A 5LBGA 1YJDH 5IW1B 2WGNB 5KYYA 2BSSB 1WT5A 4GI6A 2Y7SA 3CCHA 4QYAA 5E2TL 4JDVB 3G6JF 4C8XA 2Z8SA 1F3DH 5L2JB 1AQDB 1GW0A 2EO1A 3RHWF 4M3JA 4ELKA 3EIFA 4J6IA 2JKTM 3ZW3A 1MCPH 4Q6IC 2G0KA 4RZCB 5IMMB 1JN6B 1ETZA 2E9IA 2X6CA 5EO1A 4UM9D 3THML 5IHUL 4X9IA 1WBYA 1LDPH 1UZGA 4P05A 1NLDH 3I75B 4A04A 4FQCL 3KWUA 1XF1A 5L0QB 4WK4B 4P46D 2AI0L 1OSZA 5T5FH 5ABZA 3E2HB 1X6LA 4Y2NA 5T1JA 2EDKA 5TF1L 2PYFB 2ZWLT 3B7YA 4JPSA 1BF2A 5LB1A 4FRWA 4RA3A 3ZL1A 4S0SD 5DK0A 5H37H 3QA3A 5HGGS 5EOQH 5INCB 3NFSL 4GAAA 3OQRA 2XVBA 4LLYA 1WT5C 3EYSH 4G1MB 1CMOA 3KZ8A 1I9RL 1BYPA 1PBYA 3MZTA 4YHML 3KPPB 4RESB 5F7NC 2DJMA 3T0WA 3O2WL 3V6ZB 2A0LC 3UABA 3RQ3A 3WUWB 1D6EB 2A74B 4MB1A 5I74C 1KTLA 3BVWA 1MEXH 4FNLH 3TH3T 4NQED 4RGMC 1J5HA 4IEFB 4D9LH 1D5MA 3UYPB 3UP6A 1M7XA 3KG5A 5TFSH 4O2CB 1ZSDA 4JN2A 4LOEA 3GZPA 1KXVA 4PRHB 4G7QB 1N0LB 4IGBB 4UU9A 4DZBA 1QQDB 3I6GB 1Q38A 5LLIC 3QVAA 2BP3A 2I9LB 4Z7NF 4W70A 2E76C 1HQ4B 1RZPA 1KC5L 2VT0A 4WTQA 4F7TB 2AXHA 4YHYC 5IF0A 4DWHA 3FDWA 2XZAH 3GSXA 3O3DB 2DQDH 4B9GA 3JWDH 1F1GA 1RUMH 3GXIA 5DHEA 5JHDD 1P6FA 1D7FA 2BFVH 2OZ4H 3EYQD 4KZDH 4X6CA 1I7RA 2OV0A 4MSWB 2PABA 4AK2A 2CGRH 2W9EL 4A6YL 3RY6C 5CCKH 5CGMA 3RNKB 3ZDXE 2AC0A 3MRCA 4OIAA 4LB8A 4TRPH 1JRHH 5D7JA 4WW1B 4KNTA 5EOCL 1RIVH 5L9DL 4S0TD 4CJ1A 3QRFM 3FQTB 4NO5B 1M1XA 1RSFA 3D06A 3MV7E 2HKHH 3NRQA 5AVYB 5BRZA 3WFDL 3O3EA 5C6WH 2CR6A 2E86A 4OFYD 1YY9C 1THCA 2VXQL 1DN0A 4Y7MA 3VG0H 3ZHDA 1TQCC 4P57A 1WZMA 3MCLL 4BUQA 1NOFA 5DO2D 3FOLB 3F8UB 3LQMA 1KBGL 2EXSA 5FYKL 4YEEA 4M8RA 4JLRB 1MRFL 2MNWA 4OCWH 4BE5A 3OAUL 1RJYA 1BZ7B 1PLGH 1KTDA 2EIBA 2QQLL 4TQHA 1QZNA 1XIWD 2YGPA 3WUWG 1O6VA 1KTJA 2WTPA 3NCBB 3NABH 1T3FA 3RVUC 2EIZB 4G6JH 2KDGA 4NAQA 1MNUH 1CDBA 4HJTA 2QSTA 4OW6A 1LO0H 3QQ9C 2VN3A 4XRCB 4WUKL 2OXHA 4M6NL 4DVRH 1L5GA 2V5RA 3FTVA 2AABL 2BVOA 2UYLA 5D7JC 2P8PB 1RZFL 2R0WH 3J07A 5JIMA 2VDQH 1E2VA 2DJUA 4OF5A 2ZYSA 