2PP7A

Crystal structure of anaerobically manipulated wild type oxidized afnir (acetate bound)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp7A02
3FSVA 1W6WA 1KBVA 1ET8A 1KGYE 1A4AA 3ZDWA 2HX7A 2YXVA 5B1JC 1M9WA 4PAZA 2P80D 2ZWNA 1AR1B 3NJNA 1KCBA 1PZCA 3PAUA 4GP8B 4YSPA 4F7KA 3IEAA 1MG3C 2PPFA 2HRGA 4E9QA 2IDTA 1WA0X 3FYIB 4JKNA 5PAZA 1RKRA 2I85A 4HIPA 1GW0A 1AZUA 1A3ZA 1NICA 1PY0A 2IDQA 2BWIA 1IBZA 4JHVA 3PLYA 2IDSA 2PCFA 2AANA 4DP6X 3ABMB 3WIAA 5D4HA 4A2DA 4A67A 2Q9OA 1JZGA 2YAHA 1L9TA 1JOIA 1CURA 3ABKB 3NJHA 4YSOA 2B08A 1E65A 3FU8A 2Y1AA 3G5WA 3S3CB 3ZX1A 1ETJA 3PXLA 4A2HA 2DYSB 2YAPA 2W8CA 2XXGA 3L45A 3UADA 2VSKB 4DP4X 4E9RA 4HCGA 3NSFA 5B7MA 1PCSA 1N70A 5TK2A 2BWDA 2EILB 4A2FA 3ASOB 3UACA 1XB6A 1OOWA 1SF3A 2BZ7A 3TASA 1NWOA 3ZBMA 3X1GA 1V55B 1OCCB 2UXFA 2IWKA 2JXMA 3S3DB 4W1TA 1SFHA 4YSTA 2YXWA 4CSPA 1A4CA 1CYWA 2FT6A 3V9CA 4DP1X 1FA4A 2I7OA 1J9QA 2XWZA 1BEXA 2J56A 3TU6A 1A4BA 4ZK8A 1AIZA 1ET7A 1DZ0A 2PP7A 3HB3B 2QDVA 1OE3A 2XLLA 4YSUA 5B7EA 4F2EA 1OCRB 3S8FB 3QJRB 2QDWA 2RACA 2A3TA 1IKOP 1DYZA 2XXFA 5B7FA 4FA7B 4QKTA 1JZFA 3OM3B 4YSCA 2DYRB 3QJVB 1GS7A 1KBWA 3NJGA 1NIFA 2VW7A 2LLNA 4P5RA 2GC7C 1ADWA 3WNIA 3X1BA 4GYBA 2CUAA 1EHKB 2GBAA 2VW4A 2FQDA 3OMNB 5IY5B 4AX3A 1BYOA 3D12B 4DP5X 7PCYA 2IWEA 5F7AA 2OJ1A 1XB8A 4HCIA 1HAWA 1ZIBA 2PP8A 1QHQA 1VLXA 3TA4D 5ANHA 1PNCA 1WA1X 3QJUB 1MZYA 4A66A 2UXGA 1AZNA 1GS6X 4YVNA 3DKHA 1FFTB 2VM4A 3FYEB 4KO5A 5TK4A 1J5CA 2GI0A 2N0MA 3FSZA 2R7EA 3MX0B 5I5JA 2PLTA 1MDAA 3EH4B 5F7BA 4E9WA 2WSDA 2VSMB 1I53A 1ASQA 3EF4A 2AZAA 1X9UA 3OD3A 1RZQA 4G7SB 3QJQB 2PPCA 3FSAA 3AG1B 2XYBA 2BW4A 4G72B 1BQKA 3OMAB 3SBQA 1WS8A 2DWTA 3ABLB 3FQYA 3SBPA 1R1CA 2CJ3A 5D4IA 1OCOB 1WS7A 5I26A 5PCYA 5B1KA 2P80A 2H5UA 3OMIB 3T6XA 3JT2A 3FQ1A 2XV3A 3FU7A 4HZ1A 3NSCA 2YAOA 3CG8A 4Q8BA 4N4YB 3NJLA 1AOZA 4G70B 3DTUB 1OCZB 1BQRA 2OV0A 4WKXA 2IWFA 4E9XA 1NWPA 2XX0A 3FPYA 4BWWA 1WAEA 3QJTB 3MBWB 2JFCA 3UAEA 1GS8A 2HLEB 3BVDB 2VW6A 3FU7B 1JZEA 3DIVA 4BXSV 2CBPA 2IDUA 1XMEB 1PZAA 1NPJA 1NINA 2FT7A 1SJMA 4W9ZA 3CVCA 1ZPUA 3SQRA 4EF3A 3QPKA 4DP8X 1B3IA 1E5ZA 4BDVA 1QLEB 3CZUB 3X1FA 4KO7A 3IBOA 1RCYA 1KDIA 2ZONA 5I6KA 1GYCA 2B3IA 1JZIA 5I6NA 4G71B 2EIJB 3WKQA 4YSEA 2GIMA 1KV7A 4M3HA 1J9SA 1JERA 3WKPA 3ASNB 1OE2A 2H47C 5EHFA 1TKWA 4UF7C 2JKWA 3NJFA 3T6WA 4YVUA 2J57A 4KNUA 4GY4A 2XUWA 3ABGA 2PPEA 4KOBA 3NP4A 2HZHA 1NDTA 1PZBA 1L9PA 1SHXA 4GP4B 1MG2C 1ASOA 2PPDA 3BQVA 2PPAA 4KOCA 4L0PB 5B3SB 3GXUB 2BW5A 5LDUA 5E9NA 1SF5A 3TBCA 2GSMB 4A2GA 2AFNA 3N2JA 4MFHA 1SFDA 4P5SA 1MZZA 4YL4A 3CVDA 1TEGA 3FSWA 4YSQA 1IC0A 2IH9A 9PCYA 1CUOA 4DP9X 2FTAA 1EZLA 4UAHA 2CCWA 3NJJA 2VMJA 3WI9A 4BWTA 1J5DA 4BK5C 4BWUA 2GB2A 2IAAC 4E9VA 1IBYA 1HAUA 3T6VA 4F2FA 1JZHA 1BXUA 1WA2X 4K9JA 1SHWA 8PAZA 3C75A 3PPSA 1GSKA 1AAJA 1ZV2A 3AW5A 1A8ZA 5D4JA 1ID2A 3ERXA 4AI7A 1QNIA 1AS7A 4DPAX 1N68A 4DPBX 2IDFA 1L9RA 5I28A 4E9YA 2WO3B 3NT0A 3RYMA 3X1NA 3CVBA 4G7QB 3U25A 2W88A 1UATA 4NAJA 3WG7B 1NIAA 3T71A 2MRYA 4YSRA 2FQGA 1KDJA 5I6PA 3JTBA 2UX6A 1NIBA 1JXGA 4A2EA 4AZUA 1ILSA 5B1JA 4Q89A 4HCFA 1OF0A 2XV2A 2QPDB 5AFAA 1GY1A 1PLCA 1T5KA 1M57B 4YSDA 1PNDA 3NYKA 3ZIYA 1CYXA 6PCYA 3NJKA 1BXVA 1BQ5A 1J9RA 1TEFA 4KNTA 1L9SA 2EINB 2HRHA 5I5IA 4DP7X 4GXFA 2J5WA 4AKPA 2ZOOA 1AG0A 3NJIA 1BYPA 2BP8B 3AG2B 2EIKB 1PMYA 4E9TA 2AZUA 2H3XC 3KW8A 2J55A 2FWLB 4WTQA 1AQ8A 1OV8A 1F56A 2BZCA 3GYRA 2DY2A 1BAWA 1OE1A 1PLBA 1JVOA 1AG6A 2BP0B 2TSBA 3IE9A 4G7RB 1GY2A 1A65A 1JZJA 3V9EA 1JVLA 1ZDQA 3T9WA 1ILUA 2XX1A 3TBBA 4KO6A 4QLWA 1KYAA 3WNJA 2UXTA 5I6OA 1ET5A 2I7SA 3SBRA 2DV6A 3AG3B 3T6ZA 2Q5BA 3UGEA 1PLAA 2FQFA 1AS8A 3FU9A 4CSZA 1AACA 4YSAA 2X87A 1XB3A 2TSAA 1L9QA 5B1AB 3CDZB 1BXAA 2YAEA 3OQRA 2QPEB 4DP2X 4BDVB 5I6LA 2YQBA 4YSSA 6PAZA 2VM3A 3KW7A 2CAKA 2BP0A 2HX9A 3NSDA 2MTAA 2UXVA 1ASPA 2E86A 1JXFA 2OCCB 1E30A 2IH8A 1PAZA 3QQXA 4PCYA 3H4FA 5AZUA 2HX8A 4AKQA 1NZRA 2CALA 4ENZA 2GC4C 3PCYA 1M56B 2BHFA 3FPXA 2NRDA 1E5YA 2ZXWB 3AZUA 4N8UA 5B1BB 2UX7A 4NB7A 1AZBA 2R7EB 4TXVB 2VN3A 1NTDA 2YAFA 2BP8A 3UABA 2Y69B 4UANA 1KCWA 3N55A 4DPCX 3UAAA 3AY2A 1IUZA 2WO2B 3AG4B 3H56A 1SDDB 4KO9A 3GDCA 1V10A 5FC9A 1HFUA 3FS9A 1E67A 1SNRA 2XV0A 3X2QB 2YAQA 1ZIAA 1W8EA 1NPNA 1ZDSA 1L9OA 2HXAA 5I6MA 3FQ2A 1PF3A 1GR7A 1V54B 3IN0A 1CC3A 2EIMB 3NSYA 1SDDA 2AVFA 1X9RA 1AZCA 1J9TA 4AKOA 7PAZA 3S8GB 5AKRA 2X88A 3EHBB 1RZPA 3IN2A 3CDZA 2XU9A 4HHWA 4A68A 1TU2A 1JXDA 5I5MA 3NP3A 2XVBA 3EH3B 4NERA 1AANA 1AZRA 3NJMA 3EH5B 4X4KA 4HALA 3H4HA 1YLBB 2FJSA 2PCYA 3FT0A 4GP5B 2QT6A 3HEIB 2YARA 3X1EA 3QJSB 5A7EA 1W6LA 1FWXA 2DWSA 1NIEA 4RH4A 4E9SA 4FAAB 2YAMA 2PP9A 2FT8A 2FQEA 3PAVA 4JHUA 4M4RB 4BXVA 4DP0X 1AS6A 4KNSA 1NIDA 4HAKA 4HHGA 3S3BB 1URIA 2GHZA 3PAZA 2BO0A 2FNWA
chains in the Genus database with same CATH superfamily