1NCHA 4FADA 2NXZC 4Z7VF 4GG6B 3VFTA 3CZFA 25C8L 3RWCB 3F83A 4L9LB 1GZQA 3EO0A 4YBLB 1TYEB 5F3BA 4TUKL 2E6QA 4TUOB 2I7OA 2Q87A 2VITB 1UCBL 5F6HJ 1EEQA 1RULH 3QJVB 3HFFA 2ZWYA 4OV5A 2WBJD 3SYAA 3ZDYB 3FT2B 2XWRA 5BQ7A 5E8NB 2OXGB 4IIQA 3GSOB 3QUKB 3MA9H 4QKXB 1PGRB 3GD1C 43CAA 4FI6A 3PXHA 4M43L 1QHQA 4Z76A 3CMOL 3P4NA 2ZKXA 3VMPA 1H0DA 1OZUA 2IGLA 4AQEA 1S7VB 2EDMA 3A0OA 2P45B 5ICZA 4QRTA 4NKDA 3BGFC 4LKCA 5AWNH 5GGQH 1UZ6E 2APBA 4MQ7A 4PJXE 5HYJE 1LDSA 3LNHA 4FHBD 5FLVA 4XN7A 2V3DA 4UNIA 5C0EA 5I71B 2ZXWB 2J55A 1G1CA 2VABA 1FYTB 1HC1A 4PRPB 1AGCA 1T1WB 5DLLA 4QF1A 2HJLA 3HTLX 5C9KA 4TTGA 4B9CA 3KYKH 2HYMA 3D08A 3DV6B 4UDTA 4MQXD 4FQQB 3SBQA 3MNZA 5LGYA 4YDKH 3QH3B 3GMQB 2F7QA 2ADIA 1JG9A 1E50A 2VDLB 1N5YL 3CVCA 4OKDA 1V7ML 1H3VA 2LQRA 1TCRA 4X99B 1OTSD 2OTUB 2X3AA 4L29B 2X3BA 2J8UA 2E7LC 4YDMA 2AEPH 2DEYX 1WZLA 1EXGA 1G6RH 1NGWB 3ELAT 4YUEL 3APNA 4J39A 1FIGH 3GI8H 1KJ2B 1J8KA 2VLRB 4X5QA 1IKOP 3E1ZA 3IJHA 4IIQC 3EJZC 2R0KH 3B9KB 4HS3A 4DP2X 4HIIB 3EUDA 3OXRB 4BFIA 3GSRB 4GQ9L 1C5BH 1PAZA 1S46A 2J57A 1TR7A 2LU7A 3HI6H 1D7BA 3BH9B 3WKYA 3NAAH 1ZTMA 3PAUA 5C8JA 3MRLB 5FCUH 1ZA6B 5E4AA 4OQTL 3S36H 3LY6A 1VPOL 4RIRA 1CDYA 5AKVA 3O0RH 3EYFB 4JUTA 4AVHA 4CBPA 3QIUC 2ATKB 3IM1A 4F8NA 2CO6A 3EJCA 4PSPA 5D1XD 4TULH 4M9PA 1N4XL 5E2WL 3S6CA 4EZKA 3QFGA 1S7UA 1FL3A 4K3GA 3MO1B 2AANA 3BIAX 3S88L 3AUVA 3LQAC 4JFWA 4BSVA 5FYJD 2HX8A 3L5HA 4OM1L 5AUMB 4Z78B 5D6DA 1P4BL 2HWZL 1ROCA 1YQVH 1UATA 3NDYE 5CJOL 5JW3H 3CZNA 4Z3FA 1G7QA 4PJIB 5CN2A 1Z3GH 1EBPA 4PLKD 3F6IA 2MKLC 4ZMWA 4LSPL 2FSDA 3UYRL 5AAWA 4PLOB 2GUOA 2X44D 1L9PA 1RFDH 1YEWA 4EIGB 3ATDA 3DVNA 1RPQA 2ICES 2OMZB 2VN5A 4XN9A 3T6XA 2NY3C 4KUZH 4L4JA 4JRWA 3V6OE 5JLZA 1GTFA 4IOIB 3B43A 3D3VE 3E3QE 3V0AC 4PBDA 4NM8L 4HU8A 1CLZL 1NPJA 3ZE1E 1NC4B 2B0SL 1NA8A 4M5ZL 1UB6B 5IIEB 3BPNB 1RQ5A 5E0QA 3O4LA 3RIAF 1KIUB 3NJKA 2WWKO 1NGYA 1TTFA 3WL9A 1EEYA 