2YZ8A 2BH0A 3HG5A 3OKMB 4NKDB 1G5AA 4PRBB 3DGGB 2HP4A 4C56D 1RXLA 5DLLA 4L1SA 2DQIL 2GBVA 3CX5K 5DMJB 5K9QI 4X6CF 4GP8B 2H45A 5JIIA 3B34A 1KCSH 2CO2A 4HS3B 1H15A 1Y6NR 4XGZB 5DTFA 1WBZA 4GOSA 1KACB 2PETA 5HPOA 1YY8B 1WH0A 4MSWB 5AW4B 4AYBA 3OL2A 5GGTH 2UY7A 1GKOA 3K5SA 1F5WA 3ILPB 3AROA 4G11A 1NICA 3WMSA 4PWFA 2IG2H 2FJUB 4LSVL 5I1LB 3NIDF 3NDZE 2R23A 3QIBD 4IMKC 1JZGA 5I1CH 3IKCA 4F7EB 5EBMB 4HKZA 5GJSH 4H0IA 3MV9D 1RUPL 3ABKB 4ANWA 1VDGA 2WV3A 3CFCH 4HPHA 1A6PA 1UACL 4A2HA 2DYSB 1TJGL 1UUNA 1JZDC 1RIVL 3VI4F 4AE1A 5GGVH 3QDGE 4AJ0A 1QZNA 5T1KD 4P4KB 2X70A 5DRZA 5KW9H 5JA9A 3VB8A 3ZYJA 1AY1H 1R3LB 3WIIH 2FRGP 6FABL 1MFBL 2ED6A 3CE1A 5IVXF 4MXVE 3ALXA 3PABB 5GGSB 4BCXA 4KK9C 3NFPA 2F74A 1W0WA 1V55B 1OCCB 4K7PX 5I0VA 1KXTB 4OF7A 3C08L 3O9WA 1E4XI 5D71L 4QJ5B 4YSTA 4N90E 4N2IA 1XGUB 4X7EC 3BO8B 3K80A 3BC9A 5IB1B 3U2IA 2X6CA 1KTKE 1KN2H 4KUCF 4W6XB 2OTWA 4IIQB 5IJVB 2ICCA 2X9ZA 1A0QH 1C08B 4WAFA 2WNKA 2YRPA 4MA1C 3B7YA 4IBSA 3MLTA 3EHBC 1RZGA 4TQ8A 2EC9U 2XWEA 5CKGA 5C09A 3F7YA 1PIGA 5DD6A 3ZTJG 4O4YH 1MPAH 3PGDA 1MCNA 1J0HA 2G2RB 4JY5L 1HCVA 3VGAB 1IKOP 5IFHH 1QP1A 4JFDB 1GGIH 4EJ1C 2XXMB 1OCWH 4RAVA 1ROCA 4GQZA 4CAGA 2B39A 4N2BA 1KV3A 1DLHB 3GMRB 1VFAA 4P5RA 3L4XA 3HZYB 1N3NA 3NFNA 1IAKB 3S34H 1IQWL 5C7XH 5IMOB 4M93C 1RZKC 2WVUA 4ICWA 3WFEL 4F24A 2QR0A 2VO5A 2EVHA 2X40A 4DVRH 2F54E 2I24N 2OAAA 3DGCR 3TBWB 2R29A 1OAYH 3RDTC 4UV7H 5ESVB 2CO7A 3QEQB 1FVDA 3VXRD 4FDWA 4U1IB 1WA1X 4TNWF 1MZYA 1TFHA 2V7HB 1WHPA 3RWFB 5C0AB 5DJYB 4JJOA 4J3OH 3EDDA 4R8WL 5D5MF 5E4OA 3CFBB 5TQ0L 3B7UX 2VDPL 2R7EA 3MX0B 1YEIL 4OFIA 1IVTA 2H6PB 1UZGA 1WBYB 3IF1B 2D9QB 1P1VA 4L2YA 1B88A 2A77L 2AZAA 4K3EH 2PPCA 1JZ4A 2EYTA 1VACA 3D18A 2DLEA 3ETBF 4WWKC 5EN2A 2E6QA 3MA7B 1YUHB 1GMEA 2A4EA 4WI3A 4FI7A 3SO3C 3NEEA 1IGIL 1A1NA 3S96A 2NY2B 4XVTH 2Q10A 3ARBA 4NUMA 4V1DD 3VWJA 1UWYA 5KBNC 1U6AL 1DQQA 2XV3A 3FU7A 1ZANL 3QBTB 3KWTA 3ARQA 1T1XB 3F58L 4DKTA 1UD6A 5LBSH 3SDCD 3RG1C 2F7PA 4ZUVA 4PYHA 4P5KA 4M6OH 4K3DH 1CF8L 4LZKA 1U8QB 4Q56A 1FJ1B 4LASL 1OD9A 3MRMB 3UAEA 4Y1AA 3WFDL 2JCWA 2K8MA 3FU7B 1TJXA 3SQBA 3NCYS 5DQ9A 2QTVA 1UGNA 4LVEA 1NBVL 3GRGA 2G3NA 4BKLA 1RU9H 1TMQA 2VO8A 4DN3L 3NCBB 3DX6B 5SX5K 3UTTB 3CX5J 1TKWB 4X4XB 3ZHLA 4DP8X 5C9KA 1ND0B 3BMVA 3ZE2E 2K70A 5E5UB 3SY0A 3LD8B 4U1MA 1KB5L 4G9FE 4Z7VE 1NGPL 3MO1B 3TFKD 4X6DB 4KGJA 4PRIE 3S35H 3ISWA 3F6JA 3PWLA 3BH8B 1VF5C 2J88L 3KPMB 4M8VA 3EAKA 5EHFA 3NIDB 3AQZA 3DETD 1UKTA 3MREB 4XAKD 5FGCB 2JKWA 5EPMB 5C6PB 4BFGA 2UZYA 1JF1A 2OMYB 5D6DA 2WINA 4MMYB 2N59A 2DM2A 3TCLB 2P46B 1CLYH 1CD1B 2AXGA 4JKPL 2CXGA 5DZNA 4MLSA 5C92A 1IIIA 1M2OA 1AFVL 4Y5XB 3QFJD 4JGNA 1R46A 2VABB 2HRPH 5AW3B 4IKKA 1MLCA 5EC1B 3WNLA 2FYYA 1R3HB 4FQQB 5E9NA 1KY7A 4NUPA 4XWGH 3WKMH 1U8MB 2Y1ZA 3GJFA 4D9RD 1OGSA 4HISA 4NQDB 4HYTB 1S7XA 5M95B 2X6AA 1FL5B 3HRPA 1ZSHA 4NQCA 4DO6A 3MA9L 3WUWG 3QAQA 2HFGH 3DC0A 1AXTH 5TGBB 1TTGA 4I9XA 4NGHH 1AKJA 5DUML 4BWUA 1X9LA 2OMWA 3T6VA 5H8DA 4F2FA 5EEZA 1JDDA 4UIKH 5D1QD 3I9AA 3T04D 4M9OA 4QRRA 4J3TA 1NAKL 1FC1A 2O4EA 1A7RL 5SWQB 2V2XA 3QXAA 4NKOA 2NXYD 3MTXA 2APSA 1XH0A 1BYNA 2YN5A 4HEPG 1WGOA 4S11A 4PJAA 3X12B 1GYWA 3EYOB 3MBEB 2VZOA 4PJBE 1TZGH 2VIRA 4PJFB 1J86A 2DWYA 3NSXA 1KJ2H 4QRRD 4QJ3B 4FQHB 1UUSA 1KDJA 3FTXA 5GJSL 1JXGA 1QOKA 3RVUC 3R06A 5CU9A 3FN3A 1BVKA 4XPFL 3QQDA 4GG8A 1AKJD 1VFBB 2H2PC 2IG2L 4LSVH 5C7ZA 1A7QH 4G8EB 4LAJH 1A7OL 4M61A 5JZ7C 1CYXA 1RZKH 2ICWA 4OSUH 4X5WA 4PJBA 4H20L 3UBXG 4MMXA 3ZL1A 4XP6H 1RZ7L 2Q6WA 1HL5A 1XD0A 3QUYC 4AM0Q 3OAYH 4RWYH 1ROWA 1NFKA 3EOTH 2ZOOA 1NGZB 5IFJA 3T77A 5TF1L 3GS7A 4OD1L 2Z3FA 3OKEB 1FDLL 4PBDA 5DO2C 3EOYG 3T4YB 1VKXB 1SVZA 1P4BH 2AI0L 5CJQL 1JUFA 2BZCA 3W0WB 1FZJA 3G6JA 4XVUD 4MNGA 4YPJA 4IRSA 3BT2L 1OE1A 3HE6C 5IM7B 3AADB 3WD5L 1PEWA 4BZ1H 3BPOB 5HJDA 1A65A 3QPQC 3ULUD 3PXHA 1A7NH 2YKLL 4LVHC 4LKXA 1MHCA 3T9WA 1OF2B 3S9DB 1ETA1 1OGAA 2MOVA 4KO6A 4OZFG 1DSWA 5AAWC 1A14H 2JI3A 4C55A 5DS2A 3AAZA 3KVQA 4O2FB 3P0VH 3RGVB 4MJHA 3VFVA 2OMXB 3LMJH 3A4DA 5ALBL 3TZVA 4ADGA 2Z31C 4FQQA 5IF0A 4IGBC 5GGRB 3KLSA 4G42A 3WSQH 4BFJA 4R84A 4N0FA 4X7SH 1R0AL 2AERT 2BY3A 2RMNA 2WBJC 4JG1L 4WFHD 4TRPH 5E2WL 3WBDA 1R3JA 3GB7B 3MV9E 5K9KA 4POZD 5DJ6B 4Z18A 5IGXL 3MMEB 2ERJB 4ORGA 4M6NL 5BW7A 1BZDA 3OJMB 1N0LA 4C4KT 2M8XA 1RVFL 5DEZA 3WOVA 3KYAA 4EN3D 2FBOJ 5EEWA 4J4PC 5DJAB 1YRKA 5F0LB 3AZUA 2QSCH 4JDZA 4JPVL 3KYNB 4NB7A 5J1AB 4HIIB 5T1LD 4GRWH 4QTIH 5I1KH 2WGNB 2Y6SC 2YS4A 4W9IC 1BDYA 1PD1A 3V5HA 3QIBB 4P3WA 1PSKH 3W9DA 3IDNA 4ODXA 4OJFH 5HI4C 1CICB 4BSVA 4FF9A 3P69A 4HJJL 3HJEA 2P8LB 2PWDA 3BP5B 3IETA 3EYVB 4MQTB 2YPKB 2XPGB 3O3UN 3D3VB 4HJ1A 3TJEH 4JVWA 5FWRA 4JPWH 5I16A 5LWYL 1UEYA 3CLEH 5B4MD 3DXAB 2OJEA 4L2LA 4ZX3A 5I1IL 1XCTA 2DN7A 2K45A 4OZIE 3EOTL 2L0DA 3Q6GH 1K5WA 4U0RC 3DPBA 3F7PC 3Q2NA 3GSOA 1RJLB 1SMOA 4HIQA 4S1RH 2ZQKA 4XNYH 1FAKT 3A67L 3WTVA 4TUKH 3RIFK 4EQ3A 3EH3B 2QV4A 2VDNH 3HAEA 3QNYB 1QUNB 4FMVA 3I02A 4LPUA 4HCRL 1UD8A 2LU5A 3D52A 1S9KC 3GQFA 2B9BA 5D96B 2ZKHH 1CF8H 1FN4B 2ZKMX 1WTGT 3OLEA 3DIFA 3DUSB 1AO7D 3ATAA 1NIEA 4PGDB 2Z6FA 1C8QA 3C9NA 3QUYA 1S6NA 4BXVA 2ZYSA 2WTRB 4OM0L 2FUTA 3BDXA 2PCPB 3MUUA 4JHZA 3I9GL 1E4KA 3ESVF 3P2DA 5IQMA 4DGUA 3WFBH 4Z7NF 1IO4C 2GEQA 5CN3A 2APXA 1SHXA 3PAZA 1UWGH 1OEZW 2FNWA 2X7LB 4XAWH 1D5XA 3U6RB 2WQUA 4P23D 1CL7H 4JG1H 5C0CB 4WUKL 2Z7ZA 4L4VE 4ODTH 4YDKL 4AENA 1FBIL 1L9NA 3RNQA 1SN2A 1QPXA 2BK8A 3WAJA 3PL6A 1EHNA 4F7KA 4OAWA 4OLXL 5E95B 2K6ZA 5AQ0A 2DQDL 2FE0A 2JELH 2YEVB 2CBQA 2Z1PA 4IRJA 3QUMH 5K9QG 4NO0B 1DN2A 5PAZA 1FG2B 1UWXK 3S37H 4RISL 1II4E 3STLA 4F15B 1BVNT 3EDFA 3AABA 1RJZA 4ZD3L 4JE4B 1WPCA 3DBXB 4NQSB 4QTIL 4DUVA 3RBGA 5DMKB 4JANB 1V05A 3QCVL 4RDQF 1AC0A 4A2DA 4KZDL 4ANXA 4RMSA 4HBCH 2G5RA 4KHTH 1JI1A 4FQXD 1XCXA 1CURA 3PWPE 4GIAA 5DJXB 4WI8A 4PCKA 2CLZA 2FNBA 2CKBL 1J05B 5MEQB 2Z93B 2HKHL 4LSRL 4Y4KC 1PX4A 3F2LA 3UBXA 4RFNB 1J1XH 1LE9B 3WMPA 4JPIB 2FJFB 4PV9B 3C6EA 4PGCA 4UZUA 3LRGA 3OZLA 2WXRA 1FLRL 5EU4A 1UJ3B 3X1GA 1P0SE 4QCIA 4LQFL 3ZK0A 2H2SD 4HW6A 4GMTL 4GKLA 4UTBH 3QCTL 2YSSA 1IEBB 2BMKA 5CIPB 3WJMA 2OL3A 3CLFH 1FGVL 3UEZA 3W3BA 4LVOC 3QEGL 5TE4L 4O2EB 3QIWD 3ZYIA 4I85A 4WFHE 3UERA 4I0PC 3LVTA 2EXTA 3QYMA 2X53A 2MH4A 3S8FB 3KPRE 4WDIA 2XQYG 1D5MA 5DUPL 1EEYA 3QA3A 1YUHA 3D3VD 3QFJE 1U8JA 4DKAA 1FORH 3CVHH 3T1FB 3APMA 2D03L 4FA7B 3F65A 5GRUL 1EK3A 4A7QA 2WQ8A 4KTDH 5FFLA 2VKXA 3DJSA 1IC5L 1RFDH 4LHUG 4FNRA 3ZE1E 1NCTA 4K7PY 2GY7B 4RBPH 3MRCA 4LVNC 3X3GL 4HUWB 3K4AA 3TBYB 2COVD 4YDNA 5CP3H 2WP3T 4DSYA 2D7TL 1KWGA 2V9UA 4P5TA 5CNHA 5EU7C 2BC4B 4F9LA 4J39A 4WW2B 3TONA 2IBZX 3HI6H 1PNCA 1F4XH 1R3LA 3QJUB 3VGEA 1YEGL 3F04A 1NBYA 2BP5M 3ZRFC 1TMCB 4JO4L 3K7UA 2ZXCA 3VM5A 2NSXA 5I18L 1H6FA 1GTNA 4AVKA 4FFWD 2MNUA 1JIBA 3RIKA 2B59B 3FSZA 4FFYA 3GLZA 4FQXA 3GIVA 1SRDA 5KVDH 32C2B 2WTPA 1IGML 2BC4A 2WZ6A 4TF4A 2HLAA 4YXLL 3EJJX 1KCRH 3KDPB 1YJDL 3BRFA 2EDQA 5B8CA 2HKHH 2IH3A 4LSRH 2EDRA 5IJCC 1M2VA 1L3WA 3MTRA 4FZ8H 5CUSL 4XC3L 2XN9B 3AB0B 3O45A 1LP9B 3SE6A 1B4JL 1LWRA 2C3WA 3VFSB 2R2EB 3QH3B 5D4QA 3PGDB 1NCNA 1PEZA 1XH3B 3B2DC 5A2CA 1INDH 3SDDC 3W11C 3RZCA 2KPNA 3UC0L 4DTGL 1BZ7B 2Y7OA 3PAYA 2CO1A 3MLWL 4F7MA 1CD1A 3K6OA 3T6XA 3HPLA 2JCCB 1CFSA 2I60L 3WU1A 4NN7C 1NBVH 1SEBB 2NX5D 3DMMB 3U30C 1VB9A 4UYQA 5IHLB 1XX9C 3Q7JA 1LDPL 3ELQA 4Z3TA 3VXOA 4XNXH 4ZUTB 1ADQL 1ACYL 3K0WA 3TBTB 1NEUA 5ESAA 5KJRH 5DUBB 4KKPA 1A6VH 4XNMA 4P2RB 1ZE3H 1E6JL 2E6JA 5AVXB 5I1KL 1DFBH 2BCKA 3MRIB 2H41A 1GS8A 5J4MA 4Z3JA 3OKLB 4NPJA 3QDJE 3UZQA 4BZ1A 3QC6X 1EEUA 1HQRB 2J88H 4YBHA 2VN4A 3V55A 3VWJC 2O61A 4OCSL 4M1CC 1CG9A 1DVFB 4NWTL 2GK2A 4XVJH 5AZEL 4W9EC 2OMWB 5JO5B 5KOVC 4DN4L 2FHBA 1ZPUA 5GQBA 2OSWA 1T7XA 1U91B 5EORL 4XCEB 3DECA 3CZUB 4PJBF 3NDYE 4KO7A 3KJ6H 2MKWA 2QJDA 3ZXAC 2ZKYA 4IYKA 5F3FA 3QNXA 4EVNB 1JZIA 1QRKA 2ENJA 2JXMB 3GK8H 4JJHA 3P2TA 4P2RE 5CR1A 1I1AB 2NZ1A 1HN1A 4OCLC 1ZLDA 1LEKA 2CPCA 4HWZA 4D3CH 1XQ4A 2J3SA 1AQKL 3FUFA 5KYWA 3H0TA 5K39B 4LRNL 3T6WA 4XN9A 2XUWA 3CC5B 3EYFA 1DUZB 1U3YA 2FEEL 2K6WA 3L4WA 2R2HA 5JQHC 5T3XD 1MFAH 3QQDB 2Y0SA 4GG8B 4PEEA 2F58L 4WENB 1DQKA 3IU4L 4XNYL 4ENEC 3RWHA 4F27A 1KPVA 4WI7A 3M07A 4YDMA 3X3FH 4HKJA 3SGKA 5E6RB 1CU4H 4HKZB 3C6SA 3GXUB 3O11B 1QBLH 1I9EA 3TT3L 4DUWA 2ZTBA 4M9PA 1TLMA 2BNRA 3W5MA 1HEZA 2LTQB 2OMTB 2CO6A 5E6SB 1YMMA 4XNDA 1VFUA 2YEZA 3UO8B 5F96H 4JB9L 3NZHH 4WQOA 1VGEL 4UB0L 2I27N 2XTJC 4LHUA 4LL9A 3ATDA 4PJIB 4XC1L 1RU9L 4L1HA 3LQAL 2V2TB 4KUCD 2PXYA 4LU5L 4PW3A 4C56B 1I8LA 1T1WB 5DRXB 1I3RA 3R8QA 5EBLA 2XACC 1X5XA 5T1JA 3P4LA 4N0UA 1IE4A 1SHWA 4JMXA 4Z7WF 1BW8A 4L5FH 4PR5B 4D7BA 3T09A 1U8CB 2ZG2A 3ZKXC 5BZDB 5E5MB 3CFJA 2CMRH 2RTTA 4ECNA 5FKAA 4NAJA 5EBWA 1I82A 2QGDA 3TO2A 3KVDD 2KQMA 3BVNA 5ID0A 5EEYA 4DFHA 1J5IA 4NCC2 2MRYA 3TF4A 1JGEB 3GXPA 5L8JB 1NEZG 1R6VA 1JF1B 3NAAH 4IIQC 1DUYB 5AZEH 3QSKB 2J8OA 4ZS7H 3AJ7A 3O3BA 4PB9H 4MJIA 2OMVB 2P5ED 4R0LC 3M45A 4QHMA 1M57B 3ARDA 3HFFA 5DR5H 4Y5YA 1G9MC 2F7IA 4Y9BA 2P5WE 2JJTC 2PCXA 2P7TB 4XNUH 2VDRL 4UUJB 1CT8A 2ZUWA 4KNTA 3X11A 4RQQB 4N25A 1AXSA 2M26A 4PRHD 3MNZB 4PLNC 2V5SA 4ZOBA 1D6VL 4FFYH 1MCWW 3BAYA 4JPKH 1NDMA 4AQ8C 5DWUH 3L2LA 5HD8C 1PZUB 1KCLA 3PWUA 1WQVT 1E5AA 3AREA 3NCMA 4JLRB 1HVXA 4NAMA 1VENA 2PTTB 1IFHL 1YEEL 2NUPB 3KW8A 3ZSSA 4K3JL 3KYKH 3EO1B 2WVVA 4WTQA 5AVQB 5IMMA 1F56A 1H3TA 3Q9PA 4Q9QL 2C5DC 3OC8A 1HKLH 2Q7NA 1UKSA 3KYMA 3VFUB 4UTBL 5E8PA 5F8RC 5FYKD 4UCFA 2WQRA 4ODVL 4K71B 3LEYH 2R69H 3OHXA 3VJ6A 2HFTA 5KSVA 1RJYB 4M6OL 4ODUB 4GG6B 4D2NA 1P4LA 3CC1A 3SBRA 1X5FA 4PP2A 4B3VA 4CDGC 1M1SA 1AS8A 1YN7B 3D0VA 3POHA 5DEJA 1AXIB 2IIJA 2X87A 4FTVD 4DNLA 4YSAA 5E94B 1JSYA 3V6OA 4AW4A 1ZT1A 1F11A 2FLRT 5MHSD 3EOBB 5JIHA 5E4EB 4TNVF 4DPRA 4FA8A 3SGJC 1OB1B 2UXVA 1WC7A 2IQAB 3IS1X 2GTWB 3BPCA 5IQLA 1VZGA 5KBDA 1S5HA 5AZUA 2HX8A 4AEEA 5IT2L 1UYWL 4ALAC 4GRLB 1T0NA 1MH5B 4XBPA 3LV3A 1E5YA 3JV5A 5IB4A 5HYJA 4YIQB 4WZ9A 1TZIB 2F19H 5B1BB 3WEAA 1QTYT 4AMWA 1SXBA 1MJJA 4F58L 1SLXA 2J2ZA 1NTDA 2K0RA 1HILA 5HGDB 1G9ML 1NFDE 3GMQA 3LXAA 4PS7A 4KQ3L 4WTZA 1GW6A 3N40F 2WO2B 4X0KB 4X80L 5ADOL 2F54D 3I50L 3L48A 2YMOA 4L1TA 1V10A 1W0WB 2ICWI 4G7VH 1B4RA 1MH5A 2QZQA 3FS9A 4Y1TA 1F97A 5FCUH 4TSAL 5D7IF 4HEME 3T2OA 2BVYA 1T6WA 3QXVA 3HC3L 5MI0B 1CLOH 1ORQB 4DKEH 1IFRA 3EYUH 3L5IA 3HLAA 2VWEE 1L9OA 1E4JA 1L4IA 5C97A 3R1GH 1TENA 3KD4A 5H35B 3HG2A 4FZEL 4U2YA 1CDHA 4U2ZA 1CC3A 2OMXA 7PAZA 2VDQB 2VLJA 