2ZNXA 3FSOA 1K4CB 2VL5A 2VN6A 3HJ0A 2IQAA 3G08B 3NRPA 2DLFL 2ZD0A 5IHUH 4JJHA 1ECZA 3NZHL 3KDMB 3MTXA 4YHLH 1XGQB 5ITBH 3A23A 1FZJA 1G9NH 4NC1E 4PJ7B 4WUUD 4LSRL 3MJ9L 1U95A 4IW4C 3EH4B 4AWJC 2JKNA 3AABA 2Z4QB 2VSCA 5H35A 1MFCH 5AAWC 3V4UL 3ROOA 3WY1A 5CKAA 1GTNA 1QVOB 2Z92A 4JHWL 3WY3A 3EYOB 1EVTC 3DETD 2CLZB 2ADYA 1YNLH 1JHKL 1UADC 3HMXH 3VXRD 3FT1A 1P2CA 1BF5A 2OYLA 5L6YL 5AKRA 1XCWA 2XWBA 3FKUS 1AFVH 3FCBA 1WE5A 3RVVC 2P5EA 3VJ6B 5LBSA 3RKDD 4NQSB 4YMPA 1VACB 3BZEA 1JDDA 3VA6A 1DSFH 4DQAA 5A6IA 3P0VH 2NT1A 3DI3B 2YPLB 3HCVB 4PYHA 3HR5B 4XNZC 2H2PD 3MREA 1KLFB 3VXSB 5K1VA 2EXWC 2V2TB 3DXAD 1G1KA 5EZOH 3GJFB 4LCWA 4PJDA 4RAVB 3TN0A 1VFMA 5ACMA 1IGJB 4YDLB 3PV6A 2W65B 5IJDC 4UANA 32C2A 4GP8B 3S96A 4L8SB 4L1HA 2ENYA 2ZZUT 4RGND 4PGEA 1RXLA 4QKTA 3FUMA 1E4KA 3MRRA 3S37H 7TAAA 4IRZH 3Q44A 4QRQA 4ZX6A 4IBWA 3QEQD 4KQ0A 1HYRC 2ZWZA 3CDFA 3HC3L 3EGXB 5H4ZA 2ITCB 5IEKA 5C6TH 4LL1A 1ANUA 5GGVY 5KSUA 3TT3L 5CBAA 3TPKA 3FO0L 3KPMA 4IDJH 4HDIA 3VWKA 3N0AA 1LEIB 4LBEA 3NK4A 4HISA 4LNRA 2Q7AA 1Z3RA 3MOBL 5CXPA 4ZUVA 3U7YL 3ULSA 4QJ3B 4M56A 2WUBL 4JM2A 4DZ8A 5IQ9B 1IC0A 1RK0B 2BSTB 3DUUB 2NY5H 1BPVA 4Z3HA 4AJYV 1AD9A 1A4KB 2HFTA 2Z35B 4JFFB 4LPYA 5D2LB 2HRPH 4ICXA 4UT9L 4JRYB 2W9EH 3QDMB 5E9DA 5IHZB 4YAQA 3L7EB 5LNEA 4TN9A 1ED3B 3QJTB 4M48L 5IB2B 1P5UB 1MY7A 4NN6C 4OZFH 5I1EH 4M93B 1TQTA 3K2UL 4FXTA 3TN0C 5EOCH 4JGJA 2IQ9H 1JXDA 5DHXB 5L9DH 1A1MA 1OOAA 1JZ3A 1JNNL 5H2BA 1TKWA 2ORBL 3IMBA 2AEQH 1BVNP 4HJGA 3WFDH 1EA9C 5KN5A 2A6JB 3EBHA 3DTDA 2YAMA 1RKRA 5K39B 1E4KC 5B4MC 5DCCA 4YHIA 4G7YH 5K9OB 4IBZA 2ZSWA 5SX5K 3MCLH 4LEOA 1TVHB 2WCGA 2CG9X 4X4XA 4GT7A 5I0XA 1MRFH 4YR6A 4HWEL 2QDVA 1JMZA 4RETB 2R2BA 1CTMA 4RFNC 5A40E 2EDHA 4Z7UB 3CQPA 3MBXL 4X8CA 3HNSH 2IWKA 3DMMD 5J89A 1HHJA 2GJJA 2HRLA 4U1NB 3WFCL 4CGTA 2YSSB 3Q0HA 1M3JA 3MKKA 5LN8A 5L2KE 2B16A 1M9SA 5DQJB 5D1QB 1R5VB 2X7LB 1K6QL 4K71B 4M6NH 3IYLW