2W5PA 2XZQL 5K69A 4X6BA 3O2DL 3DUUB 3ULSA 3NZUA 1WT5C 1JYNA 3VVWA 3FO2A 4G3YL 1F13A 3IPEA 1H3UA 1OAKL 5IJKC 2XTJB 1V7NH 2V6HA 3C8HA 1A9BA 3QEHA 4ORGB 2GIYA 2HT4D 5FYKH 2DJUA 1TDQA 2QT6A 2EABA 3BKML 2AS5M 2M83A 3GS4A 4MS6A 1B6UA 2J5LC 4YHZH 4FAAB 5A7EA 2VXQA 4L3EA 5IVZA 3QQ3A 3GBEA 3TZVC 1NIDA 4XOAA 4HUNB 4LK4A 2AEPL 1URIA 4ZT1A 3KHOA 3L81A 3FO2B 2VH5L 4U4IA 4XVJL 5EA0L 2AMGA 3BI9X 3DDGA 2DAVA 1A4AA 4L29A 1Q90A 4Z7WB 2A83B 3MV11 3A24A 4PP2B 15C8L 3ZIMA 1YEJL 5A1AA 2EXWD 2P80D 4XXDA 4LARL 4TLUA 3I6LD 1K72A 1JGVH 4NUQA 4BSWB 4L3EB 5IVZB 4YZFE 3CZFB 4FQCH 1FNSL 2CCLA 2NY1C 4PRAA 3FO1B 3CAFA 4XNQB 3GF8A 4XP1H 3VI4E 2VM9A 2YRZA 4HIPA 3W82A 1L7IL 4AVHA 1IBZA 5DLML 2WLYA 1KJMB 1SBSH 3QHFH 1YNTB 2FX9H 4D0DA 3FRPG 5I30H 4JFED 5FUOL 5DMYA 1QSVA 4JRLA 4A67A 1P4UA 2XZCL 3CFEA 5C08A 3D50A 2F08A 4Y2NA 1PG7W 5D72L 4YH6A 2YEQA 1OW0A 5SWZA 2ZWYA 3D0LA 4Q6IC 3ZX1A 1OT4A 3I74A 1TUPA 2OK0H 4G83A 2F58H 1QLRA 4NQDD 4LAQH 4KDVA 2K8QA 3ASOB 5HHXL 2X28A 3RPIA 1JWMB 1XGTA 3MLPA 5DS1A 5HDOA 1LO4L 3VXSA 1T5XA 3QDJD 5D8JH 1G7MB 5B39B 5JZ7D 3HN5A 5JW3L 1FFQA 1R3KA 4FRWA 1PL3A 2RAMA 3GWJA 4G8GB 1DJHA 3SKUD 5FDWA 4YHOH 1MJ7H 2WXIA 2DBLL 4G1MB 2UUDH 4ZO6A 3T4AA 1S7QA 2XWZA 3TU6A 5IQNA 4N20A 2YQGA 1M3JA 2W65B 3GMOB 1CFBA 4MCYB 4PJGA 4PJXF 1MRFH 4NFBA 5A2LH 1JPGB 1ZVSB 3HB3B 4BKLB 1RK7A 3O4OB 2DKUA 3KPQB 4HIXH 2GJPA 3DRQA 1KNOA 4X9IA 3G7TA 5H37G 3UG5A 4X4XA 1N26A 4OLWH 3CZNA 1MFMA 2QV2A 4ZMWA 4GQ9L 4LVNB 5FHAH 1CDBA 5A6MA 5F1IA 1KBWA 3NJGA 3MYJB 3ROOA 1M9SA 5F7MC 2DWEB 3CZGA 4LCWB 2R9HD 1VPOL 4EUPH 1BYOA 3RTQC 1CI3M 4FABH 2R59A 5D1XD 5G5DB 4IKJA 2Z31D 2N01B 3ZTNH 5C71A 1I85A 3PIQB 2AAAA 2G4EA 2X44D 2A6DB 4JFQA 4JVUA 1FVCA 3UXFA 5CZRA 2WBJD 3D39E 3GLEA 1QFWI 1A8JH 2P4AB 1VLXA 4Z7UE 1OM3H 3VQ1C 1HHGA 1AZNA 1TJMA 1TJHL 1I8KA 1RPKA 4EI0A 3I75B 5JQ6L 3O3DB 3FYEB 2WKLA 3FQXA 1FO0A 4OZGA 4HFWB 5E1IA 4IOIB 3PV7A 2GI0A 1MUJA 2AEWA 3MLYL 3BIBX 3KWWA 3TYGL 3BZ5A 3GNMH 3AT8A 1ED3A 3CXHK 3RBSA 3UYRL 1DVSA 5CIPA 3WJMB 4ODVH 1OAUL 3L2MA 3SY6A 1HWHB 1NGWA 2R1WA 3BWAB 4R4ND 5HGBB 1CICA 3CFEB 1T6BX 2F7RA 3S2CA 4BSVB 1NAMB 1H3PH 3MOQA 1HNYA 3AG1B 4KQ4H 1IQDA 3ZPDA 1BQKA 2VAAB 3O3DA 3WNOA 3Q6FB 1HYSC 1EXGA 1KTCA 4PJDB 2ARJQ 3E0GA 3C5ZC 5B38B 1R1CA 5I75C 1XMWA 5KS9F 2GJJA 1PCXA 1KFGA 1LLAA 3BCDA 2ZYHA 2CIKA 2HN7B 4MAZA 1T04A 4L8CB 3MLRH 1RZFL 3OR7B 1NMBL 2VDOH 2YAOA 3D25B 2GG1A 4AW7A 3U0WH 4N0RA 1AHKA 3U36A 4FQHA 2Y2TA 2NXZD 1PG7L 2APBA 1CGTA 5EORH 2VDPH 2LU3A 4H20H 5C08E 5D7KD 3B4NA 3IGKA 5FHBL 2VDNB 3O9WB 4FQPA 5KS9E 4G1MA 4M1GL 1F3JB 1NWPA 1UG9A 5TH2A 5AB1A 4L8SB 4M8UA 2JFCA 3WKNA 4ABWA 1P1ZB 4YAQB 1FZMB 2ICEA 4P06A 3DX1A 3QFJA 4XH2B 2AQ1A 1NINA 3MRQB 4HOZA 4Z3HA 4JFDE 5FO8A 1I3RB 3U48A 5BZZA 1THAA 3NRPA 2O6EA 4NC0B 1MNUH 5EIIA 1WZLA 4D0CA 4NBXB 5JOPE 4FXLA 2FGWH 3Q2LA 3U2JA 4RMUA 1V27A 4DVBB 2WMPA 3IPFA 1KDIA 4YDIL 2V7NB 3DXAD 1MAKA 3SPHA 1I9JL 5B8CB 3ULVF 4G71B 5ELIA 1NKGA 4K55A 2B3RA 3C09C 3L5XL 1J9SA 3CU1A 4MD0B 1RK0A 1PFOA 3T1WA 5E9DE 5IFHL 1JPTH 3PABA 4FOMA 5GGSA 5INCA 4AQZA 5JXAH 3B2VH 3D69B 1OF2A 4JRXE 4NO0A 3V4PL 5I71C 4FJ6A 4JB9H 2MNWA 3O8XB 1H9VA 4J2XA 5E4EC 2ARJA 5HGHA 2NW3B 4KOBA 3R8BB 2DQGL 3LDBB 2R56H 5C0AE 1DANT 1PX3A 3LHAA 1QBAA 2WQAA 1ERNA 1J8HD 4PB0H 3QCUL 3TLRA 4KOCA 2A9CA 5HYFA 1CICD 2BW5A 3I2CH 4DF9A 1OAYL 1ZLVH 5F8QC 1AR1C 1XSOA 1V7NL 3QYCA 2Z91A 4MMXC 3F7VA 5E9DB 4YSQA 2GSIB 3DI3B 4WNQA 4X98B 4YUEL 5LNDA 3UZQB 4X6EA 5IP4A 1DLHA 3NJJA 3Q9QA 4BWTA 1J5DA 1Y18B 3SEPA 4HS3A 2G5UA 1NANH 4LBEB 4FEIA 4UU9A 4MSWA 4JM2A 5TQ2H 5E8PB 1BBJA 1EBAA 3EBGA 3V5HB 3FB7B 1RLBA 2RB8A 2DQJH 3T2LA 5HHQB 3HLKA 2JJTA 3CVBA 4CC4A 5KZCB 1J7VR 3WG7B 1SUHA 4K0OA 3KEDA 5EBMA 3GO1L 1CXIA 5K1JA 3EXLA 4ADIA 3PWVA 4NI6A 4F37K 4XPAH 1JTTA 1DSFL 5ANMB 1IJNA 4I0PD 5HDBF 4AYFB 5GZOC 1TQCC 2VC2B 4P4RA 2L8AA 1G7HA 1X4YA 4LF3A 4LIQH 4HJUA 3WXVH 5IREA 4JN2A 3M17B 1OPGH 2VE6B 2PW1A 1KSRA 1XH2A 3RTQA 5F97E 2EADA 1YMMD 4Y19B 2DTMH 5CMAA 3RL2B 5I5IA 5F9OL 4E41D 1B4TA 4YE4L 5DF0A 4U7KA 1VCAA 3AU0A 1DBAH 2R0ZH 1Z5YD 3GHEL 2FLBT 2V7NA 1XF5A 2ID5A 4NFDA 1E9QA 2B4CC 3ZY7A 4QJ4B 5I1CL 1MRCL 4MNQE 4NRXA 4QRTA 1PU0A 3IFPA 2HVBA 4R0LA 3KJ4B 2N3JA 2YFNA 4QHUB 1LQBC 1J8RA 1PLBA 4Z7OF 5CZVH 3OJDB 3V0AC 4BE6A 1FZOB 2VR6A 3FUEA 3HNVL 3KCPB 1MCIA 4ZTOL 3CSYA 4NKMB 1A2YA 4P2CG 1ZDQA 2XT1B 1T0MA 2ZOLA 1A7QL 5D2LF 4J3OF 2OMNA 5SWSB 4HS6A 5CEYA 4IJTA 1ET5A 5JUEL 3VG0L 1X7SA 4XMTA 2YD3A 3V0WL 2BXZA 1J48A 5DD1L 1DEEA 4NZDA 4CSZA 5D7KE 1BVLB 1XL6A 2W80C 5ACZB 2ITCB 4XB3A 2BY1A 3LRSB 1HHJA 2WLNA 2QHRL 2AJUL 4BDVB 4I18A 1IC4H 3S6CA 5DFVD 2IH1A 3PREA 4GQ9H 3B43A 3QUHA 4AQ1C 3F01A 1HJBC 2QELA 3L8QA 3EGSA 4H26B 3HVDA 3SKMB 4FXGB 3HTLX 5FA4A 4OB5H 3SDDD 1FV1B 3NZ8A 1QFUH 3W11D 4B7IA 1O9ZA 3N42B 2V0AA 3O41A 3L1EA 3FPXA 4OY9A 2ZJSH 3ZE2B 5C8JA 25C8L 4PS3A 1QQDA 1SJHB 3NIFF 4RA3A 4K9EH 3UAJC 4NT6B 2CLZB 1HXKA 3ARSA 3CZKA 3S8WA 3FOLB 4HUKB 4JREC 3WMQA 4BFKA 3ARVA 1FIGH 4LKCB 2YAFA 1KTDB 2KH2B 1A14L 1RERA 1E4HA 2VUOA 3AREB 2K78A 4PV8B 4NGHL 1E4KC 3QXAB 4APQA 4DPCX 2ESVA 3KS0J 4Q9QH 2DH2A 1U95A 1NL0H 4PY7A 2XY2A 5CM1A 3ARGD 4KDWA 3GMMA 1S3KL 1UJ3A 1YEDB 4ACPA 1JWSA 1XZ0B 3UJJL 4Z95H 4A7GF 4WEBL 3OKOA 2KDGA 4ZDHB 3HCVA 4A38A 3PPEA 4IRZL 4CL7A 2JKRM 3NESA 5CCGE 1OARL 3E3QC 4NO2B 2AF2A 1EJFA 5B39G 3P9MB 3MOAL 2CR3A 5LJYH 4HKBA 2ZIDA 5BMFH 3LOWA 4PY7B 1X9RA 3V6ZA 1H19A 1WVZA 3SDXF 1AP2A 4PJDF 5IQ9B 5AKRA 4H2AA 3SDAA 1QEWB 3JSSA 1AGBA 1LNUB 4FXKB 2KZ1B 1WFIA 1TU2A 5FCSH 1USZA 4TSCL 4EE2A 2PWGA 4IEFA 4E5XA 3PJLA 4ODWB 1SN0A 3BKCL 5F88B 1SOXA 4AV0A 4O9HL 1YLBB 1HZLA 3CZJA 5BRPA 2I9TB 4WO4C 1BFOA 2VR5A 4U7MA 5BQDA 2VDOL 3U0WL 4JHWL 2BHZA 3BZ4A 3HFML 5DVLA 1SOQA 2A9NH 1MHHA 4JL1A 1FZOA 5HHMB 4M4RB 5EN2B 5D7SH 1CDCA 1S7XB 2PNDA 1MCWM 1SVBA 4GRLC 2B4CH 3PHAA 1OIOA 4IKNA 4M3KB 4J3BA 2B7DT 1JV5B 3REVB 3P0YH 4EKXA 5B3JE 4PJ7A 5J3HC 4AQ1B 2ADYA 2G60H 2A73B 2H1LM 2Y24A 1LE5A 3INUL 1IRAY 3SZKC 3GHBH 4FFZL 3WIHA 1IFGA 5EV7A 1KN2L 3NJNA 4O2FA 4JO1H 3C6LD 4TUKL 3OTTA 2CH8A 3SKOB 5J13B 3OXRA 3GTNA 1PJ9A 2VJ8A 2HRGA 2GFBB 2F1BA 2H3KA 2Y36L 3MRJA 5EPMA 1ORQA 4JKNA 4OGQC 4Z7NB 4XE5B 2EZ0C 4LL1A 1X5YA 5I75B 2QFPA 1U8QA 2IDQA 4GO9A 5ALBH 1QHPA 3MMEA 4F2ME 1ZT4B 4CJ1A 1P4IH 1ZHNA 2W1NA 2N7BA 3OZKA 4I4WB 5DI8B 1X7QB 4Y9GA 2EE0A 3BKYL 3FCSA 4NOBA 3G5VA 1LP9A 1SLWA 4F93B 5HPMA 1SJHA 4Y4HD 3I9GH 1L9TA 1NFDA 1AC6A 3KYKL 1TYRA 3B9KA 3LNHA 4KRPD 3DX6A 2BPBA 4OD3H 1UZ8A 3KYNA 4YQXH 1EAOA 1WFUA 4F7MB 5LAXB 3JWDL 1KELL 2OMVA 1C12A 1PCSA 1UWEH 3DVNB 4GLRI 3R19A 3EZJB 5JHDB 1E9PA 3O6LL 3D3VE 4U7SA 2NY7L 4OF3A 2A4ZA 4JRXA 2DQDH 4PRDA 3AQXA 2IWGA 3DXAE 5AAMC 5GGRA 5DJDA 5EFIB 4Y1AE 2IWKA 3SJVB 3MKKA 4TUOA 3ALWA 4H8HA 4OU3A 4W1TA 3BDBA 1B0WA 5C6TH 3TBTA 3ZDXF 4FHBD 4BFFA 2ITFA 5FHAL 3T4YA 4MNHA 5B3NA 5I1JH 2F18A 2GSGB 3PWJB 3US9A 2IAMA 2EUZA 2I7OA 3OKMA 3WO3B 2WCPA 1AGDA 1YG9A 1DO5A 5MERA 1P5UC 3P02A 1DZ0A 2C9AA 5DD5H 5LCVH 3ZQWA 3TPUB 1XIWB 3H42H 2X4NB 3STZB 4KI5F 2OMZB 3KPTA 4ZMAT 3Q1EA 3KPLB 4LNVA 4HUMB 2XIDA 2A3TA 4IBYA 2ODHA 4BFBD 4PSRA 2A6KA 4GFTB 3EGDA 1T83C 4F7CA 3SDXA 4YHLL 5IF0B 4LPWA 3N40P 3D2UA 3U7WL 1AGDB 2P47B 5BOJA 5MERB 4LIQL 2CUAA 4JN1H 4NEHB 1I1AC 1T0OA 1UACH 1EHKB 4QRAA 4WJ5B 1NCDH 1XIWA 2VW4A 4ABUA 3QXDB 4UBDC 1A7RH 1HX0A 3QORA 2OI9B 1HTYA 1JZ6A 3Q1SL 5DD0H 3FT2B 2B16A 3JZ7A 1G94A 4FJYA 5D1ZA 1I7ZB 1YYML 2YPVH 1UWFA 1RIUL 4F7CB 2Q3AA 5I8KL 2ZCKH 4BSJA 4OZFH 3Q5YA 2EVIA 3KPOA 5ALCH 4FLRA 3M8OH 1CIUA 3ZQ9A 4CN1A 3NEOA 3QPQD 3ULUC 3UH8A 1NLBL 1RSYA 5CLYA 2RD0A 3N43B 4D9LH 4YHOL 2Q7YB 1CGXA 1N6UA 4W9GC 1NAMH 1JBJA 5D1ZB 5KUKA 3AUVA 1EXUA 5F7BA 4KROC 1O6SB 2WSDA 3A6CL 3GBNH 2VDML 3JTSB 2WMPB 4WFFD 5B1CA 2WXJA 1TR7A 4PJ9C 1D5IL 3H9SD 5L6YH 2XYBA 3CXFA 1BHGA 3GXNA 2A6JB 5F71A 2C7UA 2D7TH 2YWZA 4PR5A 5BO1L 1OKEA 3S35L 3X17A 4OD1H 1KPUA 1EPFA 4P5MA 3ZHDA 4NQQA 1G7JA 2EE6A 4HGKC 4MJJA 4Y16B 5D4IA 5C09B 2ARWA 2O30A 2A4CA 3NAAL 1J05A 1CPUA 3KXFA 1XSIA 4E41E 3FQ1A 1ZEAL 4XVSH 2Y7QA 3NSCA 1GGBH 3LPPA 3DHJA 1GAFL 3QQ9C 3T0EA 4ESKA 1FL3A 2X05A 1DBML 5LNGA 1UD2A 4DW2L 2YOAA 1IC4L 3MNVB 5AENA 4WI9A 1OZUA 5T33L 3G9VA 5G5DA 2XZZA 2IWFA 3DYMA 3KAAA 3SCMB 1I9JH 3NCCB 5DWUL 1UJTA 1FC2D 2I69A 5EIIG 1QBML 4YGVA 4OUUB 1CT8B 2IXQB 3GS0A 4JR9L 4NQUA 5KN5A 3MCLL 3ZE0B 3VACA 2EIBA 4A6YA 3I9PA 5IR1A 3B1UA 4HH9A 3AC0A 2ATKB 4K2UH 2DWXA 4YHKL 4NQED 3PE9A 5ICUA 2EKSB 1B3IA 5FA3A 3H1ZA 4TSBH 1QA9B 3TZVD 3O2DA 2OSYA 3TO4D 2R8SH 1G0XA 5GRJL 2WVVB 2P5PA 1ESOA 3M7FB 3OB0K 2GIMA 2OL3H 3DX3A 2XIBA 2WNWA 4IBVA 1F6LL 1QLFB 1SJXA 2X1OA 2YUWA 4Y7MA 3TA3A 3E2HC 3LXBA 3N43F 5JW4M 2X4QB 2EXWC 4UF7C 3PQYA 3EFOA 4MXWL 1DCEA 3NJFA 5KJRL 2EIDA 4BHUI 1X9QA 3QNZB 4ZUWA 2WSKA 2VRKA 5BVJB 5CBAB 3VGFA 3G3LA 3DARA 1TZOA 1MJ8H 2C9PA 5F0PB 4XPFH 4NXKA 4GP4B 5LGHH 4YXHH 2XC8A 3AM8C 3CQQA 3LSOA 5LUMA 3IDGB 3LQZA 1HQ4B 2I26N 2YPKA 1NCAH 3ARDC 4PBWD 1ZSDA 1OSPL 2HPOA 1QLEH 4JM2F 3WEXA 3ZU8A 3L9RA 2Z7YA 1M7IA 5D7SL 4A2GA 1GGTA 1U3HC 1T89C 4MA3B 3BXNA 3KJ6L 2ZSWA 5K59F 1CCZA 5ETUA 2CNZA 2H0JA 4MX7A 3EJSA 4HMEA 1MFEL 4JFYB 3WFCL 9PCYA 3MNDA 3A6OA 3S98A 4N1EA 4RVBA 3HE6B 4CC4C 3P73A 1C5CH 1CE6B 4WHCA 3C08H 1D7DA 1E90A 1W80A 1WE5A 2CGYA 3X14B 1BQLH 1WSST 4HT1L 4Y16A 4Y5VC 5KVDL 5EBGA 2VZVA 3CSYB 4NKMA 3QH3A 3QARA 3GHPA 4G43B 2B1HH 1RUAL 4AI7A 5F9WB 3BQUA 1QHOA 4QIRA 4E9YA 3MUHL 4M03A 4XN2A 1LO3L 1KCKA 3BISA 4IHOB 5DMGD 1U93B 3UTSD 4HD5A 3RX5A 4AE0A 3MODL 5IJVA 4FZEH 1U8OA 3IGAA 2PR9A 4G2AA 4Y7OC 3SOTA 2G3XA 1D2PA 2IO5A 3HMXL 1KCUL 3QR0A 1T83A 3VX0A 4XX5A 3JXAA 3BAJA 3LB6D 1KG0B 4L3FA 3BZEA 5I71B 1N9PA 2C4XA 2Z93A 1GY1A 5F7EH 4XC1H 2HT3C 4ZW6A 2X4RA 5KN5B 4BJLA 1TXKA 5HVHB 3SOBL 3MRRA 2C9QA 4F7TB 5FO7A 4RIRA 4JFVA 4ZTOH 3OB8A 2Z64C 3RWDA 4P59L 4P8QA 3SE8H 3RA7H 4GXFA 1WIOA 3T2PA 3RWEB 3F12B 4MVBD 1H3VA 1WDAA 3BVWA 3QIWC 1BYPA 2X4UA 4AQAB 1E28A 1YC7A 2WJ5A 4UTAH 3MDJA 2WLIB 1N18A 3NVQA 4WLCA 4Y9CA 2B8OT 4U1IA 2IFFL 1URZA 1BAWA 1E4WL 4LSQH 3QWQB 5CINH 1V3MA 1SVCP 5C0AA 3WS6A 1AO7B 2TSBA 3JUZA 2YZ1A 2VZUA 1E5BA 1NMAL 4FYQA 1JZ7A 4I1PA 2EIEA 4JM2B 1JVLA 4NC2B 4WTZG 1QWHA 5EU5A 3KYOA 4WGKA 2A83A 2AJXH 4HA1A 5DUBA 1FNAA 2KYIA 4XNMB 5TPWL 5DHVH 2DYPB 2QEJA 4KX9A 4EDXA 2OR7A 1P7BA 2X1PA 3O6KH 1D9KD 1NBCA 1L9QA 2W07B 5CGMA 1VIWA 3HAEH 3IJ7A 2OJZH 4MA3A 1EFXB 3P4NB 4L23A 4B97A 3TWCL 3TP4A 4JFZL 1V3KA 5K9OB 5AOMA 1G7HB 1SYVA 3MJ9A 5H2BA 1BVKB 1RZ7H 4H8WC 1G4MA 2EEDA 1H6UA 3SYAA 4DCQA 3P73B 4J3XA 5KJ4A 1ZXQA 4CVWA 1G7LA 3RWCB 3E6FA 2GJRA 2CALA 1NFAA 3BGAA 3CN2A 2D2CC 3WLBA 2O5ZL 4HS8H 1U3HA 4PRPA 3CSPA 3IKCB 4F7EA 5FB8A 2AC0A 4F8NA 5D8JL 2X1QA 4LASH 1N5YL 2CKNA 1CFTA 2ZNWA 2WM0A 1PPIA 2BP8A 2W59A 2Z4TA 32C2A 4N2EA 3ULVL 3N55A 1BD2E 5A16A 1UB6A 1K5NA 5DK2A 3ETSA 1BIHA 2OM5A 4IBZA 3WD5H 5HDRA 2BIPA 5D1XE 1RUPH 1ORSA 3BAEL 3IMVA 4NO5A 4AIEA 4PVBA 1NAML 1SOKA 1U0QA 1ODAA 3L5WB 3ZZSA 1HSAB 3D0AA 1KG0A 1UURA 2ZUUA 2GFBA 2Z7WA 3BQUC 1GZHC 3IJ9A 5JHDD 1KIQA 4LVHB 4PIRF 4M7LL 4OZHF 2L7JA 4OJCA 4NNPL 2QQNH 4JFSA 3UTZA 1TVBB 2JJSA 2BS8A 3S97C 1RK0B 3GRWL 1XGYL 2ZXAA 3QYNA 4DJMA 2LABA 1WLHA 2ZAIA 3TN0B 1URLA 1JPFA 1YC8A 4KC3B 5MEND 1AANA 3PGCA 4IU3B 3L3OC 5B21A 1SDAB 3DOHA 5TFSH 4H5SB 5D5MB 2ARJB 3O9WD 3HMWL 4PJGF 4PJXA 3RUGB 3SO3B 3VWJD 2PCYA 4NM4H 4M1CD 4PWIA 5DC9B 5E0QA 2QSCL 3LKQA 2TRHA 1KJVB 1CJYA 2NUPA 4GEIA 1UJ3C 3DOSA 4XHJC 2GITA 4OFDA 2W9EH 1UB5A 2HT2D 3BUIA 4I77H 3WY1A 1DTUA 4TSAH 1J1XL 5F6IC 4P3DA 1ADQA 3AMKA 4G8IA 1YN6B 4ZMOA 1M7XA 2EILB 3EJRA 3KL0A 4PJIA 3S5LB 2GABA 1JGUH 4EDWL 2C26A 4MNHB 4MQ7B 2YXVA 1HHIA 5DUMH 3U1SL 5BJTA 1JRHI 2KZWA 2IADA 3L6FB 4XCFL 4PGJA 3WS6C 1PZCA 4FS0A 4OZGB 2YC1B 4DKFH 3IEAA 4GLRH 1V5JA 3N1QC 3MV7D 2KQNA 1U8CA 1MG3C 5F7NC 4AJWA 1JS4A 4HLJA 3ZO0A 4QXTA 5ESQA 3FW6A 4E9QA 1MAJA 3PDDA 3JWDH 1TSHA 4M7LT 4OVUA 1IZKA 1XWVA 4YFEA 4U1SA 5I1DB 4FNTA 5FS5A 2J21A 4JHVA 5IHHA 1O7DC 4LE8A 1NAMA 1TZGL 4X6CB 5F21B 5D4HA 2BY0A 2O26U 5F7WC 4EAEA 3WHXA 3TT1L 1AJ7L 3IJEA 1KEGL 2MMXA 4FXKA 4LNRA 3MRBB 4IBQA 4OCXL 2Y5TA 2N0KA 3D9AH 3QUKB 1ECZA 2WNGA 2B2XL 4NUJA 5HJGA 2Q3ZA 1USQA 1TZIA 1S7UA 2W8CA 2XXGA 4OZGE 3X3GH 2HN7A 4BFNA 1RQ5A 1VERA 1CGWA 2EDDA 5FHBH 1IKFH 2UY6B 5C3LD 3HUJE 3PFUA 1WZ1H 3OSVA 4LESA 5GZOD 3MGOA 5T1KB 1IARB 2L3BA 1S5IL 1NWOA 2DJSA 3S34L 4ATTA 5C7XL 3HE7A 3GIZH 2HKFL 4Q74A 1O5PA 2YWYA 4BQ6A 1BOYA 2AXWA 4L1BA 4MDRA 5K39A 1XR9A 3LNEA 3REVA 2YXWA 3MJ7A 1F90L 1INEL 2AGJH 3FN0H 4BRVA 3MBWA 5KYXB 3VUAA 1PTZA 4WSJA 5BZWB 1DVQA 4Y4HB 4OW6A 1JHKL 1BEXA 2FGWL 1YVLA 3O8XD 1U41A 2Q1EA 3MROB 1H3XA 4LFHD 4UILH 3SDAC 3DROB 1LO3H 1UD3A 3HE7B 2ZXDA 3S37L 4M6AA 3FRUB 4YSUA 2A5UA 3V8OA 3S36H 4ZD3H 4RZCA 4FZ8L 5CUSH 4ZTEA 1DJXA 1SUJA 3ARRA 4KAQL 2OCJA 5FXCH 3VFRB 1Q72H 3KPSA 1GYVA 2AQQA 3LQAH 2WJ7A 3FQUB 3KPRD 1E43A 1T03L 4XCYB 2E59A 2PR4L 3GDBA 3LKQB 4M48H 4OM1L 4WCYL 1XR8B 3LZFL 3VNZA 3MROA 4XWOC 3SJVD 1EHLL 4GYBA 3FFDA 3QS3A 5HD8D 5IMKA 2ZZUT 1M6OB 4GI8A 4XMXA 1SDYA 5HHNB 3SOBH 3FFOA 4KJWC 1C5DA 1R34A 1WBYA 3QIUB 3HZ3A 1UWEL 3DUHA 4DP5X 3OKYA 1FSKB 1DQLH 1DFXA 1VA9A 3O4OC 3PP4L 4P9HC 4AV5A 1WCBA 5GIRB 5E6IA 3GM0A 3OJVC 4NIYE 4NKQB 2ADGB 5F44A 1MN4A 2L04A 2B9AA 1D5IH 2PYFB 3P77A 4Y0GA 2YR3A 3KLKA 1INQA 4QGYA 3E38A 2X1WL 4NN6B 2FEEI 3N41B 3DHUA 3BN9D 2XKSA 2HPTA 1IAII 1TO5A 2CKBA 4Q0XL 2EDJA 2WZPA 3T0VA 4CILA 3ILQD 5I66B 3CCHA 4TL5A 3DVFA 3FO1A 4K3GA 5JHMA 1RUMH 3EFDH 4FD0A 1HC1A 1QA9A 5LBVA 1EO7A 3B3IB 4OLZL 2O6PA 1S9WA 3R18A 3LEXB 5BRZD 5TPWH 2FX8L 4J28A 3OLGA 5J13C 1KIRB 1ZTMA 4H8UA 1OP4A 5IQ7L 1I8MB 5L4FA 4EN2A 4H7VA 1I1YB 1CLVA 3CFUA 3D4ZA 1B0RB 2BSBA 4U6TA 4PJ8A 3WN5C 4IRJD 3ZDYB 1HK6A 2X6VA 3CBKB 4YBQD 5I66A 1V7MH 1ZVNA 5GS2D 3UYOD 4WUUD 4HJEA 3MRPB 5I26A 1IAOB 3EGDB 2CGRL 3IMTA 3OMIB 3P3TA 3PQYD 1T2QL 2DQHH 4OFQA 3D06A 3ESUF 4Y4FA 1GOGA 3PS6A 2ZYIA 3NCEB 2G3MA 4JRYA 4HF5H 4HUXA 3QXDA 1ZE3C 2D2OA 4N8VG 5FKPB 5GGUB 3MLSL 1U4EA 4PJFA 3HC2A 1BQRA 3MZGB 1H0DA 1FP5A 1YY9D 2OV0A 2VRAA 1WEJH 3IDIB 3SQOL 1JHLL 3H9SB 4XP5H 3QIWB 2E0PA 2R51A 4U1HB 5JR1L 2J4WH 4HXAH 4ELMF 3US1A 4XBGA 3RTLA 3WFHA 4HCRA 1MIML 2EO7A 3IFOA 3FQTA 1BZ9B 4GBXC 4IIZA 5FW7A 3CH1B 1C16A 4PYGA 3DOIA 1FYTE 2EDLA 2JMRA 3SSGA 5HY9B 3II2A 1U8IA 2CA4A 4ZSOB 3ESNA 2JKSA 3QI9D 1ZHKB 1XHHA 1CK0L 1A6TA 3MOBL 3T77B 3TIDA 5GSVA 1EDQA 2IOMA 1IGYA 2EIJB 4R7XA 3WKQA 2JJWA 5J3HD 1TOXA 1X5HA 4KJYA 1MF2L 2PWEA 3KPPA 4RSVA 1C5DB 3BUQA 3ASNB 3ULSB 4I3SH 5CZKA 3LV3B 3GM8A 4Z7AA 3IE4A 3Q2VA 2IOIA 5DEFA 2F15A 5D9SB 5HYEA 5JW4R 1OCWL 1F4WL 2IGFH 4PVLA 5I73C 3D39B 3C6LC 1Q9WB 3GXIA 3QISA 4MAYC 1GYAA 4QHLA 1K2DA 2ALAA 1ZS8B 1NC2D 3UZEA 3T3PF 4G7YH 3PGFL 4QAWA 1X44A 1P4BL 2EH8L 4YBLB 5CSZA 4JQIH 3BZEB 3HNSL 2HZHA 4OBSA 4L1LA 4A6YL 5INDB 3DDFA 4HIHB 4GUQA 2UUDK 2JE8A 1F86A 1ASOA 4ZSOE 3J7HA 3BQVA 2QHLA 2OI9C 3HBGA 2CK2A 2R4SL 3BH8A 2E56A 4HV8A 3OWEA 5T8IA 3SKJL 2IH1B 5IQ7H 3QIUD 4BUHA 5CJBA 1DE4B 3MSPA 2DL2A 4L37A 1Q0YH 2X0WA 1UVQB 4NM4L 4A2MA 4MTMA 1HU8A 1CUOA 1ZTXL 2VN7A 4URKA 2MPAH 3DHPA 4ONHB 2AXHA 5C0GB 4Z0BL 5KBLA 4RDBA 1FNGB 4QI3A 4Y5XA 5AVTB 3WSQL 3RIFF 3S48A 4B96A 1MCOL 4H0LC 3NSJA 2R2BA 1BXUA 3LKPB 4PHZA 5CD3A 5IR1B 3BEVA 3HPJB 1EZVY 5EOTB 3TBVB 2A0LC 4PJXE 3BMWA 3H3PH 1UQSB 4O5LL 4DESA 5IEKA 5T3ZE 3UX9B 1A22B 4ZPTA 4K7PL 1JPSH 1FH5H 1Y1UA 4DPAX 1PDKB 1P5VA 1I3UA 2WO3B 3V9FA 1K6QL 1YECL 3NA9L 4LMQI 4XPGL 3THMH 1FDLH 2DYPA 5IVXE 5I8KH 3RI5F 4FMFA 1C5BL 3EDKA 2MCG1 2VLKD 1OGAD 3I2CL 1NIAA 4DEPB 2N56A 2XPZA 5FPIA 4CMHB 4NHUA 3IFNH 2F0CA 4TV3A 5L2JB 2VDQH 4QRRB 4AZUA 4A2EA 4HCFA 3D9AL 4HJ0C 3WV0A 5DO8A 5T3XH 4JFFD 3LAFA 4DQOL 4N0CC 1E2ZA 1NLDL 1RUQH 3NYKA 1XCQB 5J89A 3JV6A 3SZ6A 1TU2B 4PN6A 4P9HL 4QR7A 4Q9BA 5HVFB 4KTEH 5D7IE 3S36X 5GJTH 5IVXB 4EMZA 2A9AA 3ZHKA 3CHOA 3NRQA 2Q0ZX 2ZSVA 4JFTA 1KC5H 3LEVL 1F4XL 4JQXA 3I75A 4TQEL 4CJ0A 1G7PB 1UA7A 4E9TA 1X5LA 3TPKA 2KT6A 1OAQH 3VTMA 4QPEA 2DY2A 2BSSB 4O02B 2IV9A 1MRDL 3F8UB 4MNGE 3O0RL 5HGAA 4NZFA 1RUAH 1P84J 5DZ9A 2ORBL 3NIGF 4FL4B 5DWPA 3EZ8A 3FB5B 1Z9PA 3H6JA 2D4DA 4OUOA 1F58H 4XZUB 1KCRL 4G1EA 4B9CA 1DBJL 2ZSVB 1QLRB 4QLWA 5I8OL 1F3JA 2R9HC 1EQWA 4N22A 4KKCC 4KU1A 4L9LA 1P7HL 1S8DB 1G43A 1PSKL 2DWEA 3AG3B 5D1XC 4Y2DC 4U1KA 4YHPB 3UGEA 2ZG1A 4HULB 3GGWA 4XO5A 3OAWA 1HXYA 4M8QA 3FSOA 4WV1C 1HL9A 1OTSD 1S3RA 1TQWA 2XZQH 3FU6A 4MAYA 4Z7UF 1QSFD 3TO2B 5FDWB 3ZJAA 3H8NA 4P5MB 4N8VB 4PJEA 2H32A 3NSDA 4XMZA 4XMPL 3QZWA 4OD3L 3EYVA 5IK3A 5J6GA 1QASA 2CSPA 1S78C 2D7QA 3RB5A 2Y06L 1JJUA 1PY9A 3NABL 1N4XH 4AIXA 1WFNA 2R2BB 3LKPA 5CD3B 1JZ2A 4JFEB 4P9MH 1HE8A 2JB6B 4RISH 3WE1A 2MJWA 4ISVB 4NNXB 2GTQA 4UWQB 1NFIA 5GS0H 3TURA 1FIEA 3L54A 3KWWB 3QQ9D 2B1AL 2NZ9C 3NOIA 3RAJH 1RJLA 3GI8L 2H1PH 3DJZA 3IFNL 1D6EB 5HP5A 3IVKB 1EO8H 1TVHB 4MJ6A 5F1KC 1I75A 2HSIA 3LKRB 1SLUA 1H6TA 4ZUSB 3IWUA 2X3BA 2UWEA 4FQLL 5EFIA 3SJVA 4A6YB 2DBJA 4DVBA 4OGXH 2WCSA 1Z5LB 5J9PA 5EOCL 3LNIA 4P3CL 5DD3H 3JV0A 5ESQB 3GI9H 1F41A 3RJDA 4U1JB 5E8NB 4BELD 4HG4K 5BUPA 1CGUA 2A6DA 4JFQB 4L4TE 4GPVA 3VI3A 4L18A 4P4RB 4CU8A 3TBWA 4K8RL 2CWRA 3TC9A 1CS6A 2CGRH 1P9MA 3CSBA 1KB5A 1QRNA 1P5UB 2NTFA 3P4MA 3D69A 1DQJA 2XDHA 3S8GB 4DKDC 1PLGL 3PXJA 4FFZA 5DVKA 5CJ8A 1D5XB 3SHSA 3U6RA 3CXDH 4TQPA 1SM3H 4KDTC 3B6SB 2EH7H 3GRBA 4J6RL 2AXFB 4P2QD 4HALA 4OZIA 4KMTL 4FA6A 2R2HB 3FB7A 5F6HJ 4FG0A 4RCAA 4XP6L 2FHFA 1A1MB 1DVFD 5T5FL 3X1EA 2Z8WC 2CK0L 1KCSL 2O6FA 1FWXA 2AXJA 1QBLL 4GJTB 3ZT6A 1UOKA 1WD9A 3PL6D 4L4TB 3ZR5A 3L08A 1SXCA 1SHMA 1KMGA 1DBAL 2KLTA 1MFCH 2ZWKA 1VACB 2F1EA 3D18B 3F7VB 1DDHA 1EWHA 1QUNA 2FATH 4XMWA 4Z6AT 1JNNH 1Q94B 2JKXA 4HLZH 4ZTPL 2FEJA 2F7QA 1KGYE 3RFZB 1OO2A 4R3SB 3PNRB 4XN4A 3NJXA 1T0MB 2ZOLB 1NCIA 3VU2A 4L4VA 2GQHA 4DEPC 1T1ZA 3D25A 4R5VA 4UU9B 1HESA 4B3EA 1BP3B 5C07D 4F8QA 3L95B 5K59E 4WVRA 2DLFH 3RB7A 4Y5YC 4HXBL 4NLHA 4LCYB 3KPNA 1DN0B 1WF5A 1JL8A 1WA0X 1CTNA 2WWMD 5E6YA 4LDLB 1FAIL 3NQIA 1CK0H 3MOBH 3SE8L 1PKOA 1AZUA 5EO9A 2ENQA 5FUZH 5HGHB 1QVOB 4HBQA 2E7CA 4WI6A 2ADFH 4I2XB 3EJPA 4XNZB 1PD0A 2IALB 3ATBA 3VFOA 4PJEE 4CADB 3IJYA 4CSTA 3QNFA 4Z0XA 4ZX4A 1ZEAH 1C7SA 2PYED 5D71H 1JOIA 4APQD 2PO6D 1HIMH 2VRQA 2JQAA 3IFLL 1OAJA 4JW3A 4N1HB 2C3VA 2G60L 3M17A 3T0ED 4ZS6D 3UADA 1QSFB 1MI5B 1WIPA 2RHEA 4JCLA 5CN1A 4CGUB 1IT9H 4OZHB 3REWA 4A6YH 5BRZB 2V5RA 2VWEC 3RZCB 2YBRB 1AQDA 1X4ZA 2WUCH 3R4RA 4DZ8B 2O1AA 4WKZA 2OW7A 4X6EB 1KBGL 1XB6A 2BVUA 1AYOA 1INQB 1QUPA 4U3CA 12E8L 4YPGA 2HT3D 1Z5LA 2D3LA 1N2RA 3P9LB 4QYAA 5E8EA 4EZKA 4QYOA 3IAGC 3OF6D 1XZ0A 5DJ8A 4X9BA 15C8H 1NDGA 3RX8A 4NENA 2VSDA 4TVPD 5AAMA 1UXLA 2XWDA 4GAYA 2D3VA 2VNCA 3QCUH 2XWCA 5I82A 1J9QA 2ZICA 3CUPB 1A4BA 2R0KH 2ZP8A 3QULB 3P30H 4B95C 4AZ8B 2DQTH 4RRPG 3NIDE 4FLHA 2Z4QA 2AEIT 2V2WA 3UJIH 3HIZA 2OR9H 4EN3A 3TBSB 5D55A 3GSQA 5C0IB 3VQMA 3T3ME 5HHOB 1ND0A 1OCRB 1HHHB 2C4FT 4MRCA 2Z0UA 2AXFA 4C56E 2BIQA 1FH5L 1H5BC 3IU3A 3ABZA 4HFUL 5E9DA 3N85H 4NQDA 1NIFA 3K6IA 4PRHB 5DYOA 2BCMA 2CDEB 2C1PA 2ZYRA 3C60C 3HG1B 4O2EA 5F3HB 1BBDH 1HZHH 3D4CA 1MNNA 2AQ2A 2WQWA 1OLZA 4DEWA 3APFA 3QEUA 2Y23A 4ELME 3BKCH 1D5BB 3U0PA 8FABB 2FAUA 3S2AA 4HCIA 3U46A 1L7TH 1NLDH 1TVDA 1H8SA 1MPAL 1U8NA 4KK5C 4LEOB 4X5LA 4DAGH 1BLNA 2PP8A 4H8VA 4HMDA 5DD5L 1IGFL 3MGOB 5LCVL 2UXGA 5T1KA 1MFEH 1AKPA 3SPJA 5GS2H 3WFBL 1MAML 1PZ5B 3HAEG 2VT0A 4V33A 4GSDH 1C5CL 2P43B 1OWWA 2KZKA 1U95B 3BRDA 1MJJB 1UXSA 3HZVB 4WTXA 4N1CA 4KWUA 1HILB 4KVCH 3GJFH 5HGDA 2EC8A 3HBQA 4DGYL 2A2QT 1ACXA 3ZT7A 4XMLH 4ZOEA 4G7SB 3QJQB 3UROR 3J2PA 4QXVA 3S36L 1DQQB 1HI6A 1HEJC 1R24A 3FSAA 4HG4J 1BXXA 3UTQA 1JNJA 3WIHH 2JF1A 4G72B 4JQVC 4P2QE 5CMAB 3P9MA 1NM4A 1QYGH 1XF4B 4MD4B 5CR8A 4NZUH 4PJ9A 1OGAE 2R39A 4RZCB 4NQVA 3SDXE 2CJ3A 4N28A 3GSNA 3HUJA 5BXFB 5IBLD 5LGKA 2FZ3A 5CN2A 4RAVB 3D09A 4E5XG 2O61B 3CHRA 1U8KB 3MJ8B 3VRJA 1CDYA 2Q86A 4AXWA 5IOPB 3IFPB 1DR9A 2WLMA 4Y1AB 4NJ9H 5I8EB 4KDTA 4F57H 2YD9A 5LQBL 4U31A 3NBNA 1W0YT 2Z8VC 1AH1A 1IGTB 1ZA3A 4X2UA 1J0IA 2ICWJ 1HCFX 3FOLA 4K4KA 4F7PB 1OQXA 1R3IL 2Z65C 3BWSA 3SDYH 2P42B 3LMJL 5DJ0A 4HS6B 1NUFA 1BQHA 1OGAB 4L9DA 3QDMA 5JQ6H 5E00A 5D1QA 3VRLF 3H0TB 1J0KA 5HHOA 5KVGH 5DUJA 3BAKA 3ZL4L 2VDLH 5JOPD 4GQQA 3DTXA 1MWAH 4MD5B 3U82B 1A25A 1G0DA 3E6HA 4N86A 4JDVA 2XVLA 3C6LA 4OKDA 1KLUB 4X8GA 2NW2B 3IF1A 3GI9L 4UDUB 5LAXA 1NEZA 2CHXA 5CJOL 4JM4H 3FQRA 2BNRB 1R9FA 3AWGA 3MRFB 4LCCC 5C0DB 3V0EA 1F1AA 3D2TA 4I0CC 4U1GC 3TNMB 3L9YA 5C0AD 2W94A 3U4BH 4BZ2L 3J07A 5MP6L 4PP1C 4I4WA 4XNQA 3E8UH 3CVIL 3FHAA 3BGFC 2WC7A 3K4DA 3Q6GL 1N12A 1RV6X 2X2JA 1I85C 3QHZH 1JK9A 3QQ4A 1DBKL 2NZIA 4W9DC 1L9PA 4M5SA 3HG3A 2DMGA 3WO4B 2QADC 4M93B 5SWSD 5DVMA 1MG2C 2QQQA 1NGYA 1U58A 3A0OA 5DJ2A 2VDMB 4DK3A 2ETWA 4EZMA 4Z7QB 3LKNB 2HWZL 2J6EA 3ISYA 3TPUA 3GSXB 3COOA 1CVRA 5F7LB 4O00A 4H0GA 3VI3E 3D0LB 1SJEB 2XJKA 2ZX7A 3VXRE 2JV6A 3G6DL 4XMKL 5EU7E 2EIZA 2A74A 4KROB 4QXUL 1H8OA 2EDTA 3Q5TA 4ZMTA 4LPCA 1XGRA 1ZD6A 3E6FB 5FV2A 4KFMA 3SQBB 3Q05A 4BK5C 1HAUA 1UOWA 3IFOB 4GRLA 4XX1E 1RLWA 2FIRT 5EUKB 2AK4E 4QO1B 1RZ8A 1B9KA 2CO6B 1AI1H 4MYWB 4JKMA 5AW0B 1UWXH 3W9DB 3HNVH 1G1KA 3QXTA 2F53B 3E1ZA 2OS7A 1L9RA 5MENB 3GZKA 3O3AB 3QJZA 3VWKC 1A3RL 4KH9A 3IDMA 1EZUA 1MRFL 2AJ3B 3ARED 4M5ZL 4YXKL 4ZZFA 1IGYB 2C8NA 2C9SA 5GISL 5B4MC 2XIIA 3AAZB 4YDVB 1UATA 4KRPC 3VFVB 3DX4A 1OSPH 1O7SA 3PWPB 2NQCA 1KGJA 3WFEH 4HHAB 2XBTA 3AS1A 1MHEB 1S9XA 5A2IH 3MJ6A 5B1JA 2BVOA 2AJYH 5CSZB 4WU7A 3QDGA 3FQUA 1FO0L 4F1ZA 3MRDB 5D1ZI 2XQYK 3FTGA 5TFSL 1S46A 1EAJA 2H3NA 1I8AA 4KRMB 3IGUA 1M1XB 5E8OB 1ZAGA 1EZVX 3PWPA 4HJIA 3CFMA 4O2CB 5GGRY 1N64L 4F9PC 5KSBA 2D7NA 5I0DA 1GIGH 3AY4A 3F84A 4JY4A 4XNBA 5BCAA 3VFMB 4KKQA 4AKPA 1NFIB 1R5WA 1PKQB 4QTHB 1IM9B 4KJWD 1FYHB 3AG2B 4LLUA 2F8XC 4UQEA 2Y3NA 4DGIH 2VJ0A 2AHIA 3MRNB 3ESOA 4PLOB 1TJHH 4A7UA 4OCSH 1KIUA 3GYRA 5TQ2L 3WL9B 5CEZE 2R0KL 3RDTB 2EO9A 3IE9A 3O4LD 4TNEA 1QPPA 4FQ1H 4QRUA 3RJQB 3LTVA 3KPLA 1S5HB 1KTRL 1TETH 4PVMA 3LPFA 3LRLA 2HG5B 1GL4B 4K3EL 5KYNA 3IMUA 1C12B 1KYAA 5CXPA 4HUVB 5IV2A 2R4RH 1NQBA 3PL6B 1CE1H 4CVZA 1OTTD 1BSIA 2WYZA 1TJIH 4JQVA 2DV6A 4PJAB 2FQFA 1PKQE 1GGCH 1XB3A 1QSED 1NJ9A 4F37F 1MCSA 4LPYA 5T3XL 2GJZA 4PGCB 1IBDA 3UMNA 3V4VL 2P48B 2OMBA 4I9WD 4PG9B 5EN3A 2XN2A 5HI5D 2VM3A 4QCIB 4YHMH 1CLOL 2CAKA 1FVEB 3VJ6B 3CPLB 5KSVB 4GG6A 5AAWA 3CIQA 3K5RA 1A64A 1IBGH 3U1QA 3NEXA 4L8CA 3H9YA 1NZRA 1EIBA 4OV5A 2NNXA 1RURL 4P57B 4Z7OE 1Q9KA 3MGTB 5DSCA 4KTYA 4TQEH 3EOBA 5IVXA 3EFOB 1YQ2A 4AM0A 5CD5D 35C8H 1CFMA 2CRYA 1H6EA 3ZE0F 1F4WH 4LHJB 3IAPA 4MMZA 1QI3A 4L9LC 5IJBC 1PLGH 4Y9EA 1IUZA 5IIEB 3AG4B 1S7TB 4J6IA 4JPQA 4WW1A 3C5JB 3A67H 2K4AA 5C0FA 4KPHL 5IB3A 2FD6H 1KY6A 1JHKH 5FW8A 5F7YC 4F1SA 1OY3B 3APDA 3FO0L 3IDGA 4XH2A 4J27A 4CVUA 3RNKB 1TZHA 4L3CA 4IRJB 1NPNA 1I8LC 2YUZA 3KCPA 2P8MB 4W9CC 5EA0H 5I6MA 2XY1A 1T21B 5KTEL 1NANI 1JRHL 2CK0H 4CN4A 4BYHA 3NACL 1CFVL 5C0FB 5EZJB 3C5JA 3PQYB 3VFTB 3D7PA 5HVHC 5GPRA 1ONQA 5J56B 4NSKB 4X99A 3NH7L 3IN2A 1HXYB 4HJJH 1MJ7L 4TVSa 1Z9LA 3TEYA 2VDMH 4ZAKD 5CP7B 2PN5A 5EUOE 3TEXA 5F93C 2WLKA 5B38G 1NCCH 4WJKB 2BHUA 2W9LA 3HEIB 3MLZH 4Z3EA 1KXQA 1W6LA 43CAB 3AVEA 4W81A 4MA1B 3HOGA 5EF2A 3SKMA 5JYMA 2FQEA 4IMLB 2D73A 1W72A 3GUTB 2A6JA 5LO7A 5ETUB 1DVXA 4KNSA 4OAWB 3FN9A 2C9UA 4A7TA 3PQYE 3K4ZA 3VGAC 3UBGA 2MQGA 2BDNH 4S2SB 4FFWC 1CIDA 4L8BB 3ZYOA 1IEBA 3BP6A 2YMXL 3VYNA 3QI9B 4EUPB 2OR8A 3V4LA 4IBWA 2Y7QB 3LS4H 1QW8A 5IMLA 1BZEA 1TZAA 1CFSB 3GUTA 4QHPA 2J71A 3LRHA 4ABQA 1XEDA 4HZLA 3K2UL 5IBUB 3LEYL 5EOQL 1UM4H 4UQIM 4XP9L 1WAAF 3RVXC 5L2KA 4P07A 3HBPA 1J1OL 2WXFA 4GW4B 3G5YB 5I6XB 4I48A 2A0LD 5IW6A 2E9IA 12E8H 1MY5A 1SQ2N 2X12A 1KJ2L 5FGRA 5DQDH 3HZMB 2YAHA 1LMKA 1GPOL 4G9FD 4RGOH 2Q8BL 2FD6L 3NJHA 2VDKH 1PW3A 2BNQE 2PABA 5EC2B 1XGZA 2V5YA 3OKDA 2CHZA 2E9WA 3IDUA 3PWNB 5FB8B 3OG4B 3DV6A 1NA8A 2BOCB 4X7TB 5EZIH 1FFOB 4OIAA 4U3XA 4FTDA 4JO5A 1XCQA 3TVMC 4DQAA 1D5RA 4JN2B 1JGIA 3QR2A 5BO0D 2KMWA 2X9YA 1TTCA 4QGTA 4DT2A 3LPWA 1CL7I 3ARGA 3GKZA 5JLZB 2NUTB 2JXMA 3V10A 1YMME 3VYPA 3LN5A 3AACA 1EHXA 3QIWA 4NNYB 4XRCB 2FO4B 1BAFH 3B2XA 4OGYH 1J10A 2BVPB 5E8DL 1FA4A 1FNFA 5G55A 4U1NB 2OBGA 4WU5A 4PMEA 4KZCA 4N9GB 1OM3L 3FQTB 1T5XB 3ECVA 3NCFB 4JDTL 4JQIA 1WJ3A 4F8LA 5B39A 1JZ3A 4LGPB 4R4FH 1X5JA 3WLBB 1XGQA 1WFOA 4ES9A 4JFOB 5FGBC 2AV1B 1DQIA 2G9HA 1TQBC 2OXHA 2ZUQB 3ELAT 4M7ZB 5SX5H 3MCKA 4UTBA 4U6HA 4IKIA 1GS7A 3VCLA 1YMMB 3OSKA 1XGYH 5LDSA 1EFXA 3P4NA 5DHVB 5EO1A 3PHOA 3IXAA 5KYYB 5DEFB 1YYLL 4KKCD 4B9KC 2NY1B 3SKNA 5D7JD 1MQKL 3G5XA 4R7NB 1L0XA 5DJXA 5I9QB 3RWEA 1PX8A 3K2IA 3B9KB 5D7LB 4CMMB 3IJHB 4YBLC 3I6LE 4U6HB 2X4PA 1FORL 1RAMA 1F4YL 4H25A 1QHQA 1IGCL 3TA4D 3UZVB 3UJTH 5ANHA 1JFQL 1MEXH 1PZ2A 1IILE 5IUSA 3C5ZB 1EAPA 1VADB 3GFUA 5EU6D 1S78D 2YA2A 3D05A 4GUCA 4LHUD 3U4EA 2VLRA 4I1NB 4FKKA 3FHEA 2YSTA 1K5NB 2VLKB 2XZAH 3QZBA 5DK2B 5A7BA 2BVEA 2ADIA 4XO8A 1MDAA 1P6FA 3VGHA 2AK4D 4E9WA 2DKMA 1D6EA 1TETL 1F6AA 1GYUA 2NW2A 2J6EH 4BK8A 1RIVH 2NZ9D 3T0AA 5LB1A 5I17A 2JQZA 4P23A 2CA3A 3QR1A 3DURB 2LLLA 3VSVA 1KCVH 2YK1H 1YEKL 4TQHA 4FQ1L 2GITB 3IXTB 5AD0B 3OMZA 2D7OA 1KBPA 4H1LA 1WS8A 3VXNA 3GKWL 1F4HA 3ABLB 5GRZA 2WYTA 3K2KA 5ABDE 5JQIB 4HLZG 1E3FA 4LBEA 3NTCL 4R4BA 3K6DA 3STZA 1OCOB 2OKMA 5PCYA 3UAJA 5EF1A 2NNAB 5B1KA 2VL5A 1FPTH 2QQKL 3VXPB 2ATAA 3TN0A 3DX8B 1OHQA 2FSEA 5GGTA 4TPRH 4JPSA 5KSAC 1BQHG 4QY8A 3VD4A 4G70B 1NEPA 1PZDA 4OGAD 4Y4FC 3LZOA 2NY0B 4GRWB 2CE6A 5F6HI 2G0KA 3CN0A 5CJXA 1FFNB 3HNTH 4GAGL 2DEYX 4S1DD 2DLFL 1RHHB 1Q0XL 3RZCC 4ZI8A 3FPYA 3MXVH 4J5VA 4RFNC 4KHXL 2V5MA 3MBWB 4IU2B 3HHRB 3IJSA 3HG4A 3PWPD 3DIV